data_6TXE
# 
_entry.id   6TXE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6TXE         pdb_00006txe 10.2210/pdb6txe/pdb 
WWPDB D_1292106129 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-06-24 
2 'Structure model' 1 1 2020-07-08 
3 'Structure model' 1 2 2024-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Derived calculations'   
5 3 'Structure model' Other                    
6 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation                      
2  2 'Structure model' citation_author               
3  3 'Structure model' chem_comp_atom                
4  3 'Structure model' chem_comp_bond                
5  3 'Structure model' database_2                    
6  3 'Structure model' pdbx_database_status          
7  3 'Structure model' pdbx_initial_refinement_model 
8  3 'Structure model' pdbx_struct_conn_angle        
9  3 'Structure model' struct_conn                   
10 3 'Structure model' struct_ncs_dom_lim            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_volume'                    
2  2 'Structure model' '_citation.page_first'                        
3  2 'Structure model' '_citation.page_last'                         
4  2 'Structure model' '_citation.pdbx_database_id_PubMed'           
5  2 'Structure model' '_citation.title'                             
6  2 'Structure model' '_citation_author.identifier_ORCID'           
7  2 'Structure model' '_citation_author.name'                       
8  3 'Structure model' '_database_2.pdbx_DOI'                        
9  3 'Structure model' '_database_2.pdbx_database_accession'         
10 3 'Structure model' '_pdbx_database_status.process_site'          
11 3 'Structure model' '_pdbx_database_status.status_code_sf'        
12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id'  
20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 
24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
27 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
28 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
29 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
30 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
31 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
32 3 'Structure model' '_pdbx_struct_conn_angle.value'               
33 3 'Structure model' '_struct_conn.pdbx_dist_value'                
34 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
35 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
36 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
37 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
38 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
39 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
40 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
41 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
42 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
43 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
44 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
45 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
46 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
47 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id'        
48 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id'       
49 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id'       
50 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id'        
51 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id'        
52 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id'       
53 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id'       
54 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id'        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6TXE 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '6TX0 contains a point mutant of the same protein complexed with a different ligand' 6TX0 unspecified 
PDB '6TXA contains a point mutant of the same protein complexed with a different ligand' 6TXA unspecified 
PDB '6TXC contains the same protein complexed with a different ligand'                   6TXC unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Morris, E.R.'   1 0000-0003-1893-7515 
'Kunzelmann, S.' 2 0000-0002-2678-0549 
'Caswell, S.J.'  3 0000-0003-1590-2106 
'Arnold, L.H.'   4 0000-0001-6785-1035 
'Purkiss, A.G.'  5 0000-0002-5931-3509 
'Kelly, G.'      6 0000-0002-1149-0717 
'Taylor, I.A.'   7 0000-0002-6763-3852 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                3165 
_citation.page_last                 3165 
_citation.title                     
'Crystal structures of SAMHD1 inhibitor complexes reveal the mechanism of water-mediated dNTP hydrolysis.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-16983-2 
_citation.pdbx_database_id_PubMed   32576829 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Morris, E.R.'   1 ? 
primary 'Caswell, S.J.'  2 ? 
primary 'Kunzelmann, S.' 3 ? 
primary 'Arnold, L.H.'   4 ? 
primary 'Purkiss, A.G.'  5 ? 
primary 'Kelly, G.'      6 ? 
primary 'Taylor, I.A.'   7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Deoxynucleoside triphosphate triphosphohydrolase SAMHD1'                           60208.809 16 3.1.5.- ? ? ? 
2 non-polymer syn 'FE (III) ION'                                                                      55.845    16 ?       ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                                                     24.305    32 ?       ? ? ? 
4 non-polymer syn "5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]thymidine" 481.184   16 ?       ? ? ? 
5 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                                         523.180   16 ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   16 ?       ? ? ? 
7 non-polymer syn 'SULFATE ION'                                                                       96.063    11 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;dNTPase,Dendritic cell-derived IFNG-induced protein,DCIP,Monocyte protein 5,MOP-5,SAM domain and HD domain-containing protein 1,hSAMHD1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQ
PELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDIC
FIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNE
LRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNI
FLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMD
YGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDV
IAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQ
PELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDIC
FIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNE
LRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNI
FLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMD
YGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDV
IAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION'                                                                      FE  
3 'MAGNESIUM ION'                                                                     MG  
4 "5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]thymidine" 1FZ 
5 "GUANOSINE-5'-TRIPHOSPHATE"                                                         GTP 
6 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
7 'SULFATE ION'                                                                       SO4 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   ILE n 
1 5   HIS n 
1 6   VAL n 
1 7   ASP n 
1 8   THR n 
1 9   MET n 
1 10  LYS n 
1 11  VAL n 
1 12  ILE n 
1 13  ASN n 
1 14  ASP n 
1 15  PRO n 
1 16  ILE n 
1 17  HIS n 
1 18  GLY n 
1 19  HIS n 
1 20  ILE n 
1 21  GLU n 
1 22  LEU n 
1 23  HIS n 
1 24  PRO n 
1 25  LEU n 
1 26  LEU n 
1 27  VAL n 
1 28  ARG n 
1 29  ILE n 
1 30  ILE n 
1 31  ASP n 
1 32  THR n 
1 33  PRO n 
1 34  GLN n 
1 35  PHE n 
1 36  GLN n 
1 37  ARG n 
1 38  LEU n 
1 39  ARG n 
1 40  TYR n 
1 41  ILE n 
1 42  LYS n 
1 43  GLN n 
1 44  LEU n 
1 45  GLY n 
1 46  GLY n 
1 47  GLY n 
1 48  TYR n 
1 49  TYR n 
1 50  VAL n 
1 51  PHE n 
1 52  PRO n 
1 53  GLY n 
1 54  ALA n 
1 55  SER n 
1 56  HIS n 
1 57  ASN n 
1 58  ARG n 
1 59  PHE n 
1 60  GLU n 
1 61  HIS n 
1 62  SER n 
1 63  LEU n 
1 64  GLY n 
1 65  VAL n 
1 66  GLY n 
1 67  TYR n 
1 68  LEU n 
1 69  ALA n 
1 70  GLY n 
1 71  CYS n 
1 72  LEU n 
1 73  VAL n 
1 74  HIS n 
1 75  ALA n 
1 76  LEU n 
1 77  GLY n 
1 78  GLU n 
1 79  LYS n 
1 80  GLN n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  GLN n 
1 85  ILE n 
1 86  SER n 
1 87  GLU n 
1 88  ARG n 
1 89  ASP n 
1 90  VAL n 
1 91  LEU n 
1 92  CYS n 
1 93  VAL n 
1 94  GLN n 
1 95  ILE n 
1 96  ALA n 
1 97  GLY n 
1 98  LEU n 
1 99  CYS n 
1 100 HIS n 
1 101 ASP n 
1 102 LEU n 
1 103 GLY n 
1 104 HIS n 
1 105 GLY n 
1 106 PRO n 
1 107 PHE n 
1 108 SER n 
1 109 HIS n 
1 110 MET n 
1 111 PHE n 
1 112 ASP n 
1 113 GLY n 
1 114 ARG n 
1 115 PHE n 
1 116 ILE n 
1 117 PRO n 
1 118 LEU n 
1 119 ALA n 
1 120 ARG n 
1 121 PRO n 
1 122 GLU n 
1 123 VAL n 
1 124 LYS n 
1 125 TRP n 
1 126 THR n 
1 127 HIS n 
1 128 GLU n 
1 129 GLN n 
1 130 GLY n 
1 131 SER n 
1 132 VAL n 
1 133 MET n 
1 134 MET n 
1 135 PHE n 
1 136 GLU n 
1 137 HIS n 
1 138 LEU n 
1 139 ILE n 
1 140 ASN n 
1 141 SER n 
1 142 ASN n 
1 143 GLY n 
1 144 ILE n 
1 145 LYS n 
1 146 PRO n 
1 147 VAL n 
1 148 MET n 
1 149 GLU n 
1 150 GLN n 
1 151 TYR n 
1 152 GLY n 
1 153 LEU n 
1 154 ILE n 
1 155 PRO n 
1 156 GLU n 
1 157 GLU n 
1 158 ASP n 
1 159 ILE n 
1 160 CYS n 
1 161 PHE n 
1 162 ILE n 
1 163 LYS n 
1 164 GLU n 
1 165 GLN n 
1 166 ILE n 
1 167 VAL n 
1 168 GLY n 
1 169 PRO n 
1 170 LEU n 
1 171 GLU n 
1 172 SER n 
1 173 PRO n 
1 174 VAL n 
1 175 GLU n 
1 176 ASP n 
1 177 SER n 
1 178 LEU n 
1 179 TRP n 
1 180 PRO n 
1 181 TYR n 
1 182 LYS n 
1 183 GLY n 
1 184 ARG n 
1 185 PRO n 
1 186 GLU n 
1 187 ASN n 
1 188 LYS n 
1 189 SER n 
1 190 PHE n 
1 191 LEU n 
1 192 TYR n 
1 193 GLU n 
1 194 ILE n 
1 195 VAL n 
1 196 SER n 
1 197 ASN n 
1 198 LYS n 
1 199 ARG n 
1 200 ASN n 
1 201 GLY n 
1 202 ILE n 
1 203 ASP n 
1 204 VAL n 
1 205 ASP n 
1 206 LYS n 
1 207 TRP n 
1 208 ASP n 
1 209 TYR n 
1 210 PHE n 
1 211 ALA n 
1 212 ARG n 
1 213 ASP n 
1 214 CYS n 
1 215 HIS n 
1 216 HIS n 
1 217 LEU n 
1 218 GLY n 
1 219 ILE n 
1 220 GLN n 
1 221 ASN n 
1 222 ASN n 
1 223 PHE n 
1 224 ASP n 
1 225 TYR n 
1 226 LYS n 
1 227 ARG n 
1 228 PHE n 
1 229 ILE n 
1 230 LYS n 
1 231 PHE n 
1 232 ALA n 
1 233 ARG n 
1 234 VAL n 
1 235 CYS n 
1 236 GLU n 
1 237 VAL n 
1 238 ASP n 
1 239 ASN n 
1 240 GLU n 
1 241 LEU n 
1 242 ARG n 
1 243 ILE n 
1 244 CYS n 
1 245 ALA n 
1 246 ARG n 
1 247 ASP n 
1 248 LYS n 
1 249 GLU n 
1 250 VAL n 
1 251 GLY n 
1 252 ASN n 
1 253 LEU n 
1 254 TYR n 
1 255 ASP n 
1 256 MET n 
1 257 PHE n 
1 258 HIS n 
1 259 THR n 
1 260 ARG n 
1 261 ASN n 
1 262 SER n 
1 263 LEU n 
1 264 HIS n 
1 265 ARG n 
1 266 ARG n 
1 267 ALA n 
1 268 TYR n 
1 269 GLN n 
1 270 HIS n 
1 271 LYS n 
1 272 VAL n 
1 273 GLY n 
1 274 ASN n 
1 275 ILE n 
1 276 ILE n 
1 277 ASP n 
1 278 THR n 
1 279 MET n 
1 280 ILE n 
1 281 THR n 
1 282 ASP n 
1 283 ALA n 
1 284 PHE n 
1 285 LEU n 
1 286 LYS n 
1 287 ALA n 
1 288 ASP n 
1 289 ASP n 
1 290 TYR n 
1 291 ILE n 
1 292 GLU n 
1 293 ILE n 
1 294 THR n 
1 295 GLY n 
1 296 ALA n 
1 297 GLY n 
1 298 GLY n 
1 299 LYS n 
1 300 LYS n 
1 301 TYR n 
1 302 ARG n 
1 303 ILE n 
1 304 SER n 
1 305 THR n 
1 306 ALA n 
1 307 ILE n 
1 308 ASP n 
1 309 ASP n 
1 310 MET n 
1 311 GLU n 
1 312 ALA n 
1 313 TYR n 
1 314 THR n 
1 315 LYS n 
1 316 LEU n 
1 317 THR n 
1 318 ASP n 
1 319 ASN n 
1 320 ILE n 
1 321 PHE n 
1 322 LEU n 
1 323 GLU n 
1 324 ILE n 
1 325 LEU n 
1 326 TYR n 
1 327 SER n 
1 328 THR n 
1 329 ASP n 
1 330 PRO n 
1 331 LYS n 
1 332 LEU n 
1 333 LYS n 
1 334 ASP n 
1 335 ALA n 
1 336 ARG n 
1 337 GLU n 
1 338 ILE n 
1 339 LEU n 
1 340 LYS n 
1 341 GLN n 
1 342 ILE n 
1 343 GLU n 
1 344 TYR n 
1 345 ARG n 
1 346 ASN n 
1 347 LEU n 
1 348 PHE n 
1 349 LYS n 
1 350 TYR n 
1 351 VAL n 
1 352 GLY n 
1 353 GLU n 
1 354 THR n 
1 355 GLN n 
1 356 PRO n 
1 357 THR n 
1 358 GLY n 
1 359 GLN n 
1 360 ILE n 
1 361 LYS n 
1 362 ILE n 
1 363 LYS n 
1 364 ARG n 
1 365 GLU n 
1 366 ASP n 
1 367 TYR n 
1 368 GLU n 
1 369 SER n 
1 370 LEU n 
1 371 PRO n 
1 372 LYS n 
1 373 GLU n 
1 374 VAL n 
1 375 ALA n 
1 376 SER n 
1 377 ALA n 
1 378 LYS n 
1 379 PRO n 
1 380 LYS n 
1 381 VAL n 
1 382 LEU n 
1 383 LEU n 
1 384 ASP n 
1 385 VAL n 
1 386 LYS n 
1 387 LEU n 
1 388 LYS n 
1 389 ALA n 
1 390 GLU n 
1 391 ASP n 
1 392 PHE n 
1 393 ILE n 
1 394 VAL n 
1 395 ASP n 
1 396 VAL n 
1 397 ILE n 
1 398 ASN n 
1 399 MET n 
1 400 ASP n 
1 401 TYR n 
1 402 GLY n 
1 403 MET n 
1 404 GLN n 
1 405 GLU n 
1 406 LYS n 
1 407 ASN n 
1 408 PRO n 
1 409 ILE n 
1 410 ASP n 
1 411 HIS n 
1 412 VAL n 
1 413 SER n 
1 414 PHE n 
1 415 TYR n 
1 416 CYS n 
1 417 LYS n 
1 418 THR n 
1 419 ALA n 
1 420 PRO n 
1 421 ASN n 
1 422 ARG n 
1 423 ALA n 
1 424 ILE n 
1 425 ARG n 
1 426 ILE n 
1 427 THR n 
1 428 LYS n 
1 429 ASN n 
1 430 GLN n 
1 431 VAL n 
1 432 SER n 
1 433 GLN n 
1 434 LEU n 
1 435 LEU n 
1 436 PRO n 
1 437 GLU n 
1 438 LYS n 
1 439 PHE n 
1 440 ALA n 
1 441 GLU n 
1 442 GLN n 
1 443 LEU n 
1 444 ILE n 
1 445 ARG n 
1 446 VAL n 
1 447 TYR n 
1 448 CYS n 
1 449 LYS n 
1 450 LYS n 
1 451 VAL n 
1 452 ASP n 
1 453 ARG n 
1 454 LYS n 
1 455 SER n 
1 456 LEU n 
1 457 TYR n 
1 458 ALA n 
1 459 ALA n 
1 460 ARG n 
1 461 GLN n 
1 462 TYR n 
1 463 PHE n 
1 464 VAL n 
1 465 GLN n 
1 466 TRP n 
1 467 CYS n 
1 468 ALA n 
1 469 ASP n 
1 470 ARG n 
1 471 ASN n 
1 472 PHE n 
1 473 THR n 
1 474 LYS n 
1 475 PRO n 
1 476 GLN n 
1 477 ASP n 
1 478 GLY n 
1 479 ASP n 
1 480 VAL n 
1 481 ILE n 
1 482 ALA n 
1 483 PRO n 
1 484 LEU n 
1 485 ILE n 
1 486 THR n 
1 487 PRO n 
1 488 GLN n 
1 489 LYS n 
1 490 LYS n 
1 491 GLU n 
1 492 TRP n 
1 493 ASN n 
1 494 ASP n 
1 495 SER n 
1 496 THR n 
1 497 SER n 
1 498 VAL n 
1 499 GLN n 
1 500 ASN n 
1 501 PRO n 
1 502 THR n 
1 503 ARG n 
1 504 LEU n 
1 505 ARG n 
1 506 GLU n 
1 507 ALA n 
1 508 SER n 
1 509 LYS n 
1 510 SER n 
1 511 ARG n 
1 512 VAL n 
1 513 GLN n 
1 514 LEU n 
1 515 PHE n 
1 516 LYS n 
1 517 ASP n 
1 518 ASP n 
1 519 PRO n 
1 520 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   520 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SAMHD1, MOP5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              Rosetta2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1FZ non-polymer         . "5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]thymidine" ? 
'C10 H18 N3 O13 P3' 481.184 
ALA 'L-peptide linking' y ALANINE                                                                             ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                            ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                          ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                     ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                            ? 'C3 H7 N O2 S' 
121.158 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
? 'C10 H16 N5 O12 P3' 491.182 
FE  non-polymer         . 'FE (III) ION'                                                                      ? 'Fe 3' 55.845  
GLN 'L-peptide linking' y GLUTAMINE                                                                           ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                     ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                             ? 'C2 H5 N O2' 
75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"                                                         ? 
'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                                                                           ? 'C6 H10 N3 O2 1' 
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                          ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                             ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                              ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                          ? 'C5 H11 N O2 S' 
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                     ? 'Mg 2' 24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                       ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                             ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                              ? 'C3 H7 N O3' 
105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                       ? 'O4 S -2' 96.063  
THR 'L-peptide linking' y THREONINE                                                                           ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                          ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                            ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                              ? 'C5 H11 N O2' 
117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   107 ?   ?   ?   A . n 
A 1 2   SER 2   108 ?   ?   ?   A . n 
A 1 3   GLN 3   109 ?   ?   ?   A . n 
A 1 4   ILE 4   110 ?   ?   ?   A . n 
A 1 5   HIS 5   111 ?   ?   ?   A . n 
A 1 6   VAL 6   112 ?   ?   ?   A . n 
A 1 7   ASP 7   113 ?   ?   ?   A . n 
A 1 8   THR 8   114 114 THR THR A . n 
A 1 9   MET 9   115 115 MET MET A . n 
A 1 10  LYS 10  116 116 LYS LYS A . n 
A 1 11  VAL 11  117 117 VAL VAL A . n 
A 1 12  ILE 12  118 118 ILE ILE A . n 
A 1 13  ASN 13  119 119 ASN ASN A . n 
A 1 14  ASP 14  120 120 ASP ASP A . n 
A 1 15  PRO 15  121 121 PRO PRO A . n 
A 1 16  ILE 16  122 122 ILE ILE A . n 
A 1 17  HIS 17  123 123 HIS HIS A . n 
A 1 18  GLY 18  124 124 GLY GLY A . n 
A 1 19  HIS 19  125 125 HIS HIS A . n 
A 1 20  ILE 20  126 126 ILE ILE A . n 
A 1 21  GLU 21  127 127 GLU GLU A . n 
A 1 22  LEU 22  128 128 LEU LEU A . n 
A 1 23  HIS 23  129 129 HIS HIS A . n 
A 1 24  PRO 24  130 130 PRO PRO A . n 
A 1 25  LEU 25  131 131 LEU LEU A . n 
A 1 26  LEU 26  132 132 LEU LEU A . n 
A 1 27  VAL 27  133 133 VAL VAL A . n 
A 1 28  ARG 28  134 134 ARG ARG A . n 
A 1 29  ILE 29  135 135 ILE ILE A . n 
A 1 30  ILE 30  136 136 ILE ILE A . n 
A 1 31  ASP 31  137 137 ASP ASP A . n 
A 1 32  THR 32  138 138 THR THR A . n 
A 1 33  PRO 33  139 139 PRO PRO A . n 
A 1 34  GLN 34  140 140 GLN GLN A . n 
A 1 35  PHE 35  141 141 PHE PHE A . n 
A 1 36  GLN 36  142 142 GLN GLN A . n 
A 1 37  ARG 37  143 143 ARG ARG A . n 
A 1 38  LEU 38  144 144 LEU LEU A . n 
A 1 39  ARG 39  145 145 ARG ARG A . n 
A 1 40  TYR 40  146 146 TYR TYR A . n 
A 1 41  ILE 41  147 147 ILE ILE A . n 
A 1 42  LYS 42  148 148 LYS LYS A . n 
A 1 43  GLN 43  149 149 GLN GLN A . n 
A 1 44  LEU 44  150 150 LEU LEU A . n 
A 1 45  GLY 45  151 151 GLY GLY A . n 
A 1 46  GLY 46  152 152 GLY GLY A . n 
A 1 47  GLY 47  153 153 GLY GLY A . n 
A 1 48  TYR 48  154 154 TYR TYR A . n 
A 1 49  TYR 49  155 155 TYR TYR A . n 
A 1 50  VAL 50  156 156 VAL VAL A . n 
A 1 51  PHE 51  157 157 PHE PHE A . n 
A 1 52  PRO 52  158 158 PRO PRO A . n 
A 1 53  GLY 53  159 159 GLY GLY A . n 
A 1 54  ALA 54  160 160 ALA ALA A . n 
A 1 55  SER 55  161 161 SER SER A . n 
A 1 56  HIS 56  162 162 HIS HIS A . n 
A 1 57  ASN 57  163 163 ASN ASN A . n 
A 1 58  ARG 58  164 164 ARG ARG A . n 
A 1 59  PHE 59  165 165 PHE PHE A . n 
A 1 60  GLU 60  166 166 GLU GLU A . n 
A 1 61  HIS 61  167 167 HIS HIS A . n 
A 1 62  SER 62  168 168 SER SER A . n 
A 1 63  LEU 63  169 169 LEU LEU A . n 
A 1 64  GLY 64  170 170 GLY GLY A . n 
A 1 65  VAL 65  171 171 VAL VAL A . n 
A 1 66  GLY 66  172 172 GLY GLY A . n 
A 1 67  TYR 67  173 173 TYR TYR A . n 
A 1 68  LEU 68  174 174 LEU LEU A . n 
A 1 69  ALA 69  175 175 ALA ALA A . n 
A 1 70  GLY 70  176 176 GLY GLY A . n 
A 1 71  CYS 71  177 177 CYS CYS A . n 
A 1 72  LEU 72  178 178 LEU LEU A . n 
A 1 73  VAL 73  179 179 VAL VAL A . n 
A 1 74  HIS 74  180 180 HIS HIS A . n 
A 1 75  ALA 75  181 181 ALA ALA A . n 
A 1 76  LEU 76  182 182 LEU LEU A . n 
A 1 77  GLY 77  183 183 GLY GLY A . n 
A 1 78  GLU 78  184 184 GLU GLU A . n 
A 1 79  LYS 79  185 185 LYS LYS A . n 
A 1 80  GLN 80  186 186 GLN GLN A . n 
A 1 81  PRO 81  187 187 PRO PRO A . n 
A 1 82  GLU 82  188 188 GLU GLU A . n 
A 1 83  LEU 83  189 189 LEU LEU A . n 
A 1 84  GLN 84  190 190 GLN GLN A . n 
A 1 85  ILE 85  191 191 ILE ILE A . n 
A 1 86  SER 86  192 192 SER SER A . n 
A 1 87  GLU 87  193 193 GLU GLU A . n 
A 1 88  ARG 88  194 194 ARG ARG A . n 
A 1 89  ASP 89  195 195 ASP ASP A . n 
A 1 90  VAL 90  196 196 VAL VAL A . n 
A 1 91  LEU 91  197 197 LEU LEU A . n 
A 1 92  CYS 92  198 198 CYS CYS A . n 
A 1 93  VAL 93  199 199 VAL VAL A . n 
A 1 94  GLN 94  200 200 GLN GLN A . n 
A 1 95  ILE 95  201 201 ILE ILE A . n 
A 1 96  ALA 96  202 202 ALA ALA A . n 
A 1 97  GLY 97  203 203 GLY GLY A . n 
A 1 98  LEU 98  204 204 LEU LEU A . n 
A 1 99  CYS 99  205 205 CYS CYS A . n 
A 1 100 HIS 100 206 206 HIS HIS A . n 
A 1 101 ASP 101 207 207 ASP ASP A . n 
A 1 102 LEU 102 208 208 LEU LEU A . n 
A 1 103 GLY 103 209 209 GLY GLY A . n 
A 1 104 HIS 104 210 210 HIS HIS A . n 
A 1 105 GLY 105 211 211 GLY GLY A . n 
A 1 106 PRO 106 212 212 PRO PRO A . n 
A 1 107 PHE 107 213 213 PHE PHE A . n 
A 1 108 SER 108 214 214 SER SER A . n 
A 1 109 HIS 109 215 215 HIS HIS A . n 
A 1 110 MET 110 216 216 MET MET A . n 
A 1 111 PHE 111 217 217 PHE PHE A . n 
A 1 112 ASP 112 218 218 ASP ASP A . n 
A 1 113 GLY 113 219 219 GLY GLY A . n 
A 1 114 ARG 114 220 220 ARG ARG A . n 
A 1 115 PHE 115 221 221 PHE PHE A . n 
A 1 116 ILE 116 222 222 ILE ILE A . n 
A 1 117 PRO 117 223 223 PRO PRO A . n 
A 1 118 LEU 118 224 224 LEU LEU A . n 
A 1 119 ALA 119 225 225 ALA ALA A . n 
A 1 120 ARG 120 226 226 ARG ARG A . n 
A 1 121 PRO 121 227 227 PRO PRO A . n 
A 1 122 GLU 122 228 228 GLU GLU A . n 
A 1 123 VAL 123 229 229 VAL VAL A . n 
A 1 124 LYS 124 230 230 LYS LYS A . n 
A 1 125 TRP 125 231 231 TRP TRP A . n 
A 1 126 THR 126 232 232 THR THR A . n 
A 1 127 HIS 127 233 233 HIS HIS A . n 
A 1 128 GLU 128 234 234 GLU GLU A . n 
A 1 129 GLN 129 235 235 GLN GLN A . n 
A 1 130 GLY 130 236 236 GLY GLY A . n 
A 1 131 SER 131 237 237 SER SER A . n 
A 1 132 VAL 132 238 238 VAL VAL A . n 
A 1 133 MET 133 239 239 MET MET A . n 
A 1 134 MET 134 240 240 MET MET A . n 
A 1 135 PHE 135 241 241 PHE PHE A . n 
A 1 136 GLU 136 242 242 GLU GLU A . n 
A 1 137 HIS 137 243 243 HIS HIS A . n 
A 1 138 LEU 138 244 244 LEU LEU A . n 
A 1 139 ILE 139 245 245 ILE ILE A . n 
A 1 140 ASN 140 246 246 ASN ASN A . n 
A 1 141 SER 141 247 247 SER SER A . n 
A 1 142 ASN 142 248 248 ASN ASN A . n 
A 1 143 GLY 143 249 249 GLY GLY A . n 
A 1 144 ILE 144 250 250 ILE ILE A . n 
A 1 145 LYS 145 251 251 LYS LYS A . n 
A 1 146 PRO 146 252 252 PRO PRO A . n 
A 1 147 VAL 147 253 253 VAL VAL A . n 
A 1 148 MET 148 254 254 MET MET A . n 
A 1 149 GLU 149 255 255 GLU GLU A . n 
A 1 150 GLN 150 256 256 GLN GLN A . n 
A 1 151 TYR 151 257 257 TYR TYR A . n 
A 1 152 GLY 152 258 258 GLY GLY A . n 
A 1 153 LEU 153 259 259 LEU LEU A . n 
A 1 154 ILE 154 260 260 ILE ILE A . n 
A 1 155 PRO 155 261 261 PRO PRO A . n 
A 1 156 GLU 156 262 262 GLU GLU A . n 
A 1 157 GLU 157 263 263 GLU GLU A . n 
A 1 158 ASP 158 264 264 ASP ASP A . n 
A 1 159 ILE 159 265 265 ILE ILE A . n 
A 1 160 CYS 160 266 266 CYS CYS A . n 
A 1 161 PHE 161 267 267 PHE PHE A . n 
A 1 162 ILE 162 268 268 ILE ILE A . n 
A 1 163 LYS 163 269 269 LYS LYS A . n 
A 1 164 GLU 164 270 270 GLU GLU A . n 
A 1 165 GLN 165 271 271 GLN GLN A . n 
A 1 166 ILE 166 272 272 ILE ILE A . n 
A 1 167 VAL 167 273 273 VAL VAL A . n 
A 1 168 GLY 168 274 274 GLY GLY A . n 
A 1 169 PRO 169 275 275 PRO PRO A . n 
A 1 170 LEU 170 276 276 LEU LEU A . n 
A 1 171 GLU 171 277 277 GLU GLU A . n 
A 1 172 SER 172 278 ?   ?   ?   A . n 
A 1 173 PRO 173 279 ?   ?   ?   A . n 
A 1 174 VAL 174 280 ?   ?   ?   A . n 
A 1 175 GLU 175 281 ?   ?   ?   A . n 
A 1 176 ASP 176 282 ?   ?   ?   A . n 
A 1 177 SER 177 283 ?   ?   ?   A . n 
A 1 178 LEU 178 284 284 LEU LEU A . n 
A 1 179 TRP 179 285 285 TRP TRP A . n 
A 1 180 PRO 180 286 286 PRO PRO A . n 
A 1 181 TYR 181 287 287 TYR TYR A . n 
A 1 182 LYS 182 288 288 LYS LYS A . n 
A 1 183 GLY 183 289 289 GLY GLY A . n 
A 1 184 ARG 184 290 290 ARG ARG A . n 
A 1 185 PRO 185 291 291 PRO PRO A . n 
A 1 186 GLU 186 292 292 GLU GLU A . n 
A 1 187 ASN 187 293 293 ASN ASN A . n 
A 1 188 LYS 188 294 294 LYS LYS A . n 
A 1 189 SER 189 295 295 SER SER A . n 
A 1 190 PHE 190 296 296 PHE PHE A . n 
A 1 191 LEU 191 297 297 LEU LEU A . n 
A 1 192 TYR 192 298 298 TYR TYR A . n 
A 1 193 GLU 193 299 299 GLU GLU A . n 
A 1 194 ILE 194 300 300 ILE ILE A . n 
A 1 195 VAL 195 301 301 VAL VAL A . n 
A 1 196 SER 196 302 302 SER SER A . n 
A 1 197 ASN 197 303 303 ASN ASN A . n 
A 1 198 LYS 198 304 304 LYS LYS A . n 
A 1 199 ARG 199 305 305 ARG ARG A . n 
A 1 200 ASN 200 306 306 ASN ASN A . n 
A 1 201 GLY 201 307 307 GLY GLY A . n 
A 1 202 ILE 202 308 308 ILE ILE A . n 
A 1 203 ASP 203 309 309 ASP ASP A . n 
A 1 204 VAL 204 310 310 VAL VAL A . n 
A 1 205 ASP 205 311 311 ASP ASP A . n 
A 1 206 LYS 206 312 312 LYS LYS A . n 
A 1 207 TRP 207 313 313 TRP TRP A . n 
A 1 208 ASP 208 314 314 ASP ASP A . n 
A 1 209 TYR 209 315 315 TYR TYR A . n 
A 1 210 PHE 210 316 316 PHE PHE A . n 
A 1 211 ALA 211 317 317 ALA ALA A . n 
A 1 212 ARG 212 318 318 ARG ARG A . n 
A 1 213 ASP 213 319 319 ASP ASP A . n 
A 1 214 CYS 214 320 320 CYS CYS A . n 
A 1 215 HIS 215 321 321 HIS HIS A . n 
A 1 216 HIS 216 322 322 HIS HIS A . n 
A 1 217 LEU 217 323 323 LEU LEU A . n 
A 1 218 GLY 218 324 324 GLY GLY A . n 
A 1 219 ILE 219 325 325 ILE ILE A . n 
A 1 220 GLN 220 326 326 GLN GLN A . n 
A 1 221 ASN 221 327 327 ASN ASN A . n 
A 1 222 ASN 222 328 328 ASN ASN A . n 
A 1 223 PHE 223 329 329 PHE PHE A . n 
A 1 224 ASP 224 330 330 ASP ASP A . n 
A 1 225 TYR 225 331 331 TYR TYR A . n 
A 1 226 LYS 226 332 332 LYS LYS A . n 
A 1 227 ARG 227 333 333 ARG ARG A . n 
A 1 228 PHE 228 334 334 PHE PHE A . n 
A 1 229 ILE 229 335 335 ILE ILE A . n 
A 1 230 LYS 230 336 336 LYS LYS A . n 
A 1 231 PHE 231 337 337 PHE PHE A . n 
A 1 232 ALA 232 338 338 ALA ALA A . n 
A 1 233 ARG 233 339 339 ARG ARG A . n 
A 1 234 VAL 234 340 340 VAL VAL A . n 
A 1 235 CYS 235 341 341 CYS CYS A . n 
A 1 236 GLU 236 342 342 GLU GLU A . n 
A 1 237 VAL 237 343 343 VAL VAL A . n 
A 1 238 ASP 238 344 344 ASP ASP A . n 
A 1 239 ASN 239 345 345 ASN ASN A . n 
A 1 240 GLU 240 346 346 GLU GLU A . n 
A 1 241 LEU 241 347 347 LEU LEU A . n 
A 1 242 ARG 242 348 348 ARG ARG A . n 
A 1 243 ILE 243 349 349 ILE ILE A . n 
A 1 244 CYS 244 350 350 CYS CYS A . n 
A 1 245 ALA 245 351 351 ALA ALA A . n 
A 1 246 ARG 246 352 352 ARG ARG A . n 
A 1 247 ASP 247 353 353 ASP ASP A . n 
A 1 248 LYS 248 354 354 LYS LYS A . n 
A 1 249 GLU 249 355 355 GLU GLU A . n 
A 1 250 VAL 250 356 356 VAL VAL A . n 
A 1 251 GLY 251 357 357 GLY GLY A . n 
A 1 252 ASN 252 358 358 ASN ASN A . n 
A 1 253 LEU 253 359 359 LEU LEU A . n 
A 1 254 TYR 254 360 360 TYR TYR A . n 
A 1 255 ASP 255 361 361 ASP ASP A . n 
A 1 256 MET 256 362 362 MET MET A . n 
A 1 257 PHE 257 363 363 PHE PHE A . n 
A 1 258 HIS 258 364 364 HIS HIS A . n 
A 1 259 THR 259 365 365 THR THR A . n 
A 1 260 ARG 260 366 366 ARG ARG A . n 
A 1 261 ASN 261 367 367 ASN ASN A . n 
A 1 262 SER 262 368 368 SER SER A . n 
A 1 263 LEU 263 369 369 LEU LEU A . n 
A 1 264 HIS 264 370 370 HIS HIS A . n 
A 1 265 ARG 265 371 371 ARG ARG A . n 
A 1 266 ARG 266 372 372 ARG ARG A . n 
A 1 267 ALA 267 373 373 ALA ALA A . n 
A 1 268 TYR 268 374 374 TYR TYR A . n 
A 1 269 GLN 269 375 375 GLN GLN A . n 
A 1 270 HIS 270 376 376 HIS HIS A . n 
A 1 271 LYS 271 377 377 LYS LYS A . n 
A 1 272 VAL 272 378 378 VAL VAL A . n 
A 1 273 GLY 273 379 379 GLY GLY A . n 
A 1 274 ASN 274 380 380 ASN ASN A . n 
A 1 275 ILE 275 381 381 ILE ILE A . n 
A 1 276 ILE 276 382 382 ILE ILE A . n 
A 1 277 ASP 277 383 383 ASP ASP A . n 
A 1 278 THR 278 384 384 THR THR A . n 
A 1 279 MET 279 385 385 MET MET A . n 
A 1 280 ILE 280 386 386 ILE ILE A . n 
A 1 281 THR 281 387 387 THR THR A . n 
A 1 282 ASP 282 388 388 ASP ASP A . n 
A 1 283 ALA 283 389 389 ALA ALA A . n 
A 1 284 PHE 284 390 390 PHE PHE A . n 
A 1 285 LEU 285 391 391 LEU LEU A . n 
A 1 286 LYS 286 392 392 LYS LYS A . n 
A 1 287 ALA 287 393 393 ALA ALA A . n 
A 1 288 ASP 288 394 394 ASP ASP A . n 
A 1 289 ASP 289 395 395 ASP ASP A . n 
A 1 290 TYR 290 396 396 TYR TYR A . n 
A 1 291 ILE 291 397 397 ILE ILE A . n 
A 1 292 GLU 292 398 398 GLU GLU A . n 
A 1 293 ILE 293 399 399 ILE ILE A . n 
A 1 294 THR 294 400 400 THR THR A . n 
A 1 295 GLY 295 401 401 GLY GLY A . n 
A 1 296 ALA 296 402 402 ALA ALA A . n 
A 1 297 GLY 297 403 403 GLY GLY A . n 
A 1 298 GLY 298 404 404 GLY GLY A . n 
A 1 299 LYS 299 405 405 LYS LYS A . n 
A 1 300 LYS 300 406 406 LYS LYS A . n 
A 1 301 TYR 301 407 407 TYR TYR A . n 
A 1 302 ARG 302 408 408 ARG ARG A . n 
A 1 303 ILE 303 409 409 ILE ILE A . n 
A 1 304 SER 304 410 410 SER SER A . n 
A 1 305 THR 305 411 411 THR THR A . n 
A 1 306 ALA 306 412 412 ALA ALA A . n 
A 1 307 ILE 307 413 413 ILE ILE A . n 
A 1 308 ASP 308 414 414 ASP ASP A . n 
A 1 309 ASP 309 415 415 ASP ASP A . n 
A 1 310 MET 310 416 416 MET MET A . n 
A 1 311 GLU 311 417 417 GLU GLU A . n 
A 1 312 ALA 312 418 418 ALA ALA A . n 
A 1 313 TYR 313 419 419 TYR TYR A . n 
A 1 314 THR 314 420 420 THR THR A . n 
A 1 315 LYS 315 421 421 LYS LYS A . n 
A 1 316 LEU 316 422 422 LEU LEU A . n 
A 1 317 THR 317 423 423 THR THR A . n 
A 1 318 ASP 318 424 424 ASP ASP A . n 
A 1 319 ASN 319 425 425 ASN ASN A . n 
A 1 320 ILE 320 426 426 ILE ILE A . n 
A 1 321 PHE 321 427 427 PHE PHE A . n 
A 1 322 LEU 322 428 428 LEU LEU A . n 
A 1 323 GLU 323 429 429 GLU GLU A . n 
A 1 324 ILE 324 430 430 ILE ILE A . n 
A 1 325 LEU 325 431 431 LEU LEU A . n 
A 1 326 TYR 326 432 432 TYR TYR A . n 
A 1 327 SER 327 433 433 SER SER A . n 
A 1 328 THR 328 434 434 THR THR A . n 
A 1 329 ASP 329 435 435 ASP ASP A . n 
A 1 330 PRO 330 436 436 PRO PRO A . n 
A 1 331 LYS 331 437 437 LYS LYS A . n 
A 1 332 LEU 332 438 438 LEU LEU A . n 
A 1 333 LYS 333 439 439 LYS LYS A . n 
A 1 334 ASP 334 440 440 ASP ASP A . n 
A 1 335 ALA 335 441 441 ALA ALA A . n 
A 1 336 ARG 336 442 442 ARG ARG A . n 
A 1 337 GLU 337 443 443 GLU GLU A . n 
A 1 338 ILE 338 444 444 ILE ILE A . n 
A 1 339 LEU 339 445 445 LEU LEU A . n 
A 1 340 LYS 340 446 446 LYS LYS A . n 
A 1 341 GLN 341 447 447 GLN GLN A . n 
A 1 342 ILE 342 448 448 ILE ILE A . n 
A 1 343 GLU 343 449 449 GLU GLU A . n 
A 1 344 TYR 344 450 450 TYR TYR A . n 
A 1 345 ARG 345 451 451 ARG ARG A . n 
A 1 346 ASN 346 452 452 ASN ASN A . n 
A 1 347 LEU 347 453 453 LEU LEU A . n 
A 1 348 PHE 348 454 454 PHE PHE A . n 
A 1 349 LYS 349 455 455 LYS LYS A . n 
A 1 350 TYR 350 456 456 TYR TYR A . n 
A 1 351 VAL 351 457 457 VAL VAL A . n 
A 1 352 GLY 352 458 458 GLY GLY A . n 
A 1 353 GLU 353 459 459 GLU GLU A . n 
A 1 354 THR 354 460 460 THR THR A . n 
A 1 355 GLN 355 461 461 GLN GLN A . n 
A 1 356 PRO 356 462 462 PRO PRO A . n 
A 1 357 THR 357 463 463 THR THR A . n 
A 1 358 GLY 358 464 464 GLY GLY A . n 
A 1 359 GLN 359 465 465 GLN GLN A . n 
A 1 360 ILE 360 466 466 ILE ILE A . n 
A 1 361 LYS 361 467 467 LYS LYS A . n 
A 1 362 ILE 362 468 468 ILE ILE A . n 
A 1 363 LYS 363 469 469 LYS LYS A . n 
A 1 364 ARG 364 470 470 ARG ARG A . n 
A 1 365 GLU 365 471 471 GLU GLU A . n 
A 1 366 ASP 366 472 472 ASP ASP A . n 
A 1 367 TYR 367 473 473 TYR TYR A . n 
A 1 368 GLU 368 474 474 GLU GLU A . n 
A 1 369 SER 369 475 475 SER SER A . n 
A 1 370 LEU 370 476 476 LEU LEU A . n 
A 1 371 PRO 371 477 477 PRO PRO A . n 
A 1 372 LYS 372 478 478 LYS LYS A . n 
A 1 373 GLU 373 479 479 GLU GLU A . n 
A 1 374 VAL 374 480 480 VAL VAL A . n 
A 1 375 ALA 375 481 481 ALA ALA A . n 
A 1 376 SER 376 482 482 SER SER A . n 
A 1 377 ALA 377 483 483 ALA ALA A . n 
A 1 378 LYS 378 484 484 LYS LYS A . n 
A 1 379 PRO 379 485 485 PRO PRO A . n 
A 1 380 LYS 380 486 486 LYS LYS A . n 
A 1 381 VAL 381 487 487 VAL VAL A . n 
A 1 382 LEU 382 488 488 LEU LEU A . n 
A 1 383 LEU 383 489 489 LEU LEU A . n 
A 1 384 ASP 384 490 490 ASP ASP A . n 
A 1 385 VAL 385 491 491 VAL VAL A . n 
A 1 386 LYS 386 492 492 LYS LYS A . n 
A 1 387 LEU 387 493 493 LEU LEU A . n 
A 1 388 LYS 388 494 494 LYS LYS A . n 
A 1 389 ALA 389 495 495 ALA ALA A . n 
A 1 390 GLU 390 496 496 GLU GLU A . n 
A 1 391 ASP 391 497 497 ASP ASP A . n 
A 1 392 PHE 392 498 498 PHE PHE A . n 
A 1 393 ILE 393 499 499 ILE ILE A . n 
A 1 394 VAL 394 500 500 VAL VAL A . n 
A 1 395 ASP 395 501 501 ASP ASP A . n 
A 1 396 VAL 396 502 502 VAL VAL A . n 
A 1 397 ILE 397 503 503 ILE ILE A . n 
A 1 398 ASN 398 504 504 ASN ASN A . n 
A 1 399 MET 399 505 505 MET MET A . n 
A 1 400 ASP 400 506 506 ASP ASP A . n 
A 1 401 TYR 401 507 507 TYR TYR A . n 
A 1 402 GLY 402 508 508 GLY GLY A . n 
A 1 403 MET 403 509 509 MET MET A . n 
A 1 404 GLN 404 510 510 GLN GLN A . n 
A 1 405 GLU 405 511 511 GLU GLU A . n 
A 1 406 LYS 406 512 512 LYS LYS A . n 
A 1 407 ASN 407 513 513 ASN ASN A . n 
A 1 408 PRO 408 514 514 PRO PRO A . n 
A 1 409 ILE 409 515 515 ILE ILE A . n 
A 1 410 ASP 410 516 516 ASP ASP A . n 
A 1 411 HIS 411 517 517 HIS HIS A . n 
A 1 412 VAL 412 518 518 VAL VAL A . n 
A 1 413 SER 413 519 519 SER SER A . n 
A 1 414 PHE 414 520 520 PHE PHE A . n 
A 1 415 TYR 415 521 521 TYR TYR A . n 
A 1 416 CYS 416 522 522 CYS CYS A . n 
A 1 417 LYS 417 523 523 LYS LYS A . n 
A 1 418 THR 418 524 524 THR THR A . n 
A 1 419 ALA 419 525 525 ALA ALA A . n 
A 1 420 PRO 420 526 526 PRO PRO A . n 
A 1 421 ASN 421 527 527 ASN ASN A . n 
A 1 422 ARG 422 528 528 ARG ARG A . n 
A 1 423 ALA 423 529 529 ALA ALA A . n 
A 1 424 ILE 424 530 530 ILE ILE A . n 
A 1 425 ARG 425 531 531 ARG ARG A . n 
A 1 426 ILE 426 532 532 ILE ILE A . n 
A 1 427 THR 427 533 533 THR THR A . n 
A 1 428 LYS 428 534 534 LYS LYS A . n 
A 1 429 ASN 429 535 535 ASN ASN A . n 
A 1 430 GLN 430 536 536 GLN GLN A . n 
A 1 431 VAL 431 537 537 VAL VAL A . n 
A 1 432 SER 432 538 538 SER SER A . n 
A 1 433 GLN 433 539 539 GLN GLN A . n 
A 1 434 LEU 434 540 540 LEU LEU A . n 
A 1 435 LEU 435 541 541 LEU LEU A . n 
A 1 436 PRO 436 542 542 PRO PRO A . n 
A 1 437 GLU 437 543 543 GLU GLU A . n 
A 1 438 LYS 438 544 544 LYS LYS A . n 
A 1 439 PHE 439 545 545 PHE PHE A . n 
A 1 440 ALA 440 546 546 ALA ALA A . n 
A 1 441 GLU 441 547 547 GLU GLU A . n 
A 1 442 GLN 442 548 548 GLN GLN A . n 
A 1 443 LEU 443 549 549 LEU LEU A . n 
A 1 444 ILE 444 550 550 ILE ILE A . n 
A 1 445 ARG 445 551 551 ARG ARG A . n 
A 1 446 VAL 446 552 552 VAL VAL A . n 
A 1 447 TYR 447 553 553 TYR TYR A . n 
A 1 448 CYS 448 554 554 CYS CYS A . n 
A 1 449 LYS 449 555 555 LYS LYS A . n 
A 1 450 LYS 450 556 556 LYS LYS A . n 
A 1 451 VAL 451 557 557 VAL VAL A . n 
A 1 452 ASP 452 558 558 ASP ASP A . n 
A 1 453 ARG 453 559 559 ARG ARG A . n 
A 1 454 LYS 454 560 560 LYS LYS A . n 
A 1 455 SER 455 561 561 SER SER A . n 
A 1 456 LEU 456 562 562 LEU LEU A . n 
A 1 457 TYR 457 563 563 TYR TYR A . n 
A 1 458 ALA 458 564 564 ALA ALA A . n 
A 1 459 ALA 459 565 565 ALA ALA A . n 
A 1 460 ARG 460 566 566 ARG ARG A . n 
A 1 461 GLN 461 567 567 GLN GLN A . n 
A 1 462 TYR 462 568 568 TYR TYR A . n 
A 1 463 PHE 463 569 569 PHE PHE A . n 
A 1 464 VAL 464 570 570 VAL VAL A . n 
A 1 465 GLN 465 571 571 GLN GLN A . n 
A 1 466 TRP 466 572 572 TRP TRP A . n 
A 1 467 CYS 467 573 573 CYS CYS A . n 
A 1 468 ALA 468 574 574 ALA ALA A . n 
A 1 469 ASP 469 575 575 ASP ASP A . n 
A 1 470 ARG 470 576 576 ARG ARG A . n 
A 1 471 ASN 471 577 577 ASN ASN A . n 
A 1 472 PHE 472 578 578 PHE PHE A . n 
A 1 473 THR 473 579 579 THR THR A . n 
A 1 474 LYS 474 580 580 LYS LYS A . n 
A 1 475 PRO 475 581 581 PRO PRO A . n 
A 1 476 GLN 476 582 582 GLN GLN A . n 
A 1 477 ASP 477 583 583 ASP ASP A . n 
A 1 478 GLY 478 584 584 GLY GLY A . n 
A 1 479 ASP 479 585 585 ASP ASP A . n 
A 1 480 VAL 480 586 586 VAL VAL A . n 
A 1 481 ILE 481 587 587 ILE ILE A . n 
A 1 482 ALA 482 588 588 ALA ALA A . n 
A 1 483 PRO 483 589 589 PRO PRO A . n 
A 1 484 LEU 484 590 590 LEU LEU A . n 
A 1 485 ILE 485 591 591 ILE ILE A . n 
A 1 486 THR 486 592 592 THR THR A . n 
A 1 487 PRO 487 593 593 PRO PRO A . n 
A 1 488 GLN 488 594 594 GLN GLN A . n 
A 1 489 LYS 489 595 595 LYS LYS A . n 
A 1 490 LYS 490 596 596 LYS LYS A . n 
A 1 491 GLU 491 597 597 GLU GLU A . n 
A 1 492 TRP 492 598 598 TRP TRP A . n 
A 1 493 ASN 493 599 599 ASN ASN A . n 
A 1 494 ASP 494 600 ?   ?   ?   A . n 
A 1 495 SER 495 601 ?   ?   ?   A . n 
A 1 496 THR 496 602 ?   ?   ?   A . n 
A 1 497 SER 497 603 ?   ?   ?   A . n 
A 1 498 VAL 498 604 ?   ?   ?   A . n 
A 1 499 GLN 499 605 ?   ?   ?   A . n 
A 1 500 ASN 500 606 ?   ?   ?   A . n 
A 1 501 PRO 501 607 ?   ?   ?   A . n 
A 1 502 THR 502 608 ?   ?   ?   A . n 
A 1 503 ARG 503 609 ?   ?   ?   A . n 
A 1 504 LEU 504 610 ?   ?   ?   A . n 
A 1 505 ARG 505 611 ?   ?   ?   A . n 
A 1 506 GLU 506 612 ?   ?   ?   A . n 
A 1 507 ALA 507 613 ?   ?   ?   A . n 
A 1 508 SER 508 614 ?   ?   ?   A . n 
A 1 509 LYS 509 615 ?   ?   ?   A . n 
A 1 510 SER 510 616 ?   ?   ?   A . n 
A 1 511 ARG 511 617 ?   ?   ?   A . n 
A 1 512 VAL 512 618 ?   ?   ?   A . n 
A 1 513 GLN 513 619 ?   ?   ?   A . n 
A 1 514 LEU 514 620 ?   ?   ?   A . n 
A 1 515 PHE 515 621 ?   ?   ?   A . n 
A 1 516 LYS 516 622 ?   ?   ?   A . n 
A 1 517 ASP 517 623 ?   ?   ?   A . n 
A 1 518 ASP 518 624 ?   ?   ?   A . n 
A 1 519 PRO 519 625 ?   ?   ?   A . n 
A 1 520 MET 520 626 ?   ?   ?   A . n 
B 1 1   GLY 1   107 ?   ?   ?   B . n 
B 1 2   SER 2   108 ?   ?   ?   B . n 
B 1 3   GLN 3   109 ?   ?   ?   B . n 
B 1 4   ILE 4   110 ?   ?   ?   B . n 
B 1 5   HIS 5   111 ?   ?   ?   B . n 
B 1 6   VAL 6   112 ?   ?   ?   B . n 
B 1 7   ASP 7   113 ?   ?   ?   B . n 
B 1 8   THR 8   114 114 THR THR B . n 
B 1 9   MET 9   115 115 MET MET B . n 
B 1 10  LYS 10  116 116 LYS LYS B . n 
B 1 11  VAL 11  117 117 VAL VAL B . n 
B 1 12  ILE 12  118 118 ILE ILE B . n 
B 1 13  ASN 13  119 119 ASN ASN B . n 
B 1 14  ASP 14  120 120 ASP ASP B . n 
B 1 15  PRO 15  121 121 PRO PRO B . n 
B 1 16  ILE 16  122 122 ILE ILE B . n 
B 1 17  HIS 17  123 123 HIS HIS B . n 
B 1 18  GLY 18  124 124 GLY GLY B . n 
B 1 19  HIS 19  125 125 HIS HIS B . n 
B 1 20  ILE 20  126 126 ILE ILE B . n 
B 1 21  GLU 21  127 127 GLU GLU B . n 
B 1 22  LEU 22  128 128 LEU LEU B . n 
B 1 23  HIS 23  129 129 HIS HIS B . n 
B 1 24  PRO 24  130 130 PRO PRO B . n 
B 1 25  LEU 25  131 131 LEU LEU B . n 
B 1 26  LEU 26  132 132 LEU LEU B . n 
B 1 27  VAL 27  133 133 VAL VAL B . n 
B 1 28  ARG 28  134 134 ARG ARG B . n 
B 1 29  ILE 29  135 135 ILE ILE B . n 
B 1 30  ILE 30  136 136 ILE ILE B . n 
B 1 31  ASP 31  137 137 ASP ASP B . n 
B 1 32  THR 32  138 138 THR THR B . n 
B 1 33  PRO 33  139 139 PRO PRO B . n 
B 1 34  GLN 34  140 140 GLN GLN B . n 
B 1 35  PHE 35  141 141 PHE PHE B . n 
B 1 36  GLN 36  142 142 GLN GLN B . n 
B 1 37  ARG 37  143 143 ARG ARG B . n 
B 1 38  LEU 38  144 144 LEU LEU B . n 
B 1 39  ARG 39  145 145 ARG ARG B . n 
B 1 40  TYR 40  146 146 TYR TYR B . n 
B 1 41  ILE 41  147 147 ILE ILE B . n 
B 1 42  LYS 42  148 148 LYS LYS B . n 
B 1 43  GLN 43  149 149 GLN GLN B . n 
B 1 44  LEU 44  150 150 LEU LEU B . n 
B 1 45  GLY 45  151 151 GLY GLY B . n 
B 1 46  GLY 46  152 152 GLY GLY B . n 
B 1 47  GLY 47  153 153 GLY GLY B . n 
B 1 48  TYR 48  154 154 TYR TYR B . n 
B 1 49  TYR 49  155 155 TYR TYR B . n 
B 1 50  VAL 50  156 156 VAL VAL B . n 
B 1 51  PHE 51  157 157 PHE PHE B . n 
B 1 52  PRO 52  158 158 PRO PRO B . n 
B 1 53  GLY 53  159 159 GLY GLY B . n 
B 1 54  ALA 54  160 160 ALA ALA B . n 
B 1 55  SER 55  161 161 SER SER B . n 
B 1 56  HIS 56  162 162 HIS HIS B . n 
B 1 57  ASN 57  163 163 ASN ASN B . n 
B 1 58  ARG 58  164 164 ARG ARG B . n 
B 1 59  PHE 59  165 165 PHE PHE B . n 
B 1 60  GLU 60  166 166 GLU GLU B . n 
B 1 61  HIS 61  167 167 HIS HIS B . n 
B 1 62  SER 62  168 168 SER SER B . n 
B 1 63  LEU 63  169 169 LEU LEU B . n 
B 1 64  GLY 64  170 170 GLY GLY B . n 
B 1 65  VAL 65  171 171 VAL VAL B . n 
B 1 66  GLY 66  172 172 GLY GLY B . n 
B 1 67  TYR 67  173 173 TYR TYR B . n 
B 1 68  LEU 68  174 174 LEU LEU B . n 
B 1 69  ALA 69  175 175 ALA ALA B . n 
B 1 70  GLY 70  176 176 GLY GLY B . n 
B 1 71  CYS 71  177 177 CYS CYS B . n 
B 1 72  LEU 72  178 178 LEU LEU B . n 
B 1 73  VAL 73  179 179 VAL VAL B . n 
B 1 74  HIS 74  180 180 HIS HIS B . n 
B 1 75  ALA 75  181 181 ALA ALA B . n 
B 1 76  LEU 76  182 182 LEU LEU B . n 
B 1 77  GLY 77  183 183 GLY GLY B . n 
B 1 78  GLU 78  184 184 GLU GLU B . n 
B 1 79  LYS 79  185 185 LYS LYS B . n 
B 1 80  GLN 80  186 186 GLN GLN B . n 
B 1 81  PRO 81  187 187 PRO PRO B . n 
B 1 82  GLU 82  188 188 GLU GLU B . n 
B 1 83  LEU 83  189 189 LEU LEU B . n 
B 1 84  GLN 84  190 190 GLN GLN B . n 
B 1 85  ILE 85  191 191 ILE ILE B . n 
B 1 86  SER 86  192 192 SER SER B . n 
B 1 87  GLU 87  193 193 GLU GLU B . n 
B 1 88  ARG 88  194 194 ARG ARG B . n 
B 1 89  ASP 89  195 195 ASP ASP B . n 
B 1 90  VAL 90  196 196 VAL VAL B . n 
B 1 91  LEU 91  197 197 LEU LEU B . n 
B 1 92  CYS 92  198 198 CYS CYS B . n 
B 1 93  VAL 93  199 199 VAL VAL B . n 
B 1 94  GLN 94  200 200 GLN GLN B . n 
B 1 95  ILE 95  201 201 ILE ILE B . n 
B 1 96  ALA 96  202 202 ALA ALA B . n 
B 1 97  GLY 97  203 203 GLY GLY B . n 
B 1 98  LEU 98  204 204 LEU LEU B . n 
B 1 99  CYS 99  205 205 CYS CYS B . n 
B 1 100 HIS 100 206 206 HIS HIS B . n 
B 1 101 ASP 101 207 207 ASP ASP B . n 
B 1 102 LEU 102 208 208 LEU LEU B . n 
B 1 103 GLY 103 209 209 GLY GLY B . n 
B 1 104 HIS 104 210 210 HIS HIS B . n 
B 1 105 GLY 105 211 211 GLY GLY B . n 
B 1 106 PRO 106 212 212 PRO PRO B . n 
B 1 107 PHE 107 213 213 PHE PHE B . n 
B 1 108 SER 108 214 214 SER SER B . n 
B 1 109 HIS 109 215 215 HIS HIS B . n 
B 1 110 MET 110 216 216 MET MET B . n 
B 1 111 PHE 111 217 217 PHE PHE B . n 
B 1 112 ASP 112 218 218 ASP ASP B . n 
B 1 113 GLY 113 219 219 GLY GLY B . n 
B 1 114 ARG 114 220 220 ARG ARG B . n 
B 1 115 PHE 115 221 221 PHE PHE B . n 
B 1 116 ILE 116 222 222 ILE ILE B . n 
B 1 117 PRO 117 223 223 PRO PRO B . n 
B 1 118 LEU 118 224 224 LEU LEU B . n 
B 1 119 ALA 119 225 225 ALA ALA B . n 
B 1 120 ARG 120 226 226 ARG ARG B . n 
B 1 121 PRO 121 227 227 PRO PRO B . n 
B 1 122 GLU 122 228 228 GLU GLU B . n 
B 1 123 VAL 123 229 229 VAL VAL B . n 
B 1 124 LYS 124 230 230 LYS LYS B . n 
B 1 125 TRP 125 231 231 TRP TRP B . n 
B 1 126 THR 126 232 232 THR THR B . n 
B 1 127 HIS 127 233 233 HIS HIS B . n 
B 1 128 GLU 128 234 234 GLU GLU B . n 
B 1 129 GLN 129 235 235 GLN GLN B . n 
B 1 130 GLY 130 236 236 GLY GLY B . n 
B 1 131 SER 131 237 237 SER SER B . n 
B 1 132 VAL 132 238 238 VAL VAL B . n 
B 1 133 MET 133 239 239 MET MET B . n 
B 1 134 MET 134 240 240 MET MET B . n 
B 1 135 PHE 135 241 241 PHE PHE B . n 
B 1 136 GLU 136 242 242 GLU GLU B . n 
B 1 137 HIS 137 243 243 HIS HIS B . n 
B 1 138 LEU 138 244 244 LEU LEU B . n 
B 1 139 ILE 139 245 245 ILE ILE B . n 
B 1 140 ASN 140 246 246 ASN ASN B . n 
B 1 141 SER 141 247 247 SER SER B . n 
B 1 142 ASN 142 248 248 ASN ASN B . n 
B 1 143 GLY 143 249 249 GLY GLY B . n 
B 1 144 ILE 144 250 250 ILE ILE B . n 
B 1 145 LYS 145 251 251 LYS LYS B . n 
B 1 146 PRO 146 252 252 PRO PRO B . n 
B 1 147 VAL 147 253 253 VAL VAL B . n 
B 1 148 MET 148 254 254 MET MET B . n 
B 1 149 GLU 149 255 255 GLU GLU B . n 
B 1 150 GLN 150 256 256 GLN GLN B . n 
B 1 151 TYR 151 257 257 TYR TYR B . n 
B 1 152 GLY 152 258 258 GLY GLY B . n 
B 1 153 LEU 153 259 259 LEU LEU B . n 
B 1 154 ILE 154 260 260 ILE ILE B . n 
B 1 155 PRO 155 261 261 PRO PRO B . n 
B 1 156 GLU 156 262 262 GLU GLU B . n 
B 1 157 GLU 157 263 263 GLU GLU B . n 
B 1 158 ASP 158 264 264 ASP ASP B . n 
B 1 159 ILE 159 265 265 ILE ILE B . n 
B 1 160 CYS 160 266 266 CYS CYS B . n 
B 1 161 PHE 161 267 267 PHE PHE B . n 
B 1 162 ILE 162 268 268 ILE ILE B . n 
B 1 163 LYS 163 269 269 LYS LYS B . n 
B 1 164 GLU 164 270 270 GLU GLU B . n 
B 1 165 GLN 165 271 271 GLN GLN B . n 
B 1 166 ILE 166 272 272 ILE ILE B . n 
B 1 167 VAL 167 273 273 VAL VAL B . n 
B 1 168 GLY 168 274 274 GLY GLY B . n 
B 1 169 PRO 169 275 275 PRO PRO B . n 
B 1 170 LEU 170 276 276 LEU LEU B . n 
B 1 171 GLU 171 277 ?   ?   ?   B . n 
B 1 172 SER 172 278 ?   ?   ?   B . n 
B 1 173 PRO 173 279 ?   ?   ?   B . n 
B 1 174 VAL 174 280 ?   ?   ?   B . n 
B 1 175 GLU 175 281 ?   ?   ?   B . n 
B 1 176 ASP 176 282 ?   ?   ?   B . n 
B 1 177 SER 177 283 ?   ?   ?   B . n 
B 1 178 LEU 178 284 284 LEU LEU B . n 
B 1 179 TRP 179 285 285 TRP TRP B . n 
B 1 180 PRO 180 286 286 PRO PRO B . n 
B 1 181 TYR 181 287 287 TYR TYR B . n 
B 1 182 LYS 182 288 288 LYS LYS B . n 
B 1 183 GLY 183 289 289 GLY GLY B . n 
B 1 184 ARG 184 290 290 ARG ARG B . n 
B 1 185 PRO 185 291 291 PRO PRO B . n 
B 1 186 GLU 186 292 292 GLU GLU B . n 
B 1 187 ASN 187 293 293 ASN ASN B . n 
B 1 188 LYS 188 294 294 LYS LYS B . n 
B 1 189 SER 189 295 295 SER SER B . n 
B 1 190 PHE 190 296 296 PHE PHE B . n 
B 1 191 LEU 191 297 297 LEU LEU B . n 
B 1 192 TYR 192 298 298 TYR TYR B . n 
B 1 193 GLU 193 299 299 GLU GLU B . n 
B 1 194 ILE 194 300 300 ILE ILE B . n 
B 1 195 VAL 195 301 301 VAL VAL B . n 
B 1 196 SER 196 302 302 SER SER B . n 
B 1 197 ASN 197 303 303 ASN ASN B . n 
B 1 198 LYS 198 304 304 LYS LYS B . n 
B 1 199 ARG 199 305 305 ARG ARG B . n 
B 1 200 ASN 200 306 306 ASN ASN B . n 
B 1 201 GLY 201 307 307 GLY GLY B . n 
B 1 202 ILE 202 308 308 ILE ILE B . n 
B 1 203 ASP 203 309 309 ASP ASP B . n 
B 1 204 VAL 204 310 310 VAL VAL B . n 
B 1 205 ASP 205 311 311 ASP ASP B . n 
B 1 206 LYS 206 312 312 LYS LYS B . n 
B 1 207 TRP 207 313 313 TRP TRP B . n 
B 1 208 ASP 208 314 314 ASP ASP B . n 
B 1 209 TYR 209 315 315 TYR TYR B . n 
B 1 210 PHE 210 316 316 PHE PHE B . n 
B 1 211 ALA 211 317 317 ALA ALA B . n 
B 1 212 ARG 212 318 318 ARG ARG B . n 
B 1 213 ASP 213 319 319 ASP ASP B . n 
B 1 214 CYS 214 320 320 CYS CYS B . n 
B 1 215 HIS 215 321 321 HIS HIS B . n 
B 1 216 HIS 216 322 322 HIS HIS B . n 
B 1 217 LEU 217 323 323 LEU LEU B . n 
B 1 218 GLY 218 324 324 GLY GLY B . n 
B 1 219 ILE 219 325 325 ILE ILE B . n 
B 1 220 GLN 220 326 326 GLN GLN B . n 
B 1 221 ASN 221 327 327 ASN ASN B . n 
B 1 222 ASN 222 328 328 ASN ASN B . n 
B 1 223 PHE 223 329 329 PHE PHE B . n 
B 1 224 ASP 224 330 330 ASP ASP B . n 
B 1 225 TYR 225 331 331 TYR TYR B . n 
B 1 226 LYS 226 332 332 LYS LYS B . n 
B 1 227 ARG 227 333 333 ARG ARG B . n 
B 1 228 PHE 228 334 334 PHE PHE B . n 
B 1 229 ILE 229 335 335 ILE ILE B . n 
B 1 230 LYS 230 336 336 LYS LYS B . n 
B 1 231 PHE 231 337 337 PHE PHE B . n 
B 1 232 ALA 232 338 338 ALA ALA B . n 
B 1 233 ARG 233 339 339 ARG ARG B . n 
B 1 234 VAL 234 340 340 VAL VAL B . n 
B 1 235 CYS 235 341 341 CYS CYS B . n 
B 1 236 GLU 236 342 342 GLU GLU B . n 
B 1 237 VAL 237 343 343 VAL VAL B . n 
B 1 238 ASP 238 344 344 ASP ASP B . n 
B 1 239 ASN 239 345 345 ASN ASN B . n 
B 1 240 GLU 240 346 346 GLU GLU B . n 
B 1 241 LEU 241 347 347 LEU LEU B . n 
B 1 242 ARG 242 348 348 ARG ARG B . n 
B 1 243 ILE 243 349 349 ILE ILE B . n 
B 1 244 CYS 244 350 350 CYS CYS B . n 
B 1 245 ALA 245 351 351 ALA ALA B . n 
B 1 246 ARG 246 352 352 ARG ARG B . n 
B 1 247 ASP 247 353 353 ASP ASP B . n 
B 1 248 LYS 248 354 354 LYS LYS B . n 
B 1 249 GLU 249 355 355 GLU GLU B . n 
B 1 250 VAL 250 356 356 VAL VAL B . n 
B 1 251 GLY 251 357 357 GLY GLY B . n 
B 1 252 ASN 252 358 358 ASN ASN B . n 
B 1 253 LEU 253 359 359 LEU LEU B . n 
B 1 254 TYR 254 360 360 TYR TYR B . n 
B 1 255 ASP 255 361 361 ASP ASP B . n 
B 1 256 MET 256 362 362 MET MET B . n 
B 1 257 PHE 257 363 363 PHE PHE B . n 
B 1 258 HIS 258 364 364 HIS HIS B . n 
B 1 259 THR 259 365 365 THR THR B . n 
B 1 260 ARG 260 366 366 ARG ARG B . n 
B 1 261 ASN 261 367 367 ASN ASN B . n 
B 1 262 SER 262 368 368 SER SER B . n 
B 1 263 LEU 263 369 369 LEU LEU B . n 
B 1 264 HIS 264 370 370 HIS HIS B . n 
B 1 265 ARG 265 371 371 ARG ARG B . n 
B 1 266 ARG 266 372 372 ARG ARG B . n 
B 1 267 ALA 267 373 373 ALA ALA B . n 
B 1 268 TYR 268 374 374 TYR TYR B . n 
B 1 269 GLN 269 375 375 GLN GLN B . n 
B 1 270 HIS 270 376 376 HIS HIS B . n 
B 1 271 LYS 271 377 377 LYS LYS B . n 
B 1 272 VAL 272 378 378 VAL VAL B . n 
B 1 273 GLY 273 379 379 GLY GLY B . n 
B 1 274 ASN 274 380 380 ASN ASN B . n 
B 1 275 ILE 275 381 381 ILE ILE B . n 
B 1 276 ILE 276 382 382 ILE ILE B . n 
B 1 277 ASP 277 383 383 ASP ASP B . n 
B 1 278 THR 278 384 384 THR THR B . n 
B 1 279 MET 279 385 385 MET MET B . n 
B 1 280 ILE 280 386 386 ILE ILE B . n 
B 1 281 THR 281 387 387 THR THR B . n 
B 1 282 ASP 282 388 388 ASP ASP B . n 
B 1 283 ALA 283 389 389 ALA ALA B . n 
B 1 284 PHE 284 390 390 PHE PHE B . n 
B 1 285 LEU 285 391 391 LEU LEU B . n 
B 1 286 LYS 286 392 392 LYS LYS B . n 
B 1 287 ALA 287 393 393 ALA ALA B . n 
B 1 288 ASP 288 394 394 ASP ASP B . n 
B 1 289 ASP 289 395 395 ASP ASP B . n 
B 1 290 TYR 290 396 396 TYR TYR B . n 
B 1 291 ILE 291 397 397 ILE ILE B . n 
B 1 292 GLU 292 398 398 GLU GLU B . n 
B 1 293 ILE 293 399 399 ILE ILE B . n 
B 1 294 THR 294 400 400 THR THR B . n 
B 1 295 GLY 295 401 401 GLY GLY B . n 
B 1 296 ALA 296 402 402 ALA ALA B . n 
B 1 297 GLY 297 403 403 GLY GLY B . n 
B 1 298 GLY 298 404 404 GLY GLY B . n 
B 1 299 LYS 299 405 405 LYS LYS B . n 
B 1 300 LYS 300 406 406 LYS LYS B . n 
B 1 301 TYR 301 407 407 TYR TYR B . n 
B 1 302 ARG 302 408 408 ARG ARG B . n 
B 1 303 ILE 303 409 409 ILE ILE B . n 
B 1 304 SER 304 410 410 SER SER B . n 
B 1 305 THR 305 411 411 THR THR B . n 
B 1 306 ALA 306 412 412 ALA ALA B . n 
B 1 307 ILE 307 413 413 ILE ILE B . n 
B 1 308 ASP 308 414 414 ASP ASP B . n 
B 1 309 ASP 309 415 415 ASP ASP B . n 
B 1 310 MET 310 416 416 MET MET B . n 
B 1 311 GLU 311 417 417 GLU GLU B . n 
B 1 312 ALA 312 418 418 ALA ALA B . n 
B 1 313 TYR 313 419 419 TYR TYR B . n 
B 1 314 THR 314 420 420 THR THR B . n 
B 1 315 LYS 315 421 421 LYS LYS B . n 
B 1 316 LEU 316 422 422 LEU LEU B . n 
B 1 317 THR 317 423 423 THR THR B . n 
B 1 318 ASP 318 424 424 ASP ASP B . n 
B 1 319 ASN 319 425 425 ASN ASN B . n 
B 1 320 ILE 320 426 426 ILE ILE B . n 
B 1 321 PHE 321 427 427 PHE PHE B . n 
B 1 322 LEU 322 428 428 LEU LEU B . n 
B 1 323 GLU 323 429 429 GLU GLU B . n 
B 1 324 ILE 324 430 430 ILE ILE B . n 
B 1 325 LEU 325 431 431 LEU LEU B . n 
B 1 326 TYR 326 432 432 TYR TYR B . n 
B 1 327 SER 327 433 433 SER SER B . n 
B 1 328 THR 328 434 434 THR THR B . n 
B 1 329 ASP 329 435 435 ASP ASP B . n 
B 1 330 PRO 330 436 436 PRO PRO B . n 
B 1 331 LYS 331 437 437 LYS LYS B . n 
B 1 332 LEU 332 438 438 LEU LEU B . n 
B 1 333 LYS 333 439 439 LYS LYS B . n 
B 1 334 ASP 334 440 440 ASP ASP B . n 
B 1 335 ALA 335 441 441 ALA ALA B . n 
B 1 336 ARG 336 442 442 ARG ARG B . n 
B 1 337 GLU 337 443 443 GLU GLU B . n 
B 1 338 ILE 338 444 444 ILE ILE B . n 
B 1 339 LEU 339 445 445 LEU LEU B . n 
B 1 340 LYS 340 446 446 LYS LYS B . n 
B 1 341 GLN 341 447 447 GLN GLN B . n 
B 1 342 ILE 342 448 448 ILE ILE B . n 
B 1 343 GLU 343 449 449 GLU GLU B . n 
B 1 344 TYR 344 450 450 TYR TYR B . n 
B 1 345 ARG 345 451 451 ARG ARG B . n 
B 1 346 ASN 346 452 452 ASN ASN B . n 
B 1 347 LEU 347 453 453 LEU LEU B . n 
B 1 348 PHE 348 454 454 PHE PHE B . n 
B 1 349 LYS 349 455 455 LYS LYS B . n 
B 1 350 TYR 350 456 456 TYR TYR B . n 
B 1 351 VAL 351 457 457 VAL VAL B . n 
B 1 352 GLY 352 458 458 GLY GLY B . n 
B 1 353 GLU 353 459 459 GLU GLU B . n 
B 1 354 THR 354 460 460 THR THR B . n 
B 1 355 GLN 355 461 461 GLN GLN B . n 
B 1 356 PRO 356 462 462 PRO PRO B . n 
B 1 357 THR 357 463 463 THR THR B . n 
B 1 358 GLY 358 464 464 GLY GLY B . n 
B 1 359 GLN 359 465 465 GLN GLN B . n 
B 1 360 ILE 360 466 466 ILE ILE B . n 
B 1 361 LYS 361 467 467 LYS LYS B . n 
B 1 362 ILE 362 468 468 ILE ILE B . n 
B 1 363 LYS 363 469 469 LYS LYS B . n 
B 1 364 ARG 364 470 470 ARG ARG B . n 
B 1 365 GLU 365 471 471 GLU GLU B . n 
B 1 366 ASP 366 472 472 ASP ASP B . n 
B 1 367 TYR 367 473 473 TYR TYR B . n 
B 1 368 GLU 368 474 474 GLU GLU B . n 
B 1 369 SER 369 475 475 SER SER B . n 
B 1 370 LEU 370 476 476 LEU LEU B . n 
B 1 371 PRO 371 477 477 PRO PRO B . n 
B 1 372 LYS 372 478 478 LYS LYS B . n 
B 1 373 GLU 373 479 479 GLU GLU B . n 
B 1 374 VAL 374 480 480 VAL VAL B . n 
B 1 375 ALA 375 481 481 ALA ALA B . n 
B 1 376 SER 376 482 482 SER SER B . n 
B 1 377 ALA 377 483 483 ALA ALA B . n 
B 1 378 LYS 378 484 484 LYS LYS B . n 
B 1 379 PRO 379 485 485 PRO PRO B . n 
B 1 380 LYS 380 486 486 LYS LYS B . n 
B 1 381 VAL 381 487 487 VAL VAL B . n 
B 1 382 LEU 382 488 488 LEU LEU B . n 
B 1 383 LEU 383 489 489 LEU LEU B . n 
B 1 384 ASP 384 490 490 ASP ASP B . n 
B 1 385 VAL 385 491 491 VAL VAL B . n 
B 1 386 LYS 386 492 492 LYS LYS B . n 
B 1 387 LEU 387 493 493 LEU LEU B . n 
B 1 388 LYS 388 494 494 LYS LYS B . n 
B 1 389 ALA 389 495 495 ALA ALA B . n 
B 1 390 GLU 390 496 496 GLU GLU B . n 
B 1 391 ASP 391 497 497 ASP ASP B . n 
B 1 392 PHE 392 498 498 PHE PHE B . n 
B 1 393 ILE 393 499 499 ILE ILE B . n 
B 1 394 VAL 394 500 500 VAL VAL B . n 
B 1 395 ASP 395 501 501 ASP ASP B . n 
B 1 396 VAL 396 502 502 VAL VAL B . n 
B 1 397 ILE 397 503 503 ILE ILE B . n 
B 1 398 ASN 398 504 504 ASN ASN B . n 
B 1 399 MET 399 505 505 MET MET B . n 
B 1 400 ASP 400 506 506 ASP ASP B . n 
B 1 401 TYR 401 507 507 TYR TYR B . n 
B 1 402 GLY 402 508 508 GLY GLY B . n 
B 1 403 MET 403 509 509 MET MET B . n 
B 1 404 GLN 404 510 510 GLN GLN B . n 
B 1 405 GLU 405 511 511 GLU GLU B . n 
B 1 406 LYS 406 512 512 LYS LYS B . n 
B 1 407 ASN 407 513 513 ASN ASN B . n 
B 1 408 PRO 408 514 514 PRO PRO B . n 
B 1 409 ILE 409 515 515 ILE ILE B . n 
B 1 410 ASP 410 516 516 ASP ASP B . n 
B 1 411 HIS 411 517 517 HIS HIS B . n 
B 1 412 VAL 412 518 518 VAL VAL B . n 
B 1 413 SER 413 519 519 SER SER B . n 
B 1 414 PHE 414 520 520 PHE PHE B . n 
B 1 415 TYR 415 521 521 TYR TYR B . n 
B 1 416 CYS 416 522 522 CYS CYS B . n 
B 1 417 LYS 417 523 523 LYS LYS B . n 
B 1 418 THR 418 524 524 THR THR B . n 
B 1 419 ALA 419 525 525 ALA ALA B . n 
B 1 420 PRO 420 526 526 PRO PRO B . n 
B 1 421 ASN 421 527 527 ASN ASN B . n 
B 1 422 ARG 422 528 528 ARG ARG B . n 
B 1 423 ALA 423 529 529 ALA ALA B . n 
B 1 424 ILE 424 530 530 ILE ILE B . n 
B 1 425 ARG 425 531 531 ARG ARG B . n 
B 1 426 ILE 426 532 532 ILE ILE B . n 
B 1 427 THR 427 533 533 THR THR B . n 
B 1 428 LYS 428 534 534 LYS LYS B . n 
B 1 429 ASN 429 535 535 ASN ASN B . n 
B 1 430 GLN 430 536 536 GLN GLN B . n 
B 1 431 VAL 431 537 537 VAL VAL B . n 
B 1 432 SER 432 538 538 SER SER B . n 
B 1 433 GLN 433 539 539 GLN GLN B . n 
B 1 434 LEU 434 540 540 LEU LEU B . n 
B 1 435 LEU 435 541 541 LEU LEU B . n 
B 1 436 PRO 436 542 542 PRO PRO B . n 
B 1 437 GLU 437 543 543 GLU GLU B . n 
B 1 438 LYS 438 544 544 LYS LYS B . n 
B 1 439 PHE 439 545 545 PHE PHE B . n 
B 1 440 ALA 440 546 546 ALA ALA B . n 
B 1 441 GLU 441 547 547 GLU GLU B . n 
B 1 442 GLN 442 548 548 GLN GLN B . n 
B 1 443 LEU 443 549 549 LEU LEU B . n 
B 1 444 ILE 444 550 550 ILE ILE B . n 
B 1 445 ARG 445 551 551 ARG ARG B . n 
B 1 446 VAL 446 552 552 VAL VAL B . n 
B 1 447 TYR 447 553 553 TYR TYR B . n 
B 1 448 CYS 448 554 554 CYS CYS B . n 
B 1 449 LYS 449 555 555 LYS LYS B . n 
B 1 450 LYS 450 556 556 LYS LYS B . n 
B 1 451 VAL 451 557 557 VAL VAL B . n 
B 1 452 ASP 452 558 558 ASP ASP B . n 
B 1 453 ARG 453 559 559 ARG ARG B . n 
B 1 454 LYS 454 560 560 LYS LYS B . n 
B 1 455 SER 455 561 561 SER SER B . n 
B 1 456 LEU 456 562 562 LEU LEU B . n 
B 1 457 TYR 457 563 563 TYR TYR B . n 
B 1 458 ALA 458 564 564 ALA ALA B . n 
B 1 459 ALA 459 565 565 ALA ALA B . n 
B 1 460 ARG 460 566 566 ARG ARG B . n 
B 1 461 GLN 461 567 567 GLN GLN B . n 
B 1 462 TYR 462 568 568 TYR TYR B . n 
B 1 463 PHE 463 569 569 PHE PHE B . n 
B 1 464 VAL 464 570 570 VAL VAL B . n 
B 1 465 GLN 465 571 571 GLN GLN B . n 
B 1 466 TRP 466 572 572 TRP TRP B . n 
B 1 467 CYS 467 573 573 CYS CYS B . n 
B 1 468 ALA 468 574 574 ALA ALA B . n 
B 1 469 ASP 469 575 575 ASP ASP B . n 
B 1 470 ARG 470 576 576 ARG ARG B . n 
B 1 471 ASN 471 577 577 ASN ASN B . n 
B 1 472 PHE 472 578 578 PHE PHE B . n 
B 1 473 THR 473 579 579 THR THR B . n 
B 1 474 LYS 474 580 580 LYS LYS B . n 
B 1 475 PRO 475 581 581 PRO PRO B . n 
B 1 476 GLN 476 582 582 GLN GLN B . n 
B 1 477 ASP 477 583 583 ASP ASP B . n 
B 1 478 GLY 478 584 584 GLY GLY B . n 
B 1 479 ASP 479 585 585 ASP ASP B . n 
B 1 480 VAL 480 586 586 VAL VAL B . n 
B 1 481 ILE 481 587 587 ILE ILE B . n 
B 1 482 ALA 482 588 588 ALA ALA B . n 
B 1 483 PRO 483 589 589 PRO PRO B . n 
B 1 484 LEU 484 590 590 LEU LEU B . n 
B 1 485 ILE 485 591 591 ILE ILE B . n 
B 1 486 THR 486 592 592 THR THR B . n 
B 1 487 PRO 487 593 593 PRO PRO B . n 
B 1 488 GLN 488 594 594 GLN GLN B . n 
B 1 489 LYS 489 595 595 LYS LYS B . n 
B 1 490 LYS 490 596 596 LYS LYS B . n 
B 1 491 GLU 491 597 597 GLU GLU B . n 
B 1 492 TRP 492 598 598 TRP TRP B . n 
B 1 493 ASN 493 599 599 ASN ASN B . n 
B 1 494 ASP 494 600 ?   ?   ?   B . n 
B 1 495 SER 495 601 ?   ?   ?   B . n 
B 1 496 THR 496 602 ?   ?   ?   B . n 
B 1 497 SER 497 603 ?   ?   ?   B . n 
B 1 498 VAL 498 604 ?   ?   ?   B . n 
B 1 499 GLN 499 605 ?   ?   ?   B . n 
B 1 500 ASN 500 606 ?   ?   ?   B . n 
B 1 501 PRO 501 607 ?   ?   ?   B . n 
B 1 502 THR 502 608 ?   ?   ?   B . n 
B 1 503 ARG 503 609 ?   ?   ?   B . n 
B 1 504 LEU 504 610 ?   ?   ?   B . n 
B 1 505 ARG 505 611 ?   ?   ?   B . n 
B 1 506 GLU 506 612 ?   ?   ?   B . n 
B 1 507 ALA 507 613 ?   ?   ?   B . n 
B 1 508 SER 508 614 ?   ?   ?   B . n 
B 1 509 LYS 509 615 ?   ?   ?   B . n 
B 1 510 SER 510 616 ?   ?   ?   B . n 
B 1 511 ARG 511 617 ?   ?   ?   B . n 
B 1 512 VAL 512 618 ?   ?   ?   B . n 
B 1 513 GLN 513 619 ?   ?   ?   B . n 
B 1 514 LEU 514 620 ?   ?   ?   B . n 
B 1 515 PHE 515 621 ?   ?   ?   B . n 
B 1 516 LYS 516 622 ?   ?   ?   B . n 
B 1 517 ASP 517 623 ?   ?   ?   B . n 
B 1 518 ASP 518 624 ?   ?   ?   B . n 
B 1 519 PRO 519 625 ?   ?   ?   B . n 
B 1 520 MET 520 626 ?   ?   ?   B . n 
C 1 1   GLY 1   107 ?   ?   ?   C . n 
C 1 2   SER 2   108 ?   ?   ?   C . n 
C 1 3   GLN 3   109 ?   ?   ?   C . n 
C 1 4   ILE 4   110 ?   ?   ?   C . n 
C 1 5   HIS 5   111 ?   ?   ?   C . n 
C 1 6   VAL 6   112 ?   ?   ?   C . n 
C 1 7   ASP 7   113 ?   ?   ?   C . n 
C 1 8   THR 8   114 ?   ?   ?   C . n 
C 1 9   MET 9   115 115 MET MET C . n 
C 1 10  LYS 10  116 116 LYS LYS C . n 
C 1 11  VAL 11  117 117 VAL VAL C . n 
C 1 12  ILE 12  118 118 ILE ILE C . n 
C 1 13  ASN 13  119 119 ASN ASN C . n 
C 1 14  ASP 14  120 120 ASP ASP C . n 
C 1 15  PRO 15  121 121 PRO PRO C . n 
C 1 16  ILE 16  122 122 ILE ILE C . n 
C 1 17  HIS 17  123 123 HIS HIS C . n 
C 1 18  GLY 18  124 124 GLY GLY C . n 
C 1 19  HIS 19  125 125 HIS HIS C . n 
C 1 20  ILE 20  126 126 ILE ILE C . n 
C 1 21  GLU 21  127 127 GLU GLU C . n 
C 1 22  LEU 22  128 128 LEU LEU C . n 
C 1 23  HIS 23  129 129 HIS HIS C . n 
C 1 24  PRO 24  130 130 PRO PRO C . n 
C 1 25  LEU 25  131 131 LEU LEU C . n 
C 1 26  LEU 26  132 132 LEU LEU C . n 
C 1 27  VAL 27  133 133 VAL VAL C . n 
C 1 28  ARG 28  134 134 ARG ARG C . n 
C 1 29  ILE 29  135 135 ILE ILE C . n 
C 1 30  ILE 30  136 136 ILE ILE C . n 
C 1 31  ASP 31  137 137 ASP ASP C . n 
C 1 32  THR 32  138 138 THR THR C . n 
C 1 33  PRO 33  139 139 PRO PRO C . n 
C 1 34  GLN 34  140 140 GLN GLN C . n 
C 1 35  PHE 35  141 141 PHE PHE C . n 
C 1 36  GLN 36  142 142 GLN GLN C . n 
C 1 37  ARG 37  143 143 ARG ARG C . n 
C 1 38  LEU 38  144 144 LEU LEU C . n 
C 1 39  ARG 39  145 145 ARG ARG C . n 
C 1 40  TYR 40  146 146 TYR TYR C . n 
C 1 41  ILE 41  147 147 ILE ILE C . n 
C 1 42  LYS 42  148 148 LYS LYS C . n 
C 1 43  GLN 43  149 149 GLN GLN C . n 
C 1 44  LEU 44  150 150 LEU LEU C . n 
C 1 45  GLY 45  151 151 GLY GLY C . n 
C 1 46  GLY 46  152 152 GLY GLY C . n 
C 1 47  GLY 47  153 153 GLY GLY C . n 
C 1 48  TYR 48  154 154 TYR TYR C . n 
C 1 49  TYR 49  155 155 TYR TYR C . n 
C 1 50  VAL 50  156 156 VAL VAL C . n 
C 1 51  PHE 51  157 157 PHE PHE C . n 
C 1 52  PRO 52  158 158 PRO PRO C . n 
C 1 53  GLY 53  159 159 GLY GLY C . n 
C 1 54  ALA 54  160 160 ALA ALA C . n 
C 1 55  SER 55  161 161 SER SER C . n 
C 1 56  HIS 56  162 162 HIS HIS C . n 
C 1 57  ASN 57  163 163 ASN ASN C . n 
C 1 58  ARG 58  164 164 ARG ARG C . n 
C 1 59  PHE 59  165 165 PHE PHE C . n 
C 1 60  GLU 60  166 166 GLU GLU C . n 
C 1 61  HIS 61  167 167 HIS HIS C . n 
C 1 62  SER 62  168 168 SER SER C . n 
C 1 63  LEU 63  169 169 LEU LEU C . n 
C 1 64  GLY 64  170 170 GLY GLY C . n 
C 1 65  VAL 65  171 171 VAL VAL C . n 
C 1 66  GLY 66  172 172 GLY GLY C . n 
C 1 67  TYR 67  173 173 TYR TYR C . n 
C 1 68  LEU 68  174 174 LEU LEU C . n 
C 1 69  ALA 69  175 175 ALA ALA C . n 
C 1 70  GLY 70  176 176 GLY GLY C . n 
C 1 71  CYS 71  177 177 CYS CYS C . n 
C 1 72  LEU 72  178 178 LEU LEU C . n 
C 1 73  VAL 73  179 179 VAL VAL C . n 
C 1 74  HIS 74  180 180 HIS HIS C . n 
C 1 75  ALA 75  181 181 ALA ALA C . n 
C 1 76  LEU 76  182 182 LEU LEU C . n 
C 1 77  GLY 77  183 183 GLY GLY C . n 
C 1 78  GLU 78  184 184 GLU GLU C . n 
C 1 79  LYS 79  185 185 LYS LYS C . n 
C 1 80  GLN 80  186 186 GLN GLN C . n 
C 1 81  PRO 81  187 187 PRO PRO C . n 
C 1 82  GLU 82  188 188 GLU GLU C . n 
C 1 83  LEU 83  189 189 LEU LEU C . n 
C 1 84  GLN 84  190 190 GLN GLN C . n 
C 1 85  ILE 85  191 191 ILE ILE C . n 
C 1 86  SER 86  192 192 SER SER C . n 
C 1 87  GLU 87  193 193 GLU GLU C . n 
C 1 88  ARG 88  194 194 ARG ARG C . n 
C 1 89  ASP 89  195 195 ASP ASP C . n 
C 1 90  VAL 90  196 196 VAL VAL C . n 
C 1 91  LEU 91  197 197 LEU LEU C . n 
C 1 92  CYS 92  198 198 CYS CYS C . n 
C 1 93  VAL 93  199 199 VAL VAL C . n 
C 1 94  GLN 94  200 200 GLN GLN C . n 
C 1 95  ILE 95  201 201 ILE ILE C . n 
C 1 96  ALA 96  202 202 ALA ALA C . n 
C 1 97  GLY 97  203 203 GLY GLY C . n 
C 1 98  LEU 98  204 204 LEU LEU C . n 
C 1 99  CYS 99  205 205 CYS CYS C . n 
C 1 100 HIS 100 206 206 HIS HIS C . n 
C 1 101 ASP 101 207 207 ASP ASP C . n 
C 1 102 LEU 102 208 208 LEU LEU C . n 
C 1 103 GLY 103 209 209 GLY GLY C . n 
C 1 104 HIS 104 210 210 HIS HIS C . n 
C 1 105 GLY 105 211 211 GLY GLY C . n 
C 1 106 PRO 106 212 212 PRO PRO C . n 
C 1 107 PHE 107 213 213 PHE PHE C . n 
C 1 108 SER 108 214 214 SER SER C . n 
C 1 109 HIS 109 215 215 HIS HIS C . n 
C 1 110 MET 110 216 216 MET MET C . n 
C 1 111 PHE 111 217 217 PHE PHE C . n 
C 1 112 ASP 112 218 218 ASP ASP C . n 
C 1 113 GLY 113 219 219 GLY GLY C . n 
C 1 114 ARG 114 220 220 ARG ARG C . n 
C 1 115 PHE 115 221 221 PHE PHE C . n 
C 1 116 ILE 116 222 222 ILE ILE C . n 
C 1 117 PRO 117 223 223 PRO PRO C . n 
C 1 118 LEU 118 224 224 LEU LEU C . n 
C 1 119 ALA 119 225 225 ALA ALA C . n 
C 1 120 ARG 120 226 226 ARG ARG C . n 
C 1 121 PRO 121 227 227 PRO PRO C . n 
C 1 122 GLU 122 228 228 GLU GLU C . n 
C 1 123 VAL 123 229 229 VAL VAL C . n 
C 1 124 LYS 124 230 230 LYS LYS C . n 
C 1 125 TRP 125 231 231 TRP TRP C . n 
C 1 126 THR 126 232 232 THR THR C . n 
C 1 127 HIS 127 233 233 HIS HIS C . n 
C 1 128 GLU 128 234 234 GLU GLU C . n 
C 1 129 GLN 129 235 235 GLN GLN C . n 
C 1 130 GLY 130 236 236 GLY GLY C . n 
C 1 131 SER 131 237 237 SER SER C . n 
C 1 132 VAL 132 238 238 VAL VAL C . n 
C 1 133 MET 133 239 239 MET MET C . n 
C 1 134 MET 134 240 240 MET MET C . n 
C 1 135 PHE 135 241 241 PHE PHE C . n 
C 1 136 GLU 136 242 242 GLU GLU C . n 
C 1 137 HIS 137 243 243 HIS HIS C . n 
C 1 138 LEU 138 244 244 LEU LEU C . n 
C 1 139 ILE 139 245 245 ILE ILE C . n 
C 1 140 ASN 140 246 246 ASN ASN C . n 
C 1 141 SER 141 247 247 SER SER C . n 
C 1 142 ASN 142 248 248 ASN ASN C . n 
C 1 143 GLY 143 249 249 GLY GLY C . n 
C 1 144 ILE 144 250 250 ILE ILE C . n 
C 1 145 LYS 145 251 251 LYS LYS C . n 
C 1 146 PRO 146 252 252 PRO PRO C . n 
C 1 147 VAL 147 253 253 VAL VAL C . n 
C 1 148 MET 148 254 254 MET MET C . n 
C 1 149 GLU 149 255 255 GLU GLU C . n 
C 1 150 GLN 150 256 256 GLN GLN C . n 
C 1 151 TYR 151 257 257 TYR TYR C . n 
C 1 152 GLY 152 258 258 GLY GLY C . n 
C 1 153 LEU 153 259 259 LEU LEU C . n 
C 1 154 ILE 154 260 260 ILE ILE C . n 
C 1 155 PRO 155 261 261 PRO PRO C . n 
C 1 156 GLU 156 262 262 GLU GLU C . n 
C 1 157 GLU 157 263 263 GLU GLU C . n 
C 1 158 ASP 158 264 264 ASP ASP C . n 
C 1 159 ILE 159 265 265 ILE ILE C . n 
C 1 160 CYS 160 266 266 CYS CYS C . n 
C 1 161 PHE 161 267 267 PHE PHE C . n 
C 1 162 ILE 162 268 268 ILE ILE C . n 
C 1 163 LYS 163 269 269 LYS LYS C . n 
C 1 164 GLU 164 270 270 GLU GLU C . n 
C 1 165 GLN 165 271 271 GLN GLN C . n 
C 1 166 ILE 166 272 272 ILE ILE C . n 
C 1 167 VAL 167 273 273 VAL VAL C . n 
C 1 168 GLY 168 274 274 GLY GLY C . n 
C 1 169 PRO 169 275 275 PRO PRO C . n 
C 1 170 LEU 170 276 276 LEU LEU C . n 
C 1 171 GLU 171 277 277 GLU GLU C . n 
C 1 172 SER 172 278 ?   ?   ?   C . n 
C 1 173 PRO 173 279 ?   ?   ?   C . n 
C 1 174 VAL 174 280 ?   ?   ?   C . n 
C 1 175 GLU 175 281 ?   ?   ?   C . n 
C 1 176 ASP 176 282 ?   ?   ?   C . n 
C 1 177 SER 177 283 283 SER SER C . n 
C 1 178 LEU 178 284 284 LEU LEU C . n 
C 1 179 TRP 179 285 285 TRP TRP C . n 
C 1 180 PRO 180 286 286 PRO PRO C . n 
C 1 181 TYR 181 287 287 TYR TYR C . n 
C 1 182 LYS 182 288 288 LYS LYS C . n 
C 1 183 GLY 183 289 289 GLY GLY C . n 
C 1 184 ARG 184 290 290 ARG ARG C . n 
C 1 185 PRO 185 291 291 PRO PRO C . n 
C 1 186 GLU 186 292 292 GLU GLU C . n 
C 1 187 ASN 187 293 293 ASN ASN C . n 
C 1 188 LYS 188 294 294 LYS LYS C . n 
C 1 189 SER 189 295 295 SER SER C . n 
C 1 190 PHE 190 296 296 PHE PHE C . n 
C 1 191 LEU 191 297 297 LEU LEU C . n 
C 1 192 TYR 192 298 298 TYR TYR C . n 
C 1 193 GLU 193 299 299 GLU GLU C . n 
C 1 194 ILE 194 300 300 ILE ILE C . n 
C 1 195 VAL 195 301 301 VAL VAL C . n 
C 1 196 SER 196 302 302 SER SER C . n 
C 1 197 ASN 197 303 303 ASN ASN C . n 
C 1 198 LYS 198 304 304 LYS LYS C . n 
C 1 199 ARG 199 305 305 ARG ARG C . n 
C 1 200 ASN 200 306 306 ASN ASN C . n 
C 1 201 GLY 201 307 307 GLY GLY C . n 
C 1 202 ILE 202 308 308 ILE ILE C . n 
C 1 203 ASP 203 309 309 ASP ASP C . n 
C 1 204 VAL 204 310 310 VAL VAL C . n 
C 1 205 ASP 205 311 311 ASP ASP C . n 
C 1 206 LYS 206 312 312 LYS LYS C . n 
C 1 207 TRP 207 313 313 TRP TRP C . n 
C 1 208 ASP 208 314 314 ASP ASP C . n 
C 1 209 TYR 209 315 315 TYR TYR C . n 
C 1 210 PHE 210 316 316 PHE PHE C . n 
C 1 211 ALA 211 317 317 ALA ALA C . n 
C 1 212 ARG 212 318 318 ARG ARG C . n 
C 1 213 ASP 213 319 319 ASP ASP C . n 
C 1 214 CYS 214 320 320 CYS CYS C . n 
C 1 215 HIS 215 321 321 HIS HIS C . n 
C 1 216 HIS 216 322 322 HIS HIS C . n 
C 1 217 LEU 217 323 323 LEU LEU C . n 
C 1 218 GLY 218 324 324 GLY GLY C . n 
C 1 219 ILE 219 325 325 ILE ILE C . n 
C 1 220 GLN 220 326 326 GLN GLN C . n 
C 1 221 ASN 221 327 327 ASN ASN C . n 
C 1 222 ASN 222 328 328 ASN ASN C . n 
C 1 223 PHE 223 329 329 PHE PHE C . n 
C 1 224 ASP 224 330 330 ASP ASP C . n 
C 1 225 TYR 225 331 331 TYR TYR C . n 
C 1 226 LYS 226 332 332 LYS LYS C . n 
C 1 227 ARG 227 333 333 ARG ARG C . n 
C 1 228 PHE 228 334 334 PHE PHE C . n 
C 1 229 ILE 229 335 335 ILE ILE C . n 
C 1 230 LYS 230 336 336 LYS LYS C . n 
C 1 231 PHE 231 337 337 PHE PHE C . n 
C 1 232 ALA 232 338 338 ALA ALA C . n 
C 1 233 ARG 233 339 339 ARG ARG C . n 
C 1 234 VAL 234 340 340 VAL VAL C . n 
C 1 235 CYS 235 341 341 CYS CYS C . n 
C 1 236 GLU 236 342 342 GLU GLU C . n 
C 1 237 VAL 237 343 343 VAL VAL C . n 
C 1 238 ASP 238 344 344 ASP ASP C . n 
C 1 239 ASN 239 345 345 ASN ASN C . n 
C 1 240 GLU 240 346 346 GLU GLU C . n 
C 1 241 LEU 241 347 347 LEU LEU C . n 
C 1 242 ARG 242 348 348 ARG ARG C . n 
C 1 243 ILE 243 349 349 ILE ILE C . n 
C 1 244 CYS 244 350 350 CYS CYS C . n 
C 1 245 ALA 245 351 351 ALA ALA C . n 
C 1 246 ARG 246 352 352 ARG ARG C . n 
C 1 247 ASP 247 353 353 ASP ASP C . n 
C 1 248 LYS 248 354 354 LYS LYS C . n 
C 1 249 GLU 249 355 355 GLU GLU C . n 
C 1 250 VAL 250 356 356 VAL VAL C . n 
C 1 251 GLY 251 357 357 GLY GLY C . n 
C 1 252 ASN 252 358 358 ASN ASN C . n 
C 1 253 LEU 253 359 359 LEU LEU C . n 
C 1 254 TYR 254 360 360 TYR TYR C . n 
C 1 255 ASP 255 361 361 ASP ASP C . n 
C 1 256 MET 256 362 362 MET MET C . n 
C 1 257 PHE 257 363 363 PHE PHE C . n 
C 1 258 HIS 258 364 364 HIS HIS C . n 
C 1 259 THR 259 365 365 THR THR C . n 
C 1 260 ARG 260 366 366 ARG ARG C . n 
C 1 261 ASN 261 367 367 ASN ASN C . n 
C 1 262 SER 262 368 368 SER SER C . n 
C 1 263 LEU 263 369 369 LEU LEU C . n 
C 1 264 HIS 264 370 370 HIS HIS C . n 
C 1 265 ARG 265 371 371 ARG ARG C . n 
C 1 266 ARG 266 372 372 ARG ARG C . n 
C 1 267 ALA 267 373 373 ALA ALA C . n 
C 1 268 TYR 268 374 374 TYR TYR C . n 
C 1 269 GLN 269 375 375 GLN GLN C . n 
C 1 270 HIS 270 376 376 HIS HIS C . n 
C 1 271 LYS 271 377 377 LYS LYS C . n 
C 1 272 VAL 272 378 378 VAL VAL C . n 
C 1 273 GLY 273 379 379 GLY GLY C . n 
C 1 274 ASN 274 380 380 ASN ASN C . n 
C 1 275 ILE 275 381 381 ILE ILE C . n 
C 1 276 ILE 276 382 382 ILE ILE C . n 
C 1 277 ASP 277 383 383 ASP ASP C . n 
C 1 278 THR 278 384 384 THR THR C . n 
C 1 279 MET 279 385 385 MET MET C . n 
C 1 280 ILE 280 386 386 ILE ILE C . n 
C 1 281 THR 281 387 387 THR THR C . n 
C 1 282 ASP 282 388 388 ASP ASP C . n 
C 1 283 ALA 283 389 389 ALA ALA C . n 
C 1 284 PHE 284 390 390 PHE PHE C . n 
C 1 285 LEU 285 391 391 LEU LEU C . n 
C 1 286 LYS 286 392 392 LYS LYS C . n 
C 1 287 ALA 287 393 393 ALA ALA C . n 
C 1 288 ASP 288 394 394 ASP ASP C . n 
C 1 289 ASP 289 395 395 ASP ASP C . n 
C 1 290 TYR 290 396 396 TYR TYR C . n 
C 1 291 ILE 291 397 397 ILE ILE C . n 
C 1 292 GLU 292 398 398 GLU GLU C . n 
C 1 293 ILE 293 399 399 ILE ILE C . n 
C 1 294 THR 294 400 400 THR THR C . n 
C 1 295 GLY 295 401 401 GLY GLY C . n 
C 1 296 ALA 296 402 402 ALA ALA C . n 
C 1 297 GLY 297 403 403 GLY GLY C . n 
C 1 298 GLY 298 404 404 GLY GLY C . n 
C 1 299 LYS 299 405 405 LYS LYS C . n 
C 1 300 LYS 300 406 406 LYS LYS C . n 
C 1 301 TYR 301 407 407 TYR TYR C . n 
C 1 302 ARG 302 408 408 ARG ARG C . n 
C 1 303 ILE 303 409 409 ILE ILE C . n 
C 1 304 SER 304 410 410 SER SER C . n 
C 1 305 THR 305 411 411 THR THR C . n 
C 1 306 ALA 306 412 412 ALA ALA C . n 
C 1 307 ILE 307 413 413 ILE ILE C . n 
C 1 308 ASP 308 414 414 ASP ASP C . n 
C 1 309 ASP 309 415 415 ASP ASP C . n 
C 1 310 MET 310 416 416 MET MET C . n 
C 1 311 GLU 311 417 417 GLU GLU C . n 
C 1 312 ALA 312 418 418 ALA ALA C . n 
C 1 313 TYR 313 419 419 TYR TYR C . n 
C 1 314 THR 314 420 420 THR THR C . n 
C 1 315 LYS 315 421 421 LYS LYS C . n 
C 1 316 LEU 316 422 422 LEU LEU C . n 
C 1 317 THR 317 423 423 THR THR C . n 
C 1 318 ASP 318 424 424 ASP ASP C . n 
C 1 319 ASN 319 425 425 ASN ASN C . n 
C 1 320 ILE 320 426 426 ILE ILE C . n 
C 1 321 PHE 321 427 427 PHE PHE C . n 
C 1 322 LEU 322 428 428 LEU LEU C . n 
C 1 323 GLU 323 429 429 GLU GLU C . n 
C 1 324 ILE 324 430 430 ILE ILE C . n 
C 1 325 LEU 325 431 431 LEU LEU C . n 
C 1 326 TYR 326 432 432 TYR TYR C . n 
C 1 327 SER 327 433 433 SER SER C . n 
C 1 328 THR 328 434 434 THR THR C . n 
C 1 329 ASP 329 435 435 ASP ASP C . n 
C 1 330 PRO 330 436 436 PRO PRO C . n 
C 1 331 LYS 331 437 437 LYS LYS C . n 
C 1 332 LEU 332 438 438 LEU LEU C . n 
C 1 333 LYS 333 439 439 LYS LYS C . n 
C 1 334 ASP 334 440 440 ASP ASP C . n 
C 1 335 ALA 335 441 441 ALA ALA C . n 
C 1 336 ARG 336 442 442 ARG ARG C . n 
C 1 337 GLU 337 443 443 GLU GLU C . n 
C 1 338 ILE 338 444 444 ILE ILE C . n 
C 1 339 LEU 339 445 445 LEU LEU C . n 
C 1 340 LYS 340 446 446 LYS LYS C . n 
C 1 341 GLN 341 447 447 GLN GLN C . n 
C 1 342 ILE 342 448 448 ILE ILE C . n 
C 1 343 GLU 343 449 449 GLU GLU C . n 
C 1 344 TYR 344 450 450 TYR TYR C . n 
C 1 345 ARG 345 451 451 ARG ARG C . n 
C 1 346 ASN 346 452 452 ASN ASN C . n 
C 1 347 LEU 347 453 453 LEU LEU C . n 
C 1 348 PHE 348 454 454 PHE PHE C . n 
C 1 349 LYS 349 455 455 LYS LYS C . n 
C 1 350 TYR 350 456 456 TYR TYR C . n 
C 1 351 VAL 351 457 457 VAL VAL C . n 
C 1 352 GLY 352 458 458 GLY GLY C . n 
C 1 353 GLU 353 459 459 GLU GLU C . n 
C 1 354 THR 354 460 460 THR THR C . n 
C 1 355 GLN 355 461 461 GLN GLN C . n 
C 1 356 PRO 356 462 462 PRO PRO C . n 
C 1 357 THR 357 463 463 THR THR C . n 
C 1 358 GLY 358 464 464 GLY GLY C . n 
C 1 359 GLN 359 465 465 GLN GLN C . n 
C 1 360 ILE 360 466 466 ILE ILE C . n 
C 1 361 LYS 361 467 467 LYS LYS C . n 
C 1 362 ILE 362 468 468 ILE ILE C . n 
C 1 363 LYS 363 469 469 LYS LYS C . n 
C 1 364 ARG 364 470 470 ARG ARG C . n 
C 1 365 GLU 365 471 471 GLU GLU C . n 
C 1 366 ASP 366 472 472 ASP ASP C . n 
C 1 367 TYR 367 473 473 TYR TYR C . n 
C 1 368 GLU 368 474 474 GLU GLU C . n 
C 1 369 SER 369 475 475 SER SER C . n 
C 1 370 LEU 370 476 476 LEU LEU C . n 
C 1 371 PRO 371 477 477 PRO PRO C . n 
C 1 372 LYS 372 478 478 LYS LYS C . n 
C 1 373 GLU 373 479 479 GLU GLU C . n 
C 1 374 VAL 374 480 480 VAL VAL C . n 
C 1 375 ALA 375 481 481 ALA ALA C . n 
C 1 376 SER 376 482 482 SER SER C . n 
C 1 377 ALA 377 483 483 ALA ALA C . n 
C 1 378 LYS 378 484 484 LYS LYS C . n 
C 1 379 PRO 379 485 485 PRO PRO C . n 
C 1 380 LYS 380 486 486 LYS LYS C . n 
C 1 381 VAL 381 487 487 VAL VAL C . n 
C 1 382 LEU 382 488 488 LEU LEU C . n 
C 1 383 LEU 383 489 489 LEU LEU C . n 
C 1 384 ASP 384 490 490 ASP ASP C . n 
C 1 385 VAL 385 491 491 VAL VAL C . n 
C 1 386 LYS 386 492 492 LYS LYS C . n 
C 1 387 LEU 387 493 493 LEU LEU C . n 
C 1 388 LYS 388 494 494 LYS LYS C . n 
C 1 389 ALA 389 495 495 ALA ALA C . n 
C 1 390 GLU 390 496 496 GLU GLU C . n 
C 1 391 ASP 391 497 497 ASP ASP C . n 
C 1 392 PHE 392 498 498 PHE PHE C . n 
C 1 393 ILE 393 499 499 ILE ILE C . n 
C 1 394 VAL 394 500 500 VAL VAL C . n 
C 1 395 ASP 395 501 501 ASP ASP C . n 
C 1 396 VAL 396 502 502 VAL VAL C . n 
C 1 397 ILE 397 503 503 ILE ILE C . n 
C 1 398 ASN 398 504 504 ASN ASN C . n 
C 1 399 MET 399 505 505 MET MET C . n 
C 1 400 ASP 400 506 506 ASP ASP C . n 
C 1 401 TYR 401 507 507 TYR TYR C . n 
C 1 402 GLY 402 508 508 GLY GLY C . n 
C 1 403 MET 403 509 509 MET MET C . n 
C 1 404 GLN 404 510 510 GLN GLN C . n 
C 1 405 GLU 405 511 511 GLU GLU C . n 
C 1 406 LYS 406 512 512 LYS LYS C . n 
C 1 407 ASN 407 513 513 ASN ASN C . n 
C 1 408 PRO 408 514 514 PRO PRO C . n 
C 1 409 ILE 409 515 515 ILE ILE C . n 
C 1 410 ASP 410 516 516 ASP ASP C . n 
C 1 411 HIS 411 517 517 HIS HIS C . n 
C 1 412 VAL 412 518 518 VAL VAL C . n 
C 1 413 SER 413 519 519 SER SER C . n 
C 1 414 PHE 414 520 520 PHE PHE C . n 
C 1 415 TYR 415 521 521 TYR TYR C . n 
C 1 416 CYS 416 522 522 CYS CYS C . n 
C 1 417 LYS 417 523 523 LYS LYS C . n 
C 1 418 THR 418 524 524 THR THR C . n 
C 1 419 ALA 419 525 525 ALA ALA C . n 
C 1 420 PRO 420 526 526 PRO PRO C . n 
C 1 421 ASN 421 527 527 ASN ASN C . n 
C 1 422 ARG 422 528 528 ARG ARG C . n 
C 1 423 ALA 423 529 529 ALA ALA C . n 
C 1 424 ILE 424 530 530 ILE ILE C . n 
C 1 425 ARG 425 531 531 ARG ARG C . n 
C 1 426 ILE 426 532 532 ILE ILE C . n 
C 1 427 THR 427 533 533 THR THR C . n 
C 1 428 LYS 428 534 534 LYS LYS C . n 
C 1 429 ASN 429 535 535 ASN ASN C . n 
C 1 430 GLN 430 536 536 GLN GLN C . n 
C 1 431 VAL 431 537 537 VAL VAL C . n 
C 1 432 SER 432 538 538 SER SER C . n 
C 1 433 GLN 433 539 539 GLN GLN C . n 
C 1 434 LEU 434 540 540 LEU LEU C . n 
C 1 435 LEU 435 541 541 LEU LEU C . n 
C 1 436 PRO 436 542 542 PRO PRO C . n 
C 1 437 GLU 437 543 543 GLU GLU C . n 
C 1 438 LYS 438 544 544 LYS LYS C . n 
C 1 439 PHE 439 545 545 PHE PHE C . n 
C 1 440 ALA 440 546 546 ALA ALA C . n 
C 1 441 GLU 441 547 547 GLU GLU C . n 
C 1 442 GLN 442 548 548 GLN GLN C . n 
C 1 443 LEU 443 549 549 LEU LEU C . n 
C 1 444 ILE 444 550 550 ILE ILE C . n 
C 1 445 ARG 445 551 551 ARG ARG C . n 
C 1 446 VAL 446 552 552 VAL VAL C . n 
C 1 447 TYR 447 553 553 TYR TYR C . n 
C 1 448 CYS 448 554 554 CYS CYS C . n 
C 1 449 LYS 449 555 555 LYS LYS C . n 
C 1 450 LYS 450 556 556 LYS LYS C . n 
C 1 451 VAL 451 557 557 VAL VAL C . n 
C 1 452 ASP 452 558 558 ASP ASP C . n 
C 1 453 ARG 453 559 559 ARG ARG C . n 
C 1 454 LYS 454 560 560 LYS LYS C . n 
C 1 455 SER 455 561 561 SER SER C . n 
C 1 456 LEU 456 562 562 LEU LEU C . n 
C 1 457 TYR 457 563 563 TYR TYR C . n 
C 1 458 ALA 458 564 564 ALA ALA C . n 
C 1 459 ALA 459 565 565 ALA ALA C . n 
C 1 460 ARG 460 566 566 ARG ARG C . n 
C 1 461 GLN 461 567 567 GLN GLN C . n 
C 1 462 TYR 462 568 568 TYR TYR C . n 
C 1 463 PHE 463 569 569 PHE PHE C . n 
C 1 464 VAL 464 570 570 VAL VAL C . n 
C 1 465 GLN 465 571 571 GLN GLN C . n 
C 1 466 TRP 466 572 572 TRP TRP C . n 
C 1 467 CYS 467 573 573 CYS CYS C . n 
C 1 468 ALA 468 574 574 ALA ALA C . n 
C 1 469 ASP 469 575 575 ASP ASP C . n 
C 1 470 ARG 470 576 576 ARG ARG C . n 
C 1 471 ASN 471 577 577 ASN ASN C . n 
C 1 472 PHE 472 578 578 PHE PHE C . n 
C 1 473 THR 473 579 579 THR THR C . n 
C 1 474 LYS 474 580 580 LYS LYS C . n 
C 1 475 PRO 475 581 581 PRO PRO C . n 
C 1 476 GLN 476 582 582 GLN GLN C . n 
C 1 477 ASP 477 583 583 ASP ASP C . n 
C 1 478 GLY 478 584 584 GLY GLY C . n 
C 1 479 ASP 479 585 585 ASP ASP C . n 
C 1 480 VAL 480 586 586 VAL VAL C . n 
C 1 481 ILE 481 587 587 ILE ILE C . n 
C 1 482 ALA 482 588 588 ALA ALA C . n 
C 1 483 PRO 483 589 589 PRO PRO C . n 
C 1 484 LEU 484 590 590 LEU LEU C . n 
C 1 485 ILE 485 591 591 ILE ILE C . n 
C 1 486 THR 486 592 592 THR THR C . n 
C 1 487 PRO 487 593 593 PRO PRO C . n 
C 1 488 GLN 488 594 594 GLN GLN C . n 
C 1 489 LYS 489 595 595 LYS LYS C . n 
C 1 490 LYS 490 596 596 LYS LYS C . n 
C 1 491 GLU 491 597 597 GLU GLU C . n 
C 1 492 TRP 492 598 598 TRP TRP C . n 
C 1 493 ASN 493 599 599 ASN ASN C . n 
C 1 494 ASP 494 600 ?   ?   ?   C . n 
C 1 495 SER 495 601 ?   ?   ?   C . n 
C 1 496 THR 496 602 ?   ?   ?   C . n 
C 1 497 SER 497 603 ?   ?   ?   C . n 
C 1 498 VAL 498 604 ?   ?   ?   C . n 
C 1 499 GLN 499 605 ?   ?   ?   C . n 
C 1 500 ASN 500 606 ?   ?   ?   C . n 
C 1 501 PRO 501 607 ?   ?   ?   C . n 
C 1 502 THR 502 608 ?   ?   ?   C . n 
C 1 503 ARG 503 609 ?   ?   ?   C . n 
C 1 504 LEU 504 610 ?   ?   ?   C . n 
C 1 505 ARG 505 611 ?   ?   ?   C . n 
C 1 506 GLU 506 612 ?   ?   ?   C . n 
C 1 507 ALA 507 613 ?   ?   ?   C . n 
C 1 508 SER 508 614 ?   ?   ?   C . n 
C 1 509 LYS 509 615 ?   ?   ?   C . n 
C 1 510 SER 510 616 ?   ?   ?   C . n 
C 1 511 ARG 511 617 ?   ?   ?   C . n 
C 1 512 VAL 512 618 ?   ?   ?   C . n 
C 1 513 GLN 513 619 ?   ?   ?   C . n 
C 1 514 LEU 514 620 ?   ?   ?   C . n 
C 1 515 PHE 515 621 ?   ?   ?   C . n 
C 1 516 LYS 516 622 ?   ?   ?   C . n 
C 1 517 ASP 517 623 ?   ?   ?   C . n 
C 1 518 ASP 518 624 ?   ?   ?   C . n 
C 1 519 PRO 519 625 ?   ?   ?   C . n 
C 1 520 MET 520 626 ?   ?   ?   C . n 
D 1 1   GLY 1   107 ?   ?   ?   D . n 
D 1 2   SER 2   108 ?   ?   ?   D . n 
D 1 3   GLN 3   109 ?   ?   ?   D . n 
D 1 4   ILE 4   110 ?   ?   ?   D . n 
D 1 5   HIS 5   111 ?   ?   ?   D . n 
D 1 6   VAL 6   112 ?   ?   ?   D . n 
D 1 7   ASP 7   113 ?   ?   ?   D . n 
D 1 8   THR 8   114 114 THR THR D . n 
D 1 9   MET 9   115 115 MET MET D . n 
D 1 10  LYS 10  116 116 LYS LYS D . n 
D 1 11  VAL 11  117 117 VAL VAL D . n 
D 1 12  ILE 12  118 118 ILE ILE D . n 
D 1 13  ASN 13  119 119 ASN ASN D . n 
D 1 14  ASP 14  120 120 ASP ASP D . n 
D 1 15  PRO 15  121 121 PRO PRO D . n 
D 1 16  ILE 16  122 122 ILE ILE D . n 
D 1 17  HIS 17  123 123 HIS HIS D . n 
D 1 18  GLY 18  124 124 GLY GLY D . n 
D 1 19  HIS 19  125 125 HIS HIS D . n 
D 1 20  ILE 20  126 126 ILE ILE D . n 
D 1 21  GLU 21  127 127 GLU GLU D . n 
D 1 22  LEU 22  128 128 LEU LEU D . n 
D 1 23  HIS 23  129 129 HIS HIS D . n 
D 1 24  PRO 24  130 130 PRO PRO D . n 
D 1 25  LEU 25  131 131 LEU LEU D . n 
D 1 26  LEU 26  132 132 LEU LEU D . n 
D 1 27  VAL 27  133 133 VAL VAL D . n 
D 1 28  ARG 28  134 134 ARG ARG D . n 
D 1 29  ILE 29  135 135 ILE ILE D . n 
D 1 30  ILE 30  136 136 ILE ILE D . n 
D 1 31  ASP 31  137 137 ASP ASP D . n 
D 1 32  THR 32  138 138 THR THR D . n 
D 1 33  PRO 33  139 139 PRO PRO D . n 
D 1 34  GLN 34  140 140 GLN GLN D . n 
D 1 35  PHE 35  141 141 PHE PHE D . n 
D 1 36  GLN 36  142 142 GLN GLN D . n 
D 1 37  ARG 37  143 143 ARG ARG D . n 
D 1 38  LEU 38  144 144 LEU LEU D . n 
D 1 39  ARG 39  145 145 ARG ARG D . n 
D 1 40  TYR 40  146 146 TYR TYR D . n 
D 1 41  ILE 41  147 147 ILE ILE D . n 
D 1 42  LYS 42  148 148 LYS LYS D . n 
D 1 43  GLN 43  149 149 GLN GLN D . n 
D 1 44  LEU 44  150 150 LEU LEU D . n 
D 1 45  GLY 45  151 151 GLY GLY D . n 
D 1 46  GLY 46  152 152 GLY GLY D . n 
D 1 47  GLY 47  153 153 GLY GLY D . n 
D 1 48  TYR 48  154 154 TYR TYR D . n 
D 1 49  TYR 49  155 155 TYR TYR D . n 
D 1 50  VAL 50  156 156 VAL VAL D . n 
D 1 51  PHE 51  157 157 PHE PHE D . n 
D 1 52  PRO 52  158 158 PRO PRO D . n 
D 1 53  GLY 53  159 159 GLY GLY D . n 
D 1 54  ALA 54  160 160 ALA ALA D . n 
D 1 55  SER 55  161 161 SER SER D . n 
D 1 56  HIS 56  162 162 HIS HIS D . n 
D 1 57  ASN 57  163 163 ASN ASN D . n 
D 1 58  ARG 58  164 164 ARG ARG D . n 
D 1 59  PHE 59  165 165 PHE PHE D . n 
D 1 60  GLU 60  166 166 GLU GLU D . n 
D 1 61  HIS 61  167 167 HIS HIS D . n 
D 1 62  SER 62  168 168 SER SER D . n 
D 1 63  LEU 63  169 169 LEU LEU D . n 
D 1 64  GLY 64  170 170 GLY GLY D . n 
D 1 65  VAL 65  171 171 VAL VAL D . n 
D 1 66  GLY 66  172 172 GLY GLY D . n 
D 1 67  TYR 67  173 173 TYR TYR D . n 
D 1 68  LEU 68  174 174 LEU LEU D . n 
D 1 69  ALA 69  175 175 ALA ALA D . n 
D 1 70  GLY 70  176 176 GLY GLY D . n 
D 1 71  CYS 71  177 177 CYS CYS D . n 
D 1 72  LEU 72  178 178 LEU LEU D . n 
D 1 73  VAL 73  179 179 VAL VAL D . n 
D 1 74  HIS 74  180 180 HIS HIS D . n 
D 1 75  ALA 75  181 181 ALA ALA D . n 
D 1 76  LEU 76  182 182 LEU LEU D . n 
D 1 77  GLY 77  183 183 GLY GLY D . n 
D 1 78  GLU 78  184 184 GLU GLU D . n 
D 1 79  LYS 79  185 185 LYS LYS D . n 
D 1 80  GLN 80  186 186 GLN GLN D . n 
D 1 81  PRO 81  187 187 PRO PRO D . n 
D 1 82  GLU 82  188 188 GLU GLU D . n 
D 1 83  LEU 83  189 189 LEU LEU D . n 
D 1 84  GLN 84  190 190 GLN GLN D . n 
D 1 85  ILE 85  191 191 ILE ILE D . n 
D 1 86  SER 86  192 192 SER SER D . n 
D 1 87  GLU 87  193 193 GLU GLU D . n 
D 1 88  ARG 88  194 194 ARG ARG D . n 
D 1 89  ASP 89  195 195 ASP ASP D . n 
D 1 90  VAL 90  196 196 VAL VAL D . n 
D 1 91  LEU 91  197 197 LEU LEU D . n 
D 1 92  CYS 92  198 198 CYS CYS D . n 
D 1 93  VAL 93  199 199 VAL VAL D . n 
D 1 94  GLN 94  200 200 GLN GLN D . n 
D 1 95  ILE 95  201 201 ILE ILE D . n 
D 1 96  ALA 96  202 202 ALA ALA D . n 
D 1 97  GLY 97  203 203 GLY GLY D . n 
D 1 98  LEU 98  204 204 LEU LEU D . n 
D 1 99  CYS 99  205 205 CYS CYS D . n 
D 1 100 HIS 100 206 206 HIS HIS D . n 
D 1 101 ASP 101 207 207 ASP ASP D . n 
D 1 102 LEU 102 208 208 LEU LEU D . n 
D 1 103 GLY 103 209 209 GLY GLY D . n 
D 1 104 HIS 104 210 210 HIS HIS D . n 
D 1 105 GLY 105 211 211 GLY GLY D . n 
D 1 106 PRO 106 212 212 PRO PRO D . n 
D 1 107 PHE 107 213 213 PHE PHE D . n 
D 1 108 SER 108 214 214 SER SER D . n 
D 1 109 HIS 109 215 215 HIS HIS D . n 
D 1 110 MET 110 216 216 MET MET D . n 
D 1 111 PHE 111 217 217 PHE PHE D . n 
D 1 112 ASP 112 218 218 ASP ASP D . n 
D 1 113 GLY 113 219 219 GLY GLY D . n 
D 1 114 ARG 114 220 220 ARG ARG D . n 
D 1 115 PHE 115 221 221 PHE PHE D . n 
D 1 116 ILE 116 222 222 ILE ILE D . n 
D 1 117 PRO 117 223 223 PRO PRO D . n 
D 1 118 LEU 118 224 224 LEU LEU D . n 
D 1 119 ALA 119 225 225 ALA ALA D . n 
D 1 120 ARG 120 226 226 ARG ARG D . n 
D 1 121 PRO 121 227 227 PRO PRO D . n 
D 1 122 GLU 122 228 228 GLU GLU D . n 
D 1 123 VAL 123 229 229 VAL VAL D . n 
D 1 124 LYS 124 230 230 LYS LYS D . n 
D 1 125 TRP 125 231 231 TRP TRP D . n 
D 1 126 THR 126 232 232 THR THR D . n 
D 1 127 HIS 127 233 233 HIS HIS D . n 
D 1 128 GLU 128 234 234 GLU GLU D . n 
D 1 129 GLN 129 235 235 GLN GLN D . n 
D 1 130 GLY 130 236 236 GLY GLY D . n 
D 1 131 SER 131 237 237 SER SER D . n 
D 1 132 VAL 132 238 238 VAL VAL D . n 
D 1 133 MET 133 239 239 MET MET D . n 
D 1 134 MET 134 240 240 MET MET D . n 
D 1 135 PHE 135 241 241 PHE PHE D . n 
D 1 136 GLU 136 242 242 GLU GLU D . n 
D 1 137 HIS 137 243 243 HIS HIS D . n 
D 1 138 LEU 138 244 244 LEU LEU D . n 
D 1 139 ILE 139 245 245 ILE ILE D . n 
D 1 140 ASN 140 246 246 ASN ASN D . n 
D 1 141 SER 141 247 247 SER SER D . n 
D 1 142 ASN 142 248 248 ASN ASN D . n 
D 1 143 GLY 143 249 249 GLY GLY D . n 
D 1 144 ILE 144 250 250 ILE ILE D . n 
D 1 145 LYS 145 251 251 LYS LYS D . n 
D 1 146 PRO 146 252 252 PRO PRO D . n 
D 1 147 VAL 147 253 253 VAL VAL D . n 
D 1 148 MET 148 254 254 MET MET D . n 
D 1 149 GLU 149 255 255 GLU GLU D . n 
D 1 150 GLN 150 256 256 GLN GLN D . n 
D 1 151 TYR 151 257 257 TYR TYR D . n 
D 1 152 GLY 152 258 258 GLY GLY D . n 
D 1 153 LEU 153 259 259 LEU LEU D . n 
D 1 154 ILE 154 260 260 ILE ILE D . n 
D 1 155 PRO 155 261 261 PRO PRO D . n 
D 1 156 GLU 156 262 262 GLU GLU D . n 
D 1 157 GLU 157 263 263 GLU GLU D . n 
D 1 158 ASP 158 264 264 ASP ASP D . n 
D 1 159 ILE 159 265 265 ILE ILE D . n 
D 1 160 CYS 160 266 266 CYS CYS D . n 
D 1 161 PHE 161 267 267 PHE PHE D . n 
D 1 162 ILE 162 268 268 ILE ILE D . n 
D 1 163 LYS 163 269 269 LYS LYS D . n 
D 1 164 GLU 164 270 270 GLU GLU D . n 
D 1 165 GLN 165 271 271 GLN GLN D . n 
D 1 166 ILE 166 272 272 ILE ILE D . n 
D 1 167 VAL 167 273 273 VAL VAL D . n 
D 1 168 GLY 168 274 274 GLY GLY D . n 
D 1 169 PRO 169 275 275 PRO PRO D . n 
D 1 170 LEU 170 276 276 LEU LEU D . n 
D 1 171 GLU 171 277 277 GLU GLU D . n 
D 1 172 SER 172 278 ?   ?   ?   D . n 
D 1 173 PRO 173 279 ?   ?   ?   D . n 
D 1 174 VAL 174 280 ?   ?   ?   D . n 
D 1 175 GLU 175 281 ?   ?   ?   D . n 
D 1 176 ASP 176 282 ?   ?   ?   D . n 
D 1 177 SER 177 283 283 SER SER D . n 
D 1 178 LEU 178 284 284 LEU LEU D . n 
D 1 179 TRP 179 285 285 TRP TRP D . n 
D 1 180 PRO 180 286 286 PRO PRO D . n 
D 1 181 TYR 181 287 287 TYR TYR D . n 
D 1 182 LYS 182 288 288 LYS LYS D . n 
D 1 183 GLY 183 289 289 GLY GLY D . n 
D 1 184 ARG 184 290 290 ARG ARG D . n 
D 1 185 PRO 185 291 291 PRO PRO D . n 
D 1 186 GLU 186 292 292 GLU GLU D . n 
D 1 187 ASN 187 293 293 ASN ASN D . n 
D 1 188 LYS 188 294 294 LYS LYS D . n 
D 1 189 SER 189 295 295 SER SER D . n 
D 1 190 PHE 190 296 296 PHE PHE D . n 
D 1 191 LEU 191 297 297 LEU LEU D . n 
D 1 192 TYR 192 298 298 TYR TYR D . n 
D 1 193 GLU 193 299 299 GLU GLU D . n 
D 1 194 ILE 194 300 300 ILE ILE D . n 
D 1 195 VAL 195 301 301 VAL VAL D . n 
D 1 196 SER 196 302 302 SER SER D . n 
D 1 197 ASN 197 303 303 ASN ASN D . n 
D 1 198 LYS 198 304 304 LYS LYS D . n 
D 1 199 ARG 199 305 305 ARG ARG D . n 
D 1 200 ASN 200 306 306 ASN ASN D . n 
D 1 201 GLY 201 307 307 GLY GLY D . n 
D 1 202 ILE 202 308 308 ILE ILE D . n 
D 1 203 ASP 203 309 309 ASP ASP D . n 
D 1 204 VAL 204 310 310 VAL VAL D . n 
D 1 205 ASP 205 311 311 ASP ASP D . n 
D 1 206 LYS 206 312 312 LYS LYS D . n 
D 1 207 TRP 207 313 313 TRP TRP D . n 
D 1 208 ASP 208 314 314 ASP ASP D . n 
D 1 209 TYR 209 315 315 TYR TYR D . n 
D 1 210 PHE 210 316 316 PHE PHE D . n 
D 1 211 ALA 211 317 317 ALA ALA D . n 
D 1 212 ARG 212 318 318 ARG ARG D . n 
D 1 213 ASP 213 319 319 ASP ASP D . n 
D 1 214 CYS 214 320 320 CYS CYS D . n 
D 1 215 HIS 215 321 321 HIS HIS D . n 
D 1 216 HIS 216 322 322 HIS HIS D . n 
D 1 217 LEU 217 323 323 LEU LEU D . n 
D 1 218 GLY 218 324 324 GLY GLY D . n 
D 1 219 ILE 219 325 325 ILE ILE D . n 
D 1 220 GLN 220 326 326 GLN GLN D . n 
D 1 221 ASN 221 327 327 ASN ASN D . n 
D 1 222 ASN 222 328 328 ASN ASN D . n 
D 1 223 PHE 223 329 329 PHE PHE D . n 
D 1 224 ASP 224 330 330 ASP ASP D . n 
D 1 225 TYR 225 331 331 TYR TYR D . n 
D 1 226 LYS 226 332 332 LYS LYS D . n 
D 1 227 ARG 227 333 333 ARG ARG D . n 
D 1 228 PHE 228 334 334 PHE PHE D . n 
D 1 229 ILE 229 335 335 ILE ILE D . n 
D 1 230 LYS 230 336 336 LYS LYS D . n 
D 1 231 PHE 231 337 337 PHE PHE D . n 
D 1 232 ALA 232 338 338 ALA ALA D . n 
D 1 233 ARG 233 339 339 ARG ARG D . n 
D 1 234 VAL 234 340 340 VAL VAL D . n 
D 1 235 CYS 235 341 341 CYS CYS D . n 
D 1 236 GLU 236 342 342 GLU GLU D . n 
D 1 237 VAL 237 343 343 VAL VAL D . n 
D 1 238 ASP 238 344 344 ASP ASP D . n 
D 1 239 ASN 239 345 345 ASN ASN D . n 
D 1 240 GLU 240 346 346 GLU GLU D . n 
D 1 241 LEU 241 347 347 LEU LEU D . n 
D 1 242 ARG 242 348 348 ARG ARG D . n 
D 1 243 ILE 243 349 349 ILE ILE D . n 
D 1 244 CYS 244 350 350 CYS CYS D . n 
D 1 245 ALA 245 351 351 ALA ALA D . n 
D 1 246 ARG 246 352 352 ARG ARG D . n 
D 1 247 ASP 247 353 353 ASP ASP D . n 
D 1 248 LYS 248 354 354 LYS LYS D . n 
D 1 249 GLU 249 355 355 GLU GLU D . n 
D 1 250 VAL 250 356 356 VAL VAL D . n 
D 1 251 GLY 251 357 357 GLY GLY D . n 
D 1 252 ASN 252 358 358 ASN ASN D . n 
D 1 253 LEU 253 359 359 LEU LEU D . n 
D 1 254 TYR 254 360 360 TYR TYR D . n 
D 1 255 ASP 255 361 361 ASP ASP D . n 
D 1 256 MET 256 362 362 MET MET D . n 
D 1 257 PHE 257 363 363 PHE PHE D . n 
D 1 258 HIS 258 364 364 HIS HIS D . n 
D 1 259 THR 259 365 365 THR THR D . n 
D 1 260 ARG 260 366 366 ARG ARG D . n 
D 1 261 ASN 261 367 367 ASN ASN D . n 
D 1 262 SER 262 368 368 SER SER D . n 
D 1 263 LEU 263 369 369 LEU LEU D . n 
D 1 264 HIS 264 370 370 HIS HIS D . n 
D 1 265 ARG 265 371 371 ARG ARG D . n 
D 1 266 ARG 266 372 372 ARG ARG D . n 
D 1 267 ALA 267 373 373 ALA ALA D . n 
D 1 268 TYR 268 374 374 TYR TYR D . n 
D 1 269 GLN 269 375 375 GLN GLN D . n 
D 1 270 HIS 270 376 376 HIS HIS D . n 
D 1 271 LYS 271 377 377 LYS LYS D . n 
D 1 272 VAL 272 378 378 VAL VAL D . n 
D 1 273 GLY 273 379 379 GLY GLY D . n 
D 1 274 ASN 274 380 380 ASN ASN D . n 
D 1 275 ILE 275 381 381 ILE ILE D . n 
D 1 276 ILE 276 382 382 ILE ILE D . n 
D 1 277 ASP 277 383 383 ASP ASP D . n 
D 1 278 THR 278 384 384 THR THR D . n 
D 1 279 MET 279 385 385 MET MET D . n 
D 1 280 ILE 280 386 386 ILE ILE D . n 
D 1 281 THR 281 387 387 THR THR D . n 
D 1 282 ASP 282 388 388 ASP ASP D . n 
D 1 283 ALA 283 389 389 ALA ALA D . n 
D 1 284 PHE 284 390 390 PHE PHE D . n 
D 1 285 LEU 285 391 391 LEU LEU D . n 
D 1 286 LYS 286 392 392 LYS LYS D . n 
D 1 287 ALA 287 393 393 ALA ALA D . n 
D 1 288 ASP 288 394 394 ASP ASP D . n 
D 1 289 ASP 289 395 395 ASP ASP D . n 
D 1 290 TYR 290 396 396 TYR TYR D . n 
D 1 291 ILE 291 397 397 ILE ILE D . n 
D 1 292 GLU 292 398 398 GLU GLU D . n 
D 1 293 ILE 293 399 399 ILE ILE D . n 
D 1 294 THR 294 400 400 THR THR D . n 
D 1 295 GLY 295 401 401 GLY GLY D . n 
D 1 296 ALA 296 402 402 ALA ALA D . n 
D 1 297 GLY 297 403 403 GLY GLY D . n 
D 1 298 GLY 298 404 404 GLY GLY D . n 
D 1 299 LYS 299 405 405 LYS LYS D . n 
D 1 300 LYS 300 406 406 LYS LYS D . n 
D 1 301 TYR 301 407 407 TYR TYR D . n 
D 1 302 ARG 302 408 408 ARG ARG D . n 
D 1 303 ILE 303 409 409 ILE ILE D . n 
D 1 304 SER 304 410 410 SER SER D . n 
D 1 305 THR 305 411 411 THR THR D . n 
D 1 306 ALA 306 412 412 ALA ALA D . n 
D 1 307 ILE 307 413 413 ILE ILE D . n 
D 1 308 ASP 308 414 414 ASP ASP D . n 
D 1 309 ASP 309 415 415 ASP ASP D . n 
D 1 310 MET 310 416 416 MET MET D . n 
D 1 311 GLU 311 417 417 GLU GLU D . n 
D 1 312 ALA 312 418 418 ALA ALA D . n 
D 1 313 TYR 313 419 419 TYR TYR D . n 
D 1 314 THR 314 420 420 THR THR D . n 
D 1 315 LYS 315 421 421 LYS LYS D . n 
D 1 316 LEU 316 422 422 LEU LEU D . n 
D 1 317 THR 317 423 423 THR THR D . n 
D 1 318 ASP 318 424 424 ASP ASP D . n 
D 1 319 ASN 319 425 425 ASN ASN D . n 
D 1 320 ILE 320 426 426 ILE ILE D . n 
D 1 321 PHE 321 427 427 PHE PHE D . n 
D 1 322 LEU 322 428 428 LEU LEU D . n 
D 1 323 GLU 323 429 429 GLU GLU D . n 
D 1 324 ILE 324 430 430 ILE ILE D . n 
D 1 325 LEU 325 431 431 LEU LEU D . n 
D 1 326 TYR 326 432 432 TYR TYR D . n 
D 1 327 SER 327 433 433 SER SER D . n 
D 1 328 THR 328 434 434 THR THR D . n 
D 1 329 ASP 329 435 435 ASP ASP D . n 
D 1 330 PRO 330 436 436 PRO PRO D . n 
D 1 331 LYS 331 437 437 LYS LYS D . n 
D 1 332 LEU 332 438 438 LEU LEU D . n 
D 1 333 LYS 333 439 439 LYS LYS D . n 
D 1 334 ASP 334 440 440 ASP ASP D . n 
D 1 335 ALA 335 441 441 ALA ALA D . n 
D 1 336 ARG 336 442 442 ARG ARG D . n 
D 1 337 GLU 337 443 443 GLU GLU D . n 
D 1 338 ILE 338 444 444 ILE ILE D . n 
D 1 339 LEU 339 445 445 LEU LEU D . n 
D 1 340 LYS 340 446 446 LYS LYS D . n 
D 1 341 GLN 341 447 447 GLN GLN D . n 
D 1 342 ILE 342 448 448 ILE ILE D . n 
D 1 343 GLU 343 449 449 GLU GLU D . n 
D 1 344 TYR 344 450 450 TYR TYR D . n 
D 1 345 ARG 345 451 451 ARG ARG D . n 
D 1 346 ASN 346 452 452 ASN ASN D . n 
D 1 347 LEU 347 453 453 LEU LEU D . n 
D 1 348 PHE 348 454 454 PHE PHE D . n 
D 1 349 LYS 349 455 455 LYS LYS D . n 
D 1 350 TYR 350 456 456 TYR TYR D . n 
D 1 351 VAL 351 457 457 VAL VAL D . n 
D 1 352 GLY 352 458 458 GLY GLY D . n 
D 1 353 GLU 353 459 459 GLU GLU D . n 
D 1 354 THR 354 460 460 THR THR D . n 
D 1 355 GLN 355 461 461 GLN GLN D . n 
D 1 356 PRO 356 462 462 PRO PRO D . n 
D 1 357 THR 357 463 463 THR THR D . n 
D 1 358 GLY 358 464 464 GLY GLY D . n 
D 1 359 GLN 359 465 465 GLN GLN D . n 
D 1 360 ILE 360 466 466 ILE ILE D . n 
D 1 361 LYS 361 467 467 LYS LYS D . n 
D 1 362 ILE 362 468 468 ILE ILE D . n 
D 1 363 LYS 363 469 469 LYS LYS D . n 
D 1 364 ARG 364 470 470 ARG ARG D . n 
D 1 365 GLU 365 471 471 GLU GLU D . n 
D 1 366 ASP 366 472 472 ASP ASP D . n 
D 1 367 TYR 367 473 473 TYR TYR D . n 
D 1 368 GLU 368 474 474 GLU GLU D . n 
D 1 369 SER 369 475 475 SER SER D . n 
D 1 370 LEU 370 476 476 LEU LEU D . n 
D 1 371 PRO 371 477 477 PRO PRO D . n 
D 1 372 LYS 372 478 478 LYS LYS D . n 
D 1 373 GLU 373 479 479 GLU GLU D . n 
D 1 374 VAL 374 480 480 VAL VAL D . n 
D 1 375 ALA 375 481 481 ALA ALA D . n 
D 1 376 SER 376 482 482 SER SER D . n 
D 1 377 ALA 377 483 483 ALA ALA D . n 
D 1 378 LYS 378 484 484 LYS LYS D . n 
D 1 379 PRO 379 485 485 PRO PRO D . n 
D 1 380 LYS 380 486 486 LYS LYS D . n 
D 1 381 VAL 381 487 487 VAL VAL D . n 
D 1 382 LEU 382 488 488 LEU LEU D . n 
D 1 383 LEU 383 489 489 LEU LEU D . n 
D 1 384 ASP 384 490 490 ASP ASP D . n 
D 1 385 VAL 385 491 491 VAL VAL D . n 
D 1 386 LYS 386 492 492 LYS LYS D . n 
D 1 387 LEU 387 493 493 LEU LEU D . n 
D 1 388 LYS 388 494 494 LYS LYS D . n 
D 1 389 ALA 389 495 495 ALA ALA D . n 
D 1 390 GLU 390 496 496 GLU GLU D . n 
D 1 391 ASP 391 497 497 ASP ASP D . n 
D 1 392 PHE 392 498 498 PHE PHE D . n 
D 1 393 ILE 393 499 499 ILE ILE D . n 
D 1 394 VAL 394 500 500 VAL VAL D . n 
D 1 395 ASP 395 501 501 ASP ASP D . n 
D 1 396 VAL 396 502 502 VAL VAL D . n 
D 1 397 ILE 397 503 503 ILE ILE D . n 
D 1 398 ASN 398 504 504 ASN ASN D . n 
D 1 399 MET 399 505 505 MET MET D . n 
D 1 400 ASP 400 506 506 ASP ASP D . n 
D 1 401 TYR 401 507 507 TYR TYR D . n 
D 1 402 GLY 402 508 508 GLY GLY D . n 
D 1 403 MET 403 509 509 MET MET D . n 
D 1 404 GLN 404 510 510 GLN GLN D . n 
D 1 405 GLU 405 511 511 GLU GLU D . n 
D 1 406 LYS 406 512 512 LYS LYS D . n 
D 1 407 ASN 407 513 513 ASN ASN D . n 
D 1 408 PRO 408 514 514 PRO PRO D . n 
D 1 409 ILE 409 515 515 ILE ILE D . n 
D 1 410 ASP 410 516 516 ASP ASP D . n 
D 1 411 HIS 411 517 517 HIS HIS D . n 
D 1 412 VAL 412 518 518 VAL VAL D . n 
D 1 413 SER 413 519 519 SER SER D . n 
D 1 414 PHE 414 520 520 PHE PHE D . n 
D 1 415 TYR 415 521 521 TYR TYR D . n 
D 1 416 CYS 416 522 522 CYS CYS D . n 
D 1 417 LYS 417 523 523 LYS LYS D . n 
D 1 418 THR 418 524 524 THR THR D . n 
D 1 419 ALA 419 525 525 ALA ALA D . n 
D 1 420 PRO 420 526 526 PRO PRO D . n 
D 1 421 ASN 421 527 527 ASN ASN D . n 
D 1 422 ARG 422 528 528 ARG ARG D . n 
D 1 423 ALA 423 529 529 ALA ALA D . n 
D 1 424 ILE 424 530 530 ILE ILE D . n 
D 1 425 ARG 425 531 531 ARG ARG D . n 
D 1 426 ILE 426 532 532 ILE ILE D . n 
D 1 427 THR 427 533 533 THR THR D . n 
D 1 428 LYS 428 534 534 LYS LYS D . n 
D 1 429 ASN 429 535 535 ASN ASN D . n 
D 1 430 GLN 430 536 536 GLN GLN D . n 
D 1 431 VAL 431 537 537 VAL VAL D . n 
D 1 432 SER 432 538 538 SER SER D . n 
D 1 433 GLN 433 539 539 GLN GLN D . n 
D 1 434 LEU 434 540 540 LEU LEU D . n 
D 1 435 LEU 435 541 541 LEU LEU D . n 
D 1 436 PRO 436 542 542 PRO PRO D . n 
D 1 437 GLU 437 543 543 GLU GLU D . n 
D 1 438 LYS 438 544 544 LYS LYS D . n 
D 1 439 PHE 439 545 545 PHE PHE D . n 
D 1 440 ALA 440 546 546 ALA ALA D . n 
D 1 441 GLU 441 547 547 GLU GLU D . n 
D 1 442 GLN 442 548 548 GLN GLN D . n 
D 1 443 LEU 443 549 549 LEU LEU D . n 
D 1 444 ILE 444 550 550 ILE ILE D . n 
D 1 445 ARG 445 551 551 ARG ARG D . n 
D 1 446 VAL 446 552 552 VAL VAL D . n 
D 1 447 TYR 447 553 553 TYR TYR D . n 
D 1 448 CYS 448 554 554 CYS CYS D . n 
D 1 449 LYS 449 555 555 LYS LYS D . n 
D 1 450 LYS 450 556 556 LYS LYS D . n 
D 1 451 VAL 451 557 557 VAL VAL D . n 
D 1 452 ASP 452 558 558 ASP ASP D . n 
D 1 453 ARG 453 559 559 ARG ARG D . n 
D 1 454 LYS 454 560 560 LYS LYS D . n 
D 1 455 SER 455 561 561 SER SER D . n 
D 1 456 LEU 456 562 562 LEU LEU D . n 
D 1 457 TYR 457 563 563 TYR TYR D . n 
D 1 458 ALA 458 564 564 ALA ALA D . n 
D 1 459 ALA 459 565 565 ALA ALA D . n 
D 1 460 ARG 460 566 566 ARG ARG D . n 
D 1 461 GLN 461 567 567 GLN GLN D . n 
D 1 462 TYR 462 568 568 TYR TYR D . n 
D 1 463 PHE 463 569 569 PHE PHE D . n 
D 1 464 VAL 464 570 570 VAL VAL D . n 
D 1 465 GLN 465 571 571 GLN GLN D . n 
D 1 466 TRP 466 572 572 TRP TRP D . n 
D 1 467 CYS 467 573 573 CYS CYS D . n 
D 1 468 ALA 468 574 574 ALA ALA D . n 
D 1 469 ASP 469 575 575 ASP ASP D . n 
D 1 470 ARG 470 576 576 ARG ARG D . n 
D 1 471 ASN 471 577 577 ASN ASN D . n 
D 1 472 PHE 472 578 578 PHE PHE D . n 
D 1 473 THR 473 579 579 THR THR D . n 
D 1 474 LYS 474 580 580 LYS LYS D . n 
D 1 475 PRO 475 581 581 PRO PRO D . n 
D 1 476 GLN 476 582 582 GLN GLN D . n 
D 1 477 ASP 477 583 583 ASP ASP D . n 
D 1 478 GLY 478 584 584 GLY GLY D . n 
D 1 479 ASP 479 585 585 ASP ASP D . n 
D 1 480 VAL 480 586 586 VAL VAL D . n 
D 1 481 ILE 481 587 587 ILE ILE D . n 
D 1 482 ALA 482 588 588 ALA ALA D . n 
D 1 483 PRO 483 589 589 PRO PRO D . n 
D 1 484 LEU 484 590 590 LEU LEU D . n 
D 1 485 ILE 485 591 591 ILE ILE D . n 
D 1 486 THR 486 592 592 THR THR D . n 
D 1 487 PRO 487 593 593 PRO PRO D . n 
D 1 488 GLN 488 594 594 GLN GLN D . n 
D 1 489 LYS 489 595 595 LYS LYS D . n 
D 1 490 LYS 490 596 596 LYS LYS D . n 
D 1 491 GLU 491 597 597 GLU GLU D . n 
D 1 492 TRP 492 598 598 TRP TRP D . n 
D 1 493 ASN 493 599 599 ASN ASN D . n 
D 1 494 ASP 494 600 ?   ?   ?   D . n 
D 1 495 SER 495 601 ?   ?   ?   D . n 
D 1 496 THR 496 602 ?   ?   ?   D . n 
D 1 497 SER 497 603 ?   ?   ?   D . n 
D 1 498 VAL 498 604 ?   ?   ?   D . n 
D 1 499 GLN 499 605 ?   ?   ?   D . n 
D 1 500 ASN 500 606 ?   ?   ?   D . n 
D 1 501 PRO 501 607 ?   ?   ?   D . n 
D 1 502 THR 502 608 ?   ?   ?   D . n 
D 1 503 ARG 503 609 ?   ?   ?   D . n 
D 1 504 LEU 504 610 ?   ?   ?   D . n 
D 1 505 ARG 505 611 ?   ?   ?   D . n 
D 1 506 GLU 506 612 ?   ?   ?   D . n 
D 1 507 ALA 507 613 ?   ?   ?   D . n 
D 1 508 SER 508 614 ?   ?   ?   D . n 
D 1 509 LYS 509 615 ?   ?   ?   D . n 
D 1 510 SER 510 616 ?   ?   ?   D . n 
D 1 511 ARG 511 617 ?   ?   ?   D . n 
D 1 512 VAL 512 618 ?   ?   ?   D . n 
D 1 513 GLN 513 619 ?   ?   ?   D . n 
D 1 514 LEU 514 620 ?   ?   ?   D . n 
D 1 515 PHE 515 621 ?   ?   ?   D . n 
D 1 516 LYS 516 622 ?   ?   ?   D . n 
D 1 517 ASP 517 623 ?   ?   ?   D . n 
D 1 518 ASP 518 624 ?   ?   ?   D . n 
D 1 519 PRO 519 625 ?   ?   ?   D . n 
D 1 520 MET 520 626 ?   ?   ?   D . n 
E 1 1   GLY 1   107 ?   ?   ?   E . n 
E 1 2   SER 2   108 ?   ?   ?   E . n 
E 1 3   GLN 3   109 ?   ?   ?   E . n 
E 1 4   ILE 4   110 ?   ?   ?   E . n 
E 1 5   HIS 5   111 ?   ?   ?   E . n 
E 1 6   VAL 6   112 ?   ?   ?   E . n 
E 1 7   ASP 7   113 ?   ?   ?   E . n 
E 1 8   THR 8   114 114 THR THR E . n 
E 1 9   MET 9   115 115 MET MET E . n 
E 1 10  LYS 10  116 116 LYS LYS E . n 
E 1 11  VAL 11  117 117 VAL VAL E . n 
E 1 12  ILE 12  118 118 ILE ILE E . n 
E 1 13  ASN 13  119 119 ASN ASN E . n 
E 1 14  ASP 14  120 120 ASP ASP E . n 
E 1 15  PRO 15  121 121 PRO PRO E . n 
E 1 16  ILE 16  122 122 ILE ILE E . n 
E 1 17  HIS 17  123 123 HIS HIS E . n 
E 1 18  GLY 18  124 124 GLY GLY E . n 
E 1 19  HIS 19  125 125 HIS HIS E . n 
E 1 20  ILE 20  126 126 ILE ILE E . n 
E 1 21  GLU 21  127 127 GLU GLU E . n 
E 1 22  LEU 22  128 128 LEU LEU E . n 
E 1 23  HIS 23  129 129 HIS HIS E . n 
E 1 24  PRO 24  130 130 PRO PRO E . n 
E 1 25  LEU 25  131 131 LEU LEU E . n 
E 1 26  LEU 26  132 132 LEU LEU E . n 
E 1 27  VAL 27  133 133 VAL VAL E . n 
E 1 28  ARG 28  134 134 ARG ARG E . n 
E 1 29  ILE 29  135 135 ILE ILE E . n 
E 1 30  ILE 30  136 136 ILE ILE E . n 
E 1 31  ASP 31  137 137 ASP ASP E . n 
E 1 32  THR 32  138 138 THR THR E . n 
E 1 33  PRO 33  139 139 PRO PRO E . n 
E 1 34  GLN 34  140 140 GLN GLN E . n 
E 1 35  PHE 35  141 141 PHE PHE E . n 
E 1 36  GLN 36  142 142 GLN GLN E . n 
E 1 37  ARG 37  143 143 ARG ARG E . n 
E 1 38  LEU 38  144 144 LEU LEU E . n 
E 1 39  ARG 39  145 145 ARG ARG E . n 
E 1 40  TYR 40  146 146 TYR TYR E . n 
E 1 41  ILE 41  147 147 ILE ILE E . n 
E 1 42  LYS 42  148 148 LYS LYS E . n 
E 1 43  GLN 43  149 149 GLN GLN E . n 
E 1 44  LEU 44  150 150 LEU LEU E . n 
E 1 45  GLY 45  151 151 GLY GLY E . n 
E 1 46  GLY 46  152 152 GLY GLY E . n 
E 1 47  GLY 47  153 153 GLY GLY E . n 
E 1 48  TYR 48  154 154 TYR TYR E . n 
E 1 49  TYR 49  155 155 TYR TYR E . n 
E 1 50  VAL 50  156 156 VAL VAL E . n 
E 1 51  PHE 51  157 157 PHE PHE E . n 
E 1 52  PRO 52  158 158 PRO PRO E . n 
E 1 53  GLY 53  159 159 GLY GLY E . n 
E 1 54  ALA 54  160 160 ALA ALA E . n 
E 1 55  SER 55  161 161 SER SER E . n 
E 1 56  HIS 56  162 162 HIS HIS E . n 
E 1 57  ASN 57  163 163 ASN ASN E . n 
E 1 58  ARG 58  164 164 ARG ARG E . n 
E 1 59  PHE 59  165 165 PHE PHE E . n 
E 1 60  GLU 60  166 166 GLU GLU E . n 
E 1 61  HIS 61  167 167 HIS HIS E . n 
E 1 62  SER 62  168 168 SER SER E . n 
E 1 63  LEU 63  169 169 LEU LEU E . n 
E 1 64  GLY 64  170 170 GLY GLY E . n 
E 1 65  VAL 65  171 171 VAL VAL E . n 
E 1 66  GLY 66  172 172 GLY GLY E . n 
E 1 67  TYR 67  173 173 TYR TYR E . n 
E 1 68  LEU 68  174 174 LEU LEU E . n 
E 1 69  ALA 69  175 175 ALA ALA E . n 
E 1 70  GLY 70  176 176 GLY GLY E . n 
E 1 71  CYS 71  177 177 CYS CYS E . n 
E 1 72  LEU 72  178 178 LEU LEU E . n 
E 1 73  VAL 73  179 179 VAL VAL E . n 
E 1 74  HIS 74  180 180 HIS HIS E . n 
E 1 75  ALA 75  181 181 ALA ALA E . n 
E 1 76  LEU 76  182 182 LEU LEU E . n 
E 1 77  GLY 77  183 183 GLY GLY E . n 
E 1 78  GLU 78  184 184 GLU GLU E . n 
E 1 79  LYS 79  185 185 LYS LYS E . n 
E 1 80  GLN 80  186 186 GLN GLN E . n 
E 1 81  PRO 81  187 187 PRO PRO E . n 
E 1 82  GLU 82  188 188 GLU GLU E . n 
E 1 83  LEU 83  189 189 LEU LEU E . n 
E 1 84  GLN 84  190 190 GLN GLN E . n 
E 1 85  ILE 85  191 191 ILE ILE E . n 
E 1 86  SER 86  192 192 SER SER E . n 
E 1 87  GLU 87  193 193 GLU GLU E . n 
E 1 88  ARG 88  194 194 ARG ARG E . n 
E 1 89  ASP 89  195 195 ASP ASP E . n 
E 1 90  VAL 90  196 196 VAL VAL E . n 
E 1 91  LEU 91  197 197 LEU LEU E . n 
E 1 92  CYS 92  198 198 CYS CYS E . n 
E 1 93  VAL 93  199 199 VAL VAL E . n 
E 1 94  GLN 94  200 200 GLN GLN E . n 
E 1 95  ILE 95  201 201 ILE ILE E . n 
E 1 96  ALA 96  202 202 ALA ALA E . n 
E 1 97  GLY 97  203 203 GLY GLY E . n 
E 1 98  LEU 98  204 204 LEU LEU E . n 
E 1 99  CYS 99  205 205 CYS CYS E . n 
E 1 100 HIS 100 206 206 HIS HIS E . n 
E 1 101 ASP 101 207 207 ASP ASP E . n 
E 1 102 LEU 102 208 208 LEU LEU E . n 
E 1 103 GLY 103 209 209 GLY GLY E . n 
E 1 104 HIS 104 210 210 HIS HIS E . n 
E 1 105 GLY 105 211 211 GLY GLY E . n 
E 1 106 PRO 106 212 212 PRO PRO E . n 
E 1 107 PHE 107 213 213 PHE PHE E . n 
E 1 108 SER 108 214 214 SER SER E . n 
E 1 109 HIS 109 215 215 HIS HIS E . n 
E 1 110 MET 110 216 216 MET MET E . n 
E 1 111 PHE 111 217 217 PHE PHE E . n 
E 1 112 ASP 112 218 218 ASP ASP E . n 
E 1 113 GLY 113 219 219 GLY GLY E . n 
E 1 114 ARG 114 220 220 ARG ARG E . n 
E 1 115 PHE 115 221 221 PHE PHE E . n 
E 1 116 ILE 116 222 222 ILE ILE E . n 
E 1 117 PRO 117 223 223 PRO PRO E . n 
E 1 118 LEU 118 224 224 LEU LEU E . n 
E 1 119 ALA 119 225 225 ALA ALA E . n 
E 1 120 ARG 120 226 226 ARG ARG E . n 
E 1 121 PRO 121 227 227 PRO PRO E . n 
E 1 122 GLU 122 228 228 GLU GLU E . n 
E 1 123 VAL 123 229 229 VAL VAL E . n 
E 1 124 LYS 124 230 230 LYS LYS E . n 
E 1 125 TRP 125 231 231 TRP TRP E . n 
E 1 126 THR 126 232 232 THR THR E . n 
E 1 127 HIS 127 233 233 HIS HIS E . n 
E 1 128 GLU 128 234 234 GLU GLU E . n 
E 1 129 GLN 129 235 235 GLN GLN E . n 
E 1 130 GLY 130 236 236 GLY GLY E . n 
E 1 131 SER 131 237 237 SER SER E . n 
E 1 132 VAL 132 238 238 VAL VAL E . n 
E 1 133 MET 133 239 239 MET MET E . n 
E 1 134 MET 134 240 240 MET MET E . n 
E 1 135 PHE 135 241 241 PHE PHE E . n 
E 1 136 GLU 136 242 242 GLU GLU E . n 
E 1 137 HIS 137 243 243 HIS HIS E . n 
E 1 138 LEU 138 244 244 LEU LEU E . n 
E 1 139 ILE 139 245 245 ILE ILE E . n 
E 1 140 ASN 140 246 246 ASN ASN E . n 
E 1 141 SER 141 247 247 SER SER E . n 
E 1 142 ASN 142 248 248 ASN ASN E . n 
E 1 143 GLY 143 249 249 GLY GLY E . n 
E 1 144 ILE 144 250 250 ILE ILE E . n 
E 1 145 LYS 145 251 251 LYS LYS E . n 
E 1 146 PRO 146 252 252 PRO PRO E . n 
E 1 147 VAL 147 253 253 VAL VAL E . n 
E 1 148 MET 148 254 254 MET MET E . n 
E 1 149 GLU 149 255 255 GLU GLU E . n 
E 1 150 GLN 150 256 256 GLN GLN E . n 
E 1 151 TYR 151 257 257 TYR TYR E . n 
E 1 152 GLY 152 258 258 GLY GLY E . n 
E 1 153 LEU 153 259 259 LEU LEU E . n 
E 1 154 ILE 154 260 260 ILE ILE E . n 
E 1 155 PRO 155 261 261 PRO PRO E . n 
E 1 156 GLU 156 262 262 GLU GLU E . n 
E 1 157 GLU 157 263 263 GLU GLU E . n 
E 1 158 ASP 158 264 264 ASP ASP E . n 
E 1 159 ILE 159 265 265 ILE ILE E . n 
E 1 160 CYS 160 266 266 CYS CYS E . n 
E 1 161 PHE 161 267 267 PHE PHE E . n 
E 1 162 ILE 162 268 268 ILE ILE E . n 
E 1 163 LYS 163 269 269 LYS LYS E . n 
E 1 164 GLU 164 270 270 GLU GLU E . n 
E 1 165 GLN 165 271 271 GLN GLN E . n 
E 1 166 ILE 166 272 272 ILE ILE E . n 
E 1 167 VAL 167 273 273 VAL VAL E . n 
E 1 168 GLY 168 274 274 GLY GLY E . n 
E 1 169 PRO 169 275 275 PRO PRO E . n 
E 1 170 LEU 170 276 276 LEU LEU E . n 
E 1 171 GLU 171 277 ?   ?   ?   E . n 
E 1 172 SER 172 278 ?   ?   ?   E . n 
E 1 173 PRO 173 279 ?   ?   ?   E . n 
E 1 174 VAL 174 280 ?   ?   ?   E . n 
E 1 175 GLU 175 281 ?   ?   ?   E . n 
E 1 176 ASP 176 282 ?   ?   ?   E . n 
E 1 177 SER 177 283 ?   ?   ?   E . n 
E 1 178 LEU 178 284 284 LEU LEU E . n 
E 1 179 TRP 179 285 285 TRP TRP E . n 
E 1 180 PRO 180 286 286 PRO PRO E . n 
E 1 181 TYR 181 287 287 TYR TYR E . n 
E 1 182 LYS 182 288 288 LYS LYS E . n 
E 1 183 GLY 183 289 289 GLY GLY E . n 
E 1 184 ARG 184 290 290 ARG ARG E . n 
E 1 185 PRO 185 291 291 PRO PRO E . n 
E 1 186 GLU 186 292 292 GLU GLU E . n 
E 1 187 ASN 187 293 293 ASN ASN E . n 
E 1 188 LYS 188 294 294 LYS LYS E . n 
E 1 189 SER 189 295 295 SER SER E . n 
E 1 190 PHE 190 296 296 PHE PHE E . n 
E 1 191 LEU 191 297 297 LEU LEU E . n 
E 1 192 TYR 192 298 298 TYR TYR E . n 
E 1 193 GLU 193 299 299 GLU GLU E . n 
E 1 194 ILE 194 300 300 ILE ILE E . n 
E 1 195 VAL 195 301 301 VAL VAL E . n 
E 1 196 SER 196 302 302 SER SER E . n 
E 1 197 ASN 197 303 303 ASN ASN E . n 
E 1 198 LYS 198 304 304 LYS LYS E . n 
E 1 199 ARG 199 305 305 ARG ARG E . n 
E 1 200 ASN 200 306 306 ASN ASN E . n 
E 1 201 GLY 201 307 307 GLY GLY E . n 
E 1 202 ILE 202 308 308 ILE ILE E . n 
E 1 203 ASP 203 309 309 ASP ASP E . n 
E 1 204 VAL 204 310 310 VAL VAL E . n 
E 1 205 ASP 205 311 311 ASP ASP E . n 
E 1 206 LYS 206 312 312 LYS LYS E . n 
E 1 207 TRP 207 313 313 TRP TRP E . n 
E 1 208 ASP 208 314 314 ASP ASP E . n 
E 1 209 TYR 209 315 315 TYR TYR E . n 
E 1 210 PHE 210 316 316 PHE PHE E . n 
E 1 211 ALA 211 317 317 ALA ALA E . n 
E 1 212 ARG 212 318 318 ARG ARG E . n 
E 1 213 ASP 213 319 319 ASP ASP E . n 
E 1 214 CYS 214 320 320 CYS CYS E . n 
E 1 215 HIS 215 321 321 HIS HIS E . n 
E 1 216 HIS 216 322 322 HIS HIS E . n 
E 1 217 LEU 217 323 323 LEU LEU E . n 
E 1 218 GLY 218 324 324 GLY GLY E . n 
E 1 219 ILE 219 325 325 ILE ILE E . n 
E 1 220 GLN 220 326 326 GLN GLN E . n 
E 1 221 ASN 221 327 327 ASN ASN E . n 
E 1 222 ASN 222 328 328 ASN ASN E . n 
E 1 223 PHE 223 329 329 PHE PHE E . n 
E 1 224 ASP 224 330 330 ASP ASP E . n 
E 1 225 TYR 225 331 331 TYR TYR E . n 
E 1 226 LYS 226 332 332 LYS LYS E . n 
E 1 227 ARG 227 333 333 ARG ARG E . n 
E 1 228 PHE 228 334 334 PHE PHE E . n 
E 1 229 ILE 229 335 335 ILE ILE E . n 
E 1 230 LYS 230 336 336 LYS LYS E . n 
E 1 231 PHE 231 337 337 PHE PHE E . n 
E 1 232 ALA 232 338 338 ALA ALA E . n 
E 1 233 ARG 233 339 339 ARG ARG E . n 
E 1 234 VAL 234 340 340 VAL VAL E . n 
E 1 235 CYS 235 341 341 CYS CYS E . n 
E 1 236 GLU 236 342 342 GLU GLU E . n 
E 1 237 VAL 237 343 343 VAL VAL E . n 
E 1 238 ASP 238 344 344 ASP ASP E . n 
E 1 239 ASN 239 345 345 ASN ASN E . n 
E 1 240 GLU 240 346 346 GLU GLU E . n 
E 1 241 LEU 241 347 347 LEU LEU E . n 
E 1 242 ARG 242 348 348 ARG ARG E . n 
E 1 243 ILE 243 349 349 ILE ILE E . n 
E 1 244 CYS 244 350 350 CYS CYS E . n 
E 1 245 ALA 245 351 351 ALA ALA E . n 
E 1 246 ARG 246 352 352 ARG ARG E . n 
E 1 247 ASP 247 353 353 ASP ASP E . n 
E 1 248 LYS 248 354 354 LYS LYS E . n 
E 1 249 GLU 249 355 355 GLU GLU E . n 
E 1 250 VAL 250 356 356 VAL VAL E . n 
E 1 251 GLY 251 357 357 GLY GLY E . n 
E 1 252 ASN 252 358 358 ASN ASN E . n 
E 1 253 LEU 253 359 359 LEU LEU E . n 
E 1 254 TYR 254 360 360 TYR TYR E . n 
E 1 255 ASP 255 361 361 ASP ASP E . n 
E 1 256 MET 256 362 362 MET MET E . n 
E 1 257 PHE 257 363 363 PHE PHE E . n 
E 1 258 HIS 258 364 364 HIS HIS E . n 
E 1 259 THR 259 365 365 THR THR E . n 
E 1 260 ARG 260 366 366 ARG ARG E . n 
E 1 261 ASN 261 367 367 ASN ASN E . n 
E 1 262 SER 262 368 368 SER SER E . n 
E 1 263 LEU 263 369 369 LEU LEU E . n 
E 1 264 HIS 264 370 370 HIS HIS E . n 
E 1 265 ARG 265 371 371 ARG ARG E . n 
E 1 266 ARG 266 372 372 ARG ARG E . n 
E 1 267 ALA 267 373 373 ALA ALA E . n 
E 1 268 TYR 268 374 374 TYR TYR E . n 
E 1 269 GLN 269 375 375 GLN GLN E . n 
E 1 270 HIS 270 376 376 HIS HIS E . n 
E 1 271 LYS 271 377 377 LYS LYS E . n 
E 1 272 VAL 272 378 378 VAL VAL E . n 
E 1 273 GLY 273 379 379 GLY GLY E . n 
E 1 274 ASN 274 380 380 ASN ASN E . n 
E 1 275 ILE 275 381 381 ILE ILE E . n 
E 1 276 ILE 276 382 382 ILE ILE E . n 
E 1 277 ASP 277 383 383 ASP ASP E . n 
E 1 278 THR 278 384 384 THR THR E . n 
E 1 279 MET 279 385 385 MET MET E . n 
E 1 280 ILE 280 386 386 ILE ILE E . n 
E 1 281 THR 281 387 387 THR THR E . n 
E 1 282 ASP 282 388 388 ASP ASP E . n 
E 1 283 ALA 283 389 389 ALA ALA E . n 
E 1 284 PHE 284 390 390 PHE PHE E . n 
E 1 285 LEU 285 391 391 LEU LEU E . n 
E 1 286 LYS 286 392 392 LYS LYS E . n 
E 1 287 ALA 287 393 393 ALA ALA E . n 
E 1 288 ASP 288 394 394 ASP ASP E . n 
E 1 289 ASP 289 395 395 ASP ASP E . n 
E 1 290 TYR 290 396 396 TYR TYR E . n 
E 1 291 ILE 291 397 397 ILE ILE E . n 
E 1 292 GLU 292 398 398 GLU GLU E . n 
E 1 293 ILE 293 399 399 ILE ILE E . n 
E 1 294 THR 294 400 400 THR THR E . n 
E 1 295 GLY 295 401 401 GLY GLY E . n 
E 1 296 ALA 296 402 402 ALA ALA E . n 
E 1 297 GLY 297 403 403 GLY GLY E . n 
E 1 298 GLY 298 404 404 GLY GLY E . n 
E 1 299 LYS 299 405 405 LYS LYS E . n 
E 1 300 LYS 300 406 406 LYS LYS E . n 
E 1 301 TYR 301 407 407 TYR TYR E . n 
E 1 302 ARG 302 408 408 ARG ARG E . n 
E 1 303 ILE 303 409 409 ILE ILE E . n 
E 1 304 SER 304 410 410 SER SER E . n 
E 1 305 THR 305 411 411 THR THR E . n 
E 1 306 ALA 306 412 412 ALA ALA E . n 
E 1 307 ILE 307 413 413 ILE ILE E . n 
E 1 308 ASP 308 414 414 ASP ASP E . n 
E 1 309 ASP 309 415 415 ASP ASP E . n 
E 1 310 MET 310 416 416 MET MET E . n 
E 1 311 GLU 311 417 417 GLU GLU E . n 
E 1 312 ALA 312 418 418 ALA ALA E . n 
E 1 313 TYR 313 419 419 TYR TYR E . n 
E 1 314 THR 314 420 420 THR THR E . n 
E 1 315 LYS 315 421 421 LYS LYS E . n 
E 1 316 LEU 316 422 422 LEU LEU E . n 
E 1 317 THR 317 423 423 THR THR E . n 
E 1 318 ASP 318 424 424 ASP ASP E . n 
E 1 319 ASN 319 425 425 ASN ASN E . n 
E 1 320 ILE 320 426 426 ILE ILE E . n 
E 1 321 PHE 321 427 427 PHE PHE E . n 
E 1 322 LEU 322 428 428 LEU LEU E . n 
E 1 323 GLU 323 429 429 GLU GLU E . n 
E 1 324 ILE 324 430 430 ILE ILE E . n 
E 1 325 LEU 325 431 431 LEU LEU E . n 
E 1 326 TYR 326 432 432 TYR TYR E . n 
E 1 327 SER 327 433 433 SER SER E . n 
E 1 328 THR 328 434 434 THR THR E . n 
E 1 329 ASP 329 435 435 ASP ASP E . n 
E 1 330 PRO 330 436 436 PRO PRO E . n 
E 1 331 LYS 331 437 437 LYS LYS E . n 
E 1 332 LEU 332 438 438 LEU LEU E . n 
E 1 333 LYS 333 439 439 LYS LYS E . n 
E 1 334 ASP 334 440 440 ASP ASP E . n 
E 1 335 ALA 335 441 441 ALA ALA E . n 
E 1 336 ARG 336 442 442 ARG ARG E . n 
E 1 337 GLU 337 443 443 GLU GLU E . n 
E 1 338 ILE 338 444 444 ILE ILE E . n 
E 1 339 LEU 339 445 445 LEU LEU E . n 
E 1 340 LYS 340 446 446 LYS LYS E . n 
E 1 341 GLN 341 447 447 GLN GLN E . n 
E 1 342 ILE 342 448 448 ILE ILE E . n 
E 1 343 GLU 343 449 449 GLU GLU E . n 
E 1 344 TYR 344 450 450 TYR TYR E . n 
E 1 345 ARG 345 451 451 ARG ARG E . n 
E 1 346 ASN 346 452 452 ASN ASN E . n 
E 1 347 LEU 347 453 453 LEU LEU E . n 
E 1 348 PHE 348 454 454 PHE PHE E . n 
E 1 349 LYS 349 455 455 LYS LYS E . n 
E 1 350 TYR 350 456 456 TYR TYR E . n 
E 1 351 VAL 351 457 457 VAL VAL E . n 
E 1 352 GLY 352 458 458 GLY GLY E . n 
E 1 353 GLU 353 459 459 GLU GLU E . n 
E 1 354 THR 354 460 460 THR THR E . n 
E 1 355 GLN 355 461 461 GLN GLN E . n 
E 1 356 PRO 356 462 462 PRO PRO E . n 
E 1 357 THR 357 463 463 THR THR E . n 
E 1 358 GLY 358 464 464 GLY GLY E . n 
E 1 359 GLN 359 465 465 GLN GLN E . n 
E 1 360 ILE 360 466 466 ILE ILE E . n 
E 1 361 LYS 361 467 467 LYS LYS E . n 
E 1 362 ILE 362 468 468 ILE ILE E . n 
E 1 363 LYS 363 469 469 LYS LYS E . n 
E 1 364 ARG 364 470 470 ARG ARG E . n 
E 1 365 GLU 365 471 471 GLU GLU E . n 
E 1 366 ASP 366 472 472 ASP ASP E . n 
E 1 367 TYR 367 473 473 TYR TYR E . n 
E 1 368 GLU 368 474 474 GLU GLU E . n 
E 1 369 SER 369 475 475 SER SER E . n 
E 1 370 LEU 370 476 476 LEU LEU E . n 
E 1 371 PRO 371 477 477 PRO PRO E . n 
E 1 372 LYS 372 478 478 LYS LYS E . n 
E 1 373 GLU 373 479 479 GLU GLU E . n 
E 1 374 VAL 374 480 480 VAL VAL E . n 
E 1 375 ALA 375 481 481 ALA ALA E . n 
E 1 376 SER 376 482 482 SER SER E . n 
E 1 377 ALA 377 483 483 ALA ALA E . n 
E 1 378 LYS 378 484 484 LYS LYS E . n 
E 1 379 PRO 379 485 485 PRO PRO E . n 
E 1 380 LYS 380 486 486 LYS LYS E . n 
E 1 381 VAL 381 487 487 VAL VAL E . n 
E 1 382 LEU 382 488 488 LEU LEU E . n 
E 1 383 LEU 383 489 489 LEU LEU E . n 
E 1 384 ASP 384 490 490 ASP ASP E . n 
E 1 385 VAL 385 491 491 VAL VAL E . n 
E 1 386 LYS 386 492 492 LYS LYS E . n 
E 1 387 LEU 387 493 493 LEU LEU E . n 
E 1 388 LYS 388 494 494 LYS LYS E . n 
E 1 389 ALA 389 495 495 ALA ALA E . n 
E 1 390 GLU 390 496 496 GLU GLU E . n 
E 1 391 ASP 391 497 497 ASP ASP E . n 
E 1 392 PHE 392 498 498 PHE PHE E . n 
E 1 393 ILE 393 499 499 ILE ILE E . n 
E 1 394 VAL 394 500 500 VAL VAL E . n 
E 1 395 ASP 395 501 501 ASP ASP E . n 
E 1 396 VAL 396 502 502 VAL VAL E . n 
E 1 397 ILE 397 503 503 ILE ILE E . n 
E 1 398 ASN 398 504 504 ASN ASN E . n 
E 1 399 MET 399 505 505 MET MET E . n 
E 1 400 ASP 400 506 506 ASP ASP E . n 
E 1 401 TYR 401 507 507 TYR TYR E . n 
E 1 402 GLY 402 508 508 GLY GLY E . n 
E 1 403 MET 403 509 509 MET MET E . n 
E 1 404 GLN 404 510 510 GLN GLN E . n 
E 1 405 GLU 405 511 511 GLU GLU E . n 
E 1 406 LYS 406 512 512 LYS LYS E . n 
E 1 407 ASN 407 513 513 ASN ASN E . n 
E 1 408 PRO 408 514 514 PRO PRO E . n 
E 1 409 ILE 409 515 515 ILE ILE E . n 
E 1 410 ASP 410 516 516 ASP ASP E . n 
E 1 411 HIS 411 517 517 HIS HIS E . n 
E 1 412 VAL 412 518 518 VAL VAL E . n 
E 1 413 SER 413 519 519 SER SER E . n 
E 1 414 PHE 414 520 520 PHE PHE E . n 
E 1 415 TYR 415 521 521 TYR TYR E . n 
E 1 416 CYS 416 522 522 CYS CYS E . n 
E 1 417 LYS 417 523 523 LYS LYS E . n 
E 1 418 THR 418 524 524 THR THR E . n 
E 1 419 ALA 419 525 525 ALA ALA E . n 
E 1 420 PRO 420 526 526 PRO PRO E . n 
E 1 421 ASN 421 527 527 ASN ASN E . n 
E 1 422 ARG 422 528 528 ARG ARG E . n 
E 1 423 ALA 423 529 529 ALA ALA E . n 
E 1 424 ILE 424 530 530 ILE ILE E . n 
E 1 425 ARG 425 531 531 ARG ARG E . n 
E 1 426 ILE 426 532 532 ILE ILE E . n 
E 1 427 THR 427 533 533 THR THR E . n 
E 1 428 LYS 428 534 534 LYS LYS E . n 
E 1 429 ASN 429 535 535 ASN ASN E . n 
E 1 430 GLN 430 536 536 GLN GLN E . n 
E 1 431 VAL 431 537 537 VAL VAL E . n 
E 1 432 SER 432 538 538 SER SER E . n 
E 1 433 GLN 433 539 539 GLN GLN E . n 
E 1 434 LEU 434 540 540 LEU LEU E . n 
E 1 435 LEU 435 541 541 LEU LEU E . n 
E 1 436 PRO 436 542 542 PRO PRO E . n 
E 1 437 GLU 437 543 543 GLU GLU E . n 
E 1 438 LYS 438 544 544 LYS LYS E . n 
E 1 439 PHE 439 545 545 PHE PHE E . n 
E 1 440 ALA 440 546 546 ALA ALA E . n 
E 1 441 GLU 441 547 547 GLU GLU E . n 
E 1 442 GLN 442 548 548 GLN GLN E . n 
E 1 443 LEU 443 549 549 LEU LEU E . n 
E 1 444 ILE 444 550 550 ILE ILE E . n 
E 1 445 ARG 445 551 551 ARG ARG E . n 
E 1 446 VAL 446 552 552 VAL VAL E . n 
E 1 447 TYR 447 553 553 TYR TYR E . n 
E 1 448 CYS 448 554 554 CYS CYS E . n 
E 1 449 LYS 449 555 555 LYS LYS E . n 
E 1 450 LYS 450 556 556 LYS LYS E . n 
E 1 451 VAL 451 557 557 VAL VAL E . n 
E 1 452 ASP 452 558 558 ASP ASP E . n 
E 1 453 ARG 453 559 559 ARG ARG E . n 
E 1 454 LYS 454 560 560 LYS LYS E . n 
E 1 455 SER 455 561 561 SER SER E . n 
E 1 456 LEU 456 562 562 LEU LEU E . n 
E 1 457 TYR 457 563 563 TYR TYR E . n 
E 1 458 ALA 458 564 564 ALA ALA E . n 
E 1 459 ALA 459 565 565 ALA ALA E . n 
E 1 460 ARG 460 566 566 ARG ARG E . n 
E 1 461 GLN 461 567 567 GLN GLN E . n 
E 1 462 TYR 462 568 568 TYR TYR E . n 
E 1 463 PHE 463 569 569 PHE PHE E . n 
E 1 464 VAL 464 570 570 VAL VAL E . n 
E 1 465 GLN 465 571 571 GLN GLN E . n 
E 1 466 TRP 466 572 572 TRP TRP E . n 
E 1 467 CYS 467 573 573 CYS CYS E . n 
E 1 468 ALA 468 574 574 ALA ALA E . n 
E 1 469 ASP 469 575 575 ASP ASP E . n 
E 1 470 ARG 470 576 576 ARG ARG E . n 
E 1 471 ASN 471 577 577 ASN ASN E . n 
E 1 472 PHE 472 578 578 PHE PHE E . n 
E 1 473 THR 473 579 579 THR THR E . n 
E 1 474 LYS 474 580 580 LYS LYS E . n 
E 1 475 PRO 475 581 581 PRO PRO E . n 
E 1 476 GLN 476 582 582 GLN GLN E . n 
E 1 477 ASP 477 583 583 ASP ASP E . n 
E 1 478 GLY 478 584 584 GLY GLY E . n 
E 1 479 ASP 479 585 585 ASP ASP E . n 
E 1 480 VAL 480 586 586 VAL VAL E . n 
E 1 481 ILE 481 587 587 ILE ILE E . n 
E 1 482 ALA 482 588 588 ALA ALA E . n 
E 1 483 PRO 483 589 589 PRO PRO E . n 
E 1 484 LEU 484 590 590 LEU LEU E . n 
E 1 485 ILE 485 591 591 ILE ILE E . n 
E 1 486 THR 486 592 592 THR THR E . n 
E 1 487 PRO 487 593 593 PRO PRO E . n 
E 1 488 GLN 488 594 594 GLN GLN E . n 
E 1 489 LYS 489 595 595 LYS LYS E . n 
E 1 490 LYS 490 596 596 LYS LYS E . n 
E 1 491 GLU 491 597 597 GLU GLU E . n 
E 1 492 TRP 492 598 598 TRP TRP E . n 
E 1 493 ASN 493 599 599 ASN ASN E . n 
E 1 494 ASP 494 600 ?   ?   ?   E . n 
E 1 495 SER 495 601 ?   ?   ?   E . n 
E 1 496 THR 496 602 ?   ?   ?   E . n 
E 1 497 SER 497 603 ?   ?   ?   E . n 
E 1 498 VAL 498 604 ?   ?   ?   E . n 
E 1 499 GLN 499 605 ?   ?   ?   E . n 
E 1 500 ASN 500 606 ?   ?   ?   E . n 
E 1 501 PRO 501 607 ?   ?   ?   E . n 
E 1 502 THR 502 608 ?   ?   ?   E . n 
E 1 503 ARG 503 609 ?   ?   ?   E . n 
E 1 504 LEU 504 610 ?   ?   ?   E . n 
E 1 505 ARG 505 611 ?   ?   ?   E . n 
E 1 506 GLU 506 612 ?   ?   ?   E . n 
E 1 507 ALA 507 613 ?   ?   ?   E . n 
E 1 508 SER 508 614 ?   ?   ?   E . n 
E 1 509 LYS 509 615 ?   ?   ?   E . n 
E 1 510 SER 510 616 ?   ?   ?   E . n 
E 1 511 ARG 511 617 ?   ?   ?   E . n 
E 1 512 VAL 512 618 ?   ?   ?   E . n 
E 1 513 GLN 513 619 ?   ?   ?   E . n 
E 1 514 LEU 514 620 ?   ?   ?   E . n 
E 1 515 PHE 515 621 ?   ?   ?   E . n 
E 1 516 LYS 516 622 ?   ?   ?   E . n 
E 1 517 ASP 517 623 ?   ?   ?   E . n 
E 1 518 ASP 518 624 ?   ?   ?   E . n 
E 1 519 PRO 519 625 ?   ?   ?   E . n 
E 1 520 MET 520 626 ?   ?   ?   E . n 
F 1 1   GLY 1   107 ?   ?   ?   F . n 
F 1 2   SER 2   108 ?   ?   ?   F . n 
F 1 3   GLN 3   109 ?   ?   ?   F . n 
F 1 4   ILE 4   110 ?   ?   ?   F . n 
F 1 5   HIS 5   111 ?   ?   ?   F . n 
F 1 6   VAL 6   112 ?   ?   ?   F . n 
F 1 7   ASP 7   113 ?   ?   ?   F . n 
F 1 8   THR 8   114 114 THR THR F . n 
F 1 9   MET 9   115 115 MET MET F . n 
F 1 10  LYS 10  116 116 LYS LYS F . n 
F 1 11  VAL 11  117 117 VAL VAL F . n 
F 1 12  ILE 12  118 118 ILE ILE F . n 
F 1 13  ASN 13  119 119 ASN ASN F . n 
F 1 14  ASP 14  120 120 ASP ASP F . n 
F 1 15  PRO 15  121 121 PRO PRO F . n 
F 1 16  ILE 16  122 122 ILE ILE F . n 
F 1 17  HIS 17  123 123 HIS HIS F . n 
F 1 18  GLY 18  124 124 GLY GLY F . n 
F 1 19  HIS 19  125 125 HIS HIS F . n 
F 1 20  ILE 20  126 126 ILE ILE F . n 
F 1 21  GLU 21  127 127 GLU GLU F . n 
F 1 22  LEU 22  128 128 LEU LEU F . n 
F 1 23  HIS 23  129 129 HIS HIS F . n 
F 1 24  PRO 24  130 130 PRO PRO F . n 
F 1 25  LEU 25  131 131 LEU LEU F . n 
F 1 26  LEU 26  132 132 LEU LEU F . n 
F 1 27  VAL 27  133 133 VAL VAL F . n 
F 1 28  ARG 28  134 134 ARG ARG F . n 
F 1 29  ILE 29  135 135 ILE ILE F . n 
F 1 30  ILE 30  136 136 ILE ILE F . n 
F 1 31  ASP 31  137 137 ASP ASP F . n 
F 1 32  THR 32  138 138 THR THR F . n 
F 1 33  PRO 33  139 139 PRO PRO F . n 
F 1 34  GLN 34  140 140 GLN GLN F . n 
F 1 35  PHE 35  141 141 PHE PHE F . n 
F 1 36  GLN 36  142 142 GLN GLN F . n 
F 1 37  ARG 37  143 143 ARG ARG F . n 
F 1 38  LEU 38  144 144 LEU LEU F . n 
F 1 39  ARG 39  145 145 ARG ARG F . n 
F 1 40  TYR 40  146 146 TYR TYR F . n 
F 1 41  ILE 41  147 147 ILE ILE F . n 
F 1 42  LYS 42  148 148 LYS LYS F . n 
F 1 43  GLN 43  149 149 GLN GLN F . n 
F 1 44  LEU 44  150 150 LEU LEU F . n 
F 1 45  GLY 45  151 151 GLY GLY F . n 
F 1 46  GLY 46  152 152 GLY GLY F . n 
F 1 47  GLY 47  153 153 GLY GLY F . n 
F 1 48  TYR 48  154 154 TYR TYR F . n 
F 1 49  TYR 49  155 155 TYR TYR F . n 
F 1 50  VAL 50  156 156 VAL VAL F . n 
F 1 51  PHE 51  157 157 PHE PHE F . n 
F 1 52  PRO 52  158 158 PRO PRO F . n 
F 1 53  GLY 53  159 159 GLY GLY F . n 
F 1 54  ALA 54  160 160 ALA ALA F . n 
F 1 55  SER 55  161 161 SER SER F . n 
F 1 56  HIS 56  162 162 HIS HIS F . n 
F 1 57  ASN 57  163 163 ASN ASN F . n 
F 1 58  ARG 58  164 164 ARG ARG F . n 
F 1 59  PHE 59  165 165 PHE PHE F . n 
F 1 60  GLU 60  166 166 GLU GLU F . n 
F 1 61  HIS 61  167 167 HIS HIS F . n 
F 1 62  SER 62  168 168 SER SER F . n 
F 1 63  LEU 63  169 169 LEU LEU F . n 
F 1 64  GLY 64  170 170 GLY GLY F . n 
F 1 65  VAL 65  171 171 VAL VAL F . n 
F 1 66  GLY 66  172 172 GLY GLY F . n 
F 1 67  TYR 67  173 173 TYR TYR F . n 
F 1 68  LEU 68  174 174 LEU LEU F . n 
F 1 69  ALA 69  175 175 ALA ALA F . n 
F 1 70  GLY 70  176 176 GLY GLY F . n 
F 1 71  CYS 71  177 177 CYS CYS F . n 
F 1 72  LEU 72  178 178 LEU LEU F . n 
F 1 73  VAL 73  179 179 VAL VAL F . n 
F 1 74  HIS 74  180 180 HIS HIS F . n 
F 1 75  ALA 75  181 181 ALA ALA F . n 
F 1 76  LEU 76  182 182 LEU LEU F . n 
F 1 77  GLY 77  183 183 GLY GLY F . n 
F 1 78  GLU 78  184 184 GLU GLU F . n 
F 1 79  LYS 79  185 185 LYS LYS F . n 
F 1 80  GLN 80  186 186 GLN GLN F . n 
F 1 81  PRO 81  187 187 PRO PRO F . n 
F 1 82  GLU 82  188 188 GLU GLU F . n 
F 1 83  LEU 83  189 189 LEU LEU F . n 
F 1 84  GLN 84  190 190 GLN GLN F . n 
F 1 85  ILE 85  191 191 ILE ILE F . n 
F 1 86  SER 86  192 192 SER SER F . n 
F 1 87  GLU 87  193 193 GLU GLU F . n 
F 1 88  ARG 88  194 194 ARG ARG F . n 
F 1 89  ASP 89  195 195 ASP ASP F . n 
F 1 90  VAL 90  196 196 VAL VAL F . n 
F 1 91  LEU 91  197 197 LEU LEU F . n 
F 1 92  CYS 92  198 198 CYS CYS F . n 
F 1 93  VAL 93  199 199 VAL VAL F . n 
F 1 94  GLN 94  200 200 GLN GLN F . n 
F 1 95  ILE 95  201 201 ILE ILE F . n 
F 1 96  ALA 96  202 202 ALA ALA F . n 
F 1 97  GLY 97  203 203 GLY GLY F . n 
F 1 98  LEU 98  204 204 LEU LEU F . n 
F 1 99  CYS 99  205 205 CYS CYS F . n 
F 1 100 HIS 100 206 206 HIS HIS F . n 
F 1 101 ASP 101 207 207 ASP ASP F . n 
F 1 102 LEU 102 208 208 LEU LEU F . n 
F 1 103 GLY 103 209 209 GLY GLY F . n 
F 1 104 HIS 104 210 210 HIS HIS F . n 
F 1 105 GLY 105 211 211 GLY GLY F . n 
F 1 106 PRO 106 212 212 PRO PRO F . n 
F 1 107 PHE 107 213 213 PHE PHE F . n 
F 1 108 SER 108 214 214 SER SER F . n 
F 1 109 HIS 109 215 215 HIS HIS F . n 
F 1 110 MET 110 216 216 MET MET F . n 
F 1 111 PHE 111 217 217 PHE PHE F . n 
F 1 112 ASP 112 218 218 ASP ASP F . n 
F 1 113 GLY 113 219 219 GLY GLY F . n 
F 1 114 ARG 114 220 220 ARG ARG F . n 
F 1 115 PHE 115 221 221 PHE PHE F . n 
F 1 116 ILE 116 222 222 ILE ILE F . n 
F 1 117 PRO 117 223 223 PRO PRO F . n 
F 1 118 LEU 118 224 224 LEU LEU F . n 
F 1 119 ALA 119 225 225 ALA ALA F . n 
F 1 120 ARG 120 226 226 ARG ARG F . n 
F 1 121 PRO 121 227 227 PRO PRO F . n 
F 1 122 GLU 122 228 228 GLU GLU F . n 
F 1 123 VAL 123 229 229 VAL VAL F . n 
F 1 124 LYS 124 230 230 LYS LYS F . n 
F 1 125 TRP 125 231 231 TRP TRP F . n 
F 1 126 THR 126 232 232 THR THR F . n 
F 1 127 HIS 127 233 233 HIS HIS F . n 
F 1 128 GLU 128 234 234 GLU GLU F . n 
F 1 129 GLN 129 235 235 GLN GLN F . n 
F 1 130 GLY 130 236 236 GLY GLY F . n 
F 1 131 SER 131 237 237 SER SER F . n 
F 1 132 VAL 132 238 238 VAL VAL F . n 
F 1 133 MET 133 239 239 MET MET F . n 
F 1 134 MET 134 240 240 MET MET F . n 
F 1 135 PHE 135 241 241 PHE PHE F . n 
F 1 136 GLU 136 242 242 GLU GLU F . n 
F 1 137 HIS 137 243 243 HIS HIS F . n 
F 1 138 LEU 138 244 244 LEU LEU F . n 
F 1 139 ILE 139 245 245 ILE ILE F . n 
F 1 140 ASN 140 246 246 ASN ASN F . n 
F 1 141 SER 141 247 247 SER SER F . n 
F 1 142 ASN 142 248 248 ASN ASN F . n 
F 1 143 GLY 143 249 249 GLY GLY F . n 
F 1 144 ILE 144 250 250 ILE ILE F . n 
F 1 145 LYS 145 251 251 LYS LYS F . n 
F 1 146 PRO 146 252 252 PRO PRO F . n 
F 1 147 VAL 147 253 253 VAL VAL F . n 
F 1 148 MET 148 254 254 MET MET F . n 
F 1 149 GLU 149 255 255 GLU GLU F . n 
F 1 150 GLN 150 256 256 GLN GLN F . n 
F 1 151 TYR 151 257 257 TYR TYR F . n 
F 1 152 GLY 152 258 258 GLY GLY F . n 
F 1 153 LEU 153 259 259 LEU LEU F . n 
F 1 154 ILE 154 260 260 ILE ILE F . n 
F 1 155 PRO 155 261 261 PRO PRO F . n 
F 1 156 GLU 156 262 262 GLU GLU F . n 
F 1 157 GLU 157 263 263 GLU GLU F . n 
F 1 158 ASP 158 264 264 ASP ASP F . n 
F 1 159 ILE 159 265 265 ILE ILE F . n 
F 1 160 CYS 160 266 266 CYS CYS F . n 
F 1 161 PHE 161 267 267 PHE PHE F . n 
F 1 162 ILE 162 268 268 ILE ILE F . n 
F 1 163 LYS 163 269 269 LYS LYS F . n 
F 1 164 GLU 164 270 270 GLU GLU F . n 
F 1 165 GLN 165 271 271 GLN GLN F . n 
F 1 166 ILE 166 272 272 ILE ILE F . n 
F 1 167 VAL 167 273 273 VAL VAL F . n 
F 1 168 GLY 168 274 274 GLY GLY F . n 
F 1 169 PRO 169 275 275 PRO PRO F . n 
F 1 170 LEU 170 276 276 LEU LEU F . n 
F 1 171 GLU 171 277 ?   ?   ?   F . n 
F 1 172 SER 172 278 ?   ?   ?   F . n 
F 1 173 PRO 173 279 ?   ?   ?   F . n 
F 1 174 VAL 174 280 ?   ?   ?   F . n 
F 1 175 GLU 175 281 ?   ?   ?   F . n 
F 1 176 ASP 176 282 ?   ?   ?   F . n 
F 1 177 SER 177 283 ?   ?   ?   F . n 
F 1 178 LEU 178 284 284 LEU LEU F . n 
F 1 179 TRP 179 285 285 TRP TRP F . n 
F 1 180 PRO 180 286 286 PRO PRO F . n 
F 1 181 TYR 181 287 287 TYR TYR F . n 
F 1 182 LYS 182 288 288 LYS LYS F . n 
F 1 183 GLY 183 289 289 GLY GLY F . n 
F 1 184 ARG 184 290 290 ARG ARG F . n 
F 1 185 PRO 185 291 291 PRO PRO F . n 
F 1 186 GLU 186 292 292 GLU GLU F . n 
F 1 187 ASN 187 293 293 ASN ASN F . n 
F 1 188 LYS 188 294 294 LYS LYS F . n 
F 1 189 SER 189 295 295 SER SER F . n 
F 1 190 PHE 190 296 296 PHE PHE F . n 
F 1 191 LEU 191 297 297 LEU LEU F . n 
F 1 192 TYR 192 298 298 TYR TYR F . n 
F 1 193 GLU 193 299 299 GLU GLU F . n 
F 1 194 ILE 194 300 300 ILE ILE F . n 
F 1 195 VAL 195 301 301 VAL VAL F . n 
F 1 196 SER 196 302 302 SER SER F . n 
F 1 197 ASN 197 303 303 ASN ASN F . n 
F 1 198 LYS 198 304 304 LYS LYS F . n 
F 1 199 ARG 199 305 305 ARG ARG F . n 
F 1 200 ASN 200 306 306 ASN ASN F . n 
F 1 201 GLY 201 307 307 GLY GLY F . n 
F 1 202 ILE 202 308 308 ILE ILE F . n 
F 1 203 ASP 203 309 309 ASP ASP F . n 
F 1 204 VAL 204 310 310 VAL VAL F . n 
F 1 205 ASP 205 311 311 ASP ASP F . n 
F 1 206 LYS 206 312 312 LYS LYS F . n 
F 1 207 TRP 207 313 313 TRP TRP F . n 
F 1 208 ASP 208 314 314 ASP ASP F . n 
F 1 209 TYR 209 315 315 TYR TYR F . n 
F 1 210 PHE 210 316 316 PHE PHE F . n 
F 1 211 ALA 211 317 317 ALA ALA F . n 
F 1 212 ARG 212 318 318 ARG ARG F . n 
F 1 213 ASP 213 319 319 ASP ASP F . n 
F 1 214 CYS 214 320 320 CYS CYS F . n 
F 1 215 HIS 215 321 321 HIS HIS F . n 
F 1 216 HIS 216 322 322 HIS HIS F . n 
F 1 217 LEU 217 323 323 LEU LEU F . n 
F 1 218 GLY 218 324 324 GLY GLY F . n 
F 1 219 ILE 219 325 325 ILE ILE F . n 
F 1 220 GLN 220 326 326 GLN GLN F . n 
F 1 221 ASN 221 327 327 ASN ASN F . n 
F 1 222 ASN 222 328 328 ASN ASN F . n 
F 1 223 PHE 223 329 329 PHE PHE F . n 
F 1 224 ASP 224 330 330 ASP ASP F . n 
F 1 225 TYR 225 331 331 TYR TYR F . n 
F 1 226 LYS 226 332 332 LYS LYS F . n 
F 1 227 ARG 227 333 333 ARG ARG F . n 
F 1 228 PHE 228 334 334 PHE PHE F . n 
F 1 229 ILE 229 335 335 ILE ILE F . n 
F 1 230 LYS 230 336 336 LYS LYS F . n 
F 1 231 PHE 231 337 337 PHE PHE F . n 
F 1 232 ALA 232 338 338 ALA ALA F . n 
F 1 233 ARG 233 339 339 ARG ARG F . n 
F 1 234 VAL 234 340 340 VAL VAL F . n 
F 1 235 CYS 235 341 341 CYS CYS F . n 
F 1 236 GLU 236 342 342 GLU GLU F . n 
F 1 237 VAL 237 343 343 VAL VAL F . n 
F 1 238 ASP 238 344 344 ASP ASP F . n 
F 1 239 ASN 239 345 345 ASN ASN F . n 
F 1 240 GLU 240 346 346 GLU GLU F . n 
F 1 241 LEU 241 347 347 LEU LEU F . n 
F 1 242 ARG 242 348 348 ARG ARG F . n 
F 1 243 ILE 243 349 349 ILE ILE F . n 
F 1 244 CYS 244 350 350 CYS CYS F . n 
F 1 245 ALA 245 351 351 ALA ALA F . n 
F 1 246 ARG 246 352 352 ARG ARG F . n 
F 1 247 ASP 247 353 353 ASP ASP F . n 
F 1 248 LYS 248 354 354 LYS LYS F . n 
F 1 249 GLU 249 355 355 GLU GLU F . n 
F 1 250 VAL 250 356 356 VAL VAL F . n 
F 1 251 GLY 251 357 357 GLY GLY F . n 
F 1 252 ASN 252 358 358 ASN ASN F . n 
F 1 253 LEU 253 359 359 LEU LEU F . n 
F 1 254 TYR 254 360 360 TYR TYR F . n 
F 1 255 ASP 255 361 361 ASP ASP F . n 
F 1 256 MET 256 362 362 MET MET F . n 
F 1 257 PHE 257 363 363 PHE PHE F . n 
F 1 258 HIS 258 364 364 HIS HIS F . n 
F 1 259 THR 259 365 365 THR THR F . n 
F 1 260 ARG 260 366 366 ARG ARG F . n 
F 1 261 ASN 261 367 367 ASN ASN F . n 
F 1 262 SER 262 368 368 SER SER F . n 
F 1 263 LEU 263 369 369 LEU LEU F . n 
F 1 264 HIS 264 370 370 HIS HIS F . n 
F 1 265 ARG 265 371 371 ARG ARG F . n 
F 1 266 ARG 266 372 372 ARG ARG F . n 
F 1 267 ALA 267 373 373 ALA ALA F . n 
F 1 268 TYR 268 374 374 TYR TYR F . n 
F 1 269 GLN 269 375 375 GLN GLN F . n 
F 1 270 HIS 270 376 376 HIS HIS F . n 
F 1 271 LYS 271 377 377 LYS LYS F . n 
F 1 272 VAL 272 378 378 VAL VAL F . n 
F 1 273 GLY 273 379 379 GLY GLY F . n 
F 1 274 ASN 274 380 380 ASN ASN F . n 
F 1 275 ILE 275 381 381 ILE ILE F . n 
F 1 276 ILE 276 382 382 ILE ILE F . n 
F 1 277 ASP 277 383 383 ASP ASP F . n 
F 1 278 THR 278 384 384 THR THR F . n 
F 1 279 MET 279 385 385 MET MET F . n 
F 1 280 ILE 280 386 386 ILE ILE F . n 
F 1 281 THR 281 387 387 THR THR F . n 
F 1 282 ASP 282 388 388 ASP ASP F . n 
F 1 283 ALA 283 389 389 ALA ALA F . n 
F 1 284 PHE 284 390 390 PHE PHE F . n 
F 1 285 LEU 285 391 391 LEU LEU F . n 
F 1 286 LYS 286 392 392 LYS LYS F . n 
F 1 287 ALA 287 393 393 ALA ALA F . n 
F 1 288 ASP 288 394 394 ASP ASP F . n 
F 1 289 ASP 289 395 395 ASP ASP F . n 
F 1 290 TYR 290 396 396 TYR TYR F . n 
F 1 291 ILE 291 397 397 ILE ILE F . n 
F 1 292 GLU 292 398 398 GLU GLU F . n 
F 1 293 ILE 293 399 399 ILE ILE F . n 
F 1 294 THR 294 400 400 THR THR F . n 
F 1 295 GLY 295 401 401 GLY GLY F . n 
F 1 296 ALA 296 402 402 ALA ALA F . n 
F 1 297 GLY 297 403 403 GLY GLY F . n 
F 1 298 GLY 298 404 404 GLY GLY F . n 
F 1 299 LYS 299 405 405 LYS LYS F . n 
F 1 300 LYS 300 406 406 LYS LYS F . n 
F 1 301 TYR 301 407 407 TYR TYR F . n 
F 1 302 ARG 302 408 408 ARG ARG F . n 
F 1 303 ILE 303 409 409 ILE ILE F . n 
F 1 304 SER 304 410 410 SER SER F . n 
F 1 305 THR 305 411 411 THR THR F . n 
F 1 306 ALA 306 412 412 ALA ALA F . n 
F 1 307 ILE 307 413 413 ILE ILE F . n 
F 1 308 ASP 308 414 414 ASP ASP F . n 
F 1 309 ASP 309 415 415 ASP ASP F . n 
F 1 310 MET 310 416 416 MET MET F . n 
F 1 311 GLU 311 417 417 GLU GLU F . n 
F 1 312 ALA 312 418 418 ALA ALA F . n 
F 1 313 TYR 313 419 419 TYR TYR F . n 
F 1 314 THR 314 420 420 THR THR F . n 
F 1 315 LYS 315 421 421 LYS LYS F . n 
F 1 316 LEU 316 422 422 LEU LEU F . n 
F 1 317 THR 317 423 423 THR THR F . n 
F 1 318 ASP 318 424 424 ASP ASP F . n 
F 1 319 ASN 319 425 425 ASN ASN F . n 
F 1 320 ILE 320 426 426 ILE ILE F . n 
F 1 321 PHE 321 427 427 PHE PHE F . n 
F 1 322 LEU 322 428 428 LEU LEU F . n 
F 1 323 GLU 323 429 429 GLU GLU F . n 
F 1 324 ILE 324 430 430 ILE ILE F . n 
F 1 325 LEU 325 431 431 LEU LEU F . n 
F 1 326 TYR 326 432 432 TYR TYR F . n 
F 1 327 SER 327 433 433 SER SER F . n 
F 1 328 THR 328 434 434 THR THR F . n 
F 1 329 ASP 329 435 435 ASP ASP F . n 
F 1 330 PRO 330 436 436 PRO PRO F . n 
F 1 331 LYS 331 437 437 LYS LYS F . n 
F 1 332 LEU 332 438 438 LEU LEU F . n 
F 1 333 LYS 333 439 439 LYS LYS F . n 
F 1 334 ASP 334 440 440 ASP ASP F . n 
F 1 335 ALA 335 441 441 ALA ALA F . n 
F 1 336 ARG 336 442 442 ARG ARG F . n 
F 1 337 GLU 337 443 443 GLU GLU F . n 
F 1 338 ILE 338 444 444 ILE ILE F . n 
F 1 339 LEU 339 445 445 LEU LEU F . n 
F 1 340 LYS 340 446 446 LYS LYS F . n 
F 1 341 GLN 341 447 447 GLN GLN F . n 
F 1 342 ILE 342 448 448 ILE ILE F . n 
F 1 343 GLU 343 449 449 GLU GLU F . n 
F 1 344 TYR 344 450 450 TYR TYR F . n 
F 1 345 ARG 345 451 451 ARG ARG F . n 
F 1 346 ASN 346 452 452 ASN ASN F . n 
F 1 347 LEU 347 453 453 LEU LEU F . n 
F 1 348 PHE 348 454 454 PHE PHE F . n 
F 1 349 LYS 349 455 455 LYS LYS F . n 
F 1 350 TYR 350 456 456 TYR TYR F . n 
F 1 351 VAL 351 457 457 VAL VAL F . n 
F 1 352 GLY 352 458 458 GLY GLY F . n 
F 1 353 GLU 353 459 459 GLU GLU F . n 
F 1 354 THR 354 460 460 THR THR F . n 
F 1 355 GLN 355 461 461 GLN GLN F . n 
F 1 356 PRO 356 462 462 PRO PRO F . n 
F 1 357 THR 357 463 463 THR THR F . n 
F 1 358 GLY 358 464 464 GLY GLY F . n 
F 1 359 GLN 359 465 465 GLN GLN F . n 
F 1 360 ILE 360 466 466 ILE ILE F . n 
F 1 361 LYS 361 467 467 LYS LYS F . n 
F 1 362 ILE 362 468 468 ILE ILE F . n 
F 1 363 LYS 363 469 469 LYS LYS F . n 
F 1 364 ARG 364 470 470 ARG ARG F . n 
F 1 365 GLU 365 471 471 GLU GLU F . n 
F 1 366 ASP 366 472 472 ASP ASP F . n 
F 1 367 TYR 367 473 473 TYR TYR F . n 
F 1 368 GLU 368 474 474 GLU GLU F . n 
F 1 369 SER 369 475 475 SER SER F . n 
F 1 370 LEU 370 476 476 LEU LEU F . n 
F 1 371 PRO 371 477 477 PRO PRO F . n 
F 1 372 LYS 372 478 478 LYS LYS F . n 
F 1 373 GLU 373 479 479 GLU GLU F . n 
F 1 374 VAL 374 480 480 VAL VAL F . n 
F 1 375 ALA 375 481 481 ALA ALA F . n 
F 1 376 SER 376 482 482 SER SER F . n 
F 1 377 ALA 377 483 483 ALA ALA F . n 
F 1 378 LYS 378 484 484 LYS LYS F . n 
F 1 379 PRO 379 485 485 PRO PRO F . n 
F 1 380 LYS 380 486 486 LYS LYS F . n 
F 1 381 VAL 381 487 487 VAL VAL F . n 
F 1 382 LEU 382 488 488 LEU LEU F . n 
F 1 383 LEU 383 489 489 LEU LEU F . n 
F 1 384 ASP 384 490 490 ASP ASP F . n 
F 1 385 VAL 385 491 491 VAL VAL F . n 
F 1 386 LYS 386 492 492 LYS LYS F . n 
F 1 387 LEU 387 493 493 LEU LEU F . n 
F 1 388 LYS 388 494 494 LYS LYS F . n 
F 1 389 ALA 389 495 495 ALA ALA F . n 
F 1 390 GLU 390 496 496 GLU GLU F . n 
F 1 391 ASP 391 497 497 ASP ASP F . n 
F 1 392 PHE 392 498 498 PHE PHE F . n 
F 1 393 ILE 393 499 499 ILE ILE F . n 
F 1 394 VAL 394 500 500 VAL VAL F . n 
F 1 395 ASP 395 501 501 ASP ASP F . n 
F 1 396 VAL 396 502 502 VAL VAL F . n 
F 1 397 ILE 397 503 503 ILE ILE F . n 
F 1 398 ASN 398 504 504 ASN ASN F . n 
F 1 399 MET 399 505 505 MET MET F . n 
F 1 400 ASP 400 506 506 ASP ASP F . n 
F 1 401 TYR 401 507 507 TYR TYR F . n 
F 1 402 GLY 402 508 508 GLY GLY F . n 
F 1 403 MET 403 509 509 MET MET F . n 
F 1 404 GLN 404 510 510 GLN GLN F . n 
F 1 405 GLU 405 511 511 GLU GLU F . n 
F 1 406 LYS 406 512 512 LYS LYS F . n 
F 1 407 ASN 407 513 513 ASN ASN F . n 
F 1 408 PRO 408 514 514 PRO PRO F . n 
F 1 409 ILE 409 515 515 ILE ILE F . n 
F 1 410 ASP 410 516 516 ASP ASP F . n 
F 1 411 HIS 411 517 517 HIS HIS F . n 
F 1 412 VAL 412 518 518 VAL VAL F . n 
F 1 413 SER 413 519 519 SER SER F . n 
F 1 414 PHE 414 520 520 PHE PHE F . n 
F 1 415 TYR 415 521 521 TYR TYR F . n 
F 1 416 CYS 416 522 522 CYS CYS F . n 
F 1 417 LYS 417 523 523 LYS LYS F . n 
F 1 418 THR 418 524 524 THR THR F . n 
F 1 419 ALA 419 525 525 ALA ALA F . n 
F 1 420 PRO 420 526 526 PRO PRO F . n 
F 1 421 ASN 421 527 527 ASN ASN F . n 
F 1 422 ARG 422 528 528 ARG ARG F . n 
F 1 423 ALA 423 529 529 ALA ALA F . n 
F 1 424 ILE 424 530 530 ILE ILE F . n 
F 1 425 ARG 425 531 531 ARG ARG F . n 
F 1 426 ILE 426 532 532 ILE ILE F . n 
F 1 427 THR 427 533 533 THR THR F . n 
F 1 428 LYS 428 534 534 LYS LYS F . n 
F 1 429 ASN 429 535 535 ASN ASN F . n 
F 1 430 GLN 430 536 536 GLN GLN F . n 
F 1 431 VAL 431 537 537 VAL VAL F . n 
F 1 432 SER 432 538 538 SER SER F . n 
F 1 433 GLN 433 539 539 GLN GLN F . n 
F 1 434 LEU 434 540 540 LEU LEU F . n 
F 1 435 LEU 435 541 541 LEU LEU F . n 
F 1 436 PRO 436 542 542 PRO PRO F . n 
F 1 437 GLU 437 543 543 GLU GLU F . n 
F 1 438 LYS 438 544 544 LYS LYS F . n 
F 1 439 PHE 439 545 545 PHE PHE F . n 
F 1 440 ALA 440 546 546 ALA ALA F . n 
F 1 441 GLU 441 547 547 GLU GLU F . n 
F 1 442 GLN 442 548 548 GLN GLN F . n 
F 1 443 LEU 443 549 549 LEU LEU F . n 
F 1 444 ILE 444 550 550 ILE ILE F . n 
F 1 445 ARG 445 551 551 ARG ARG F . n 
F 1 446 VAL 446 552 552 VAL VAL F . n 
F 1 447 TYR 447 553 553 TYR TYR F . n 
F 1 448 CYS 448 554 554 CYS CYS F . n 
F 1 449 LYS 449 555 555 LYS LYS F . n 
F 1 450 LYS 450 556 556 LYS LYS F . n 
F 1 451 VAL 451 557 557 VAL VAL F . n 
F 1 452 ASP 452 558 558 ASP ASP F . n 
F 1 453 ARG 453 559 559 ARG ARG F . n 
F 1 454 LYS 454 560 560 LYS LYS F . n 
F 1 455 SER 455 561 561 SER SER F . n 
F 1 456 LEU 456 562 562 LEU LEU F . n 
F 1 457 TYR 457 563 563 TYR TYR F . n 
F 1 458 ALA 458 564 564 ALA ALA F . n 
F 1 459 ALA 459 565 565 ALA ALA F . n 
F 1 460 ARG 460 566 566 ARG ARG F . n 
F 1 461 GLN 461 567 567 GLN GLN F . n 
F 1 462 TYR 462 568 568 TYR TYR F . n 
F 1 463 PHE 463 569 569 PHE PHE F . n 
F 1 464 VAL 464 570 570 VAL VAL F . n 
F 1 465 GLN 465 571 571 GLN GLN F . n 
F 1 466 TRP 466 572 572 TRP TRP F . n 
F 1 467 CYS 467 573 573 CYS CYS F . n 
F 1 468 ALA 468 574 574 ALA ALA F . n 
F 1 469 ASP 469 575 575 ASP ASP F . n 
F 1 470 ARG 470 576 576 ARG ARG F . n 
F 1 471 ASN 471 577 577 ASN ASN F . n 
F 1 472 PHE 472 578 578 PHE PHE F . n 
F 1 473 THR 473 579 579 THR THR F . n 
F 1 474 LYS 474 580 580 LYS LYS F . n 
F 1 475 PRO 475 581 581 PRO PRO F . n 
F 1 476 GLN 476 582 582 GLN GLN F . n 
F 1 477 ASP 477 583 583 ASP ASP F . n 
F 1 478 GLY 478 584 584 GLY GLY F . n 
F 1 479 ASP 479 585 585 ASP ASP F . n 
F 1 480 VAL 480 586 586 VAL VAL F . n 
F 1 481 ILE 481 587 587 ILE ILE F . n 
F 1 482 ALA 482 588 588 ALA ALA F . n 
F 1 483 PRO 483 589 589 PRO PRO F . n 
F 1 484 LEU 484 590 590 LEU LEU F . n 
F 1 485 ILE 485 591 591 ILE ILE F . n 
F 1 486 THR 486 592 592 THR THR F . n 
F 1 487 PRO 487 593 593 PRO PRO F . n 
F 1 488 GLN 488 594 594 GLN GLN F . n 
F 1 489 LYS 489 595 595 LYS LYS F . n 
F 1 490 LYS 490 596 596 LYS LYS F . n 
F 1 491 GLU 491 597 597 GLU GLU F . n 
F 1 492 TRP 492 598 598 TRP TRP F . n 
F 1 493 ASN 493 599 ?   ?   ?   F . n 
F 1 494 ASP 494 600 ?   ?   ?   F . n 
F 1 495 SER 495 601 ?   ?   ?   F . n 
F 1 496 THR 496 602 ?   ?   ?   F . n 
F 1 497 SER 497 603 ?   ?   ?   F . n 
F 1 498 VAL 498 604 ?   ?   ?   F . n 
F 1 499 GLN 499 605 ?   ?   ?   F . n 
F 1 500 ASN 500 606 ?   ?   ?   F . n 
F 1 501 PRO 501 607 ?   ?   ?   F . n 
F 1 502 THR 502 608 ?   ?   ?   F . n 
F 1 503 ARG 503 609 ?   ?   ?   F . n 
F 1 504 LEU 504 610 ?   ?   ?   F . n 
F 1 505 ARG 505 611 ?   ?   ?   F . n 
F 1 506 GLU 506 612 ?   ?   ?   F . n 
F 1 507 ALA 507 613 ?   ?   ?   F . n 
F 1 508 SER 508 614 ?   ?   ?   F . n 
F 1 509 LYS 509 615 ?   ?   ?   F . n 
F 1 510 SER 510 616 ?   ?   ?   F . n 
F 1 511 ARG 511 617 ?   ?   ?   F . n 
F 1 512 VAL 512 618 ?   ?   ?   F . n 
F 1 513 GLN 513 619 ?   ?   ?   F . n 
F 1 514 LEU 514 620 ?   ?   ?   F . n 
F 1 515 PHE 515 621 ?   ?   ?   F . n 
F 1 516 LYS 516 622 ?   ?   ?   F . n 
F 1 517 ASP 517 623 ?   ?   ?   F . n 
F 1 518 ASP 518 624 ?   ?   ?   F . n 
F 1 519 PRO 519 625 ?   ?   ?   F . n 
F 1 520 MET 520 626 ?   ?   ?   F . n 
G 1 1   GLY 1   107 ?   ?   ?   G . n 
G 1 2   SER 2   108 ?   ?   ?   G . n 
G 1 3   GLN 3   109 ?   ?   ?   G . n 
G 1 4   ILE 4   110 ?   ?   ?   G . n 
G 1 5   HIS 5   111 ?   ?   ?   G . n 
G 1 6   VAL 6   112 ?   ?   ?   G . n 
G 1 7   ASP 7   113 ?   ?   ?   G . n 
G 1 8   THR 8   114 114 THR THR G . n 
G 1 9   MET 9   115 115 MET MET G . n 
G 1 10  LYS 10  116 116 LYS LYS G . n 
G 1 11  VAL 11  117 117 VAL VAL G . n 
G 1 12  ILE 12  118 118 ILE ILE G . n 
G 1 13  ASN 13  119 119 ASN ASN G . n 
G 1 14  ASP 14  120 120 ASP ASP G . n 
G 1 15  PRO 15  121 121 PRO PRO G . n 
G 1 16  ILE 16  122 122 ILE ILE G . n 
G 1 17  HIS 17  123 123 HIS HIS G . n 
G 1 18  GLY 18  124 124 GLY GLY G . n 
G 1 19  HIS 19  125 125 HIS HIS G . n 
G 1 20  ILE 20  126 126 ILE ILE G . n 
G 1 21  GLU 21  127 127 GLU GLU G . n 
G 1 22  LEU 22  128 128 LEU LEU G . n 
G 1 23  HIS 23  129 129 HIS HIS G . n 
G 1 24  PRO 24  130 130 PRO PRO G . n 
G 1 25  LEU 25  131 131 LEU LEU G . n 
G 1 26  LEU 26  132 132 LEU LEU G . n 
G 1 27  VAL 27  133 133 VAL VAL G . n 
G 1 28  ARG 28  134 134 ARG ARG G . n 
G 1 29  ILE 29  135 135 ILE ILE G . n 
G 1 30  ILE 30  136 136 ILE ILE G . n 
G 1 31  ASP 31  137 137 ASP ASP G . n 
G 1 32  THR 32  138 138 THR THR G . n 
G 1 33  PRO 33  139 139 PRO PRO G . n 
G 1 34  GLN 34  140 140 GLN GLN G . n 
G 1 35  PHE 35  141 141 PHE PHE G . n 
G 1 36  GLN 36  142 142 GLN GLN G . n 
G 1 37  ARG 37  143 143 ARG ARG G . n 
G 1 38  LEU 38  144 144 LEU LEU G . n 
G 1 39  ARG 39  145 145 ARG ARG G . n 
G 1 40  TYR 40  146 146 TYR TYR G . n 
G 1 41  ILE 41  147 147 ILE ILE G . n 
G 1 42  LYS 42  148 148 LYS LYS G . n 
G 1 43  GLN 43  149 149 GLN GLN G . n 
G 1 44  LEU 44  150 150 LEU LEU G . n 
G 1 45  GLY 45  151 151 GLY GLY G . n 
G 1 46  GLY 46  152 152 GLY GLY G . n 
G 1 47  GLY 47  153 153 GLY GLY G . n 
G 1 48  TYR 48  154 154 TYR TYR G . n 
G 1 49  TYR 49  155 155 TYR TYR G . n 
G 1 50  VAL 50  156 156 VAL VAL G . n 
G 1 51  PHE 51  157 157 PHE PHE G . n 
G 1 52  PRO 52  158 158 PRO PRO G . n 
G 1 53  GLY 53  159 159 GLY GLY G . n 
G 1 54  ALA 54  160 160 ALA ALA G . n 
G 1 55  SER 55  161 161 SER SER G . n 
G 1 56  HIS 56  162 162 HIS HIS G . n 
G 1 57  ASN 57  163 163 ASN ASN G . n 
G 1 58  ARG 58  164 164 ARG ARG G . n 
G 1 59  PHE 59  165 165 PHE PHE G . n 
G 1 60  GLU 60  166 166 GLU GLU G . n 
G 1 61  HIS 61  167 167 HIS HIS G . n 
G 1 62  SER 62  168 168 SER SER G . n 
G 1 63  LEU 63  169 169 LEU LEU G . n 
G 1 64  GLY 64  170 170 GLY GLY G . n 
G 1 65  VAL 65  171 171 VAL VAL G . n 
G 1 66  GLY 66  172 172 GLY GLY G . n 
G 1 67  TYR 67  173 173 TYR TYR G . n 
G 1 68  LEU 68  174 174 LEU LEU G . n 
G 1 69  ALA 69  175 175 ALA ALA G . n 
G 1 70  GLY 70  176 176 GLY GLY G . n 
G 1 71  CYS 71  177 177 CYS CYS G . n 
G 1 72  LEU 72  178 178 LEU LEU G . n 
G 1 73  VAL 73  179 179 VAL VAL G . n 
G 1 74  HIS 74  180 180 HIS HIS G . n 
G 1 75  ALA 75  181 181 ALA ALA G . n 
G 1 76  LEU 76  182 182 LEU LEU G . n 
G 1 77  GLY 77  183 183 GLY GLY G . n 
G 1 78  GLU 78  184 184 GLU GLU G . n 
G 1 79  LYS 79  185 185 LYS LYS G . n 
G 1 80  GLN 80  186 186 GLN GLN G . n 
G 1 81  PRO 81  187 187 PRO PRO G . n 
G 1 82  GLU 82  188 188 GLU GLU G . n 
G 1 83  LEU 83  189 189 LEU LEU G . n 
G 1 84  GLN 84  190 190 GLN GLN G . n 
G 1 85  ILE 85  191 191 ILE ILE G . n 
G 1 86  SER 86  192 192 SER SER G . n 
G 1 87  GLU 87  193 193 GLU GLU G . n 
G 1 88  ARG 88  194 194 ARG ARG G . n 
G 1 89  ASP 89  195 195 ASP ASP G . n 
G 1 90  VAL 90  196 196 VAL VAL G . n 
G 1 91  LEU 91  197 197 LEU LEU G . n 
G 1 92  CYS 92  198 198 CYS CYS G . n 
G 1 93  VAL 93  199 199 VAL VAL G . n 
G 1 94  GLN 94  200 200 GLN GLN G . n 
G 1 95  ILE 95  201 201 ILE ILE G . n 
G 1 96  ALA 96  202 202 ALA ALA G . n 
G 1 97  GLY 97  203 203 GLY GLY G . n 
G 1 98  LEU 98  204 204 LEU LEU G . n 
G 1 99  CYS 99  205 205 CYS CYS G . n 
G 1 100 HIS 100 206 206 HIS HIS G . n 
G 1 101 ASP 101 207 207 ASP ASP G . n 
G 1 102 LEU 102 208 208 LEU LEU G . n 
G 1 103 GLY 103 209 209 GLY GLY G . n 
G 1 104 HIS 104 210 210 HIS HIS G . n 
G 1 105 GLY 105 211 211 GLY GLY G . n 
G 1 106 PRO 106 212 212 PRO PRO G . n 
G 1 107 PHE 107 213 213 PHE PHE G . n 
G 1 108 SER 108 214 214 SER SER G . n 
G 1 109 HIS 109 215 215 HIS HIS G . n 
G 1 110 MET 110 216 216 MET MET G . n 
G 1 111 PHE 111 217 217 PHE PHE G . n 
G 1 112 ASP 112 218 218 ASP ASP G . n 
G 1 113 GLY 113 219 219 GLY GLY G . n 
G 1 114 ARG 114 220 220 ARG ARG G . n 
G 1 115 PHE 115 221 221 PHE PHE G . n 
G 1 116 ILE 116 222 222 ILE ILE G . n 
G 1 117 PRO 117 223 223 PRO PRO G . n 
G 1 118 LEU 118 224 224 LEU LEU G . n 
G 1 119 ALA 119 225 225 ALA ALA G . n 
G 1 120 ARG 120 226 226 ARG ARG G . n 
G 1 121 PRO 121 227 227 PRO PRO G . n 
G 1 122 GLU 122 228 228 GLU GLU G . n 
G 1 123 VAL 123 229 229 VAL VAL G . n 
G 1 124 LYS 124 230 230 LYS LYS G . n 
G 1 125 TRP 125 231 231 TRP TRP G . n 
G 1 126 THR 126 232 232 THR THR G . n 
G 1 127 HIS 127 233 233 HIS HIS G . n 
G 1 128 GLU 128 234 234 GLU GLU G . n 
G 1 129 GLN 129 235 235 GLN GLN G . n 
G 1 130 GLY 130 236 236 GLY GLY G . n 
G 1 131 SER 131 237 237 SER SER G . n 
G 1 132 VAL 132 238 238 VAL VAL G . n 
G 1 133 MET 133 239 239 MET MET G . n 
G 1 134 MET 134 240 240 MET MET G . n 
G 1 135 PHE 135 241 241 PHE PHE G . n 
G 1 136 GLU 136 242 242 GLU GLU G . n 
G 1 137 HIS 137 243 243 HIS HIS G . n 
G 1 138 LEU 138 244 244 LEU LEU G . n 
G 1 139 ILE 139 245 245 ILE ILE G . n 
G 1 140 ASN 140 246 246 ASN ASN G . n 
G 1 141 SER 141 247 247 SER SER G . n 
G 1 142 ASN 142 248 248 ASN ASN G . n 
G 1 143 GLY 143 249 249 GLY GLY G . n 
G 1 144 ILE 144 250 250 ILE ILE G . n 
G 1 145 LYS 145 251 251 LYS LYS G . n 
G 1 146 PRO 146 252 252 PRO PRO G . n 
G 1 147 VAL 147 253 253 VAL VAL G . n 
G 1 148 MET 148 254 254 MET MET G . n 
G 1 149 GLU 149 255 255 GLU GLU G . n 
G 1 150 GLN 150 256 256 GLN GLN G . n 
G 1 151 TYR 151 257 257 TYR TYR G . n 
G 1 152 GLY 152 258 258 GLY GLY G . n 
G 1 153 LEU 153 259 259 LEU LEU G . n 
G 1 154 ILE 154 260 260 ILE ILE G . n 
G 1 155 PRO 155 261 261 PRO PRO G . n 
G 1 156 GLU 156 262 262 GLU GLU G . n 
G 1 157 GLU 157 263 263 GLU GLU G . n 
G 1 158 ASP 158 264 264 ASP ASP G . n 
G 1 159 ILE 159 265 265 ILE ILE G . n 
G 1 160 CYS 160 266 266 CYS CYS G . n 
G 1 161 PHE 161 267 267 PHE PHE G . n 
G 1 162 ILE 162 268 268 ILE ILE G . n 
G 1 163 LYS 163 269 269 LYS LYS G . n 
G 1 164 GLU 164 270 270 GLU GLU G . n 
G 1 165 GLN 165 271 271 GLN GLN G . n 
G 1 166 ILE 166 272 272 ILE ILE G . n 
G 1 167 VAL 167 273 273 VAL VAL G . n 
G 1 168 GLY 168 274 274 GLY GLY G . n 
G 1 169 PRO 169 275 275 PRO PRO G . n 
G 1 170 LEU 170 276 276 LEU LEU G . n 
G 1 171 GLU 171 277 277 GLU GLU G . n 
G 1 172 SER 172 278 ?   ?   ?   G . n 
G 1 173 PRO 173 279 ?   ?   ?   G . n 
G 1 174 VAL 174 280 ?   ?   ?   G . n 
G 1 175 GLU 175 281 ?   ?   ?   G . n 
G 1 176 ASP 176 282 ?   ?   ?   G . n 
G 1 177 SER 177 283 ?   ?   ?   G . n 
G 1 178 LEU 178 284 284 LEU LEU G . n 
G 1 179 TRP 179 285 285 TRP TRP G . n 
G 1 180 PRO 180 286 286 PRO PRO G . n 
G 1 181 TYR 181 287 287 TYR TYR G . n 
G 1 182 LYS 182 288 288 LYS LYS G . n 
G 1 183 GLY 183 289 289 GLY GLY G . n 
G 1 184 ARG 184 290 290 ARG ARG G . n 
G 1 185 PRO 185 291 291 PRO PRO G . n 
G 1 186 GLU 186 292 292 GLU GLU G . n 
G 1 187 ASN 187 293 293 ASN ASN G . n 
G 1 188 LYS 188 294 294 LYS LYS G . n 
G 1 189 SER 189 295 295 SER SER G . n 
G 1 190 PHE 190 296 296 PHE PHE G . n 
G 1 191 LEU 191 297 297 LEU LEU G . n 
G 1 192 TYR 192 298 298 TYR TYR G . n 
G 1 193 GLU 193 299 299 GLU GLU G . n 
G 1 194 ILE 194 300 300 ILE ILE G . n 
G 1 195 VAL 195 301 301 VAL VAL G . n 
G 1 196 SER 196 302 302 SER SER G . n 
G 1 197 ASN 197 303 303 ASN ASN G . n 
G 1 198 LYS 198 304 304 LYS LYS G . n 
G 1 199 ARG 199 305 305 ARG ARG G . n 
G 1 200 ASN 200 306 306 ASN ASN G . n 
G 1 201 GLY 201 307 307 GLY GLY G . n 
G 1 202 ILE 202 308 308 ILE ILE G . n 
G 1 203 ASP 203 309 309 ASP ASP G . n 
G 1 204 VAL 204 310 310 VAL VAL G . n 
G 1 205 ASP 205 311 311 ASP ASP G . n 
G 1 206 LYS 206 312 312 LYS LYS G . n 
G 1 207 TRP 207 313 313 TRP TRP G . n 
G 1 208 ASP 208 314 314 ASP ASP G . n 
G 1 209 TYR 209 315 315 TYR TYR G . n 
G 1 210 PHE 210 316 316 PHE PHE G . n 
G 1 211 ALA 211 317 317 ALA ALA G . n 
G 1 212 ARG 212 318 318 ARG ARG G . n 
G 1 213 ASP 213 319 319 ASP ASP G . n 
G 1 214 CYS 214 320 320 CYS CYS G . n 
G 1 215 HIS 215 321 321 HIS HIS G . n 
G 1 216 HIS 216 322 322 HIS HIS G . n 
G 1 217 LEU 217 323 323 LEU LEU G . n 
G 1 218 GLY 218 324 324 GLY GLY G . n 
G 1 219 ILE 219 325 325 ILE ILE G . n 
G 1 220 GLN 220 326 326 GLN GLN G . n 
G 1 221 ASN 221 327 327 ASN ASN G . n 
G 1 222 ASN 222 328 328 ASN ASN G . n 
G 1 223 PHE 223 329 329 PHE PHE G . n 
G 1 224 ASP 224 330 330 ASP ASP G . n 
G 1 225 TYR 225 331 331 TYR TYR G . n 
G 1 226 LYS 226 332 332 LYS LYS G . n 
G 1 227 ARG 227 333 333 ARG ARG G . n 
G 1 228 PHE 228 334 334 PHE PHE G . n 
G 1 229 ILE 229 335 335 ILE ILE G . n 
G 1 230 LYS 230 336 336 LYS LYS G . n 
G 1 231 PHE 231 337 337 PHE PHE G . n 
G 1 232 ALA 232 338 338 ALA ALA G . n 
G 1 233 ARG 233 339 339 ARG ARG G . n 
G 1 234 VAL 234 340 340 VAL VAL G . n 
G 1 235 CYS 235 341 341 CYS CYS G . n 
G 1 236 GLU 236 342 342 GLU GLU G . n 
G 1 237 VAL 237 343 343 VAL VAL G . n 
G 1 238 ASP 238 344 344 ASP ASP G . n 
G 1 239 ASN 239 345 345 ASN ASN G . n 
G 1 240 GLU 240 346 346 GLU GLU G . n 
G 1 241 LEU 241 347 347 LEU LEU G . n 
G 1 242 ARG 242 348 348 ARG ARG G . n 
G 1 243 ILE 243 349 349 ILE ILE G . n 
G 1 244 CYS 244 350 350 CYS CYS G . n 
G 1 245 ALA 245 351 351 ALA ALA G . n 
G 1 246 ARG 246 352 352 ARG ARG G . n 
G 1 247 ASP 247 353 353 ASP ASP G . n 
G 1 248 LYS 248 354 354 LYS LYS G . n 
G 1 249 GLU 249 355 355 GLU GLU G . n 
G 1 250 VAL 250 356 356 VAL VAL G . n 
G 1 251 GLY 251 357 357 GLY GLY G . n 
G 1 252 ASN 252 358 358 ASN ASN G . n 
G 1 253 LEU 253 359 359 LEU LEU G . n 
G 1 254 TYR 254 360 360 TYR TYR G . n 
G 1 255 ASP 255 361 361 ASP ASP G . n 
G 1 256 MET 256 362 362 MET MET G . n 
G 1 257 PHE 257 363 363 PHE PHE G . n 
G 1 258 HIS 258 364 364 HIS HIS G . n 
G 1 259 THR 259 365 365 THR THR G . n 
G 1 260 ARG 260 366 366 ARG ARG G . n 
G 1 261 ASN 261 367 367 ASN ASN G . n 
G 1 262 SER 262 368 368 SER SER G . n 
G 1 263 LEU 263 369 369 LEU LEU G . n 
G 1 264 HIS 264 370 370 HIS HIS G . n 
G 1 265 ARG 265 371 371 ARG ARG G . n 
G 1 266 ARG 266 372 372 ARG ARG G . n 
G 1 267 ALA 267 373 373 ALA ALA G . n 
G 1 268 TYR 268 374 374 TYR TYR G . n 
G 1 269 GLN 269 375 375 GLN GLN G . n 
G 1 270 HIS 270 376 376 HIS HIS G . n 
G 1 271 LYS 271 377 377 LYS LYS G . n 
G 1 272 VAL 272 378 378 VAL VAL G . n 
G 1 273 GLY 273 379 379 GLY GLY G . n 
G 1 274 ASN 274 380 380 ASN ASN G . n 
G 1 275 ILE 275 381 381 ILE ILE G . n 
G 1 276 ILE 276 382 382 ILE ILE G . n 
G 1 277 ASP 277 383 383 ASP ASP G . n 
G 1 278 THR 278 384 384 THR THR G . n 
G 1 279 MET 279 385 385 MET MET G . n 
G 1 280 ILE 280 386 386 ILE ILE G . n 
G 1 281 THR 281 387 387 THR THR G . n 
G 1 282 ASP 282 388 388 ASP ASP G . n 
G 1 283 ALA 283 389 389 ALA ALA G . n 
G 1 284 PHE 284 390 390 PHE PHE G . n 
G 1 285 LEU 285 391 391 LEU LEU G . n 
G 1 286 LYS 286 392 392 LYS LYS G . n 
G 1 287 ALA 287 393 393 ALA ALA G . n 
G 1 288 ASP 288 394 394 ASP ASP G . n 
G 1 289 ASP 289 395 395 ASP ASP G . n 
G 1 290 TYR 290 396 396 TYR TYR G . n 
G 1 291 ILE 291 397 397 ILE ILE G . n 
G 1 292 GLU 292 398 398 GLU GLU G . n 
G 1 293 ILE 293 399 399 ILE ILE G . n 
G 1 294 THR 294 400 400 THR THR G . n 
G 1 295 GLY 295 401 401 GLY GLY G . n 
G 1 296 ALA 296 402 402 ALA ALA G . n 
G 1 297 GLY 297 403 403 GLY GLY G . n 
G 1 298 GLY 298 404 404 GLY GLY G . n 
G 1 299 LYS 299 405 405 LYS LYS G . n 
G 1 300 LYS 300 406 406 LYS LYS G . n 
G 1 301 TYR 301 407 407 TYR TYR G . n 
G 1 302 ARG 302 408 408 ARG ARG G . n 
G 1 303 ILE 303 409 409 ILE ILE G . n 
G 1 304 SER 304 410 410 SER SER G . n 
G 1 305 THR 305 411 411 THR THR G . n 
G 1 306 ALA 306 412 412 ALA ALA G . n 
G 1 307 ILE 307 413 413 ILE ILE G . n 
G 1 308 ASP 308 414 414 ASP ASP G . n 
G 1 309 ASP 309 415 415 ASP ASP G . n 
G 1 310 MET 310 416 416 MET MET G . n 
G 1 311 GLU 311 417 417 GLU GLU G . n 
G 1 312 ALA 312 418 418 ALA ALA G . n 
G 1 313 TYR 313 419 419 TYR TYR G . n 
G 1 314 THR 314 420 420 THR THR G . n 
G 1 315 LYS 315 421 421 LYS LYS G . n 
G 1 316 LEU 316 422 422 LEU LEU G . n 
G 1 317 THR 317 423 423 THR THR G . n 
G 1 318 ASP 318 424 424 ASP ASP G . n 
G 1 319 ASN 319 425 425 ASN ASN G . n 
G 1 320 ILE 320 426 426 ILE ILE G . n 
G 1 321 PHE 321 427 427 PHE PHE G . n 
G 1 322 LEU 322 428 428 LEU LEU G . n 
G 1 323 GLU 323 429 429 GLU GLU G . n 
G 1 324 ILE 324 430 430 ILE ILE G . n 
G 1 325 LEU 325 431 431 LEU LEU G . n 
G 1 326 TYR 326 432 432 TYR TYR G . n 
G 1 327 SER 327 433 433 SER SER G . n 
G 1 328 THR 328 434 434 THR THR G . n 
G 1 329 ASP 329 435 435 ASP ASP G . n 
G 1 330 PRO 330 436 436 PRO PRO G . n 
G 1 331 LYS 331 437 437 LYS LYS G . n 
G 1 332 LEU 332 438 438 LEU LEU G . n 
G 1 333 LYS 333 439 439 LYS LYS G . n 
G 1 334 ASP 334 440 440 ASP ASP G . n 
G 1 335 ALA 335 441 441 ALA ALA G . n 
G 1 336 ARG 336 442 442 ARG ARG G . n 
G 1 337 GLU 337 443 443 GLU GLU G . n 
G 1 338 ILE 338 444 444 ILE ILE G . n 
G 1 339 LEU 339 445 445 LEU LEU G . n 
G 1 340 LYS 340 446 446 LYS LYS G . n 
G 1 341 GLN 341 447 447 GLN GLN G . n 
G 1 342 ILE 342 448 448 ILE ILE G . n 
G 1 343 GLU 343 449 449 GLU GLU G . n 
G 1 344 TYR 344 450 450 TYR TYR G . n 
G 1 345 ARG 345 451 451 ARG ARG G . n 
G 1 346 ASN 346 452 452 ASN ASN G . n 
G 1 347 LEU 347 453 453 LEU LEU G . n 
G 1 348 PHE 348 454 454 PHE PHE G . n 
G 1 349 LYS 349 455 455 LYS LYS G . n 
G 1 350 TYR 350 456 456 TYR TYR G . n 
G 1 351 VAL 351 457 457 VAL VAL G . n 
G 1 352 GLY 352 458 458 GLY GLY G . n 
G 1 353 GLU 353 459 459 GLU GLU G . n 
G 1 354 THR 354 460 460 THR THR G . n 
G 1 355 GLN 355 461 461 GLN GLN G . n 
G 1 356 PRO 356 462 462 PRO PRO G . n 
G 1 357 THR 357 463 463 THR THR G . n 
G 1 358 GLY 358 464 464 GLY GLY G . n 
G 1 359 GLN 359 465 465 GLN GLN G . n 
G 1 360 ILE 360 466 466 ILE ILE G . n 
G 1 361 LYS 361 467 467 LYS LYS G . n 
G 1 362 ILE 362 468 468 ILE ILE G . n 
G 1 363 LYS 363 469 469 LYS LYS G . n 
G 1 364 ARG 364 470 470 ARG ARG G . n 
G 1 365 GLU 365 471 471 GLU GLU G . n 
G 1 366 ASP 366 472 472 ASP ASP G . n 
G 1 367 TYR 367 473 473 TYR TYR G . n 
G 1 368 GLU 368 474 474 GLU GLU G . n 
G 1 369 SER 369 475 475 SER SER G . n 
G 1 370 LEU 370 476 476 LEU LEU G . n 
G 1 371 PRO 371 477 477 PRO PRO G . n 
G 1 372 LYS 372 478 478 LYS LYS G . n 
G 1 373 GLU 373 479 479 GLU GLU G . n 
G 1 374 VAL 374 480 480 VAL VAL G . n 
G 1 375 ALA 375 481 481 ALA ALA G . n 
G 1 376 SER 376 482 482 SER SER G . n 
G 1 377 ALA 377 483 483 ALA ALA G . n 
G 1 378 LYS 378 484 484 LYS LYS G . n 
G 1 379 PRO 379 485 485 PRO PRO G . n 
G 1 380 LYS 380 486 486 LYS LYS G . n 
G 1 381 VAL 381 487 487 VAL VAL G . n 
G 1 382 LEU 382 488 488 LEU LEU G . n 
G 1 383 LEU 383 489 489 LEU LEU G . n 
G 1 384 ASP 384 490 490 ASP ASP G . n 
G 1 385 VAL 385 491 491 VAL VAL G . n 
G 1 386 LYS 386 492 492 LYS LYS G . n 
G 1 387 LEU 387 493 493 LEU LEU G . n 
G 1 388 LYS 388 494 494 LYS LYS G . n 
G 1 389 ALA 389 495 495 ALA ALA G . n 
G 1 390 GLU 390 496 496 GLU GLU G . n 
G 1 391 ASP 391 497 497 ASP ASP G . n 
G 1 392 PHE 392 498 498 PHE PHE G . n 
G 1 393 ILE 393 499 499 ILE ILE G . n 
G 1 394 VAL 394 500 500 VAL VAL G . n 
G 1 395 ASP 395 501 501 ASP ASP G . n 
G 1 396 VAL 396 502 502 VAL VAL G . n 
G 1 397 ILE 397 503 503 ILE ILE G . n 
G 1 398 ASN 398 504 504 ASN ASN G . n 
G 1 399 MET 399 505 505 MET MET G . n 
G 1 400 ASP 400 506 506 ASP ASP G . n 
G 1 401 TYR 401 507 507 TYR TYR G . n 
G 1 402 GLY 402 508 508 GLY GLY G . n 
G 1 403 MET 403 509 509 MET MET G . n 
G 1 404 GLN 404 510 510 GLN GLN G . n 
G 1 405 GLU 405 511 511 GLU GLU G . n 
G 1 406 LYS 406 512 512 LYS LYS G . n 
G 1 407 ASN 407 513 513 ASN ASN G . n 
G 1 408 PRO 408 514 514 PRO PRO G . n 
G 1 409 ILE 409 515 515 ILE ILE G . n 
G 1 410 ASP 410 516 516 ASP ASP G . n 
G 1 411 HIS 411 517 517 HIS HIS G . n 
G 1 412 VAL 412 518 518 VAL VAL G . n 
G 1 413 SER 413 519 519 SER SER G . n 
G 1 414 PHE 414 520 520 PHE PHE G . n 
G 1 415 TYR 415 521 521 TYR TYR G . n 
G 1 416 CYS 416 522 522 CYS CYS G . n 
G 1 417 LYS 417 523 523 LYS LYS G . n 
G 1 418 THR 418 524 524 THR THR G . n 
G 1 419 ALA 419 525 525 ALA ALA G . n 
G 1 420 PRO 420 526 526 PRO PRO G . n 
G 1 421 ASN 421 527 527 ASN ASN G . n 
G 1 422 ARG 422 528 528 ARG ARG G . n 
G 1 423 ALA 423 529 529 ALA ALA G . n 
G 1 424 ILE 424 530 530 ILE ILE G . n 
G 1 425 ARG 425 531 531 ARG ARG G . n 
G 1 426 ILE 426 532 532 ILE ILE G . n 
G 1 427 THR 427 533 533 THR THR G . n 
G 1 428 LYS 428 534 534 LYS LYS G . n 
G 1 429 ASN 429 535 535 ASN ASN G . n 
G 1 430 GLN 430 536 536 GLN GLN G . n 
G 1 431 VAL 431 537 537 VAL VAL G . n 
G 1 432 SER 432 538 538 SER SER G . n 
G 1 433 GLN 433 539 539 GLN GLN G . n 
G 1 434 LEU 434 540 540 LEU LEU G . n 
G 1 435 LEU 435 541 541 LEU LEU G . n 
G 1 436 PRO 436 542 542 PRO PRO G . n 
G 1 437 GLU 437 543 543 GLU GLU G . n 
G 1 438 LYS 438 544 544 LYS LYS G . n 
G 1 439 PHE 439 545 545 PHE PHE G . n 
G 1 440 ALA 440 546 546 ALA ALA G . n 
G 1 441 GLU 441 547 547 GLU GLU G . n 
G 1 442 GLN 442 548 548 GLN GLN G . n 
G 1 443 LEU 443 549 549 LEU LEU G . n 
G 1 444 ILE 444 550 550 ILE ILE G . n 
G 1 445 ARG 445 551 551 ARG ARG G . n 
G 1 446 VAL 446 552 552 VAL VAL G . n 
G 1 447 TYR 447 553 553 TYR TYR G . n 
G 1 448 CYS 448 554 554 CYS CYS G . n 
G 1 449 LYS 449 555 555 LYS LYS G . n 
G 1 450 LYS 450 556 556 LYS LYS G . n 
G 1 451 VAL 451 557 557 VAL VAL G . n 
G 1 452 ASP 452 558 558 ASP ASP G . n 
G 1 453 ARG 453 559 559 ARG ARG G . n 
G 1 454 LYS 454 560 560 LYS LYS G . n 
G 1 455 SER 455 561 561 SER SER G . n 
G 1 456 LEU 456 562 562 LEU LEU G . n 
G 1 457 TYR 457 563 563 TYR TYR G . n 
G 1 458 ALA 458 564 564 ALA ALA G . n 
G 1 459 ALA 459 565 565 ALA ALA G . n 
G 1 460 ARG 460 566 566 ARG ARG G . n 
G 1 461 GLN 461 567 567 GLN GLN G . n 
G 1 462 TYR 462 568 568 TYR TYR G . n 
G 1 463 PHE 463 569 569 PHE PHE G . n 
G 1 464 VAL 464 570 570 VAL VAL G . n 
G 1 465 GLN 465 571 571 GLN GLN G . n 
G 1 466 TRP 466 572 572 TRP TRP G . n 
G 1 467 CYS 467 573 573 CYS CYS G . n 
G 1 468 ALA 468 574 574 ALA ALA G . n 
G 1 469 ASP 469 575 575 ASP ASP G . n 
G 1 470 ARG 470 576 576 ARG ARG G . n 
G 1 471 ASN 471 577 577 ASN ASN G . n 
G 1 472 PHE 472 578 578 PHE PHE G . n 
G 1 473 THR 473 579 579 THR THR G . n 
G 1 474 LYS 474 580 580 LYS LYS G . n 
G 1 475 PRO 475 581 581 PRO PRO G . n 
G 1 476 GLN 476 582 582 GLN GLN G . n 
G 1 477 ASP 477 583 583 ASP ASP G . n 
G 1 478 GLY 478 584 584 GLY GLY G . n 
G 1 479 ASP 479 585 585 ASP ASP G . n 
G 1 480 VAL 480 586 586 VAL VAL G . n 
G 1 481 ILE 481 587 587 ILE ILE G . n 
G 1 482 ALA 482 588 588 ALA ALA G . n 
G 1 483 PRO 483 589 589 PRO PRO G . n 
G 1 484 LEU 484 590 590 LEU LEU G . n 
G 1 485 ILE 485 591 591 ILE ILE G . n 
G 1 486 THR 486 592 592 THR THR G . n 
G 1 487 PRO 487 593 593 PRO PRO G . n 
G 1 488 GLN 488 594 594 GLN GLN G . n 
G 1 489 LYS 489 595 595 LYS LYS G . n 
G 1 490 LYS 490 596 596 LYS LYS G . n 
G 1 491 GLU 491 597 597 GLU GLU G . n 
G 1 492 TRP 492 598 598 TRP TRP G . n 
G 1 493 ASN 493 599 ?   ?   ?   G . n 
G 1 494 ASP 494 600 ?   ?   ?   G . n 
G 1 495 SER 495 601 ?   ?   ?   G . n 
G 1 496 THR 496 602 ?   ?   ?   G . n 
G 1 497 SER 497 603 ?   ?   ?   G . n 
G 1 498 VAL 498 604 ?   ?   ?   G . n 
G 1 499 GLN 499 605 ?   ?   ?   G . n 
G 1 500 ASN 500 606 ?   ?   ?   G . n 
G 1 501 PRO 501 607 ?   ?   ?   G . n 
G 1 502 THR 502 608 ?   ?   ?   G . n 
G 1 503 ARG 503 609 ?   ?   ?   G . n 
G 1 504 LEU 504 610 ?   ?   ?   G . n 
G 1 505 ARG 505 611 ?   ?   ?   G . n 
G 1 506 GLU 506 612 ?   ?   ?   G . n 
G 1 507 ALA 507 613 ?   ?   ?   G . n 
G 1 508 SER 508 614 ?   ?   ?   G . n 
G 1 509 LYS 509 615 ?   ?   ?   G . n 
G 1 510 SER 510 616 ?   ?   ?   G . n 
G 1 511 ARG 511 617 ?   ?   ?   G . n 
G 1 512 VAL 512 618 ?   ?   ?   G . n 
G 1 513 GLN 513 619 ?   ?   ?   G . n 
G 1 514 LEU 514 620 ?   ?   ?   G . n 
G 1 515 PHE 515 621 ?   ?   ?   G . n 
G 1 516 LYS 516 622 ?   ?   ?   G . n 
G 1 517 ASP 517 623 ?   ?   ?   G . n 
G 1 518 ASP 518 624 ?   ?   ?   G . n 
G 1 519 PRO 519 625 ?   ?   ?   G . n 
G 1 520 MET 520 626 ?   ?   ?   G . n 
H 1 1   GLY 1   107 ?   ?   ?   H . n 
H 1 2   SER 2   108 ?   ?   ?   H . n 
H 1 3   GLN 3   109 ?   ?   ?   H . n 
H 1 4   ILE 4   110 ?   ?   ?   H . n 
H 1 5   HIS 5   111 ?   ?   ?   H . n 
H 1 6   VAL 6   112 ?   ?   ?   H . n 
H 1 7   ASP 7   113 ?   ?   ?   H . n 
H 1 8   THR 8   114 114 THR THR H . n 
H 1 9   MET 9   115 115 MET MET H . n 
H 1 10  LYS 10  116 116 LYS LYS H . n 
H 1 11  VAL 11  117 117 VAL VAL H . n 
H 1 12  ILE 12  118 118 ILE ILE H . n 
H 1 13  ASN 13  119 119 ASN ASN H . n 
H 1 14  ASP 14  120 120 ASP ASP H . n 
H 1 15  PRO 15  121 121 PRO PRO H . n 
H 1 16  ILE 16  122 122 ILE ILE H . n 
H 1 17  HIS 17  123 123 HIS HIS H . n 
H 1 18  GLY 18  124 124 GLY GLY H . n 
H 1 19  HIS 19  125 125 HIS HIS H . n 
H 1 20  ILE 20  126 126 ILE ILE H . n 
H 1 21  GLU 21  127 127 GLU GLU H . n 
H 1 22  LEU 22  128 128 LEU LEU H . n 
H 1 23  HIS 23  129 129 HIS HIS H . n 
H 1 24  PRO 24  130 130 PRO PRO H . n 
H 1 25  LEU 25  131 131 LEU LEU H . n 
H 1 26  LEU 26  132 132 LEU LEU H . n 
H 1 27  VAL 27  133 133 VAL VAL H . n 
H 1 28  ARG 28  134 134 ARG ARG H . n 
H 1 29  ILE 29  135 135 ILE ILE H . n 
H 1 30  ILE 30  136 136 ILE ILE H . n 
H 1 31  ASP 31  137 137 ASP ASP H . n 
H 1 32  THR 32  138 138 THR THR H . n 
H 1 33  PRO 33  139 139 PRO PRO H . n 
H 1 34  GLN 34  140 140 GLN GLN H . n 
H 1 35  PHE 35  141 141 PHE PHE H . n 
H 1 36  GLN 36  142 142 GLN GLN H . n 
H 1 37  ARG 37  143 143 ARG ARG H . n 
H 1 38  LEU 38  144 144 LEU LEU H . n 
H 1 39  ARG 39  145 145 ARG ARG H . n 
H 1 40  TYR 40  146 146 TYR TYR H . n 
H 1 41  ILE 41  147 147 ILE ILE H . n 
H 1 42  LYS 42  148 148 LYS LYS H . n 
H 1 43  GLN 43  149 149 GLN GLN H . n 
H 1 44  LEU 44  150 150 LEU LEU H . n 
H 1 45  GLY 45  151 151 GLY GLY H . n 
H 1 46  GLY 46  152 152 GLY GLY H . n 
H 1 47  GLY 47  153 153 GLY GLY H . n 
H 1 48  TYR 48  154 154 TYR TYR H . n 
H 1 49  TYR 49  155 155 TYR TYR H . n 
H 1 50  VAL 50  156 156 VAL VAL H . n 
H 1 51  PHE 51  157 157 PHE PHE H . n 
H 1 52  PRO 52  158 158 PRO PRO H . n 
H 1 53  GLY 53  159 159 GLY GLY H . n 
H 1 54  ALA 54  160 160 ALA ALA H . n 
H 1 55  SER 55  161 161 SER SER H . n 
H 1 56  HIS 56  162 162 HIS HIS H . n 
H 1 57  ASN 57  163 163 ASN ASN H . n 
H 1 58  ARG 58  164 164 ARG ARG H . n 
H 1 59  PHE 59  165 165 PHE PHE H . n 
H 1 60  GLU 60  166 166 GLU GLU H . n 
H 1 61  HIS 61  167 167 HIS HIS H . n 
H 1 62  SER 62  168 168 SER SER H . n 
H 1 63  LEU 63  169 169 LEU LEU H . n 
H 1 64  GLY 64  170 170 GLY GLY H . n 
H 1 65  VAL 65  171 171 VAL VAL H . n 
H 1 66  GLY 66  172 172 GLY GLY H . n 
H 1 67  TYR 67  173 173 TYR TYR H . n 
H 1 68  LEU 68  174 174 LEU LEU H . n 
H 1 69  ALA 69  175 175 ALA ALA H . n 
H 1 70  GLY 70  176 176 GLY GLY H . n 
H 1 71  CYS 71  177 177 CYS CYS H . n 
H 1 72  LEU 72  178 178 LEU LEU H . n 
H 1 73  VAL 73  179 179 VAL VAL H . n 
H 1 74  HIS 74  180 180 HIS HIS H . n 
H 1 75  ALA 75  181 181 ALA ALA H . n 
H 1 76  LEU 76  182 182 LEU LEU H . n 
H 1 77  GLY 77  183 183 GLY GLY H . n 
H 1 78  GLU 78  184 184 GLU GLU H . n 
H 1 79  LYS 79  185 185 LYS LYS H . n 
H 1 80  GLN 80  186 186 GLN GLN H . n 
H 1 81  PRO 81  187 187 PRO PRO H . n 
H 1 82  GLU 82  188 188 GLU GLU H . n 
H 1 83  LEU 83  189 189 LEU LEU H . n 
H 1 84  GLN 84  190 190 GLN GLN H . n 
H 1 85  ILE 85  191 191 ILE ILE H . n 
H 1 86  SER 86  192 192 SER SER H . n 
H 1 87  GLU 87  193 193 GLU GLU H . n 
H 1 88  ARG 88  194 194 ARG ARG H . n 
H 1 89  ASP 89  195 195 ASP ASP H . n 
H 1 90  VAL 90  196 196 VAL VAL H . n 
H 1 91  LEU 91  197 197 LEU LEU H . n 
H 1 92  CYS 92  198 198 CYS CYS H . n 
H 1 93  VAL 93  199 199 VAL VAL H . n 
H 1 94  GLN 94  200 200 GLN GLN H . n 
H 1 95  ILE 95  201 201 ILE ILE H . n 
H 1 96  ALA 96  202 202 ALA ALA H . n 
H 1 97  GLY 97  203 203 GLY GLY H . n 
H 1 98  LEU 98  204 204 LEU LEU H . n 
H 1 99  CYS 99  205 205 CYS CYS H . n 
H 1 100 HIS 100 206 206 HIS HIS H . n 
H 1 101 ASP 101 207 207 ASP ASP H . n 
H 1 102 LEU 102 208 208 LEU LEU H . n 
H 1 103 GLY 103 209 209 GLY GLY H . n 
H 1 104 HIS 104 210 210 HIS HIS H . n 
H 1 105 GLY 105 211 211 GLY GLY H . n 
H 1 106 PRO 106 212 212 PRO PRO H . n 
H 1 107 PHE 107 213 213 PHE PHE H . n 
H 1 108 SER 108 214 214 SER SER H . n 
H 1 109 HIS 109 215 215 HIS HIS H . n 
H 1 110 MET 110 216 216 MET MET H . n 
H 1 111 PHE 111 217 217 PHE PHE H . n 
H 1 112 ASP 112 218 218 ASP ASP H . n 
H 1 113 GLY 113 219 219 GLY GLY H . n 
H 1 114 ARG 114 220 220 ARG ARG H . n 
H 1 115 PHE 115 221 221 PHE PHE H . n 
H 1 116 ILE 116 222 222 ILE ILE H . n 
H 1 117 PRO 117 223 223 PRO PRO H . n 
H 1 118 LEU 118 224 224 LEU LEU H . n 
H 1 119 ALA 119 225 225 ALA ALA H . n 
H 1 120 ARG 120 226 226 ARG ARG H . n 
H 1 121 PRO 121 227 227 PRO PRO H . n 
H 1 122 GLU 122 228 228 GLU GLU H . n 
H 1 123 VAL 123 229 229 VAL VAL H . n 
H 1 124 LYS 124 230 230 LYS LYS H . n 
H 1 125 TRP 125 231 231 TRP TRP H . n 
H 1 126 THR 126 232 232 THR THR H . n 
H 1 127 HIS 127 233 233 HIS HIS H . n 
H 1 128 GLU 128 234 234 GLU GLU H . n 
H 1 129 GLN 129 235 235 GLN GLN H . n 
H 1 130 GLY 130 236 236 GLY GLY H . n 
H 1 131 SER 131 237 237 SER SER H . n 
H 1 132 VAL 132 238 238 VAL VAL H . n 
H 1 133 MET 133 239 239 MET MET H . n 
H 1 134 MET 134 240 240 MET MET H . n 
H 1 135 PHE 135 241 241 PHE PHE H . n 
H 1 136 GLU 136 242 242 GLU GLU H . n 
H 1 137 HIS 137 243 243 HIS HIS H . n 
H 1 138 LEU 138 244 244 LEU LEU H . n 
H 1 139 ILE 139 245 245 ILE ILE H . n 
H 1 140 ASN 140 246 246 ASN ASN H . n 
H 1 141 SER 141 247 247 SER SER H . n 
H 1 142 ASN 142 248 248 ASN ASN H . n 
H 1 143 GLY 143 249 249 GLY GLY H . n 
H 1 144 ILE 144 250 250 ILE ILE H . n 
H 1 145 LYS 145 251 251 LYS LYS H . n 
H 1 146 PRO 146 252 252 PRO PRO H . n 
H 1 147 VAL 147 253 253 VAL VAL H . n 
H 1 148 MET 148 254 254 MET MET H . n 
H 1 149 GLU 149 255 255 GLU GLU H . n 
H 1 150 GLN 150 256 256 GLN GLN H . n 
H 1 151 TYR 151 257 257 TYR TYR H . n 
H 1 152 GLY 152 258 258 GLY GLY H . n 
H 1 153 LEU 153 259 259 LEU LEU H . n 
H 1 154 ILE 154 260 260 ILE ILE H . n 
H 1 155 PRO 155 261 261 PRO PRO H . n 
H 1 156 GLU 156 262 262 GLU GLU H . n 
H 1 157 GLU 157 263 263 GLU GLU H . n 
H 1 158 ASP 158 264 264 ASP ASP H . n 
H 1 159 ILE 159 265 265 ILE ILE H . n 
H 1 160 CYS 160 266 266 CYS CYS H . n 
H 1 161 PHE 161 267 267 PHE PHE H . n 
H 1 162 ILE 162 268 268 ILE ILE H . n 
H 1 163 LYS 163 269 269 LYS LYS H . n 
H 1 164 GLU 164 270 270 GLU GLU H . n 
H 1 165 GLN 165 271 271 GLN GLN H . n 
H 1 166 ILE 166 272 272 ILE ILE H . n 
H 1 167 VAL 167 273 273 VAL VAL H . n 
H 1 168 GLY 168 274 274 GLY GLY H . n 
H 1 169 PRO 169 275 275 PRO PRO H . n 
H 1 170 LEU 170 276 276 LEU LEU H . n 
H 1 171 GLU 171 277 277 GLU GLU H . n 
H 1 172 SER 172 278 ?   ?   ?   H . n 
H 1 173 PRO 173 279 ?   ?   ?   H . n 
H 1 174 VAL 174 280 ?   ?   ?   H . n 
H 1 175 GLU 175 281 ?   ?   ?   H . n 
H 1 176 ASP 176 282 ?   ?   ?   H . n 
H 1 177 SER 177 283 ?   ?   ?   H . n 
H 1 178 LEU 178 284 284 LEU LEU H . n 
H 1 179 TRP 179 285 285 TRP TRP H . n 
H 1 180 PRO 180 286 286 PRO PRO H . n 
H 1 181 TYR 181 287 287 TYR TYR H . n 
H 1 182 LYS 182 288 288 LYS LYS H . n 
H 1 183 GLY 183 289 289 GLY GLY H . n 
H 1 184 ARG 184 290 290 ARG ARG H . n 
H 1 185 PRO 185 291 291 PRO PRO H . n 
H 1 186 GLU 186 292 292 GLU GLU H . n 
H 1 187 ASN 187 293 293 ASN ASN H . n 
H 1 188 LYS 188 294 294 LYS LYS H . n 
H 1 189 SER 189 295 295 SER SER H . n 
H 1 190 PHE 190 296 296 PHE PHE H . n 
H 1 191 LEU 191 297 297 LEU LEU H . n 
H 1 192 TYR 192 298 298 TYR TYR H . n 
H 1 193 GLU 193 299 299 GLU GLU H . n 
H 1 194 ILE 194 300 300 ILE ILE H . n 
H 1 195 VAL 195 301 301 VAL VAL H . n 
H 1 196 SER 196 302 302 SER SER H . n 
H 1 197 ASN 197 303 303 ASN ASN H . n 
H 1 198 LYS 198 304 304 LYS LYS H . n 
H 1 199 ARG 199 305 305 ARG ARG H . n 
H 1 200 ASN 200 306 306 ASN ASN H . n 
H 1 201 GLY 201 307 307 GLY GLY H . n 
H 1 202 ILE 202 308 308 ILE ILE H . n 
H 1 203 ASP 203 309 309 ASP ASP H . n 
H 1 204 VAL 204 310 310 VAL VAL H . n 
H 1 205 ASP 205 311 311 ASP ASP H . n 
H 1 206 LYS 206 312 312 LYS LYS H . n 
H 1 207 TRP 207 313 313 TRP TRP H . n 
H 1 208 ASP 208 314 314 ASP ASP H . n 
H 1 209 TYR 209 315 315 TYR TYR H . n 
H 1 210 PHE 210 316 316 PHE PHE H . n 
H 1 211 ALA 211 317 317 ALA ALA H . n 
H 1 212 ARG 212 318 318 ARG ARG H . n 
H 1 213 ASP 213 319 319 ASP ASP H . n 
H 1 214 CYS 214 320 320 CYS CYS H . n 
H 1 215 HIS 215 321 321 HIS HIS H . n 
H 1 216 HIS 216 322 322 HIS HIS H . n 
H 1 217 LEU 217 323 323 LEU LEU H . n 
H 1 218 GLY 218 324 324 GLY GLY H . n 
H 1 219 ILE 219 325 325 ILE ILE H . n 
H 1 220 GLN 220 326 326 GLN GLN H . n 
H 1 221 ASN 221 327 327 ASN ASN H . n 
H 1 222 ASN 222 328 328 ASN ASN H . n 
H 1 223 PHE 223 329 329 PHE PHE H . n 
H 1 224 ASP 224 330 330 ASP ASP H . n 
H 1 225 TYR 225 331 331 TYR TYR H . n 
H 1 226 LYS 226 332 332 LYS LYS H . n 
H 1 227 ARG 227 333 333 ARG ARG H . n 
H 1 228 PHE 228 334 334 PHE PHE H . n 
H 1 229 ILE 229 335 335 ILE ILE H . n 
H 1 230 LYS 230 336 336 LYS LYS H . n 
H 1 231 PHE 231 337 337 PHE PHE H . n 
H 1 232 ALA 232 338 338 ALA ALA H . n 
H 1 233 ARG 233 339 339 ARG ARG H . n 
H 1 234 VAL 234 340 340 VAL VAL H . n 
H 1 235 CYS 235 341 341 CYS CYS H . n 
H 1 236 GLU 236 342 342 GLU GLU H . n 
H 1 237 VAL 237 343 343 VAL VAL H . n 
H 1 238 ASP 238 344 344 ASP ASP H . n 
H 1 239 ASN 239 345 345 ASN ASN H . n 
H 1 240 GLU 240 346 346 GLU GLU H . n 
H 1 241 LEU 241 347 347 LEU LEU H . n 
H 1 242 ARG 242 348 348 ARG ARG H . n 
H 1 243 ILE 243 349 349 ILE ILE H . n 
H 1 244 CYS 244 350 350 CYS CYS H . n 
H 1 245 ALA 245 351 351 ALA ALA H . n 
H 1 246 ARG 246 352 352 ARG ARG H . n 
H 1 247 ASP 247 353 353 ASP ASP H . n 
H 1 248 LYS 248 354 354 LYS LYS H . n 
H 1 249 GLU 249 355 355 GLU GLU H . n 
H 1 250 VAL 250 356 356 VAL VAL H . n 
H 1 251 GLY 251 357 357 GLY GLY H . n 
H 1 252 ASN 252 358 358 ASN ASN H . n 
H 1 253 LEU 253 359 359 LEU LEU H . n 
H 1 254 TYR 254 360 360 TYR TYR H . n 
H 1 255 ASP 255 361 361 ASP ASP H . n 
H 1 256 MET 256 362 362 MET MET H . n 
H 1 257 PHE 257 363 363 PHE PHE H . n 
H 1 258 HIS 258 364 364 HIS HIS H . n 
H 1 259 THR 259 365 365 THR THR H . n 
H 1 260 ARG 260 366 366 ARG ARG H . n 
H 1 261 ASN 261 367 367 ASN ASN H . n 
H 1 262 SER 262 368 368 SER SER H . n 
H 1 263 LEU 263 369 369 LEU LEU H . n 
H 1 264 HIS 264 370 370 HIS HIS H . n 
H 1 265 ARG 265 371 371 ARG ARG H . n 
H 1 266 ARG 266 372 372 ARG ARG H . n 
H 1 267 ALA 267 373 373 ALA ALA H . n 
H 1 268 TYR 268 374 374 TYR TYR H . n 
H 1 269 GLN 269 375 375 GLN GLN H . n 
H 1 270 HIS 270 376 376 HIS HIS H . n 
H 1 271 LYS 271 377 377 LYS LYS H . n 
H 1 272 VAL 272 378 378 VAL VAL H . n 
H 1 273 GLY 273 379 379 GLY GLY H . n 
H 1 274 ASN 274 380 380 ASN ASN H . n 
H 1 275 ILE 275 381 381 ILE ILE H . n 
H 1 276 ILE 276 382 382 ILE ILE H . n 
H 1 277 ASP 277 383 383 ASP ASP H . n 
H 1 278 THR 278 384 384 THR THR H . n 
H 1 279 MET 279 385 385 MET MET H . n 
H 1 280 ILE 280 386 386 ILE ILE H . n 
H 1 281 THR 281 387 387 THR THR H . n 
H 1 282 ASP 282 388 388 ASP ASP H . n 
H 1 283 ALA 283 389 389 ALA ALA H . n 
H 1 284 PHE 284 390 390 PHE PHE H . n 
H 1 285 LEU 285 391 391 LEU LEU H . n 
H 1 286 LYS 286 392 392 LYS LYS H . n 
H 1 287 ALA 287 393 393 ALA ALA H . n 
H 1 288 ASP 288 394 394 ASP ASP H . n 
H 1 289 ASP 289 395 395 ASP ASP H . n 
H 1 290 TYR 290 396 396 TYR TYR H . n 
H 1 291 ILE 291 397 397 ILE ILE H . n 
H 1 292 GLU 292 398 398 GLU GLU H . n 
H 1 293 ILE 293 399 399 ILE ILE H . n 
H 1 294 THR 294 400 400 THR THR H . n 
H 1 295 GLY 295 401 401 GLY GLY H . n 
H 1 296 ALA 296 402 402 ALA ALA H . n 
H 1 297 GLY 297 403 403 GLY GLY H . n 
H 1 298 GLY 298 404 404 GLY GLY H . n 
H 1 299 LYS 299 405 405 LYS LYS H . n 
H 1 300 LYS 300 406 406 LYS LYS H . n 
H 1 301 TYR 301 407 407 TYR TYR H . n 
H 1 302 ARG 302 408 408 ARG ARG H . n 
H 1 303 ILE 303 409 409 ILE ILE H . n 
H 1 304 SER 304 410 410 SER SER H . n 
H 1 305 THR 305 411 411 THR THR H . n 
H 1 306 ALA 306 412 412 ALA ALA H . n 
H 1 307 ILE 307 413 413 ILE ILE H . n 
H 1 308 ASP 308 414 414 ASP ASP H . n 
H 1 309 ASP 309 415 415 ASP ASP H . n 
H 1 310 MET 310 416 416 MET MET H . n 
H 1 311 GLU 311 417 417 GLU GLU H . n 
H 1 312 ALA 312 418 418 ALA ALA H . n 
H 1 313 TYR 313 419 419 TYR TYR H . n 
H 1 314 THR 314 420 420 THR THR H . n 
H 1 315 LYS 315 421 421 LYS LYS H . n 
H 1 316 LEU 316 422 422 LEU LEU H . n 
H 1 317 THR 317 423 423 THR THR H . n 
H 1 318 ASP 318 424 424 ASP ASP H . n 
H 1 319 ASN 319 425 425 ASN ASN H . n 
H 1 320 ILE 320 426 426 ILE ILE H . n 
H 1 321 PHE 321 427 427 PHE PHE H . n 
H 1 322 LEU 322 428 428 LEU LEU H . n 
H 1 323 GLU 323 429 429 GLU GLU H . n 
H 1 324 ILE 324 430 430 ILE ILE H . n 
H 1 325 LEU 325 431 431 LEU LEU H . n 
H 1 326 TYR 326 432 432 TYR TYR H . n 
H 1 327 SER 327 433 433 SER SER H . n 
H 1 328 THR 328 434 434 THR THR H . n 
H 1 329 ASP 329 435 435 ASP ASP H . n 
H 1 330 PRO 330 436 436 PRO PRO H . n 
H 1 331 LYS 331 437 437 LYS LYS H . n 
H 1 332 LEU 332 438 438 LEU LEU H . n 
H 1 333 LYS 333 439 439 LYS LYS H . n 
H 1 334 ASP 334 440 440 ASP ASP H . n 
H 1 335 ALA 335 441 441 ALA ALA H . n 
H 1 336 ARG 336 442 442 ARG ARG H . n 
H 1 337 GLU 337 443 443 GLU GLU H . n 
H 1 338 ILE 338 444 444 ILE ILE H . n 
H 1 339 LEU 339 445 445 LEU LEU H . n 
H 1 340 LYS 340 446 446 LYS LYS H . n 
H 1 341 GLN 341 447 447 GLN GLN H . n 
H 1 342 ILE 342 448 448 ILE ILE H . n 
H 1 343 GLU 343 449 449 GLU GLU H . n 
H 1 344 TYR 344 450 450 TYR TYR H . n 
H 1 345 ARG 345 451 451 ARG ARG H . n 
H 1 346 ASN 346 452 452 ASN ASN H . n 
H 1 347 LEU 347 453 453 LEU LEU H . n 
H 1 348 PHE 348 454 454 PHE PHE H . n 
H 1 349 LYS 349 455 455 LYS LYS H . n 
H 1 350 TYR 350 456 456 TYR TYR H . n 
H 1 351 VAL 351 457 457 VAL VAL H . n 
H 1 352 GLY 352 458 458 GLY GLY H . n 
H 1 353 GLU 353 459 459 GLU GLU H . n 
H 1 354 THR 354 460 460 THR THR H . n 
H 1 355 GLN 355 461 461 GLN GLN H . n 
H 1 356 PRO 356 462 462 PRO PRO H . n 
H 1 357 THR 357 463 463 THR THR H . n 
H 1 358 GLY 358 464 464 GLY GLY H . n 
H 1 359 GLN 359 465 465 GLN GLN H . n 
H 1 360 ILE 360 466 466 ILE ILE H . n 
H 1 361 LYS 361 467 467 LYS LYS H . n 
H 1 362 ILE 362 468 468 ILE ILE H . n 
H 1 363 LYS 363 469 469 LYS LYS H . n 
H 1 364 ARG 364 470 470 ARG ARG H . n 
H 1 365 GLU 365 471 471 GLU GLU H . n 
H 1 366 ASP 366 472 472 ASP ASP H . n 
H 1 367 TYR 367 473 473 TYR TYR H . n 
H 1 368 GLU 368 474 474 GLU GLU H . n 
H 1 369 SER 369 475 475 SER SER H . n 
H 1 370 LEU 370 476 476 LEU LEU H . n 
H 1 371 PRO 371 477 477 PRO PRO H . n 
H 1 372 LYS 372 478 478 LYS LYS H . n 
H 1 373 GLU 373 479 479 GLU GLU H . n 
H 1 374 VAL 374 480 480 VAL VAL H . n 
H 1 375 ALA 375 481 481 ALA ALA H . n 
H 1 376 SER 376 482 482 SER SER H . n 
H 1 377 ALA 377 483 483 ALA ALA H . n 
H 1 378 LYS 378 484 484 LYS LYS H . n 
H 1 379 PRO 379 485 485 PRO PRO H . n 
H 1 380 LYS 380 486 486 LYS LYS H . n 
H 1 381 VAL 381 487 487 VAL VAL H . n 
H 1 382 LEU 382 488 488 LEU LEU H . n 
H 1 383 LEU 383 489 489 LEU LEU H . n 
H 1 384 ASP 384 490 490 ASP ASP H . n 
H 1 385 VAL 385 491 491 VAL VAL H . n 
H 1 386 LYS 386 492 492 LYS LYS H . n 
H 1 387 LEU 387 493 493 LEU LEU H . n 
H 1 388 LYS 388 494 494 LYS LYS H . n 
H 1 389 ALA 389 495 495 ALA ALA H . n 
H 1 390 GLU 390 496 496 GLU GLU H . n 
H 1 391 ASP 391 497 497 ASP ASP H . n 
H 1 392 PHE 392 498 498 PHE PHE H . n 
H 1 393 ILE 393 499 499 ILE ILE H . n 
H 1 394 VAL 394 500 500 VAL VAL H . n 
H 1 395 ASP 395 501 501 ASP ASP H . n 
H 1 396 VAL 396 502 502 VAL VAL H . n 
H 1 397 ILE 397 503 503 ILE ILE H . n 
H 1 398 ASN 398 504 504 ASN ASN H . n 
H 1 399 MET 399 505 505 MET MET H . n 
H 1 400 ASP 400 506 506 ASP ASP H . n 
H 1 401 TYR 401 507 507 TYR TYR H . n 
H 1 402 GLY 402 508 508 GLY GLY H . n 
H 1 403 MET 403 509 509 MET MET H . n 
H 1 404 GLN 404 510 510 GLN GLN H . n 
H 1 405 GLU 405 511 511 GLU GLU H . n 
H 1 406 LYS 406 512 512 LYS LYS H . n 
H 1 407 ASN 407 513 513 ASN ASN H . n 
H 1 408 PRO 408 514 514 PRO PRO H . n 
H 1 409 ILE 409 515 515 ILE ILE H . n 
H 1 410 ASP 410 516 516 ASP ASP H . n 
H 1 411 HIS 411 517 517 HIS HIS H . n 
H 1 412 VAL 412 518 518 VAL VAL H . n 
H 1 413 SER 413 519 519 SER SER H . n 
H 1 414 PHE 414 520 520 PHE PHE H . n 
H 1 415 TYR 415 521 521 TYR TYR H . n 
H 1 416 CYS 416 522 522 CYS CYS H . n 
H 1 417 LYS 417 523 523 LYS LYS H . n 
H 1 418 THR 418 524 524 THR THR H . n 
H 1 419 ALA 419 525 525 ALA ALA H . n 
H 1 420 PRO 420 526 526 PRO PRO H . n 
H 1 421 ASN 421 527 527 ASN ASN H . n 
H 1 422 ARG 422 528 528 ARG ARG H . n 
H 1 423 ALA 423 529 529 ALA ALA H . n 
H 1 424 ILE 424 530 530 ILE ILE H . n 
H 1 425 ARG 425 531 531 ARG ARG H . n 
H 1 426 ILE 426 532 532 ILE ILE H . n 
H 1 427 THR 427 533 533 THR THR H . n 
H 1 428 LYS 428 534 534 LYS LYS H . n 
H 1 429 ASN 429 535 535 ASN ASN H . n 
H 1 430 GLN 430 536 536 GLN GLN H . n 
H 1 431 VAL 431 537 537 VAL VAL H . n 
H 1 432 SER 432 538 538 SER SER H . n 
H 1 433 GLN 433 539 539 GLN GLN H . n 
H 1 434 LEU 434 540 540 LEU LEU H . n 
H 1 435 LEU 435 541 541 LEU LEU H . n 
H 1 436 PRO 436 542 542 PRO PRO H . n 
H 1 437 GLU 437 543 543 GLU GLU H . n 
H 1 438 LYS 438 544 544 LYS LYS H . n 
H 1 439 PHE 439 545 545 PHE PHE H . n 
H 1 440 ALA 440 546 546 ALA ALA H . n 
H 1 441 GLU 441 547 547 GLU GLU H . n 
H 1 442 GLN 442 548 548 GLN GLN H . n 
H 1 443 LEU 443 549 549 LEU LEU H . n 
H 1 444 ILE 444 550 550 ILE ILE H . n 
H 1 445 ARG 445 551 551 ARG ARG H . n 
H 1 446 VAL 446 552 552 VAL VAL H . n 
H 1 447 TYR 447 553 553 TYR TYR H . n 
H 1 448 CYS 448 554 554 CYS CYS H . n 
H 1 449 LYS 449 555 555 LYS LYS H . n 
H 1 450 LYS 450 556 556 LYS LYS H . n 
H 1 451 VAL 451 557 557 VAL VAL H . n 
H 1 452 ASP 452 558 558 ASP ASP H . n 
H 1 453 ARG 453 559 559 ARG ARG H . n 
H 1 454 LYS 454 560 560 LYS LYS H . n 
H 1 455 SER 455 561 561 SER SER H . n 
H 1 456 LEU 456 562 562 LEU LEU H . n 
H 1 457 TYR 457 563 563 TYR TYR H . n 
H 1 458 ALA 458 564 564 ALA ALA H . n 
H 1 459 ALA 459 565 565 ALA ALA H . n 
H 1 460 ARG 460 566 566 ARG ARG H . n 
H 1 461 GLN 461 567 567 GLN GLN H . n 
H 1 462 TYR 462 568 568 TYR TYR H . n 
H 1 463 PHE 463 569 569 PHE PHE H . n 
H 1 464 VAL 464 570 570 VAL VAL H . n 
H 1 465 GLN 465 571 571 GLN GLN H . n 
H 1 466 TRP 466 572 572 TRP TRP H . n 
H 1 467 CYS 467 573 573 CYS CYS H . n 
H 1 468 ALA 468 574 574 ALA ALA H . n 
H 1 469 ASP 469 575 575 ASP ASP H . n 
H 1 470 ARG 470 576 576 ARG ARG H . n 
H 1 471 ASN 471 577 577 ASN ASN H . n 
H 1 472 PHE 472 578 578 PHE PHE H . n 
H 1 473 THR 473 579 579 THR THR H . n 
H 1 474 LYS 474 580 580 LYS LYS H . n 
H 1 475 PRO 475 581 581 PRO PRO H . n 
H 1 476 GLN 476 582 582 GLN GLN H . n 
H 1 477 ASP 477 583 583 ASP ASP H . n 
H 1 478 GLY 478 584 584 GLY GLY H . n 
H 1 479 ASP 479 585 585 ASP ASP H . n 
H 1 480 VAL 480 586 586 VAL VAL H . n 
H 1 481 ILE 481 587 587 ILE ILE H . n 
H 1 482 ALA 482 588 588 ALA ALA H . n 
H 1 483 PRO 483 589 589 PRO PRO H . n 
H 1 484 LEU 484 590 590 LEU LEU H . n 
H 1 485 ILE 485 591 591 ILE ILE H . n 
H 1 486 THR 486 592 592 THR THR H . n 
H 1 487 PRO 487 593 593 PRO PRO H . n 
H 1 488 GLN 488 594 594 GLN GLN H . n 
H 1 489 LYS 489 595 595 LYS LYS H . n 
H 1 490 LYS 490 596 596 LYS LYS H . n 
H 1 491 GLU 491 597 597 GLU GLU H . n 
H 1 492 TRP 492 598 598 TRP TRP H . n 
H 1 493 ASN 493 599 599 ASN ASN H . n 
H 1 494 ASP 494 600 ?   ?   ?   H . n 
H 1 495 SER 495 601 ?   ?   ?   H . n 
H 1 496 THR 496 602 ?   ?   ?   H . n 
H 1 497 SER 497 603 ?   ?   ?   H . n 
H 1 498 VAL 498 604 ?   ?   ?   H . n 
H 1 499 GLN 499 605 ?   ?   ?   H . n 
H 1 500 ASN 500 606 ?   ?   ?   H . n 
H 1 501 PRO 501 607 ?   ?   ?   H . n 
H 1 502 THR 502 608 ?   ?   ?   H . n 
H 1 503 ARG 503 609 ?   ?   ?   H . n 
H 1 504 LEU 504 610 ?   ?   ?   H . n 
H 1 505 ARG 505 611 ?   ?   ?   H . n 
H 1 506 GLU 506 612 ?   ?   ?   H . n 
H 1 507 ALA 507 613 ?   ?   ?   H . n 
H 1 508 SER 508 614 ?   ?   ?   H . n 
H 1 509 LYS 509 615 ?   ?   ?   H . n 
H 1 510 SER 510 616 ?   ?   ?   H . n 
H 1 511 ARG 511 617 ?   ?   ?   H . n 
H 1 512 VAL 512 618 ?   ?   ?   H . n 
H 1 513 GLN 513 619 ?   ?   ?   H . n 
H 1 514 LEU 514 620 ?   ?   ?   H . n 
H 1 515 PHE 515 621 ?   ?   ?   H . n 
H 1 516 LYS 516 622 ?   ?   ?   H . n 
H 1 517 ASP 517 623 ?   ?   ?   H . n 
H 1 518 ASP 518 624 ?   ?   ?   H . n 
H 1 519 PRO 519 625 ?   ?   ?   H . n 
H 1 520 MET 520 626 ?   ?   ?   H . n 
I 1 1   GLY 1   107 ?   ?   ?   I . n 
I 1 2   SER 2   108 ?   ?   ?   I . n 
I 1 3   GLN 3   109 ?   ?   ?   I . n 
I 1 4   ILE 4   110 ?   ?   ?   I . n 
I 1 5   HIS 5   111 ?   ?   ?   I . n 
I 1 6   VAL 6   112 ?   ?   ?   I . n 
I 1 7   ASP 7   113 ?   ?   ?   I . n 
I 1 8   THR 8   114 ?   ?   ?   I . n 
I 1 9   MET 9   115 115 MET MET I . n 
I 1 10  LYS 10  116 116 LYS LYS I . n 
I 1 11  VAL 11  117 117 VAL VAL I . n 
I 1 12  ILE 12  118 118 ILE ILE I . n 
I 1 13  ASN 13  119 119 ASN ASN I . n 
I 1 14  ASP 14  120 120 ASP ASP I . n 
I 1 15  PRO 15  121 121 PRO PRO I . n 
I 1 16  ILE 16  122 122 ILE ILE I . n 
I 1 17  HIS 17  123 123 HIS HIS I . n 
I 1 18  GLY 18  124 124 GLY GLY I . n 
I 1 19  HIS 19  125 125 HIS HIS I . n 
I 1 20  ILE 20  126 126 ILE ILE I . n 
I 1 21  GLU 21  127 127 GLU GLU I . n 
I 1 22  LEU 22  128 128 LEU LEU I . n 
I 1 23  HIS 23  129 129 HIS HIS I . n 
I 1 24  PRO 24  130 130 PRO PRO I . n 
I 1 25  LEU 25  131 131 LEU LEU I . n 
I 1 26  LEU 26  132 132 LEU LEU I . n 
I 1 27  VAL 27  133 133 VAL VAL I . n 
I 1 28  ARG 28  134 134 ARG ARG I . n 
I 1 29  ILE 29  135 135 ILE ILE I . n 
I 1 30  ILE 30  136 136 ILE ILE I . n 
I 1 31  ASP 31  137 137 ASP ASP I . n 
I 1 32  THR 32  138 138 THR THR I . n 
I 1 33  PRO 33  139 139 PRO PRO I . n 
I 1 34  GLN 34  140 140 GLN GLN I . n 
I 1 35  PHE 35  141 141 PHE PHE I . n 
I 1 36  GLN 36  142 142 GLN GLN I . n 
I 1 37  ARG 37  143 143 ARG ARG I . n 
I 1 38  LEU 38  144 144 LEU LEU I . n 
I 1 39  ARG 39  145 145 ARG ARG I . n 
I 1 40  TYR 40  146 146 TYR TYR I . n 
I 1 41  ILE 41  147 147 ILE ILE I . n 
I 1 42  LYS 42  148 148 LYS LYS I . n 
I 1 43  GLN 43  149 149 GLN GLN I . n 
I 1 44  LEU 44  150 150 LEU LEU I . n 
I 1 45  GLY 45  151 151 GLY GLY I . n 
I 1 46  GLY 46  152 152 GLY GLY I . n 
I 1 47  GLY 47  153 153 GLY GLY I . n 
I 1 48  TYR 48  154 154 TYR TYR I . n 
I 1 49  TYR 49  155 155 TYR TYR I . n 
I 1 50  VAL 50  156 156 VAL VAL I . n 
I 1 51  PHE 51  157 157 PHE PHE I . n 
I 1 52  PRO 52  158 158 PRO PRO I . n 
I 1 53  GLY 53  159 159 GLY GLY I . n 
I 1 54  ALA 54  160 160 ALA ALA I . n 
I 1 55  SER 55  161 161 SER SER I . n 
I 1 56  HIS 56  162 162 HIS HIS I . n 
I 1 57  ASN 57  163 163 ASN ASN I . n 
I 1 58  ARG 58  164 164 ARG ARG I . n 
I 1 59  PHE 59  165 165 PHE PHE I . n 
I 1 60  GLU 60  166 166 GLU GLU I . n 
I 1 61  HIS 61  167 167 HIS HIS I . n 
I 1 62  SER 62  168 168 SER SER I . n 
I 1 63  LEU 63  169 169 LEU LEU I . n 
I 1 64  GLY 64  170 170 GLY GLY I . n 
I 1 65  VAL 65  171 171 VAL VAL I . n 
I 1 66  GLY 66  172 172 GLY GLY I . n 
I 1 67  TYR 67  173 173 TYR TYR I . n 
I 1 68  LEU 68  174 174 LEU LEU I . n 
I 1 69  ALA 69  175 175 ALA ALA I . n 
I 1 70  GLY 70  176 176 GLY GLY I . n 
I 1 71  CYS 71  177 177 CYS CYS I . n 
I 1 72  LEU 72  178 178 LEU LEU I . n 
I 1 73  VAL 73  179 179 VAL VAL I . n 
I 1 74  HIS 74  180 180 HIS HIS I . n 
I 1 75  ALA 75  181 181 ALA ALA I . n 
I 1 76  LEU 76  182 182 LEU LEU I . n 
I 1 77  GLY 77  183 183 GLY GLY I . n 
I 1 78  GLU 78  184 184 GLU GLU I . n 
I 1 79  LYS 79  185 185 LYS LYS I . n 
I 1 80  GLN 80  186 186 GLN GLN I . n 
I 1 81  PRO 81  187 187 PRO PRO I . n 
I 1 82  GLU 82  188 188 GLU GLU I . n 
I 1 83  LEU 83  189 189 LEU LEU I . n 
I 1 84  GLN 84  190 190 GLN GLN I . n 
I 1 85  ILE 85  191 191 ILE ILE I . n 
I 1 86  SER 86  192 192 SER SER I . n 
I 1 87  GLU 87  193 193 GLU GLU I . n 
I 1 88  ARG 88  194 194 ARG ARG I . n 
I 1 89  ASP 89  195 195 ASP ASP I . n 
I 1 90  VAL 90  196 196 VAL VAL I . n 
I 1 91  LEU 91  197 197 LEU LEU I . n 
I 1 92  CYS 92  198 198 CYS CYS I . n 
I 1 93  VAL 93  199 199 VAL VAL I . n 
I 1 94  GLN 94  200 200 GLN GLN I . n 
I 1 95  ILE 95  201 201 ILE ILE I . n 
I 1 96  ALA 96  202 202 ALA ALA I . n 
I 1 97  GLY 97  203 203 GLY GLY I . n 
I 1 98  LEU 98  204 204 LEU LEU I . n 
I 1 99  CYS 99  205 205 CYS CYS I . n 
I 1 100 HIS 100 206 206 HIS HIS I . n 
I 1 101 ASP 101 207 207 ASP ASP I . n 
I 1 102 LEU 102 208 208 LEU LEU I . n 
I 1 103 GLY 103 209 209 GLY GLY I . n 
I 1 104 HIS 104 210 210 HIS HIS I . n 
I 1 105 GLY 105 211 211 GLY GLY I . n 
I 1 106 PRO 106 212 212 PRO PRO I . n 
I 1 107 PHE 107 213 213 PHE PHE I . n 
I 1 108 SER 108 214 214 SER SER I . n 
I 1 109 HIS 109 215 215 HIS HIS I . n 
I 1 110 MET 110 216 216 MET MET I . n 
I 1 111 PHE 111 217 217 PHE PHE I . n 
I 1 112 ASP 112 218 218 ASP ASP I . n 
I 1 113 GLY 113 219 219 GLY GLY I . n 
I 1 114 ARG 114 220 220 ARG ARG I . n 
I 1 115 PHE 115 221 221 PHE PHE I . n 
I 1 116 ILE 116 222 222 ILE ILE I . n 
I 1 117 PRO 117 223 223 PRO PRO I . n 
I 1 118 LEU 118 224 224 LEU LEU I . n 
I 1 119 ALA 119 225 225 ALA ALA I . n 
I 1 120 ARG 120 226 226 ARG ARG I . n 
I 1 121 PRO 121 227 227 PRO PRO I . n 
I 1 122 GLU 122 228 228 GLU GLU I . n 
I 1 123 VAL 123 229 229 VAL VAL I . n 
I 1 124 LYS 124 230 230 LYS LYS I . n 
I 1 125 TRP 125 231 231 TRP TRP I . n 
I 1 126 THR 126 232 232 THR THR I . n 
I 1 127 HIS 127 233 233 HIS HIS I . n 
I 1 128 GLU 128 234 234 GLU GLU I . n 
I 1 129 GLN 129 235 235 GLN GLN I . n 
I 1 130 GLY 130 236 236 GLY GLY I . n 
I 1 131 SER 131 237 237 SER SER I . n 
I 1 132 VAL 132 238 238 VAL VAL I . n 
I 1 133 MET 133 239 239 MET MET I . n 
I 1 134 MET 134 240 240 MET MET I . n 
I 1 135 PHE 135 241 241 PHE PHE I . n 
I 1 136 GLU 136 242 242 GLU GLU I . n 
I 1 137 HIS 137 243 243 HIS HIS I . n 
I 1 138 LEU 138 244 244 LEU LEU I . n 
I 1 139 ILE 139 245 245 ILE ILE I . n 
I 1 140 ASN 140 246 246 ASN ASN I . n 
I 1 141 SER 141 247 247 SER SER I . n 
I 1 142 ASN 142 248 248 ASN ASN I . n 
I 1 143 GLY 143 249 249 GLY GLY I . n 
I 1 144 ILE 144 250 250 ILE ILE I . n 
I 1 145 LYS 145 251 251 LYS LYS I . n 
I 1 146 PRO 146 252 252 PRO PRO I . n 
I 1 147 VAL 147 253 253 VAL VAL I . n 
I 1 148 MET 148 254 254 MET MET I . n 
I 1 149 GLU 149 255 255 GLU GLU I . n 
I 1 150 GLN 150 256 256 GLN GLN I . n 
I 1 151 TYR 151 257 257 TYR TYR I . n 
I 1 152 GLY 152 258 258 GLY GLY I . n 
I 1 153 LEU 153 259 259 LEU LEU I . n 
I 1 154 ILE 154 260 260 ILE ILE I . n 
I 1 155 PRO 155 261 261 PRO PRO I . n 
I 1 156 GLU 156 262 262 GLU GLU I . n 
I 1 157 GLU 157 263 263 GLU GLU I . n 
I 1 158 ASP 158 264 264 ASP ASP I . n 
I 1 159 ILE 159 265 265 ILE ILE I . n 
I 1 160 CYS 160 266 266 CYS CYS I . n 
I 1 161 PHE 161 267 267 PHE PHE I . n 
I 1 162 ILE 162 268 268 ILE ILE I . n 
I 1 163 LYS 163 269 269 LYS LYS I . n 
I 1 164 GLU 164 270 270 GLU GLU I . n 
I 1 165 GLN 165 271 271 GLN GLN I . n 
I 1 166 ILE 166 272 272 ILE ILE I . n 
I 1 167 VAL 167 273 273 VAL VAL I . n 
I 1 168 GLY 168 274 274 GLY GLY I . n 
I 1 169 PRO 169 275 275 PRO PRO I . n 
I 1 170 LEU 170 276 276 LEU LEU I . n 
I 1 171 GLU 171 277 ?   ?   ?   I . n 
I 1 172 SER 172 278 ?   ?   ?   I . n 
I 1 173 PRO 173 279 ?   ?   ?   I . n 
I 1 174 VAL 174 280 ?   ?   ?   I . n 
I 1 175 GLU 175 281 ?   ?   ?   I . n 
I 1 176 ASP 176 282 ?   ?   ?   I . n 
I 1 177 SER 177 283 ?   ?   ?   I . n 
I 1 178 LEU 178 284 ?   ?   ?   I . n 
I 1 179 TRP 179 285 285 TRP TRP I . n 
I 1 180 PRO 180 286 286 PRO PRO I . n 
I 1 181 TYR 181 287 287 TYR TYR I . n 
I 1 182 LYS 182 288 288 LYS LYS I . n 
I 1 183 GLY 183 289 289 GLY GLY I . n 
I 1 184 ARG 184 290 290 ARG ARG I . n 
I 1 185 PRO 185 291 291 PRO PRO I . n 
I 1 186 GLU 186 292 292 GLU GLU I . n 
I 1 187 ASN 187 293 293 ASN ASN I . n 
I 1 188 LYS 188 294 294 LYS LYS I . n 
I 1 189 SER 189 295 295 SER SER I . n 
I 1 190 PHE 190 296 296 PHE PHE I . n 
I 1 191 LEU 191 297 297 LEU LEU I . n 
I 1 192 TYR 192 298 298 TYR TYR I . n 
I 1 193 GLU 193 299 299 GLU GLU I . n 
I 1 194 ILE 194 300 300 ILE ILE I . n 
I 1 195 VAL 195 301 301 VAL VAL I . n 
I 1 196 SER 196 302 302 SER SER I . n 
I 1 197 ASN 197 303 303 ASN ASN I . n 
I 1 198 LYS 198 304 304 LYS LYS I . n 
I 1 199 ARG 199 305 305 ARG ARG I . n 
I 1 200 ASN 200 306 306 ASN ASN I . n 
I 1 201 GLY 201 307 307 GLY GLY I . n 
I 1 202 ILE 202 308 308 ILE ILE I . n 
I 1 203 ASP 203 309 309 ASP ASP I . n 
I 1 204 VAL 204 310 310 VAL VAL I . n 
I 1 205 ASP 205 311 311 ASP ASP I . n 
I 1 206 LYS 206 312 312 LYS LYS I . n 
I 1 207 TRP 207 313 313 TRP TRP I . n 
I 1 208 ASP 208 314 314 ASP ASP I . n 
I 1 209 TYR 209 315 315 TYR TYR I . n 
I 1 210 PHE 210 316 316 PHE PHE I . n 
I 1 211 ALA 211 317 317 ALA ALA I . n 
I 1 212 ARG 212 318 318 ARG ARG I . n 
I 1 213 ASP 213 319 319 ASP ASP I . n 
I 1 214 CYS 214 320 320 CYS CYS I . n 
I 1 215 HIS 215 321 321 HIS HIS I . n 
I 1 216 HIS 216 322 322 HIS HIS I . n 
I 1 217 LEU 217 323 323 LEU LEU I . n 
I 1 218 GLY 218 324 324 GLY GLY I . n 
I 1 219 ILE 219 325 325 ILE ILE I . n 
I 1 220 GLN 220 326 326 GLN GLN I . n 
I 1 221 ASN 221 327 327 ASN ASN I . n 
I 1 222 ASN 222 328 328 ASN ASN I . n 
I 1 223 PHE 223 329 329 PHE PHE I . n 
I 1 224 ASP 224 330 330 ASP ASP I . n 
I 1 225 TYR 225 331 331 TYR TYR I . n 
I 1 226 LYS 226 332 332 LYS LYS I . n 
I 1 227 ARG 227 333 333 ARG ARG I . n 
I 1 228 PHE 228 334 334 PHE PHE I . n 
I 1 229 ILE 229 335 335 ILE ILE I . n 
I 1 230 LYS 230 336 336 LYS LYS I . n 
I 1 231 PHE 231 337 337 PHE PHE I . n 
I 1 232 ALA 232 338 338 ALA ALA I . n 
I 1 233 ARG 233 339 339 ARG ARG I . n 
I 1 234 VAL 234 340 340 VAL VAL I . n 
I 1 235 CYS 235 341 341 CYS CYS I . n 
I 1 236 GLU 236 342 342 GLU GLU I . n 
I 1 237 VAL 237 343 343 VAL VAL I . n 
I 1 238 ASP 238 344 344 ASP ASP I . n 
I 1 239 ASN 239 345 345 ASN ASN I . n 
I 1 240 GLU 240 346 346 GLU GLU I . n 
I 1 241 LEU 241 347 347 LEU LEU I . n 
I 1 242 ARG 242 348 348 ARG ARG I . n 
I 1 243 ILE 243 349 349 ILE ILE I . n 
I 1 244 CYS 244 350 350 CYS CYS I . n 
I 1 245 ALA 245 351 351 ALA ALA I . n 
I 1 246 ARG 246 352 352 ARG ARG I . n 
I 1 247 ASP 247 353 353 ASP ASP I . n 
I 1 248 LYS 248 354 354 LYS LYS I . n 
I 1 249 GLU 249 355 355 GLU GLU I . n 
I 1 250 VAL 250 356 356 VAL VAL I . n 
I 1 251 GLY 251 357 357 GLY GLY I . n 
I 1 252 ASN 252 358 358 ASN ASN I . n 
I 1 253 LEU 253 359 359 LEU LEU I . n 
I 1 254 TYR 254 360 360 TYR TYR I . n 
I 1 255 ASP 255 361 361 ASP ASP I . n 
I 1 256 MET 256 362 362 MET MET I . n 
I 1 257 PHE 257 363 363 PHE PHE I . n 
I 1 258 HIS 258 364 364 HIS HIS I . n 
I 1 259 THR 259 365 365 THR THR I . n 
I 1 260 ARG 260 366 366 ARG ARG I . n 
I 1 261 ASN 261 367 367 ASN ASN I . n 
I 1 262 SER 262 368 368 SER SER I . n 
I 1 263 LEU 263 369 369 LEU LEU I . n 
I 1 264 HIS 264 370 370 HIS HIS I . n 
I 1 265 ARG 265 371 371 ARG ARG I . n 
I 1 266 ARG 266 372 372 ARG ARG I . n 
I 1 267 ALA 267 373 373 ALA ALA I . n 
I 1 268 TYR 268 374 374 TYR TYR I . n 
I 1 269 GLN 269 375 375 GLN GLN I . n 
I 1 270 HIS 270 376 376 HIS HIS I . n 
I 1 271 LYS 271 377 377 LYS LYS I . n 
I 1 272 VAL 272 378 378 VAL VAL I . n 
I 1 273 GLY 273 379 379 GLY GLY I . n 
I 1 274 ASN 274 380 380 ASN ASN I . n 
I 1 275 ILE 275 381 381 ILE ILE I . n 
I 1 276 ILE 276 382 382 ILE ILE I . n 
I 1 277 ASP 277 383 383 ASP ASP I . n 
I 1 278 THR 278 384 384 THR THR I . n 
I 1 279 MET 279 385 385 MET MET I . n 
I 1 280 ILE 280 386 386 ILE ILE I . n 
I 1 281 THR 281 387 387 THR THR I . n 
I 1 282 ASP 282 388 388 ASP ASP I . n 
I 1 283 ALA 283 389 389 ALA ALA I . n 
I 1 284 PHE 284 390 390 PHE PHE I . n 
I 1 285 LEU 285 391 391 LEU LEU I . n 
I 1 286 LYS 286 392 392 LYS LYS I . n 
I 1 287 ALA 287 393 393 ALA ALA I . n 
I 1 288 ASP 288 394 394 ASP ASP I . n 
I 1 289 ASP 289 395 395 ASP ASP I . n 
I 1 290 TYR 290 396 396 TYR TYR I . n 
I 1 291 ILE 291 397 397 ILE ILE I . n 
I 1 292 GLU 292 398 398 GLU GLU I . n 
I 1 293 ILE 293 399 399 ILE ILE I . n 
I 1 294 THR 294 400 400 THR THR I . n 
I 1 295 GLY 295 401 401 GLY GLY I . n 
I 1 296 ALA 296 402 402 ALA ALA I . n 
I 1 297 GLY 297 403 403 GLY GLY I . n 
I 1 298 GLY 298 404 404 GLY GLY I . n 
I 1 299 LYS 299 405 405 LYS LYS I . n 
I 1 300 LYS 300 406 406 LYS LYS I . n 
I 1 301 TYR 301 407 407 TYR TYR I . n 
I 1 302 ARG 302 408 408 ARG ARG I . n 
I 1 303 ILE 303 409 409 ILE ILE I . n 
I 1 304 SER 304 410 410 SER SER I . n 
I 1 305 THR 305 411 411 THR THR I . n 
I 1 306 ALA 306 412 412 ALA ALA I . n 
I 1 307 ILE 307 413 413 ILE ILE I . n 
I 1 308 ASP 308 414 414 ASP ASP I . n 
I 1 309 ASP 309 415 415 ASP ASP I . n 
I 1 310 MET 310 416 416 MET MET I . n 
I 1 311 GLU 311 417 417 GLU GLU I . n 
I 1 312 ALA 312 418 418 ALA ALA I . n 
I 1 313 TYR 313 419 419 TYR TYR I . n 
I 1 314 THR 314 420 420 THR THR I . n 
I 1 315 LYS 315 421 421 LYS LYS I . n 
I 1 316 LEU 316 422 422 LEU LEU I . n 
I 1 317 THR 317 423 423 THR THR I . n 
I 1 318 ASP 318 424 424 ASP ASP I . n 
I 1 319 ASN 319 425 425 ASN ASN I . n 
I 1 320 ILE 320 426 426 ILE ILE I . n 
I 1 321 PHE 321 427 427 PHE PHE I . n 
I 1 322 LEU 322 428 428 LEU LEU I . n 
I 1 323 GLU 323 429 429 GLU GLU I . n 
I 1 324 ILE 324 430 430 ILE ILE I . n 
I 1 325 LEU 325 431 431 LEU LEU I . n 
I 1 326 TYR 326 432 432 TYR TYR I . n 
I 1 327 SER 327 433 433 SER SER I . n 
I 1 328 THR 328 434 434 THR THR I . n 
I 1 329 ASP 329 435 435 ASP ASP I . n 
I 1 330 PRO 330 436 436 PRO PRO I . n 
I 1 331 LYS 331 437 437 LYS LYS I . n 
I 1 332 LEU 332 438 438 LEU LEU I . n 
I 1 333 LYS 333 439 439 LYS LYS I . n 
I 1 334 ASP 334 440 440 ASP ASP I . n 
I 1 335 ALA 335 441 441 ALA ALA I . n 
I 1 336 ARG 336 442 442 ARG ARG I . n 
I 1 337 GLU 337 443 443 GLU GLU I . n 
I 1 338 ILE 338 444 444 ILE ILE I . n 
I 1 339 LEU 339 445 445 LEU LEU I . n 
I 1 340 LYS 340 446 446 LYS LYS I . n 
I 1 341 GLN 341 447 447 GLN GLN I . n 
I 1 342 ILE 342 448 448 ILE ILE I . n 
I 1 343 GLU 343 449 449 GLU GLU I . n 
I 1 344 TYR 344 450 450 TYR TYR I . n 
I 1 345 ARG 345 451 451 ARG ARG I . n 
I 1 346 ASN 346 452 452 ASN ASN I . n 
I 1 347 LEU 347 453 453 LEU LEU I . n 
I 1 348 PHE 348 454 454 PHE PHE I . n 
I 1 349 LYS 349 455 455 LYS LYS I . n 
I 1 350 TYR 350 456 456 TYR TYR I . n 
I 1 351 VAL 351 457 457 VAL VAL I . n 
I 1 352 GLY 352 458 458 GLY GLY I . n 
I 1 353 GLU 353 459 459 GLU GLU I . n 
I 1 354 THR 354 460 460 THR THR I . n 
I 1 355 GLN 355 461 461 GLN GLN I . n 
I 1 356 PRO 356 462 462 PRO PRO I . n 
I 1 357 THR 357 463 463 THR THR I . n 
I 1 358 GLY 358 464 464 GLY GLY I . n 
I 1 359 GLN 359 465 465 GLN GLN I . n 
I 1 360 ILE 360 466 466 ILE ILE I . n 
I 1 361 LYS 361 467 467 LYS LYS I . n 
I 1 362 ILE 362 468 468 ILE ILE I . n 
I 1 363 LYS 363 469 469 LYS LYS I . n 
I 1 364 ARG 364 470 470 ARG ARG I . n 
I 1 365 GLU 365 471 471 GLU GLU I . n 
I 1 366 ASP 366 472 472 ASP ASP I . n 
I 1 367 TYR 367 473 473 TYR TYR I . n 
I 1 368 GLU 368 474 474 GLU GLU I . n 
I 1 369 SER 369 475 475 SER SER I . n 
I 1 370 LEU 370 476 476 LEU LEU I . n 
I 1 371 PRO 371 477 477 PRO PRO I . n 
I 1 372 LYS 372 478 478 LYS LYS I . n 
I 1 373 GLU 373 479 479 GLU GLU I . n 
I 1 374 VAL 374 480 480 VAL VAL I . n 
I 1 375 ALA 375 481 481 ALA ALA I . n 
I 1 376 SER 376 482 482 SER SER I . n 
I 1 377 ALA 377 483 483 ALA ALA I . n 
I 1 378 LYS 378 484 484 LYS LYS I . n 
I 1 379 PRO 379 485 485 PRO PRO I . n 
I 1 380 LYS 380 486 486 LYS LYS I . n 
I 1 381 VAL 381 487 487 VAL VAL I . n 
I 1 382 LEU 382 488 488 LEU LEU I . n 
I 1 383 LEU 383 489 489 LEU LEU I . n 
I 1 384 ASP 384 490 490 ASP ASP I . n 
I 1 385 VAL 385 491 491 VAL VAL I . n 
I 1 386 LYS 386 492 492 LYS LYS I . n 
I 1 387 LEU 387 493 493 LEU LEU I . n 
I 1 388 LYS 388 494 494 LYS LYS I . n 
I 1 389 ALA 389 495 495 ALA ALA I . n 
I 1 390 GLU 390 496 496 GLU GLU I . n 
I 1 391 ASP 391 497 497 ASP ASP I . n 
I 1 392 PHE 392 498 498 PHE PHE I . n 
I 1 393 ILE 393 499 499 ILE ILE I . n 
I 1 394 VAL 394 500 500 VAL VAL I . n 
I 1 395 ASP 395 501 501 ASP ASP I . n 
I 1 396 VAL 396 502 502 VAL VAL I . n 
I 1 397 ILE 397 503 503 ILE ILE I . n 
I 1 398 ASN 398 504 504 ASN ASN I . n 
I 1 399 MET 399 505 505 MET MET I . n 
I 1 400 ASP 400 506 506 ASP ASP I . n 
I 1 401 TYR 401 507 507 TYR TYR I . n 
I 1 402 GLY 402 508 508 GLY GLY I . n 
I 1 403 MET 403 509 509 MET MET I . n 
I 1 404 GLN 404 510 510 GLN GLN I . n 
I 1 405 GLU 405 511 511 GLU GLU I . n 
I 1 406 LYS 406 512 512 LYS LYS I . n 
I 1 407 ASN 407 513 513 ASN ASN I . n 
I 1 408 PRO 408 514 514 PRO PRO I . n 
I 1 409 ILE 409 515 515 ILE ILE I . n 
I 1 410 ASP 410 516 516 ASP ASP I . n 
I 1 411 HIS 411 517 517 HIS HIS I . n 
I 1 412 VAL 412 518 518 VAL VAL I . n 
I 1 413 SER 413 519 519 SER SER I . n 
I 1 414 PHE 414 520 520 PHE PHE I . n 
I 1 415 TYR 415 521 521 TYR TYR I . n 
I 1 416 CYS 416 522 522 CYS CYS I . n 
I 1 417 LYS 417 523 523 LYS LYS I . n 
I 1 418 THR 418 524 524 THR THR I . n 
I 1 419 ALA 419 525 525 ALA ALA I . n 
I 1 420 PRO 420 526 526 PRO PRO I . n 
I 1 421 ASN 421 527 527 ASN ASN I . n 
I 1 422 ARG 422 528 528 ARG ARG I . n 
I 1 423 ALA 423 529 529 ALA ALA I . n 
I 1 424 ILE 424 530 530 ILE ILE I . n 
I 1 425 ARG 425 531 531 ARG ARG I . n 
I 1 426 ILE 426 532 532 ILE ILE I . n 
I 1 427 THR 427 533 533 THR THR I . n 
I 1 428 LYS 428 534 534 LYS LYS I . n 
I 1 429 ASN 429 535 535 ASN ASN I . n 
I 1 430 GLN 430 536 536 GLN GLN I . n 
I 1 431 VAL 431 537 537 VAL VAL I . n 
I 1 432 SER 432 538 538 SER SER I . n 
I 1 433 GLN 433 539 539 GLN GLN I . n 
I 1 434 LEU 434 540 540 LEU LEU I . n 
I 1 435 LEU 435 541 541 LEU LEU I . n 
I 1 436 PRO 436 542 542 PRO PRO I . n 
I 1 437 GLU 437 543 543 GLU GLU I . n 
I 1 438 LYS 438 544 544 LYS LYS I . n 
I 1 439 PHE 439 545 545 PHE PHE I . n 
I 1 440 ALA 440 546 546 ALA ALA I . n 
I 1 441 GLU 441 547 547 GLU GLU I . n 
I 1 442 GLN 442 548 548 GLN GLN I . n 
I 1 443 LEU 443 549 549 LEU LEU I . n 
I 1 444 ILE 444 550 550 ILE ILE I . n 
I 1 445 ARG 445 551 551 ARG ARG I . n 
I 1 446 VAL 446 552 552 VAL VAL I . n 
I 1 447 TYR 447 553 553 TYR TYR I . n 
I 1 448 CYS 448 554 554 CYS CYS I . n 
I 1 449 LYS 449 555 555 LYS LYS I . n 
I 1 450 LYS 450 556 556 LYS LYS I . n 
I 1 451 VAL 451 557 557 VAL VAL I . n 
I 1 452 ASP 452 558 558 ASP ASP I . n 
I 1 453 ARG 453 559 559 ARG ARG I . n 
I 1 454 LYS 454 560 560 LYS LYS I . n 
I 1 455 SER 455 561 561 SER SER I . n 
I 1 456 LEU 456 562 562 LEU LEU I . n 
I 1 457 TYR 457 563 563 TYR TYR I . n 
I 1 458 ALA 458 564 564 ALA ALA I . n 
I 1 459 ALA 459 565 565 ALA ALA I . n 
I 1 460 ARG 460 566 566 ARG ARG I . n 
I 1 461 GLN 461 567 567 GLN GLN I . n 
I 1 462 TYR 462 568 568 TYR TYR I . n 
I 1 463 PHE 463 569 569 PHE PHE I . n 
I 1 464 VAL 464 570 570 VAL VAL I . n 
I 1 465 GLN 465 571 571 GLN GLN I . n 
I 1 466 TRP 466 572 572 TRP TRP I . n 
I 1 467 CYS 467 573 573 CYS CYS I . n 
I 1 468 ALA 468 574 574 ALA ALA I . n 
I 1 469 ASP 469 575 575 ASP ASP I . n 
I 1 470 ARG 470 576 576 ARG ARG I . n 
I 1 471 ASN 471 577 577 ASN ASN I . n 
I 1 472 PHE 472 578 578 PHE PHE I . n 
I 1 473 THR 473 579 579 THR THR I . n 
I 1 474 LYS 474 580 580 LYS LYS I . n 
I 1 475 PRO 475 581 581 PRO PRO I . n 
I 1 476 GLN 476 582 582 GLN GLN I . n 
I 1 477 ASP 477 583 583 ASP ASP I . n 
I 1 478 GLY 478 584 584 GLY GLY I . n 
I 1 479 ASP 479 585 585 ASP ASP I . n 
I 1 480 VAL 480 586 586 VAL VAL I . n 
I 1 481 ILE 481 587 587 ILE ILE I . n 
I 1 482 ALA 482 588 588 ALA ALA I . n 
I 1 483 PRO 483 589 589 PRO PRO I . n 
I 1 484 LEU 484 590 590 LEU LEU I . n 
I 1 485 ILE 485 591 591 ILE ILE I . n 
I 1 486 THR 486 592 592 THR THR I . n 
I 1 487 PRO 487 593 593 PRO PRO I . n 
I 1 488 GLN 488 594 594 GLN GLN I . n 
I 1 489 LYS 489 595 595 LYS LYS I . n 
I 1 490 LYS 490 596 596 LYS LYS I . n 
I 1 491 GLU 491 597 597 GLU GLU I . n 
I 1 492 TRP 492 598 598 TRP TRP I . n 
I 1 493 ASN 493 599 599 ASN ASN I . n 
I 1 494 ASP 494 600 ?   ?   ?   I . n 
I 1 495 SER 495 601 ?   ?   ?   I . n 
I 1 496 THR 496 602 ?   ?   ?   I . n 
I 1 497 SER 497 603 ?   ?   ?   I . n 
I 1 498 VAL 498 604 ?   ?   ?   I . n 
I 1 499 GLN 499 605 ?   ?   ?   I . n 
I 1 500 ASN 500 606 ?   ?   ?   I . n 
I 1 501 PRO 501 607 ?   ?   ?   I . n 
I 1 502 THR 502 608 ?   ?   ?   I . n 
I 1 503 ARG 503 609 ?   ?   ?   I . n 
I 1 504 LEU 504 610 ?   ?   ?   I . n 
I 1 505 ARG 505 611 ?   ?   ?   I . n 
I 1 506 GLU 506 612 ?   ?   ?   I . n 
I 1 507 ALA 507 613 ?   ?   ?   I . n 
I 1 508 SER 508 614 ?   ?   ?   I . n 
I 1 509 LYS 509 615 ?   ?   ?   I . n 
I 1 510 SER 510 616 ?   ?   ?   I . n 
I 1 511 ARG 511 617 ?   ?   ?   I . n 
I 1 512 VAL 512 618 ?   ?   ?   I . n 
I 1 513 GLN 513 619 ?   ?   ?   I . n 
I 1 514 LEU 514 620 ?   ?   ?   I . n 
I 1 515 PHE 515 621 ?   ?   ?   I . n 
I 1 516 LYS 516 622 ?   ?   ?   I . n 
I 1 517 ASP 517 623 ?   ?   ?   I . n 
I 1 518 ASP 518 624 ?   ?   ?   I . n 
I 1 519 PRO 519 625 ?   ?   ?   I . n 
I 1 520 MET 520 626 ?   ?   ?   I . n 
J 1 1   GLY 1   107 ?   ?   ?   J . n 
J 1 2   SER 2   108 ?   ?   ?   J . n 
J 1 3   GLN 3   109 ?   ?   ?   J . n 
J 1 4   ILE 4   110 ?   ?   ?   J . n 
J 1 5   HIS 5   111 ?   ?   ?   J . n 
J 1 6   VAL 6   112 ?   ?   ?   J . n 
J 1 7   ASP 7   113 ?   ?   ?   J . n 
J 1 8   THR 8   114 ?   ?   ?   J . n 
J 1 9   MET 9   115 115 MET MET J . n 
J 1 10  LYS 10  116 116 LYS LYS J . n 
J 1 11  VAL 11  117 117 VAL VAL J . n 
J 1 12  ILE 12  118 118 ILE ILE J . n 
J 1 13  ASN 13  119 119 ASN ASN J . n 
J 1 14  ASP 14  120 120 ASP ASP J . n 
J 1 15  PRO 15  121 121 PRO PRO J . n 
J 1 16  ILE 16  122 122 ILE ILE J . n 
J 1 17  HIS 17  123 123 HIS HIS J . n 
J 1 18  GLY 18  124 124 GLY GLY J . n 
J 1 19  HIS 19  125 125 HIS HIS J . n 
J 1 20  ILE 20  126 126 ILE ILE J . n 
J 1 21  GLU 21  127 127 GLU GLU J . n 
J 1 22  LEU 22  128 128 LEU LEU J . n 
J 1 23  HIS 23  129 129 HIS HIS J . n 
J 1 24  PRO 24  130 130 PRO PRO J . n 
J 1 25  LEU 25  131 131 LEU LEU J . n 
J 1 26  LEU 26  132 132 LEU LEU J . n 
J 1 27  VAL 27  133 133 VAL VAL J . n 
J 1 28  ARG 28  134 134 ARG ARG J . n 
J 1 29  ILE 29  135 135 ILE ILE J . n 
J 1 30  ILE 30  136 136 ILE ILE J . n 
J 1 31  ASP 31  137 137 ASP ASP J . n 
J 1 32  THR 32  138 138 THR THR J . n 
J 1 33  PRO 33  139 139 PRO PRO J . n 
J 1 34  GLN 34  140 140 GLN GLN J . n 
J 1 35  PHE 35  141 141 PHE PHE J . n 
J 1 36  GLN 36  142 142 GLN GLN J . n 
J 1 37  ARG 37  143 143 ARG ARG J . n 
J 1 38  LEU 38  144 144 LEU LEU J . n 
J 1 39  ARG 39  145 145 ARG ARG J . n 
J 1 40  TYR 40  146 146 TYR TYR J . n 
J 1 41  ILE 41  147 147 ILE ILE J . n 
J 1 42  LYS 42  148 148 LYS LYS J . n 
J 1 43  GLN 43  149 149 GLN GLN J . n 
J 1 44  LEU 44  150 150 LEU LEU J . n 
J 1 45  GLY 45  151 151 GLY GLY J . n 
J 1 46  GLY 46  152 152 GLY GLY J . n 
J 1 47  GLY 47  153 153 GLY GLY J . n 
J 1 48  TYR 48  154 154 TYR TYR J . n 
J 1 49  TYR 49  155 155 TYR TYR J . n 
J 1 50  VAL 50  156 156 VAL VAL J . n 
J 1 51  PHE 51  157 157 PHE PHE J . n 
J 1 52  PRO 52  158 158 PRO PRO J . n 
J 1 53  GLY 53  159 159 GLY GLY J . n 
J 1 54  ALA 54  160 160 ALA ALA J . n 
J 1 55  SER 55  161 161 SER SER J . n 
J 1 56  HIS 56  162 162 HIS HIS J . n 
J 1 57  ASN 57  163 163 ASN ASN J . n 
J 1 58  ARG 58  164 164 ARG ARG J . n 
J 1 59  PHE 59  165 165 PHE PHE J . n 
J 1 60  GLU 60  166 166 GLU GLU J . n 
J 1 61  HIS 61  167 167 HIS HIS J . n 
J 1 62  SER 62  168 168 SER SER J . n 
J 1 63  LEU 63  169 169 LEU LEU J . n 
J 1 64  GLY 64  170 170 GLY GLY J . n 
J 1 65  VAL 65  171 171 VAL VAL J . n 
J 1 66  GLY 66  172 172 GLY GLY J . n 
J 1 67  TYR 67  173 173 TYR TYR J . n 
J 1 68  LEU 68  174 174 LEU LEU J . n 
J 1 69  ALA 69  175 175 ALA ALA J . n 
J 1 70  GLY 70  176 176 GLY GLY J . n 
J 1 71  CYS 71  177 177 CYS CYS J . n 
J 1 72  LEU 72  178 178 LEU LEU J . n 
J 1 73  VAL 73  179 179 VAL VAL J . n 
J 1 74  HIS 74  180 180 HIS HIS J . n 
J 1 75  ALA 75  181 181 ALA ALA J . n 
J 1 76  LEU 76  182 182 LEU LEU J . n 
J 1 77  GLY 77  183 183 GLY GLY J . n 
J 1 78  GLU 78  184 184 GLU GLU J . n 
J 1 79  LYS 79  185 185 LYS LYS J . n 
J 1 80  GLN 80  186 186 GLN GLN J . n 
J 1 81  PRO 81  187 187 PRO PRO J . n 
J 1 82  GLU 82  188 188 GLU GLU J . n 
J 1 83  LEU 83  189 189 LEU LEU J . n 
J 1 84  GLN 84  190 190 GLN GLN J . n 
J 1 85  ILE 85  191 191 ILE ILE J . n 
J 1 86  SER 86  192 192 SER SER J . n 
J 1 87  GLU 87  193 193 GLU GLU J . n 
J 1 88  ARG 88  194 194 ARG ARG J . n 
J 1 89  ASP 89  195 195 ASP ASP J . n 
J 1 90  VAL 90  196 196 VAL VAL J . n 
J 1 91  LEU 91  197 197 LEU LEU J . n 
J 1 92  CYS 92  198 198 CYS CYS J . n 
J 1 93  VAL 93  199 199 VAL VAL J . n 
J 1 94  GLN 94  200 200 GLN GLN J . n 
J 1 95  ILE 95  201 201 ILE ILE J . n 
J 1 96  ALA 96  202 202 ALA ALA J . n 
J 1 97  GLY 97  203 203 GLY GLY J . n 
J 1 98  LEU 98  204 204 LEU LEU J . n 
J 1 99  CYS 99  205 205 CYS CYS J . n 
J 1 100 HIS 100 206 206 HIS HIS J . n 
J 1 101 ASP 101 207 207 ASP ASP J . n 
J 1 102 LEU 102 208 208 LEU LEU J . n 
J 1 103 GLY 103 209 209 GLY GLY J . n 
J 1 104 HIS 104 210 210 HIS HIS J . n 
J 1 105 GLY 105 211 211 GLY GLY J . n 
J 1 106 PRO 106 212 212 PRO PRO J . n 
J 1 107 PHE 107 213 213 PHE PHE J . n 
J 1 108 SER 108 214 214 SER SER J . n 
J 1 109 HIS 109 215 215 HIS HIS J . n 
J 1 110 MET 110 216 216 MET MET J . n 
J 1 111 PHE 111 217 217 PHE PHE J . n 
J 1 112 ASP 112 218 218 ASP ASP J . n 
J 1 113 GLY 113 219 219 GLY GLY J . n 
J 1 114 ARG 114 220 220 ARG ARG J . n 
J 1 115 PHE 115 221 221 PHE PHE J . n 
J 1 116 ILE 116 222 222 ILE ILE J . n 
J 1 117 PRO 117 223 223 PRO PRO J . n 
J 1 118 LEU 118 224 224 LEU LEU J . n 
J 1 119 ALA 119 225 225 ALA ALA J . n 
J 1 120 ARG 120 226 226 ARG ARG J . n 
J 1 121 PRO 121 227 227 PRO PRO J . n 
J 1 122 GLU 122 228 228 GLU GLU J . n 
J 1 123 VAL 123 229 229 VAL VAL J . n 
J 1 124 LYS 124 230 230 LYS LYS J . n 
J 1 125 TRP 125 231 231 TRP TRP J . n 
J 1 126 THR 126 232 232 THR THR J . n 
J 1 127 HIS 127 233 233 HIS HIS J . n 
J 1 128 GLU 128 234 234 GLU GLU J . n 
J 1 129 GLN 129 235 235 GLN GLN J . n 
J 1 130 GLY 130 236 236 GLY GLY J . n 
J 1 131 SER 131 237 237 SER SER J . n 
J 1 132 VAL 132 238 238 VAL VAL J . n 
J 1 133 MET 133 239 239 MET MET J . n 
J 1 134 MET 134 240 240 MET MET J . n 
J 1 135 PHE 135 241 241 PHE PHE J . n 
J 1 136 GLU 136 242 242 GLU GLU J . n 
J 1 137 HIS 137 243 243 HIS HIS J . n 
J 1 138 LEU 138 244 244 LEU LEU J . n 
J 1 139 ILE 139 245 245 ILE ILE J . n 
J 1 140 ASN 140 246 246 ASN ASN J . n 
J 1 141 SER 141 247 247 SER SER J . n 
J 1 142 ASN 142 248 248 ASN ASN J . n 
J 1 143 GLY 143 249 249 GLY GLY J . n 
J 1 144 ILE 144 250 250 ILE ILE J . n 
J 1 145 LYS 145 251 251 LYS LYS J . n 
J 1 146 PRO 146 252 252 PRO PRO J . n 
J 1 147 VAL 147 253 253 VAL VAL J . n 
J 1 148 MET 148 254 254 MET MET J . n 
J 1 149 GLU 149 255 255 GLU GLU J . n 
J 1 150 GLN 150 256 256 GLN GLN J . n 
J 1 151 TYR 151 257 257 TYR TYR J . n 
J 1 152 GLY 152 258 258 GLY GLY J . n 
J 1 153 LEU 153 259 259 LEU LEU J . n 
J 1 154 ILE 154 260 260 ILE ILE J . n 
J 1 155 PRO 155 261 261 PRO PRO J . n 
J 1 156 GLU 156 262 262 GLU GLU J . n 
J 1 157 GLU 157 263 263 GLU GLU J . n 
J 1 158 ASP 158 264 264 ASP ASP J . n 
J 1 159 ILE 159 265 265 ILE ILE J . n 
J 1 160 CYS 160 266 266 CYS CYS J . n 
J 1 161 PHE 161 267 267 PHE PHE J . n 
J 1 162 ILE 162 268 268 ILE ILE J . n 
J 1 163 LYS 163 269 269 LYS LYS J . n 
J 1 164 GLU 164 270 270 GLU GLU J . n 
J 1 165 GLN 165 271 271 GLN GLN J . n 
J 1 166 ILE 166 272 272 ILE ILE J . n 
J 1 167 VAL 167 273 273 VAL VAL J . n 
J 1 168 GLY 168 274 274 GLY GLY J . n 
J 1 169 PRO 169 275 275 PRO PRO J . n 
J 1 170 LEU 170 276 276 LEU LEU J . n 
J 1 171 GLU 171 277 277 GLU GLU J . n 
J 1 172 SER 172 278 ?   ?   ?   J . n 
J 1 173 PRO 173 279 ?   ?   ?   J . n 
J 1 174 VAL 174 280 ?   ?   ?   J . n 
J 1 175 GLU 175 281 ?   ?   ?   J . n 
J 1 176 ASP 176 282 ?   ?   ?   J . n 
J 1 177 SER 177 283 ?   ?   ?   J . n 
J 1 178 LEU 178 284 284 LEU LEU J . n 
J 1 179 TRP 179 285 285 TRP TRP J . n 
J 1 180 PRO 180 286 286 PRO PRO J . n 
J 1 181 TYR 181 287 287 TYR TYR J . n 
J 1 182 LYS 182 288 288 LYS LYS J . n 
J 1 183 GLY 183 289 289 GLY GLY J . n 
J 1 184 ARG 184 290 290 ARG ARG J . n 
J 1 185 PRO 185 291 291 PRO PRO J . n 
J 1 186 GLU 186 292 292 GLU GLU J . n 
J 1 187 ASN 187 293 293 ASN ASN J . n 
J 1 188 LYS 188 294 294 LYS LYS J . n 
J 1 189 SER 189 295 295 SER SER J . n 
J 1 190 PHE 190 296 296 PHE PHE J . n 
J 1 191 LEU 191 297 297 LEU LEU J . n 
J 1 192 TYR 192 298 298 TYR TYR J . n 
J 1 193 GLU 193 299 299 GLU GLU J . n 
J 1 194 ILE 194 300 300 ILE ILE J . n 
J 1 195 VAL 195 301 301 VAL VAL J . n 
J 1 196 SER 196 302 302 SER SER J . n 
J 1 197 ASN 197 303 303 ASN ASN J . n 
J 1 198 LYS 198 304 304 LYS LYS J . n 
J 1 199 ARG 199 305 305 ARG ARG J . n 
J 1 200 ASN 200 306 306 ASN ASN J . n 
J 1 201 GLY 201 307 307 GLY GLY J . n 
J 1 202 ILE 202 308 308 ILE ILE J . n 
J 1 203 ASP 203 309 309 ASP ASP J . n 
J 1 204 VAL 204 310 310 VAL VAL J . n 
J 1 205 ASP 205 311 311 ASP ASP J . n 
J 1 206 LYS 206 312 312 LYS LYS J . n 
J 1 207 TRP 207 313 313 TRP TRP J . n 
J 1 208 ASP 208 314 314 ASP ASP J . n 
J 1 209 TYR 209 315 315 TYR TYR J . n 
J 1 210 PHE 210 316 316 PHE PHE J . n 
J 1 211 ALA 211 317 317 ALA ALA J . n 
J 1 212 ARG 212 318 318 ARG ARG J . n 
J 1 213 ASP 213 319 319 ASP ASP J . n 
J 1 214 CYS 214 320 320 CYS CYS J . n 
J 1 215 HIS 215 321 321 HIS HIS J . n 
J 1 216 HIS 216 322 322 HIS HIS J . n 
J 1 217 LEU 217 323 323 LEU LEU J . n 
J 1 218 GLY 218 324 324 GLY GLY J . n 
J 1 219 ILE 219 325 325 ILE ILE J . n 
J 1 220 GLN 220 326 326 GLN GLN J . n 
J 1 221 ASN 221 327 327 ASN ASN J . n 
J 1 222 ASN 222 328 328 ASN ASN J . n 
J 1 223 PHE 223 329 329 PHE PHE J . n 
J 1 224 ASP 224 330 330 ASP ASP J . n 
J 1 225 TYR 225 331 331 TYR TYR J . n 
J 1 226 LYS 226 332 332 LYS LYS J . n 
J 1 227 ARG 227 333 333 ARG ARG J . n 
J 1 228 PHE 228 334 334 PHE PHE J . n 
J 1 229 ILE 229 335 335 ILE ILE J . n 
J 1 230 LYS 230 336 336 LYS LYS J . n 
J 1 231 PHE 231 337 337 PHE PHE J . n 
J 1 232 ALA 232 338 338 ALA ALA J . n 
J 1 233 ARG 233 339 339 ARG ARG J . n 
J 1 234 VAL 234 340 340 VAL VAL J . n 
J 1 235 CYS 235 341 341 CYS CYS J . n 
J 1 236 GLU 236 342 342 GLU GLU J . n 
J 1 237 VAL 237 343 343 VAL VAL J . n 
J 1 238 ASP 238 344 344 ASP ASP J . n 
J 1 239 ASN 239 345 345 ASN ASN J . n 
J 1 240 GLU 240 346 346 GLU GLU J . n 
J 1 241 LEU 241 347 347 LEU LEU J . n 
J 1 242 ARG 242 348 348 ARG ARG J . n 
J 1 243 ILE 243 349 349 ILE ILE J . n 
J 1 244 CYS 244 350 350 CYS CYS J . n 
J 1 245 ALA 245 351 351 ALA ALA J . n 
J 1 246 ARG 246 352 352 ARG ARG J . n 
J 1 247 ASP 247 353 353 ASP ASP J . n 
J 1 248 LYS 248 354 354 LYS LYS J . n 
J 1 249 GLU 249 355 355 GLU GLU J . n 
J 1 250 VAL 250 356 356 VAL VAL J . n 
J 1 251 GLY 251 357 357 GLY GLY J . n 
J 1 252 ASN 252 358 358 ASN ASN J . n 
J 1 253 LEU 253 359 359 LEU LEU J . n 
J 1 254 TYR 254 360 360 TYR TYR J . n 
J 1 255 ASP 255 361 361 ASP ASP J . n 
J 1 256 MET 256 362 362 MET MET J . n 
J 1 257 PHE 257 363 363 PHE PHE J . n 
J 1 258 HIS 258 364 364 HIS HIS J . n 
J 1 259 THR 259 365 365 THR THR J . n 
J 1 260 ARG 260 366 366 ARG ARG J . n 
J 1 261 ASN 261 367 367 ASN ASN J . n 
J 1 262 SER 262 368 368 SER SER J . n 
J 1 263 LEU 263 369 369 LEU LEU J . n 
J 1 264 HIS 264 370 370 HIS HIS J . n 
J 1 265 ARG 265 371 371 ARG ARG J . n 
J 1 266 ARG 266 372 372 ARG ARG J . n 
J 1 267 ALA 267 373 373 ALA ALA J . n 
J 1 268 TYR 268 374 374 TYR TYR J . n 
J 1 269 GLN 269 375 375 GLN GLN J . n 
J 1 270 HIS 270 376 376 HIS HIS J . n 
J 1 271 LYS 271 377 377 LYS LYS J . n 
J 1 272 VAL 272 378 378 VAL VAL J . n 
J 1 273 GLY 273 379 379 GLY GLY J . n 
J 1 274 ASN 274 380 380 ASN ASN J . n 
J 1 275 ILE 275 381 381 ILE ILE J . n 
J 1 276 ILE 276 382 382 ILE ILE J . n 
J 1 277 ASP 277 383 383 ASP ASP J . n 
J 1 278 THR 278 384 384 THR THR J . n 
J 1 279 MET 279 385 385 MET MET J . n 
J 1 280 ILE 280 386 386 ILE ILE J . n 
J 1 281 THR 281 387 387 THR THR J . n 
J 1 282 ASP 282 388 388 ASP ASP J . n 
J 1 283 ALA 283 389 389 ALA ALA J . n 
J 1 284 PHE 284 390 390 PHE PHE J . n 
J 1 285 LEU 285 391 391 LEU LEU J . n 
J 1 286 LYS 286 392 392 LYS LYS J . n 
J 1 287 ALA 287 393 393 ALA ALA J . n 
J 1 288 ASP 288 394 394 ASP ASP J . n 
J 1 289 ASP 289 395 395 ASP ASP J . n 
J 1 290 TYR 290 396 396 TYR TYR J . n 
J 1 291 ILE 291 397 397 ILE ILE J . n 
J 1 292 GLU 292 398 398 GLU GLU J . n 
J 1 293 ILE 293 399 399 ILE ILE J . n 
J 1 294 THR 294 400 400 THR THR J . n 
J 1 295 GLY 295 401 401 GLY GLY J . n 
J 1 296 ALA 296 402 402 ALA ALA J . n 
J 1 297 GLY 297 403 403 GLY GLY J . n 
J 1 298 GLY 298 404 404 GLY GLY J . n 
J 1 299 LYS 299 405 405 LYS LYS J . n 
J 1 300 LYS 300 406 406 LYS LYS J . n 
J 1 301 TYR 301 407 407 TYR TYR J . n 
J 1 302 ARG 302 408 408 ARG ARG J . n 
J 1 303 ILE 303 409 409 ILE ILE J . n 
J 1 304 SER 304 410 410 SER SER J . n 
J 1 305 THR 305 411 411 THR THR J . n 
J 1 306 ALA 306 412 412 ALA ALA J . n 
J 1 307 ILE 307 413 413 ILE ILE J . n 
J 1 308 ASP 308 414 414 ASP ASP J . n 
J 1 309 ASP 309 415 415 ASP ASP J . n 
J 1 310 MET 310 416 416 MET MET J . n 
J 1 311 GLU 311 417 417 GLU GLU J . n 
J 1 312 ALA 312 418 418 ALA ALA J . n 
J 1 313 TYR 313 419 419 TYR TYR J . n 
J 1 314 THR 314 420 420 THR THR J . n 
J 1 315 LYS 315 421 421 LYS LYS J . n 
J 1 316 LEU 316 422 422 LEU LEU J . n 
J 1 317 THR 317 423 423 THR THR J . n 
J 1 318 ASP 318 424 424 ASP ASP J . n 
J 1 319 ASN 319 425 425 ASN ASN J . n 
J 1 320 ILE 320 426 426 ILE ILE J . n 
J 1 321 PHE 321 427 427 PHE PHE J . n 
J 1 322 LEU 322 428 428 LEU LEU J . n 
J 1 323 GLU 323 429 429 GLU GLU J . n 
J 1 324 ILE 324 430 430 ILE ILE J . n 
J 1 325 LEU 325 431 431 LEU LEU J . n 
J 1 326 TYR 326 432 432 TYR TYR J . n 
J 1 327 SER 327 433 433 SER SER J . n 
J 1 328 THR 328 434 434 THR THR J . n 
J 1 329 ASP 329 435 435 ASP ASP J . n 
J 1 330 PRO 330 436 436 PRO PRO J . n 
J 1 331 LYS 331 437 437 LYS LYS J . n 
J 1 332 LEU 332 438 438 LEU LEU J . n 
J 1 333 LYS 333 439 439 LYS LYS J . n 
J 1 334 ASP 334 440 440 ASP ASP J . n 
J 1 335 ALA 335 441 441 ALA ALA J . n 
J 1 336 ARG 336 442 442 ARG ARG J . n 
J 1 337 GLU 337 443 443 GLU GLU J . n 
J 1 338 ILE 338 444 444 ILE ILE J . n 
J 1 339 LEU 339 445 445 LEU LEU J . n 
J 1 340 LYS 340 446 446 LYS LYS J . n 
J 1 341 GLN 341 447 447 GLN GLN J . n 
J 1 342 ILE 342 448 448 ILE ILE J . n 
J 1 343 GLU 343 449 449 GLU GLU J . n 
J 1 344 TYR 344 450 450 TYR TYR J . n 
J 1 345 ARG 345 451 451 ARG ARG J . n 
J 1 346 ASN 346 452 452 ASN ASN J . n 
J 1 347 LEU 347 453 453 LEU LEU J . n 
J 1 348 PHE 348 454 454 PHE PHE J . n 
J 1 349 LYS 349 455 455 LYS LYS J . n 
J 1 350 TYR 350 456 456 TYR TYR J . n 
J 1 351 VAL 351 457 457 VAL VAL J . n 
J 1 352 GLY 352 458 458 GLY GLY J . n 
J 1 353 GLU 353 459 459 GLU GLU J . n 
J 1 354 THR 354 460 460 THR THR J . n 
J 1 355 GLN 355 461 461 GLN GLN J . n 
J 1 356 PRO 356 462 462 PRO PRO J . n 
J 1 357 THR 357 463 463 THR THR J . n 
J 1 358 GLY 358 464 464 GLY GLY J . n 
J 1 359 GLN 359 465 465 GLN GLN J . n 
J 1 360 ILE 360 466 466 ILE ILE J . n 
J 1 361 LYS 361 467 467 LYS LYS J . n 
J 1 362 ILE 362 468 468 ILE ILE J . n 
J 1 363 LYS 363 469 469 LYS LYS J . n 
J 1 364 ARG 364 470 470 ARG ARG J . n 
J 1 365 GLU 365 471 471 GLU GLU J . n 
J 1 366 ASP 366 472 472 ASP ASP J . n 
J 1 367 TYR 367 473 473 TYR TYR J . n 
J 1 368 GLU 368 474 474 GLU GLU J . n 
J 1 369 SER 369 475 475 SER SER J . n 
J 1 370 LEU 370 476 476 LEU LEU J . n 
J 1 371 PRO 371 477 477 PRO PRO J . n 
J 1 372 LYS 372 478 478 LYS LYS J . n 
J 1 373 GLU 373 479 479 GLU GLU J . n 
J 1 374 VAL 374 480 480 VAL VAL J . n 
J 1 375 ALA 375 481 481 ALA ALA J . n 
J 1 376 SER 376 482 482 SER SER J . n 
J 1 377 ALA 377 483 483 ALA ALA J . n 
J 1 378 LYS 378 484 484 LYS LYS J . n 
J 1 379 PRO 379 485 485 PRO PRO J . n 
J 1 380 LYS 380 486 486 LYS LYS J . n 
J 1 381 VAL 381 487 487 VAL VAL J . n 
J 1 382 LEU 382 488 488 LEU LEU J . n 
J 1 383 LEU 383 489 489 LEU LEU J . n 
J 1 384 ASP 384 490 490 ASP ASP J . n 
J 1 385 VAL 385 491 491 VAL VAL J . n 
J 1 386 LYS 386 492 492 LYS LYS J . n 
J 1 387 LEU 387 493 493 LEU LEU J . n 
J 1 388 LYS 388 494 494 LYS LYS J . n 
J 1 389 ALA 389 495 495 ALA ALA J . n 
J 1 390 GLU 390 496 496 GLU GLU J . n 
J 1 391 ASP 391 497 497 ASP ASP J . n 
J 1 392 PHE 392 498 498 PHE PHE J . n 
J 1 393 ILE 393 499 499 ILE ILE J . n 
J 1 394 VAL 394 500 500 VAL VAL J . n 
J 1 395 ASP 395 501 501 ASP ASP J . n 
J 1 396 VAL 396 502 502 VAL VAL J . n 
J 1 397 ILE 397 503 503 ILE ILE J . n 
J 1 398 ASN 398 504 504 ASN ASN J . n 
J 1 399 MET 399 505 505 MET MET J . n 
J 1 400 ASP 400 506 506 ASP ASP J . n 
J 1 401 TYR 401 507 507 TYR TYR J . n 
J 1 402 GLY 402 508 508 GLY GLY J . n 
J 1 403 MET 403 509 509 MET MET J . n 
J 1 404 GLN 404 510 510 GLN GLN J . n 
J 1 405 GLU 405 511 511 GLU GLU J . n 
J 1 406 LYS 406 512 512 LYS LYS J . n 
J 1 407 ASN 407 513 513 ASN ASN J . n 
J 1 408 PRO 408 514 514 PRO PRO J . n 
J 1 409 ILE 409 515 515 ILE ILE J . n 
J 1 410 ASP 410 516 516 ASP ASP J . n 
J 1 411 HIS 411 517 517 HIS HIS J . n 
J 1 412 VAL 412 518 518 VAL VAL J . n 
J 1 413 SER 413 519 519 SER SER J . n 
J 1 414 PHE 414 520 520 PHE PHE J . n 
J 1 415 TYR 415 521 521 TYR TYR J . n 
J 1 416 CYS 416 522 522 CYS CYS J . n 
J 1 417 LYS 417 523 523 LYS LYS J . n 
J 1 418 THR 418 524 524 THR THR J . n 
J 1 419 ALA 419 525 525 ALA ALA J . n 
J 1 420 PRO 420 526 526 PRO PRO J . n 
J 1 421 ASN 421 527 527 ASN ASN J . n 
J 1 422 ARG 422 528 528 ARG ARG J . n 
J 1 423 ALA 423 529 529 ALA ALA J . n 
J 1 424 ILE 424 530 530 ILE ILE J . n 
J 1 425 ARG 425 531 531 ARG ARG J . n 
J 1 426 ILE 426 532 532 ILE ILE J . n 
J 1 427 THR 427 533 533 THR THR J . n 
J 1 428 LYS 428 534 534 LYS LYS J . n 
J 1 429 ASN 429 535 535 ASN ASN J . n 
J 1 430 GLN 430 536 536 GLN GLN J . n 
J 1 431 VAL 431 537 537 VAL VAL J . n 
J 1 432 SER 432 538 538 SER SER J . n 
J 1 433 GLN 433 539 539 GLN GLN J . n 
J 1 434 LEU 434 540 540 LEU LEU J . n 
J 1 435 LEU 435 541 541 LEU LEU J . n 
J 1 436 PRO 436 542 542 PRO PRO J . n 
J 1 437 GLU 437 543 543 GLU GLU J . n 
J 1 438 LYS 438 544 544 LYS LYS J . n 
J 1 439 PHE 439 545 545 PHE PHE J . n 
J 1 440 ALA 440 546 546 ALA ALA J . n 
J 1 441 GLU 441 547 547 GLU GLU J . n 
J 1 442 GLN 442 548 548 GLN GLN J . n 
J 1 443 LEU 443 549 549 LEU LEU J . n 
J 1 444 ILE 444 550 550 ILE ILE J . n 
J 1 445 ARG 445 551 551 ARG ARG J . n 
J 1 446 VAL 446 552 552 VAL VAL J . n 
J 1 447 TYR 447 553 553 TYR TYR J . n 
J 1 448 CYS 448 554 554 CYS CYS J . n 
J 1 449 LYS 449 555 555 LYS LYS J . n 
J 1 450 LYS 450 556 556 LYS LYS J . n 
J 1 451 VAL 451 557 557 VAL VAL J . n 
J 1 452 ASP 452 558 558 ASP ASP J . n 
J 1 453 ARG 453 559 559 ARG ARG J . n 
J 1 454 LYS 454 560 560 LYS LYS J . n 
J 1 455 SER 455 561 561 SER SER J . n 
J 1 456 LEU 456 562 562 LEU LEU J . n 
J 1 457 TYR 457 563 563 TYR TYR J . n 
J 1 458 ALA 458 564 564 ALA ALA J . n 
J 1 459 ALA 459 565 565 ALA ALA J . n 
J 1 460 ARG 460 566 566 ARG ARG J . n 
J 1 461 GLN 461 567 567 GLN GLN J . n 
J 1 462 TYR 462 568 568 TYR TYR J . n 
J 1 463 PHE 463 569 569 PHE PHE J . n 
J 1 464 VAL 464 570 570 VAL VAL J . n 
J 1 465 GLN 465 571 571 GLN GLN J . n 
J 1 466 TRP 466 572 572 TRP TRP J . n 
J 1 467 CYS 467 573 573 CYS CYS J . n 
J 1 468 ALA 468 574 574 ALA ALA J . n 
J 1 469 ASP 469 575 575 ASP ASP J . n 
J 1 470 ARG 470 576 576 ARG ARG J . n 
J 1 471 ASN 471 577 577 ASN ASN J . n 
J 1 472 PHE 472 578 578 PHE PHE J . n 
J 1 473 THR 473 579 579 THR THR J . n 
J 1 474 LYS 474 580 580 LYS LYS J . n 
J 1 475 PRO 475 581 581 PRO PRO J . n 
J 1 476 GLN 476 582 582 GLN GLN J . n 
J 1 477 ASP 477 583 583 ASP ASP J . n 
J 1 478 GLY 478 584 584 GLY GLY J . n 
J 1 479 ASP 479 585 585 ASP ASP J . n 
J 1 480 VAL 480 586 586 VAL VAL J . n 
J 1 481 ILE 481 587 587 ILE ILE J . n 
J 1 482 ALA 482 588 588 ALA ALA J . n 
J 1 483 PRO 483 589 589 PRO PRO J . n 
J 1 484 LEU 484 590 590 LEU LEU J . n 
J 1 485 ILE 485 591 591 ILE ILE J . n 
J 1 486 THR 486 592 592 THR THR J . n 
J 1 487 PRO 487 593 593 PRO PRO J . n 
J 1 488 GLN 488 594 594 GLN GLN J . n 
J 1 489 LYS 489 595 595 LYS LYS J . n 
J 1 490 LYS 490 596 596 LYS LYS J . n 
J 1 491 GLU 491 597 597 GLU GLU J . n 
J 1 492 TRP 492 598 598 TRP TRP J . n 
J 1 493 ASN 493 599 ?   ?   ?   J . n 
J 1 494 ASP 494 600 ?   ?   ?   J . n 
J 1 495 SER 495 601 ?   ?   ?   J . n 
J 1 496 THR 496 602 ?   ?   ?   J . n 
J 1 497 SER 497 603 ?   ?   ?   J . n 
J 1 498 VAL 498 604 ?   ?   ?   J . n 
J 1 499 GLN 499 605 ?   ?   ?   J . n 
J 1 500 ASN 500 606 ?   ?   ?   J . n 
J 1 501 PRO 501 607 ?   ?   ?   J . n 
J 1 502 THR 502 608 ?   ?   ?   J . n 
J 1 503 ARG 503 609 ?   ?   ?   J . n 
J 1 504 LEU 504 610 ?   ?   ?   J . n 
J 1 505 ARG 505 611 ?   ?   ?   J . n 
J 1 506 GLU 506 612 ?   ?   ?   J . n 
J 1 507 ALA 507 613 ?   ?   ?   J . n 
J 1 508 SER 508 614 ?   ?   ?   J . n 
J 1 509 LYS 509 615 ?   ?   ?   J . n 
J 1 510 SER 510 616 ?   ?   ?   J . n 
J 1 511 ARG 511 617 ?   ?   ?   J . n 
J 1 512 VAL 512 618 ?   ?   ?   J . n 
J 1 513 GLN 513 619 ?   ?   ?   J . n 
J 1 514 LEU 514 620 ?   ?   ?   J . n 
J 1 515 PHE 515 621 ?   ?   ?   J . n 
J 1 516 LYS 516 622 ?   ?   ?   J . n 
J 1 517 ASP 517 623 ?   ?   ?   J . n 
J 1 518 ASP 518 624 ?   ?   ?   J . n 
J 1 519 PRO 519 625 ?   ?   ?   J . n 
J 1 520 MET 520 626 ?   ?   ?   J . n 
K 1 1   GLY 1   107 ?   ?   ?   K . n 
K 1 2   SER 2   108 ?   ?   ?   K . n 
K 1 3   GLN 3   109 ?   ?   ?   K . n 
K 1 4   ILE 4   110 ?   ?   ?   K . n 
K 1 5   HIS 5   111 ?   ?   ?   K . n 
K 1 6   VAL 6   112 ?   ?   ?   K . n 
K 1 7   ASP 7   113 ?   ?   ?   K . n 
K 1 8   THR 8   114 ?   ?   ?   K . n 
K 1 9   MET 9   115 115 MET MET K . n 
K 1 10  LYS 10  116 116 LYS LYS K . n 
K 1 11  VAL 11  117 117 VAL VAL K . n 
K 1 12  ILE 12  118 118 ILE ILE K . n 
K 1 13  ASN 13  119 119 ASN ASN K . n 
K 1 14  ASP 14  120 120 ASP ASP K . n 
K 1 15  PRO 15  121 121 PRO PRO K . n 
K 1 16  ILE 16  122 122 ILE ILE K . n 
K 1 17  HIS 17  123 123 HIS HIS K . n 
K 1 18  GLY 18  124 124 GLY GLY K . n 
K 1 19  HIS 19  125 125 HIS HIS K . n 
K 1 20  ILE 20  126 126 ILE ILE K . n 
K 1 21  GLU 21  127 127 GLU GLU K . n 
K 1 22  LEU 22  128 128 LEU LEU K . n 
K 1 23  HIS 23  129 129 HIS HIS K . n 
K 1 24  PRO 24  130 130 PRO PRO K . n 
K 1 25  LEU 25  131 131 LEU LEU K . n 
K 1 26  LEU 26  132 132 LEU LEU K . n 
K 1 27  VAL 27  133 133 VAL VAL K . n 
K 1 28  ARG 28  134 134 ARG ARG K . n 
K 1 29  ILE 29  135 135 ILE ILE K . n 
K 1 30  ILE 30  136 136 ILE ILE K . n 
K 1 31  ASP 31  137 137 ASP ASP K . n 
K 1 32  THR 32  138 138 THR THR K . n 
K 1 33  PRO 33  139 139 PRO PRO K . n 
K 1 34  GLN 34  140 140 GLN GLN K . n 
K 1 35  PHE 35  141 141 PHE PHE K . n 
K 1 36  GLN 36  142 142 GLN GLN K . n 
K 1 37  ARG 37  143 143 ARG ARG K . n 
K 1 38  LEU 38  144 144 LEU LEU K . n 
K 1 39  ARG 39  145 145 ARG ARG K . n 
K 1 40  TYR 40  146 146 TYR TYR K . n 
K 1 41  ILE 41  147 147 ILE ILE K . n 
K 1 42  LYS 42  148 148 LYS LYS K . n 
K 1 43  GLN 43  149 149 GLN GLN K . n 
K 1 44  LEU 44  150 150 LEU LEU K . n 
K 1 45  GLY 45  151 151 GLY GLY K . n 
K 1 46  GLY 46  152 152 GLY GLY K . n 
K 1 47  GLY 47  153 153 GLY GLY K . n 
K 1 48  TYR 48  154 154 TYR TYR K . n 
K 1 49  TYR 49  155 155 TYR TYR K . n 
K 1 50  VAL 50  156 156 VAL VAL K . n 
K 1 51  PHE 51  157 157 PHE PHE K . n 
K 1 52  PRO 52  158 158 PRO PRO K . n 
K 1 53  GLY 53  159 159 GLY GLY K . n 
K 1 54  ALA 54  160 160 ALA ALA K . n 
K 1 55  SER 55  161 161 SER SER K . n 
K 1 56  HIS 56  162 162 HIS HIS K . n 
K 1 57  ASN 57  163 163 ASN ASN K . n 
K 1 58  ARG 58  164 164 ARG ARG K . n 
K 1 59  PHE 59  165 165 PHE PHE K . n 
K 1 60  GLU 60  166 166 GLU GLU K . n 
K 1 61  HIS 61  167 167 HIS HIS K . n 
K 1 62  SER 62  168 168 SER SER K . n 
K 1 63  LEU 63  169 169 LEU LEU K . n 
K 1 64  GLY 64  170 170 GLY GLY K . n 
K 1 65  VAL 65  171 171 VAL VAL K . n 
K 1 66  GLY 66  172 172 GLY GLY K . n 
K 1 67  TYR 67  173 173 TYR TYR K . n 
K 1 68  LEU 68  174 174 LEU LEU K . n 
K 1 69  ALA 69  175 175 ALA ALA K . n 
K 1 70  GLY 70  176 176 GLY GLY K . n 
K 1 71  CYS 71  177 177 CYS CYS K . n 
K 1 72  LEU 72  178 178 LEU LEU K . n 
K 1 73  VAL 73  179 179 VAL VAL K . n 
K 1 74  HIS 74  180 180 HIS HIS K . n 
K 1 75  ALA 75  181 181 ALA ALA K . n 
K 1 76  LEU 76  182 182 LEU LEU K . n 
K 1 77  GLY 77  183 183 GLY GLY K . n 
K 1 78  GLU 78  184 184 GLU GLU K . n 
K 1 79  LYS 79  185 185 LYS LYS K . n 
K 1 80  GLN 80  186 186 GLN GLN K . n 
K 1 81  PRO 81  187 187 PRO PRO K . n 
K 1 82  GLU 82  188 188 GLU GLU K . n 
K 1 83  LEU 83  189 189 LEU LEU K . n 
K 1 84  GLN 84  190 190 GLN GLN K . n 
K 1 85  ILE 85  191 191 ILE ILE K . n 
K 1 86  SER 86  192 192 SER SER K . n 
K 1 87  GLU 87  193 193 GLU GLU K . n 
K 1 88  ARG 88  194 194 ARG ARG K . n 
K 1 89  ASP 89  195 195 ASP ASP K . n 
K 1 90  VAL 90  196 196 VAL VAL K . n 
K 1 91  LEU 91  197 197 LEU LEU K . n 
K 1 92  CYS 92  198 198 CYS CYS K . n 
K 1 93  VAL 93  199 199 VAL VAL K . n 
K 1 94  GLN 94  200 200 GLN GLN K . n 
K 1 95  ILE 95  201 201 ILE ILE K . n 
K 1 96  ALA 96  202 202 ALA ALA K . n 
K 1 97  GLY 97  203 203 GLY GLY K . n 
K 1 98  LEU 98  204 204 LEU LEU K . n 
K 1 99  CYS 99  205 205 CYS CYS K . n 
K 1 100 HIS 100 206 206 HIS HIS K . n 
K 1 101 ASP 101 207 207 ASP ASP K . n 
K 1 102 LEU 102 208 208 LEU LEU K . n 
K 1 103 GLY 103 209 209 GLY GLY K . n 
K 1 104 HIS 104 210 210 HIS HIS K . n 
K 1 105 GLY 105 211 211 GLY GLY K . n 
K 1 106 PRO 106 212 212 PRO PRO K . n 
K 1 107 PHE 107 213 213 PHE PHE K . n 
K 1 108 SER 108 214 214 SER SER K . n 
K 1 109 HIS 109 215 215 HIS HIS K . n 
K 1 110 MET 110 216 216 MET MET K . n 
K 1 111 PHE 111 217 217 PHE PHE K . n 
K 1 112 ASP 112 218 218 ASP ASP K . n 
K 1 113 GLY 113 219 219 GLY GLY K . n 
K 1 114 ARG 114 220 220 ARG ARG K . n 
K 1 115 PHE 115 221 221 PHE PHE K . n 
K 1 116 ILE 116 222 222 ILE ILE K . n 
K 1 117 PRO 117 223 223 PRO PRO K . n 
K 1 118 LEU 118 224 224 LEU LEU K . n 
K 1 119 ALA 119 225 225 ALA ALA K . n 
K 1 120 ARG 120 226 226 ARG ARG K . n 
K 1 121 PRO 121 227 227 PRO PRO K . n 
K 1 122 GLU 122 228 228 GLU GLU K . n 
K 1 123 VAL 123 229 229 VAL VAL K . n 
K 1 124 LYS 124 230 230 LYS LYS K . n 
K 1 125 TRP 125 231 231 TRP TRP K . n 
K 1 126 THR 126 232 232 THR THR K . n 
K 1 127 HIS 127 233 233 HIS HIS K . n 
K 1 128 GLU 128 234 234 GLU GLU K . n 
K 1 129 GLN 129 235 235 GLN GLN K . n 
K 1 130 GLY 130 236 236 GLY GLY K . n 
K 1 131 SER 131 237 237 SER SER K . n 
K 1 132 VAL 132 238 238 VAL VAL K . n 
K 1 133 MET 133 239 239 MET MET K . n 
K 1 134 MET 134 240 240 MET MET K . n 
K 1 135 PHE 135 241 241 PHE PHE K . n 
K 1 136 GLU 136 242 242 GLU GLU K . n 
K 1 137 HIS 137 243 243 HIS HIS K . n 
K 1 138 LEU 138 244 244 LEU LEU K . n 
K 1 139 ILE 139 245 245 ILE ILE K . n 
K 1 140 ASN 140 246 246 ASN ASN K . n 
K 1 141 SER 141 247 247 SER SER K . n 
K 1 142 ASN 142 248 248 ASN ASN K . n 
K 1 143 GLY 143 249 249 GLY GLY K . n 
K 1 144 ILE 144 250 250 ILE ILE K . n 
K 1 145 LYS 145 251 251 LYS LYS K . n 
K 1 146 PRO 146 252 252 PRO PRO K . n 
K 1 147 VAL 147 253 253 VAL VAL K . n 
K 1 148 MET 148 254 254 MET MET K . n 
K 1 149 GLU 149 255 255 GLU GLU K . n 
K 1 150 GLN 150 256 256 GLN GLN K . n 
K 1 151 TYR 151 257 257 TYR TYR K . n 
K 1 152 GLY 152 258 258 GLY GLY K . n 
K 1 153 LEU 153 259 259 LEU LEU K . n 
K 1 154 ILE 154 260 260 ILE ILE K . n 
K 1 155 PRO 155 261 261 PRO PRO K . n 
K 1 156 GLU 156 262 262 GLU GLU K . n 
K 1 157 GLU 157 263 263 GLU GLU K . n 
K 1 158 ASP 158 264 264 ASP ASP K . n 
K 1 159 ILE 159 265 265 ILE ILE K . n 
K 1 160 CYS 160 266 266 CYS CYS K . n 
K 1 161 PHE 161 267 267 PHE PHE K . n 
K 1 162 ILE 162 268 268 ILE ILE K . n 
K 1 163 LYS 163 269 269 LYS LYS K . n 
K 1 164 GLU 164 270 270 GLU GLU K . n 
K 1 165 GLN 165 271 271 GLN GLN K . n 
K 1 166 ILE 166 272 272 ILE ILE K . n 
K 1 167 VAL 167 273 273 VAL VAL K . n 
K 1 168 GLY 168 274 274 GLY GLY K . n 
K 1 169 PRO 169 275 275 PRO PRO K . n 
K 1 170 LEU 170 276 276 LEU LEU K . n 
K 1 171 GLU 171 277 ?   ?   ?   K . n 
K 1 172 SER 172 278 ?   ?   ?   K . n 
K 1 173 PRO 173 279 ?   ?   ?   K . n 
K 1 174 VAL 174 280 ?   ?   ?   K . n 
K 1 175 GLU 175 281 ?   ?   ?   K . n 
K 1 176 ASP 176 282 ?   ?   ?   K . n 
K 1 177 SER 177 283 ?   ?   ?   K . n 
K 1 178 LEU 178 284 284 LEU LEU K . n 
K 1 179 TRP 179 285 285 TRP TRP K . n 
K 1 180 PRO 180 286 286 PRO PRO K . n 
K 1 181 TYR 181 287 287 TYR TYR K . n 
K 1 182 LYS 182 288 288 LYS LYS K . n 
K 1 183 GLY 183 289 289 GLY GLY K . n 
K 1 184 ARG 184 290 290 ARG ARG K . n 
K 1 185 PRO 185 291 291 PRO PRO K . n 
K 1 186 GLU 186 292 292 GLU GLU K . n 
K 1 187 ASN 187 293 293 ASN ASN K . n 
K 1 188 LYS 188 294 294 LYS LYS K . n 
K 1 189 SER 189 295 295 SER SER K . n 
K 1 190 PHE 190 296 296 PHE PHE K . n 
K 1 191 LEU 191 297 297 LEU LEU K . n 
K 1 192 TYR 192 298 298 TYR TYR K . n 
K 1 193 GLU 193 299 299 GLU GLU K . n 
K 1 194 ILE 194 300 300 ILE ILE K . n 
K 1 195 VAL 195 301 301 VAL VAL K . n 
K 1 196 SER 196 302 302 SER SER K . n 
K 1 197 ASN 197 303 303 ASN ASN K . n 
K 1 198 LYS 198 304 304 LYS LYS K . n 
K 1 199 ARG 199 305 305 ARG ARG K . n 
K 1 200 ASN 200 306 306 ASN ASN K . n 
K 1 201 GLY 201 307 307 GLY GLY K . n 
K 1 202 ILE 202 308 308 ILE ILE K . n 
K 1 203 ASP 203 309 309 ASP ASP K . n 
K 1 204 VAL 204 310 310 VAL VAL K . n 
K 1 205 ASP 205 311 311 ASP ASP K . n 
K 1 206 LYS 206 312 312 LYS LYS K . n 
K 1 207 TRP 207 313 313 TRP TRP K . n 
K 1 208 ASP 208 314 314 ASP ASP K . n 
K 1 209 TYR 209 315 315 TYR TYR K . n 
K 1 210 PHE 210 316 316 PHE PHE K . n 
K 1 211 ALA 211 317 317 ALA ALA K . n 
K 1 212 ARG 212 318 318 ARG ARG K . n 
K 1 213 ASP 213 319 319 ASP ASP K . n 
K 1 214 CYS 214 320 320 CYS CYS K . n 
K 1 215 HIS 215 321 321 HIS HIS K . n 
K 1 216 HIS 216 322 322 HIS HIS K . n 
K 1 217 LEU 217 323 323 LEU LEU K . n 
K 1 218 GLY 218 324 324 GLY GLY K . n 
K 1 219 ILE 219 325 325 ILE ILE K . n 
K 1 220 GLN 220 326 326 GLN GLN K . n 
K 1 221 ASN 221 327 327 ASN ASN K . n 
K 1 222 ASN 222 328 328 ASN ASN K . n 
K 1 223 PHE 223 329 329 PHE PHE K . n 
K 1 224 ASP 224 330 330 ASP ASP K . n 
K 1 225 TYR 225 331 331 TYR TYR K . n 
K 1 226 LYS 226 332 332 LYS LYS K . n 
K 1 227 ARG 227 333 333 ARG ARG K . n 
K 1 228 PHE 228 334 334 PHE PHE K . n 
K 1 229 ILE 229 335 335 ILE ILE K . n 
K 1 230 LYS 230 336 336 LYS LYS K . n 
K 1 231 PHE 231 337 337 PHE PHE K . n 
K 1 232 ALA 232 338 338 ALA ALA K . n 
K 1 233 ARG 233 339 339 ARG ARG K . n 
K 1 234 VAL 234 340 340 VAL VAL K . n 
K 1 235 CYS 235 341 341 CYS CYS K . n 
K 1 236 GLU 236 342 342 GLU GLU K . n 
K 1 237 VAL 237 343 343 VAL VAL K . n 
K 1 238 ASP 238 344 344 ASP ASP K . n 
K 1 239 ASN 239 345 345 ASN ASN K . n 
K 1 240 GLU 240 346 346 GLU GLU K . n 
K 1 241 LEU 241 347 347 LEU LEU K . n 
K 1 242 ARG 242 348 348 ARG ARG K . n 
K 1 243 ILE 243 349 349 ILE ILE K . n 
K 1 244 CYS 244 350 350 CYS CYS K . n 
K 1 245 ALA 245 351 351 ALA ALA K . n 
K 1 246 ARG 246 352 352 ARG ARG K . n 
K 1 247 ASP 247 353 353 ASP ASP K . n 
K 1 248 LYS 248 354 354 LYS LYS K . n 
K 1 249 GLU 249 355 355 GLU GLU K . n 
K 1 250 VAL 250 356 356 VAL VAL K . n 
K 1 251 GLY 251 357 357 GLY GLY K . n 
K 1 252 ASN 252 358 358 ASN ASN K . n 
K 1 253 LEU 253 359 359 LEU LEU K . n 
K 1 254 TYR 254 360 360 TYR TYR K . n 
K 1 255 ASP 255 361 361 ASP ASP K . n 
K 1 256 MET 256 362 362 MET MET K . n 
K 1 257 PHE 257 363 363 PHE PHE K . n 
K 1 258 HIS 258 364 364 HIS HIS K . n 
K 1 259 THR 259 365 365 THR THR K . n 
K 1 260 ARG 260 366 366 ARG ARG K . n 
K 1 261 ASN 261 367 367 ASN ASN K . n 
K 1 262 SER 262 368 368 SER SER K . n 
K 1 263 LEU 263 369 369 LEU LEU K . n 
K 1 264 HIS 264 370 370 HIS HIS K . n 
K 1 265 ARG 265 371 371 ARG ARG K . n 
K 1 266 ARG 266 372 372 ARG ARG K . n 
K 1 267 ALA 267 373 373 ALA ALA K . n 
K 1 268 TYR 268 374 374 TYR TYR K . n 
K 1 269 GLN 269 375 375 GLN GLN K . n 
K 1 270 HIS 270 376 376 HIS HIS K . n 
K 1 271 LYS 271 377 377 LYS LYS K . n 
K 1 272 VAL 272 378 378 VAL VAL K . n 
K 1 273 GLY 273 379 379 GLY GLY K . n 
K 1 274 ASN 274 380 380 ASN ASN K . n 
K 1 275 ILE 275 381 381 ILE ILE K . n 
K 1 276 ILE 276 382 382 ILE ILE K . n 
K 1 277 ASP 277 383 383 ASP ASP K . n 
K 1 278 THR 278 384 384 THR THR K . n 
K 1 279 MET 279 385 385 MET MET K . n 
K 1 280 ILE 280 386 386 ILE ILE K . n 
K 1 281 THR 281 387 387 THR THR K . n 
K 1 282 ASP 282 388 388 ASP ASP K . n 
K 1 283 ALA 283 389 389 ALA ALA K . n 
K 1 284 PHE 284 390 390 PHE PHE K . n 
K 1 285 LEU 285 391 391 LEU LEU K . n 
K 1 286 LYS 286 392 392 LYS LYS K . n 
K 1 287 ALA 287 393 393 ALA ALA K . n 
K 1 288 ASP 288 394 394 ASP ASP K . n 
K 1 289 ASP 289 395 395 ASP ASP K . n 
K 1 290 TYR 290 396 396 TYR TYR K . n 
K 1 291 ILE 291 397 397 ILE ILE K . n 
K 1 292 GLU 292 398 398 GLU GLU K . n 
K 1 293 ILE 293 399 399 ILE ILE K . n 
K 1 294 THR 294 400 400 THR THR K . n 
K 1 295 GLY 295 401 401 GLY GLY K . n 
K 1 296 ALA 296 402 402 ALA ALA K . n 
K 1 297 GLY 297 403 403 GLY GLY K . n 
K 1 298 GLY 298 404 404 GLY GLY K . n 
K 1 299 LYS 299 405 405 LYS LYS K . n 
K 1 300 LYS 300 406 406 LYS LYS K . n 
K 1 301 TYR 301 407 407 TYR TYR K . n 
K 1 302 ARG 302 408 408 ARG ARG K . n 
K 1 303 ILE 303 409 409 ILE ILE K . n 
K 1 304 SER 304 410 410 SER SER K . n 
K 1 305 THR 305 411 411 THR THR K . n 
K 1 306 ALA 306 412 412 ALA ALA K . n 
K 1 307 ILE 307 413 413 ILE ILE K . n 
K 1 308 ASP 308 414 414 ASP ASP K . n 
K 1 309 ASP 309 415 415 ASP ASP K . n 
K 1 310 MET 310 416 416 MET MET K . n 
K 1 311 GLU 311 417 417 GLU GLU K . n 
K 1 312 ALA 312 418 418 ALA ALA K . n 
K 1 313 TYR 313 419 419 TYR TYR K . n 
K 1 314 THR 314 420 420 THR THR K . n 
K 1 315 LYS 315 421 421 LYS LYS K . n 
K 1 316 LEU 316 422 422 LEU LEU K . n 
K 1 317 THR 317 423 423 THR THR K . n 
K 1 318 ASP 318 424 424 ASP ASP K . n 
K 1 319 ASN 319 425 425 ASN ASN K . n 
K 1 320 ILE 320 426 426 ILE ILE K . n 
K 1 321 PHE 321 427 427 PHE PHE K . n 
K 1 322 LEU 322 428 428 LEU LEU K . n 
K 1 323 GLU 323 429 429 GLU GLU K . n 
K 1 324 ILE 324 430 430 ILE ILE K . n 
K 1 325 LEU 325 431 431 LEU LEU K . n 
K 1 326 TYR 326 432 432 TYR TYR K . n 
K 1 327 SER 327 433 433 SER SER K . n 
K 1 328 THR 328 434 434 THR THR K . n 
K 1 329 ASP 329 435 435 ASP ASP K . n 
K 1 330 PRO 330 436 436 PRO PRO K . n 
K 1 331 LYS 331 437 437 LYS LYS K . n 
K 1 332 LEU 332 438 438 LEU LEU K . n 
K 1 333 LYS 333 439 439 LYS LYS K . n 
K 1 334 ASP 334 440 440 ASP ASP K . n 
K 1 335 ALA 335 441 441 ALA ALA K . n 
K 1 336 ARG 336 442 442 ARG ARG K . n 
K 1 337 GLU 337 443 443 GLU GLU K . n 
K 1 338 ILE 338 444 444 ILE ILE K . n 
K 1 339 LEU 339 445 445 LEU LEU K . n 
K 1 340 LYS 340 446 446 LYS LYS K . n 
K 1 341 GLN 341 447 447 GLN GLN K . n 
K 1 342 ILE 342 448 448 ILE ILE K . n 
K 1 343 GLU 343 449 449 GLU GLU K . n 
K 1 344 TYR 344 450 450 TYR TYR K . n 
K 1 345 ARG 345 451 451 ARG ARG K . n 
K 1 346 ASN 346 452 452 ASN ASN K . n 
K 1 347 LEU 347 453 453 LEU LEU K . n 
K 1 348 PHE 348 454 454 PHE PHE K . n 
K 1 349 LYS 349 455 455 LYS LYS K . n 
K 1 350 TYR 350 456 456 TYR TYR K . n 
K 1 351 VAL 351 457 457 VAL VAL K . n 
K 1 352 GLY 352 458 458 GLY GLY K . n 
K 1 353 GLU 353 459 459 GLU GLU K . n 
K 1 354 THR 354 460 460 THR THR K . n 
K 1 355 GLN 355 461 461 GLN GLN K . n 
K 1 356 PRO 356 462 462 PRO PRO K . n 
K 1 357 THR 357 463 463 THR THR K . n 
K 1 358 GLY 358 464 464 GLY GLY K . n 
K 1 359 GLN 359 465 465 GLN GLN K . n 
K 1 360 ILE 360 466 466 ILE ILE K . n 
K 1 361 LYS 361 467 467 LYS LYS K . n 
K 1 362 ILE 362 468 468 ILE ILE K . n 
K 1 363 LYS 363 469 469 LYS LYS K . n 
K 1 364 ARG 364 470 470 ARG ARG K . n 
K 1 365 GLU 365 471 471 GLU GLU K . n 
K 1 366 ASP 366 472 472 ASP ASP K . n 
K 1 367 TYR 367 473 473 TYR TYR K . n 
K 1 368 GLU 368 474 474 GLU GLU K . n 
K 1 369 SER 369 475 475 SER SER K . n 
K 1 370 LEU 370 476 476 LEU LEU K . n 
K 1 371 PRO 371 477 477 PRO PRO K . n 
K 1 372 LYS 372 478 478 LYS LYS K . n 
K 1 373 GLU 373 479 479 GLU GLU K . n 
K 1 374 VAL 374 480 480 VAL VAL K . n 
K 1 375 ALA 375 481 481 ALA ALA K . n 
K 1 376 SER 376 482 482 SER SER K . n 
K 1 377 ALA 377 483 483 ALA ALA K . n 
K 1 378 LYS 378 484 484 LYS LYS K . n 
K 1 379 PRO 379 485 485 PRO PRO K . n 
K 1 380 LYS 380 486 486 LYS LYS K . n 
K 1 381 VAL 381 487 487 VAL VAL K . n 
K 1 382 LEU 382 488 488 LEU LEU K . n 
K 1 383 LEU 383 489 489 LEU LEU K . n 
K 1 384 ASP 384 490 490 ASP ASP K . n 
K 1 385 VAL 385 491 491 VAL VAL K . n 
K 1 386 LYS 386 492 492 LYS LYS K . n 
K 1 387 LEU 387 493 493 LEU LEU K . n 
K 1 388 LYS 388 494 494 LYS LYS K . n 
K 1 389 ALA 389 495 495 ALA ALA K . n 
K 1 390 GLU 390 496 496 GLU GLU K . n 
K 1 391 ASP 391 497 497 ASP ASP K . n 
K 1 392 PHE 392 498 498 PHE PHE K . n 
K 1 393 ILE 393 499 499 ILE ILE K . n 
K 1 394 VAL 394 500 500 VAL VAL K . n 
K 1 395 ASP 395 501 501 ASP ASP K . n 
K 1 396 VAL 396 502 502 VAL VAL K . n 
K 1 397 ILE 397 503 503 ILE ILE K . n 
K 1 398 ASN 398 504 504 ASN ASN K . n 
K 1 399 MET 399 505 505 MET MET K . n 
K 1 400 ASP 400 506 506 ASP ASP K . n 
K 1 401 TYR 401 507 507 TYR TYR K . n 
K 1 402 GLY 402 508 508 GLY GLY K . n 
K 1 403 MET 403 509 509 MET MET K . n 
K 1 404 GLN 404 510 510 GLN GLN K . n 
K 1 405 GLU 405 511 511 GLU GLU K . n 
K 1 406 LYS 406 512 512 LYS LYS K . n 
K 1 407 ASN 407 513 513 ASN ASN K . n 
K 1 408 PRO 408 514 514 PRO PRO K . n 
K 1 409 ILE 409 515 515 ILE ILE K . n 
K 1 410 ASP 410 516 516 ASP ASP K . n 
K 1 411 HIS 411 517 517 HIS HIS K . n 
K 1 412 VAL 412 518 518 VAL VAL K . n 
K 1 413 SER 413 519 519 SER SER K . n 
K 1 414 PHE 414 520 520 PHE PHE K . n 
K 1 415 TYR 415 521 521 TYR TYR K . n 
K 1 416 CYS 416 522 522 CYS CYS K . n 
K 1 417 LYS 417 523 523 LYS LYS K . n 
K 1 418 THR 418 524 524 THR THR K . n 
K 1 419 ALA 419 525 525 ALA ALA K . n 
K 1 420 PRO 420 526 526 PRO PRO K . n 
K 1 421 ASN 421 527 527 ASN ASN K . n 
K 1 422 ARG 422 528 528 ARG ARG K . n 
K 1 423 ALA 423 529 529 ALA ALA K . n 
K 1 424 ILE 424 530 530 ILE ILE K . n 
K 1 425 ARG 425 531 531 ARG ARG K . n 
K 1 426 ILE 426 532 532 ILE ILE K . n 
K 1 427 THR 427 533 533 THR THR K . n 
K 1 428 LYS 428 534 534 LYS LYS K . n 
K 1 429 ASN 429 535 535 ASN ASN K . n 
K 1 430 GLN 430 536 536 GLN GLN K . n 
K 1 431 VAL 431 537 537 VAL VAL K . n 
K 1 432 SER 432 538 538 SER SER K . n 
K 1 433 GLN 433 539 539 GLN GLN K . n 
K 1 434 LEU 434 540 540 LEU LEU K . n 
K 1 435 LEU 435 541 541 LEU LEU K . n 
K 1 436 PRO 436 542 542 PRO PRO K . n 
K 1 437 GLU 437 543 543 GLU GLU K . n 
K 1 438 LYS 438 544 544 LYS LYS K . n 
K 1 439 PHE 439 545 545 PHE PHE K . n 
K 1 440 ALA 440 546 546 ALA ALA K . n 
K 1 441 GLU 441 547 547 GLU GLU K . n 
K 1 442 GLN 442 548 548 GLN GLN K . n 
K 1 443 LEU 443 549 549 LEU LEU K . n 
K 1 444 ILE 444 550 550 ILE ILE K . n 
K 1 445 ARG 445 551 551 ARG ARG K . n 
K 1 446 VAL 446 552 552 VAL VAL K . n 
K 1 447 TYR 447 553 553 TYR TYR K . n 
K 1 448 CYS 448 554 554 CYS CYS K . n 
K 1 449 LYS 449 555 555 LYS LYS K . n 
K 1 450 LYS 450 556 556 LYS LYS K . n 
K 1 451 VAL 451 557 557 VAL VAL K . n 
K 1 452 ASP 452 558 558 ASP ASP K . n 
K 1 453 ARG 453 559 559 ARG ARG K . n 
K 1 454 LYS 454 560 560 LYS LYS K . n 
K 1 455 SER 455 561 561 SER SER K . n 
K 1 456 LEU 456 562 562 LEU LEU K . n 
K 1 457 TYR 457 563 563 TYR TYR K . n 
K 1 458 ALA 458 564 564 ALA ALA K . n 
K 1 459 ALA 459 565 565 ALA ALA K . n 
K 1 460 ARG 460 566 566 ARG ARG K . n 
K 1 461 GLN 461 567 567 GLN GLN K . n 
K 1 462 TYR 462 568 568 TYR TYR K . n 
K 1 463 PHE 463 569 569 PHE PHE K . n 
K 1 464 VAL 464 570 570 VAL VAL K . n 
K 1 465 GLN 465 571 571 GLN GLN K . n 
K 1 466 TRP 466 572 572 TRP TRP K . n 
K 1 467 CYS 467 573 573 CYS CYS K . n 
K 1 468 ALA 468 574 574 ALA ALA K . n 
K 1 469 ASP 469 575 575 ASP ASP K . n 
K 1 470 ARG 470 576 576 ARG ARG K . n 
K 1 471 ASN 471 577 577 ASN ASN K . n 
K 1 472 PHE 472 578 578 PHE PHE K . n 
K 1 473 THR 473 579 579 THR THR K . n 
K 1 474 LYS 474 580 580 LYS LYS K . n 
K 1 475 PRO 475 581 581 PRO PRO K . n 
K 1 476 GLN 476 582 582 GLN GLN K . n 
K 1 477 ASP 477 583 583 ASP ASP K . n 
K 1 478 GLY 478 584 584 GLY GLY K . n 
K 1 479 ASP 479 585 585 ASP ASP K . n 
K 1 480 VAL 480 586 586 VAL VAL K . n 
K 1 481 ILE 481 587 587 ILE ILE K . n 
K 1 482 ALA 482 588 588 ALA ALA K . n 
K 1 483 PRO 483 589 589 PRO PRO K . n 
K 1 484 LEU 484 590 590 LEU LEU K . n 
K 1 485 ILE 485 591 591 ILE ILE K . n 
K 1 486 THR 486 592 592 THR THR K . n 
K 1 487 PRO 487 593 593 PRO PRO K . n 
K 1 488 GLN 488 594 594 GLN GLN K . n 
K 1 489 LYS 489 595 595 LYS LYS K . n 
K 1 490 LYS 490 596 596 LYS LYS K . n 
K 1 491 GLU 491 597 597 GLU GLU K . n 
K 1 492 TRP 492 598 598 TRP TRP K . n 
K 1 493 ASN 493 599 599 ASN ASN K . n 
K 1 494 ASP 494 600 ?   ?   ?   K . n 
K 1 495 SER 495 601 ?   ?   ?   K . n 
K 1 496 THR 496 602 ?   ?   ?   K . n 
K 1 497 SER 497 603 ?   ?   ?   K . n 
K 1 498 VAL 498 604 ?   ?   ?   K . n 
K 1 499 GLN 499 605 ?   ?   ?   K . n 
K 1 500 ASN 500 606 ?   ?   ?   K . n 
K 1 501 PRO 501 607 ?   ?   ?   K . n 
K 1 502 THR 502 608 ?   ?   ?   K . n 
K 1 503 ARG 503 609 ?   ?   ?   K . n 
K 1 504 LEU 504 610 ?   ?   ?   K . n 
K 1 505 ARG 505 611 ?   ?   ?   K . n 
K 1 506 GLU 506 612 ?   ?   ?   K . n 
K 1 507 ALA 507 613 ?   ?   ?   K . n 
K 1 508 SER 508 614 ?   ?   ?   K . n 
K 1 509 LYS 509 615 ?   ?   ?   K . n 
K 1 510 SER 510 616 ?   ?   ?   K . n 
K 1 511 ARG 511 617 ?   ?   ?   K . n 
K 1 512 VAL 512 618 ?   ?   ?   K . n 
K 1 513 GLN 513 619 ?   ?   ?   K . n 
K 1 514 LEU 514 620 ?   ?   ?   K . n 
K 1 515 PHE 515 621 ?   ?   ?   K . n 
K 1 516 LYS 516 622 ?   ?   ?   K . n 
K 1 517 ASP 517 623 ?   ?   ?   K . n 
K 1 518 ASP 518 624 ?   ?   ?   K . n 
K 1 519 PRO 519 625 ?   ?   ?   K . n 
K 1 520 MET 520 626 ?   ?   ?   K . n 
L 1 1   GLY 1   107 ?   ?   ?   L . n 
L 1 2   SER 2   108 ?   ?   ?   L . n 
L 1 3   GLN 3   109 ?   ?   ?   L . n 
L 1 4   ILE 4   110 ?   ?   ?   L . n 
L 1 5   HIS 5   111 ?   ?   ?   L . n 
L 1 6   VAL 6   112 ?   ?   ?   L . n 
L 1 7   ASP 7   113 ?   ?   ?   L . n 
L 1 8   THR 8   114 ?   ?   ?   L . n 
L 1 9   MET 9   115 115 MET MET L . n 
L 1 10  LYS 10  116 116 LYS LYS L . n 
L 1 11  VAL 11  117 117 VAL VAL L . n 
L 1 12  ILE 12  118 118 ILE ILE L . n 
L 1 13  ASN 13  119 119 ASN ASN L . n 
L 1 14  ASP 14  120 120 ASP ASP L . n 
L 1 15  PRO 15  121 121 PRO PRO L . n 
L 1 16  ILE 16  122 122 ILE ILE L . n 
L 1 17  HIS 17  123 123 HIS HIS L . n 
L 1 18  GLY 18  124 124 GLY GLY L . n 
L 1 19  HIS 19  125 125 HIS HIS L . n 
L 1 20  ILE 20  126 126 ILE ILE L . n 
L 1 21  GLU 21  127 127 GLU GLU L . n 
L 1 22  LEU 22  128 128 LEU LEU L . n 
L 1 23  HIS 23  129 129 HIS HIS L . n 
L 1 24  PRO 24  130 130 PRO PRO L . n 
L 1 25  LEU 25  131 131 LEU LEU L . n 
L 1 26  LEU 26  132 132 LEU LEU L . n 
L 1 27  VAL 27  133 133 VAL VAL L . n 
L 1 28  ARG 28  134 134 ARG ARG L . n 
L 1 29  ILE 29  135 135 ILE ILE L . n 
L 1 30  ILE 30  136 136 ILE ILE L . n 
L 1 31  ASP 31  137 137 ASP ASP L . n 
L 1 32  THR 32  138 138 THR THR L . n 
L 1 33  PRO 33  139 139 PRO PRO L . n 
L 1 34  GLN 34  140 140 GLN GLN L . n 
L 1 35  PHE 35  141 141 PHE PHE L . n 
L 1 36  GLN 36  142 142 GLN GLN L . n 
L 1 37  ARG 37  143 143 ARG ARG L . n 
L 1 38  LEU 38  144 144 LEU LEU L . n 
L 1 39  ARG 39  145 145 ARG ARG L . n 
L 1 40  TYR 40  146 146 TYR TYR L . n 
L 1 41  ILE 41  147 147 ILE ILE L . n 
L 1 42  LYS 42  148 148 LYS LYS L . n 
L 1 43  GLN 43  149 149 GLN GLN L . n 
L 1 44  LEU 44  150 150 LEU LEU L . n 
L 1 45  GLY 45  151 151 GLY GLY L . n 
L 1 46  GLY 46  152 152 GLY GLY L . n 
L 1 47  GLY 47  153 153 GLY GLY L . n 
L 1 48  TYR 48  154 154 TYR TYR L . n 
L 1 49  TYR 49  155 155 TYR TYR L . n 
L 1 50  VAL 50  156 156 VAL VAL L . n 
L 1 51  PHE 51  157 157 PHE PHE L . n 
L 1 52  PRO 52  158 158 PRO PRO L . n 
L 1 53  GLY 53  159 159 GLY GLY L . n 
L 1 54  ALA 54  160 160 ALA ALA L . n 
L 1 55  SER 55  161 161 SER SER L . n 
L 1 56  HIS 56  162 162 HIS HIS L . n 
L 1 57  ASN 57  163 163 ASN ASN L . n 
L 1 58  ARG 58  164 164 ARG ARG L . n 
L 1 59  PHE 59  165 165 PHE PHE L . n 
L 1 60  GLU 60  166 166 GLU GLU L . n 
L 1 61  HIS 61  167 167 HIS HIS L . n 
L 1 62  SER 62  168 168 SER SER L . n 
L 1 63  LEU 63  169 169 LEU LEU L . n 
L 1 64  GLY 64  170 170 GLY GLY L . n 
L 1 65  VAL 65  171 171 VAL VAL L . n 
L 1 66  GLY 66  172 172 GLY GLY L . n 
L 1 67  TYR 67  173 173 TYR TYR L . n 
L 1 68  LEU 68  174 174 LEU LEU L . n 
L 1 69  ALA 69  175 175 ALA ALA L . n 
L 1 70  GLY 70  176 176 GLY GLY L . n 
L 1 71  CYS 71  177 177 CYS CYS L . n 
L 1 72  LEU 72  178 178 LEU LEU L . n 
L 1 73  VAL 73  179 179 VAL VAL L . n 
L 1 74  HIS 74  180 180 HIS HIS L . n 
L 1 75  ALA 75  181 181 ALA ALA L . n 
L 1 76  LEU 76  182 182 LEU LEU L . n 
L 1 77  GLY 77  183 183 GLY GLY L . n 
L 1 78  GLU 78  184 184 GLU GLU L . n 
L 1 79  LYS 79  185 185 LYS LYS L . n 
L 1 80  GLN 80  186 186 GLN GLN L . n 
L 1 81  PRO 81  187 187 PRO PRO L . n 
L 1 82  GLU 82  188 188 GLU GLU L . n 
L 1 83  LEU 83  189 189 LEU LEU L . n 
L 1 84  GLN 84  190 190 GLN GLN L . n 
L 1 85  ILE 85  191 191 ILE ILE L . n 
L 1 86  SER 86  192 192 SER SER L . n 
L 1 87  GLU 87  193 193 GLU GLU L . n 
L 1 88  ARG 88  194 194 ARG ARG L . n 
L 1 89  ASP 89  195 195 ASP ASP L . n 
L 1 90  VAL 90  196 196 VAL VAL L . n 
L 1 91  LEU 91  197 197 LEU LEU L . n 
L 1 92  CYS 92  198 198 CYS CYS L . n 
L 1 93  VAL 93  199 199 VAL VAL L . n 
L 1 94  GLN 94  200 200 GLN GLN L . n 
L 1 95  ILE 95  201 201 ILE ILE L . n 
L 1 96  ALA 96  202 202 ALA ALA L . n 
L 1 97  GLY 97  203 203 GLY GLY L . n 
L 1 98  LEU 98  204 204 LEU LEU L . n 
L 1 99  CYS 99  205 205 CYS CYS L . n 
L 1 100 HIS 100 206 206 HIS HIS L . n 
L 1 101 ASP 101 207 207 ASP ASP L . n 
L 1 102 LEU 102 208 208 LEU LEU L . n 
L 1 103 GLY 103 209 209 GLY GLY L . n 
L 1 104 HIS 104 210 210 HIS HIS L . n 
L 1 105 GLY 105 211 211 GLY GLY L . n 
L 1 106 PRO 106 212 212 PRO PRO L . n 
L 1 107 PHE 107 213 213 PHE PHE L . n 
L 1 108 SER 108 214 214 SER SER L . n 
L 1 109 HIS 109 215 215 HIS HIS L . n 
L 1 110 MET 110 216 216 MET MET L . n 
L 1 111 PHE 111 217 217 PHE PHE L . n 
L 1 112 ASP 112 218 218 ASP ASP L . n 
L 1 113 GLY 113 219 219 GLY GLY L . n 
L 1 114 ARG 114 220 220 ARG ARG L . n 
L 1 115 PHE 115 221 221 PHE PHE L . n 
L 1 116 ILE 116 222 222 ILE ILE L . n 
L 1 117 PRO 117 223 223 PRO PRO L . n 
L 1 118 LEU 118 224 224 LEU LEU L . n 
L 1 119 ALA 119 225 225 ALA ALA L . n 
L 1 120 ARG 120 226 226 ARG ARG L . n 
L 1 121 PRO 121 227 227 PRO PRO L . n 
L 1 122 GLU 122 228 228 GLU GLU L . n 
L 1 123 VAL 123 229 229 VAL VAL L . n 
L 1 124 LYS 124 230 230 LYS LYS L . n 
L 1 125 TRP 125 231 231 TRP TRP L . n 
L 1 126 THR 126 232 232 THR THR L . n 
L 1 127 HIS 127 233 233 HIS HIS L . n 
L 1 128 GLU 128 234 234 GLU GLU L . n 
L 1 129 GLN 129 235 235 GLN GLN L . n 
L 1 130 GLY 130 236 236 GLY GLY L . n 
L 1 131 SER 131 237 237 SER SER L . n 
L 1 132 VAL 132 238 238 VAL VAL L . n 
L 1 133 MET 133 239 239 MET MET L . n 
L 1 134 MET 134 240 240 MET MET L . n 
L 1 135 PHE 135 241 241 PHE PHE L . n 
L 1 136 GLU 136 242 242 GLU GLU L . n 
L 1 137 HIS 137 243 243 HIS HIS L . n 
L 1 138 LEU 138 244 244 LEU LEU L . n 
L 1 139 ILE 139 245 245 ILE ILE L . n 
L 1 140 ASN 140 246 246 ASN ASN L . n 
L 1 141 SER 141 247 247 SER SER L . n 
L 1 142 ASN 142 248 248 ASN ASN L . n 
L 1 143 GLY 143 249 249 GLY GLY L . n 
L 1 144 ILE 144 250 250 ILE ILE L . n 
L 1 145 LYS 145 251 251 LYS LYS L . n 
L 1 146 PRO 146 252 252 PRO PRO L . n 
L 1 147 VAL 147 253 253 VAL VAL L . n 
L 1 148 MET 148 254 254 MET MET L . n 
L 1 149 GLU 149 255 255 GLU GLU L . n 
L 1 150 GLN 150 256 256 GLN GLN L . n 
L 1 151 TYR 151 257 257 TYR TYR L . n 
L 1 152 GLY 152 258 258 GLY GLY L . n 
L 1 153 LEU 153 259 259 LEU LEU L . n 
L 1 154 ILE 154 260 260 ILE ILE L . n 
L 1 155 PRO 155 261 261 PRO PRO L . n 
L 1 156 GLU 156 262 262 GLU GLU L . n 
L 1 157 GLU 157 263 263 GLU GLU L . n 
L 1 158 ASP 158 264 264 ASP ASP L . n 
L 1 159 ILE 159 265 265 ILE ILE L . n 
L 1 160 CYS 160 266 266 CYS CYS L . n 
L 1 161 PHE 161 267 267 PHE PHE L . n 
L 1 162 ILE 162 268 268 ILE ILE L . n 
L 1 163 LYS 163 269 269 LYS LYS L . n 
L 1 164 GLU 164 270 270 GLU GLU L . n 
L 1 165 GLN 165 271 271 GLN GLN L . n 
L 1 166 ILE 166 272 272 ILE ILE L . n 
L 1 167 VAL 167 273 273 VAL VAL L . n 
L 1 168 GLY 168 274 274 GLY GLY L . n 
L 1 169 PRO 169 275 275 PRO PRO L . n 
L 1 170 LEU 170 276 ?   ?   ?   L . n 
L 1 171 GLU 171 277 ?   ?   ?   L . n 
L 1 172 SER 172 278 ?   ?   ?   L . n 
L 1 173 PRO 173 279 ?   ?   ?   L . n 
L 1 174 VAL 174 280 ?   ?   ?   L . n 
L 1 175 GLU 175 281 ?   ?   ?   L . n 
L 1 176 ASP 176 282 ?   ?   ?   L . n 
L 1 177 SER 177 283 ?   ?   ?   L . n 
L 1 178 LEU 178 284 284 LEU LEU L . n 
L 1 179 TRP 179 285 285 TRP TRP L . n 
L 1 180 PRO 180 286 286 PRO PRO L . n 
L 1 181 TYR 181 287 287 TYR TYR L . n 
L 1 182 LYS 182 288 288 LYS LYS L . n 
L 1 183 GLY 183 289 289 GLY GLY L . n 
L 1 184 ARG 184 290 290 ARG ARG L . n 
L 1 185 PRO 185 291 291 PRO PRO L . n 
L 1 186 GLU 186 292 292 GLU GLU L . n 
L 1 187 ASN 187 293 293 ASN ASN L . n 
L 1 188 LYS 188 294 294 LYS LYS L . n 
L 1 189 SER 189 295 295 SER SER L . n 
L 1 190 PHE 190 296 296 PHE PHE L . n 
L 1 191 LEU 191 297 297 LEU LEU L . n 
L 1 192 TYR 192 298 298 TYR TYR L . n 
L 1 193 GLU 193 299 299 GLU GLU L . n 
L 1 194 ILE 194 300 300 ILE ILE L . n 
L 1 195 VAL 195 301 301 VAL VAL L . n 
L 1 196 SER 196 302 302 SER SER L . n 
L 1 197 ASN 197 303 303 ASN ASN L . n 
L 1 198 LYS 198 304 304 LYS LYS L . n 
L 1 199 ARG 199 305 305 ARG ARG L . n 
L 1 200 ASN 200 306 306 ASN ASN L . n 
L 1 201 GLY 201 307 307 GLY GLY L . n 
L 1 202 ILE 202 308 308 ILE ILE L . n 
L 1 203 ASP 203 309 309 ASP ASP L . n 
L 1 204 VAL 204 310 310 VAL VAL L . n 
L 1 205 ASP 205 311 311 ASP ASP L . n 
L 1 206 LYS 206 312 312 LYS LYS L . n 
L 1 207 TRP 207 313 313 TRP TRP L . n 
L 1 208 ASP 208 314 314 ASP ASP L . n 
L 1 209 TYR 209 315 315 TYR TYR L . n 
L 1 210 PHE 210 316 316 PHE PHE L . n 
L 1 211 ALA 211 317 317 ALA ALA L . n 
L 1 212 ARG 212 318 318 ARG ARG L . n 
L 1 213 ASP 213 319 319 ASP ASP L . n 
L 1 214 CYS 214 320 320 CYS CYS L . n 
L 1 215 HIS 215 321 321 HIS HIS L . n 
L 1 216 HIS 216 322 322 HIS HIS L . n 
L 1 217 LEU 217 323 323 LEU LEU L . n 
L 1 218 GLY 218 324 324 GLY GLY L . n 
L 1 219 ILE 219 325 325 ILE ILE L . n 
L 1 220 GLN 220 326 326 GLN GLN L . n 
L 1 221 ASN 221 327 327 ASN ASN L . n 
L 1 222 ASN 222 328 328 ASN ASN L . n 
L 1 223 PHE 223 329 329 PHE PHE L . n 
L 1 224 ASP 224 330 330 ASP ASP L . n 
L 1 225 TYR 225 331 331 TYR TYR L . n 
L 1 226 LYS 226 332 332 LYS LYS L . n 
L 1 227 ARG 227 333 333 ARG ARG L . n 
L 1 228 PHE 228 334 334 PHE PHE L . n 
L 1 229 ILE 229 335 335 ILE ILE L . n 
L 1 230 LYS 230 336 336 LYS LYS L . n 
L 1 231 PHE 231 337 337 PHE PHE L . n 
L 1 232 ALA 232 338 338 ALA ALA L . n 
L 1 233 ARG 233 339 339 ARG ARG L . n 
L 1 234 VAL 234 340 340 VAL VAL L . n 
L 1 235 CYS 235 341 341 CYS CYS L . n 
L 1 236 GLU 236 342 342 GLU GLU L . n 
L 1 237 VAL 237 343 343 VAL VAL L . n 
L 1 238 ASP 238 344 344 ASP ASP L . n 
L 1 239 ASN 239 345 345 ASN ASN L . n 
L 1 240 GLU 240 346 346 GLU GLU L . n 
L 1 241 LEU 241 347 347 LEU LEU L . n 
L 1 242 ARG 242 348 348 ARG ARG L . n 
L 1 243 ILE 243 349 349 ILE ILE L . n 
L 1 244 CYS 244 350 350 CYS CYS L . n 
L 1 245 ALA 245 351 351 ALA ALA L . n 
L 1 246 ARG 246 352 352 ARG ARG L . n 
L 1 247 ASP 247 353 353 ASP ASP L . n 
L 1 248 LYS 248 354 354 LYS LYS L . n 
L 1 249 GLU 249 355 355 GLU GLU L . n 
L 1 250 VAL 250 356 356 VAL VAL L . n 
L 1 251 GLY 251 357 357 GLY GLY L . n 
L 1 252 ASN 252 358 358 ASN ASN L . n 
L 1 253 LEU 253 359 359 LEU LEU L . n 
L 1 254 TYR 254 360 360 TYR TYR L . n 
L 1 255 ASP 255 361 361 ASP ASP L . n 
L 1 256 MET 256 362 362 MET MET L . n 
L 1 257 PHE 257 363 363 PHE PHE L . n 
L 1 258 HIS 258 364 364 HIS HIS L . n 
L 1 259 THR 259 365 365 THR THR L . n 
L 1 260 ARG 260 366 366 ARG ARG L . n 
L 1 261 ASN 261 367 367 ASN ASN L . n 
L 1 262 SER 262 368 368 SER SER L . n 
L 1 263 LEU 263 369 369 LEU LEU L . n 
L 1 264 HIS 264 370 370 HIS HIS L . n 
L 1 265 ARG 265 371 371 ARG ARG L . n 
L 1 266 ARG 266 372 372 ARG ARG L . n 
L 1 267 ALA 267 373 373 ALA ALA L . n 
L 1 268 TYR 268 374 374 TYR TYR L . n 
L 1 269 GLN 269 375 375 GLN GLN L . n 
L 1 270 HIS 270 376 376 HIS HIS L . n 
L 1 271 LYS 271 377 377 LYS LYS L . n 
L 1 272 VAL 272 378 378 VAL VAL L . n 
L 1 273 GLY 273 379 379 GLY GLY L . n 
L 1 274 ASN 274 380 380 ASN ASN L . n 
L 1 275 ILE 275 381 381 ILE ILE L . n 
L 1 276 ILE 276 382 382 ILE ILE L . n 
L 1 277 ASP 277 383 383 ASP ASP L . n 
L 1 278 THR 278 384 384 THR THR L . n 
L 1 279 MET 279 385 385 MET MET L . n 
L 1 280 ILE 280 386 386 ILE ILE L . n 
L 1 281 THR 281 387 387 THR THR L . n 
L 1 282 ASP 282 388 388 ASP ASP L . n 
L 1 283 ALA 283 389 389 ALA ALA L . n 
L 1 284 PHE 284 390 390 PHE PHE L . n 
L 1 285 LEU 285 391 391 LEU LEU L . n 
L 1 286 LYS 286 392 392 LYS LYS L . n 
L 1 287 ALA 287 393 393 ALA ALA L . n 
L 1 288 ASP 288 394 394 ASP ASP L . n 
L 1 289 ASP 289 395 395 ASP ASP L . n 
L 1 290 TYR 290 396 396 TYR TYR L . n 
L 1 291 ILE 291 397 397 ILE ILE L . n 
L 1 292 GLU 292 398 398 GLU GLU L . n 
L 1 293 ILE 293 399 399 ILE ILE L . n 
L 1 294 THR 294 400 400 THR THR L . n 
L 1 295 GLY 295 401 401 GLY GLY L . n 
L 1 296 ALA 296 402 402 ALA ALA L . n 
L 1 297 GLY 297 403 403 GLY GLY L . n 
L 1 298 GLY 298 404 404 GLY GLY L . n 
L 1 299 LYS 299 405 405 LYS LYS L . n 
L 1 300 LYS 300 406 406 LYS LYS L . n 
L 1 301 TYR 301 407 407 TYR TYR L . n 
L 1 302 ARG 302 408 408 ARG ARG L . n 
L 1 303 ILE 303 409 409 ILE ILE L . n 
L 1 304 SER 304 410 410 SER SER L . n 
L 1 305 THR 305 411 411 THR THR L . n 
L 1 306 ALA 306 412 412 ALA ALA L . n 
L 1 307 ILE 307 413 413 ILE ILE L . n 
L 1 308 ASP 308 414 414 ASP ASP L . n 
L 1 309 ASP 309 415 415 ASP ASP L . n 
L 1 310 MET 310 416 416 MET MET L . n 
L 1 311 GLU 311 417 417 GLU GLU L . n 
L 1 312 ALA 312 418 418 ALA ALA L . n 
L 1 313 TYR 313 419 419 TYR TYR L . n 
L 1 314 THR 314 420 420 THR THR L . n 
L 1 315 LYS 315 421 421 LYS LYS L . n 
L 1 316 LEU 316 422 422 LEU LEU L . n 
L 1 317 THR 317 423 423 THR THR L . n 
L 1 318 ASP 318 424 424 ASP ASP L . n 
L 1 319 ASN 319 425 425 ASN ASN L . n 
L 1 320 ILE 320 426 426 ILE ILE L . n 
L 1 321 PHE 321 427 427 PHE PHE L . n 
L 1 322 LEU 322 428 428 LEU LEU L . n 
L 1 323 GLU 323 429 429 GLU GLU L . n 
L 1 324 ILE 324 430 430 ILE ILE L . n 
L 1 325 LEU 325 431 431 LEU LEU L . n 
L 1 326 TYR 326 432 432 TYR TYR L . n 
L 1 327 SER 327 433 433 SER SER L . n 
L 1 328 THR 328 434 434 THR THR L . n 
L 1 329 ASP 329 435 435 ASP ASP L . n 
L 1 330 PRO 330 436 436 PRO PRO L . n 
L 1 331 LYS 331 437 437 LYS LYS L . n 
L 1 332 LEU 332 438 438 LEU LEU L . n 
L 1 333 LYS 333 439 439 LYS LYS L . n 
L 1 334 ASP 334 440 440 ASP ASP L . n 
L 1 335 ALA 335 441 441 ALA ALA L . n 
L 1 336 ARG 336 442 442 ARG ARG L . n 
L 1 337 GLU 337 443 443 GLU GLU L . n 
L 1 338 ILE 338 444 444 ILE ILE L . n 
L 1 339 LEU 339 445 445 LEU LEU L . n 
L 1 340 LYS 340 446 446 LYS LYS L . n 
L 1 341 GLN 341 447 447 GLN GLN L . n 
L 1 342 ILE 342 448 448 ILE ILE L . n 
L 1 343 GLU 343 449 449 GLU GLU L . n 
L 1 344 TYR 344 450 450 TYR TYR L . n 
L 1 345 ARG 345 451 451 ARG ARG L . n 
L 1 346 ASN 346 452 452 ASN ASN L . n 
L 1 347 LEU 347 453 453 LEU LEU L . n 
L 1 348 PHE 348 454 454 PHE PHE L . n 
L 1 349 LYS 349 455 455 LYS LYS L . n 
L 1 350 TYR 350 456 456 TYR TYR L . n 
L 1 351 VAL 351 457 457 VAL VAL L . n 
L 1 352 GLY 352 458 458 GLY GLY L . n 
L 1 353 GLU 353 459 459 GLU GLU L . n 
L 1 354 THR 354 460 460 THR THR L . n 
L 1 355 GLN 355 461 461 GLN GLN L . n 
L 1 356 PRO 356 462 462 PRO PRO L . n 
L 1 357 THR 357 463 463 THR THR L . n 
L 1 358 GLY 358 464 464 GLY GLY L . n 
L 1 359 GLN 359 465 465 GLN GLN L . n 
L 1 360 ILE 360 466 466 ILE ILE L . n 
L 1 361 LYS 361 467 467 LYS LYS L . n 
L 1 362 ILE 362 468 468 ILE ILE L . n 
L 1 363 LYS 363 469 469 LYS LYS L . n 
L 1 364 ARG 364 470 470 ARG ARG L . n 
L 1 365 GLU 365 471 471 GLU GLU L . n 
L 1 366 ASP 366 472 472 ASP ASP L . n 
L 1 367 TYR 367 473 473 TYR TYR L . n 
L 1 368 GLU 368 474 474 GLU GLU L . n 
L 1 369 SER 369 475 475 SER SER L . n 
L 1 370 LEU 370 476 476 LEU LEU L . n 
L 1 371 PRO 371 477 477 PRO PRO L . n 
L 1 372 LYS 372 478 478 LYS LYS L . n 
L 1 373 GLU 373 479 479 GLU GLU L . n 
L 1 374 VAL 374 480 480 VAL VAL L . n 
L 1 375 ALA 375 481 481 ALA ALA L . n 
L 1 376 SER 376 482 482 SER SER L . n 
L 1 377 ALA 377 483 483 ALA ALA L . n 
L 1 378 LYS 378 484 484 LYS LYS L . n 
L 1 379 PRO 379 485 485 PRO PRO L . n 
L 1 380 LYS 380 486 486 LYS LYS L . n 
L 1 381 VAL 381 487 487 VAL VAL L . n 
L 1 382 LEU 382 488 488 LEU LEU L . n 
L 1 383 LEU 383 489 489 LEU LEU L . n 
L 1 384 ASP 384 490 490 ASP ASP L . n 
L 1 385 VAL 385 491 491 VAL VAL L . n 
L 1 386 LYS 386 492 492 LYS LYS L . n 
L 1 387 LEU 387 493 493 LEU LEU L . n 
L 1 388 LYS 388 494 494 LYS LYS L . n 
L 1 389 ALA 389 495 495 ALA ALA L . n 
L 1 390 GLU 390 496 496 GLU GLU L . n 
L 1 391 ASP 391 497 497 ASP ASP L . n 
L 1 392 PHE 392 498 498 PHE PHE L . n 
L 1 393 ILE 393 499 499 ILE ILE L . n 
L 1 394 VAL 394 500 500 VAL VAL L . n 
L 1 395 ASP 395 501 501 ASP ASP L . n 
L 1 396 VAL 396 502 502 VAL VAL L . n 
L 1 397 ILE 397 503 503 ILE ILE L . n 
L 1 398 ASN 398 504 504 ASN ASN L . n 
L 1 399 MET 399 505 505 MET MET L . n 
L 1 400 ASP 400 506 506 ASP ASP L . n 
L 1 401 TYR 401 507 507 TYR TYR L . n 
L 1 402 GLY 402 508 508 GLY GLY L . n 
L 1 403 MET 403 509 509 MET MET L . n 
L 1 404 GLN 404 510 510 GLN GLN L . n 
L 1 405 GLU 405 511 511 GLU GLU L . n 
L 1 406 LYS 406 512 512 LYS LYS L . n 
L 1 407 ASN 407 513 513 ASN ASN L . n 
L 1 408 PRO 408 514 514 PRO PRO L . n 
L 1 409 ILE 409 515 515 ILE ILE L . n 
L 1 410 ASP 410 516 516 ASP ASP L . n 
L 1 411 HIS 411 517 517 HIS HIS L . n 
L 1 412 VAL 412 518 518 VAL VAL L . n 
L 1 413 SER 413 519 519 SER SER L . n 
L 1 414 PHE 414 520 520 PHE PHE L . n 
L 1 415 TYR 415 521 521 TYR TYR L . n 
L 1 416 CYS 416 522 522 CYS CYS L . n 
L 1 417 LYS 417 523 523 LYS LYS L . n 
L 1 418 THR 418 524 524 THR THR L . n 
L 1 419 ALA 419 525 525 ALA ALA L . n 
L 1 420 PRO 420 526 526 PRO PRO L . n 
L 1 421 ASN 421 527 527 ASN ASN L . n 
L 1 422 ARG 422 528 528 ARG ARG L . n 
L 1 423 ALA 423 529 529 ALA ALA L . n 
L 1 424 ILE 424 530 530 ILE ILE L . n 
L 1 425 ARG 425 531 531 ARG ARG L . n 
L 1 426 ILE 426 532 532 ILE ILE L . n 
L 1 427 THR 427 533 533 THR THR L . n 
L 1 428 LYS 428 534 534 LYS LYS L . n 
L 1 429 ASN 429 535 535 ASN ASN L . n 
L 1 430 GLN 430 536 536 GLN GLN L . n 
L 1 431 VAL 431 537 537 VAL VAL L . n 
L 1 432 SER 432 538 538 SER SER L . n 
L 1 433 GLN 433 539 539 GLN GLN L . n 
L 1 434 LEU 434 540 540 LEU LEU L . n 
L 1 435 LEU 435 541 541 LEU LEU L . n 
L 1 436 PRO 436 542 542 PRO PRO L . n 
L 1 437 GLU 437 543 543 GLU GLU L . n 
L 1 438 LYS 438 544 544 LYS LYS L . n 
L 1 439 PHE 439 545 545 PHE PHE L . n 
L 1 440 ALA 440 546 546 ALA ALA L . n 
L 1 441 GLU 441 547 547 GLU GLU L . n 
L 1 442 GLN 442 548 548 GLN GLN L . n 
L 1 443 LEU 443 549 549 LEU LEU L . n 
L 1 444 ILE 444 550 550 ILE ILE L . n 
L 1 445 ARG 445 551 551 ARG ARG L . n 
L 1 446 VAL 446 552 552 VAL VAL L . n 
L 1 447 TYR 447 553 553 TYR TYR L . n 
L 1 448 CYS 448 554 554 CYS CYS L . n 
L 1 449 LYS 449 555 555 LYS LYS L . n 
L 1 450 LYS 450 556 556 LYS LYS L . n 
L 1 451 VAL 451 557 557 VAL VAL L . n 
L 1 452 ASP 452 558 558 ASP ASP L . n 
L 1 453 ARG 453 559 559 ARG ARG L . n 
L 1 454 LYS 454 560 560 LYS LYS L . n 
L 1 455 SER 455 561 561 SER SER L . n 
L 1 456 LEU 456 562 562 LEU LEU L . n 
L 1 457 TYR 457 563 563 TYR TYR L . n 
L 1 458 ALA 458 564 564 ALA ALA L . n 
L 1 459 ALA 459 565 565 ALA ALA L . n 
L 1 460 ARG 460 566 566 ARG ARG L . n 
L 1 461 GLN 461 567 567 GLN GLN L . n 
L 1 462 TYR 462 568 568 TYR TYR L . n 
L 1 463 PHE 463 569 569 PHE PHE L . n 
L 1 464 VAL 464 570 570 VAL VAL L . n 
L 1 465 GLN 465 571 571 GLN GLN L . n 
L 1 466 TRP 466 572 572 TRP TRP L . n 
L 1 467 CYS 467 573 573 CYS CYS L . n 
L 1 468 ALA 468 574 574 ALA ALA L . n 
L 1 469 ASP 469 575 575 ASP ASP L . n 
L 1 470 ARG 470 576 576 ARG ARG L . n 
L 1 471 ASN 471 577 577 ASN ASN L . n 
L 1 472 PHE 472 578 578 PHE PHE L . n 
L 1 473 THR 473 579 579 THR THR L . n 
L 1 474 LYS 474 580 580 LYS LYS L . n 
L 1 475 PRO 475 581 581 PRO PRO L . n 
L 1 476 GLN 476 582 582 GLN GLN L . n 
L 1 477 ASP 477 583 583 ASP ASP L . n 
L 1 478 GLY 478 584 584 GLY GLY L . n 
L 1 479 ASP 479 585 585 ASP ASP L . n 
L 1 480 VAL 480 586 586 VAL VAL L . n 
L 1 481 ILE 481 587 587 ILE ILE L . n 
L 1 482 ALA 482 588 588 ALA ALA L . n 
L 1 483 PRO 483 589 589 PRO PRO L . n 
L 1 484 LEU 484 590 590 LEU LEU L . n 
L 1 485 ILE 485 591 591 ILE ILE L . n 
L 1 486 THR 486 592 592 THR THR L . n 
L 1 487 PRO 487 593 593 PRO PRO L . n 
L 1 488 GLN 488 594 594 GLN GLN L . n 
L 1 489 LYS 489 595 595 LYS LYS L . n 
L 1 490 LYS 490 596 596 LYS LYS L . n 
L 1 491 GLU 491 597 597 GLU GLU L . n 
L 1 492 TRP 492 598 598 TRP TRP L . n 
L 1 493 ASN 493 599 599 ASN ASN L . n 
L 1 494 ASP 494 600 600 ASP ASP L . n 
L 1 495 SER 495 601 ?   ?   ?   L . n 
L 1 496 THR 496 602 ?   ?   ?   L . n 
L 1 497 SER 497 603 ?   ?   ?   L . n 
L 1 498 VAL 498 604 ?   ?   ?   L . n 
L 1 499 GLN 499 605 ?   ?   ?   L . n 
L 1 500 ASN 500 606 ?   ?   ?   L . n 
L 1 501 PRO 501 607 ?   ?   ?   L . n 
L 1 502 THR 502 608 ?   ?   ?   L . n 
L 1 503 ARG 503 609 ?   ?   ?   L . n 
L 1 504 LEU 504 610 ?   ?   ?   L . n 
L 1 505 ARG 505 611 ?   ?   ?   L . n 
L 1 506 GLU 506 612 ?   ?   ?   L . n 
L 1 507 ALA 507 613 ?   ?   ?   L . n 
L 1 508 SER 508 614 ?   ?   ?   L . n 
L 1 509 LYS 509 615 ?   ?   ?   L . n 
L 1 510 SER 510 616 ?   ?   ?   L . n 
L 1 511 ARG 511 617 ?   ?   ?   L . n 
L 1 512 VAL 512 618 ?   ?   ?   L . n 
L 1 513 GLN 513 619 ?   ?   ?   L . n 
L 1 514 LEU 514 620 ?   ?   ?   L . n 
L 1 515 PHE 515 621 ?   ?   ?   L . n 
L 1 516 LYS 516 622 ?   ?   ?   L . n 
L 1 517 ASP 517 623 ?   ?   ?   L . n 
L 1 518 ASP 518 624 ?   ?   ?   L . n 
L 1 519 PRO 519 625 ?   ?   ?   L . n 
L 1 520 MET 520 626 ?   ?   ?   L . n 
M 1 1   GLY 1   107 ?   ?   ?   M . n 
M 1 2   SER 2   108 ?   ?   ?   M . n 
M 1 3   GLN 3   109 ?   ?   ?   M . n 
M 1 4   ILE 4   110 ?   ?   ?   M . n 
M 1 5   HIS 5   111 ?   ?   ?   M . n 
M 1 6   VAL 6   112 ?   ?   ?   M . n 
M 1 7   ASP 7   113 ?   ?   ?   M . n 
M 1 8   THR 8   114 ?   ?   ?   M . n 
M 1 9   MET 9   115 115 MET MET M . n 
M 1 10  LYS 10  116 116 LYS LYS M . n 
M 1 11  VAL 11  117 117 VAL VAL M . n 
M 1 12  ILE 12  118 118 ILE ILE M . n 
M 1 13  ASN 13  119 119 ASN ASN M . n 
M 1 14  ASP 14  120 120 ASP ASP M . n 
M 1 15  PRO 15  121 121 PRO PRO M . n 
M 1 16  ILE 16  122 122 ILE ILE M . n 
M 1 17  HIS 17  123 123 HIS HIS M . n 
M 1 18  GLY 18  124 124 GLY GLY M . n 
M 1 19  HIS 19  125 125 HIS HIS M . n 
M 1 20  ILE 20  126 126 ILE ILE M . n 
M 1 21  GLU 21  127 127 GLU GLU M . n 
M 1 22  LEU 22  128 128 LEU LEU M . n 
M 1 23  HIS 23  129 129 HIS HIS M . n 
M 1 24  PRO 24  130 130 PRO PRO M . n 
M 1 25  LEU 25  131 131 LEU LEU M . n 
M 1 26  LEU 26  132 132 LEU LEU M . n 
M 1 27  VAL 27  133 133 VAL VAL M . n 
M 1 28  ARG 28  134 134 ARG ARG M . n 
M 1 29  ILE 29  135 135 ILE ILE M . n 
M 1 30  ILE 30  136 136 ILE ILE M . n 
M 1 31  ASP 31  137 137 ASP ASP M . n 
M 1 32  THR 32  138 138 THR THR M . n 
M 1 33  PRO 33  139 139 PRO PRO M . n 
M 1 34  GLN 34  140 140 GLN GLN M . n 
M 1 35  PHE 35  141 141 PHE PHE M . n 
M 1 36  GLN 36  142 142 GLN GLN M . n 
M 1 37  ARG 37  143 143 ARG ARG M . n 
M 1 38  LEU 38  144 144 LEU LEU M . n 
M 1 39  ARG 39  145 145 ARG ARG M . n 
M 1 40  TYR 40  146 146 TYR TYR M . n 
M 1 41  ILE 41  147 147 ILE ILE M . n 
M 1 42  LYS 42  148 148 LYS LYS M . n 
M 1 43  GLN 43  149 149 GLN GLN M . n 
M 1 44  LEU 44  150 150 LEU LEU M . n 
M 1 45  GLY 45  151 151 GLY GLY M . n 
M 1 46  GLY 46  152 152 GLY GLY M . n 
M 1 47  GLY 47  153 153 GLY GLY M . n 
M 1 48  TYR 48  154 154 TYR TYR M . n 
M 1 49  TYR 49  155 155 TYR TYR M . n 
M 1 50  VAL 50  156 156 VAL VAL M . n 
M 1 51  PHE 51  157 157 PHE PHE M . n 
M 1 52  PRO 52  158 158 PRO PRO M . n 
M 1 53  GLY 53  159 159 GLY GLY M . n 
M 1 54  ALA 54  160 160 ALA ALA M . n 
M 1 55  SER 55  161 161 SER SER M . n 
M 1 56  HIS 56  162 162 HIS HIS M . n 
M 1 57  ASN 57  163 163 ASN ASN M . n 
M 1 58  ARG 58  164 164 ARG ARG M . n 
M 1 59  PHE 59  165 165 PHE PHE M . n 
M 1 60  GLU 60  166 166 GLU GLU M . n 
M 1 61  HIS 61  167 167 HIS HIS M . n 
M 1 62  SER 62  168 168 SER SER M . n 
M 1 63  LEU 63  169 169 LEU LEU M . n 
M 1 64  GLY 64  170 170 GLY GLY M . n 
M 1 65  VAL 65  171 171 VAL VAL M . n 
M 1 66  GLY 66  172 172 GLY GLY M . n 
M 1 67  TYR 67  173 173 TYR TYR M . n 
M 1 68  LEU 68  174 174 LEU LEU M . n 
M 1 69  ALA 69  175 175 ALA ALA M . n 
M 1 70  GLY 70  176 176 GLY GLY M . n 
M 1 71  CYS 71  177 177 CYS CYS M . n 
M 1 72  LEU 72  178 178 LEU LEU M . n 
M 1 73  VAL 73  179 179 VAL VAL M . n 
M 1 74  HIS 74  180 180 HIS HIS M . n 
M 1 75  ALA 75  181 181 ALA ALA M . n 
M 1 76  LEU 76  182 182 LEU LEU M . n 
M 1 77  GLY 77  183 183 GLY GLY M . n 
M 1 78  GLU 78  184 184 GLU GLU M . n 
M 1 79  LYS 79  185 185 LYS LYS M . n 
M 1 80  GLN 80  186 186 GLN GLN M . n 
M 1 81  PRO 81  187 187 PRO PRO M . n 
M 1 82  GLU 82  188 188 GLU GLU M . n 
M 1 83  LEU 83  189 189 LEU LEU M . n 
M 1 84  GLN 84  190 190 GLN GLN M . n 
M 1 85  ILE 85  191 191 ILE ILE M . n 
M 1 86  SER 86  192 192 SER SER M . n 
M 1 87  GLU 87  193 193 GLU GLU M . n 
M 1 88  ARG 88  194 194 ARG ARG M . n 
M 1 89  ASP 89  195 195 ASP ASP M . n 
M 1 90  VAL 90  196 196 VAL VAL M . n 
M 1 91  LEU 91  197 197 LEU LEU M . n 
M 1 92  CYS 92  198 198 CYS CYS M . n 
M 1 93  VAL 93  199 199 VAL VAL M . n 
M 1 94  GLN 94  200 200 GLN GLN M . n 
M 1 95  ILE 95  201 201 ILE ILE M . n 
M 1 96  ALA 96  202 202 ALA ALA M . n 
M 1 97  GLY 97  203 203 GLY GLY M . n 
M 1 98  LEU 98  204 204 LEU LEU M . n 
M 1 99  CYS 99  205 205 CYS CYS M . n 
M 1 100 HIS 100 206 206 HIS HIS M . n 
M 1 101 ASP 101 207 207 ASP ASP M . n 
M 1 102 LEU 102 208 208 LEU LEU M . n 
M 1 103 GLY 103 209 209 GLY GLY M . n 
M 1 104 HIS 104 210 210 HIS HIS M . n 
M 1 105 GLY 105 211 211 GLY GLY M . n 
M 1 106 PRO 106 212 212 PRO PRO M . n 
M 1 107 PHE 107 213 213 PHE PHE M . n 
M 1 108 SER 108 214 214 SER SER M . n 
M 1 109 HIS 109 215 215 HIS HIS M . n 
M 1 110 MET 110 216 216 MET MET M . n 
M 1 111 PHE 111 217 217 PHE PHE M . n 
M 1 112 ASP 112 218 218 ASP ASP M . n 
M 1 113 GLY 113 219 219 GLY GLY M . n 
M 1 114 ARG 114 220 220 ARG ARG M . n 
M 1 115 PHE 115 221 221 PHE PHE M . n 
M 1 116 ILE 116 222 222 ILE ILE M . n 
M 1 117 PRO 117 223 223 PRO PRO M . n 
M 1 118 LEU 118 224 224 LEU LEU M . n 
M 1 119 ALA 119 225 225 ALA ALA M . n 
M 1 120 ARG 120 226 226 ARG ARG M . n 
M 1 121 PRO 121 227 227 PRO PRO M . n 
M 1 122 GLU 122 228 228 GLU GLU M . n 
M 1 123 VAL 123 229 229 VAL VAL M . n 
M 1 124 LYS 124 230 230 LYS LYS M . n 
M 1 125 TRP 125 231 231 TRP TRP M . n 
M 1 126 THR 126 232 232 THR THR M . n 
M 1 127 HIS 127 233 233 HIS HIS M . n 
M 1 128 GLU 128 234 234 GLU GLU M . n 
M 1 129 GLN 129 235 235 GLN GLN M . n 
M 1 130 GLY 130 236 236 GLY GLY M . n 
M 1 131 SER 131 237 237 SER SER M . n 
M 1 132 VAL 132 238 238 VAL VAL M . n 
M 1 133 MET 133 239 239 MET MET M . n 
M 1 134 MET 134 240 240 MET MET M . n 
M 1 135 PHE 135 241 241 PHE PHE M . n 
M 1 136 GLU 136 242 242 GLU GLU M . n 
M 1 137 HIS 137 243 243 HIS HIS M . n 
M 1 138 LEU 138 244 244 LEU LEU M . n 
M 1 139 ILE 139 245 245 ILE ILE M . n 
M 1 140 ASN 140 246 246 ASN ASN M . n 
M 1 141 SER 141 247 247 SER SER M . n 
M 1 142 ASN 142 248 248 ASN ASN M . n 
M 1 143 GLY 143 249 249 GLY GLY M . n 
M 1 144 ILE 144 250 250 ILE ILE M . n 
M 1 145 LYS 145 251 251 LYS LYS M . n 
M 1 146 PRO 146 252 252 PRO PRO M . n 
M 1 147 VAL 147 253 253 VAL VAL M . n 
M 1 148 MET 148 254 254 MET MET M . n 
M 1 149 GLU 149 255 255 GLU GLU M . n 
M 1 150 GLN 150 256 256 GLN GLN M . n 
M 1 151 TYR 151 257 257 TYR TYR M . n 
M 1 152 GLY 152 258 258 GLY GLY M . n 
M 1 153 LEU 153 259 259 LEU LEU M . n 
M 1 154 ILE 154 260 260 ILE ILE M . n 
M 1 155 PRO 155 261 261 PRO PRO M . n 
M 1 156 GLU 156 262 262 GLU GLU M . n 
M 1 157 GLU 157 263 263 GLU GLU M . n 
M 1 158 ASP 158 264 264 ASP ASP M . n 
M 1 159 ILE 159 265 265 ILE ILE M . n 
M 1 160 CYS 160 266 266 CYS CYS M . n 
M 1 161 PHE 161 267 267 PHE PHE M . n 
M 1 162 ILE 162 268 268 ILE ILE M . n 
M 1 163 LYS 163 269 269 LYS LYS M . n 
M 1 164 GLU 164 270 270 GLU GLU M . n 
M 1 165 GLN 165 271 271 GLN GLN M . n 
M 1 166 ILE 166 272 272 ILE ILE M . n 
M 1 167 VAL 167 273 273 VAL VAL M . n 
M 1 168 GLY 168 274 274 GLY GLY M . n 
M 1 169 PRO 169 275 275 PRO PRO M . n 
M 1 170 LEU 170 276 ?   ?   ?   M . n 
M 1 171 GLU 171 277 ?   ?   ?   M . n 
M 1 172 SER 172 278 ?   ?   ?   M . n 
M 1 173 PRO 173 279 ?   ?   ?   M . n 
M 1 174 VAL 174 280 ?   ?   ?   M . n 
M 1 175 GLU 175 281 ?   ?   ?   M . n 
M 1 176 ASP 176 282 ?   ?   ?   M . n 
M 1 177 SER 177 283 ?   ?   ?   M . n 
M 1 178 LEU 178 284 ?   ?   ?   M . n 
M 1 179 TRP 179 285 285 TRP TRP M . n 
M 1 180 PRO 180 286 286 PRO PRO M . n 
M 1 181 TYR 181 287 287 TYR TYR M . n 
M 1 182 LYS 182 288 288 LYS LYS M . n 
M 1 183 GLY 183 289 289 GLY GLY M . n 
M 1 184 ARG 184 290 290 ARG ARG M . n 
M 1 185 PRO 185 291 291 PRO PRO M . n 
M 1 186 GLU 186 292 292 GLU GLU M . n 
M 1 187 ASN 187 293 293 ASN ASN M . n 
M 1 188 LYS 188 294 294 LYS LYS M . n 
M 1 189 SER 189 295 295 SER SER M . n 
M 1 190 PHE 190 296 296 PHE PHE M . n 
M 1 191 LEU 191 297 297 LEU LEU M . n 
M 1 192 TYR 192 298 298 TYR TYR M . n 
M 1 193 GLU 193 299 299 GLU GLU M . n 
M 1 194 ILE 194 300 300 ILE ILE M . n 
M 1 195 VAL 195 301 301 VAL VAL M . n 
M 1 196 SER 196 302 302 SER SER M . n 
M 1 197 ASN 197 303 303 ASN ASN M . n 
M 1 198 LYS 198 304 304 LYS LYS M . n 
M 1 199 ARG 199 305 305 ARG ARG M . n 
M 1 200 ASN 200 306 306 ASN ASN M . n 
M 1 201 GLY 201 307 307 GLY GLY M . n 
M 1 202 ILE 202 308 308 ILE ILE M . n 
M 1 203 ASP 203 309 309 ASP ASP M . n 
M 1 204 VAL 204 310 310 VAL VAL M . n 
M 1 205 ASP 205 311 311 ASP ASP M . n 
M 1 206 LYS 206 312 312 LYS LYS M . n 
M 1 207 TRP 207 313 313 TRP TRP M . n 
M 1 208 ASP 208 314 314 ASP ASP M . n 
M 1 209 TYR 209 315 315 TYR TYR M . n 
M 1 210 PHE 210 316 316 PHE PHE M . n 
M 1 211 ALA 211 317 317 ALA ALA M . n 
M 1 212 ARG 212 318 318 ARG ARG M . n 
M 1 213 ASP 213 319 319 ASP ASP M . n 
M 1 214 CYS 214 320 320 CYS CYS M . n 
M 1 215 HIS 215 321 321 HIS HIS M . n 
M 1 216 HIS 216 322 322 HIS HIS M . n 
M 1 217 LEU 217 323 323 LEU LEU M . n 
M 1 218 GLY 218 324 324 GLY GLY M . n 
M 1 219 ILE 219 325 325 ILE ILE M . n 
M 1 220 GLN 220 326 326 GLN GLN M . n 
M 1 221 ASN 221 327 327 ASN ASN M . n 
M 1 222 ASN 222 328 328 ASN ASN M . n 
M 1 223 PHE 223 329 329 PHE PHE M . n 
M 1 224 ASP 224 330 330 ASP ASP M . n 
M 1 225 TYR 225 331 331 TYR TYR M . n 
M 1 226 LYS 226 332 332 LYS LYS M . n 
M 1 227 ARG 227 333 333 ARG ARG M . n 
M 1 228 PHE 228 334 334 PHE PHE M . n 
M 1 229 ILE 229 335 335 ILE ILE M . n 
M 1 230 LYS 230 336 336 LYS LYS M . n 
M 1 231 PHE 231 337 337 PHE PHE M . n 
M 1 232 ALA 232 338 338 ALA ALA M . n 
M 1 233 ARG 233 339 339 ARG ARG M . n 
M 1 234 VAL 234 340 340 VAL VAL M . n 
M 1 235 CYS 235 341 341 CYS CYS M . n 
M 1 236 GLU 236 342 342 GLU GLU M . n 
M 1 237 VAL 237 343 343 VAL VAL M . n 
M 1 238 ASP 238 344 344 ASP ASP M . n 
M 1 239 ASN 239 345 345 ASN ASN M . n 
M 1 240 GLU 240 346 346 GLU GLU M . n 
M 1 241 LEU 241 347 347 LEU LEU M . n 
M 1 242 ARG 242 348 348 ARG ARG M . n 
M 1 243 ILE 243 349 349 ILE ILE M . n 
M 1 244 CYS 244 350 350 CYS CYS M . n 
M 1 245 ALA 245 351 351 ALA ALA M . n 
M 1 246 ARG 246 352 352 ARG ARG M . n 
M 1 247 ASP 247 353 353 ASP ASP M . n 
M 1 248 LYS 248 354 354 LYS LYS M . n 
M 1 249 GLU 249 355 355 GLU GLU M . n 
M 1 250 VAL 250 356 356 VAL VAL M . n 
M 1 251 GLY 251 357 357 GLY GLY M . n 
M 1 252 ASN 252 358 358 ASN ASN M . n 
M 1 253 LEU 253 359 359 LEU LEU M . n 
M 1 254 TYR 254 360 360 TYR TYR M . n 
M 1 255 ASP 255 361 361 ASP ASP M . n 
M 1 256 MET 256 362 362 MET MET M . n 
M 1 257 PHE 257 363 363 PHE PHE M . n 
M 1 258 HIS 258 364 364 HIS HIS M . n 
M 1 259 THR 259 365 365 THR THR M . n 
M 1 260 ARG 260 366 366 ARG ARG M . n 
M 1 261 ASN 261 367 367 ASN ASN M . n 
M 1 262 SER 262 368 368 SER SER M . n 
M 1 263 LEU 263 369 369 LEU LEU M . n 
M 1 264 HIS 264 370 370 HIS HIS M . n 
M 1 265 ARG 265 371 371 ARG ARG M . n 
M 1 266 ARG 266 372 372 ARG ARG M . n 
M 1 267 ALA 267 373 373 ALA ALA M . n 
M 1 268 TYR 268 374 374 TYR TYR M . n 
M 1 269 GLN 269 375 375 GLN GLN M . n 
M 1 270 HIS 270 376 376 HIS HIS M . n 
M 1 271 LYS 271 377 377 LYS LYS M . n 
M 1 272 VAL 272 378 378 VAL VAL M . n 
M 1 273 GLY 273 379 379 GLY GLY M . n 
M 1 274 ASN 274 380 380 ASN ASN M . n 
M 1 275 ILE 275 381 381 ILE ILE M . n 
M 1 276 ILE 276 382 382 ILE ILE M . n 
M 1 277 ASP 277 383 383 ASP ASP M . n 
M 1 278 THR 278 384 384 THR THR M . n 
M 1 279 MET 279 385 385 MET MET M . n 
M 1 280 ILE 280 386 386 ILE ILE M . n 
M 1 281 THR 281 387 387 THR THR M . n 
M 1 282 ASP 282 388 388 ASP ASP M . n 
M 1 283 ALA 283 389 389 ALA ALA M . n 
M 1 284 PHE 284 390 390 PHE PHE M . n 
M 1 285 LEU 285 391 391 LEU LEU M . n 
M 1 286 LYS 286 392 392 LYS LYS M . n 
M 1 287 ALA 287 393 393 ALA ALA M . n 
M 1 288 ASP 288 394 394 ASP ASP M . n 
M 1 289 ASP 289 395 395 ASP ASP M . n 
M 1 290 TYR 290 396 396 TYR TYR M . n 
M 1 291 ILE 291 397 397 ILE ILE M . n 
M 1 292 GLU 292 398 398 GLU GLU M . n 
M 1 293 ILE 293 399 399 ILE ILE M . n 
M 1 294 THR 294 400 400 THR THR M . n 
M 1 295 GLY 295 401 401 GLY GLY M . n 
M 1 296 ALA 296 402 402 ALA ALA M . n 
M 1 297 GLY 297 403 403 GLY GLY M . n 
M 1 298 GLY 298 404 404 GLY GLY M . n 
M 1 299 LYS 299 405 405 LYS LYS M . n 
M 1 300 LYS 300 406 406 LYS LYS M . n 
M 1 301 TYR 301 407 407 TYR TYR M . n 
M 1 302 ARG 302 408 408 ARG ARG M . n 
M 1 303 ILE 303 409 409 ILE ILE M . n 
M 1 304 SER 304 410 410 SER SER M . n 
M 1 305 THR 305 411 411 THR THR M . n 
M 1 306 ALA 306 412 412 ALA ALA M . n 
M 1 307 ILE 307 413 413 ILE ILE M . n 
M 1 308 ASP 308 414 414 ASP ASP M . n 
M 1 309 ASP 309 415 415 ASP ASP M . n 
M 1 310 MET 310 416 416 MET MET M . n 
M 1 311 GLU 311 417 417 GLU GLU M . n 
M 1 312 ALA 312 418 418 ALA ALA M . n 
M 1 313 TYR 313 419 419 TYR TYR M . n 
M 1 314 THR 314 420 420 THR THR M . n 
M 1 315 LYS 315 421 421 LYS LYS M . n 
M 1 316 LEU 316 422 422 LEU LEU M . n 
M 1 317 THR 317 423 423 THR THR M . n 
M 1 318 ASP 318 424 424 ASP ASP M . n 
M 1 319 ASN 319 425 425 ASN ASN M . n 
M 1 320 ILE 320 426 426 ILE ILE M . n 
M 1 321 PHE 321 427 427 PHE PHE M . n 
M 1 322 LEU 322 428 428 LEU LEU M . n 
M 1 323 GLU 323 429 429 GLU GLU M . n 
M 1 324 ILE 324 430 430 ILE ILE M . n 
M 1 325 LEU 325 431 431 LEU LEU M . n 
M 1 326 TYR 326 432 432 TYR TYR M . n 
M 1 327 SER 327 433 433 SER SER M . n 
M 1 328 THR 328 434 434 THR THR M . n 
M 1 329 ASP 329 435 435 ASP ASP M . n 
M 1 330 PRO 330 436 436 PRO PRO M . n 
M 1 331 LYS 331 437 437 LYS LYS M . n 
M 1 332 LEU 332 438 438 LEU LEU M . n 
M 1 333 LYS 333 439 439 LYS LYS M . n 
M 1 334 ASP 334 440 440 ASP ASP M . n 
M 1 335 ALA 335 441 441 ALA ALA M . n 
M 1 336 ARG 336 442 442 ARG ARG M . n 
M 1 337 GLU 337 443 443 GLU GLU M . n 
M 1 338 ILE 338 444 444 ILE ILE M . n 
M 1 339 LEU 339 445 445 LEU LEU M . n 
M 1 340 LYS 340 446 446 LYS LYS M . n 
M 1 341 GLN 341 447 447 GLN GLN M . n 
M 1 342 ILE 342 448 448 ILE ILE M . n 
M 1 343 GLU 343 449 449 GLU GLU M . n 
M 1 344 TYR 344 450 450 TYR TYR M . n 
M 1 345 ARG 345 451 451 ARG ARG M . n 
M 1 346 ASN 346 452 452 ASN ASN M . n 
M 1 347 LEU 347 453 453 LEU LEU M . n 
M 1 348 PHE 348 454 454 PHE PHE M . n 
M 1 349 LYS 349 455 455 LYS LYS M . n 
M 1 350 TYR 350 456 456 TYR TYR M . n 
M 1 351 VAL 351 457 457 VAL VAL M . n 
M 1 352 GLY 352 458 458 GLY GLY M . n 
M 1 353 GLU 353 459 459 GLU GLU M . n 
M 1 354 THR 354 460 460 THR THR M . n 
M 1 355 GLN 355 461 461 GLN GLN M . n 
M 1 356 PRO 356 462 462 PRO PRO M . n 
M 1 357 THR 357 463 463 THR THR M . n 
M 1 358 GLY 358 464 464 GLY GLY M . n 
M 1 359 GLN 359 465 465 GLN GLN M . n 
M 1 360 ILE 360 466 466 ILE ILE M . n 
M 1 361 LYS 361 467 467 LYS LYS M . n 
M 1 362 ILE 362 468 468 ILE ILE M . n 
M 1 363 LYS 363 469 469 LYS LYS M . n 
M 1 364 ARG 364 470 470 ARG ARG M . n 
M 1 365 GLU 365 471 471 GLU GLU M . n 
M 1 366 ASP 366 472 472 ASP ASP M . n 
M 1 367 TYR 367 473 473 TYR TYR M . n 
M 1 368 GLU 368 474 474 GLU GLU M . n 
M 1 369 SER 369 475 475 SER SER M . n 
M 1 370 LEU 370 476 476 LEU LEU M . n 
M 1 371 PRO 371 477 477 PRO PRO M . n 
M 1 372 LYS 372 478 478 LYS LYS M . n 
M 1 373 GLU 373 479 479 GLU GLU M . n 
M 1 374 VAL 374 480 480 VAL VAL M . n 
M 1 375 ALA 375 481 481 ALA ALA M . n 
M 1 376 SER 376 482 482 SER SER M . n 
M 1 377 ALA 377 483 483 ALA ALA M . n 
M 1 378 LYS 378 484 484 LYS LYS M . n 
M 1 379 PRO 379 485 485 PRO PRO M . n 
M 1 380 LYS 380 486 486 LYS LYS M . n 
M 1 381 VAL 381 487 487 VAL VAL M . n 
M 1 382 LEU 382 488 488 LEU LEU M . n 
M 1 383 LEU 383 489 489 LEU LEU M . n 
M 1 384 ASP 384 490 490 ASP ASP M . n 
M 1 385 VAL 385 491 491 VAL VAL M . n 
M 1 386 LYS 386 492 492 LYS LYS M . n 
M 1 387 LEU 387 493 493 LEU LEU M . n 
M 1 388 LYS 388 494 494 LYS LYS M . n 
M 1 389 ALA 389 495 495 ALA ALA M . n 
M 1 390 GLU 390 496 496 GLU GLU M . n 
M 1 391 ASP 391 497 497 ASP ASP M . n 
M 1 392 PHE 392 498 498 PHE PHE M . n 
M 1 393 ILE 393 499 499 ILE ILE M . n 
M 1 394 VAL 394 500 500 VAL VAL M . n 
M 1 395 ASP 395 501 501 ASP ASP M . n 
M 1 396 VAL 396 502 502 VAL VAL M . n 
M 1 397 ILE 397 503 503 ILE ILE M . n 
M 1 398 ASN 398 504 504 ASN ASN M . n 
M 1 399 MET 399 505 505 MET MET M . n 
M 1 400 ASP 400 506 506 ASP ASP M . n 
M 1 401 TYR 401 507 507 TYR TYR M . n 
M 1 402 GLY 402 508 508 GLY GLY M . n 
M 1 403 MET 403 509 509 MET MET M . n 
M 1 404 GLN 404 510 510 GLN GLN M . n 
M 1 405 GLU 405 511 511 GLU GLU M . n 
M 1 406 LYS 406 512 512 LYS LYS M . n 
M 1 407 ASN 407 513 513 ASN ASN M . n 
M 1 408 PRO 408 514 514 PRO PRO M . n 
M 1 409 ILE 409 515 515 ILE ILE M . n 
M 1 410 ASP 410 516 516 ASP ASP M . n 
M 1 411 HIS 411 517 517 HIS HIS M . n 
M 1 412 VAL 412 518 518 VAL VAL M . n 
M 1 413 SER 413 519 519 SER SER M . n 
M 1 414 PHE 414 520 520 PHE PHE M . n 
M 1 415 TYR 415 521 521 TYR TYR M . n 
M 1 416 CYS 416 522 522 CYS CYS M . n 
M 1 417 LYS 417 523 523 LYS LYS M . n 
M 1 418 THR 418 524 524 THR THR M . n 
M 1 419 ALA 419 525 525 ALA ALA M . n 
M 1 420 PRO 420 526 526 PRO PRO M . n 
M 1 421 ASN 421 527 527 ASN ASN M . n 
M 1 422 ARG 422 528 528 ARG ARG M . n 
M 1 423 ALA 423 529 529 ALA ALA M . n 
M 1 424 ILE 424 530 530 ILE ILE M . n 
M 1 425 ARG 425 531 531 ARG ARG M . n 
M 1 426 ILE 426 532 532 ILE ILE M . n 
M 1 427 THR 427 533 533 THR THR M . n 
M 1 428 LYS 428 534 534 LYS LYS M . n 
M 1 429 ASN 429 535 535 ASN ASN M . n 
M 1 430 GLN 430 536 536 GLN GLN M . n 
M 1 431 VAL 431 537 537 VAL VAL M . n 
M 1 432 SER 432 538 538 SER SER M . n 
M 1 433 GLN 433 539 539 GLN GLN M . n 
M 1 434 LEU 434 540 540 LEU LEU M . n 
M 1 435 LEU 435 541 541 LEU LEU M . n 
M 1 436 PRO 436 542 542 PRO PRO M . n 
M 1 437 GLU 437 543 543 GLU GLU M . n 
M 1 438 LYS 438 544 544 LYS LYS M . n 
M 1 439 PHE 439 545 545 PHE PHE M . n 
M 1 440 ALA 440 546 546 ALA ALA M . n 
M 1 441 GLU 441 547 547 GLU GLU M . n 
M 1 442 GLN 442 548 548 GLN GLN M . n 
M 1 443 LEU 443 549 549 LEU LEU M . n 
M 1 444 ILE 444 550 550 ILE ILE M . n 
M 1 445 ARG 445 551 551 ARG ARG M . n 
M 1 446 VAL 446 552 552 VAL VAL M . n 
M 1 447 TYR 447 553 553 TYR TYR M . n 
M 1 448 CYS 448 554 554 CYS CYS M . n 
M 1 449 LYS 449 555 555 LYS LYS M . n 
M 1 450 LYS 450 556 556 LYS LYS M . n 
M 1 451 VAL 451 557 557 VAL VAL M . n 
M 1 452 ASP 452 558 558 ASP ASP M . n 
M 1 453 ARG 453 559 559 ARG ARG M . n 
M 1 454 LYS 454 560 560 LYS LYS M . n 
M 1 455 SER 455 561 561 SER SER M . n 
M 1 456 LEU 456 562 562 LEU LEU M . n 
M 1 457 TYR 457 563 563 TYR TYR M . n 
M 1 458 ALA 458 564 564 ALA ALA M . n 
M 1 459 ALA 459 565 565 ALA ALA M . n 
M 1 460 ARG 460 566 566 ARG ARG M . n 
M 1 461 GLN 461 567 567 GLN GLN M . n 
M 1 462 TYR 462 568 568 TYR TYR M . n 
M 1 463 PHE 463 569 569 PHE PHE M . n 
M 1 464 VAL 464 570 570 VAL VAL M . n 
M 1 465 GLN 465 571 571 GLN GLN M . n 
M 1 466 TRP 466 572 572 TRP TRP M . n 
M 1 467 CYS 467 573 573 CYS CYS M . n 
M 1 468 ALA 468 574 574 ALA ALA M . n 
M 1 469 ASP 469 575 575 ASP ASP M . n 
M 1 470 ARG 470 576 576 ARG ARG M . n 
M 1 471 ASN 471 577 577 ASN ASN M . n 
M 1 472 PHE 472 578 578 PHE PHE M . n 
M 1 473 THR 473 579 579 THR THR M . n 
M 1 474 LYS 474 580 580 LYS LYS M . n 
M 1 475 PRO 475 581 581 PRO PRO M . n 
M 1 476 GLN 476 582 582 GLN GLN M . n 
M 1 477 ASP 477 583 583 ASP ASP M . n 
M 1 478 GLY 478 584 584 GLY GLY M . n 
M 1 479 ASP 479 585 585 ASP ASP M . n 
M 1 480 VAL 480 586 586 VAL VAL M . n 
M 1 481 ILE 481 587 587 ILE ILE M . n 
M 1 482 ALA 482 588 588 ALA ALA M . n 
M 1 483 PRO 483 589 589 PRO PRO M . n 
M 1 484 LEU 484 590 590 LEU LEU M . n 
M 1 485 ILE 485 591 591 ILE ILE M . n 
M 1 486 THR 486 592 592 THR THR M . n 
M 1 487 PRO 487 593 593 PRO PRO M . n 
M 1 488 GLN 488 594 594 GLN GLN M . n 
M 1 489 LYS 489 595 595 LYS LYS M . n 
M 1 490 LYS 490 596 596 LYS LYS M . n 
M 1 491 GLU 491 597 597 GLU GLU M . n 
M 1 492 TRP 492 598 598 TRP TRP M . n 
M 1 493 ASN 493 599 ?   ?   ?   M . n 
M 1 494 ASP 494 600 ?   ?   ?   M . n 
M 1 495 SER 495 601 ?   ?   ?   M . n 
M 1 496 THR 496 602 ?   ?   ?   M . n 
M 1 497 SER 497 603 ?   ?   ?   M . n 
M 1 498 VAL 498 604 ?   ?   ?   M . n 
M 1 499 GLN 499 605 ?   ?   ?   M . n 
M 1 500 ASN 500 606 ?   ?   ?   M . n 
M 1 501 PRO 501 607 ?   ?   ?   M . n 
M 1 502 THR 502 608 ?   ?   ?   M . n 
M 1 503 ARG 503 609 ?   ?   ?   M . n 
M 1 504 LEU 504 610 ?   ?   ?   M . n 
M 1 505 ARG 505 611 ?   ?   ?   M . n 
M 1 506 GLU 506 612 ?   ?   ?   M . n 
M 1 507 ALA 507 613 ?   ?   ?   M . n 
M 1 508 SER 508 614 ?   ?   ?   M . n 
M 1 509 LYS 509 615 ?   ?   ?   M . n 
M 1 510 SER 510 616 ?   ?   ?   M . n 
M 1 511 ARG 511 617 ?   ?   ?   M . n 
M 1 512 VAL 512 618 ?   ?   ?   M . n 
M 1 513 GLN 513 619 ?   ?   ?   M . n 
M 1 514 LEU 514 620 ?   ?   ?   M . n 
M 1 515 PHE 515 621 ?   ?   ?   M . n 
M 1 516 LYS 516 622 ?   ?   ?   M . n 
M 1 517 ASP 517 623 ?   ?   ?   M . n 
M 1 518 ASP 518 624 ?   ?   ?   M . n 
M 1 519 PRO 519 625 ?   ?   ?   M . n 
M 1 520 MET 520 626 ?   ?   ?   M . n 
N 1 1   GLY 1   107 ?   ?   ?   N . n 
N 1 2   SER 2   108 ?   ?   ?   N . n 
N 1 3   GLN 3   109 ?   ?   ?   N . n 
N 1 4   ILE 4   110 ?   ?   ?   N . n 
N 1 5   HIS 5   111 ?   ?   ?   N . n 
N 1 6   VAL 6   112 ?   ?   ?   N . n 
N 1 7   ASP 7   113 ?   ?   ?   N . n 
N 1 8   THR 8   114 ?   ?   ?   N . n 
N 1 9   MET 9   115 115 MET MET N . n 
N 1 10  LYS 10  116 116 LYS LYS N . n 
N 1 11  VAL 11  117 117 VAL VAL N . n 
N 1 12  ILE 12  118 118 ILE ILE N . n 
N 1 13  ASN 13  119 119 ASN ASN N . n 
N 1 14  ASP 14  120 120 ASP ASP N . n 
N 1 15  PRO 15  121 121 PRO PRO N . n 
N 1 16  ILE 16  122 122 ILE ILE N . n 
N 1 17  HIS 17  123 123 HIS HIS N . n 
N 1 18  GLY 18  124 124 GLY GLY N . n 
N 1 19  HIS 19  125 125 HIS HIS N . n 
N 1 20  ILE 20  126 126 ILE ILE N . n 
N 1 21  GLU 21  127 127 GLU GLU N . n 
N 1 22  LEU 22  128 128 LEU LEU N . n 
N 1 23  HIS 23  129 129 HIS HIS N . n 
N 1 24  PRO 24  130 130 PRO PRO N . n 
N 1 25  LEU 25  131 131 LEU LEU N . n 
N 1 26  LEU 26  132 132 LEU LEU N . n 
N 1 27  VAL 27  133 133 VAL VAL N . n 
N 1 28  ARG 28  134 134 ARG ARG N . n 
N 1 29  ILE 29  135 135 ILE ILE N . n 
N 1 30  ILE 30  136 136 ILE ILE N . n 
N 1 31  ASP 31  137 137 ASP ASP N . n 
N 1 32  THR 32  138 138 THR THR N . n 
N 1 33  PRO 33  139 139 PRO PRO N . n 
N 1 34  GLN 34  140 140 GLN GLN N . n 
N 1 35  PHE 35  141 141 PHE PHE N . n 
N 1 36  GLN 36  142 142 GLN GLN N . n 
N 1 37  ARG 37  143 143 ARG ARG N . n 
N 1 38  LEU 38  144 144 LEU LEU N . n 
N 1 39  ARG 39  145 145 ARG ARG N . n 
N 1 40  TYR 40  146 146 TYR TYR N . n 
N 1 41  ILE 41  147 147 ILE ILE N . n 
N 1 42  LYS 42  148 148 LYS LYS N . n 
N 1 43  GLN 43  149 149 GLN GLN N . n 
N 1 44  LEU 44  150 150 LEU LEU N . n 
N 1 45  GLY 45  151 151 GLY GLY N . n 
N 1 46  GLY 46  152 152 GLY GLY N . n 
N 1 47  GLY 47  153 153 GLY GLY N . n 
N 1 48  TYR 48  154 154 TYR TYR N . n 
N 1 49  TYR 49  155 155 TYR TYR N . n 
N 1 50  VAL 50  156 156 VAL VAL N . n 
N 1 51  PHE 51  157 157 PHE PHE N . n 
N 1 52  PRO 52  158 158 PRO PRO N . n 
N 1 53  GLY 53  159 159 GLY GLY N . n 
N 1 54  ALA 54  160 160 ALA ALA N . n 
N 1 55  SER 55  161 161 SER SER N . n 
N 1 56  HIS 56  162 162 HIS HIS N . n 
N 1 57  ASN 57  163 163 ASN ASN N . n 
N 1 58  ARG 58  164 164 ARG ARG N . n 
N 1 59  PHE 59  165 165 PHE PHE N . n 
N 1 60  GLU 60  166 166 GLU GLU N . n 
N 1 61  HIS 61  167 167 HIS HIS N . n 
N 1 62  SER 62  168 168 SER SER N . n 
N 1 63  LEU 63  169 169 LEU LEU N . n 
N 1 64  GLY 64  170 170 GLY GLY N . n 
N 1 65  VAL 65  171 171 VAL VAL N . n 
N 1 66  GLY 66  172 172 GLY GLY N . n 
N 1 67  TYR 67  173 173 TYR TYR N . n 
N 1 68  LEU 68  174 174 LEU LEU N . n 
N 1 69  ALA 69  175 175 ALA ALA N . n 
N 1 70  GLY 70  176 176 GLY GLY N . n 
N 1 71  CYS 71  177 177 CYS CYS N . n 
N 1 72  LEU 72  178 178 LEU LEU N . n 
N 1 73  VAL 73  179 179 VAL VAL N . n 
N 1 74  HIS 74  180 180 HIS HIS N . n 
N 1 75  ALA 75  181 181 ALA ALA N . n 
N 1 76  LEU 76  182 182 LEU LEU N . n 
N 1 77  GLY 77  183 183 GLY GLY N . n 
N 1 78  GLU 78  184 184 GLU GLU N . n 
N 1 79  LYS 79  185 185 LYS LYS N . n 
N 1 80  GLN 80  186 186 GLN GLN N . n 
N 1 81  PRO 81  187 187 PRO PRO N . n 
N 1 82  GLU 82  188 188 GLU GLU N . n 
N 1 83  LEU 83  189 189 LEU LEU N . n 
N 1 84  GLN 84  190 190 GLN GLN N . n 
N 1 85  ILE 85  191 191 ILE ILE N . n 
N 1 86  SER 86  192 192 SER SER N . n 
N 1 87  GLU 87  193 193 GLU GLU N . n 
N 1 88  ARG 88  194 194 ARG ARG N . n 
N 1 89  ASP 89  195 195 ASP ASP N . n 
N 1 90  VAL 90  196 196 VAL VAL N . n 
N 1 91  LEU 91  197 197 LEU LEU N . n 
N 1 92  CYS 92  198 198 CYS CYS N . n 
N 1 93  VAL 93  199 199 VAL VAL N . n 
N 1 94  GLN 94  200 200 GLN GLN N . n 
N 1 95  ILE 95  201 201 ILE ILE N . n 
N 1 96  ALA 96  202 202 ALA ALA N . n 
N 1 97  GLY 97  203 203 GLY GLY N . n 
N 1 98  LEU 98  204 204 LEU LEU N . n 
N 1 99  CYS 99  205 205 CYS CYS N . n 
N 1 100 HIS 100 206 206 HIS HIS N . n 
N 1 101 ASP 101 207 207 ASP ASP N . n 
N 1 102 LEU 102 208 208 LEU LEU N . n 
N 1 103 GLY 103 209 209 GLY GLY N . n 
N 1 104 HIS 104 210 210 HIS HIS N . n 
N 1 105 GLY 105 211 211 GLY GLY N . n 
N 1 106 PRO 106 212 212 PRO PRO N . n 
N 1 107 PHE 107 213 213 PHE PHE N . n 
N 1 108 SER 108 214 214 SER SER N . n 
N 1 109 HIS 109 215 215 HIS HIS N . n 
N 1 110 MET 110 216 216 MET MET N . n 
N 1 111 PHE 111 217 217 PHE PHE N . n 
N 1 112 ASP 112 218 218 ASP ASP N . n 
N 1 113 GLY 113 219 219 GLY GLY N . n 
N 1 114 ARG 114 220 220 ARG ARG N . n 
N 1 115 PHE 115 221 221 PHE PHE N . n 
N 1 116 ILE 116 222 222 ILE ILE N . n 
N 1 117 PRO 117 223 223 PRO PRO N . n 
N 1 118 LEU 118 224 224 LEU LEU N . n 
N 1 119 ALA 119 225 225 ALA ALA N . n 
N 1 120 ARG 120 226 226 ARG ARG N . n 
N 1 121 PRO 121 227 227 PRO PRO N . n 
N 1 122 GLU 122 228 228 GLU GLU N . n 
N 1 123 VAL 123 229 229 VAL VAL N . n 
N 1 124 LYS 124 230 230 LYS LYS N . n 
N 1 125 TRP 125 231 231 TRP TRP N . n 
N 1 126 THR 126 232 232 THR THR N . n 
N 1 127 HIS 127 233 233 HIS HIS N . n 
N 1 128 GLU 128 234 234 GLU GLU N . n 
N 1 129 GLN 129 235 235 GLN GLN N . n 
N 1 130 GLY 130 236 236 GLY GLY N . n 
N 1 131 SER 131 237 237 SER SER N . n 
N 1 132 VAL 132 238 238 VAL VAL N . n 
N 1 133 MET 133 239 239 MET MET N . n 
N 1 134 MET 134 240 240 MET MET N . n 
N 1 135 PHE 135 241 241 PHE PHE N . n 
N 1 136 GLU 136 242 242 GLU GLU N . n 
N 1 137 HIS 137 243 243 HIS HIS N . n 
N 1 138 LEU 138 244 244 LEU LEU N . n 
N 1 139 ILE 139 245 245 ILE ILE N . n 
N 1 140 ASN 140 246 246 ASN ASN N . n 
N 1 141 SER 141 247 247 SER SER N . n 
N 1 142 ASN 142 248 248 ASN ASN N . n 
N 1 143 GLY 143 249 249 GLY GLY N . n 
N 1 144 ILE 144 250 250 ILE ILE N . n 
N 1 145 LYS 145 251 251 LYS LYS N . n 
N 1 146 PRO 146 252 252 PRO PRO N . n 
N 1 147 VAL 147 253 253 VAL VAL N . n 
N 1 148 MET 148 254 254 MET MET N . n 
N 1 149 GLU 149 255 255 GLU GLU N . n 
N 1 150 GLN 150 256 256 GLN GLN N . n 
N 1 151 TYR 151 257 257 TYR TYR N . n 
N 1 152 GLY 152 258 258 GLY GLY N . n 
N 1 153 LEU 153 259 259 LEU LEU N . n 
N 1 154 ILE 154 260 260 ILE ILE N . n 
N 1 155 PRO 155 261 261 PRO PRO N . n 
N 1 156 GLU 156 262 262 GLU GLU N . n 
N 1 157 GLU 157 263 263 GLU GLU N . n 
N 1 158 ASP 158 264 264 ASP ASP N . n 
N 1 159 ILE 159 265 265 ILE ILE N . n 
N 1 160 CYS 160 266 266 CYS CYS N . n 
N 1 161 PHE 161 267 267 PHE PHE N . n 
N 1 162 ILE 162 268 268 ILE ILE N . n 
N 1 163 LYS 163 269 269 LYS LYS N . n 
N 1 164 GLU 164 270 270 GLU GLU N . n 
N 1 165 GLN 165 271 271 GLN GLN N . n 
N 1 166 ILE 166 272 272 ILE ILE N . n 
N 1 167 VAL 167 273 273 VAL VAL N . n 
N 1 168 GLY 168 274 274 GLY GLY N . n 
N 1 169 PRO 169 275 275 PRO PRO N . n 
N 1 170 LEU 170 276 276 LEU LEU N . n 
N 1 171 GLU 171 277 ?   ?   ?   N . n 
N 1 172 SER 172 278 ?   ?   ?   N . n 
N 1 173 PRO 173 279 ?   ?   ?   N . n 
N 1 174 VAL 174 280 ?   ?   ?   N . n 
N 1 175 GLU 175 281 ?   ?   ?   N . n 
N 1 176 ASP 176 282 ?   ?   ?   N . n 
N 1 177 SER 177 283 ?   ?   ?   N . n 
N 1 178 LEU 178 284 ?   ?   ?   N . n 
N 1 179 TRP 179 285 285 TRP TRP N . n 
N 1 180 PRO 180 286 286 PRO PRO N . n 
N 1 181 TYR 181 287 287 TYR TYR N . n 
N 1 182 LYS 182 288 288 LYS LYS N . n 
N 1 183 GLY 183 289 289 GLY GLY N . n 
N 1 184 ARG 184 290 290 ARG ARG N . n 
N 1 185 PRO 185 291 291 PRO PRO N . n 
N 1 186 GLU 186 292 292 GLU GLU N . n 
N 1 187 ASN 187 293 293 ASN ASN N . n 
N 1 188 LYS 188 294 294 LYS LYS N . n 
N 1 189 SER 189 295 295 SER SER N . n 
N 1 190 PHE 190 296 296 PHE PHE N . n 
N 1 191 LEU 191 297 297 LEU LEU N . n 
N 1 192 TYR 192 298 298 TYR TYR N . n 
N 1 193 GLU 193 299 299 GLU GLU N . n 
N 1 194 ILE 194 300 300 ILE ILE N . n 
N 1 195 VAL 195 301 301 VAL VAL N . n 
N 1 196 SER 196 302 302 SER SER N . n 
N 1 197 ASN 197 303 303 ASN ASN N . n 
N 1 198 LYS 198 304 304 LYS LYS N . n 
N 1 199 ARG 199 305 305 ARG ARG N . n 
N 1 200 ASN 200 306 306 ASN ASN N . n 
N 1 201 GLY 201 307 307 GLY GLY N . n 
N 1 202 ILE 202 308 308 ILE ILE N . n 
N 1 203 ASP 203 309 309 ASP ASP N . n 
N 1 204 VAL 204 310 310 VAL VAL N . n 
N 1 205 ASP 205 311 311 ASP ASP N . n 
N 1 206 LYS 206 312 312 LYS LYS N . n 
N 1 207 TRP 207 313 313 TRP TRP N . n 
N 1 208 ASP 208 314 314 ASP ASP N . n 
N 1 209 TYR 209 315 315 TYR TYR N . n 
N 1 210 PHE 210 316 316 PHE PHE N . n 
N 1 211 ALA 211 317 317 ALA ALA N . n 
N 1 212 ARG 212 318 318 ARG ARG N . n 
N 1 213 ASP 213 319 319 ASP ASP N . n 
N 1 214 CYS 214 320 320 CYS CYS N . n 
N 1 215 HIS 215 321 321 HIS HIS N . n 
N 1 216 HIS 216 322 322 HIS HIS N . n 
N 1 217 LEU 217 323 323 LEU LEU N . n 
N 1 218 GLY 218 324 324 GLY GLY N . n 
N 1 219 ILE 219 325 325 ILE ILE N . n 
N 1 220 GLN 220 326 326 GLN GLN N . n 
N 1 221 ASN 221 327 327 ASN ASN N . n 
N 1 222 ASN 222 328 328 ASN ASN N . n 
N 1 223 PHE 223 329 329 PHE PHE N . n 
N 1 224 ASP 224 330 330 ASP ASP N . n 
N 1 225 TYR 225 331 331 TYR TYR N . n 
N 1 226 LYS 226 332 332 LYS LYS N . n 
N 1 227 ARG 227 333 333 ARG ARG N . n 
N 1 228 PHE 228 334 334 PHE PHE N . n 
N 1 229 ILE 229 335 335 ILE ILE N . n 
N 1 230 LYS 230 336 336 LYS LYS N . n 
N 1 231 PHE 231 337 337 PHE PHE N . n 
N 1 232 ALA 232 338 338 ALA ALA N . n 
N 1 233 ARG 233 339 339 ARG ARG N . n 
N 1 234 VAL 234 340 340 VAL VAL N . n 
N 1 235 CYS 235 341 341 CYS CYS N . n 
N 1 236 GLU 236 342 342 GLU GLU N . n 
N 1 237 VAL 237 343 343 VAL VAL N . n 
N 1 238 ASP 238 344 344 ASP ASP N . n 
N 1 239 ASN 239 345 345 ASN ASN N . n 
N 1 240 GLU 240 346 346 GLU GLU N . n 
N 1 241 LEU 241 347 347 LEU LEU N . n 
N 1 242 ARG 242 348 348 ARG ARG N . n 
N 1 243 ILE 243 349 349 ILE ILE N . n 
N 1 244 CYS 244 350 350 CYS CYS N . n 
N 1 245 ALA 245 351 351 ALA ALA N . n 
N 1 246 ARG 246 352 352 ARG ARG N . n 
N 1 247 ASP 247 353 353 ASP ASP N . n 
N 1 248 LYS 248 354 354 LYS LYS N . n 
N 1 249 GLU 249 355 355 GLU GLU N . n 
N 1 250 VAL 250 356 356 VAL VAL N . n 
N 1 251 GLY 251 357 357 GLY GLY N . n 
N 1 252 ASN 252 358 358 ASN ASN N . n 
N 1 253 LEU 253 359 359 LEU LEU N . n 
N 1 254 TYR 254 360 360 TYR TYR N . n 
N 1 255 ASP 255 361 361 ASP ASP N . n 
N 1 256 MET 256 362 362 MET MET N . n 
N 1 257 PHE 257 363 363 PHE PHE N . n 
N 1 258 HIS 258 364 364 HIS HIS N . n 
N 1 259 THR 259 365 365 THR THR N . n 
N 1 260 ARG 260 366 366 ARG ARG N . n 
N 1 261 ASN 261 367 367 ASN ASN N . n 
N 1 262 SER 262 368 368 SER SER N . n 
N 1 263 LEU 263 369 369 LEU LEU N . n 
N 1 264 HIS 264 370 370 HIS HIS N . n 
N 1 265 ARG 265 371 371 ARG ARG N . n 
N 1 266 ARG 266 372 372 ARG ARG N . n 
N 1 267 ALA 267 373 373 ALA ALA N . n 
N 1 268 TYR 268 374 374 TYR TYR N . n 
N 1 269 GLN 269 375 375 GLN GLN N . n 
N 1 270 HIS 270 376 376 HIS HIS N . n 
N 1 271 LYS 271 377 377 LYS LYS N . n 
N 1 272 VAL 272 378 378 VAL VAL N . n 
N 1 273 GLY 273 379 379 GLY GLY N . n 
N 1 274 ASN 274 380 380 ASN ASN N . n 
N 1 275 ILE 275 381 381 ILE ILE N . n 
N 1 276 ILE 276 382 382 ILE ILE N . n 
N 1 277 ASP 277 383 383 ASP ASP N . n 
N 1 278 THR 278 384 384 THR THR N . n 
N 1 279 MET 279 385 385 MET MET N . n 
N 1 280 ILE 280 386 386 ILE ILE N . n 
N 1 281 THR 281 387 387 THR THR N . n 
N 1 282 ASP 282 388 388 ASP ASP N . n 
N 1 283 ALA 283 389 389 ALA ALA N . n 
N 1 284 PHE 284 390 390 PHE PHE N . n 
N 1 285 LEU 285 391 391 LEU LEU N . n 
N 1 286 LYS 286 392 392 LYS LYS N . n 
N 1 287 ALA 287 393 393 ALA ALA N . n 
N 1 288 ASP 288 394 394 ASP ASP N . n 
N 1 289 ASP 289 395 395 ASP ASP N . n 
N 1 290 TYR 290 396 396 TYR TYR N . n 
N 1 291 ILE 291 397 397 ILE ILE N . n 
N 1 292 GLU 292 398 398 GLU GLU N . n 
N 1 293 ILE 293 399 399 ILE ILE N . n 
N 1 294 THR 294 400 400 THR THR N . n 
N 1 295 GLY 295 401 401 GLY GLY N . n 
N 1 296 ALA 296 402 402 ALA ALA N . n 
N 1 297 GLY 297 403 403 GLY GLY N . n 
N 1 298 GLY 298 404 404 GLY GLY N . n 
N 1 299 LYS 299 405 405 LYS LYS N . n 
N 1 300 LYS 300 406 406 LYS LYS N . n 
N 1 301 TYR 301 407 407 TYR TYR N . n 
N 1 302 ARG 302 408 408 ARG ARG N . n 
N 1 303 ILE 303 409 409 ILE ILE N . n 
N 1 304 SER 304 410 410 SER SER N . n 
N 1 305 THR 305 411 411 THR THR N . n 
N 1 306 ALA 306 412 412 ALA ALA N . n 
N 1 307 ILE 307 413 413 ILE ILE N . n 
N 1 308 ASP 308 414 414 ASP ASP N . n 
N 1 309 ASP 309 415 415 ASP ASP N . n 
N 1 310 MET 310 416 416 MET MET N . n 
N 1 311 GLU 311 417 417 GLU GLU N . n 
N 1 312 ALA 312 418 418 ALA ALA N . n 
N 1 313 TYR 313 419 419 TYR TYR N . n 
N 1 314 THR 314 420 420 THR THR N . n 
N 1 315 LYS 315 421 421 LYS LYS N . n 
N 1 316 LEU 316 422 422 LEU LEU N . n 
N 1 317 THR 317 423 423 THR THR N . n 
N 1 318 ASP 318 424 424 ASP ASP N . n 
N 1 319 ASN 319 425 425 ASN ASN N . n 
N 1 320 ILE 320 426 426 ILE ILE N . n 
N 1 321 PHE 321 427 427 PHE PHE N . n 
N 1 322 LEU 322 428 428 LEU LEU N . n 
N 1 323 GLU 323 429 429 GLU GLU N . n 
N 1 324 ILE 324 430 430 ILE ILE N . n 
N 1 325 LEU 325 431 431 LEU LEU N . n 
N 1 326 TYR 326 432 432 TYR TYR N . n 
N 1 327 SER 327 433 433 SER SER N . n 
N 1 328 THR 328 434 434 THR THR N . n 
N 1 329 ASP 329 435 435 ASP ASP N . n 
N 1 330 PRO 330 436 436 PRO PRO N . n 
N 1 331 LYS 331 437 437 LYS LYS N . n 
N 1 332 LEU 332 438 438 LEU LEU N . n 
N 1 333 LYS 333 439 439 LYS LYS N . n 
N 1 334 ASP 334 440 440 ASP ASP N . n 
N 1 335 ALA 335 441 441 ALA ALA N . n 
N 1 336 ARG 336 442 442 ARG ARG N . n 
N 1 337 GLU 337 443 443 GLU GLU N . n 
N 1 338 ILE 338 444 444 ILE ILE N . n 
N 1 339 LEU 339 445 445 LEU LEU N . n 
N 1 340 LYS 340 446 446 LYS LYS N . n 
N 1 341 GLN 341 447 447 GLN GLN N . n 
N 1 342 ILE 342 448 448 ILE ILE N . n 
N 1 343 GLU 343 449 449 GLU GLU N . n 
N 1 344 TYR 344 450 450 TYR TYR N . n 
N 1 345 ARG 345 451 451 ARG ARG N . n 
N 1 346 ASN 346 452 452 ASN ASN N . n 
N 1 347 LEU 347 453 453 LEU LEU N . n 
N 1 348 PHE 348 454 454 PHE PHE N . n 
N 1 349 LYS 349 455 455 LYS LYS N . n 
N 1 350 TYR 350 456 456 TYR TYR N . n 
N 1 351 VAL 351 457 457 VAL VAL N . n 
N 1 352 GLY 352 458 458 GLY GLY N . n 
N 1 353 GLU 353 459 459 GLU GLU N . n 
N 1 354 THR 354 460 460 THR THR N . n 
N 1 355 GLN 355 461 461 GLN GLN N . n 
N 1 356 PRO 356 462 462 PRO PRO N . n 
N 1 357 THR 357 463 463 THR THR N . n 
N 1 358 GLY 358 464 464 GLY GLY N . n 
N 1 359 GLN 359 465 465 GLN GLN N . n 
N 1 360 ILE 360 466 466 ILE ILE N . n 
N 1 361 LYS 361 467 467 LYS LYS N . n 
N 1 362 ILE 362 468 468 ILE ILE N . n 
N 1 363 LYS 363 469 469 LYS LYS N . n 
N 1 364 ARG 364 470 470 ARG ARG N . n 
N 1 365 GLU 365 471 471 GLU GLU N . n 
N 1 366 ASP 366 472 472 ASP ASP N . n 
N 1 367 TYR 367 473 473 TYR TYR N . n 
N 1 368 GLU 368 474 474 GLU GLU N . n 
N 1 369 SER 369 475 475 SER SER N . n 
N 1 370 LEU 370 476 476 LEU LEU N . n 
N 1 371 PRO 371 477 477 PRO PRO N . n 
N 1 372 LYS 372 478 478 LYS LYS N . n 
N 1 373 GLU 373 479 479 GLU GLU N . n 
N 1 374 VAL 374 480 480 VAL VAL N . n 
N 1 375 ALA 375 481 481 ALA ALA N . n 
N 1 376 SER 376 482 482 SER SER N . n 
N 1 377 ALA 377 483 483 ALA ALA N . n 
N 1 378 LYS 378 484 484 LYS LYS N . n 
N 1 379 PRO 379 485 485 PRO PRO N . n 
N 1 380 LYS 380 486 486 LYS LYS N . n 
N 1 381 VAL 381 487 487 VAL VAL N . n 
N 1 382 LEU 382 488 488 LEU LEU N . n 
N 1 383 LEU 383 489 489 LEU LEU N . n 
N 1 384 ASP 384 490 490 ASP ASP N . n 
N 1 385 VAL 385 491 491 VAL VAL N . n 
N 1 386 LYS 386 492 492 LYS LYS N . n 
N 1 387 LEU 387 493 493 LEU LEU N . n 
N 1 388 LYS 388 494 494 LYS LYS N . n 
N 1 389 ALA 389 495 495 ALA ALA N . n 
N 1 390 GLU 390 496 496 GLU GLU N . n 
N 1 391 ASP 391 497 497 ASP ASP N . n 
N 1 392 PHE 392 498 498 PHE PHE N . n 
N 1 393 ILE 393 499 499 ILE ILE N . n 
N 1 394 VAL 394 500 500 VAL VAL N . n 
N 1 395 ASP 395 501 501 ASP ASP N . n 
N 1 396 VAL 396 502 502 VAL VAL N . n 
N 1 397 ILE 397 503 503 ILE ILE N . n 
N 1 398 ASN 398 504 504 ASN ASN N . n 
N 1 399 MET 399 505 505 MET MET N . n 
N 1 400 ASP 400 506 506 ASP ASP N . n 
N 1 401 TYR 401 507 507 TYR TYR N . n 
N 1 402 GLY 402 508 508 GLY GLY N . n 
N 1 403 MET 403 509 509 MET MET N . n 
N 1 404 GLN 404 510 510 GLN GLN N . n 
N 1 405 GLU 405 511 511 GLU GLU N . n 
N 1 406 LYS 406 512 512 LYS LYS N . n 
N 1 407 ASN 407 513 513 ASN ASN N . n 
N 1 408 PRO 408 514 514 PRO PRO N . n 
N 1 409 ILE 409 515 515 ILE ILE N . n 
N 1 410 ASP 410 516 516 ASP ASP N . n 
N 1 411 HIS 411 517 517 HIS HIS N . n 
N 1 412 VAL 412 518 518 VAL VAL N . n 
N 1 413 SER 413 519 519 SER SER N . n 
N 1 414 PHE 414 520 520 PHE PHE N . n 
N 1 415 TYR 415 521 521 TYR TYR N . n 
N 1 416 CYS 416 522 522 CYS CYS N . n 
N 1 417 LYS 417 523 523 LYS LYS N . n 
N 1 418 THR 418 524 524 THR THR N . n 
N 1 419 ALA 419 525 525 ALA ALA N . n 
N 1 420 PRO 420 526 526 PRO PRO N . n 
N 1 421 ASN 421 527 527 ASN ASN N . n 
N 1 422 ARG 422 528 528 ARG ARG N . n 
N 1 423 ALA 423 529 529 ALA ALA N . n 
N 1 424 ILE 424 530 530 ILE ILE N . n 
N 1 425 ARG 425 531 531 ARG ARG N . n 
N 1 426 ILE 426 532 532 ILE ILE N . n 
N 1 427 THR 427 533 533 THR THR N . n 
N 1 428 LYS 428 534 534 LYS LYS N . n 
N 1 429 ASN 429 535 535 ASN ASN N . n 
N 1 430 GLN 430 536 536 GLN GLN N . n 
N 1 431 VAL 431 537 537 VAL VAL N . n 
N 1 432 SER 432 538 538 SER SER N . n 
N 1 433 GLN 433 539 539 GLN GLN N . n 
N 1 434 LEU 434 540 540 LEU LEU N . n 
N 1 435 LEU 435 541 541 LEU LEU N . n 
N 1 436 PRO 436 542 542 PRO PRO N . n 
N 1 437 GLU 437 543 543 GLU GLU N . n 
N 1 438 LYS 438 544 544 LYS LYS N . n 
N 1 439 PHE 439 545 545 PHE PHE N . n 
N 1 440 ALA 440 546 546 ALA ALA N . n 
N 1 441 GLU 441 547 547 GLU GLU N . n 
N 1 442 GLN 442 548 548 GLN GLN N . n 
N 1 443 LEU 443 549 549 LEU LEU N . n 
N 1 444 ILE 444 550 550 ILE ILE N . n 
N 1 445 ARG 445 551 551 ARG ARG N . n 
N 1 446 VAL 446 552 552 VAL VAL N . n 
N 1 447 TYR 447 553 553 TYR TYR N . n 
N 1 448 CYS 448 554 554 CYS CYS N . n 
N 1 449 LYS 449 555 555 LYS LYS N . n 
N 1 450 LYS 450 556 556 LYS LYS N . n 
N 1 451 VAL 451 557 557 VAL VAL N . n 
N 1 452 ASP 452 558 558 ASP ASP N . n 
N 1 453 ARG 453 559 559 ARG ARG N . n 
N 1 454 LYS 454 560 560 LYS LYS N . n 
N 1 455 SER 455 561 561 SER SER N . n 
N 1 456 LEU 456 562 562 LEU LEU N . n 
N 1 457 TYR 457 563 563 TYR TYR N . n 
N 1 458 ALA 458 564 564 ALA ALA N . n 
N 1 459 ALA 459 565 565 ALA ALA N . n 
N 1 460 ARG 460 566 566 ARG ARG N . n 
N 1 461 GLN 461 567 567 GLN GLN N . n 
N 1 462 TYR 462 568 568 TYR TYR N . n 
N 1 463 PHE 463 569 569 PHE PHE N . n 
N 1 464 VAL 464 570 570 VAL VAL N . n 
N 1 465 GLN 465 571 571 GLN GLN N . n 
N 1 466 TRP 466 572 572 TRP TRP N . n 
N 1 467 CYS 467 573 573 CYS CYS N . n 
N 1 468 ALA 468 574 574 ALA ALA N . n 
N 1 469 ASP 469 575 575 ASP ASP N . n 
N 1 470 ARG 470 576 576 ARG ARG N . n 
N 1 471 ASN 471 577 577 ASN ASN N . n 
N 1 472 PHE 472 578 578 PHE PHE N . n 
N 1 473 THR 473 579 579 THR THR N . n 
N 1 474 LYS 474 580 580 LYS LYS N . n 
N 1 475 PRO 475 581 581 PRO PRO N . n 
N 1 476 GLN 476 582 582 GLN GLN N . n 
N 1 477 ASP 477 583 583 ASP ASP N . n 
N 1 478 GLY 478 584 584 GLY GLY N . n 
N 1 479 ASP 479 585 585 ASP ASP N . n 
N 1 480 VAL 480 586 586 VAL VAL N . n 
N 1 481 ILE 481 587 587 ILE ILE N . n 
N 1 482 ALA 482 588 588 ALA ALA N . n 
N 1 483 PRO 483 589 589 PRO PRO N . n 
N 1 484 LEU 484 590 590 LEU LEU N . n 
N 1 485 ILE 485 591 591 ILE ILE N . n 
N 1 486 THR 486 592 592 THR THR N . n 
N 1 487 PRO 487 593 593 PRO PRO N . n 
N 1 488 GLN 488 594 594 GLN GLN N . n 
N 1 489 LYS 489 595 595 LYS LYS N . n 
N 1 490 LYS 490 596 596 LYS LYS N . n 
N 1 491 GLU 491 597 597 GLU GLU N . n 
N 1 492 TRP 492 598 598 TRP TRP N . n 
N 1 493 ASN 493 599 599 ASN ASN N . n 
N 1 494 ASP 494 600 ?   ?   ?   N . n 
N 1 495 SER 495 601 ?   ?   ?   N . n 
N 1 496 THR 496 602 ?   ?   ?   N . n 
N 1 497 SER 497 603 ?   ?   ?   N . n 
N 1 498 VAL 498 604 ?   ?   ?   N . n 
N 1 499 GLN 499 605 ?   ?   ?   N . n 
N 1 500 ASN 500 606 ?   ?   ?   N . n 
N 1 501 PRO 501 607 ?   ?   ?   N . n 
N 1 502 THR 502 608 ?   ?   ?   N . n 
N 1 503 ARG 503 609 ?   ?   ?   N . n 
N 1 504 LEU 504 610 ?   ?   ?   N . n 
N 1 505 ARG 505 611 ?   ?   ?   N . n 
N 1 506 GLU 506 612 ?   ?   ?   N . n 
N 1 507 ALA 507 613 ?   ?   ?   N . n 
N 1 508 SER 508 614 ?   ?   ?   N . n 
N 1 509 LYS 509 615 ?   ?   ?   N . n 
N 1 510 SER 510 616 ?   ?   ?   N . n 
N 1 511 ARG 511 617 ?   ?   ?   N . n 
N 1 512 VAL 512 618 ?   ?   ?   N . n 
N 1 513 GLN 513 619 ?   ?   ?   N . n 
N 1 514 LEU 514 620 ?   ?   ?   N . n 
N 1 515 PHE 515 621 ?   ?   ?   N . n 
N 1 516 LYS 516 622 ?   ?   ?   N . n 
N 1 517 ASP 517 623 ?   ?   ?   N . n 
N 1 518 ASP 518 624 ?   ?   ?   N . n 
N 1 519 PRO 519 625 ?   ?   ?   N . n 
N 1 520 MET 520 626 ?   ?   ?   N . n 
O 1 1   GLY 1   107 ?   ?   ?   O . n 
O 1 2   SER 2   108 ?   ?   ?   O . n 
O 1 3   GLN 3   109 ?   ?   ?   O . n 
O 1 4   ILE 4   110 ?   ?   ?   O . n 
O 1 5   HIS 5   111 ?   ?   ?   O . n 
O 1 6   VAL 6   112 ?   ?   ?   O . n 
O 1 7   ASP 7   113 ?   ?   ?   O . n 
O 1 8   THR 8   114 114 THR THR O . n 
O 1 9   MET 9   115 115 MET MET O . n 
O 1 10  LYS 10  116 116 LYS LYS O . n 
O 1 11  VAL 11  117 117 VAL VAL O . n 
O 1 12  ILE 12  118 118 ILE ILE O . n 
O 1 13  ASN 13  119 119 ASN ASN O . n 
O 1 14  ASP 14  120 120 ASP ASP O . n 
O 1 15  PRO 15  121 121 PRO PRO O . n 
O 1 16  ILE 16  122 122 ILE ILE O . n 
O 1 17  HIS 17  123 123 HIS HIS O . n 
O 1 18  GLY 18  124 124 GLY GLY O . n 
O 1 19  HIS 19  125 125 HIS HIS O . n 
O 1 20  ILE 20  126 126 ILE ILE O . n 
O 1 21  GLU 21  127 127 GLU GLU O . n 
O 1 22  LEU 22  128 128 LEU LEU O . n 
O 1 23  HIS 23  129 129 HIS HIS O . n 
O 1 24  PRO 24  130 130 PRO PRO O . n 
O 1 25  LEU 25  131 131 LEU LEU O . n 
O 1 26  LEU 26  132 132 LEU LEU O . n 
O 1 27  VAL 27  133 133 VAL VAL O . n 
O 1 28  ARG 28  134 134 ARG ARG O . n 
O 1 29  ILE 29  135 135 ILE ILE O . n 
O 1 30  ILE 30  136 136 ILE ILE O . n 
O 1 31  ASP 31  137 137 ASP ASP O . n 
O 1 32  THR 32  138 138 THR THR O . n 
O 1 33  PRO 33  139 139 PRO PRO O . n 
O 1 34  GLN 34  140 140 GLN GLN O . n 
O 1 35  PHE 35  141 141 PHE PHE O . n 
O 1 36  GLN 36  142 142 GLN GLN O . n 
O 1 37  ARG 37  143 143 ARG ARG O . n 
O 1 38  LEU 38  144 144 LEU LEU O . n 
O 1 39  ARG 39  145 145 ARG ARG O . n 
O 1 40  TYR 40  146 146 TYR TYR O . n 
O 1 41  ILE 41  147 147 ILE ILE O . n 
O 1 42  LYS 42  148 148 LYS LYS O . n 
O 1 43  GLN 43  149 149 GLN GLN O . n 
O 1 44  LEU 44  150 150 LEU LEU O . n 
O 1 45  GLY 45  151 151 GLY GLY O . n 
O 1 46  GLY 46  152 152 GLY GLY O . n 
O 1 47  GLY 47  153 153 GLY GLY O . n 
O 1 48  TYR 48  154 154 TYR TYR O . n 
O 1 49  TYR 49  155 155 TYR TYR O . n 
O 1 50  VAL 50  156 156 VAL VAL O . n 
O 1 51  PHE 51  157 157 PHE PHE O . n 
O 1 52  PRO 52  158 158 PRO PRO O . n 
O 1 53  GLY 53  159 159 GLY GLY O . n 
O 1 54  ALA 54  160 160 ALA ALA O . n 
O 1 55  SER 55  161 161 SER SER O . n 
O 1 56  HIS 56  162 162 HIS HIS O . n 
O 1 57  ASN 57  163 163 ASN ASN O . n 
O 1 58  ARG 58  164 164 ARG ARG O . n 
O 1 59  PHE 59  165 165 PHE PHE O . n 
O 1 60  GLU 60  166 166 GLU GLU O . n 
O 1 61  HIS 61  167 167 HIS HIS O . n 
O 1 62  SER 62  168 168 SER SER O . n 
O 1 63  LEU 63  169 169 LEU LEU O . n 
O 1 64  GLY 64  170 170 GLY GLY O . n 
O 1 65  VAL 65  171 171 VAL VAL O . n 
O 1 66  GLY 66  172 172 GLY GLY O . n 
O 1 67  TYR 67  173 173 TYR TYR O . n 
O 1 68  LEU 68  174 174 LEU LEU O . n 
O 1 69  ALA 69  175 175 ALA ALA O . n 
O 1 70  GLY 70  176 176 GLY GLY O . n 
O 1 71  CYS 71  177 177 CYS CYS O . n 
O 1 72  LEU 72  178 178 LEU LEU O . n 
O 1 73  VAL 73  179 179 VAL VAL O . n 
O 1 74  HIS 74  180 180 HIS HIS O . n 
O 1 75  ALA 75  181 181 ALA ALA O . n 
O 1 76  LEU 76  182 182 LEU LEU O . n 
O 1 77  GLY 77  183 183 GLY GLY O . n 
O 1 78  GLU 78  184 184 GLU GLU O . n 
O 1 79  LYS 79  185 185 LYS LYS O . n 
O 1 80  GLN 80  186 186 GLN GLN O . n 
O 1 81  PRO 81  187 187 PRO PRO O . n 
O 1 82  GLU 82  188 188 GLU GLU O . n 
O 1 83  LEU 83  189 189 LEU LEU O . n 
O 1 84  GLN 84  190 190 GLN GLN O . n 
O 1 85  ILE 85  191 191 ILE ILE O . n 
O 1 86  SER 86  192 192 SER SER O . n 
O 1 87  GLU 87  193 193 GLU GLU O . n 
O 1 88  ARG 88  194 194 ARG ARG O . n 
O 1 89  ASP 89  195 195 ASP ASP O . n 
O 1 90  VAL 90  196 196 VAL VAL O . n 
O 1 91  LEU 91  197 197 LEU LEU O . n 
O 1 92  CYS 92  198 198 CYS CYS O . n 
O 1 93  VAL 93  199 199 VAL VAL O . n 
O 1 94  GLN 94  200 200 GLN GLN O . n 
O 1 95  ILE 95  201 201 ILE ILE O . n 
O 1 96  ALA 96  202 202 ALA ALA O . n 
O 1 97  GLY 97  203 203 GLY GLY O . n 
O 1 98  LEU 98  204 204 LEU LEU O . n 
O 1 99  CYS 99  205 205 CYS CYS O . n 
O 1 100 HIS 100 206 206 HIS HIS O . n 
O 1 101 ASP 101 207 207 ASP ASP O . n 
O 1 102 LEU 102 208 208 LEU LEU O . n 
O 1 103 GLY 103 209 209 GLY GLY O . n 
O 1 104 HIS 104 210 210 HIS HIS O . n 
O 1 105 GLY 105 211 211 GLY GLY O . n 
O 1 106 PRO 106 212 212 PRO PRO O . n 
O 1 107 PHE 107 213 213 PHE PHE O . n 
O 1 108 SER 108 214 214 SER SER O . n 
O 1 109 HIS 109 215 215 HIS HIS O . n 
O 1 110 MET 110 216 216 MET MET O . n 
O 1 111 PHE 111 217 217 PHE PHE O . n 
O 1 112 ASP 112 218 218 ASP ASP O . n 
O 1 113 GLY 113 219 219 GLY GLY O . n 
O 1 114 ARG 114 220 220 ARG ARG O . n 
O 1 115 PHE 115 221 221 PHE PHE O . n 
O 1 116 ILE 116 222 222 ILE ILE O . n 
O 1 117 PRO 117 223 223 PRO PRO O . n 
O 1 118 LEU 118 224 224 LEU LEU O . n 
O 1 119 ALA 119 225 225 ALA ALA O . n 
O 1 120 ARG 120 226 226 ARG ARG O . n 
O 1 121 PRO 121 227 227 PRO PRO O . n 
O 1 122 GLU 122 228 228 GLU GLU O . n 
O 1 123 VAL 123 229 229 VAL VAL O . n 
O 1 124 LYS 124 230 230 LYS LYS O . n 
O 1 125 TRP 125 231 231 TRP TRP O . n 
O 1 126 THR 126 232 232 THR THR O . n 
O 1 127 HIS 127 233 233 HIS HIS O . n 
O 1 128 GLU 128 234 234 GLU GLU O . n 
O 1 129 GLN 129 235 235 GLN GLN O . n 
O 1 130 GLY 130 236 236 GLY GLY O . n 
O 1 131 SER 131 237 237 SER SER O . n 
O 1 132 VAL 132 238 238 VAL VAL O . n 
O 1 133 MET 133 239 239 MET MET O . n 
O 1 134 MET 134 240 240 MET MET O . n 
O 1 135 PHE 135 241 241 PHE PHE O . n 
O 1 136 GLU 136 242 242 GLU GLU O . n 
O 1 137 HIS 137 243 243 HIS HIS O . n 
O 1 138 LEU 138 244 244 LEU LEU O . n 
O 1 139 ILE 139 245 245 ILE ILE O . n 
O 1 140 ASN 140 246 246 ASN ASN O . n 
O 1 141 SER 141 247 247 SER SER O . n 
O 1 142 ASN 142 248 248 ASN ASN O . n 
O 1 143 GLY 143 249 249 GLY GLY O . n 
O 1 144 ILE 144 250 250 ILE ILE O . n 
O 1 145 LYS 145 251 251 LYS LYS O . n 
O 1 146 PRO 146 252 252 PRO PRO O . n 
O 1 147 VAL 147 253 253 VAL VAL O . n 
O 1 148 MET 148 254 254 MET MET O . n 
O 1 149 GLU 149 255 255 GLU GLU O . n 
O 1 150 GLN 150 256 256 GLN GLN O . n 
O 1 151 TYR 151 257 257 TYR TYR O . n 
O 1 152 GLY 152 258 258 GLY GLY O . n 
O 1 153 LEU 153 259 259 LEU LEU O . n 
O 1 154 ILE 154 260 260 ILE ILE O . n 
O 1 155 PRO 155 261 261 PRO PRO O . n 
O 1 156 GLU 156 262 262 GLU GLU O . n 
O 1 157 GLU 157 263 263 GLU GLU O . n 
O 1 158 ASP 158 264 264 ASP ASP O . n 
O 1 159 ILE 159 265 265 ILE ILE O . n 
O 1 160 CYS 160 266 266 CYS CYS O . n 
O 1 161 PHE 161 267 267 PHE PHE O . n 
O 1 162 ILE 162 268 268 ILE ILE O . n 
O 1 163 LYS 163 269 269 LYS LYS O . n 
O 1 164 GLU 164 270 270 GLU GLU O . n 
O 1 165 GLN 165 271 271 GLN GLN O . n 
O 1 166 ILE 166 272 272 ILE ILE O . n 
O 1 167 VAL 167 273 273 VAL VAL O . n 
O 1 168 GLY 168 274 274 GLY GLY O . n 
O 1 169 PRO 169 275 275 PRO PRO O . n 
O 1 170 LEU 170 276 276 LEU LEU O . n 
O 1 171 GLU 171 277 277 GLU GLU O . n 
O 1 172 SER 172 278 278 SER SER O . n 
O 1 173 PRO 173 279 279 PRO PRO O . n 
O 1 174 VAL 174 280 280 VAL VAL O . n 
O 1 175 GLU 175 281 281 GLU ALA O . n 
O 1 176 ASP 176 282 282 ASP ASP O . n 
O 1 177 SER 177 283 283 SER SER O . n 
O 1 178 LEU 178 284 284 LEU LEU O . n 
O 1 179 TRP 179 285 285 TRP TRP O . n 
O 1 180 PRO 180 286 286 PRO PRO O . n 
O 1 181 TYR 181 287 287 TYR TYR O . n 
O 1 182 LYS 182 288 288 LYS LYS O . n 
O 1 183 GLY 183 289 289 GLY GLY O . n 
O 1 184 ARG 184 290 290 ARG ARG O . n 
O 1 185 PRO 185 291 291 PRO PRO O . n 
O 1 186 GLU 186 292 292 GLU GLU O . n 
O 1 187 ASN 187 293 293 ASN ASN O . n 
O 1 188 LYS 188 294 294 LYS LYS O . n 
O 1 189 SER 189 295 295 SER SER O . n 
O 1 190 PHE 190 296 296 PHE PHE O . n 
O 1 191 LEU 191 297 297 LEU LEU O . n 
O 1 192 TYR 192 298 298 TYR TYR O . n 
O 1 193 GLU 193 299 299 GLU GLU O . n 
O 1 194 ILE 194 300 300 ILE ILE O . n 
O 1 195 VAL 195 301 301 VAL VAL O . n 
O 1 196 SER 196 302 302 SER SER O . n 
O 1 197 ASN 197 303 303 ASN ASN O . n 
O 1 198 LYS 198 304 304 LYS LYS O . n 
O 1 199 ARG 199 305 305 ARG ARG O . n 
O 1 200 ASN 200 306 306 ASN ASN O . n 
O 1 201 GLY 201 307 307 GLY GLY O . n 
O 1 202 ILE 202 308 308 ILE ILE O . n 
O 1 203 ASP 203 309 309 ASP ASP O . n 
O 1 204 VAL 204 310 310 VAL VAL O . n 
O 1 205 ASP 205 311 311 ASP ASP O . n 
O 1 206 LYS 206 312 312 LYS LYS O . n 
O 1 207 TRP 207 313 313 TRP TRP O . n 
O 1 208 ASP 208 314 314 ASP ASP O . n 
O 1 209 TYR 209 315 315 TYR TYR O . n 
O 1 210 PHE 210 316 316 PHE PHE O . n 
O 1 211 ALA 211 317 317 ALA ALA O . n 
O 1 212 ARG 212 318 318 ARG ARG O . n 
O 1 213 ASP 213 319 319 ASP ASP O . n 
O 1 214 CYS 214 320 320 CYS CYS O . n 
O 1 215 HIS 215 321 321 HIS HIS O . n 
O 1 216 HIS 216 322 322 HIS HIS O . n 
O 1 217 LEU 217 323 323 LEU LEU O . n 
O 1 218 GLY 218 324 324 GLY GLY O . n 
O 1 219 ILE 219 325 325 ILE ILE O . n 
O 1 220 GLN 220 326 326 GLN GLN O . n 
O 1 221 ASN 221 327 327 ASN ASN O . n 
O 1 222 ASN 222 328 328 ASN ASN O . n 
O 1 223 PHE 223 329 329 PHE PHE O . n 
O 1 224 ASP 224 330 330 ASP ASP O . n 
O 1 225 TYR 225 331 331 TYR TYR O . n 
O 1 226 LYS 226 332 332 LYS LYS O . n 
O 1 227 ARG 227 333 333 ARG ARG O . n 
O 1 228 PHE 228 334 334 PHE PHE O . n 
O 1 229 ILE 229 335 335 ILE ILE O . n 
O 1 230 LYS 230 336 336 LYS LYS O . n 
O 1 231 PHE 231 337 337 PHE PHE O . n 
O 1 232 ALA 232 338 338 ALA ALA O . n 
O 1 233 ARG 233 339 339 ARG ARG O . n 
O 1 234 VAL 234 340 340 VAL VAL O . n 
O 1 235 CYS 235 341 341 CYS CYS O . n 
O 1 236 GLU 236 342 342 GLU GLU O . n 
O 1 237 VAL 237 343 343 VAL VAL O . n 
O 1 238 ASP 238 344 344 ASP ASP O . n 
O 1 239 ASN 239 345 345 ASN ASN O . n 
O 1 240 GLU 240 346 346 GLU GLU O . n 
O 1 241 LEU 241 347 347 LEU LEU O . n 
O 1 242 ARG 242 348 348 ARG ARG O . n 
O 1 243 ILE 243 349 349 ILE ILE O . n 
O 1 244 CYS 244 350 350 CYS CYS O . n 
O 1 245 ALA 245 351 351 ALA ALA O . n 
O 1 246 ARG 246 352 352 ARG ARG O . n 
O 1 247 ASP 247 353 353 ASP ASP O . n 
O 1 248 LYS 248 354 354 LYS LYS O . n 
O 1 249 GLU 249 355 355 GLU GLU O . n 
O 1 250 VAL 250 356 356 VAL VAL O . n 
O 1 251 GLY 251 357 357 GLY GLY O . n 
O 1 252 ASN 252 358 358 ASN ASN O . n 
O 1 253 LEU 253 359 359 LEU LEU O . n 
O 1 254 TYR 254 360 360 TYR TYR O . n 
O 1 255 ASP 255 361 361 ASP ASP O . n 
O 1 256 MET 256 362 362 MET MET O . n 
O 1 257 PHE 257 363 363 PHE PHE O . n 
O 1 258 HIS 258 364 364 HIS HIS O . n 
O 1 259 THR 259 365 365 THR THR O . n 
O 1 260 ARG 260 366 366 ARG ARG O . n 
O 1 261 ASN 261 367 367 ASN ASN O . n 
O 1 262 SER 262 368 368 SER SER O . n 
O 1 263 LEU 263 369 369 LEU LEU O . n 
O 1 264 HIS 264 370 370 HIS HIS O . n 
O 1 265 ARG 265 371 371 ARG ARG O . n 
O 1 266 ARG 266 372 372 ARG ARG O . n 
O 1 267 ALA 267 373 373 ALA ALA O . n 
O 1 268 TYR 268 374 374 TYR TYR O . n 
O 1 269 GLN 269 375 375 GLN GLN O . n 
O 1 270 HIS 270 376 376 HIS HIS O . n 
O 1 271 LYS 271 377 377 LYS LYS O . n 
O 1 272 VAL 272 378 378 VAL VAL O . n 
O 1 273 GLY 273 379 379 GLY GLY O . n 
O 1 274 ASN 274 380 380 ASN ASN O . n 
O 1 275 ILE 275 381 381 ILE ILE O . n 
O 1 276 ILE 276 382 382 ILE ILE O . n 
O 1 277 ASP 277 383 383 ASP ASP O . n 
O 1 278 THR 278 384 384 THR THR O . n 
O 1 279 MET 279 385 385 MET MET O . n 
O 1 280 ILE 280 386 386 ILE ILE O . n 
O 1 281 THR 281 387 387 THR THR O . n 
O 1 282 ASP 282 388 388 ASP ASP O . n 
O 1 283 ALA 283 389 389 ALA ALA O . n 
O 1 284 PHE 284 390 390 PHE PHE O . n 
O 1 285 LEU 285 391 391 LEU LEU O . n 
O 1 286 LYS 286 392 392 LYS LYS O . n 
O 1 287 ALA 287 393 393 ALA ALA O . n 
O 1 288 ASP 288 394 394 ASP ASP O . n 
O 1 289 ASP 289 395 395 ASP ASP O . n 
O 1 290 TYR 290 396 396 TYR TYR O . n 
O 1 291 ILE 291 397 397 ILE ILE O . n 
O 1 292 GLU 292 398 398 GLU GLU O . n 
O 1 293 ILE 293 399 399 ILE ILE O . n 
O 1 294 THR 294 400 400 THR THR O . n 
O 1 295 GLY 295 401 401 GLY GLY O . n 
O 1 296 ALA 296 402 402 ALA ALA O . n 
O 1 297 GLY 297 403 403 GLY GLY O . n 
O 1 298 GLY 298 404 404 GLY GLY O . n 
O 1 299 LYS 299 405 405 LYS LYS O . n 
O 1 300 LYS 300 406 406 LYS LYS O . n 
O 1 301 TYR 301 407 407 TYR TYR O . n 
O 1 302 ARG 302 408 408 ARG ARG O . n 
O 1 303 ILE 303 409 409 ILE ILE O . n 
O 1 304 SER 304 410 410 SER SER O . n 
O 1 305 THR 305 411 411 THR THR O . n 
O 1 306 ALA 306 412 412 ALA ALA O . n 
O 1 307 ILE 307 413 413 ILE ILE O . n 
O 1 308 ASP 308 414 414 ASP ASP O . n 
O 1 309 ASP 309 415 415 ASP ASP O . n 
O 1 310 MET 310 416 416 MET MET O . n 
O 1 311 GLU 311 417 417 GLU GLU O . n 
O 1 312 ALA 312 418 418 ALA ALA O . n 
O 1 313 TYR 313 419 419 TYR TYR O . n 
O 1 314 THR 314 420 420 THR THR O . n 
O 1 315 LYS 315 421 421 LYS LYS O . n 
O 1 316 LEU 316 422 422 LEU LEU O . n 
O 1 317 THR 317 423 423 THR THR O . n 
O 1 318 ASP 318 424 424 ASP ASP O . n 
O 1 319 ASN 319 425 425 ASN ASN O . n 
O 1 320 ILE 320 426 426 ILE ILE O . n 
O 1 321 PHE 321 427 427 PHE PHE O . n 
O 1 322 LEU 322 428 428 LEU LEU O . n 
O 1 323 GLU 323 429 429 GLU GLU O . n 
O 1 324 ILE 324 430 430 ILE ILE O . n 
O 1 325 LEU 325 431 431 LEU LEU O . n 
O 1 326 TYR 326 432 432 TYR TYR O . n 
O 1 327 SER 327 433 433 SER SER O . n 
O 1 328 THR 328 434 434 THR THR O . n 
O 1 329 ASP 329 435 435 ASP ASP O . n 
O 1 330 PRO 330 436 436 PRO PRO O . n 
O 1 331 LYS 331 437 437 LYS LYS O . n 
O 1 332 LEU 332 438 438 LEU LEU O . n 
O 1 333 LYS 333 439 439 LYS LYS O . n 
O 1 334 ASP 334 440 440 ASP ASP O . n 
O 1 335 ALA 335 441 441 ALA ALA O . n 
O 1 336 ARG 336 442 442 ARG ARG O . n 
O 1 337 GLU 337 443 443 GLU GLU O . n 
O 1 338 ILE 338 444 444 ILE ILE O . n 
O 1 339 LEU 339 445 445 LEU LEU O . n 
O 1 340 LYS 340 446 446 LYS LYS O . n 
O 1 341 GLN 341 447 447 GLN GLN O . n 
O 1 342 ILE 342 448 448 ILE ILE O . n 
O 1 343 GLU 343 449 449 GLU GLU O . n 
O 1 344 TYR 344 450 450 TYR TYR O . n 
O 1 345 ARG 345 451 451 ARG ARG O . n 
O 1 346 ASN 346 452 452 ASN ASN O . n 
O 1 347 LEU 347 453 453 LEU LEU O . n 
O 1 348 PHE 348 454 454 PHE PHE O . n 
O 1 349 LYS 349 455 455 LYS LYS O . n 
O 1 350 TYR 350 456 456 TYR TYR O . n 
O 1 351 VAL 351 457 457 VAL VAL O . n 
O 1 352 GLY 352 458 458 GLY GLY O . n 
O 1 353 GLU 353 459 459 GLU GLU O . n 
O 1 354 THR 354 460 460 THR THR O . n 
O 1 355 GLN 355 461 461 GLN GLN O . n 
O 1 356 PRO 356 462 462 PRO PRO O . n 
O 1 357 THR 357 463 463 THR THR O . n 
O 1 358 GLY 358 464 464 GLY GLY O . n 
O 1 359 GLN 359 465 465 GLN GLN O . n 
O 1 360 ILE 360 466 466 ILE ILE O . n 
O 1 361 LYS 361 467 467 LYS LYS O . n 
O 1 362 ILE 362 468 468 ILE ILE O . n 
O 1 363 LYS 363 469 469 LYS LYS O . n 
O 1 364 ARG 364 470 470 ARG ARG O . n 
O 1 365 GLU 365 471 471 GLU GLU O . n 
O 1 366 ASP 366 472 472 ASP ASP O . n 
O 1 367 TYR 367 473 473 TYR TYR O . n 
O 1 368 GLU 368 474 474 GLU GLU O . n 
O 1 369 SER 369 475 475 SER SER O . n 
O 1 370 LEU 370 476 476 LEU LEU O . n 
O 1 371 PRO 371 477 477 PRO PRO O . n 
O 1 372 LYS 372 478 478 LYS LYS O . n 
O 1 373 GLU 373 479 479 GLU GLU O . n 
O 1 374 VAL 374 480 480 VAL VAL O . n 
O 1 375 ALA 375 481 481 ALA ALA O . n 
O 1 376 SER 376 482 482 SER SER O . n 
O 1 377 ALA 377 483 483 ALA ALA O . n 
O 1 378 LYS 378 484 484 LYS LYS O . n 
O 1 379 PRO 379 485 485 PRO PRO O . n 
O 1 380 LYS 380 486 486 LYS LYS O . n 
O 1 381 VAL 381 487 487 VAL VAL O . n 
O 1 382 LEU 382 488 488 LEU LEU O . n 
O 1 383 LEU 383 489 489 LEU LEU O . n 
O 1 384 ASP 384 490 490 ASP ASP O . n 
O 1 385 VAL 385 491 491 VAL VAL O . n 
O 1 386 LYS 386 492 492 LYS LYS O . n 
O 1 387 LEU 387 493 493 LEU LEU O . n 
O 1 388 LYS 388 494 494 LYS LYS O . n 
O 1 389 ALA 389 495 495 ALA ALA O . n 
O 1 390 GLU 390 496 496 GLU GLU O . n 
O 1 391 ASP 391 497 497 ASP ASP O . n 
O 1 392 PHE 392 498 498 PHE PHE O . n 
O 1 393 ILE 393 499 499 ILE ILE O . n 
O 1 394 VAL 394 500 500 VAL VAL O . n 
O 1 395 ASP 395 501 501 ASP ASP O . n 
O 1 396 VAL 396 502 502 VAL VAL O . n 
O 1 397 ILE 397 503 503 ILE ILE O . n 
O 1 398 ASN 398 504 504 ASN ASN O . n 
O 1 399 MET 399 505 505 MET MET O . n 
O 1 400 ASP 400 506 506 ASP ASP O . n 
O 1 401 TYR 401 507 507 TYR TYR O . n 
O 1 402 GLY 402 508 508 GLY GLY O . n 
O 1 403 MET 403 509 509 MET MET O . n 
O 1 404 GLN 404 510 510 GLN GLN O . n 
O 1 405 GLU 405 511 511 GLU GLU O . n 
O 1 406 LYS 406 512 512 LYS LYS O . n 
O 1 407 ASN 407 513 513 ASN ASN O . n 
O 1 408 PRO 408 514 514 PRO PRO O . n 
O 1 409 ILE 409 515 515 ILE ILE O . n 
O 1 410 ASP 410 516 516 ASP ASP O . n 
O 1 411 HIS 411 517 517 HIS HIS O . n 
O 1 412 VAL 412 518 518 VAL VAL O . n 
O 1 413 SER 413 519 519 SER SER O . n 
O 1 414 PHE 414 520 520 PHE PHE O . n 
O 1 415 TYR 415 521 521 TYR TYR O . n 
O 1 416 CYS 416 522 522 CYS CYS O . n 
O 1 417 LYS 417 523 523 LYS LYS O . n 
O 1 418 THR 418 524 524 THR THR O . n 
O 1 419 ALA 419 525 525 ALA ALA O . n 
O 1 420 PRO 420 526 526 PRO PRO O . n 
O 1 421 ASN 421 527 527 ASN ASN O . n 
O 1 422 ARG 422 528 528 ARG ARG O . n 
O 1 423 ALA 423 529 529 ALA ALA O . n 
O 1 424 ILE 424 530 530 ILE ILE O . n 
O 1 425 ARG 425 531 531 ARG ARG O . n 
O 1 426 ILE 426 532 532 ILE ILE O . n 
O 1 427 THR 427 533 533 THR THR O . n 
O 1 428 LYS 428 534 534 LYS LYS O . n 
O 1 429 ASN 429 535 535 ASN ASN O . n 
O 1 430 GLN 430 536 536 GLN GLN O . n 
O 1 431 VAL 431 537 537 VAL VAL O . n 
O 1 432 SER 432 538 538 SER SER O . n 
O 1 433 GLN 433 539 539 GLN GLN O . n 
O 1 434 LEU 434 540 540 LEU LEU O . n 
O 1 435 LEU 435 541 541 LEU LEU O . n 
O 1 436 PRO 436 542 542 PRO PRO O . n 
O 1 437 GLU 437 543 543 GLU GLU O . n 
O 1 438 LYS 438 544 544 LYS LYS O . n 
O 1 439 PHE 439 545 545 PHE PHE O . n 
O 1 440 ALA 440 546 546 ALA ALA O . n 
O 1 441 GLU 441 547 547 GLU GLU O . n 
O 1 442 GLN 442 548 548 GLN GLN O . n 
O 1 443 LEU 443 549 549 LEU LEU O . n 
O 1 444 ILE 444 550 550 ILE ILE O . n 
O 1 445 ARG 445 551 551 ARG ARG O . n 
O 1 446 VAL 446 552 552 VAL VAL O . n 
O 1 447 TYR 447 553 553 TYR TYR O . n 
O 1 448 CYS 448 554 554 CYS CYS O . n 
O 1 449 LYS 449 555 555 LYS LYS O . n 
O 1 450 LYS 450 556 556 LYS LYS O . n 
O 1 451 VAL 451 557 557 VAL VAL O . n 
O 1 452 ASP 452 558 558 ASP ASP O . n 
O 1 453 ARG 453 559 559 ARG ARG O . n 
O 1 454 LYS 454 560 560 LYS LYS O . n 
O 1 455 SER 455 561 561 SER SER O . n 
O 1 456 LEU 456 562 562 LEU LEU O . n 
O 1 457 TYR 457 563 563 TYR TYR O . n 
O 1 458 ALA 458 564 564 ALA ALA O . n 
O 1 459 ALA 459 565 565 ALA ALA O . n 
O 1 460 ARG 460 566 566 ARG ARG O . n 
O 1 461 GLN 461 567 567 GLN GLN O . n 
O 1 462 TYR 462 568 568 TYR TYR O . n 
O 1 463 PHE 463 569 569 PHE PHE O . n 
O 1 464 VAL 464 570 570 VAL VAL O . n 
O 1 465 GLN 465 571 571 GLN GLN O . n 
O 1 466 TRP 466 572 572 TRP TRP O . n 
O 1 467 CYS 467 573 573 CYS CYS O . n 
O 1 468 ALA 468 574 574 ALA ALA O . n 
O 1 469 ASP 469 575 575 ASP ASP O . n 
O 1 470 ARG 470 576 576 ARG ARG O . n 
O 1 471 ASN 471 577 577 ASN ASN O . n 
O 1 472 PHE 472 578 578 PHE PHE O . n 
O 1 473 THR 473 579 579 THR THR O . n 
O 1 474 LYS 474 580 580 LYS LYS O . n 
O 1 475 PRO 475 581 581 PRO PRO O . n 
O 1 476 GLN 476 582 582 GLN GLN O . n 
O 1 477 ASP 477 583 583 ASP ASP O . n 
O 1 478 GLY 478 584 584 GLY GLY O . n 
O 1 479 ASP 479 585 585 ASP ASP O . n 
O 1 480 VAL 480 586 586 VAL VAL O . n 
O 1 481 ILE 481 587 587 ILE ILE O . n 
O 1 482 ALA 482 588 588 ALA ALA O . n 
O 1 483 PRO 483 589 589 PRO PRO O . n 
O 1 484 LEU 484 590 590 LEU LEU O . n 
O 1 485 ILE 485 591 591 ILE ILE O . n 
O 1 486 THR 486 592 592 THR THR O . n 
O 1 487 PRO 487 593 593 PRO PRO O . n 
O 1 488 GLN 488 594 594 GLN GLN O . n 
O 1 489 LYS 489 595 ?   ?   ?   O . n 
O 1 490 LYS 490 596 ?   ?   ?   O . n 
O 1 491 GLU 491 597 ?   ?   ?   O . n 
O 1 492 TRP 492 598 ?   ?   ?   O . n 
O 1 493 ASN 493 599 ?   ?   ?   O . n 
O 1 494 ASP 494 600 ?   ?   ?   O . n 
O 1 495 SER 495 601 ?   ?   ?   O . n 
O 1 496 THR 496 602 ?   ?   ?   O . n 
O 1 497 SER 497 603 ?   ?   ?   O . n 
O 1 498 VAL 498 604 ?   ?   ?   O . n 
O 1 499 GLN 499 605 ?   ?   ?   O . n 
O 1 500 ASN 500 606 ?   ?   ?   O . n 
O 1 501 PRO 501 607 ?   ?   ?   O . n 
O 1 502 THR 502 608 ?   ?   ?   O . n 
O 1 503 ARG 503 609 ?   ?   ?   O . n 
O 1 504 LEU 504 610 ?   ?   ?   O . n 
O 1 505 ARG 505 611 ?   ?   ?   O . n 
O 1 506 GLU 506 612 ?   ?   ?   O . n 
O 1 507 ALA 507 613 ?   ?   ?   O . n 
O 1 508 SER 508 614 ?   ?   ?   O . n 
O 1 509 LYS 509 615 ?   ?   ?   O . n 
O 1 510 SER 510 616 ?   ?   ?   O . n 
O 1 511 ARG 511 617 ?   ?   ?   O . n 
O 1 512 VAL 512 618 ?   ?   ?   O . n 
O 1 513 GLN 513 619 ?   ?   ?   O . n 
O 1 514 LEU 514 620 ?   ?   ?   O . n 
O 1 515 PHE 515 621 ?   ?   ?   O . n 
O 1 516 LYS 516 622 ?   ?   ?   O . n 
O 1 517 ASP 517 623 ?   ?   ?   O . n 
O 1 518 ASP 518 624 ?   ?   ?   O . n 
O 1 519 PRO 519 625 ?   ?   ?   O . n 
O 1 520 MET 520 626 ?   ?   ?   O . n 
P 1 1   GLY 1   107 ?   ?   ?   P . n 
P 1 2   SER 2   108 ?   ?   ?   P . n 
P 1 3   GLN 3   109 ?   ?   ?   P . n 
P 1 4   ILE 4   110 ?   ?   ?   P . n 
P 1 5   HIS 5   111 ?   ?   ?   P . n 
P 1 6   VAL 6   112 ?   ?   ?   P . n 
P 1 7   ASP 7   113 ?   ?   ?   P . n 
P 1 8   THR 8   114 114 THR THR P . n 
P 1 9   MET 9   115 115 MET MET P . n 
P 1 10  LYS 10  116 116 LYS LYS P . n 
P 1 11  VAL 11  117 117 VAL VAL P . n 
P 1 12  ILE 12  118 118 ILE ILE P . n 
P 1 13  ASN 13  119 119 ASN ASN P . n 
P 1 14  ASP 14  120 120 ASP ASP P . n 
P 1 15  PRO 15  121 121 PRO PRO P . n 
P 1 16  ILE 16  122 122 ILE ILE P . n 
P 1 17  HIS 17  123 123 HIS HIS P . n 
P 1 18  GLY 18  124 124 GLY GLY P . n 
P 1 19  HIS 19  125 125 HIS HIS P . n 
P 1 20  ILE 20  126 126 ILE ILE P . n 
P 1 21  GLU 21  127 127 GLU GLU P . n 
P 1 22  LEU 22  128 128 LEU LEU P . n 
P 1 23  HIS 23  129 129 HIS HIS P . n 
P 1 24  PRO 24  130 130 PRO PRO P . n 
P 1 25  LEU 25  131 131 LEU LEU P . n 
P 1 26  LEU 26  132 132 LEU LEU P . n 
P 1 27  VAL 27  133 133 VAL VAL P . n 
P 1 28  ARG 28  134 134 ARG ARG P . n 
P 1 29  ILE 29  135 135 ILE ILE P . n 
P 1 30  ILE 30  136 136 ILE ILE P . n 
P 1 31  ASP 31  137 137 ASP ASP P . n 
P 1 32  THR 32  138 138 THR THR P . n 
P 1 33  PRO 33  139 139 PRO PRO P . n 
P 1 34  GLN 34  140 140 GLN GLN P . n 
P 1 35  PHE 35  141 141 PHE PHE P . n 
P 1 36  GLN 36  142 142 GLN GLN P . n 
P 1 37  ARG 37  143 143 ARG ARG P . n 
P 1 38  LEU 38  144 144 LEU LEU P . n 
P 1 39  ARG 39  145 145 ARG ARG P . n 
P 1 40  TYR 40  146 146 TYR TYR P . n 
P 1 41  ILE 41  147 147 ILE ILE P . n 
P 1 42  LYS 42  148 148 LYS LYS P . n 
P 1 43  GLN 43  149 149 GLN GLN P . n 
P 1 44  LEU 44  150 150 LEU LEU P . n 
P 1 45  GLY 45  151 151 GLY GLY P . n 
P 1 46  GLY 46  152 152 GLY GLY P . n 
P 1 47  GLY 47  153 153 GLY GLY P . n 
P 1 48  TYR 48  154 154 TYR TYR P . n 
P 1 49  TYR 49  155 155 TYR TYR P . n 
P 1 50  VAL 50  156 156 VAL VAL P . n 
P 1 51  PHE 51  157 157 PHE PHE P . n 
P 1 52  PRO 52  158 158 PRO PRO P . n 
P 1 53  GLY 53  159 159 GLY GLY P . n 
P 1 54  ALA 54  160 160 ALA ALA P . n 
P 1 55  SER 55  161 161 SER SER P . n 
P 1 56  HIS 56  162 162 HIS HIS P . n 
P 1 57  ASN 57  163 163 ASN ASN P . n 
P 1 58  ARG 58  164 164 ARG ARG P . n 
P 1 59  PHE 59  165 165 PHE PHE P . n 
P 1 60  GLU 60  166 166 GLU GLU P . n 
P 1 61  HIS 61  167 167 HIS HIS P . n 
P 1 62  SER 62  168 168 SER SER P . n 
P 1 63  LEU 63  169 169 LEU LEU P . n 
P 1 64  GLY 64  170 170 GLY GLY P . n 
P 1 65  VAL 65  171 171 VAL VAL P . n 
P 1 66  GLY 66  172 172 GLY GLY P . n 
P 1 67  TYR 67  173 173 TYR TYR P . n 
P 1 68  LEU 68  174 174 LEU LEU P . n 
P 1 69  ALA 69  175 175 ALA ALA P . n 
P 1 70  GLY 70  176 176 GLY GLY P . n 
P 1 71  CYS 71  177 177 CYS CYS P . n 
P 1 72  LEU 72  178 178 LEU LEU P . n 
P 1 73  VAL 73  179 179 VAL VAL P . n 
P 1 74  HIS 74  180 180 HIS HIS P . n 
P 1 75  ALA 75  181 181 ALA ALA P . n 
P 1 76  LEU 76  182 182 LEU LEU P . n 
P 1 77  GLY 77  183 183 GLY GLY P . n 
P 1 78  GLU 78  184 184 GLU GLU P . n 
P 1 79  LYS 79  185 185 LYS LYS P . n 
P 1 80  GLN 80  186 186 GLN GLN P . n 
P 1 81  PRO 81  187 187 PRO PRO P . n 
P 1 82  GLU 82  188 188 GLU GLU P . n 
P 1 83  LEU 83  189 189 LEU LEU P . n 
P 1 84  GLN 84  190 190 GLN GLN P . n 
P 1 85  ILE 85  191 191 ILE ILE P . n 
P 1 86  SER 86  192 192 SER SER P . n 
P 1 87  GLU 87  193 193 GLU GLU P . n 
P 1 88  ARG 88  194 194 ARG ARG P . n 
P 1 89  ASP 89  195 195 ASP ASP P . n 
P 1 90  VAL 90  196 196 VAL VAL P . n 
P 1 91  LEU 91  197 197 LEU LEU P . n 
P 1 92  CYS 92  198 198 CYS CYS P . n 
P 1 93  VAL 93  199 199 VAL VAL P . n 
P 1 94  GLN 94  200 200 GLN GLN P . n 
P 1 95  ILE 95  201 201 ILE ILE P . n 
P 1 96  ALA 96  202 202 ALA ALA P . n 
P 1 97  GLY 97  203 203 GLY GLY P . n 
P 1 98  LEU 98  204 204 LEU LEU P . n 
P 1 99  CYS 99  205 205 CYS CYS P . n 
P 1 100 HIS 100 206 206 HIS HIS P . n 
P 1 101 ASP 101 207 207 ASP ASP P . n 
P 1 102 LEU 102 208 208 LEU LEU P . n 
P 1 103 GLY 103 209 209 GLY GLY P . n 
P 1 104 HIS 104 210 210 HIS HIS P . n 
P 1 105 GLY 105 211 211 GLY GLY P . n 
P 1 106 PRO 106 212 212 PRO PRO P . n 
P 1 107 PHE 107 213 213 PHE PHE P . n 
P 1 108 SER 108 214 214 SER SER P . n 
P 1 109 HIS 109 215 215 HIS HIS P . n 
P 1 110 MET 110 216 216 MET MET P . n 
P 1 111 PHE 111 217 217 PHE PHE P . n 
P 1 112 ASP 112 218 218 ASP ASP P . n 
P 1 113 GLY 113 219 219 GLY GLY P . n 
P 1 114 ARG 114 220 220 ARG ARG P . n 
P 1 115 PHE 115 221 221 PHE PHE P . n 
P 1 116 ILE 116 222 222 ILE ILE P . n 
P 1 117 PRO 117 223 223 PRO PRO P . n 
P 1 118 LEU 118 224 224 LEU LEU P . n 
P 1 119 ALA 119 225 225 ALA ALA P . n 
P 1 120 ARG 120 226 226 ARG ARG P . n 
P 1 121 PRO 121 227 227 PRO PRO P . n 
P 1 122 GLU 122 228 228 GLU GLU P . n 
P 1 123 VAL 123 229 229 VAL VAL P . n 
P 1 124 LYS 124 230 230 LYS LYS P . n 
P 1 125 TRP 125 231 231 TRP TRP P . n 
P 1 126 THR 126 232 232 THR THR P . n 
P 1 127 HIS 127 233 233 HIS HIS P . n 
P 1 128 GLU 128 234 234 GLU GLU P . n 
P 1 129 GLN 129 235 235 GLN GLN P . n 
P 1 130 GLY 130 236 236 GLY GLY P . n 
P 1 131 SER 131 237 237 SER SER P . n 
P 1 132 VAL 132 238 238 VAL VAL P . n 
P 1 133 MET 133 239 239 MET MET P . n 
P 1 134 MET 134 240 240 MET MET P . n 
P 1 135 PHE 135 241 241 PHE PHE P . n 
P 1 136 GLU 136 242 242 GLU GLU P . n 
P 1 137 HIS 137 243 243 HIS HIS P . n 
P 1 138 LEU 138 244 244 LEU LEU P . n 
P 1 139 ILE 139 245 245 ILE ILE P . n 
P 1 140 ASN 140 246 246 ASN ASN P . n 
P 1 141 SER 141 247 247 SER SER P . n 
P 1 142 ASN 142 248 248 ASN ASN P . n 
P 1 143 GLY 143 249 249 GLY GLY P . n 
P 1 144 ILE 144 250 250 ILE ILE P . n 
P 1 145 LYS 145 251 251 LYS LYS P . n 
P 1 146 PRO 146 252 252 PRO PRO P . n 
P 1 147 VAL 147 253 253 VAL VAL P . n 
P 1 148 MET 148 254 254 MET MET P . n 
P 1 149 GLU 149 255 255 GLU GLU P . n 
P 1 150 GLN 150 256 256 GLN GLN P . n 
P 1 151 TYR 151 257 257 TYR TYR P . n 
P 1 152 GLY 152 258 258 GLY GLY P . n 
P 1 153 LEU 153 259 259 LEU LEU P . n 
P 1 154 ILE 154 260 260 ILE ILE P . n 
P 1 155 PRO 155 261 261 PRO PRO P . n 
P 1 156 GLU 156 262 262 GLU GLU P . n 
P 1 157 GLU 157 263 263 GLU GLU P . n 
P 1 158 ASP 158 264 264 ASP ASP P . n 
P 1 159 ILE 159 265 265 ILE ILE P . n 
P 1 160 CYS 160 266 266 CYS CYS P . n 
P 1 161 PHE 161 267 267 PHE PHE P . n 
P 1 162 ILE 162 268 268 ILE ILE P . n 
P 1 163 LYS 163 269 269 LYS LYS P . n 
P 1 164 GLU 164 270 270 GLU GLU P . n 
P 1 165 GLN 165 271 271 GLN GLN P . n 
P 1 166 ILE 166 272 272 ILE ILE P . n 
P 1 167 VAL 167 273 273 VAL VAL P . n 
P 1 168 GLY 168 274 274 GLY GLY P . n 
P 1 169 PRO 169 275 275 PRO PRO P . n 
P 1 170 LEU 170 276 276 LEU LEU P . n 
P 1 171 GLU 171 277 ?   ?   ?   P . n 
P 1 172 SER 172 278 ?   ?   ?   P . n 
P 1 173 PRO 173 279 ?   ?   ?   P . n 
P 1 174 VAL 174 280 ?   ?   ?   P . n 
P 1 175 GLU 175 281 ?   ?   ?   P . n 
P 1 176 ASP 176 282 ?   ?   ?   P . n 
P 1 177 SER 177 283 ?   ?   ?   P . n 
P 1 178 LEU 178 284 284 LEU LEU P . n 
P 1 179 TRP 179 285 285 TRP TRP P . n 
P 1 180 PRO 180 286 286 PRO PRO P . n 
P 1 181 TYR 181 287 287 TYR TYR P . n 
P 1 182 LYS 182 288 288 LYS LYS P . n 
P 1 183 GLY 183 289 289 GLY GLY P . n 
P 1 184 ARG 184 290 290 ARG ARG P . n 
P 1 185 PRO 185 291 291 PRO PRO P . n 
P 1 186 GLU 186 292 292 GLU GLU P . n 
P 1 187 ASN 187 293 293 ASN ASN P . n 
P 1 188 LYS 188 294 294 LYS LYS P . n 
P 1 189 SER 189 295 295 SER SER P . n 
P 1 190 PHE 190 296 296 PHE PHE P . n 
P 1 191 LEU 191 297 297 LEU LEU P . n 
P 1 192 TYR 192 298 298 TYR TYR P . n 
P 1 193 GLU 193 299 299 GLU GLU P . n 
P 1 194 ILE 194 300 300 ILE ILE P . n 
P 1 195 VAL 195 301 301 VAL VAL P . n 
P 1 196 SER 196 302 302 SER SER P . n 
P 1 197 ASN 197 303 303 ASN ASN P . n 
P 1 198 LYS 198 304 304 LYS LYS P . n 
P 1 199 ARG 199 305 305 ARG ARG P . n 
P 1 200 ASN 200 306 306 ASN ASN P . n 
P 1 201 GLY 201 307 307 GLY GLY P . n 
P 1 202 ILE 202 308 308 ILE ILE P . n 
P 1 203 ASP 203 309 309 ASP ASP P . n 
P 1 204 VAL 204 310 310 VAL VAL P . n 
P 1 205 ASP 205 311 311 ASP ASP P . n 
P 1 206 LYS 206 312 312 LYS LYS P . n 
P 1 207 TRP 207 313 313 TRP TRP P . n 
P 1 208 ASP 208 314 314 ASP ASP P . n 
P 1 209 TYR 209 315 315 TYR TYR P . n 
P 1 210 PHE 210 316 316 PHE PHE P . n 
P 1 211 ALA 211 317 317 ALA ALA P . n 
P 1 212 ARG 212 318 318 ARG ARG P . n 
P 1 213 ASP 213 319 319 ASP ASP P . n 
P 1 214 CYS 214 320 320 CYS CYS P . n 
P 1 215 HIS 215 321 321 HIS HIS P . n 
P 1 216 HIS 216 322 322 HIS HIS P . n 
P 1 217 LEU 217 323 323 LEU LEU P . n 
P 1 218 GLY 218 324 324 GLY GLY P . n 
P 1 219 ILE 219 325 325 ILE ILE P . n 
P 1 220 GLN 220 326 326 GLN GLN P . n 
P 1 221 ASN 221 327 327 ASN ASN P . n 
P 1 222 ASN 222 328 328 ASN ASN P . n 
P 1 223 PHE 223 329 329 PHE PHE P . n 
P 1 224 ASP 224 330 330 ASP ASP P . n 
P 1 225 TYR 225 331 331 TYR TYR P . n 
P 1 226 LYS 226 332 332 LYS LYS P . n 
P 1 227 ARG 227 333 333 ARG ARG P . n 
P 1 228 PHE 228 334 334 PHE PHE P . n 
P 1 229 ILE 229 335 335 ILE ILE P . n 
P 1 230 LYS 230 336 336 LYS LYS P . n 
P 1 231 PHE 231 337 337 PHE PHE P . n 
P 1 232 ALA 232 338 338 ALA ALA P . n 
P 1 233 ARG 233 339 339 ARG ARG P . n 
P 1 234 VAL 234 340 340 VAL VAL P . n 
P 1 235 CYS 235 341 341 CYS CYS P . n 
P 1 236 GLU 236 342 342 GLU GLU P . n 
P 1 237 VAL 237 343 343 VAL VAL P . n 
P 1 238 ASP 238 344 344 ASP ASP P . n 
P 1 239 ASN 239 345 345 ASN ASN P . n 
P 1 240 GLU 240 346 346 GLU GLU P . n 
P 1 241 LEU 241 347 347 LEU LEU P . n 
P 1 242 ARG 242 348 348 ARG ARG P . n 
P 1 243 ILE 243 349 349 ILE ILE P . n 
P 1 244 CYS 244 350 350 CYS CYS P . n 
P 1 245 ALA 245 351 351 ALA ALA P . n 
P 1 246 ARG 246 352 352 ARG ARG P . n 
P 1 247 ASP 247 353 353 ASP ASP P . n 
P 1 248 LYS 248 354 354 LYS LYS P . n 
P 1 249 GLU 249 355 355 GLU GLU P . n 
P 1 250 VAL 250 356 356 VAL VAL P . n 
P 1 251 GLY 251 357 357 GLY GLY P . n 
P 1 252 ASN 252 358 358 ASN ASN P . n 
P 1 253 LEU 253 359 359 LEU LEU P . n 
P 1 254 TYR 254 360 360 TYR TYR P . n 
P 1 255 ASP 255 361 361 ASP ASP P . n 
P 1 256 MET 256 362 362 MET MET P . n 
P 1 257 PHE 257 363 363 PHE PHE P . n 
P 1 258 HIS 258 364 364 HIS HIS P . n 
P 1 259 THR 259 365 365 THR THR P . n 
P 1 260 ARG 260 366 366 ARG ARG P . n 
P 1 261 ASN 261 367 367 ASN ASN P . n 
P 1 262 SER 262 368 368 SER SER P . n 
P 1 263 LEU 263 369 369 LEU LEU P . n 
P 1 264 HIS 264 370 370 HIS HIS P . n 
P 1 265 ARG 265 371 371 ARG ARG P . n 
P 1 266 ARG 266 372 372 ARG ARG P . n 
P 1 267 ALA 267 373 373 ALA ALA P . n 
P 1 268 TYR 268 374 374 TYR TYR P . n 
P 1 269 GLN 269 375 375 GLN GLN P . n 
P 1 270 HIS 270 376 376 HIS HIS P . n 
P 1 271 LYS 271 377 377 LYS LYS P . n 
P 1 272 VAL 272 378 378 VAL VAL P . n 
P 1 273 GLY 273 379 379 GLY GLY P . n 
P 1 274 ASN 274 380 380 ASN ASN P . n 
P 1 275 ILE 275 381 381 ILE ILE P . n 
P 1 276 ILE 276 382 382 ILE ILE P . n 
P 1 277 ASP 277 383 383 ASP ASP P . n 
P 1 278 THR 278 384 384 THR THR P . n 
P 1 279 MET 279 385 385 MET MET P . n 
P 1 280 ILE 280 386 386 ILE ILE P . n 
P 1 281 THR 281 387 387 THR THR P . n 
P 1 282 ASP 282 388 388 ASP ASP P . n 
P 1 283 ALA 283 389 389 ALA ALA P . n 
P 1 284 PHE 284 390 390 PHE PHE P . n 
P 1 285 LEU 285 391 391 LEU LEU P . n 
P 1 286 LYS 286 392 392 LYS LYS P . n 
P 1 287 ALA 287 393 393 ALA ALA P . n 
P 1 288 ASP 288 394 394 ASP ASP P . n 
P 1 289 ASP 289 395 395 ASP ASP P . n 
P 1 290 TYR 290 396 396 TYR TYR P . n 
P 1 291 ILE 291 397 397 ILE ILE P . n 
P 1 292 GLU 292 398 398 GLU GLU P . n 
P 1 293 ILE 293 399 399 ILE ILE P . n 
P 1 294 THR 294 400 400 THR THR P . n 
P 1 295 GLY 295 401 401 GLY GLY P . n 
P 1 296 ALA 296 402 402 ALA ALA P . n 
P 1 297 GLY 297 403 403 GLY GLY P . n 
P 1 298 GLY 298 404 404 GLY GLY P . n 
P 1 299 LYS 299 405 405 LYS LYS P . n 
P 1 300 LYS 300 406 406 LYS LYS P . n 
P 1 301 TYR 301 407 407 TYR TYR P . n 
P 1 302 ARG 302 408 408 ARG ARG P . n 
P 1 303 ILE 303 409 409 ILE ILE P . n 
P 1 304 SER 304 410 410 SER SER P . n 
P 1 305 THR 305 411 411 THR THR P . n 
P 1 306 ALA 306 412 412 ALA ALA P . n 
P 1 307 ILE 307 413 413 ILE ILE P . n 
P 1 308 ASP 308 414 414 ASP ASP P . n 
P 1 309 ASP 309 415 415 ASP ASP P . n 
P 1 310 MET 310 416 416 MET MET P . n 
P 1 311 GLU 311 417 417 GLU GLU P . n 
P 1 312 ALA 312 418 418 ALA ALA P . n 
P 1 313 TYR 313 419 419 TYR TYR P . n 
P 1 314 THR 314 420 420 THR THR P . n 
P 1 315 LYS 315 421 421 LYS LYS P . n 
P 1 316 LEU 316 422 422 LEU LEU P . n 
P 1 317 THR 317 423 423 THR THR P . n 
P 1 318 ASP 318 424 424 ASP ASP P . n 
P 1 319 ASN 319 425 425 ASN ASN P . n 
P 1 320 ILE 320 426 426 ILE ILE P . n 
P 1 321 PHE 321 427 427 PHE PHE P . n 
P 1 322 LEU 322 428 428 LEU LEU P . n 
P 1 323 GLU 323 429 429 GLU GLU P . n 
P 1 324 ILE 324 430 430 ILE ILE P . n 
P 1 325 LEU 325 431 431 LEU LEU P . n 
P 1 326 TYR 326 432 432 TYR TYR P . n 
P 1 327 SER 327 433 433 SER SER P . n 
P 1 328 THR 328 434 434 THR THR P . n 
P 1 329 ASP 329 435 435 ASP ASP P . n 
P 1 330 PRO 330 436 436 PRO PRO P . n 
P 1 331 LYS 331 437 437 LYS LYS P . n 
P 1 332 LEU 332 438 438 LEU LEU P . n 
P 1 333 LYS 333 439 439 LYS LYS P . n 
P 1 334 ASP 334 440 440 ASP ASP P . n 
P 1 335 ALA 335 441 441 ALA ALA P . n 
P 1 336 ARG 336 442 442 ARG ARG P . n 
P 1 337 GLU 337 443 443 GLU GLU P . n 
P 1 338 ILE 338 444 444 ILE ILE P . n 
P 1 339 LEU 339 445 445 LEU LEU P . n 
P 1 340 LYS 340 446 446 LYS LYS P . n 
P 1 341 GLN 341 447 447 GLN GLN P . n 
P 1 342 ILE 342 448 448 ILE ILE P . n 
P 1 343 GLU 343 449 449 GLU GLU P . n 
P 1 344 TYR 344 450 450 TYR TYR P . n 
P 1 345 ARG 345 451 451 ARG ARG P . n 
P 1 346 ASN 346 452 452 ASN ASN P . n 
P 1 347 LEU 347 453 453 LEU LEU P . n 
P 1 348 PHE 348 454 454 PHE PHE P . n 
P 1 349 LYS 349 455 455 LYS LYS P . n 
P 1 350 TYR 350 456 456 TYR TYR P . n 
P 1 351 VAL 351 457 457 VAL VAL P . n 
P 1 352 GLY 352 458 458 GLY GLY P . n 
P 1 353 GLU 353 459 459 GLU GLU P . n 
P 1 354 THR 354 460 460 THR THR P . n 
P 1 355 GLN 355 461 461 GLN GLN P . n 
P 1 356 PRO 356 462 462 PRO PRO P . n 
P 1 357 THR 357 463 463 THR THR P . n 
P 1 358 GLY 358 464 464 GLY GLY P . n 
P 1 359 GLN 359 465 465 GLN GLN P . n 
P 1 360 ILE 360 466 466 ILE ILE P . n 
P 1 361 LYS 361 467 467 LYS LYS P . n 
P 1 362 ILE 362 468 468 ILE ILE P . n 
P 1 363 LYS 363 469 469 LYS LYS P . n 
P 1 364 ARG 364 470 470 ARG ARG P . n 
P 1 365 GLU 365 471 471 GLU GLU P . n 
P 1 366 ASP 366 472 472 ASP ASP P . n 
P 1 367 TYR 367 473 473 TYR TYR P . n 
P 1 368 GLU 368 474 474 GLU GLU P . n 
P 1 369 SER 369 475 475 SER SER P . n 
P 1 370 LEU 370 476 476 LEU LEU P . n 
P 1 371 PRO 371 477 477 PRO PRO P . n 
P 1 372 LYS 372 478 478 LYS LYS P . n 
P 1 373 GLU 373 479 479 GLU GLU P . n 
P 1 374 VAL 374 480 480 VAL VAL P . n 
P 1 375 ALA 375 481 481 ALA ALA P . n 
P 1 376 SER 376 482 482 SER SER P . n 
P 1 377 ALA 377 483 483 ALA ALA P . n 
P 1 378 LYS 378 484 484 LYS LYS P . n 
P 1 379 PRO 379 485 485 PRO PRO P . n 
P 1 380 LYS 380 486 486 LYS LYS P . n 
P 1 381 VAL 381 487 487 VAL VAL P . n 
P 1 382 LEU 382 488 488 LEU LEU P . n 
P 1 383 LEU 383 489 489 LEU LEU P . n 
P 1 384 ASP 384 490 490 ASP ASP P . n 
P 1 385 VAL 385 491 491 VAL VAL P . n 
P 1 386 LYS 386 492 492 LYS LYS P . n 
P 1 387 LEU 387 493 493 LEU LEU P . n 
P 1 388 LYS 388 494 494 LYS LYS P . n 
P 1 389 ALA 389 495 495 ALA ALA P . n 
P 1 390 GLU 390 496 496 GLU GLU P . n 
P 1 391 ASP 391 497 497 ASP ASP P . n 
P 1 392 PHE 392 498 498 PHE PHE P . n 
P 1 393 ILE 393 499 499 ILE ILE P . n 
P 1 394 VAL 394 500 500 VAL VAL P . n 
P 1 395 ASP 395 501 501 ASP ASP P . n 
P 1 396 VAL 396 502 502 VAL VAL P . n 
P 1 397 ILE 397 503 503 ILE ILE P . n 
P 1 398 ASN 398 504 504 ASN ASN P . n 
P 1 399 MET 399 505 505 MET MET P . n 
P 1 400 ASP 400 506 506 ASP ASP P . n 
P 1 401 TYR 401 507 507 TYR TYR P . n 
P 1 402 GLY 402 508 508 GLY GLY P . n 
P 1 403 MET 403 509 509 MET MET P . n 
P 1 404 GLN 404 510 510 GLN GLN P . n 
P 1 405 GLU 405 511 511 GLU GLU P . n 
P 1 406 LYS 406 512 512 LYS LYS P . n 
P 1 407 ASN 407 513 513 ASN ASN P . n 
P 1 408 PRO 408 514 514 PRO PRO P . n 
P 1 409 ILE 409 515 515 ILE ILE P . n 
P 1 410 ASP 410 516 516 ASP ASP P . n 
P 1 411 HIS 411 517 517 HIS HIS P . n 
P 1 412 VAL 412 518 518 VAL VAL P . n 
P 1 413 SER 413 519 519 SER SER P . n 
P 1 414 PHE 414 520 520 PHE PHE P . n 
P 1 415 TYR 415 521 521 TYR TYR P . n 
P 1 416 CYS 416 522 522 CYS CYS P . n 
P 1 417 LYS 417 523 523 LYS LYS P . n 
P 1 418 THR 418 524 524 THR THR P . n 
P 1 419 ALA 419 525 525 ALA ALA P . n 
P 1 420 PRO 420 526 526 PRO PRO P . n 
P 1 421 ASN 421 527 527 ASN ASN P . n 
P 1 422 ARG 422 528 528 ARG ARG P . n 
P 1 423 ALA 423 529 529 ALA ALA P . n 
P 1 424 ILE 424 530 530 ILE ILE P . n 
P 1 425 ARG 425 531 531 ARG ARG P . n 
P 1 426 ILE 426 532 532 ILE ILE P . n 
P 1 427 THR 427 533 533 THR THR P . n 
P 1 428 LYS 428 534 534 LYS LYS P . n 
P 1 429 ASN 429 535 535 ASN ASN P . n 
P 1 430 GLN 430 536 536 GLN GLN P . n 
P 1 431 VAL 431 537 537 VAL VAL P . n 
P 1 432 SER 432 538 538 SER SER P . n 
P 1 433 GLN 433 539 539 GLN GLN P . n 
P 1 434 LEU 434 540 540 LEU LEU P . n 
P 1 435 LEU 435 541 541 LEU LEU P . n 
P 1 436 PRO 436 542 542 PRO PRO P . n 
P 1 437 GLU 437 543 543 GLU GLU P . n 
P 1 438 LYS 438 544 544 LYS LYS P . n 
P 1 439 PHE 439 545 545 PHE PHE P . n 
P 1 440 ALA 440 546 546 ALA ALA P . n 
P 1 441 GLU 441 547 547 GLU GLU P . n 
P 1 442 GLN 442 548 548 GLN GLN P . n 
P 1 443 LEU 443 549 549 LEU LEU P . n 
P 1 444 ILE 444 550 550 ILE ILE P . n 
P 1 445 ARG 445 551 551 ARG ARG P . n 
P 1 446 VAL 446 552 552 VAL VAL P . n 
P 1 447 TYR 447 553 553 TYR TYR P . n 
P 1 448 CYS 448 554 554 CYS CYS P . n 
P 1 449 LYS 449 555 555 LYS LYS P . n 
P 1 450 LYS 450 556 556 LYS LYS P . n 
P 1 451 VAL 451 557 557 VAL VAL P . n 
P 1 452 ASP 452 558 558 ASP ASP P . n 
P 1 453 ARG 453 559 559 ARG ARG P . n 
P 1 454 LYS 454 560 560 LYS LYS P . n 
P 1 455 SER 455 561 561 SER SER P . n 
P 1 456 LEU 456 562 562 LEU LEU P . n 
P 1 457 TYR 457 563 563 TYR TYR P . n 
P 1 458 ALA 458 564 564 ALA ALA P . n 
P 1 459 ALA 459 565 565 ALA ALA P . n 
P 1 460 ARG 460 566 566 ARG ARG P . n 
P 1 461 GLN 461 567 567 GLN GLN P . n 
P 1 462 TYR 462 568 568 TYR TYR P . n 
P 1 463 PHE 463 569 569 PHE PHE P . n 
P 1 464 VAL 464 570 570 VAL VAL P . n 
P 1 465 GLN 465 571 571 GLN GLN P . n 
P 1 466 TRP 466 572 572 TRP TRP P . n 
P 1 467 CYS 467 573 573 CYS CYS P . n 
P 1 468 ALA 468 574 574 ALA ALA P . n 
P 1 469 ASP 469 575 575 ASP ASP P . n 
P 1 470 ARG 470 576 576 ARG ARG P . n 
P 1 471 ASN 471 577 577 ASN ASN P . n 
P 1 472 PHE 472 578 578 PHE PHE P . n 
P 1 473 THR 473 579 579 THR THR P . n 
P 1 474 LYS 474 580 580 LYS LYS P . n 
P 1 475 PRO 475 581 581 PRO PRO P . n 
P 1 476 GLN 476 582 582 GLN GLN P . n 
P 1 477 ASP 477 583 583 ASP ASP P . n 
P 1 478 GLY 478 584 584 GLY GLY P . n 
P 1 479 ASP 479 585 585 ASP ASP P . n 
P 1 480 VAL 480 586 586 VAL VAL P . n 
P 1 481 ILE 481 587 587 ILE ILE P . n 
P 1 482 ALA 482 588 588 ALA ALA P . n 
P 1 483 PRO 483 589 589 PRO PRO P . n 
P 1 484 LEU 484 590 590 LEU LEU P . n 
P 1 485 ILE 485 591 591 ILE ILE P . n 
P 1 486 THR 486 592 592 THR THR P . n 
P 1 487 PRO 487 593 593 PRO PRO P . n 
P 1 488 GLN 488 594 594 GLN GLN P . n 
P 1 489 LYS 489 595 ?   ?   ?   P . n 
P 1 490 LYS 490 596 ?   ?   ?   P . n 
P 1 491 GLU 491 597 ?   ?   ?   P . n 
P 1 492 TRP 492 598 ?   ?   ?   P . n 
P 1 493 ASN 493 599 ?   ?   ?   P . n 
P 1 494 ASP 494 600 ?   ?   ?   P . n 
P 1 495 SER 495 601 ?   ?   ?   P . n 
P 1 496 THR 496 602 ?   ?   ?   P . n 
P 1 497 SER 497 603 ?   ?   ?   P . n 
P 1 498 VAL 498 604 ?   ?   ?   P . n 
P 1 499 GLN 499 605 ?   ?   ?   P . n 
P 1 500 ASN 500 606 ?   ?   ?   P . n 
P 1 501 PRO 501 607 ?   ?   ?   P . n 
P 1 502 THR 502 608 ?   ?   ?   P . n 
P 1 503 ARG 503 609 ?   ?   ?   P . n 
P 1 504 LEU 504 610 ?   ?   ?   P . n 
P 1 505 ARG 505 611 ?   ?   ?   P . n 
P 1 506 GLU 506 612 ?   ?   ?   P . n 
P 1 507 ALA 507 613 ?   ?   ?   P . n 
P 1 508 SER 508 614 ?   ?   ?   P . n 
P 1 509 LYS 509 615 ?   ?   ?   P . n 
P 1 510 SER 510 616 ?   ?   ?   P . n 
P 1 511 ARG 511 617 ?   ?   ?   P . n 
P 1 512 VAL 512 618 ?   ?   ?   P . n 
P 1 513 GLN 513 619 ?   ?   ?   P . n 
P 1 514 LEU 514 620 ?   ?   ?   P . n 
P 1 515 PHE 515 621 ?   ?   ?   P . n 
P 1 516 LYS 516 622 ?   ?   ?   P . n 
P 1 517 ASP 517 623 ?   ?   ?   P . n 
P 1 518 ASP 518 624 ?   ?   ?   P . n 
P 1 519 PRO 519 625 ?   ?   ?   P . n 
P 1 520 MET 520 626 ?   ?   ?   P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
Q  2 FE  1 701 701 FE  FE  A . 
R  3 MG  1 702 703 MG  MG  A . 
S  3 MG  1 703 704 MG  MG  A . 
T  4 1FZ 1 704 801 1FZ UNL A . 
U  5 GTP 1 705 802 GTP GTP A . 
V  6 DTP 1 706 803 DTP DTP A . 
W  2 FE  1 701 701 FE  FE  B . 
X  3 MG  1 702 703 MG  MG  B . 
Y  3 MG  1 703 704 MG  MG  B . 
Z  4 1FZ 1 704 801 1FZ UNL B . 
AA 5 GTP 1 705 802 GTP GTP B . 
BA 7 SO4 1 706 901 SO4 SO4 B . 
CA 6 DTP 1 707 803 DTP DTP B . 
DA 6 DTP 1 701 803 DTP DTP C . 
EA 2 FE  1 702 701 FE  FE  C . 
FA 3 MG  1 703 703 MG  MG  C . 
GA 3 MG  1 704 704 MG  MG  C . 
HA 4 1FZ 1 705 801 1FZ UNL C . 
IA 7 SO4 1 706 901 SO4 SO4 C . 
JA 6 DTP 1 701 803 DTP DTP D . 
KA 5 GTP 1 702 802 GTP GTP D . 
LA 2 FE  1 703 701 FE  FE  D . 
MA 3 MG  1 704 703 MG  MG  D . 
NA 3 MG  1 705 704 MG  MG  D . 
OA 4 1FZ 1 706 801 1FZ UNL D . 
PA 5 GTP 1 707 802 GTP GTP D . 
QA 7 SO4 1 708 901 SO4 SO4 D . 
RA 2 FE  1 701 701 FE  FE  E . 
SA 3 MG  1 702 703 MG  MG  E . 
TA 3 MG  1 703 704 MG  MG  E . 
UA 4 1FZ 1 704 801 1FZ UNL E . 
VA 5 GTP 1 705 802 GTP GTP E . 
WA 7 SO4 1 706 901 SO4 SO4 E . 
XA 6 DTP 1 707 803 DTP DTP E . 
YA 2 FE  1 701 701 FE  FE  F . 
ZA 3 MG  1 702 703 MG  MG  F . 
AB 3 MG  1 703 704 MG  MG  F . 
BB 4 1FZ 1 704 801 1FZ UNL F . 
CB 5 GTP 1 705 802 GTP GTP F . 
DB 7 SO4 1 706 901 SO4 SO4 F . 
EB 6 DTP 1 707 803 DTP DTP F . 
FB 6 DTP 1 701 803 DTP DTP G . 
GB 2 FE  1 702 701 FE  FE  G . 
HB 3 MG  1 703 703 MG  MG  G . 
IB 3 MG  1 704 704 MG  MG  G . 
JB 4 1FZ 1 705 801 1FZ UNL G . 
KB 5 GTP 1 706 802 GTP GTP G . 
LB 6 DTP 1 701 803 DTP DTP H . 
MB 2 FE  1 702 701 FE  FE  H . 
NB 3 MG  1 703 703 MG  MG  H . 
OB 3 MG  1 704 704 MG  MG  H . 
PB 4 1FZ 1 705 801 1FZ UNL H . 
QB 5 GTP 1 706 802 GTP GTP H . 
RB 7 SO4 1 707 901 SO4 SO4 H . 
SB 2 FE  1 701 701 FE  FE  I . 
TB 3 MG  1 702 703 MG  MG  I . 
UB 3 MG  1 703 704 MG  MG  I . 
VB 4 1FZ 1 704 801 1FZ UNL I . 
WB 5 GTP 1 705 802 GTP GTP I . 
XB 7 SO4 1 706 901 SO4 SO4 I . 
YB 5 GTP 1 707 802 GTP GTP I . 
ZB 6 DTP 1 708 803 DTP DTP I . 
AC 2 FE  1 701 701 FE  FE  J . 
BC 3 MG  1 702 703 MG  MG  J . 
CC 3 MG  1 703 704 MG  MG  J . 
DC 4 1FZ 1 704 801 1FZ UNL J . 
EC 7 SO4 1 705 901 SO4 SO4 J . 
FC 6 DTP 1 706 803 DTP DTP J . 
GC 6 DTP 1 701 803 DTP DTP K . 
HC 2 FE  1 702 701 FE  FE  K . 
IC 3 MG  1 703 703 MG  MG  K . 
JC 3 MG  1 704 704 MG  MG  K . 
KC 4 1FZ 1 705 801 1FZ UNL K . 
LC 5 GTP 1 706 802 GTP GTP K . 
MC 7 SO4 1 707 901 SO4 SO4 K . 
NC 6 DTP 1 701 803 DTP DTP L . 
OC 2 FE  1 702 701 FE  FE  L . 
PC 3 MG  1 703 703 MG  MG  L . 
QC 3 MG  1 704 704 MG  MG  L . 
RC 4 1FZ 1 705 801 1FZ UNL L . 
SC 5 GTP 1 706 802 GTP GTP L . 
TC 2 FE  1 701 701 FE  FE  M . 
UC 3 MG  1 702 703 MG  MG  M . 
VC 3 MG  1 703 704 MG  MG  M . 
WC 4 1FZ 1 704 801 1FZ UNL M . 
XC 5 GTP 1 705 802 GTP GTP M . 
YC 6 DTP 1 706 803 DTP DTP M . 
ZC 6 DTP 1 707 803 DTP DTP M . 
AD 6 DTP 1 701 803 DTP DTP N . 
BD 2 FE  1 702 701 FE  FE  N . 
CD 3 MG  1 703 703 MG  MG  N . 
DD 3 MG  1 704 704 MG  MG  N . 
ED 4 1FZ 1 705 801 1FZ UNL N . 
FD 5 GTP 1 706 802 GTP GTP N . 
GD 7 SO4 1 707 901 SO4 SO4 N . 
HD 6 DTP 1 708 803 DTP DTP N . 
ID 2 FE  1 701 701 FE  FE  O . 
JD 3 MG  1 702 703 MG  MG  O . 
KD 3 MG  1 703 704 MG  MG  O . 
LD 4 1FZ 1 704 801 1FZ UNL O . 
MD 5 GTP 1 705 802 GTP GTP O . 
ND 7 SO4 1 706 901 SO4 SO4 O . 
OD 2 FE  1 701 701 FE  FE  P . 
PD 3 MG  1 702 703 MG  MG  P . 
QD 3 MG  1 703 704 MG  MG  P . 
RD 4 1FZ 1 704 801 1FZ UNL P . 
SD 5 GTP 1 705 802 GTP GTP P . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1    1 Y 1 A LYS 185 ? CG  ? A LYS 79  CG  
2    1 Y 1 A LYS 185 ? CD  ? A LYS 79  CD  
3    1 Y 1 A LYS 185 ? CE  ? A LYS 79  CE  
4    1 Y 1 A LYS 185 ? NZ  ? A LYS 79  NZ  
5    1 Y 1 A LYS 230 ? CG  ? A LYS 124 CG  
6    1 Y 1 A LYS 230 ? CD  ? A LYS 124 CD  
7    1 Y 1 A LYS 230 ? CE  ? A LYS 124 CE  
8    1 Y 1 A LYS 230 ? NZ  ? A LYS 124 NZ  
9    1 Y 1 A LYS 288 ? CG  ? A LYS 182 CG  
10   1 Y 1 A LYS 288 ? CD  ? A LYS 182 CD  
11   1 Y 1 A LYS 288 ? CE  ? A LYS 182 CE  
12   1 Y 1 A LYS 288 ? NZ  ? A LYS 182 NZ  
13   1 Y 1 A GLN 326 ? CG  ? A GLN 220 CG  
14   1 Y 1 A GLN 326 ? CD  ? A GLN 220 CD  
15   1 Y 1 A GLN 326 ? OE1 ? A GLN 220 OE1 
16   1 Y 1 A GLN 326 ? NE2 ? A GLN 220 NE2 
17   1 Y 1 A GLN 465 ? CG  ? A GLN 359 CG  
18   1 Y 1 A GLN 465 ? CD  ? A GLN 359 CD  
19   1 Y 1 A GLN 465 ? OE1 ? A GLN 359 OE1 
20   1 Y 1 A GLN 465 ? NE2 ? A GLN 359 NE2 
21   1 Y 1 A LYS 467 ? CG  ? A LYS 361 CG  
22   1 Y 1 A LYS 467 ? CD  ? A LYS 361 CD  
23   1 Y 1 A LYS 467 ? CE  ? A LYS 361 CE  
24   1 Y 1 A LYS 467 ? NZ  ? A LYS 361 NZ  
25   1 Y 1 A LYS 469 ? CG  ? A LYS 363 CG  
26   1 Y 1 A LYS 469 ? CD  ? A LYS 363 CD  
27   1 Y 1 A LYS 469 ? CE  ? A LYS 363 CE  
28   1 Y 1 A LYS 469 ? NZ  ? A LYS 363 NZ  
29   1 Y 1 A GLU 474 ? CG  ? A GLU 368 CG  
30   1 Y 1 A GLU 474 ? CD  ? A GLU 368 CD  
31   1 Y 1 A GLU 474 ? OE1 ? A GLU 368 OE1 
32   1 Y 1 A GLU 474 ? OE2 ? A GLU 368 OE2 
33   1 Y 1 A LYS 486 ? CG  ? A LYS 380 CG  
34   1 Y 1 A LYS 486 ? CD  ? A LYS 380 CD  
35   1 Y 1 A LYS 486 ? CE  ? A LYS 380 CE  
36   1 Y 1 A LYS 486 ? NZ  ? A LYS 380 NZ  
37   1 Y 1 A LYS 492 ? CG  ? A LYS 386 CG  
38   1 Y 1 A LYS 492 ? CD  ? A LYS 386 CD  
39   1 Y 1 A LYS 492 ? CE  ? A LYS 386 CE  
40   1 Y 1 A LYS 492 ? NZ  ? A LYS 386 NZ  
41   1 Y 1 A LYS 494 ? CG  ? A LYS 388 CG  
42   1 Y 1 A LYS 494 ? CD  ? A LYS 388 CD  
43   1 Y 1 A LYS 494 ? CE  ? A LYS 388 CE  
44   1 Y 1 A LYS 494 ? NZ  ? A LYS 388 NZ  
45   1 Y 1 A ARG 559 ? CG  ? A ARG 453 CG  
46   1 Y 1 A ARG 559 ? CD  ? A ARG 453 CD  
47   1 Y 1 A ARG 559 ? NE  ? A ARG 453 NE  
48   1 Y 1 A ARG 559 ? CZ  ? A ARG 453 CZ  
49   1 Y 1 A ARG 559 ? NH1 ? A ARG 453 NH1 
50   1 Y 1 A ARG 559 ? NH2 ? A ARG 453 NH2 
51   1 Y 1 A LYS 560 ? CG  ? A LYS 454 CG  
52   1 Y 1 A LYS 560 ? CD  ? A LYS 454 CD  
53   1 Y 1 A LYS 560 ? CE  ? A LYS 454 CE  
54   1 Y 1 A LYS 560 ? NZ  ? A LYS 454 NZ  
55   1 Y 1 A GLN 594 ? CG  ? A GLN 488 CG  
56   1 Y 1 A GLN 594 ? CD  ? A GLN 488 CD  
57   1 Y 1 A GLN 594 ? OE1 ? A GLN 488 OE1 
58   1 Y 1 A GLN 594 ? NE2 ? A GLN 488 NE2 
59   1 Y 1 A LYS 596 ? CG  ? A LYS 490 CG  
60   1 Y 1 A LYS 596 ? CD  ? A LYS 490 CD  
61   1 Y 1 A LYS 596 ? CE  ? A LYS 490 CE  
62   1 Y 1 A LYS 596 ? NZ  ? A LYS 490 NZ  
63   1 Y 1 B LYS 185 ? CG  ? B LYS 79  CG  
64   1 Y 1 B LYS 185 ? CD  ? B LYS 79  CD  
65   1 Y 1 B LYS 185 ? CE  ? B LYS 79  CE  
66   1 Y 1 B LYS 185 ? NZ  ? B LYS 79  NZ  
67   1 Y 1 B LYS 230 ? CG  ? B LYS 124 CG  
68   1 Y 1 B LYS 230 ? CD  ? B LYS 124 CD  
69   1 Y 1 B LYS 230 ? CE  ? B LYS 124 CE  
70   1 Y 1 B LYS 230 ? NZ  ? B LYS 124 NZ  
71   1 Y 1 B GLU 262 ? CG  ? B GLU 156 CG  
72   1 Y 1 B GLU 262 ? CD  ? B GLU 156 CD  
73   1 Y 1 B GLU 262 ? OE1 ? B GLU 156 OE1 
74   1 Y 1 B GLU 262 ? OE2 ? B GLU 156 OE2 
75   1 Y 1 B LYS 288 ? CG  ? B LYS 182 CG  
76   1 Y 1 B LYS 288 ? CD  ? B LYS 182 CD  
77   1 Y 1 B LYS 288 ? CE  ? B LYS 182 CE  
78   1 Y 1 B LYS 288 ? NZ  ? B LYS 182 NZ  
79   1 Y 1 B GLN 326 ? CG  ? B GLN 220 CG  
80   1 Y 1 B GLN 326 ? CD  ? B GLN 220 CD  
81   1 Y 1 B GLN 326 ? OE1 ? B GLN 220 OE1 
82   1 Y 1 B GLN 326 ? NE2 ? B GLN 220 NE2 
83   1 Y 1 B GLN 465 ? CG  ? B GLN 359 CG  
84   1 Y 1 B GLN 465 ? CD  ? B GLN 359 CD  
85   1 Y 1 B GLN 465 ? OE1 ? B GLN 359 OE1 
86   1 Y 1 B GLN 465 ? NE2 ? B GLN 359 NE2 
87   1 Y 1 B LYS 467 ? CG  ? B LYS 361 CG  
88   1 Y 1 B LYS 467 ? CD  ? B LYS 361 CD  
89   1 Y 1 B LYS 467 ? CE  ? B LYS 361 CE  
90   1 Y 1 B LYS 467 ? NZ  ? B LYS 361 NZ  
91   1 Y 1 B LYS 469 ? CG  ? B LYS 363 CG  
92   1 Y 1 B LYS 469 ? CD  ? B LYS 363 CD  
93   1 Y 1 B LYS 469 ? CE  ? B LYS 363 CE  
94   1 Y 1 B LYS 469 ? NZ  ? B LYS 363 NZ  
95   1 Y 1 B GLU 474 ? CG  ? B GLU 368 CG  
96   1 Y 1 B GLU 474 ? CD  ? B GLU 368 CD  
97   1 Y 1 B GLU 474 ? OE1 ? B GLU 368 OE1 
98   1 Y 1 B GLU 474 ? OE2 ? B GLU 368 OE2 
99   1 Y 1 B LYS 478 ? CG  ? B LYS 372 CG  
100  1 Y 1 B LYS 478 ? CD  ? B LYS 372 CD  
101  1 Y 1 B LYS 478 ? CE  ? B LYS 372 CE  
102  1 Y 1 B LYS 478 ? NZ  ? B LYS 372 NZ  
103  1 Y 1 B LYS 484 ? CG  ? B LYS 378 CG  
104  1 Y 1 B LYS 484 ? CD  ? B LYS 378 CD  
105  1 Y 1 B LYS 484 ? CE  ? B LYS 378 CE  
106  1 Y 1 B LYS 484 ? NZ  ? B LYS 378 NZ  
107  1 Y 1 B LYS 486 ? CG  ? B LYS 380 CG  
108  1 Y 1 B LYS 486 ? CD  ? B LYS 380 CD  
109  1 Y 1 B LYS 486 ? CE  ? B LYS 380 CE  
110  1 Y 1 B LYS 486 ? NZ  ? B LYS 380 NZ  
111  1 Y 1 B LYS 492 ? CG  ? B LYS 386 CG  
112  1 Y 1 B LYS 492 ? CD  ? B LYS 386 CD  
113  1 Y 1 B LYS 492 ? CE  ? B LYS 386 CE  
114  1 Y 1 B LYS 492 ? NZ  ? B LYS 386 NZ  
115  1 Y 1 B LYS 494 ? CG  ? B LYS 388 CG  
116  1 Y 1 B LYS 494 ? CD  ? B LYS 388 CD  
117  1 Y 1 B LYS 494 ? CE  ? B LYS 388 CE  
118  1 Y 1 B LYS 494 ? NZ  ? B LYS 388 NZ  
119  1 Y 1 B ARG 559 ? CG  ? B ARG 453 CG  
120  1 Y 1 B ARG 559 ? CD  ? B ARG 453 CD  
121  1 Y 1 B ARG 559 ? NE  ? B ARG 453 NE  
122  1 Y 1 B ARG 559 ? CZ  ? B ARG 453 CZ  
123  1 Y 1 B ARG 559 ? NH1 ? B ARG 453 NH1 
124  1 Y 1 B ARG 559 ? NH2 ? B ARG 453 NH2 
125  1 Y 1 B LYS 560 ? CG  ? B LYS 454 CG  
126  1 Y 1 B LYS 560 ? CD  ? B LYS 454 CD  
127  1 Y 1 B LYS 560 ? CE  ? B LYS 454 CE  
128  1 Y 1 B LYS 560 ? NZ  ? B LYS 454 NZ  
129  1 Y 1 B LYS 580 ? CG  ? B LYS 474 CG  
130  1 Y 1 B LYS 580 ? CD  ? B LYS 474 CD  
131  1 Y 1 B LYS 580 ? CE  ? B LYS 474 CE  
132  1 Y 1 B LYS 580 ? NZ  ? B LYS 474 NZ  
133  1 Y 1 B LYS 596 ? CG  ? B LYS 490 CG  
134  1 Y 1 B LYS 596 ? CD  ? B LYS 490 CD  
135  1 Y 1 B LYS 596 ? CE  ? B LYS 490 CE  
136  1 Y 1 B LYS 596 ? NZ  ? B LYS 490 NZ  
137  1 Y 1 C LYS 185 ? CG  ? C LYS 79  CG  
138  1 Y 1 C LYS 185 ? CD  ? C LYS 79  CD  
139  1 Y 1 C LYS 185 ? CE  ? C LYS 79  CE  
140  1 Y 1 C LYS 185 ? NZ  ? C LYS 79  NZ  
141  1 Y 1 C LYS 230 ? CG  ? C LYS 124 CG  
142  1 Y 1 C LYS 230 ? CD  ? C LYS 124 CD  
143  1 Y 1 C LYS 230 ? CE  ? C LYS 124 CE  
144  1 Y 1 C LYS 230 ? NZ  ? C LYS 124 NZ  
145  1 Y 1 C GLU 277 ? CG  ? C GLU 171 CG  
146  1 Y 1 C GLU 277 ? CD  ? C GLU 171 CD  
147  1 Y 1 C GLU 277 ? OE1 ? C GLU 171 OE1 
148  1 Y 1 C GLU 277 ? OE2 ? C GLU 171 OE2 
149  1 Y 1 C LYS 288 ? CG  ? C LYS 182 CG  
150  1 Y 1 C LYS 288 ? CD  ? C LYS 182 CD  
151  1 Y 1 C LYS 288 ? CE  ? C LYS 182 CE  
152  1 Y 1 C LYS 288 ? NZ  ? C LYS 182 NZ  
153  1 Y 1 C GLN 326 ? CG  ? C GLN 220 CG  
154  1 Y 1 C GLN 326 ? CD  ? C GLN 220 CD  
155  1 Y 1 C GLN 326 ? OE1 ? C GLN 220 OE1 
156  1 Y 1 C GLN 326 ? NE2 ? C GLN 220 NE2 
157  1 Y 1 C GLU 398 ? CG  ? C GLU 292 CG  
158  1 Y 1 C GLU 398 ? CD  ? C GLU 292 CD  
159  1 Y 1 C GLU 398 ? OE1 ? C GLU 292 OE1 
160  1 Y 1 C GLU 398 ? OE2 ? C GLU 292 OE2 
161  1 Y 1 C LYS 405 ? CG  ? C LYS 299 CG  
162  1 Y 1 C LYS 405 ? CD  ? C LYS 299 CD  
163  1 Y 1 C LYS 405 ? CE  ? C LYS 299 CE  
164  1 Y 1 C LYS 405 ? NZ  ? C LYS 299 NZ  
165  1 Y 1 C LYS 406 ? CG  ? C LYS 300 CG  
166  1 Y 1 C LYS 406 ? CD  ? C LYS 300 CD  
167  1 Y 1 C LYS 406 ? CE  ? C LYS 300 CE  
168  1 Y 1 C LYS 406 ? NZ  ? C LYS 300 NZ  
169  1 Y 1 C ARG 408 ? CG  ? C ARG 302 CG  
170  1 Y 1 C ARG 408 ? CD  ? C ARG 302 CD  
171  1 Y 1 C ARG 408 ? NE  ? C ARG 302 NE  
172  1 Y 1 C ARG 408 ? CZ  ? C ARG 302 CZ  
173  1 Y 1 C ARG 408 ? NH1 ? C ARG 302 NH1 
174  1 Y 1 C ARG 408 ? NH2 ? C ARG 302 NH2 
175  1 Y 1 C GLN 465 ? CG  ? C GLN 359 CG  
176  1 Y 1 C GLN 465 ? CD  ? C GLN 359 CD  
177  1 Y 1 C GLN 465 ? OE1 ? C GLN 359 OE1 
178  1 Y 1 C GLN 465 ? NE2 ? C GLN 359 NE2 
179  1 Y 1 C LYS 467 ? CG  ? C LYS 361 CG  
180  1 Y 1 C LYS 467 ? CD  ? C LYS 361 CD  
181  1 Y 1 C LYS 467 ? CE  ? C LYS 361 CE  
182  1 Y 1 C LYS 467 ? NZ  ? C LYS 361 NZ  
183  1 Y 1 C LYS 469 ? CG  ? C LYS 363 CG  
184  1 Y 1 C LYS 469 ? CD  ? C LYS 363 CD  
185  1 Y 1 C LYS 469 ? CE  ? C LYS 363 CE  
186  1 Y 1 C LYS 469 ? NZ  ? C LYS 363 NZ  
187  1 Y 1 C GLU 474 ? CG  ? C GLU 368 CG  
188  1 Y 1 C GLU 474 ? CD  ? C GLU 368 CD  
189  1 Y 1 C GLU 474 ? OE1 ? C GLU 368 OE1 
190  1 Y 1 C GLU 474 ? OE2 ? C GLU 368 OE2 
191  1 Y 1 C LYS 478 ? CG  ? C LYS 372 CG  
192  1 Y 1 C LYS 478 ? CD  ? C LYS 372 CD  
193  1 Y 1 C LYS 478 ? CE  ? C LYS 372 CE  
194  1 Y 1 C LYS 478 ? NZ  ? C LYS 372 NZ  
195  1 Y 1 C LYS 486 ? CG  ? C LYS 380 CG  
196  1 Y 1 C LYS 486 ? CD  ? C LYS 380 CD  
197  1 Y 1 C LYS 486 ? CE  ? C LYS 380 CE  
198  1 Y 1 C LYS 486 ? NZ  ? C LYS 380 NZ  
199  1 Y 1 C LYS 492 ? CG  ? C LYS 386 CG  
200  1 Y 1 C LYS 492 ? CD  ? C LYS 386 CD  
201  1 Y 1 C LYS 492 ? CE  ? C LYS 386 CE  
202  1 Y 1 C LYS 492 ? NZ  ? C LYS 386 NZ  
203  1 Y 1 C ARG 559 ? CG  ? C ARG 453 CG  
204  1 Y 1 C ARG 559 ? CD  ? C ARG 453 CD  
205  1 Y 1 C ARG 559 ? NE  ? C ARG 453 NE  
206  1 Y 1 C ARG 559 ? CZ  ? C ARG 453 CZ  
207  1 Y 1 C ARG 559 ? NH1 ? C ARG 453 NH1 
208  1 Y 1 C ARG 559 ? NH2 ? C ARG 453 NH2 
209  1 Y 1 C GLN 594 ? CG  ? C GLN 488 CG  
210  1 Y 1 C GLN 594 ? CD  ? C GLN 488 CD  
211  1 Y 1 C GLN 594 ? OE1 ? C GLN 488 OE1 
212  1 Y 1 C GLN 594 ? NE2 ? C GLN 488 NE2 
213  1 Y 1 C LYS 596 ? CG  ? C LYS 490 CG  
214  1 Y 1 C LYS 596 ? CD  ? C LYS 490 CD  
215  1 Y 1 C LYS 596 ? CE  ? C LYS 490 CE  
216  1 Y 1 C LYS 596 ? NZ  ? C LYS 490 NZ  
217  1 Y 1 C GLU 597 ? CG  ? C GLU 491 CG  
218  1 Y 1 C GLU 597 ? CD  ? C GLU 491 CD  
219  1 Y 1 C GLU 597 ? OE1 ? C GLU 491 OE1 
220  1 Y 1 C GLU 597 ? OE2 ? C GLU 491 OE2 
221  1 Y 1 D LYS 185 ? CG  ? D LYS 79  CG  
222  1 Y 1 D LYS 185 ? CD  ? D LYS 79  CD  
223  1 Y 1 D LYS 185 ? CE  ? D LYS 79  CE  
224  1 Y 1 D LYS 185 ? NZ  ? D LYS 79  NZ  
225  1 Y 1 D LYS 230 ? CG  ? D LYS 124 CG  
226  1 Y 1 D LYS 230 ? CD  ? D LYS 124 CD  
227  1 Y 1 D LYS 230 ? CE  ? D LYS 124 CE  
228  1 Y 1 D LYS 230 ? NZ  ? D LYS 124 NZ  
229  1 Y 1 D GLU 262 ? CG  ? D GLU 156 CG  
230  1 Y 1 D GLU 262 ? CD  ? D GLU 156 CD  
231  1 Y 1 D GLU 262 ? OE1 ? D GLU 156 OE1 
232  1 Y 1 D GLU 262 ? OE2 ? D GLU 156 OE2 
233  1 Y 1 D GLU 277 ? CG  ? D GLU 171 CG  
234  1 Y 1 D GLU 277 ? CD  ? D GLU 171 CD  
235  1 Y 1 D GLU 277 ? OE1 ? D GLU 171 OE1 
236  1 Y 1 D GLU 277 ? OE2 ? D GLU 171 OE2 
237  1 Y 1 D GLN 326 ? CG  ? D GLN 220 CG  
238  1 Y 1 D GLN 326 ? CD  ? D GLN 220 CD  
239  1 Y 1 D GLN 326 ? OE1 ? D GLN 220 OE1 
240  1 Y 1 D GLN 326 ? NE2 ? D GLN 220 NE2 
241  1 Y 1 D LYS 421 ? CG  ? D LYS 315 CG  
242  1 Y 1 D LYS 421 ? CD  ? D LYS 315 CD  
243  1 Y 1 D LYS 421 ? CE  ? D LYS 315 CE  
244  1 Y 1 D LYS 421 ? NZ  ? D LYS 315 NZ  
245  1 Y 1 D GLN 465 ? CG  ? D GLN 359 CG  
246  1 Y 1 D GLN 465 ? CD  ? D GLN 359 CD  
247  1 Y 1 D GLN 465 ? OE1 ? D GLN 359 OE1 
248  1 Y 1 D GLN 465 ? NE2 ? D GLN 359 NE2 
249  1 Y 1 D LYS 467 ? CG  ? D LYS 361 CG  
250  1 Y 1 D LYS 467 ? CD  ? D LYS 361 CD  
251  1 Y 1 D LYS 467 ? CE  ? D LYS 361 CE  
252  1 Y 1 D LYS 467 ? NZ  ? D LYS 361 NZ  
253  1 Y 1 D LYS 469 ? CG  ? D LYS 363 CG  
254  1 Y 1 D LYS 469 ? CD  ? D LYS 363 CD  
255  1 Y 1 D LYS 469 ? CE  ? D LYS 363 CE  
256  1 Y 1 D LYS 469 ? NZ  ? D LYS 363 NZ  
257  1 Y 1 D GLU 474 ? CG  ? D GLU 368 CG  
258  1 Y 1 D GLU 474 ? CD  ? D GLU 368 CD  
259  1 Y 1 D GLU 474 ? OE1 ? D GLU 368 OE1 
260  1 Y 1 D GLU 474 ? OE2 ? D GLU 368 OE2 
261  1 Y 1 D LYS 478 ? CG  ? D LYS 372 CG  
262  1 Y 1 D LYS 478 ? CD  ? D LYS 372 CD  
263  1 Y 1 D LYS 478 ? CE  ? D LYS 372 CE  
264  1 Y 1 D LYS 478 ? NZ  ? D LYS 372 NZ  
265  1 Y 1 D LYS 484 ? CG  ? D LYS 378 CG  
266  1 Y 1 D LYS 484 ? CD  ? D LYS 378 CD  
267  1 Y 1 D LYS 484 ? CE  ? D LYS 378 CE  
268  1 Y 1 D LYS 484 ? NZ  ? D LYS 378 NZ  
269  1 Y 1 D LYS 486 ? CG  ? D LYS 380 CG  
270  1 Y 1 D LYS 486 ? CD  ? D LYS 380 CD  
271  1 Y 1 D LYS 486 ? CE  ? D LYS 380 CE  
272  1 Y 1 D LYS 486 ? NZ  ? D LYS 380 NZ  
273  1 Y 1 D LYS 492 ? CG  ? D LYS 386 CG  
274  1 Y 1 D LYS 492 ? CD  ? D LYS 386 CD  
275  1 Y 1 D LYS 492 ? CE  ? D LYS 386 CE  
276  1 Y 1 D LYS 492 ? NZ  ? D LYS 386 NZ  
277  1 Y 1 D LYS 494 ? CG  ? D LYS 388 CG  
278  1 Y 1 D LYS 494 ? CD  ? D LYS 388 CD  
279  1 Y 1 D LYS 494 ? CE  ? D LYS 388 CE  
280  1 Y 1 D LYS 494 ? NZ  ? D LYS 388 NZ  
281  1 Y 1 D ARG 559 ? CG  ? D ARG 453 CG  
282  1 Y 1 D ARG 559 ? CD  ? D ARG 453 CD  
283  1 Y 1 D ARG 559 ? NE  ? D ARG 453 NE  
284  1 Y 1 D ARG 559 ? CZ  ? D ARG 453 CZ  
285  1 Y 1 D ARG 559 ? NH1 ? D ARG 453 NH1 
286  1 Y 1 D ARG 559 ? NH2 ? D ARG 453 NH2 
287  1 Y 1 D LYS 560 ? CG  ? D LYS 454 CG  
288  1 Y 1 D LYS 560 ? CD  ? D LYS 454 CD  
289  1 Y 1 D LYS 560 ? CE  ? D LYS 454 CE  
290  1 Y 1 D LYS 560 ? NZ  ? D LYS 454 NZ  
291  1 Y 1 D LYS 596 ? CG  ? D LYS 490 CG  
292  1 Y 1 D LYS 596 ? CD  ? D LYS 490 CD  
293  1 Y 1 D LYS 596 ? CE  ? D LYS 490 CE  
294  1 Y 1 D LYS 596 ? NZ  ? D LYS 490 NZ  
295  1 Y 1 D GLU 597 ? CG  ? D GLU 491 CG  
296  1 Y 1 D GLU 597 ? CD  ? D GLU 491 CD  
297  1 Y 1 D GLU 597 ? OE1 ? D GLU 491 OE1 
298  1 Y 1 D GLU 597 ? OE2 ? D GLU 491 OE2 
299  1 Y 1 E LYS 185 ? CG  ? E LYS 79  CG  
300  1 Y 1 E LYS 185 ? CD  ? E LYS 79  CD  
301  1 Y 1 E LYS 185 ? CE  ? E LYS 79  CE  
302  1 Y 1 E LYS 185 ? NZ  ? E LYS 79  NZ  
303  1 Y 1 E LYS 230 ? CG  ? E LYS 124 CG  
304  1 Y 1 E LYS 230 ? CD  ? E LYS 124 CD  
305  1 Y 1 E LYS 230 ? CE  ? E LYS 124 CE  
306  1 Y 1 E LYS 230 ? NZ  ? E LYS 124 NZ  
307  1 Y 1 E LYS 288 ? CG  ? E LYS 182 CG  
308  1 Y 1 E LYS 288 ? CD  ? E LYS 182 CD  
309  1 Y 1 E LYS 288 ? CE  ? E LYS 182 CE  
310  1 Y 1 E LYS 288 ? NZ  ? E LYS 182 NZ  
311  1 Y 1 E GLN 326 ? CG  ? E GLN 220 CG  
312  1 Y 1 E GLN 326 ? CD  ? E GLN 220 CD  
313  1 Y 1 E GLN 326 ? OE1 ? E GLN 220 OE1 
314  1 Y 1 E GLN 326 ? NE2 ? E GLN 220 NE2 
315  1 Y 1 E GLN 465 ? CG  ? E GLN 359 CG  
316  1 Y 1 E GLN 465 ? CD  ? E GLN 359 CD  
317  1 Y 1 E GLN 465 ? OE1 ? E GLN 359 OE1 
318  1 Y 1 E GLN 465 ? NE2 ? E GLN 359 NE2 
319  1 Y 1 E LYS 467 ? CG  ? E LYS 361 CG  
320  1 Y 1 E LYS 467 ? CD  ? E LYS 361 CD  
321  1 Y 1 E LYS 467 ? CE  ? E LYS 361 CE  
322  1 Y 1 E LYS 467 ? NZ  ? E LYS 361 NZ  
323  1 Y 1 E LYS 469 ? CG  ? E LYS 363 CG  
324  1 Y 1 E LYS 469 ? CD  ? E LYS 363 CD  
325  1 Y 1 E LYS 469 ? CE  ? E LYS 363 CE  
326  1 Y 1 E LYS 469 ? NZ  ? E LYS 363 NZ  
327  1 Y 1 E GLU 474 ? CG  ? E GLU 368 CG  
328  1 Y 1 E GLU 474 ? CD  ? E GLU 368 CD  
329  1 Y 1 E GLU 474 ? OE1 ? E GLU 368 OE1 
330  1 Y 1 E GLU 474 ? OE2 ? E GLU 368 OE2 
331  1 Y 1 E LYS 478 ? CG  ? E LYS 372 CG  
332  1 Y 1 E LYS 478 ? CD  ? E LYS 372 CD  
333  1 Y 1 E LYS 478 ? CE  ? E LYS 372 CE  
334  1 Y 1 E LYS 478 ? NZ  ? E LYS 372 NZ  
335  1 Y 1 E LYS 484 ? CG  ? E LYS 378 CG  
336  1 Y 1 E LYS 484 ? CD  ? E LYS 378 CD  
337  1 Y 1 E LYS 484 ? CE  ? E LYS 378 CE  
338  1 Y 1 E LYS 484 ? NZ  ? E LYS 378 NZ  
339  1 Y 1 E LYS 486 ? CG  ? E LYS 380 CG  
340  1 Y 1 E LYS 486 ? CD  ? E LYS 380 CD  
341  1 Y 1 E LYS 486 ? CE  ? E LYS 380 CE  
342  1 Y 1 E LYS 486 ? NZ  ? E LYS 380 NZ  
343  1 Y 1 E LYS 492 ? CG  ? E LYS 386 CG  
344  1 Y 1 E LYS 492 ? CD  ? E LYS 386 CD  
345  1 Y 1 E LYS 492 ? CE  ? E LYS 386 CE  
346  1 Y 1 E LYS 492 ? NZ  ? E LYS 386 NZ  
347  1 Y 1 E LYS 494 ? CG  ? E LYS 388 CG  
348  1 Y 1 E LYS 494 ? CD  ? E LYS 388 CD  
349  1 Y 1 E LYS 494 ? CE  ? E LYS 388 CE  
350  1 Y 1 E LYS 494 ? NZ  ? E LYS 388 NZ  
351  1 Y 1 E GLU 496 ? CG  ? E GLU 390 CG  
352  1 Y 1 E GLU 496 ? CD  ? E GLU 390 CD  
353  1 Y 1 E GLU 496 ? OE1 ? E GLU 390 OE1 
354  1 Y 1 E GLU 496 ? OE2 ? E GLU 390 OE2 
355  1 Y 1 E ARG 559 ? CG  ? E ARG 453 CG  
356  1 Y 1 E ARG 559 ? CD  ? E ARG 453 CD  
357  1 Y 1 E ARG 559 ? NE  ? E ARG 453 NE  
358  1 Y 1 E ARG 559 ? CZ  ? E ARG 453 CZ  
359  1 Y 1 E ARG 559 ? NH1 ? E ARG 453 NH1 
360  1 Y 1 E ARG 559 ? NH2 ? E ARG 453 NH2 
361  1 Y 1 E LYS 560 ? CG  ? E LYS 454 CG  
362  1 Y 1 E LYS 560 ? CD  ? E LYS 454 CD  
363  1 Y 1 E LYS 560 ? CE  ? E LYS 454 CE  
364  1 Y 1 E LYS 560 ? NZ  ? E LYS 454 NZ  
365  1 Y 1 E LYS 596 ? CG  ? E LYS 490 CG  
366  1 Y 1 E LYS 596 ? CD  ? E LYS 490 CD  
367  1 Y 1 E LYS 596 ? CE  ? E LYS 490 CE  
368  1 Y 1 E LYS 596 ? NZ  ? E LYS 490 NZ  
369  1 Y 1 F LYS 185 ? CG  ? F LYS 79  CG  
370  1 Y 1 F LYS 185 ? CD  ? F LYS 79  CD  
371  1 Y 1 F LYS 185 ? CE  ? F LYS 79  CE  
372  1 Y 1 F LYS 185 ? NZ  ? F LYS 79  NZ  
373  1 Y 1 F LYS 230 ? CG  ? F LYS 124 CG  
374  1 Y 1 F LYS 230 ? CD  ? F LYS 124 CD  
375  1 Y 1 F LYS 230 ? CE  ? F LYS 124 CE  
376  1 Y 1 F LYS 230 ? NZ  ? F LYS 124 NZ  
377  1 Y 1 F LYS 288 ? CG  ? F LYS 182 CG  
378  1 Y 1 F LYS 288 ? CD  ? F LYS 182 CD  
379  1 Y 1 F LYS 288 ? CE  ? F LYS 182 CE  
380  1 Y 1 F LYS 288 ? NZ  ? F LYS 182 NZ  
381  1 Y 1 F LYS 405 ? CG  ? F LYS 299 CG  
382  1 Y 1 F LYS 405 ? CD  ? F LYS 299 CD  
383  1 Y 1 F LYS 405 ? CE  ? F LYS 299 CE  
384  1 Y 1 F LYS 405 ? NZ  ? F LYS 299 NZ  
385  1 Y 1 F ARG 408 ? CG  ? F ARG 302 CG  
386  1 Y 1 F ARG 408 ? CD  ? F ARG 302 CD  
387  1 Y 1 F ARG 408 ? NE  ? F ARG 302 NE  
388  1 Y 1 F ARG 408 ? CZ  ? F ARG 302 CZ  
389  1 Y 1 F ARG 408 ? NH1 ? F ARG 302 NH1 
390  1 Y 1 F ARG 408 ? NH2 ? F ARG 302 NH2 
391  1 Y 1 F LYS 437 ? CG  ? F LYS 331 CG  
392  1 Y 1 F LYS 437 ? CD  ? F LYS 331 CD  
393  1 Y 1 F LYS 437 ? CE  ? F LYS 331 CE  
394  1 Y 1 F LYS 437 ? NZ  ? F LYS 331 NZ  
395  1 Y 1 F GLN 465 ? CG  ? F GLN 359 CG  
396  1 Y 1 F GLN 465 ? CD  ? F GLN 359 CD  
397  1 Y 1 F GLN 465 ? OE1 ? F GLN 359 OE1 
398  1 Y 1 F GLN 465 ? NE2 ? F GLN 359 NE2 
399  1 Y 1 F LYS 467 ? CG  ? F LYS 361 CG  
400  1 Y 1 F LYS 467 ? CD  ? F LYS 361 CD  
401  1 Y 1 F LYS 467 ? CE  ? F LYS 361 CE  
402  1 Y 1 F LYS 467 ? NZ  ? F LYS 361 NZ  
403  1 Y 1 F LYS 469 ? CG  ? F LYS 363 CG  
404  1 Y 1 F LYS 469 ? CD  ? F LYS 363 CD  
405  1 Y 1 F LYS 469 ? CE  ? F LYS 363 CE  
406  1 Y 1 F LYS 469 ? NZ  ? F LYS 363 NZ  
407  1 Y 1 F LYS 478 ? CG  ? F LYS 372 CG  
408  1 Y 1 F LYS 478 ? CD  ? F LYS 372 CD  
409  1 Y 1 F LYS 478 ? CE  ? F LYS 372 CE  
410  1 Y 1 F LYS 478 ? NZ  ? F LYS 372 NZ  
411  1 Y 1 F LYS 486 ? CG  ? F LYS 380 CG  
412  1 Y 1 F LYS 486 ? CD  ? F LYS 380 CD  
413  1 Y 1 F LYS 486 ? CE  ? F LYS 380 CE  
414  1 Y 1 F LYS 486 ? NZ  ? F LYS 380 NZ  
415  1 Y 1 F LYS 492 ? CG  ? F LYS 386 CG  
416  1 Y 1 F LYS 492 ? CD  ? F LYS 386 CD  
417  1 Y 1 F LYS 492 ? CE  ? F LYS 386 CE  
418  1 Y 1 F LYS 492 ? NZ  ? F LYS 386 NZ  
419  1 Y 1 F LYS 494 ? CG  ? F LYS 388 CG  
420  1 Y 1 F LYS 494 ? CD  ? F LYS 388 CD  
421  1 Y 1 F LYS 494 ? CE  ? F LYS 388 CE  
422  1 Y 1 F LYS 494 ? NZ  ? F LYS 388 NZ  
423  1 Y 1 F ARG 559 ? CG  ? F ARG 453 CG  
424  1 Y 1 F ARG 559 ? CD  ? F ARG 453 CD  
425  1 Y 1 F ARG 559 ? NE  ? F ARG 453 NE  
426  1 Y 1 F ARG 559 ? CZ  ? F ARG 453 CZ  
427  1 Y 1 F ARG 559 ? NH1 ? F ARG 453 NH1 
428  1 Y 1 F ARG 559 ? NH2 ? F ARG 453 NH2 
429  1 Y 1 F LYS 560 ? CG  ? F LYS 454 CG  
430  1 Y 1 F LYS 560 ? CD  ? F LYS 454 CD  
431  1 Y 1 F LYS 560 ? CE  ? F LYS 454 CE  
432  1 Y 1 F LYS 560 ? NZ  ? F LYS 454 NZ  
433  1 Y 1 F LYS 595 ? CG  ? F LYS 489 CG  
434  1 Y 1 F LYS 595 ? CD  ? F LYS 489 CD  
435  1 Y 1 F LYS 595 ? CE  ? F LYS 489 CE  
436  1 Y 1 F LYS 595 ? NZ  ? F LYS 489 NZ  
437  1 Y 1 F LYS 596 ? CG  ? F LYS 490 CG  
438  1 Y 1 F LYS 596 ? CD  ? F LYS 490 CD  
439  1 Y 1 F LYS 596 ? CE  ? F LYS 490 CE  
440  1 Y 1 F LYS 596 ? NZ  ? F LYS 490 NZ  
441  1 Y 1 F GLU 597 ? CG  ? F GLU 491 CG  
442  1 Y 1 F GLU 597 ? CD  ? F GLU 491 CD  
443  1 Y 1 F GLU 597 ? OE1 ? F GLU 491 OE1 
444  1 Y 1 F GLU 597 ? OE2 ? F GLU 491 OE2 
445  1 Y 1 G LYS 185 ? CG  ? G LYS 79  CG  
446  1 Y 1 G LYS 185 ? CD  ? G LYS 79  CD  
447  1 Y 1 G LYS 185 ? CE  ? G LYS 79  CE  
448  1 Y 1 G LYS 185 ? NZ  ? G LYS 79  NZ  
449  1 Y 1 G LYS 230 ? CG  ? G LYS 124 CG  
450  1 Y 1 G LYS 230 ? CD  ? G LYS 124 CD  
451  1 Y 1 G LYS 230 ? CE  ? G LYS 124 CE  
452  1 Y 1 G LYS 230 ? NZ  ? G LYS 124 NZ  
453  1 Y 1 G GLU 262 ? CG  ? G GLU 156 CG  
454  1 Y 1 G GLU 262 ? CD  ? G GLU 156 CD  
455  1 Y 1 G GLU 262 ? OE1 ? G GLU 156 OE1 
456  1 Y 1 G GLU 262 ? OE2 ? G GLU 156 OE2 
457  1 Y 1 G LYS 288 ? CG  ? G LYS 182 CG  
458  1 Y 1 G LYS 288 ? CD  ? G LYS 182 CD  
459  1 Y 1 G LYS 288 ? CE  ? G LYS 182 CE  
460  1 Y 1 G LYS 288 ? NZ  ? G LYS 182 NZ  
461  1 Y 1 G GLN 326 ? CG  ? G GLN 220 CG  
462  1 Y 1 G GLN 326 ? CD  ? G GLN 220 CD  
463  1 Y 1 G GLN 326 ? OE1 ? G GLN 220 OE1 
464  1 Y 1 G GLN 326 ? NE2 ? G GLN 220 NE2 
465  1 Y 1 G LYS 405 ? CG  ? G LYS 299 CG  
466  1 Y 1 G LYS 405 ? CD  ? G LYS 299 CD  
467  1 Y 1 G LYS 405 ? CE  ? G LYS 299 CE  
468  1 Y 1 G LYS 405 ? NZ  ? G LYS 299 NZ  
469  1 Y 1 G LYS 421 ? CG  ? G LYS 315 CG  
470  1 Y 1 G LYS 421 ? CD  ? G LYS 315 CD  
471  1 Y 1 G LYS 421 ? CE  ? G LYS 315 CE  
472  1 Y 1 G LYS 421 ? NZ  ? G LYS 315 NZ  
473  1 Y 1 G LYS 439 ? CG  ? G LYS 333 CG  
474  1 Y 1 G LYS 439 ? CD  ? G LYS 333 CD  
475  1 Y 1 G LYS 439 ? CE  ? G LYS 333 CE  
476  1 Y 1 G LYS 439 ? NZ  ? G LYS 333 NZ  
477  1 Y 1 G GLN 465 ? CG  ? G GLN 359 CG  
478  1 Y 1 G GLN 465 ? CD  ? G GLN 359 CD  
479  1 Y 1 G GLN 465 ? OE1 ? G GLN 359 OE1 
480  1 Y 1 G GLN 465 ? NE2 ? G GLN 359 NE2 
481  1 Y 1 G LYS 467 ? CG  ? G LYS 361 CG  
482  1 Y 1 G LYS 467 ? CD  ? G LYS 361 CD  
483  1 Y 1 G LYS 467 ? CE  ? G LYS 361 CE  
484  1 Y 1 G LYS 467 ? NZ  ? G LYS 361 NZ  
485  1 Y 1 G LYS 469 ? CG  ? G LYS 363 CG  
486  1 Y 1 G LYS 469 ? CD  ? G LYS 363 CD  
487  1 Y 1 G LYS 469 ? CE  ? G LYS 363 CE  
488  1 Y 1 G LYS 469 ? NZ  ? G LYS 363 NZ  
489  1 Y 1 G LYS 478 ? CG  ? G LYS 372 CG  
490  1 Y 1 G LYS 478 ? CD  ? G LYS 372 CD  
491  1 Y 1 G LYS 478 ? CE  ? G LYS 372 CE  
492  1 Y 1 G LYS 478 ? NZ  ? G LYS 372 NZ  
493  1 Y 1 G LYS 484 ? CG  ? G LYS 378 CG  
494  1 Y 1 G LYS 484 ? CD  ? G LYS 378 CD  
495  1 Y 1 G LYS 484 ? CE  ? G LYS 378 CE  
496  1 Y 1 G LYS 484 ? NZ  ? G LYS 378 NZ  
497  1 Y 1 G LYS 486 ? CG  ? G LYS 380 CG  
498  1 Y 1 G LYS 486 ? CD  ? G LYS 380 CD  
499  1 Y 1 G LYS 486 ? CE  ? G LYS 380 CE  
500  1 Y 1 G LYS 486 ? NZ  ? G LYS 380 NZ  
501  1 Y 1 G LYS 492 ? CG  ? G LYS 386 CG  
502  1 Y 1 G LYS 492 ? CD  ? G LYS 386 CD  
503  1 Y 1 G LYS 492 ? CE  ? G LYS 386 CE  
504  1 Y 1 G LYS 492 ? NZ  ? G LYS 386 NZ  
505  1 Y 1 G LYS 494 ? CG  ? G LYS 388 CG  
506  1 Y 1 G LYS 494 ? CD  ? G LYS 388 CD  
507  1 Y 1 G LYS 494 ? CE  ? G LYS 388 CE  
508  1 Y 1 G LYS 494 ? NZ  ? G LYS 388 NZ  
509  1 Y 1 G ARG 559 ? CG  ? G ARG 453 CG  
510  1 Y 1 G ARG 559 ? CD  ? G ARG 453 CD  
511  1 Y 1 G ARG 559 ? NE  ? G ARG 453 NE  
512  1 Y 1 G ARG 559 ? CZ  ? G ARG 453 CZ  
513  1 Y 1 G ARG 559 ? NH1 ? G ARG 453 NH1 
514  1 Y 1 G ARG 559 ? NH2 ? G ARG 453 NH2 
515  1 Y 1 G LYS 560 ? CG  ? G LYS 454 CG  
516  1 Y 1 G LYS 560 ? CD  ? G LYS 454 CD  
517  1 Y 1 G LYS 560 ? CE  ? G LYS 454 CE  
518  1 Y 1 G LYS 560 ? NZ  ? G LYS 454 NZ  
519  1 Y 1 G LYS 580 ? CG  ? G LYS 474 CG  
520  1 Y 1 G LYS 580 ? CD  ? G LYS 474 CD  
521  1 Y 1 G LYS 580 ? CE  ? G LYS 474 CE  
522  1 Y 1 G LYS 580 ? NZ  ? G LYS 474 NZ  
523  1 Y 1 G LYS 595 ? CG  ? G LYS 489 CG  
524  1 Y 1 G LYS 595 ? CD  ? G LYS 489 CD  
525  1 Y 1 G LYS 595 ? CE  ? G LYS 489 CE  
526  1 Y 1 G LYS 595 ? NZ  ? G LYS 489 NZ  
527  1 Y 1 G LYS 596 ? CG  ? G LYS 490 CG  
528  1 Y 1 G LYS 596 ? CD  ? G LYS 490 CD  
529  1 Y 1 G LYS 596 ? CE  ? G LYS 490 CE  
530  1 Y 1 G LYS 596 ? NZ  ? G LYS 490 NZ  
531  1 Y 1 G GLU 597 ? CG  ? G GLU 491 CG  
532  1 Y 1 G GLU 597 ? CD  ? G GLU 491 CD  
533  1 Y 1 G GLU 597 ? OE1 ? G GLU 491 OE1 
534  1 Y 1 G GLU 597 ? OE2 ? G GLU 491 OE2 
535  1 Y 1 H LYS 185 ? CG  ? H LYS 79  CG  
536  1 Y 1 H LYS 185 ? CD  ? H LYS 79  CD  
537  1 Y 1 H LYS 185 ? CE  ? H LYS 79  CE  
538  1 Y 1 H LYS 185 ? NZ  ? H LYS 79  NZ  
539  1 Y 1 H LYS 230 ? CG  ? H LYS 124 CG  
540  1 Y 1 H LYS 230 ? CD  ? H LYS 124 CD  
541  1 Y 1 H LYS 230 ? CE  ? H LYS 124 CE  
542  1 Y 1 H LYS 230 ? NZ  ? H LYS 124 NZ  
543  1 Y 1 H GLU 277 ? CG  ? H GLU 171 CG  
544  1 Y 1 H GLU 277 ? CD  ? H GLU 171 CD  
545  1 Y 1 H GLU 277 ? OE1 ? H GLU 171 OE1 
546  1 Y 1 H GLU 277 ? OE2 ? H GLU 171 OE2 
547  1 Y 1 H GLN 326 ? CG  ? H GLN 220 CG  
548  1 Y 1 H GLN 326 ? CD  ? H GLN 220 CD  
549  1 Y 1 H GLN 326 ? OE1 ? H GLN 220 OE1 
550  1 Y 1 H GLN 326 ? NE2 ? H GLN 220 NE2 
551  1 Y 1 H LYS 405 ? CG  ? H LYS 299 CG  
552  1 Y 1 H LYS 405 ? CD  ? H LYS 299 CD  
553  1 Y 1 H LYS 405 ? CE  ? H LYS 299 CE  
554  1 Y 1 H LYS 405 ? NZ  ? H LYS 299 NZ  
555  1 Y 1 H LYS 439 ? CG  ? H LYS 333 CG  
556  1 Y 1 H LYS 439 ? CD  ? H LYS 333 CD  
557  1 Y 1 H LYS 439 ? CE  ? H LYS 333 CE  
558  1 Y 1 H LYS 439 ? NZ  ? H LYS 333 NZ  
559  1 Y 1 H GLN 465 ? CG  ? H GLN 359 CG  
560  1 Y 1 H GLN 465 ? CD  ? H GLN 359 CD  
561  1 Y 1 H GLN 465 ? OE1 ? H GLN 359 OE1 
562  1 Y 1 H GLN 465 ? NE2 ? H GLN 359 NE2 
563  1 Y 1 H LYS 467 ? CG  ? H LYS 361 CG  
564  1 Y 1 H LYS 467 ? CD  ? H LYS 361 CD  
565  1 Y 1 H LYS 467 ? CE  ? H LYS 361 CE  
566  1 Y 1 H LYS 467 ? NZ  ? H LYS 361 NZ  
567  1 Y 1 H LYS 469 ? CG  ? H LYS 363 CG  
568  1 Y 1 H LYS 469 ? CD  ? H LYS 363 CD  
569  1 Y 1 H LYS 469 ? CE  ? H LYS 363 CE  
570  1 Y 1 H LYS 469 ? NZ  ? H LYS 363 NZ  
571  1 Y 1 H GLU 474 ? CG  ? H GLU 368 CG  
572  1 Y 1 H GLU 474 ? CD  ? H GLU 368 CD  
573  1 Y 1 H GLU 474 ? OE1 ? H GLU 368 OE1 
574  1 Y 1 H GLU 474 ? OE2 ? H GLU 368 OE2 
575  1 Y 1 H LYS 492 ? CG  ? H LYS 386 CG  
576  1 Y 1 H LYS 492 ? CD  ? H LYS 386 CD  
577  1 Y 1 H LYS 492 ? CE  ? H LYS 386 CE  
578  1 Y 1 H LYS 492 ? NZ  ? H LYS 386 NZ  
579  1 Y 1 H ARG 559 ? CG  ? H ARG 453 CG  
580  1 Y 1 H ARG 559 ? CD  ? H ARG 453 CD  
581  1 Y 1 H ARG 559 ? NE  ? H ARG 453 NE  
582  1 Y 1 H ARG 559 ? CZ  ? H ARG 453 CZ  
583  1 Y 1 H ARG 559 ? NH1 ? H ARG 453 NH1 
584  1 Y 1 H ARG 559 ? NH2 ? H ARG 453 NH2 
585  1 Y 1 H LYS 560 ? CG  ? H LYS 454 CG  
586  1 Y 1 H LYS 560 ? CD  ? H LYS 454 CD  
587  1 Y 1 H LYS 560 ? CE  ? H LYS 454 CE  
588  1 Y 1 H LYS 560 ? NZ  ? H LYS 454 NZ  
589  1 Y 1 H GLN 594 ? CG  ? H GLN 488 CG  
590  1 Y 1 H GLN 594 ? CD  ? H GLN 488 CD  
591  1 Y 1 H GLN 594 ? OE1 ? H GLN 488 OE1 
592  1 Y 1 H GLN 594 ? NE2 ? H GLN 488 NE2 
593  1 Y 1 H LYS 596 ? CG  ? H LYS 490 CG  
594  1 Y 1 H LYS 596 ? CD  ? H LYS 490 CD  
595  1 Y 1 H LYS 596 ? CE  ? H LYS 490 CE  
596  1 Y 1 H LYS 596 ? NZ  ? H LYS 490 NZ  
597  1 Y 1 I LYS 185 ? CG  ? I LYS 79  CG  
598  1 Y 1 I LYS 185 ? CD  ? I LYS 79  CD  
599  1 Y 1 I LYS 185 ? CE  ? I LYS 79  CE  
600  1 Y 1 I LYS 185 ? NZ  ? I LYS 79  NZ  
601  1 Y 1 I LYS 230 ? CG  ? I LYS 124 CG  
602  1 Y 1 I LYS 230 ? CD  ? I LYS 124 CD  
603  1 Y 1 I LYS 230 ? CE  ? I LYS 124 CE  
604  1 Y 1 I LYS 230 ? NZ  ? I LYS 124 NZ  
605  1 Y 1 I GLN 326 ? CG  ? I GLN 220 CG  
606  1 Y 1 I GLN 326 ? CD  ? I GLN 220 CD  
607  1 Y 1 I GLN 326 ? OE1 ? I GLN 220 OE1 
608  1 Y 1 I GLN 326 ? NE2 ? I GLN 220 NE2 
609  1 Y 1 I LYS 405 ? CG  ? I LYS 299 CG  
610  1 Y 1 I LYS 405 ? CD  ? I LYS 299 CD  
611  1 Y 1 I LYS 405 ? CE  ? I LYS 299 CE  
612  1 Y 1 I LYS 405 ? NZ  ? I LYS 299 NZ  
613  1 Y 1 I LYS 406 ? CG  ? I LYS 300 CG  
614  1 Y 1 I LYS 406 ? CD  ? I LYS 300 CD  
615  1 Y 1 I LYS 406 ? CE  ? I LYS 300 CE  
616  1 Y 1 I LYS 406 ? NZ  ? I LYS 300 NZ  
617  1 Y 1 I ARG 408 ? CG  ? I ARG 302 CG  
618  1 Y 1 I ARG 408 ? CD  ? I ARG 302 CD  
619  1 Y 1 I ARG 408 ? NE  ? I ARG 302 NE  
620  1 Y 1 I ARG 408 ? CZ  ? I ARG 302 CZ  
621  1 Y 1 I ARG 408 ? NH1 ? I ARG 302 NH1 
622  1 Y 1 I ARG 408 ? NH2 ? I ARG 302 NH2 
623  1 Y 1 I LYS 439 ? CG  ? I LYS 333 CG  
624  1 Y 1 I LYS 439 ? CD  ? I LYS 333 CD  
625  1 Y 1 I LYS 439 ? CE  ? I LYS 333 CE  
626  1 Y 1 I LYS 439 ? NZ  ? I LYS 333 NZ  
627  1 Y 1 I GLN 465 ? CG  ? I GLN 359 CG  
628  1 Y 1 I GLN 465 ? CD  ? I GLN 359 CD  
629  1 Y 1 I GLN 465 ? OE1 ? I GLN 359 OE1 
630  1 Y 1 I GLN 465 ? NE2 ? I GLN 359 NE2 
631  1 Y 1 I LYS 467 ? CG  ? I LYS 361 CG  
632  1 Y 1 I LYS 467 ? CD  ? I LYS 361 CD  
633  1 Y 1 I LYS 467 ? CE  ? I LYS 361 CE  
634  1 Y 1 I LYS 467 ? NZ  ? I LYS 361 NZ  
635  1 Y 1 I LYS 469 ? CG  ? I LYS 363 CG  
636  1 Y 1 I LYS 469 ? CD  ? I LYS 363 CD  
637  1 Y 1 I LYS 469 ? CE  ? I LYS 363 CE  
638  1 Y 1 I LYS 469 ? NZ  ? I LYS 363 NZ  
639  1 Y 1 I GLU 474 ? CG  ? I GLU 368 CG  
640  1 Y 1 I GLU 474 ? CD  ? I GLU 368 CD  
641  1 Y 1 I GLU 474 ? OE1 ? I GLU 368 OE1 
642  1 Y 1 I GLU 474 ? OE2 ? I GLU 368 OE2 
643  1 Y 1 I LYS 478 ? CG  ? I LYS 372 CG  
644  1 Y 1 I LYS 478 ? CD  ? I LYS 372 CD  
645  1 Y 1 I LYS 478 ? CE  ? I LYS 372 CE  
646  1 Y 1 I LYS 478 ? NZ  ? I LYS 372 NZ  
647  1 Y 1 I LYS 484 ? CG  ? I LYS 378 CG  
648  1 Y 1 I LYS 484 ? CD  ? I LYS 378 CD  
649  1 Y 1 I LYS 484 ? CE  ? I LYS 378 CE  
650  1 Y 1 I LYS 484 ? NZ  ? I LYS 378 NZ  
651  1 Y 1 I LYS 486 ? CG  ? I LYS 380 CG  
652  1 Y 1 I LYS 486 ? CD  ? I LYS 380 CD  
653  1 Y 1 I LYS 486 ? CE  ? I LYS 380 CE  
654  1 Y 1 I LYS 486 ? NZ  ? I LYS 380 NZ  
655  1 Y 1 I LYS 492 ? CG  ? I LYS 386 CG  
656  1 Y 1 I LYS 492 ? CD  ? I LYS 386 CD  
657  1 Y 1 I LYS 492 ? CE  ? I LYS 386 CE  
658  1 Y 1 I LYS 492 ? NZ  ? I LYS 386 NZ  
659  1 Y 1 I ARG 559 ? CG  ? I ARG 453 CG  
660  1 Y 1 I ARG 559 ? CD  ? I ARG 453 CD  
661  1 Y 1 I ARG 559 ? NE  ? I ARG 453 NE  
662  1 Y 1 I ARG 559 ? CZ  ? I ARG 453 CZ  
663  1 Y 1 I ARG 559 ? NH1 ? I ARG 453 NH1 
664  1 Y 1 I ARG 559 ? NH2 ? I ARG 453 NH2 
665  1 Y 1 I GLN 594 ? CG  ? I GLN 488 CG  
666  1 Y 1 I GLN 594 ? CD  ? I GLN 488 CD  
667  1 Y 1 I GLN 594 ? OE1 ? I GLN 488 OE1 
668  1 Y 1 I GLN 594 ? NE2 ? I GLN 488 NE2 
669  1 Y 1 I LYS 596 ? CG  ? I LYS 490 CG  
670  1 Y 1 I LYS 596 ? CD  ? I LYS 490 CD  
671  1 Y 1 I LYS 596 ? CE  ? I LYS 490 CE  
672  1 Y 1 I LYS 596 ? NZ  ? I LYS 490 NZ  
673  1 Y 1 J LYS 185 ? CG  ? J LYS 79  CG  
674  1 Y 1 J LYS 185 ? CD  ? J LYS 79  CD  
675  1 Y 1 J LYS 185 ? CE  ? J LYS 79  CE  
676  1 Y 1 J LYS 185 ? NZ  ? J LYS 79  NZ  
677  1 Y 1 J LYS 230 ? CG  ? J LYS 124 CG  
678  1 Y 1 J LYS 230 ? CD  ? J LYS 124 CD  
679  1 Y 1 J LYS 230 ? CE  ? J LYS 124 CE  
680  1 Y 1 J LYS 230 ? NZ  ? J LYS 124 NZ  
681  1 Y 1 J GLU 262 ? CG  ? J GLU 156 CG  
682  1 Y 1 J GLU 262 ? CD  ? J GLU 156 CD  
683  1 Y 1 J GLU 262 ? OE1 ? J GLU 156 OE1 
684  1 Y 1 J GLU 262 ? OE2 ? J GLU 156 OE2 
685  1 Y 1 J GLU 277 ? CG  ? J GLU 171 CG  
686  1 Y 1 J GLU 277 ? CD  ? J GLU 171 CD  
687  1 Y 1 J GLU 277 ? OE1 ? J GLU 171 OE1 
688  1 Y 1 J GLU 277 ? OE2 ? J GLU 171 OE2 
689  1 Y 1 J GLN 326 ? CG  ? J GLN 220 CG  
690  1 Y 1 J GLN 326 ? CD  ? J GLN 220 CD  
691  1 Y 1 J GLN 326 ? OE1 ? J GLN 220 OE1 
692  1 Y 1 J GLN 326 ? NE2 ? J GLN 220 NE2 
693  1 Y 1 J LYS 406 ? CG  ? J LYS 300 CG  
694  1 Y 1 J LYS 406 ? CD  ? J LYS 300 CD  
695  1 Y 1 J LYS 406 ? CE  ? J LYS 300 CE  
696  1 Y 1 J LYS 406 ? NZ  ? J LYS 300 NZ  
697  1 Y 1 J LYS 421 ? CG  ? J LYS 315 CG  
698  1 Y 1 J LYS 421 ? CD  ? J LYS 315 CD  
699  1 Y 1 J LYS 421 ? CE  ? J LYS 315 CE  
700  1 Y 1 J LYS 421 ? NZ  ? J LYS 315 NZ  
701  1 Y 1 J LYS 439 ? CG  ? J LYS 333 CG  
702  1 Y 1 J LYS 439 ? CD  ? J LYS 333 CD  
703  1 Y 1 J LYS 439 ? CE  ? J LYS 333 CE  
704  1 Y 1 J LYS 439 ? NZ  ? J LYS 333 NZ  
705  1 Y 1 J GLN 465 ? CG  ? J GLN 359 CG  
706  1 Y 1 J GLN 465 ? CD  ? J GLN 359 CD  
707  1 Y 1 J GLN 465 ? OE1 ? J GLN 359 OE1 
708  1 Y 1 J GLN 465 ? NE2 ? J GLN 359 NE2 
709  1 Y 1 J LYS 467 ? CG  ? J LYS 361 CG  
710  1 Y 1 J LYS 467 ? CD  ? J LYS 361 CD  
711  1 Y 1 J LYS 467 ? CE  ? J LYS 361 CE  
712  1 Y 1 J LYS 467 ? NZ  ? J LYS 361 NZ  
713  1 Y 1 J LYS 469 ? CG  ? J LYS 363 CG  
714  1 Y 1 J LYS 469 ? CD  ? J LYS 363 CD  
715  1 Y 1 J LYS 469 ? CE  ? J LYS 363 CE  
716  1 Y 1 J LYS 469 ? NZ  ? J LYS 363 NZ  
717  1 Y 1 J GLU 474 ? CG  ? J GLU 368 CG  
718  1 Y 1 J GLU 474 ? CD  ? J GLU 368 CD  
719  1 Y 1 J GLU 474 ? OE1 ? J GLU 368 OE1 
720  1 Y 1 J GLU 474 ? OE2 ? J GLU 368 OE2 
721  1 Y 1 J LYS 478 ? CG  ? J LYS 372 CG  
722  1 Y 1 J LYS 478 ? CD  ? J LYS 372 CD  
723  1 Y 1 J LYS 478 ? CE  ? J LYS 372 CE  
724  1 Y 1 J LYS 478 ? NZ  ? J LYS 372 NZ  
725  1 Y 1 J LYS 484 ? CG  ? J LYS 378 CG  
726  1 Y 1 J LYS 484 ? CD  ? J LYS 378 CD  
727  1 Y 1 J LYS 484 ? CE  ? J LYS 378 CE  
728  1 Y 1 J LYS 484 ? NZ  ? J LYS 378 NZ  
729  1 Y 1 J LYS 486 ? CG  ? J LYS 380 CG  
730  1 Y 1 J LYS 486 ? CD  ? J LYS 380 CD  
731  1 Y 1 J LYS 486 ? CE  ? J LYS 380 CE  
732  1 Y 1 J LYS 486 ? NZ  ? J LYS 380 NZ  
733  1 Y 1 J LYS 492 ? CG  ? J LYS 386 CG  
734  1 Y 1 J LYS 492 ? CD  ? J LYS 386 CD  
735  1 Y 1 J LYS 492 ? CE  ? J LYS 386 CE  
736  1 Y 1 J LYS 492 ? NZ  ? J LYS 386 NZ  
737  1 Y 1 J LYS 494 ? CG  ? J LYS 388 CG  
738  1 Y 1 J LYS 494 ? CD  ? J LYS 388 CD  
739  1 Y 1 J LYS 494 ? CE  ? J LYS 388 CE  
740  1 Y 1 J LYS 494 ? NZ  ? J LYS 388 NZ  
741  1 Y 1 J ARG 559 ? CG  ? J ARG 453 CG  
742  1 Y 1 J ARG 559 ? CD  ? J ARG 453 CD  
743  1 Y 1 J ARG 559 ? NE  ? J ARG 453 NE  
744  1 Y 1 J ARG 559 ? CZ  ? J ARG 453 CZ  
745  1 Y 1 J ARG 559 ? NH1 ? J ARG 453 NH1 
746  1 Y 1 J ARG 559 ? NH2 ? J ARG 453 NH2 
747  1 Y 1 J LYS 560 ? CG  ? J LYS 454 CG  
748  1 Y 1 J LYS 560 ? CD  ? J LYS 454 CD  
749  1 Y 1 J LYS 560 ? CE  ? J LYS 454 CE  
750  1 Y 1 J LYS 560 ? NZ  ? J LYS 454 NZ  
751  1 Y 1 J LYS 596 ? CG  ? J LYS 490 CG  
752  1 Y 1 J LYS 596 ? CD  ? J LYS 490 CD  
753  1 Y 1 J LYS 596 ? CE  ? J LYS 490 CE  
754  1 Y 1 J LYS 596 ? NZ  ? J LYS 490 NZ  
755  1 Y 1 J GLU 597 ? CG  ? J GLU 491 CG  
756  1 Y 1 J GLU 597 ? CD  ? J GLU 491 CD  
757  1 Y 1 J GLU 597 ? OE1 ? J GLU 491 OE1 
758  1 Y 1 J GLU 597 ? OE2 ? J GLU 491 OE2 
759  1 Y 1 K LYS 185 ? CG  ? K LYS 79  CG  
760  1 Y 1 K LYS 185 ? CD  ? K LYS 79  CD  
761  1 Y 1 K LYS 185 ? CE  ? K LYS 79  CE  
762  1 Y 1 K LYS 185 ? NZ  ? K LYS 79  NZ  
763  1 Y 1 K LYS 230 ? CG  ? K LYS 124 CG  
764  1 Y 1 K LYS 230 ? CD  ? K LYS 124 CD  
765  1 Y 1 K LYS 230 ? CE  ? K LYS 124 CE  
766  1 Y 1 K LYS 230 ? NZ  ? K LYS 124 NZ  
767  1 Y 1 K LYS 288 ? CG  ? K LYS 182 CG  
768  1 Y 1 K LYS 288 ? CD  ? K LYS 182 CD  
769  1 Y 1 K LYS 288 ? CE  ? K LYS 182 CE  
770  1 Y 1 K LYS 288 ? NZ  ? K LYS 182 NZ  
771  1 Y 1 K GLN 326 ? CG  ? K GLN 220 CG  
772  1 Y 1 K GLN 326 ? CD  ? K GLN 220 CD  
773  1 Y 1 K GLN 326 ? OE1 ? K GLN 220 OE1 
774  1 Y 1 K GLN 326 ? NE2 ? K GLN 220 NE2 
775  1 Y 1 K GLU 398 ? CG  ? K GLU 292 CG  
776  1 Y 1 K GLU 398 ? CD  ? K GLU 292 CD  
777  1 Y 1 K GLU 398 ? OE1 ? K GLU 292 OE1 
778  1 Y 1 K GLU 398 ? OE2 ? K GLU 292 OE2 
779  1 Y 1 K LYS 405 ? CG  ? K LYS 299 CG  
780  1 Y 1 K LYS 405 ? CD  ? K LYS 299 CD  
781  1 Y 1 K LYS 405 ? CE  ? K LYS 299 CE  
782  1 Y 1 K LYS 405 ? NZ  ? K LYS 299 NZ  
783  1 Y 1 K LYS 406 ? CG  ? K LYS 300 CG  
784  1 Y 1 K LYS 406 ? CD  ? K LYS 300 CD  
785  1 Y 1 K LYS 406 ? CE  ? K LYS 300 CE  
786  1 Y 1 K LYS 406 ? NZ  ? K LYS 300 NZ  
787  1 Y 1 K ARG 408 ? CG  ? K ARG 302 CG  
788  1 Y 1 K ARG 408 ? CD  ? K ARG 302 CD  
789  1 Y 1 K ARG 408 ? NE  ? K ARG 302 NE  
790  1 Y 1 K ARG 408 ? CZ  ? K ARG 302 CZ  
791  1 Y 1 K ARG 408 ? NH1 ? K ARG 302 NH1 
792  1 Y 1 K ARG 408 ? NH2 ? K ARG 302 NH2 
793  1 Y 1 K LYS 437 ? CG  ? K LYS 331 CG  
794  1 Y 1 K LYS 437 ? CD  ? K LYS 331 CD  
795  1 Y 1 K LYS 437 ? CE  ? K LYS 331 CE  
796  1 Y 1 K LYS 437 ? NZ  ? K LYS 331 NZ  
797  1 Y 1 K GLN 465 ? CG  ? K GLN 359 CG  
798  1 Y 1 K GLN 465 ? CD  ? K GLN 359 CD  
799  1 Y 1 K GLN 465 ? OE1 ? K GLN 359 OE1 
800  1 Y 1 K GLN 465 ? NE2 ? K GLN 359 NE2 
801  1 Y 1 K LYS 467 ? CG  ? K LYS 361 CG  
802  1 Y 1 K LYS 467 ? CD  ? K LYS 361 CD  
803  1 Y 1 K LYS 467 ? CE  ? K LYS 361 CE  
804  1 Y 1 K LYS 467 ? NZ  ? K LYS 361 NZ  
805  1 Y 1 K LYS 469 ? CG  ? K LYS 363 CG  
806  1 Y 1 K LYS 469 ? CD  ? K LYS 363 CD  
807  1 Y 1 K LYS 469 ? CE  ? K LYS 363 CE  
808  1 Y 1 K LYS 469 ? NZ  ? K LYS 363 NZ  
809  1 Y 1 K GLU 474 ? CG  ? K GLU 368 CG  
810  1 Y 1 K GLU 474 ? CD  ? K GLU 368 CD  
811  1 Y 1 K GLU 474 ? OE1 ? K GLU 368 OE1 
812  1 Y 1 K GLU 474 ? OE2 ? K GLU 368 OE2 
813  1 Y 1 K LYS 478 ? CG  ? K LYS 372 CG  
814  1 Y 1 K LYS 478 ? CD  ? K LYS 372 CD  
815  1 Y 1 K LYS 478 ? CE  ? K LYS 372 CE  
816  1 Y 1 K LYS 478 ? NZ  ? K LYS 372 NZ  
817  1 Y 1 K LYS 486 ? CG  ? K LYS 380 CG  
818  1 Y 1 K LYS 486 ? CD  ? K LYS 380 CD  
819  1 Y 1 K LYS 486 ? CE  ? K LYS 380 CE  
820  1 Y 1 K LYS 486 ? NZ  ? K LYS 380 NZ  
821  1 Y 1 K LYS 492 ? CG  ? K LYS 386 CG  
822  1 Y 1 K LYS 492 ? CD  ? K LYS 386 CD  
823  1 Y 1 K LYS 492 ? CE  ? K LYS 386 CE  
824  1 Y 1 K LYS 492 ? NZ  ? K LYS 386 NZ  
825  1 Y 1 K LYS 494 ? CG  ? K LYS 388 CG  
826  1 Y 1 K LYS 494 ? CD  ? K LYS 388 CD  
827  1 Y 1 K LYS 494 ? CE  ? K LYS 388 CE  
828  1 Y 1 K LYS 494 ? NZ  ? K LYS 388 NZ  
829  1 Y 1 K ARG 559 ? CG  ? K ARG 453 CG  
830  1 Y 1 K ARG 559 ? CD  ? K ARG 453 CD  
831  1 Y 1 K ARG 559 ? NE  ? K ARG 453 NE  
832  1 Y 1 K ARG 559 ? CZ  ? K ARG 453 CZ  
833  1 Y 1 K ARG 559 ? NH1 ? K ARG 453 NH1 
834  1 Y 1 K ARG 559 ? NH2 ? K ARG 453 NH2 
835  1 Y 1 K LYS 560 ? CG  ? K LYS 454 CG  
836  1 Y 1 K LYS 560 ? CD  ? K LYS 454 CD  
837  1 Y 1 K LYS 560 ? CE  ? K LYS 454 CE  
838  1 Y 1 K LYS 560 ? NZ  ? K LYS 454 NZ  
839  1 Y 1 K LYS 596 ? CG  ? K LYS 490 CG  
840  1 Y 1 K LYS 596 ? CD  ? K LYS 490 CD  
841  1 Y 1 K LYS 596 ? CE  ? K LYS 490 CE  
842  1 Y 1 K LYS 596 ? NZ  ? K LYS 490 NZ  
843  1 Y 1 L LYS 185 ? CG  ? L LYS 79  CG  
844  1 Y 1 L LYS 185 ? CD  ? L LYS 79  CD  
845  1 Y 1 L LYS 185 ? CE  ? L LYS 79  CE  
846  1 Y 1 L LYS 185 ? NZ  ? L LYS 79  NZ  
847  1 Y 1 L LYS 230 ? CG  ? L LYS 124 CG  
848  1 Y 1 L LYS 230 ? CD  ? L LYS 124 CD  
849  1 Y 1 L LYS 230 ? CE  ? L LYS 124 CE  
850  1 Y 1 L LYS 230 ? NZ  ? L LYS 124 NZ  
851  1 Y 1 L LYS 288 ? CG  ? L LYS 182 CG  
852  1 Y 1 L LYS 288 ? CD  ? L LYS 182 CD  
853  1 Y 1 L LYS 288 ? CE  ? L LYS 182 CE  
854  1 Y 1 L LYS 288 ? NZ  ? L LYS 182 NZ  
855  1 Y 1 L GLN 326 ? CG  ? L GLN 220 CG  
856  1 Y 1 L GLN 326 ? CD  ? L GLN 220 CD  
857  1 Y 1 L GLN 326 ? OE1 ? L GLN 220 OE1 
858  1 Y 1 L GLN 326 ? NE2 ? L GLN 220 NE2 
859  1 Y 1 L LYS 405 ? CG  ? L LYS 299 CG  
860  1 Y 1 L LYS 405 ? CD  ? L LYS 299 CD  
861  1 Y 1 L LYS 405 ? CE  ? L LYS 299 CE  
862  1 Y 1 L LYS 405 ? NZ  ? L LYS 299 NZ  
863  1 Y 1 L LYS 406 ? CG  ? L LYS 300 CG  
864  1 Y 1 L LYS 406 ? CD  ? L LYS 300 CD  
865  1 Y 1 L LYS 406 ? CE  ? L LYS 300 CE  
866  1 Y 1 L LYS 406 ? NZ  ? L LYS 300 NZ  
867  1 Y 1 L ARG 408 ? CG  ? L ARG 302 CG  
868  1 Y 1 L ARG 408 ? CD  ? L ARG 302 CD  
869  1 Y 1 L ARG 408 ? NE  ? L ARG 302 NE  
870  1 Y 1 L ARG 408 ? CZ  ? L ARG 302 CZ  
871  1 Y 1 L ARG 408 ? NH1 ? L ARG 302 NH1 
872  1 Y 1 L ARG 408 ? NH2 ? L ARG 302 NH2 
873  1 Y 1 L LYS 437 ? CG  ? L LYS 331 CG  
874  1 Y 1 L LYS 437 ? CD  ? L LYS 331 CD  
875  1 Y 1 L LYS 437 ? CE  ? L LYS 331 CE  
876  1 Y 1 L LYS 437 ? NZ  ? L LYS 331 NZ  
877  1 Y 1 L LYS 439 ? CG  ? L LYS 333 CG  
878  1 Y 1 L LYS 439 ? CD  ? L LYS 333 CD  
879  1 Y 1 L LYS 439 ? CE  ? L LYS 333 CE  
880  1 Y 1 L LYS 439 ? NZ  ? L LYS 333 NZ  
881  1 Y 1 L GLN 465 ? CG  ? L GLN 359 CG  
882  1 Y 1 L GLN 465 ? CD  ? L GLN 359 CD  
883  1 Y 1 L GLN 465 ? OE1 ? L GLN 359 OE1 
884  1 Y 1 L GLN 465 ? NE2 ? L GLN 359 NE2 
885  1 Y 1 L LYS 467 ? CG  ? L LYS 361 CG  
886  1 Y 1 L LYS 467 ? CD  ? L LYS 361 CD  
887  1 Y 1 L LYS 467 ? CE  ? L LYS 361 CE  
888  1 Y 1 L LYS 467 ? NZ  ? L LYS 361 NZ  
889  1 Y 1 L LYS 469 ? CG  ? L LYS 363 CG  
890  1 Y 1 L LYS 469 ? CD  ? L LYS 363 CD  
891  1 Y 1 L LYS 469 ? CE  ? L LYS 363 CE  
892  1 Y 1 L LYS 469 ? NZ  ? L LYS 363 NZ  
893  1 Y 1 L ARG 470 ? CG  ? L ARG 364 CG  
894  1 Y 1 L ARG 470 ? CD  ? L ARG 364 CD  
895  1 Y 1 L ARG 470 ? NE  ? L ARG 364 NE  
896  1 Y 1 L ARG 470 ? CZ  ? L ARG 364 CZ  
897  1 Y 1 L ARG 470 ? NH1 ? L ARG 364 NH1 
898  1 Y 1 L ARG 470 ? NH2 ? L ARG 364 NH2 
899  1 Y 1 L GLU 474 ? CG  ? L GLU 368 CG  
900  1 Y 1 L GLU 474 ? CD  ? L GLU 368 CD  
901  1 Y 1 L GLU 474 ? OE1 ? L GLU 368 OE1 
902  1 Y 1 L GLU 474 ? OE2 ? L GLU 368 OE2 
903  1 Y 1 L LYS 478 ? CG  ? L LYS 372 CG  
904  1 Y 1 L LYS 478 ? CD  ? L LYS 372 CD  
905  1 Y 1 L LYS 478 ? CE  ? L LYS 372 CE  
906  1 Y 1 L LYS 478 ? NZ  ? L LYS 372 NZ  
907  1 Y 1 L LYS 484 ? CG  ? L LYS 378 CG  
908  1 Y 1 L LYS 484 ? CD  ? L LYS 378 CD  
909  1 Y 1 L LYS 484 ? CE  ? L LYS 378 CE  
910  1 Y 1 L LYS 484 ? NZ  ? L LYS 378 NZ  
911  1 Y 1 L LYS 486 ? CG  ? L LYS 380 CG  
912  1 Y 1 L LYS 486 ? CD  ? L LYS 380 CD  
913  1 Y 1 L LYS 486 ? CE  ? L LYS 380 CE  
914  1 Y 1 L LYS 486 ? NZ  ? L LYS 380 NZ  
915  1 Y 1 L LYS 492 ? CG  ? L LYS 386 CG  
916  1 Y 1 L LYS 492 ? CD  ? L LYS 386 CD  
917  1 Y 1 L LYS 492 ? CE  ? L LYS 386 CE  
918  1 Y 1 L LYS 492 ? NZ  ? L LYS 386 NZ  
919  1 Y 1 L LYS 494 ? CG  ? L LYS 388 CG  
920  1 Y 1 L LYS 494 ? CD  ? L LYS 388 CD  
921  1 Y 1 L LYS 494 ? CE  ? L LYS 388 CE  
922  1 Y 1 L LYS 494 ? NZ  ? L LYS 388 NZ  
923  1 Y 1 L LYS 512 ? CG  ? L LYS 406 CG  
924  1 Y 1 L LYS 512 ? CD  ? L LYS 406 CD  
925  1 Y 1 L LYS 512 ? CE  ? L LYS 406 CE  
926  1 Y 1 L LYS 512 ? NZ  ? L LYS 406 NZ  
927  1 Y 1 L ARG 528 ? CG  ? L ARG 422 CG  
928  1 Y 1 L ARG 528 ? CD  ? L ARG 422 CD  
929  1 Y 1 L ARG 528 ? NE  ? L ARG 422 NE  
930  1 Y 1 L ARG 528 ? CZ  ? L ARG 422 CZ  
931  1 Y 1 L ARG 528 ? NH1 ? L ARG 422 NH1 
932  1 Y 1 L ARG 528 ? NH2 ? L ARG 422 NH2 
933  1 Y 1 L LYS 556 ? CG  ? L LYS 450 CG  
934  1 Y 1 L LYS 556 ? CD  ? L LYS 450 CD  
935  1 Y 1 L LYS 556 ? CE  ? L LYS 450 CE  
936  1 Y 1 L LYS 556 ? NZ  ? L LYS 450 NZ  
937  1 Y 1 L ARG 559 ? CG  ? L ARG 453 CG  
938  1 Y 1 L ARG 559 ? CD  ? L ARG 453 CD  
939  1 Y 1 L ARG 559 ? NE  ? L ARG 453 NE  
940  1 Y 1 L ARG 559 ? CZ  ? L ARG 453 CZ  
941  1 Y 1 L ARG 559 ? NH1 ? L ARG 453 NH1 
942  1 Y 1 L ARG 559 ? NH2 ? L ARG 453 NH2 
943  1 Y 1 L LYS 560 ? CG  ? L LYS 454 CG  
944  1 Y 1 L LYS 560 ? CD  ? L LYS 454 CD  
945  1 Y 1 L LYS 560 ? CE  ? L LYS 454 CE  
946  1 Y 1 L LYS 560 ? NZ  ? L LYS 454 NZ  
947  1 Y 1 L GLN 594 ? CG  ? L GLN 488 CG  
948  1 Y 1 L GLN 594 ? CD  ? L GLN 488 CD  
949  1 Y 1 L GLN 594 ? OE1 ? L GLN 488 OE1 
950  1 Y 1 L GLN 594 ? NE2 ? L GLN 488 NE2 
951  1 Y 1 L LYS 595 ? CG  ? L LYS 489 CG  
952  1 Y 1 L LYS 595 ? CD  ? L LYS 489 CD  
953  1 Y 1 L LYS 595 ? CE  ? L LYS 489 CE  
954  1 Y 1 L LYS 595 ? NZ  ? L LYS 489 NZ  
955  1 Y 1 L LYS 596 ? CG  ? L LYS 490 CG  
956  1 Y 1 L LYS 596 ? CD  ? L LYS 490 CD  
957  1 Y 1 L LYS 596 ? CE  ? L LYS 490 CE  
958  1 Y 1 L LYS 596 ? NZ  ? L LYS 490 NZ  
959  1 Y 1 L GLU 597 ? CG  ? L GLU 491 CG  
960  1 Y 1 L GLU 597 ? CD  ? L GLU 491 CD  
961  1 Y 1 L GLU 597 ? OE1 ? L GLU 491 OE1 
962  1 Y 1 L GLU 597 ? OE2 ? L GLU 491 OE2 
963  1 Y 1 L ASP 600 ? CG  ? L ASP 494 CG  
964  1 Y 1 L ASP 600 ? OD1 ? L ASP 494 OD1 
965  1 Y 1 L ASP 600 ? OD2 ? L ASP 494 OD2 
966  1 Y 1 M LYS 185 ? CG  ? M LYS 79  CG  
967  1 Y 1 M LYS 185 ? CD  ? M LYS 79  CD  
968  1 Y 1 M LYS 185 ? CE  ? M LYS 79  CE  
969  1 Y 1 M LYS 185 ? NZ  ? M LYS 79  NZ  
970  1 Y 1 M LYS 230 ? CG  ? M LYS 124 CG  
971  1 Y 1 M LYS 230 ? CD  ? M LYS 124 CD  
972  1 Y 1 M LYS 230 ? CE  ? M LYS 124 CE  
973  1 Y 1 M LYS 230 ? NZ  ? M LYS 124 NZ  
974  1 Y 1 M GLU 262 ? CG  ? M GLU 156 CG  
975  1 Y 1 M GLU 262 ? CD  ? M GLU 156 CD  
976  1 Y 1 M GLU 262 ? OE1 ? M GLU 156 OE1 
977  1 Y 1 M GLU 262 ? OE2 ? M GLU 156 OE2 
978  1 Y 1 M LYS 288 ? CG  ? M LYS 182 CG  
979  1 Y 1 M LYS 288 ? CD  ? M LYS 182 CD  
980  1 Y 1 M LYS 288 ? CE  ? M LYS 182 CE  
981  1 Y 1 M LYS 288 ? NZ  ? M LYS 182 NZ  
982  1 Y 1 M LYS 304 ? CG  ? M LYS 198 CG  
983  1 Y 1 M LYS 304 ? CD  ? M LYS 198 CD  
984  1 Y 1 M LYS 304 ? CE  ? M LYS 198 CE  
985  1 Y 1 M LYS 304 ? NZ  ? M LYS 198 NZ  
986  1 Y 1 M ARG 305 ? CG  ? M ARG 199 CG  
987  1 Y 1 M ARG 305 ? CD  ? M ARG 199 CD  
988  1 Y 1 M ARG 305 ? NE  ? M ARG 199 NE  
989  1 Y 1 M ARG 305 ? CZ  ? M ARG 199 CZ  
990  1 Y 1 M ARG 305 ? NH1 ? M ARG 199 NH1 
991  1 Y 1 M ARG 305 ? NH2 ? M ARG 199 NH2 
992  1 Y 1 M GLN 326 ? CG  ? M GLN 220 CG  
993  1 Y 1 M GLN 326 ? CD  ? M GLN 220 CD  
994  1 Y 1 M GLN 326 ? OE1 ? M GLN 220 OE1 
995  1 Y 1 M GLN 326 ? NE2 ? M GLN 220 NE2 
996  1 Y 1 M ARG 348 ? CG  ? M ARG 242 CG  
997  1 Y 1 M ARG 348 ? CD  ? M ARG 242 CD  
998  1 Y 1 M ARG 348 ? NE  ? M ARG 242 NE  
999  1 Y 1 M ARG 348 ? CZ  ? M ARG 242 CZ  
1000 1 Y 1 M ARG 348 ? NH1 ? M ARG 242 NH1 
1001 1 Y 1 M ARG 348 ? NH2 ? M ARG 242 NH2 
1002 1 Y 1 M LYS 405 ? CG  ? M LYS 299 CG  
1003 1 Y 1 M LYS 405 ? CD  ? M LYS 299 CD  
1004 1 Y 1 M LYS 405 ? CE  ? M LYS 299 CE  
1005 1 Y 1 M LYS 405 ? NZ  ? M LYS 299 NZ  
1006 1 Y 1 M LYS 406 ? CG  ? M LYS 300 CG  
1007 1 Y 1 M LYS 406 ? CD  ? M LYS 300 CD  
1008 1 Y 1 M LYS 406 ? CE  ? M LYS 300 CE  
1009 1 Y 1 M LYS 406 ? NZ  ? M LYS 300 NZ  
1010 1 Y 1 M ARG 408 ? CG  ? M ARG 302 CG  
1011 1 Y 1 M ARG 408 ? CD  ? M ARG 302 CD  
1012 1 Y 1 M ARG 408 ? NE  ? M ARG 302 NE  
1013 1 Y 1 M ARG 408 ? CZ  ? M ARG 302 CZ  
1014 1 Y 1 M ARG 408 ? NH1 ? M ARG 302 NH1 
1015 1 Y 1 M ARG 408 ? NH2 ? M ARG 302 NH2 
1016 1 Y 1 M LYS 421 ? CG  ? M LYS 315 CG  
1017 1 Y 1 M LYS 421 ? CD  ? M LYS 315 CD  
1018 1 Y 1 M LYS 421 ? CE  ? M LYS 315 CE  
1019 1 Y 1 M LYS 421 ? NZ  ? M LYS 315 NZ  
1020 1 Y 1 M GLU 429 ? CG  ? M GLU 323 CG  
1021 1 Y 1 M GLU 429 ? CD  ? M GLU 323 CD  
1022 1 Y 1 M GLU 429 ? OE1 ? M GLU 323 OE1 
1023 1 Y 1 M GLU 429 ? OE2 ? M GLU 323 OE2 
1024 1 Y 1 M LYS 437 ? CG  ? M LYS 331 CG  
1025 1 Y 1 M LYS 437 ? CD  ? M LYS 331 CD  
1026 1 Y 1 M LYS 437 ? CE  ? M LYS 331 CE  
1027 1 Y 1 M LYS 437 ? NZ  ? M LYS 331 NZ  
1028 1 Y 1 M LYS 439 ? CG  ? M LYS 333 CG  
1029 1 Y 1 M LYS 439 ? CD  ? M LYS 333 CD  
1030 1 Y 1 M LYS 439 ? CE  ? M LYS 333 CE  
1031 1 Y 1 M LYS 439 ? NZ  ? M LYS 333 NZ  
1032 1 Y 1 M GLN 465 ? CG  ? M GLN 359 CG  
1033 1 Y 1 M GLN 465 ? CD  ? M GLN 359 CD  
1034 1 Y 1 M GLN 465 ? OE1 ? M GLN 359 OE1 
1035 1 Y 1 M GLN 465 ? NE2 ? M GLN 359 NE2 
1036 1 Y 1 M LYS 467 ? CG  ? M LYS 361 CG  
1037 1 Y 1 M LYS 467 ? CD  ? M LYS 361 CD  
1038 1 Y 1 M LYS 467 ? CE  ? M LYS 361 CE  
1039 1 Y 1 M LYS 467 ? NZ  ? M LYS 361 NZ  
1040 1 Y 1 M LYS 469 ? CG  ? M LYS 363 CG  
1041 1 Y 1 M LYS 469 ? CD  ? M LYS 363 CD  
1042 1 Y 1 M LYS 469 ? CE  ? M LYS 363 CE  
1043 1 Y 1 M LYS 469 ? NZ  ? M LYS 363 NZ  
1044 1 Y 1 M ARG 470 ? CG  ? M ARG 364 CG  
1045 1 Y 1 M ARG 470 ? CD  ? M ARG 364 CD  
1046 1 Y 1 M ARG 470 ? NE  ? M ARG 364 NE  
1047 1 Y 1 M ARG 470 ? CZ  ? M ARG 364 CZ  
1048 1 Y 1 M ARG 470 ? NH1 ? M ARG 364 NH1 
1049 1 Y 1 M ARG 470 ? NH2 ? M ARG 364 NH2 
1050 1 Y 1 M GLU 474 ? CG  ? M GLU 368 CG  
1051 1 Y 1 M GLU 474 ? CD  ? M GLU 368 CD  
1052 1 Y 1 M GLU 474 ? OE1 ? M GLU 368 OE1 
1053 1 Y 1 M GLU 474 ? OE2 ? M GLU 368 OE2 
1054 1 Y 1 M LYS 478 ? CG  ? M LYS 372 CG  
1055 1 Y 1 M LYS 478 ? CD  ? M LYS 372 CD  
1056 1 Y 1 M LYS 478 ? CE  ? M LYS 372 CE  
1057 1 Y 1 M LYS 478 ? NZ  ? M LYS 372 NZ  
1058 1 Y 1 M LYS 484 ? CG  ? M LYS 378 CG  
1059 1 Y 1 M LYS 484 ? CD  ? M LYS 378 CD  
1060 1 Y 1 M LYS 484 ? CE  ? M LYS 378 CE  
1061 1 Y 1 M LYS 484 ? NZ  ? M LYS 378 NZ  
1062 1 Y 1 M LYS 486 ? CG  ? M LYS 380 CG  
1063 1 Y 1 M LYS 486 ? CD  ? M LYS 380 CD  
1064 1 Y 1 M LYS 486 ? CE  ? M LYS 380 CE  
1065 1 Y 1 M LYS 486 ? NZ  ? M LYS 380 NZ  
1066 1 Y 1 M LYS 492 ? CG  ? M LYS 386 CG  
1067 1 Y 1 M LYS 492 ? CD  ? M LYS 386 CD  
1068 1 Y 1 M LYS 492 ? CE  ? M LYS 386 CE  
1069 1 Y 1 M LYS 492 ? NZ  ? M LYS 386 NZ  
1070 1 Y 1 M LYS 494 ? CG  ? M LYS 388 CG  
1071 1 Y 1 M LYS 494 ? CD  ? M LYS 388 CD  
1072 1 Y 1 M LYS 494 ? CE  ? M LYS 388 CE  
1073 1 Y 1 M LYS 494 ? NZ  ? M LYS 388 NZ  
1074 1 Y 1 M ARG 528 ? CG  ? M ARG 422 CG  
1075 1 Y 1 M ARG 528 ? CD  ? M ARG 422 CD  
1076 1 Y 1 M ARG 528 ? NE  ? M ARG 422 NE  
1077 1 Y 1 M ARG 528 ? CZ  ? M ARG 422 CZ  
1078 1 Y 1 M ARG 528 ? NH1 ? M ARG 422 NH1 
1079 1 Y 1 M ARG 528 ? NH2 ? M ARG 422 NH2 
1080 1 Y 1 M ARG 559 ? CG  ? M ARG 453 CG  
1081 1 Y 1 M ARG 559 ? CD  ? M ARG 453 CD  
1082 1 Y 1 M ARG 559 ? NE  ? M ARG 453 NE  
1083 1 Y 1 M ARG 559 ? CZ  ? M ARG 453 CZ  
1084 1 Y 1 M ARG 559 ? NH1 ? M ARG 453 NH1 
1085 1 Y 1 M ARG 559 ? NH2 ? M ARG 453 NH2 
1086 1 Y 1 M LYS 560 ? CG  ? M LYS 454 CG  
1087 1 Y 1 M LYS 560 ? CD  ? M LYS 454 CD  
1088 1 Y 1 M LYS 560 ? CE  ? M LYS 454 CE  
1089 1 Y 1 M LYS 560 ? NZ  ? M LYS 454 NZ  
1090 1 Y 1 M LYS 580 ? CG  ? M LYS 474 CG  
1091 1 Y 1 M LYS 580 ? CD  ? M LYS 474 CD  
1092 1 Y 1 M LYS 580 ? CE  ? M LYS 474 CE  
1093 1 Y 1 M LYS 580 ? NZ  ? M LYS 474 NZ  
1094 1 Y 1 M LYS 595 ? CG  ? M LYS 489 CG  
1095 1 Y 1 M LYS 595 ? CD  ? M LYS 489 CD  
1096 1 Y 1 M LYS 595 ? CE  ? M LYS 489 CE  
1097 1 Y 1 M LYS 595 ? NZ  ? M LYS 489 NZ  
1098 1 Y 1 M LYS 596 ? CG  ? M LYS 490 CG  
1099 1 Y 1 M LYS 596 ? CD  ? M LYS 490 CD  
1100 1 Y 1 M LYS 596 ? CE  ? M LYS 490 CE  
1101 1 Y 1 M LYS 596 ? NZ  ? M LYS 490 NZ  
1102 1 Y 1 M GLU 597 ? CG  ? M GLU 491 CG  
1103 1 Y 1 M GLU 597 ? CD  ? M GLU 491 CD  
1104 1 Y 1 M GLU 597 ? OE1 ? M GLU 491 OE1 
1105 1 Y 1 M GLU 597 ? OE2 ? M GLU 491 OE2 
1106 1 Y 1 N LYS 185 ? CG  ? N LYS 79  CG  
1107 1 Y 1 N LYS 185 ? CD  ? N LYS 79  CD  
1108 1 Y 1 N LYS 185 ? CE  ? N LYS 79  CE  
1109 1 Y 1 N LYS 185 ? NZ  ? N LYS 79  NZ  
1110 1 Y 1 N LYS 230 ? CG  ? N LYS 124 CG  
1111 1 Y 1 N LYS 230 ? CD  ? N LYS 124 CD  
1112 1 Y 1 N LYS 230 ? CE  ? N LYS 124 CE  
1113 1 Y 1 N LYS 230 ? NZ  ? N LYS 124 NZ  
1114 1 Y 1 N LYS 288 ? CG  ? N LYS 182 CG  
1115 1 Y 1 N LYS 288 ? CD  ? N LYS 182 CD  
1116 1 Y 1 N LYS 288 ? CE  ? N LYS 182 CE  
1117 1 Y 1 N LYS 288 ? NZ  ? N LYS 182 NZ  
1118 1 Y 1 N ARG 305 ? CG  ? N ARG 199 CG  
1119 1 Y 1 N ARG 305 ? CD  ? N ARG 199 CD  
1120 1 Y 1 N ARG 305 ? NE  ? N ARG 199 NE  
1121 1 Y 1 N ARG 305 ? CZ  ? N ARG 199 CZ  
1122 1 Y 1 N ARG 305 ? NH1 ? N ARG 199 NH1 
1123 1 Y 1 N ARG 305 ? NH2 ? N ARG 199 NH2 
1124 1 Y 1 N GLN 326 ? CG  ? N GLN 220 CG  
1125 1 Y 1 N GLN 326 ? CD  ? N GLN 220 CD  
1126 1 Y 1 N GLN 326 ? OE1 ? N GLN 220 OE1 
1127 1 Y 1 N GLN 326 ? NE2 ? N GLN 220 NE2 
1128 1 Y 1 N LYS 405 ? CG  ? N LYS 299 CG  
1129 1 Y 1 N LYS 405 ? CD  ? N LYS 299 CD  
1130 1 Y 1 N LYS 405 ? CE  ? N LYS 299 CE  
1131 1 Y 1 N LYS 405 ? NZ  ? N LYS 299 NZ  
1132 1 Y 1 N LYS 406 ? CG  ? N LYS 300 CG  
1133 1 Y 1 N LYS 406 ? CD  ? N LYS 300 CD  
1134 1 Y 1 N LYS 406 ? CE  ? N LYS 300 CE  
1135 1 Y 1 N LYS 406 ? NZ  ? N LYS 300 NZ  
1136 1 Y 1 N ARG 408 ? CG  ? N ARG 302 CG  
1137 1 Y 1 N ARG 408 ? CD  ? N ARG 302 CD  
1138 1 Y 1 N ARG 408 ? NE  ? N ARG 302 NE  
1139 1 Y 1 N ARG 408 ? CZ  ? N ARG 302 CZ  
1140 1 Y 1 N ARG 408 ? NH1 ? N ARG 302 NH1 
1141 1 Y 1 N ARG 408 ? NH2 ? N ARG 302 NH2 
1142 1 Y 1 N LYS 437 ? CG  ? N LYS 331 CG  
1143 1 Y 1 N LYS 437 ? CD  ? N LYS 331 CD  
1144 1 Y 1 N LYS 437 ? CE  ? N LYS 331 CE  
1145 1 Y 1 N LYS 437 ? NZ  ? N LYS 331 NZ  
1146 1 Y 1 N GLN 465 ? CG  ? N GLN 359 CG  
1147 1 Y 1 N GLN 465 ? CD  ? N GLN 359 CD  
1148 1 Y 1 N GLN 465 ? OE1 ? N GLN 359 OE1 
1149 1 Y 1 N GLN 465 ? NE2 ? N GLN 359 NE2 
1150 1 Y 1 N LYS 467 ? CG  ? N LYS 361 CG  
1151 1 Y 1 N LYS 467 ? CD  ? N LYS 361 CD  
1152 1 Y 1 N LYS 467 ? CE  ? N LYS 361 CE  
1153 1 Y 1 N LYS 467 ? NZ  ? N LYS 361 NZ  
1154 1 Y 1 N LYS 469 ? CG  ? N LYS 363 CG  
1155 1 Y 1 N LYS 469 ? CD  ? N LYS 363 CD  
1156 1 Y 1 N LYS 469 ? CE  ? N LYS 363 CE  
1157 1 Y 1 N LYS 469 ? NZ  ? N LYS 363 NZ  
1158 1 Y 1 N GLU 474 ? CG  ? N GLU 368 CG  
1159 1 Y 1 N GLU 474 ? CD  ? N GLU 368 CD  
1160 1 Y 1 N GLU 474 ? OE1 ? N GLU 368 OE1 
1161 1 Y 1 N GLU 474 ? OE2 ? N GLU 368 OE2 
1162 1 Y 1 N LYS 478 ? CG  ? N LYS 372 CG  
1163 1 Y 1 N LYS 478 ? CD  ? N LYS 372 CD  
1164 1 Y 1 N LYS 478 ? CE  ? N LYS 372 CE  
1165 1 Y 1 N LYS 478 ? NZ  ? N LYS 372 NZ  
1166 1 Y 1 N LYS 486 ? CG  ? N LYS 380 CG  
1167 1 Y 1 N LYS 486 ? CD  ? N LYS 380 CD  
1168 1 Y 1 N LYS 486 ? CE  ? N LYS 380 CE  
1169 1 Y 1 N LYS 486 ? NZ  ? N LYS 380 NZ  
1170 1 Y 1 N LYS 492 ? CG  ? N LYS 386 CG  
1171 1 Y 1 N LYS 492 ? CD  ? N LYS 386 CD  
1172 1 Y 1 N LYS 492 ? CE  ? N LYS 386 CE  
1173 1 Y 1 N LYS 492 ? NZ  ? N LYS 386 NZ  
1174 1 Y 1 N ARG 528 ? CG  ? N ARG 422 CG  
1175 1 Y 1 N ARG 528 ? CD  ? N ARG 422 CD  
1176 1 Y 1 N ARG 528 ? NE  ? N ARG 422 NE  
1177 1 Y 1 N ARG 528 ? CZ  ? N ARG 422 CZ  
1178 1 Y 1 N ARG 528 ? NH1 ? N ARG 422 NH1 
1179 1 Y 1 N ARG 528 ? NH2 ? N ARG 422 NH2 
1180 1 Y 1 N GLN 536 ? CG  ? N GLN 430 CG  
1181 1 Y 1 N GLN 536 ? CD  ? N GLN 430 CD  
1182 1 Y 1 N GLN 536 ? OE1 ? N GLN 430 OE1 
1183 1 Y 1 N GLN 536 ? NE2 ? N GLN 430 NE2 
1184 1 Y 1 N ARG 559 ? CG  ? N ARG 453 CG  
1185 1 Y 1 N ARG 559 ? CD  ? N ARG 453 CD  
1186 1 Y 1 N ARG 559 ? NE  ? N ARG 453 NE  
1187 1 Y 1 N ARG 559 ? CZ  ? N ARG 453 CZ  
1188 1 Y 1 N ARG 559 ? NH1 ? N ARG 453 NH1 
1189 1 Y 1 N ARG 559 ? NH2 ? N ARG 453 NH2 
1190 1 Y 1 N LYS 596 ? CG  ? N LYS 490 CG  
1191 1 Y 1 N LYS 596 ? CD  ? N LYS 490 CD  
1192 1 Y 1 N LYS 596 ? CE  ? N LYS 490 CE  
1193 1 Y 1 N LYS 596 ? NZ  ? N LYS 490 NZ  
1194 1 Y 1 O LYS 185 ? CG  ? O LYS 79  CG  
1195 1 Y 1 O LYS 185 ? CD  ? O LYS 79  CD  
1196 1 Y 1 O LYS 185 ? CE  ? O LYS 79  CE  
1197 1 Y 1 O LYS 185 ? NZ  ? O LYS 79  NZ  
1198 1 Y 1 O LYS 230 ? CG  ? O LYS 124 CG  
1199 1 Y 1 O LYS 230 ? CD  ? O LYS 124 CD  
1200 1 Y 1 O LYS 230 ? CE  ? O LYS 124 CE  
1201 1 Y 1 O LYS 230 ? NZ  ? O LYS 124 NZ  
1202 1 Y 1 O GLU 277 ? CG  ? O GLU 171 CG  
1203 1 Y 1 O GLU 277 ? CD  ? O GLU 171 CD  
1204 1 Y 1 O GLU 277 ? OE1 ? O GLU 171 OE1 
1205 1 Y 1 O GLU 277 ? OE2 ? O GLU 171 OE2 
1206 1 Y 1 O GLU 281 ? CG  ? O GLU 175 CG  
1207 1 Y 1 O GLU 281 ? CD  ? O GLU 175 CD  
1208 1 Y 1 O GLU 281 ? OE1 ? O GLU 175 OE1 
1209 1 Y 1 O GLU 281 ? OE2 ? O GLU 175 OE2 
1210 1 Y 1 O LYS 288 ? CG  ? O LYS 182 CG  
1211 1 Y 1 O LYS 288 ? CD  ? O LYS 182 CD  
1212 1 Y 1 O LYS 288 ? CE  ? O LYS 182 CE  
1213 1 Y 1 O LYS 288 ? NZ  ? O LYS 182 NZ  
1214 1 Y 1 O GLN 326 ? CG  ? O GLN 220 CG  
1215 1 Y 1 O GLN 326 ? CD  ? O GLN 220 CD  
1216 1 Y 1 O GLN 326 ? OE1 ? O GLN 220 OE1 
1217 1 Y 1 O GLN 326 ? NE2 ? O GLN 220 NE2 
1218 1 Y 1 O LYS 405 ? CG  ? O LYS 299 CG  
1219 1 Y 1 O LYS 405 ? CD  ? O LYS 299 CD  
1220 1 Y 1 O LYS 405 ? CE  ? O LYS 299 CE  
1221 1 Y 1 O LYS 405 ? NZ  ? O LYS 299 NZ  
1222 1 Y 1 O LYS 406 ? CG  ? O LYS 300 CG  
1223 1 Y 1 O LYS 406 ? CD  ? O LYS 300 CD  
1224 1 Y 1 O LYS 406 ? CE  ? O LYS 300 CE  
1225 1 Y 1 O LYS 406 ? NZ  ? O LYS 300 NZ  
1226 1 Y 1 O ARG 408 ? CG  ? O ARG 302 CG  
1227 1 Y 1 O ARG 408 ? CD  ? O ARG 302 CD  
1228 1 Y 1 O ARG 408 ? NE  ? O ARG 302 NE  
1229 1 Y 1 O ARG 408 ? CZ  ? O ARG 302 CZ  
1230 1 Y 1 O ARG 408 ? NH1 ? O ARG 302 NH1 
1231 1 Y 1 O ARG 408 ? NH2 ? O ARG 302 NH2 
1232 1 Y 1 O LYS 437 ? CG  ? O LYS 331 CG  
1233 1 Y 1 O LYS 437 ? CD  ? O LYS 331 CD  
1234 1 Y 1 O LYS 437 ? CE  ? O LYS 331 CE  
1235 1 Y 1 O LYS 437 ? NZ  ? O LYS 331 NZ  
1236 1 Y 1 O GLN 465 ? CG  ? O GLN 359 CG  
1237 1 Y 1 O GLN 465 ? CD  ? O GLN 359 CD  
1238 1 Y 1 O GLN 465 ? OE1 ? O GLN 359 OE1 
1239 1 Y 1 O GLN 465 ? NE2 ? O GLN 359 NE2 
1240 1 Y 1 O LYS 467 ? CG  ? O LYS 361 CG  
1241 1 Y 1 O LYS 467 ? CD  ? O LYS 361 CD  
1242 1 Y 1 O LYS 467 ? CE  ? O LYS 361 CE  
1243 1 Y 1 O LYS 467 ? NZ  ? O LYS 361 NZ  
1244 1 Y 1 O LYS 469 ? CG  ? O LYS 363 CG  
1245 1 Y 1 O LYS 469 ? CD  ? O LYS 363 CD  
1246 1 Y 1 O LYS 469 ? CE  ? O LYS 363 CE  
1247 1 Y 1 O LYS 469 ? NZ  ? O LYS 363 NZ  
1248 1 Y 1 O GLU 474 ? CG  ? O GLU 368 CG  
1249 1 Y 1 O GLU 474 ? CD  ? O GLU 368 CD  
1250 1 Y 1 O GLU 474 ? OE1 ? O GLU 368 OE1 
1251 1 Y 1 O GLU 474 ? OE2 ? O GLU 368 OE2 
1252 1 Y 1 O LYS 478 ? CG  ? O LYS 372 CG  
1253 1 Y 1 O LYS 478 ? CD  ? O LYS 372 CD  
1254 1 Y 1 O LYS 478 ? CE  ? O LYS 372 CE  
1255 1 Y 1 O LYS 478 ? NZ  ? O LYS 372 NZ  
1256 1 Y 1 O LYS 484 ? CG  ? O LYS 378 CG  
1257 1 Y 1 O LYS 484 ? CD  ? O LYS 378 CD  
1258 1 Y 1 O LYS 484 ? CE  ? O LYS 378 CE  
1259 1 Y 1 O LYS 484 ? NZ  ? O LYS 378 NZ  
1260 1 Y 1 O LYS 486 ? CG  ? O LYS 380 CG  
1261 1 Y 1 O LYS 486 ? CD  ? O LYS 380 CD  
1262 1 Y 1 O LYS 486 ? CE  ? O LYS 380 CE  
1263 1 Y 1 O LYS 486 ? NZ  ? O LYS 380 NZ  
1264 1 Y 1 O LYS 492 ? CG  ? O LYS 386 CG  
1265 1 Y 1 O LYS 492 ? CD  ? O LYS 386 CD  
1266 1 Y 1 O LYS 492 ? CE  ? O LYS 386 CE  
1267 1 Y 1 O LYS 492 ? NZ  ? O LYS 386 NZ  
1268 1 Y 1 O LYS 494 ? CG  ? O LYS 388 CG  
1269 1 Y 1 O LYS 494 ? CD  ? O LYS 388 CD  
1270 1 Y 1 O LYS 494 ? CE  ? O LYS 388 CE  
1271 1 Y 1 O LYS 494 ? NZ  ? O LYS 388 NZ  
1272 1 Y 1 O ARG 559 ? CG  ? O ARG 453 CG  
1273 1 Y 1 O ARG 559 ? CD  ? O ARG 453 CD  
1274 1 Y 1 O ARG 559 ? NE  ? O ARG 453 NE  
1275 1 Y 1 O ARG 559 ? CZ  ? O ARG 453 CZ  
1276 1 Y 1 O ARG 559 ? NH1 ? O ARG 453 NH1 
1277 1 Y 1 O ARG 559 ? NH2 ? O ARG 453 NH2 
1278 1 Y 1 O LYS 560 ? CG  ? O LYS 454 CG  
1279 1 Y 1 O LYS 560 ? CD  ? O LYS 454 CD  
1280 1 Y 1 O LYS 560 ? CE  ? O LYS 454 CE  
1281 1 Y 1 O LYS 560 ? NZ  ? O LYS 454 NZ  
1282 1 Y 1 O LYS 580 ? CG  ? O LYS 474 CG  
1283 1 Y 1 O LYS 580 ? CD  ? O LYS 474 CD  
1284 1 Y 1 O LYS 580 ? CE  ? O LYS 474 CE  
1285 1 Y 1 O LYS 580 ? NZ  ? O LYS 474 NZ  
1286 1 Y 1 O GLN 582 ? CG  ? O GLN 476 CG  
1287 1 Y 1 O GLN 582 ? CD  ? O GLN 476 CD  
1288 1 Y 1 O GLN 582 ? OE1 ? O GLN 476 OE1 
1289 1 Y 1 O GLN 582 ? NE2 ? O GLN 476 NE2 
1290 1 Y 1 O GLN 594 ? CG  ? O GLN 488 CG  
1291 1 Y 1 O GLN 594 ? CD  ? O GLN 488 CD  
1292 1 Y 1 O GLN 594 ? OE1 ? O GLN 488 OE1 
1293 1 Y 1 O GLN 594 ? NE2 ? O GLN 488 NE2 
1294 1 Y 1 P LYS 185 ? CG  ? P LYS 79  CG  
1295 1 Y 1 P LYS 185 ? CD  ? P LYS 79  CD  
1296 1 Y 1 P LYS 185 ? CE  ? P LYS 79  CE  
1297 1 Y 1 P LYS 185 ? NZ  ? P LYS 79  NZ  
1298 1 Y 1 P LYS 230 ? CG  ? P LYS 124 CG  
1299 1 Y 1 P LYS 230 ? CD  ? P LYS 124 CD  
1300 1 Y 1 P LYS 230 ? CE  ? P LYS 124 CE  
1301 1 Y 1 P LYS 230 ? NZ  ? P LYS 124 NZ  
1302 1 Y 1 P ARG 305 ? CG  ? P ARG 199 CG  
1303 1 Y 1 P ARG 305 ? CD  ? P ARG 199 CD  
1304 1 Y 1 P ARG 305 ? NE  ? P ARG 199 NE  
1305 1 Y 1 P ARG 305 ? CZ  ? P ARG 199 CZ  
1306 1 Y 1 P ARG 305 ? NH1 ? P ARG 199 NH1 
1307 1 Y 1 P ARG 305 ? NH2 ? P ARG 199 NH2 
1308 1 Y 1 P GLN 326 ? CG  ? P GLN 220 CG  
1309 1 Y 1 P GLN 326 ? CD  ? P GLN 220 CD  
1310 1 Y 1 P GLN 326 ? OE1 ? P GLN 220 OE1 
1311 1 Y 1 P GLN 326 ? NE2 ? P GLN 220 NE2 
1312 1 Y 1 P GLU 398 ? CG  ? P GLU 292 CG  
1313 1 Y 1 P GLU 398 ? CD  ? P GLU 292 CD  
1314 1 Y 1 P GLU 398 ? OE1 ? P GLU 292 OE1 
1315 1 Y 1 P GLU 398 ? OE2 ? P GLU 292 OE2 
1316 1 Y 1 P LYS 405 ? CG  ? P LYS 299 CG  
1317 1 Y 1 P LYS 405 ? CD  ? P LYS 299 CD  
1318 1 Y 1 P LYS 405 ? CE  ? P LYS 299 CE  
1319 1 Y 1 P LYS 405 ? NZ  ? P LYS 299 NZ  
1320 1 Y 1 P LYS 406 ? CG  ? P LYS 300 CG  
1321 1 Y 1 P LYS 406 ? CD  ? P LYS 300 CD  
1322 1 Y 1 P LYS 406 ? CE  ? P LYS 300 CE  
1323 1 Y 1 P LYS 406 ? NZ  ? P LYS 300 NZ  
1324 1 Y 1 P ARG 408 ? CG  ? P ARG 302 CG  
1325 1 Y 1 P ARG 408 ? CD  ? P ARG 302 CD  
1326 1 Y 1 P ARG 408 ? NE  ? P ARG 302 NE  
1327 1 Y 1 P ARG 408 ? CZ  ? P ARG 302 CZ  
1328 1 Y 1 P ARG 408 ? NH1 ? P ARG 302 NH1 
1329 1 Y 1 P ARG 408 ? NH2 ? P ARG 302 NH2 
1330 1 Y 1 P GLU 417 ? CG  ? P GLU 311 CG  
1331 1 Y 1 P GLU 417 ? CD  ? P GLU 311 CD  
1332 1 Y 1 P GLU 417 ? OE1 ? P GLU 311 OE1 
1333 1 Y 1 P GLU 417 ? OE2 ? P GLU 311 OE2 
1334 1 Y 1 P LYS 421 ? CG  ? P LYS 315 CG  
1335 1 Y 1 P LYS 421 ? CD  ? P LYS 315 CD  
1336 1 Y 1 P LYS 421 ? CE  ? P LYS 315 CE  
1337 1 Y 1 P LYS 421 ? NZ  ? P LYS 315 NZ  
1338 1 Y 1 P LYS 437 ? CG  ? P LYS 331 CG  
1339 1 Y 1 P LYS 437 ? CD  ? P LYS 331 CD  
1340 1 Y 1 P LYS 437 ? CE  ? P LYS 331 CE  
1341 1 Y 1 P LYS 437 ? NZ  ? P LYS 331 NZ  
1342 1 Y 1 P LYS 439 ? CG  ? P LYS 333 CG  
1343 1 Y 1 P LYS 439 ? CD  ? P LYS 333 CD  
1344 1 Y 1 P LYS 439 ? CE  ? P LYS 333 CE  
1345 1 Y 1 P LYS 439 ? NZ  ? P LYS 333 NZ  
1346 1 Y 1 P GLN 461 ? CG  ? P GLN 355 CG  
1347 1 Y 1 P GLN 461 ? CD  ? P GLN 355 CD  
1348 1 Y 1 P GLN 461 ? OE1 ? P GLN 355 OE1 
1349 1 Y 1 P GLN 461 ? NE2 ? P GLN 355 NE2 
1350 1 Y 1 P GLN 465 ? CG  ? P GLN 359 CG  
1351 1 Y 1 P GLN 465 ? CD  ? P GLN 359 CD  
1352 1 Y 1 P GLN 465 ? OE1 ? P GLN 359 OE1 
1353 1 Y 1 P GLN 465 ? NE2 ? P GLN 359 NE2 
1354 1 Y 1 P LYS 467 ? CG  ? P LYS 361 CG  
1355 1 Y 1 P LYS 467 ? CD  ? P LYS 361 CD  
1356 1 Y 1 P LYS 467 ? CE  ? P LYS 361 CE  
1357 1 Y 1 P LYS 467 ? NZ  ? P LYS 361 NZ  
1358 1 Y 1 P LYS 469 ? CG  ? P LYS 363 CG  
1359 1 Y 1 P LYS 469 ? CD  ? P LYS 363 CD  
1360 1 Y 1 P LYS 469 ? CE  ? P LYS 363 CE  
1361 1 Y 1 P LYS 469 ? NZ  ? P LYS 363 NZ  
1362 1 Y 1 P ARG 470 ? CG  ? P ARG 364 CG  
1363 1 Y 1 P ARG 470 ? CD  ? P ARG 364 CD  
1364 1 Y 1 P ARG 470 ? NE  ? P ARG 364 NE  
1365 1 Y 1 P ARG 470 ? CZ  ? P ARG 364 CZ  
1366 1 Y 1 P ARG 470 ? NH1 ? P ARG 364 NH1 
1367 1 Y 1 P ARG 470 ? NH2 ? P ARG 364 NH2 
1368 1 Y 1 P GLU 471 ? CG  ? P GLU 365 CG  
1369 1 Y 1 P GLU 471 ? CD  ? P GLU 365 CD  
1370 1 Y 1 P GLU 471 ? OE1 ? P GLU 365 OE1 
1371 1 Y 1 P GLU 471 ? OE2 ? P GLU 365 OE2 
1372 1 Y 1 P GLU 474 ? CG  ? P GLU 368 CG  
1373 1 Y 1 P GLU 474 ? CD  ? P GLU 368 CD  
1374 1 Y 1 P GLU 474 ? OE1 ? P GLU 368 OE1 
1375 1 Y 1 P GLU 474 ? OE2 ? P GLU 368 OE2 
1376 1 Y 1 P LYS 478 ? CG  ? P LYS 372 CG  
1377 1 Y 1 P LYS 478 ? CD  ? P LYS 372 CD  
1378 1 Y 1 P LYS 478 ? CE  ? P LYS 372 CE  
1379 1 Y 1 P LYS 478 ? NZ  ? P LYS 372 NZ  
1380 1 Y 1 P LYS 484 ? CG  ? P LYS 378 CG  
1381 1 Y 1 P LYS 484 ? CD  ? P LYS 378 CD  
1382 1 Y 1 P LYS 484 ? CE  ? P LYS 378 CE  
1383 1 Y 1 P LYS 484 ? NZ  ? P LYS 378 NZ  
1384 1 Y 1 P LYS 486 ? CG  ? P LYS 380 CG  
1385 1 Y 1 P LYS 486 ? CD  ? P LYS 380 CD  
1386 1 Y 1 P LYS 486 ? CE  ? P LYS 380 CE  
1387 1 Y 1 P LYS 486 ? NZ  ? P LYS 380 NZ  
1388 1 Y 1 P LYS 492 ? CG  ? P LYS 386 CG  
1389 1 Y 1 P LYS 492 ? CD  ? P LYS 386 CD  
1390 1 Y 1 P LYS 492 ? CE  ? P LYS 386 CE  
1391 1 Y 1 P LYS 492 ? NZ  ? P LYS 386 NZ  
1392 1 Y 1 P LYS 494 ? CG  ? P LYS 388 CG  
1393 1 Y 1 P LYS 494 ? CD  ? P LYS 388 CD  
1394 1 Y 1 P LYS 494 ? CE  ? P LYS 388 CE  
1395 1 Y 1 P LYS 494 ? NZ  ? P LYS 388 NZ  
1396 1 Y 1 P GLU 496 ? CG  ? P GLU 390 CG  
1397 1 Y 1 P GLU 496 ? CD  ? P GLU 390 CD  
1398 1 Y 1 P GLU 496 ? OE1 ? P GLU 390 OE1 
1399 1 Y 1 P GLU 496 ? OE2 ? P GLU 390 OE2 
1400 1 Y 1 P ARG 559 ? CG  ? P ARG 453 CG  
1401 1 Y 1 P ARG 559 ? CD  ? P ARG 453 CD  
1402 1 Y 1 P ARG 559 ? NE  ? P ARG 453 NE  
1403 1 Y 1 P ARG 559 ? CZ  ? P ARG 453 CZ  
1404 1 Y 1 P ARG 559 ? NH1 ? P ARG 453 NH1 
1405 1 Y 1 P ARG 559 ? NH2 ? P ARG 453 NH2 
1406 1 Y 1 P LYS 560 ? CG  ? P LYS 454 CG  
1407 1 Y 1 P LYS 560 ? CD  ? P LYS 454 CD  
1408 1 Y 1 P LYS 560 ? CE  ? P LYS 454 CE  
1409 1 Y 1 P LYS 560 ? NZ  ? P LYS 454 NZ  
1410 1 Y 1 P ARG 566 ? CG  ? P ARG 460 CG  
1411 1 Y 1 P ARG 566 ? CD  ? P ARG 460 CD  
1412 1 Y 1 P ARG 566 ? NE  ? P ARG 460 NE  
1413 1 Y 1 P ARG 566 ? CZ  ? P ARG 460 CZ  
1414 1 Y 1 P ARG 566 ? NH1 ? P ARG 460 NH1 
1415 1 Y 1 P ARG 566 ? NH2 ? P ARG 460 NH2 
1416 1 Y 1 P GLN 571 ? CG  ? P GLN 465 CG  
1417 1 Y 1 P GLN 571 ? CD  ? P GLN 465 CD  
1418 1 Y 1 P GLN 571 ? OE1 ? P GLN 465 OE1 
1419 1 Y 1 P GLN 571 ? NE2 ? P GLN 465 NE2 
1420 1 Y 1 P LYS 580 ? CG  ? P LYS 474 CG  
1421 1 Y 1 P LYS 580 ? CD  ? P LYS 474 CD  
1422 1 Y 1 P LYS 580 ? CE  ? P LYS 474 CE  
1423 1 Y 1 P LYS 580 ? NZ  ? P LYS 474 NZ  
1424 1 Y 1 P GLN 582 ? CG  ? P GLN 476 CG  
1425 1 Y 1 P GLN 582 ? CD  ? P GLN 476 CD  
1426 1 Y 1 P GLN 582 ? OE1 ? P GLN 476 OE1 
1427 1 Y 1 P GLN 582 ? NE2 ? P GLN 476 NE2 
1428 1 Y 1 P GLN 594 ? CG  ? P GLN 488 CG  
1429 1 Y 1 P GLN 594 ? CD  ? P GLN 488 CD  
1430 1 Y 1 P GLN 594 ? OE1 ? P GLN 488 OE1 
1431 1 Y 1 P GLN 594 ? NE2 ? P GLN 488 NE2 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.7.4    2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? STARANISO   ? ? ? .        3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.7.17   4 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0158 5 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25     6 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.310 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6TXE 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     97.482 
_cell.length_a_esd                 ? 
_cell.length_b                     172.232 
_cell.length_b_esd                 ? 
_cell.length_c                     275.271 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        32 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6TXE 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6TXE 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.61 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Bistris methane-HCl pH 6, 19% (w/v) PEG 3350, 0.15 M Li2SO4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97950 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97950 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            50.1 
_reflns.entry_id                         6TXE 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.186 
_reflns.d_resolution_low                 91.364 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       80315 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             91.364 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.0 
_reflns.pdbx_Rmerge_I_obs                0.433 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.467 
_reflns.pdbx_Rpim_I_all                  0.175 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.960 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
3.186  3.630  ? 1.7  ? ? ? ? 4016 76.2 ? ? ? ? 1.161 ? ? ? ? ? ? ? ? 6.7 ? ? ? ? 1.257 0.476 ? 1 1 0.668 ? ? 
10.672 91.364 ? 16.1 ? ? ? ? 4014 96.7 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 6.8 ? ? ? ? 0.087 0.033 ? 2 1 0.996 ? ? 
# 
_refine.aniso_B[1][1]                            -1.3300 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.6200 
_refine.aniso_B[2][2]                            3.5200 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -2.2700 
_refine.B_iso_max                                204.000 
_refine.B_iso_mean                               64.6920 
_refine.B_iso_min                                15.100 
_refine.correlation_coeff_Fo_to_Fc               0.8740 
_refine.correlation_coeff_Fo_to_Fc_free          0.7980 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6TXE 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.1900 
_refine.ls_d_res_low                             91.2200 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     76240 
_refine.ls_number_reflns_R_free                  4073 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    53.3500 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2196 
_refine.ls_R_factor_R_free                       0.2518 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2179 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6TXA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.9140 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             78.2170 
_refine.overall_SU_ML                            0.5640 
_refine.overall_SU_R_Cruickshank_DPI             0.7955 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.1900 
_refine_hist.d_res_low                        91.2200 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               62675 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       7654 
_refine_hist.pdbx_B_iso_mean_ligand           50.73 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        61116 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1559 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.019  64182  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  57427  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.411  1.972  87377  ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.008  2.995  132956 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 5.502  5.000  7623   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 35.696 23.986 3096   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 14.018 15.000 10439  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 15.255 15.000 396    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.073  0.200  9398   ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  70642  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  13306  ? r_gen_planes_other     ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 1   'interatomic distance' ? A 31922 ? ? 1   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 2   'interatomic distance' ? B 31922 ? ? 1   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 3   'interatomic distance' ? A 31872 ? ? 2   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 4   'interatomic distance' ? C 31872 ? ? 2   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 5   'interatomic distance' ? A 31930 ? ? 3   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 6   'interatomic distance' ? D 31930 ? ? 3   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 7   'interatomic distance' ? A 31958 ? ? 4   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 8   'interatomic distance' ? E 31958 ? ? 4   
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 9   'interatomic distance' ? A 31864 ? ? 5   
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 10  'interatomic distance' ? F 31864 ? ? 5   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 11  'interatomic distance' ? A 31672 ? ? 6   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 12  'interatomic distance' ? G 31672 ? ? 6   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 13  'interatomic distance' ? A 31980 ? ? 7   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 14  'interatomic distance' ? H 31980 ? ? 7   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 15  'interatomic distance' ? A 31738 ? ? 8   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 16  'interatomic distance' ? I 31738 ? ? 8   
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 17  'interatomic distance' ? A 31654 ? ? 9   
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 18  'interatomic distance' ? J 31654 ? ? 9   
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 19  'interatomic distance' ? A 31958 ? ? 10  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 20  'interatomic distance' ? K 31958 ? ? 10  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 21  'interatomic distance' ? A 31474 ? ? 11  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 22  'interatomic distance' ? L 31474 ? ? 11  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 23  'interatomic distance' ? A 31262 ? ? 12  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 24  'interatomic distance' ? M 31262 ? ? 12  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 25  'interatomic distance' ? A 31710 ? ? 13  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 26  'interatomic distance' ? N 31710 ? ? 13  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 27  'interatomic distance' ? A 31398 ? ? 14  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 28  'interatomic distance' ? O 31398 ? ? 14  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 29  'interatomic distance' ? A 31174 ? ? 15  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 30  'interatomic distance' ? P 31174 ? ? 15  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 31  'interatomic distance' ? B 31740 ? ? 16  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 32  'interatomic distance' ? C 31740 ? ? 16  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 33  'interatomic distance' ? B 31850 ? ? 17  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 34  'interatomic distance' ? D 31850 ? ? 17  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 35  'interatomic distance' ? B 31966 ? ? 18  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 36  'interatomic distance' ? E 31966 ? ? 18  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 37  'interatomic distance' ? B 31522 ? ? 19  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 38  'interatomic distance' ? F 31522 ? ? 19  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 39  'interatomic distance' ? B 31730 ? ? 20  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 40  'interatomic distance' ? G 31730 ? ? 20  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 41  'interatomic distance' ? B 31866 ? ? 21  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 42  'interatomic distance' ? H 31866 ? ? 21  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 43  'interatomic distance' ? B 31722 ? ? 22  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 44  'interatomic distance' ? I 31722 ? ? 22  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 45  'interatomic distance' ? B 31586 ? ? 23  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 46  'interatomic distance' ? J 31586 ? ? 23  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 47  'interatomic distance' ? B 31662 ? ? 24  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 48  'interatomic distance' ? K 31662 ? ? 24  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 49  'interatomic distance' ? B 31370 ? ? 25  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 50  'interatomic distance' ? L 31370 ? ? 25  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 51  'interatomic distance' ? B 31248 ? ? 26  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 52  'interatomic distance' ? M 31248 ? ? 26  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 53  'interatomic distance' ? B 31630 ? ? 27  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 54  'interatomic distance' ? N 31630 ? ? 27  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 55  'interatomic distance' ? B 31444 ? ? 28  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 56  'interatomic distance' ? O 31444 ? ? 28  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 57  'interatomic distance' ? B 31038 ? ? 29  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 58  'interatomic distance' ? P 31038 ? ? 29  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 59  'interatomic distance' ? C 31780 ? ? 30  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 60  'interatomic distance' ? D 31780 ? ? 30  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 61  'interatomic distance' ? C 31920 ? ? 31  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 62  'interatomic distance' ? E 31920 ? ? 31  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 63  'interatomic distance' ? C 31724 ? ? 32  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 64  'interatomic distance' ? F 31724 ? ? 32  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 65  'interatomic distance' ? C 31542 ? ? 33  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 66  'interatomic distance' ? G 31542 ? ? 33  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 67  'interatomic distance' ? C 31946 ? ? 34  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 68  'interatomic distance' ? H 31946 ? ? 34  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 69  'interatomic distance' ? C 31830 ? ? 35  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 70  'interatomic distance' ? I 31830 ? ? 35  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 71  'interatomic distance' ? C 31762 ? ? 36  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 72  'interatomic distance' ? J 31762 ? ? 36  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 73  'interatomic distance' ? C 31946 ? ? 37  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 74  'interatomic distance' ? K 31946 ? ? 37  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 75  'interatomic distance' ? C 31588 ? ? 38  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 76  'interatomic distance' ? L 31588 ? ? 38  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 77  'interatomic distance' ? C 31328 ? ? 39  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 78  'interatomic distance' ? M 31328 ? ? 39  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 79  'interatomic distance' ? C 31754 ? ? 40  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 80  'interatomic distance' ? N 31754 ? ? 40  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 81  'interatomic distance' ? C 31346 ? ? 41  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 82  'interatomic distance' ? O 31346 ? ? 41  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 83  'interatomic distance' ? C 31026 ? ? 42  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 84  'interatomic distance' ? P 31026 ? ? 42  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 85  'interatomic distance' ? D 31976 ? ? 43  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 86  'interatomic distance' ? E 31976 ? ? 43  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 87  'interatomic distance' ? D 31784 ? ? 44  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 88  'interatomic distance' ? F 31784 ? ? 44  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 89  'interatomic distance' ? D 31854 ? ? 45  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 90  'interatomic distance' ? G 31854 ? ? 45  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 91  'interatomic distance' ? D 31924 ? ? 46  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 92  'interatomic distance' ? H 31924 ? ? 46  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 93  'interatomic distance' ? D 31808 ? ? 47  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 94  'interatomic distance' ? I 31808 ? ? 47  
'X-RAY DIFFRACTION' 1 ? ? 0.020 ? 0.050 95  'interatomic distance' ? D 31862 ? ? 48  
'X-RAY DIFFRACTION' 2 ? ? 0.020 ? 0.050 96  'interatomic distance' ? J 31862 ? ? 48  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 97  'interatomic distance' ? D 31826 ? ? 49  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 98  'interatomic distance' ? K 31826 ? ? 49  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 99  'interatomic distance' ? D 31654 ? ? 50  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 100 'interatomic distance' ? L 31654 ? ? 50  
'X-RAY DIFFRACTION' 1 ? ? 0.020 ? 0.050 101 'interatomic distance' ? D 31454 ? ? 51  
'X-RAY DIFFRACTION' 2 ? ? 0.020 ? 0.050 102 'interatomic distance' ? M 31454 ? ? 51  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 103 'interatomic distance' ? D 31662 ? ? 52  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 104 'interatomic distance' ? N 31662 ? ? 52  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 105 'interatomic distance' ? D 31518 ? ? 53  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 106 'interatomic distance' ? O 31518 ? ? 53  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 107 'interatomic distance' ? D 31118 ? ? 54  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 108 'interatomic distance' ? P 31118 ? ? 54  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 109 'interatomic distance' ? E 31644 ? ? 55  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 110 'interatomic distance' ? F 31644 ? ? 55  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 111 'interatomic distance' ? E 31710 ? ? 56  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 112 'interatomic distance' ? G 31710 ? ? 56  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 113 'interatomic distance' ? E 31984 ? ? 57  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 114 'interatomic distance' ? H 31984 ? ? 57  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 115 'interatomic distance' ? E 31816 ? ? 58  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 116 'interatomic distance' ? I 31816 ? ? 58  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 117 'interatomic distance' ? E 31732 ? ? 59  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 118 'interatomic distance' ? J 31732 ? ? 59  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 119 'interatomic distance' ? E 31882 ? ? 60  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 120 'interatomic distance' ? K 31882 ? ? 60  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 121 'interatomic distance' ? E 31602 ? ? 61  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 122 'interatomic distance' ? L 31602 ? ? 61  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 123 'interatomic distance' ? E 31340 ? ? 62  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 124 'interatomic distance' ? M 31340 ? ? 62  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 125 'interatomic distance' ? E 31788 ? ? 63  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 126 'interatomic distance' ? N 31788 ? ? 63  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 127 'interatomic distance' ? E 31482 ? ? 64  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 128 'interatomic distance' ? O 31482 ? ? 64  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 129 'interatomic distance' ? E 31090 ? ? 65  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 130 'interatomic distance' ? P 31090 ? ? 65  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 131 'interatomic distance' ? F 31794 ? ? 66  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 132 'interatomic distance' ? G 31794 ? ? 66  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 133 'interatomic distance' ? F 31704 ? ? 67  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 134 'interatomic distance' ? H 31704 ? ? 67  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 135 'interatomic distance' ? F 31396 ? ? 68  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 136 'interatomic distance' ? I 31396 ? ? 68  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 137 'interatomic distance' ? F 31660 ? ? 69  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 138 'interatomic distance' ? J 31660 ? ? 69  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 139 'interatomic distance' ? F 31740 ? ? 70  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 140 'interatomic distance' ? K 31740 ? ? 70  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 141 'interatomic distance' ? F 31390 ? ? 71  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 142 'interatomic distance' ? L 31390 ? ? 71  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 143 'interatomic distance' ? F 31368 ? ? 72  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 144 'interatomic distance' ? M 31368 ? ? 72  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 145 'interatomic distance' ? F 31378 ? ? 73  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 146 'interatomic distance' ? N 31378 ? ? 73  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 147 'interatomic distance' ? F 31514 ? ? 74  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 148 'interatomic distance' ? O 31514 ? ? 74  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 149 'interatomic distance' ? F 31176 ? ? 75  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 150 'interatomic distance' ? P 31176 ? ? 75  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 151 'interatomic distance' ? G 31626 ? ? 76  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 152 'interatomic distance' ? H 31626 ? ? 76  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 153 'interatomic distance' ? G 31604 ? ? 77  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 154 'interatomic distance' ? I 31604 ? ? 77  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 155 'interatomic distance' ? G 31602 ? ? 78  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 156 'interatomic distance' ? J 31602 ? ? 78  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 157 'interatomic distance' ? G 31492 ? ? 79  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 158 'interatomic distance' ? K 31492 ? ? 79  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 159 'interatomic distance' ? G 31268 ? ? 80  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 160 'interatomic distance' ? L 31268 ? ? 80  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 161 'interatomic distance' ? G 31408 ? ? 81  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 162 'interatomic distance' ? M 31408 ? ? 81  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 163 'interatomic distance' ? G 31492 ? ? 82  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 164 'interatomic distance' ? N 31492 ? ? 82  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 165 'interatomic distance' ? G 31418 ? ? 83  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 166 'interatomic distance' ? O 31418 ? ? 83  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 167 'interatomic distance' ? G 31132 ? ? 84  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 168 'interatomic distance' ? P 31132 ? ? 84  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 169 'interatomic distance' ? H 31936 ? ? 85  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 170 'interatomic distance' ? I 31936 ? ? 85  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 171 'interatomic distance' ? H 31662 ? ? 86  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 172 'interatomic distance' ? J 31662 ? ? 86  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 173 'interatomic distance' ? H 31818 ? ? 87  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 174 'interatomic distance' ? K 31818 ? ? 87  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 175 'interatomic distance' ? H 31576 ? ? 88  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 176 'interatomic distance' ? L 31576 ? ? 88  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 177 'interatomic distance' ? H 31286 ? ? 89  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 178 'interatomic distance' ? M 31286 ? ? 89  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 179 'interatomic distance' ? H 31832 ? ? 90  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 180 'interatomic distance' ? N 31832 ? ? 90  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 181 'interatomic distance' ? H 31408 ? ? 91  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 182 'interatomic distance' ? O 31408 ? ? 91  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 183 'interatomic distance' ? H 31072 ? ? 92  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 184 'interatomic distance' ? P 31072 ? ? 92  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 185 'interatomic distance' ? I 31742 ? ? 93  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 186 'interatomic distance' ? J 31742 ? ? 93  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 187 'interatomic distance' ? I 31720 ? ? 94  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 188 'interatomic distance' ? K 31720 ? ? 94  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 189 'interatomic distance' ? I 31554 ? ? 95  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 190 'interatomic distance' ? L 31554 ? ? 95  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 191 'interatomic distance' ? I 31436 ? ? 96  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 192 'interatomic distance' ? M 31436 ? ? 96  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 193 'interatomic distance' ? I 31812 ? ? 97  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 194 'interatomic distance' ? N 31812 ? ? 97  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 195 'interatomic distance' ? I 31304 ? ? 98  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 196 'interatomic distance' ? O 31304 ? ? 98  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 197 'interatomic distance' ? I 30878 ? ? 99  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 198 'interatomic distance' ? P 30878 ? ? 99  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 199 'interatomic distance' ? J 31782 ? ? 100 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 200 'interatomic distance' ? K 31782 ? ? 100 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 201 'interatomic distance' ? J 31558 ? ? 101 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 202 'interatomic distance' ? L 31558 ? ? 101 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 203 'interatomic distance' ? J 31432 ? ? 102 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 204 'interatomic distance' ? M 31432 ? ? 102 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 205 'interatomic distance' ? J 31648 ? ? 103 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 206 'interatomic distance' ? N 31648 ? ? 103 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 207 'interatomic distance' ? J 31384 ? ? 104 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 208 'interatomic distance' ? O 31384 ? ? 104 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 209 'interatomic distance' ? J 31122 ? ? 105 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 210 'interatomic distance' ? P 31122 ? ? 105 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 211 'interatomic distance' ? K 31592 ? ? 106 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 212 'interatomic distance' ? L 31592 ? ? 106 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 213 'interatomic distance' ? K 31348 ? ? 107 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 214 'interatomic distance' ? M 31348 ? ? 107 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 215 'interatomic distance' ? K 31704 ? ? 108 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 216 'interatomic distance' ? N 31704 ? ? 108 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 217 'interatomic distance' ? K 31320 ? ? 109 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 218 'interatomic distance' ? O 31320 ? ? 109 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 219 'interatomic distance' ? K 31124 ? ? 110 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 220 'interatomic distance' ? P 31124 ? ? 110 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 221 'interatomic distance' ? L 31124 ? ? 111 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 222 'interatomic distance' ? M 31124 ? ? 111 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 223 'interatomic distance' ? L 31444 ? ? 112 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 224 'interatomic distance' ? N 31444 ? ? 112 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 225 'interatomic distance' ? L 31282 ? ? 113 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 226 'interatomic distance' ? O 31282 ? ? 113 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 227 'interatomic distance' ? L 30868 ? ? 114 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 228 'interatomic distance' ? P 30868 ? ? 114 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 229 'interatomic distance' ? M 31352 ? ? 115 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 230 'interatomic distance' ? N 31352 ? ? 115 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 231 'interatomic distance' ? M 31066 ? ? 116 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 232 'interatomic distance' ? O 31066 ? ? 116 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 233 'interatomic distance' ? M 30758 ? ? 117 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 234 'interatomic distance' ? P 30758 ? ? 117 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 235 'interatomic distance' ? N 31218 ? ? 118 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 236 'interatomic distance' ? O 31218 ? ? 118 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 237 'interatomic distance' ? N 30938 ? ? 119 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 238 'interatomic distance' ? P 30938 ? ? 119 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 239 'interatomic distance' ? O 31098 ? ? 120 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 240 'interatomic distance' ? P 31098 ? ? 120 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.1900 
_refine_ls_shell.d_res_low                        3.2730 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             13 
_refine_ls_shell.number_reflns_R_work             146 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.4320 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3350 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1   1 A 
1   2 B 
2   1 A 
2   2 C 
3   1 A 
3   2 D 
4   1 A 
4   2 E 
5   1 A 
5   2 F 
6   1 A 
6   2 G 
7   1 A 
7   2 H 
8   1 A 
8   2 I 
9   1 A 
9   2 J 
10  1 A 
10  2 K 
11  1 A 
11  2 L 
12  1 A 
12  2 M 
13  1 A 
13  2 N 
14  1 A 
14  2 O 
15  1 A 
15  2 P 
16  1 B 
16  2 C 
17  1 B 
17  2 D 
18  1 B 
18  2 E 
19  1 B 
19  2 F 
20  1 B 
20  2 G 
21  1 B 
21  2 H 
22  1 B 
22  2 I 
23  1 B 
23  2 J 
24  1 B 
24  2 K 
25  1 B 
25  2 L 
26  1 B 
26  2 M 
27  1 B 
27  2 N 
28  1 B 
28  2 O 
29  1 B 
29  2 P 
30  1 C 
30  2 D 
31  1 C 
31  2 E 
32  1 C 
32  2 F 
33  1 C 
33  2 G 
34  1 C 
34  2 H 
35  1 C 
35  2 I 
36  1 C 
36  2 J 
37  1 C 
37  2 K 
38  1 C 
38  2 L 
39  1 C 
39  2 M 
40  1 C 
40  2 N 
41  1 C 
41  2 O 
42  1 C 
42  2 P 
43  1 D 
43  2 E 
44  1 D 
44  2 F 
45  1 D 
45  2 G 
46  1 D 
46  2 H 
47  1 D 
47  2 I 
48  1 D 
48  2 J 
49  1 D 
49  2 K 
50  1 D 
50  2 L 
51  1 D 
51  2 M 
52  1 D 
52  2 N 
53  1 D 
53  2 O 
54  1 D 
54  2 P 
55  1 E 
55  2 F 
56  1 E 
56  2 G 
57  1 E 
57  2 H 
58  1 E 
58  2 I 
59  1 E 
59  2 J 
60  1 E 
60  2 K 
61  1 E 
61  2 L 
62  1 E 
62  2 M 
63  1 E 
63  2 N 
64  1 E 
64  2 O 
65  1 E 
65  2 P 
66  1 F 
66  2 G 
67  1 F 
67  2 H 
68  1 F 
68  2 I 
69  1 F 
69  2 J 
70  1 F 
70  2 K 
71  1 F 
71  2 L 
72  1 F 
72  2 M 
73  1 F 
73  2 N 
74  1 F 
74  2 O 
75  1 F 
75  2 P 
76  1 G 
76  2 H 
77  1 G 
77  2 I 
78  1 G 
78  2 J 
79  1 G 
79  2 K 
80  1 G 
80  2 L 
81  1 G 
81  2 M 
82  1 G 
82  2 N 
83  1 G 
83  2 O 
84  1 G 
84  2 P 
85  1 H 
85  2 I 
86  1 H 
86  2 J 
87  1 H 
87  2 K 
88  1 H 
88  2 L 
89  1 H 
89  2 M 
90  1 H 
90  2 N 
91  1 H 
91  2 O 
92  1 H 
92  2 P 
93  1 I 
93  2 J 
94  1 I 
94  2 K 
95  1 I 
95  2 L 
96  1 I 
96  2 M 
97  1 I 
97  2 N 
98  1 I 
98  2 O 
99  1 I 
99  2 P 
100 1 J 
100 2 K 
101 1 J 
101 2 L 
102 1 J 
102 2 M 
103 1 J 
103 2 N 
104 1 J 
104 2 O 
105 1 J 
105 2 P 
106 1 K 
106 2 L 
107 1 K 
107 2 M 
108 1 K 
108 2 N 
109 1 K 
109 2 O 
110 1 K 
110 2 P 
111 1 L 
111 2 M 
112 1 L 
112 2 N 
113 1 L 
113 2 O 
114 1 L 
114 2 P 
115 1 M 
115 2 N 
116 1 M 
116 2 O 
117 1 M 
117 2 P 
118 1 N 
118 2 O 
119 1 N 
119 2 P 
120 1 O 
120 2 P 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_comp_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_comp_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.selection_details 
1   1 0 A THR 8 . A ASN 493 . A THR 114 A ASN 599 0 ? 
1   2 0 B THR 8 . B ASN 493 . B THR 114 B ASN 599 0 ? 
2   1 0 A MET 9 . A ASN 493 . A MET 115 A ASN 599 0 ? 
2   2 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
3   1 0 A THR 8 . A ASN 493 . A THR 114 A ASN 599 0 ? 
3   2 0 D THR 8 . D ASN 493 . D THR 114 D ASN 599 0 ? 
4   1 0 A THR 8 . A ASN 493 . A THR 114 A ASN 599 0 ? 
4   2 0 E THR 8 . E ASN 493 . E THR 114 E ASN 599 0 ? 
5   1 0 A THR 8 . A TRP 492 . A THR 114 A TRP 598 0 ? 
5   2 0 F THR 8 . F TRP 492 . F THR 114 F TRP 598 0 ? 
6   1 0 A THR 8 . A GLU 491 . A THR 114 A GLU 597 0 ? 
6   2 0 G THR 8 . G GLU 491 . G THR 114 G GLU 597 0 ? 
7   1 0 A THR 8 . A ASN 493 . A THR 114 A ASN 599 0 ? 
7   2 0 H THR 8 . H ASN 493 . H THR 114 H ASN 599 0 ? 
8   1 0 A MET 9 . A ASN 493 . A MET 115 A ASN 599 0 ? 
8   2 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
9   1 0 A MET 9 . A GLU 491 . A MET 115 A GLU 597 0 ? 
9   2 0 J MET 9 . J GLU 491 . J MET 115 J GLU 597 0 ? 
10  1 0 A MET 9 . A ASN 493 . A MET 115 A ASN 599 0 ? 
10  2 0 K MET 9 . K ASN 493 . K MET 115 K ASN 599 0 ? 
11  1 0 A MET 9 . A ASN 493 . A MET 115 A ASN 599 0 ? 
11  2 0 L MET 9 . L ASN 493 . L MET 115 L ASN 599 0 ? 
12  1 0 A MET 9 . A TRP 492 . A MET 115 A TRP 598 0 ? 
12  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
13  1 0 A MET 9 . A ASN 493 . A MET 115 A ASN 599 0 ? 
13  2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
14  1 0 A THR 8 . A GLN 488 . A THR 114 A GLN 594 0 ? 
14  2 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
15  1 0 A THR 8 . A PRO 487 . A THR 114 A PRO 593 0 ? 
15  2 0 P THR 8 . P PRO 487 . P THR 114 P PRO 593 0 ? 
16  1 0 B MET 9 . B ASN 493 . B MET 115 B ASN 599 0 ? 
16  2 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
17  1 0 B THR 8 . B ASN 493 . B THR 114 B ASN 599 0 ? 
17  2 0 D THR 8 . D ASN 493 . D THR 114 D ASN 599 0 ? 
18  1 0 B THR 8 . B ASN 493 . B THR 114 B ASN 599 0 ? 
18  2 0 E THR 8 . E ASN 493 . E THR 114 E ASN 599 0 ? 
19  1 0 B THR 8 . B GLU 491 . B THR 114 B GLU 597 0 ? 
19  2 0 F THR 8 . F GLU 491 . F THR 114 F GLU 597 0 ? 
20  1 0 B THR 8 . B TRP 492 . B THR 114 B TRP 598 0 ? 
20  2 0 G THR 8 . G TRP 492 . G THR 114 G TRP 598 0 ? 
21  1 0 B THR 8 . B ASN 493 . B THR 114 B ASN 599 0 ? 
21  2 0 H THR 8 . H ASN 493 . H THR 114 H ASN 599 0 ? 
22  1 0 B MET 9 . B ASN 493 . B MET 115 B ASN 599 0 ? 
22  2 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
23  1 0 B MET 9 . B GLU 491 . B MET 115 B GLU 597 0 ? 
23  2 0 J MET 9 . J GLU 491 . J MET 115 J GLU 597 0 ? 
24  1 0 B MET 9 . B TRP 492 . B MET 115 B TRP 598 0 ? 
24  2 0 K MET 9 . K TRP 492 . K MET 115 K TRP 598 0 ? 
25  1 0 B MET 9 . B TRP 492 . B MET 115 B TRP 598 0 ? 
25  2 0 L MET 9 . L TRP 492 . L MET 115 L TRP 598 0 ? 
26  1 0 B MET 9 . B TRP 492 . B MET 115 B TRP 598 0 ? 
26  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
27  1 0 B MET 9 . B ASN 493 . B MET 115 B ASN 599 0 ? 
27  2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
28  1 0 B THR 8 . B GLN 488 . B THR 114 B GLN 594 0 ? 
28  2 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
29  1 0 B THR 8 . B PRO 487 . B THR 114 B PRO 593 0 ? 
29  2 0 P THR 8 . P PRO 487 . P THR 114 P PRO 593 0 ? 
30  1 0 C MET 9 . C TRP 492 . C MET 115 C TRP 598 0 ? 
30  2 0 D MET 9 . D TRP 492 . D MET 115 D TRP 598 0 ? 
31  1 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
31  2 0 E MET 9 . E ASN 493 . E MET 115 E ASN 599 0 ? 
32  1 0 C MET 9 . C TRP 492 . C MET 115 C TRP 598 0 ? 
32  2 0 F MET 9 . F TRP 492 . F MET 115 F TRP 598 0 ? 
33  1 0 C MET 9 . C GLU 491 . C MET 115 C GLU 597 0 ? 
33  2 0 G MET 9 . G GLU 491 . G MET 115 G GLU 597 0 ? 
34  1 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
34  2 0 H MET 9 . H ASN 493 . H MET 115 H ASN 599 0 ? 
35  1 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
35  2 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
36  1 0 C MET 9 . C TRP 492 . C MET 115 C TRP 598 0 ? 
36  2 0 J MET 9 . J TRP 492 . J MET 115 J TRP 598 0 ? 
37  1 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
37  2 0 K MET 9 . K ASN 493 . K MET 115 K ASN 599 0 ? 
38  1 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
38  2 0 L MET 9 . L ASN 493 . L MET 115 L ASN 599 0 ? 
39  1 0 C MET 9 . C TRP 492 . C MET 115 C TRP 598 0 ? 
39  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
40  1 0 C MET 9 . C ASN 493 . C MET 115 C ASN 599 0 ? 
40  2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
41  1 0 C MET 9 . C PRO 487 . C MET 115 C PRO 593 0 ? 
41  2 0 O MET 9 . O PRO 487 . O MET 115 O PRO 593 0 ? 
42  1 0 C MET 9 . C PRO 487 . C MET 115 C PRO 593 0 ? 
42  2 0 P MET 9 . P PRO 487 . P MET 115 P PRO 593 0 ? 
43  1 0 D THR 8 . D ASN 493 . D THR 114 D ASN 599 0 ? 
43  2 0 E THR 8 . E ASN 493 . E THR 114 E ASN 599 0 ? 
44  1 0 D THR 8 . D TRP 492 . D THR 114 D TRP 598 0 ? 
44  2 0 F THR 8 . F TRP 492 . F THR 114 F TRP 598 0 ? 
45  1 0 D THR 8 . D TRP 492 . D THR 114 D TRP 598 0 ? 
45  2 0 G THR 8 . G TRP 492 . G THR 114 G TRP 598 0 ? 
46  1 0 D THR 8 . D ASN 493 . D THR 114 D ASN 599 0 ? 
46  2 0 H THR 8 . H ASN 493 . H THR 114 H ASN 599 0 ? 
47  1 0 D MET 9 . D ASN 493 . D MET 115 D ASN 599 0 ? 
47  2 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
48  1 0 D MET 9 . D GLU 491 . D MET 115 D GLU 597 0 ? 
48  2 0 J MET 9 . J GLU 491 . J MET 115 J GLU 597 0 ? 
49  1 0 D MET 9 . D ASN 493 . D MET 115 D ASN 599 0 ? 
49  2 0 K MET 9 . K ASN 493 . K MET 115 K ASN 599 0 ? 
50  1 0 D MET 9 . D ASN 493 . D MET 115 D ASN 599 0 ? 
50  2 0 L MET 9 . L ASN 493 . L MET 115 L ASN 599 0 ? 
51  1 0 D MET 9 . D TRP 492 . D MET 115 D TRP 598 0 ? 
51  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
52  1 0 D MET 9 . D ASN 493 . D MET 115 D ASN 599 0 ? 
52  2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
53  1 0 D THR 8 . D GLN 488 . D THR 114 D GLN 594 0 ? 
53  2 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
54  1 0 D THR 8 . D PRO 487 . D THR 114 D PRO 593 0 ? 
54  2 0 P THR 8 . P PRO 487 . P THR 114 P PRO 593 0 ? 
55  1 0 E THR 8 . E GLU 491 . E THR 114 E GLU 597 0 ? 
55  2 0 F THR 8 . F GLU 491 . F THR 114 F GLU 597 0 ? 
56  1 0 E THR 8 . E TRP 492 . E THR 114 E TRP 598 0 ? 
56  2 0 G THR 8 . G TRP 492 . G THR 114 G TRP 598 0 ? 
57  1 0 E THR 8 . E ASN 493 . E THR 114 E ASN 599 0 ? 
57  2 0 H THR 8 . H ASN 493 . H THR 114 H ASN 599 0 ? 
58  1 0 E MET 9 . E ASN 493 . E MET 115 E ASN 599 0 ? 
58  2 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
59  1 0 E MET 9 . E GLU 491 . E MET 115 E GLU 597 0 ? 
59  2 0 J MET 9 . J GLU 491 . J MET 115 J GLU 597 0 ? 
60  1 0 E MET 9 . E TRP 492 . E MET 115 E TRP 598 0 ? 
60  2 0 K MET 9 . K TRP 492 . K MET 115 K TRP 598 0 ? 
61  1 0 E MET 9 . E TRP 492 . E MET 115 E TRP 598 0 ? 
61  2 0 L MET 9 . L TRP 492 . L MET 115 L TRP 598 0 ? 
62  1 0 E MET 9 . E TRP 492 . E MET 115 E TRP 598 0 ? 
62  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
63  1 0 E MET 9 . E ASN 493 . E MET 115 E ASN 599 0 ? 
63  2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
64  1 0 E THR 8 . E GLN 488 . E THR 114 E GLN 594 0 ? 
64  2 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
65  1 0 E THR 8 . E PRO 487 . E THR 114 E PRO 593 0 ? 
65  2 0 P THR 8 . P PRO 487 . P THR 114 P PRO 593 0 ? 
66  1 0 F THR 8 . F TRP 492 . F THR 114 F TRP 598 0 ? 
66  2 0 G THR 8 . G TRP 492 . G THR 114 G TRP 598 0 ? 
67  1 0 F THR 8 . F TRP 492 . F THR 114 F TRP 598 0 ? 
67  2 0 H THR 8 . H TRP 492 . H THR 114 H TRP 598 0 ? 
68  1 0 F MET 9 . F GLU 491 . F MET 115 F GLU 597 0 ? 
68  2 0 I MET 9 . I GLU 491 . I MET 115 I GLU 597 0 ? 
69  1 0 F MET 9 . F TRP 492 . F MET 115 F TRP 598 0 ? 
69  2 0 J MET 9 . J TRP 492 . J MET 115 J TRP 598 0 ? 
70  1 0 F MET 9 . F GLU 491 . F MET 115 F GLU 597 0 ? 
70  2 0 K MET 9 . K GLU 491 . K MET 115 K GLU 597 0 ? 
71  1 0 F MET 9 . F GLU 491 . F MET 115 F GLU 597 0 ? 
71  2 0 L MET 9 . L GLU 491 . L MET 115 L GLU 597 0 ? 
72  1 0 F MET 9 . F TRP 492 . F MET 115 F TRP 598 0 ? 
72  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
73  1 0 F MET 9 . F GLU 491 . F MET 115 F GLU 597 0 ? 
73  2 0 N MET 9 . N GLU 491 . N MET 115 N GLU 597 0 ? 
74  1 0 F THR 8 . F GLN 488 . F THR 114 F GLN 594 0 ? 
74  2 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
75  1 0 F THR 8 . F PRO 487 . F THR 114 F PRO 593 0 ? 
75  2 0 P THR 8 . P PRO 487 . P THR 114 P PRO 593 0 ? 
76  1 0 G THR 8 . G GLU 491 . G THR 114 G GLU 597 0 ? 
76  2 0 H THR 8 . H GLU 491 . H THR 114 H GLU 597 0 ? 
77  1 0 G MET 9 . G TRP 492 . G MET 115 G TRP 598 0 ? 
77  2 0 I MET 9 . I TRP 492 . I MET 115 I TRP 598 0 ? 
78  1 0 G MET 9 . G GLU 491 . G MET 115 G GLU 597 0 ? 
78  2 0 J MET 9 . J GLU 491 . J MET 115 J GLU 597 0 ? 
79  1 0 G MET 9 . G GLU 491 . G MET 115 G GLU 597 0 ? 
79  2 0 K MET 9 . K GLU 491 . K MET 115 K GLU 597 0 ? 
80  1 0 G MET 9 . G GLU 491 . G MET 115 G GLU 597 0 ? 
80  2 0 L MET 9 . L GLU 491 . L MET 115 L GLU 597 0 ? 
81  1 0 G MET 9 . G TRP 492 . G MET 115 G TRP 598 0 ? 
81  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
82  1 0 G MET 9 . G TRP 492 . G MET 115 G TRP 598 0 ? 
82  2 0 N MET 9 . N TRP 492 . N MET 115 N TRP 598 0 ? 
83  1 0 G THR 8 . G GLN 488 . G THR 114 G GLN 594 0 ? 
83  2 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
84  1 0 G THR 8 . G PRO 487 . G THR 114 G PRO 593 0 ? 
84  2 0 P THR 8 . P PRO 487 . P THR 114 P PRO 593 0 ? 
85  1 0 H MET 9 . H ASN 493 . H MET 115 H ASN 599 0 ? 
85  2 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
86  1 0 H MET 9 . H GLU 491 . H MET 115 H GLU 597 0 ? 
86  2 0 J MET 9 . J GLU 491 . J MET 115 J GLU 597 0 ? 
87  1 0 H MET 9 . H ASN 493 . H MET 115 H ASN 599 0 ? 
87  2 0 K MET 9 . K ASN 493 . K MET 115 K ASN 599 0 ? 
88  1 0 H MET 9 . H ASN 493 . H MET 115 H ASN 599 0 ? 
88  2 0 L MET 9 . L ASN 493 . L MET 115 L ASN 599 0 ? 
89  1 0 H MET 9 . H TRP 492 . H MET 115 H TRP 598 0 ? 
89  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
90  1 0 H MET 9 . H ASN 493 . H MET 115 H ASN 599 0 ? 
90  2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
91  1 0 H THR 8 . H GLN 488 . H THR 114 H GLN 594 0 ? 
91  2 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
92  1 0 H THR 8 . H PRO 487 . H THR 114 H PRO 593 0 ? 
92  2 0 P THR 8 . P PRO 487 . P THR 114 P PRO 593 0 ? 
93  1 0 I MET 9 . I TRP 492 . I MET 115 I TRP 598 0 ? 
93  2 0 J MET 9 . J TRP 492 . J MET 115 J TRP 598 0 ? 
94  1 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
94  2 0 K MET 9 . K ASN 493 . K MET 115 K ASN 599 0 ? 
95  1 0 I MET 9 . I TRP 492 . I MET 115 I TRP 598 0 ? 
95  2 0 L MET 9 . L TRP 492 . L MET 115 L TRP 598 0 ? 
96  1 0 I MET 9 . I TRP 492 . I MET 115 I TRP 598 0 ? 
96  2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
97  1 0 I MET 9 . I ASN 493 . I MET 115 I ASN 599 0 ? 
97  2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
98  1 0 I MET 9 . I GLN 488 . I MET 115 I GLN 594 0 ? 
98  2 0 O MET 9 . O GLN 488 . O MET 115 O GLN 594 0 ? 
99  1 0 I MET 9 . I PRO 487 . I MET 115 I PRO 593 0 ? 
99  2 0 P MET 9 . P PRO 487 . P MET 115 P PRO 593 0 ? 
100 1 0 J MET 9 . J TRP 492 . J MET 115 J TRP 598 0 ? 
100 2 0 K MET 9 . K TRP 492 . K MET 115 K TRP 598 0 ? 
101 1 0 J MET 9 . J TRP 492 . J MET 115 J TRP 598 0 ? 
101 2 0 L MET 9 . L TRP 492 . L MET 115 L TRP 598 0 ? 
102 1 0 J MET 9 . J TRP 492 . J MET 115 J TRP 598 0 ? 
102 2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
103 1 0 J MET 9 . J TRP 492 . J MET 115 J TRP 598 0 ? 
103 2 0 N MET 9 . N TRP 492 . N MET 115 N TRP 598 0 ? 
104 1 0 J MET 9 . J GLN 488 . J MET 115 J GLN 594 0 ? 
104 2 0 O MET 9 . O GLN 488 . O MET 115 O GLN 594 0 ? 
105 1 0 J MET 9 . J PRO 487 . J MET 115 J PRO 593 0 ? 
105 2 0 P MET 9 . P PRO 487 . P MET 115 P PRO 593 0 ? 
106 1 0 K MET 9 . K ASN 493 . K MET 115 K ASN 599 0 ? 
106 2 0 L MET 9 . L ASN 493 . L MET 115 L ASN 599 0 ? 
107 1 0 K MET 9 . K TRP 492 . K MET 115 K TRP 598 0 ? 
107 2 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
108 1 0 K MET 9 . K ASN 493 . K MET 115 K ASN 599 0 ? 
108 2 0 N MET 9 . N ASN 493 . N MET 115 N ASN 599 0 ? 
109 1 0 K MET 9 . K GLN 488 . K MET 115 K GLN 594 0 ? 
109 2 0 O MET 9 . O GLN 488 . O MET 115 O GLN 594 0 ? 
110 1 0 K MET 9 . K PRO 487 . K MET 115 K PRO 593 0 ? 
110 2 0 P MET 9 . P PRO 487 . P MET 115 P PRO 593 0 ? 
111 1 0 L MET 9 . L GLU 491 . L MET 115 L GLU 597 0 ? 
111 2 0 M MET 9 . M GLU 491 . M MET 115 M GLU 597 0 ? 
112 1 0 L MET 9 . L TRP 492 . L MET 115 L TRP 598 0 ? 
112 2 0 N MET 9 . N TRP 492 . N MET 115 N TRP 598 0 ? 
113 1 0 L MET 9 . L GLN 488 . L MET 115 L GLN 594 0 ? 
113 2 0 O MET 9 . O GLN 488 . O MET 115 O GLN 594 0 ? 
114 1 0 L MET 9 . L PRO 487 . L MET 115 L PRO 593 0 ? 
114 2 0 P MET 9 . P PRO 487 . P MET 115 P PRO 593 0 ? 
115 1 0 M MET 9 . M TRP 492 . M MET 115 M TRP 598 0 ? 
115 2 0 N MET 9 . N TRP 492 . N MET 115 N TRP 598 0 ? 
116 1 0 M MET 9 . M GLN 488 . M MET 115 M GLN 594 0 ? 
116 2 0 O MET 9 . O GLN 488 . O MET 115 O GLN 594 0 ? 
117 1 0 M MET 9 . M PRO 487 . M MET 115 M PRO 593 0 ? 
117 2 0 P MET 9 . P PRO 487 . P MET 115 P PRO 593 0 ? 
118 1 0 N MET 9 . N GLN 488 . N MET 115 N GLN 594 0 ? 
118 2 0 O MET 9 . O GLN 488 . O MET 115 O GLN 594 0 ? 
119 1 0 N MET 9 . N PRO 487 . N MET 115 N PRO 593 0 ? 
119 2 0 P MET 9 . P PRO 487 . P MET 115 P PRO 593 0 ? 
120 1 0 O THR 8 . O GLN 488 . O THR 114 O GLN 594 0 ? 
120 2 0 P THR 8 . P GLN 488 . P THR 114 P GLN 594 0 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1   ? 
2   ? 
3   ? 
4   ? 
5   ? 
6   ? 
7   ? 
8   ? 
9   ? 
10  ? 
11  ? 
12  ? 
13  ? 
14  ? 
15  ? 
16  ? 
17  ? 
18  ? 
19  ? 
20  ? 
21  ? 
22  ? 
23  ? 
24  ? 
25  ? 
26  ? 
27  ? 
28  ? 
29  ? 
30  ? 
31  ? 
32  ? 
33  ? 
34  ? 
35  ? 
36  ? 
37  ? 
38  ? 
39  ? 
40  ? 
41  ? 
42  ? 
43  ? 
44  ? 
45  ? 
46  ? 
47  ? 
48  ? 
49  ? 
50  ? 
51  ? 
52  ? 
53  ? 
54  ? 
55  ? 
56  ? 
57  ? 
58  ? 
59  ? 
60  ? 
61  ? 
62  ? 
63  ? 
64  ? 
65  ? 
66  ? 
67  ? 
68  ? 
69  ? 
70  ? 
71  ? 
72  ? 
73  ? 
74  ? 
75  ? 
76  ? 
77  ? 
78  ? 
79  ? 
80  ? 
81  ? 
82  ? 
83  ? 
84  ? 
85  ? 
86  ? 
87  ? 
88  ? 
89  ? 
90  ? 
91  ? 
92  ? 
93  ? 
94  ? 
95  ? 
96  ? 
97  ? 
98  ? 
99  ? 
100 ? 
101 ? 
102 ? 
103 ? 
104 ? 
105 ? 
106 ? 
107 ? 
108 ? 
109 ? 
110 ? 
111 ? 
112 ? 
113 ? 
114 ? 
115 ? 
116 ? 
117 ? 
118 ? 
119 ? 
120 ? 
# 
_struct.entry_id                     6TXE 
_struct.title                        
'Crystal structure of tetrameric human wt-SAMHD1 (residues 109-626) with GTP, dATP, dTMPNPP and Mg' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6TXE 
_struct_keywords.text            'triphosphohydrolase, metallo-enzyme, binuclear, HD, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 6 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 4 ? 
AA N N 5 ? 
BA N N 7 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 4 ? 
IA N N 7 ? 
JA N N 6 ? 
KA N N 5 ? 
LA N N 2 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 4 ? 
PA N N 5 ? 
QA N N 7 ? 
RA N N 2 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 4 ? 
VA N N 5 ? 
WA N N 7 ? 
XA N N 6 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 3 ? 
BB N N 4 ? 
CB N N 5 ? 
DB N N 7 ? 
EB N N 6 ? 
FB N N 6 ? 
GB N N 2 ? 
HB N N 3 ? 
IB N N 3 ? 
JB N N 4 ? 
KB N N 5 ? 
LB N N 6 ? 
MB N N 2 ? 
NB N N 3 ? 
OB N N 3 ? 
PB N N 4 ? 
QB N N 5 ? 
RB N N 7 ? 
SB N N 2 ? 
TB N N 3 ? 
UB N N 3 ? 
VB N N 4 ? 
WB N N 5 ? 
XB N N 7 ? 
YB N N 5 ? 
ZB N N 6 ? 
AC N N 2 ? 
BC N N 3 ? 
CC N N 3 ? 
DC N N 4 ? 
EC N N 7 ? 
FC N N 6 ? 
GC N N 6 ? 
HC N N 2 ? 
IC N N 3 ? 
JC N N 3 ? 
KC N N 4 ? 
LC N N 5 ? 
MC N N 7 ? 
NC N N 6 ? 
OC N N 2 ? 
PC N N 3 ? 
QC N N 3 ? 
RC N N 4 ? 
SC N N 5 ? 
TC N N 2 ? 
UC N N 3 ? 
VC N N 3 ? 
WC N N 4 ? 
XC N N 5 ? 
YC N N 6 ? 
ZC N N 6 ? 
AD N N 6 ? 
BD N N 2 ? 
CD N N 3 ? 
DD N N 3 ? 
ED N N 4 ? 
FD N N 5 ? 
GD N N 7 ? 
HD N N 6 ? 
ID N N 2 ? 
JD N N 3 ? 
KD N N 3 ? 
LD N N 4 ? 
MD N N 5 ? 
ND N N 7 ? 
OD N N 2 ? 
PD N N 3 ? 
QD N N 3 ? 
RD N N 4 ? 
SD N N 5 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAMH1_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y3Z3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPE
LQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFI
KEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELR
ICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFL
EILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYG
MQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIA
PLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_struct_ref.pdbx_align_begin           109 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6TXE A 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
2  1 6TXE B 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
3  1 6TXE C 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
4  1 6TXE D 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
5  1 6TXE E 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
6  1 6TXE F 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
7  1 6TXE G 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
8  1 6TXE H 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
9  1 6TXE I 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
10 1 6TXE J 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
11 1 6TXE K 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
12 1 6TXE L 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
13 1 6TXE M 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
14 1 6TXE N 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
15 1 6TXE O 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
16 1 6TXE P 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6TXE GLY A 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 1  
1  6TXE SER A 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 2  
2  6TXE GLY B 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 3  
2  6TXE SER B 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 4  
3  6TXE GLY C 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 5  
3  6TXE SER C 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 6  
4  6TXE GLY D 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 7  
4  6TXE SER D 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 8  
5  6TXE GLY E 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 9  
5  6TXE SER E 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 10 
6  6TXE GLY F 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 11 
6  6TXE SER F 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 12 
7  6TXE GLY G 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 13 
7  6TXE SER G 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 14 
8  6TXE GLY H 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 15 
8  6TXE SER H 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 16 
9  6TXE GLY I 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 17 
9  6TXE SER I 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 18 
10 6TXE GLY J 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 19 
10 6TXE SER J 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 20 
11 6TXE GLY K 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 21 
11 6TXE SER K 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 22 
12 6TXE GLY L 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 23 
12 6TXE SER L 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 24 
13 6TXE GLY M 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 25 
13 6TXE SER M 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 26 
14 6TXE GLY N 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 27 
14 6TXE SER N 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 28 
15 6TXE GLY O 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 29 
15 6TXE SER O 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 30 
16 6TXE GLY P 1 ? UNP Q9Y3Z3 ? ? 'expression tag' 107 31 
16 6TXE SER P 2 ? UNP Q9Y3Z3 ? ? 'expression tag' 108 32 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
3 author_and_software_defined_assembly PISA tetrameric 4 
4 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 26450 ? 
1 MORE         -147  ? 
1 'SSA (A^2)'  65430 ? 
2 'ABSA (A^2)' 26290 ? 
2 MORE         -148  ? 
2 'SSA (A^2)'  65290 ? 
3 'ABSA (A^2)' 26330 ? 
3 MORE         -149  ? 
3 'SSA (A^2)'  64000 ? 
4 'ABSA (A^2)' 25700 ? 
4 MORE         -132  ? 
4 'SSA (A^2)'  64090 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA           
2 1 E,F,G,H,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB 
3 1 I,J,K,L,SB,TB,UB,VB,WB,XB,YB,ZB,AC,BC,CC,DC,EC,FC,GC,HC,IC,JC,KC,LC,MC,NC,OC,PC,QC,RC,SC 
4 1 M,N,O,P,TC,UC,VC,WC,XC,YC,ZC,AD,BD,CD,DD,ED,FD,GD,HD,ID,JD,KD,LD,MD,ND,OD,PD,QD,RD,SD    
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'assay for oligomerization' 
_pdbx_struct_assembly_auth_evidence.details                
;SEC-MALLS and AUC experiments demonstrate the HD domain crystallised here assembles into a homotetramer in the presence of GTP, dATP, dTMPNPP and Mg2+.
;
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 HIS A 23  ? ASP A 31  ? HIS A 129 ASP A 137 1 ? 9  
HELX_P HELX_P2   AA2 THR A 32  ? ARG A 37  ? THR A 138 ARG A 143 1 ? 6  
HELX_P HELX_P3   AA3 LEU A 38  ? ILE A 41  ? LEU A 144 ILE A 147 5 ? 4  
HELX_P HELX_P4   AA4 LEU A 44  ? VAL A 50  ? LEU A 150 VAL A 156 5 ? 7  
HELX_P HELX_P5   AA5 ASN A 57  ? GLN A 80  ? ASN A 163 GLN A 186 1 ? 24 
HELX_P HELX_P6   AA6 PRO A 81  ? GLN A 84  ? PRO A 187 GLN A 190 5 ? 4  
HELX_P HELX_P7   AA7 SER A 86  ? HIS A 100 ? SER A 192 HIS A 206 1 ? 15 
HELX_P HELX_P8   AA8 SER A 108 ? ARG A 114 ? SER A 214 ARG A 220 1 ? 7  
HELX_P HELX_P9   AA9 ARG A 114 ? ARG A 120 ? ARG A 220 ARG A 226 1 ? 7  
HELX_P HELX_P10  AB1 THR A 126 ? GLY A 143 ? THR A 232 GLY A 249 1 ? 18 
HELX_P HELX_P11  AB2 ILE A 144 ? TYR A 151 ? ILE A 250 TYR A 257 1 ? 8  
HELX_P HELX_P12  AB3 ILE A 154 ? GLY A 168 ? ILE A 260 GLY A 274 1 ? 15 
HELX_P HELX_P13  AB4 PRO A 185 ? ILE A 194 ? PRO A 291 ILE A 300 5 ? 10 
HELX_P HELX_P14  AB5 ASP A 203 ? GLY A 218 ? ASP A 309 GLY A 324 1 ? 16 
HELX_P HELX_P15  AB6 ASP A 224 ? PHE A 231 ? ASP A 330 PHE A 337 1 ? 8  
HELX_P HELX_P16  AB7 GLU A 249 ? ALA A 267 ? GLU A 355 ALA A 373 1 ? 19 
HELX_P HELX_P17  AB8 HIS A 270 ? ASP A 288 ? HIS A 376 ASP A 394 1 ? 19 
HELX_P HELX_P18  AB9 ASP A 289 ? ILE A 291 ? ASP A 395 ILE A 397 5 ? 3  
HELX_P HELX_P19  AC1 ALA A 296 ? GLY A 298 ? ALA A 402 GLY A 404 5 ? 3  
HELX_P HELX_P20  AC2 THR A 305 ? ASP A 308 ? THR A 411 ASP A 414 5 ? 4  
HELX_P HELX_P21  AC3 ASP A 309 ? THR A 314 ? ASP A 415 THR A 420 1 ? 6  
HELX_P HELX_P22  AC4 LYS A 315 ? THR A 317 ? LYS A 421 THR A 423 5 ? 3  
HELX_P HELX_P23  AC5 ASP A 318 ? SER A 327 ? ASP A 424 SER A 433 1 ? 10 
HELX_P HELX_P24  AC6 ASP A 329 ? LYS A 331 ? ASP A 435 LYS A 437 5 ? 3  
HELX_P HELX_P25  AC7 LEU A 332 ? ARG A 345 ? LEU A 438 ARG A 451 1 ? 14 
HELX_P HELX_P26  AC8 LYS A 363 ? GLU A 368 ? LYS A 469 GLU A 474 5 ? 6  
HELX_P HELX_P27  AC9 SER A 369 ? ALA A 377 ? SER A 475 ALA A 483 1 ? 9  
HELX_P HELX_P28  AD1 LYS A 388 ? GLU A 390 ? LYS A 494 GLU A 496 5 ? 3  
HELX_P HELX_P29  AD2 ASN A 407 ? VAL A 412 ? ASN A 513 VAL A 518 5 ? 6  
HELX_P HELX_P30  AD3 ASP A 452 ? ARG A 470 ? ASP A 558 ARG A 576 1 ? 19 
HELX_P HELX_P31  AD4 ASP A 477 ? ALA A 482 ? ASP A 583 ALA A 588 1 ? 6  
HELX_P HELX_P32  AD5 ILE A 485 ? ASN A 493 ? ILE A 591 ASN A 599 5 ? 9  
HELX_P HELX_P33  AD6 HIS B 23  ? ASP B 31  ? HIS B 129 ASP B 137 1 ? 9  
HELX_P HELX_P34  AD7 THR B 32  ? ARG B 37  ? THR B 138 ARG B 143 1 ? 6  
HELX_P HELX_P35  AD8 LEU B 38  ? ILE B 41  ? LEU B 144 ILE B 147 5 ? 4  
HELX_P HELX_P36  AD9 LEU B 44  ? VAL B 50  ? LEU B 150 VAL B 156 5 ? 7  
HELX_P HELX_P37  AE1 ASN B 57  ? GLN B 80  ? ASN B 163 GLN B 186 1 ? 24 
HELX_P HELX_P38  AE2 PRO B 81  ? GLN B 84  ? PRO B 187 GLN B 190 5 ? 4  
HELX_P HELX_P39  AE3 SER B 86  ? HIS B 100 ? SER B 192 HIS B 206 1 ? 15 
HELX_P HELX_P40  AE4 SER B 108 ? ARG B 114 ? SER B 214 ARG B 220 1 ? 7  
HELX_P HELX_P41  AE5 ARG B 114 ? ARG B 120 ? ARG B 220 ARG B 226 1 ? 7  
HELX_P HELX_P42  AE6 THR B 126 ? GLY B 143 ? THR B 232 GLY B 249 1 ? 18 
HELX_P HELX_P43  AE7 ILE B 144 ? TYR B 151 ? ILE B 250 TYR B 257 1 ? 8  
HELX_P HELX_P44  AE8 ILE B 154 ? GLY B 168 ? ILE B 260 GLY B 274 1 ? 15 
HELX_P HELX_P45  AE9 PRO B 185 ? ILE B 194 ? PRO B 291 ILE B 300 5 ? 10 
HELX_P HELX_P46  AF1 ASP B 203 ? GLY B 218 ? ASP B 309 GLY B 324 1 ? 16 
HELX_P HELX_P47  AF2 ASP B 224 ? PHE B 231 ? ASP B 330 PHE B 337 1 ? 8  
HELX_P HELX_P48  AF3 GLU B 249 ? ALA B 267 ? GLU B 355 ALA B 373 1 ? 19 
HELX_P HELX_P49  AF4 HIS B 270 ? ASP B 288 ? HIS B 376 ASP B 394 1 ? 19 
HELX_P HELX_P50  AF5 ASP B 289 ? ILE B 291 ? ASP B 395 ILE B 397 5 ? 3  
HELX_P HELX_P51  AF6 ALA B 296 ? GLY B 298 ? ALA B 402 GLY B 404 5 ? 3  
HELX_P HELX_P52  AF7 THR B 305 ? ASP B 308 ? THR B 411 ASP B 414 5 ? 4  
HELX_P HELX_P53  AF8 ASP B 309 ? THR B 314 ? ASP B 415 THR B 420 1 ? 6  
HELX_P HELX_P54  AF9 LYS B 315 ? THR B 317 ? LYS B 421 THR B 423 5 ? 3  
HELX_P HELX_P55  AG1 ASP B 318 ? SER B 327 ? ASP B 424 SER B 433 1 ? 10 
HELX_P HELX_P56  AG2 ASP B 329 ? LYS B 331 ? ASP B 435 LYS B 437 5 ? 3  
HELX_P HELX_P57  AG3 LEU B 332 ? ARG B 345 ? LEU B 438 ARG B 451 1 ? 14 
HELX_P HELX_P58  AG4 LYS B 363 ? GLU B 368 ? LYS B 469 GLU B 474 5 ? 6  
HELX_P HELX_P59  AG5 SER B 369 ? ALA B 377 ? SER B 475 ALA B 483 1 ? 9  
HELX_P HELX_P60  AG6 LYS B 388 ? GLU B 390 ? LYS B 494 GLU B 496 5 ? 3  
HELX_P HELX_P61  AG7 ASN B 407 ? VAL B 412 ? ASN B 513 VAL B 518 5 ? 6  
HELX_P HELX_P62  AG8 ASP B 452 ? ARG B 470 ? ASP B 558 ARG B 576 1 ? 19 
HELX_P HELX_P63  AG9 ASP B 477 ? ALA B 482 ? ASP B 583 ALA B 588 1 ? 6  
HELX_P HELX_P64  AH1 ILE B 485 ? ASN B 493 ? ILE B 591 ASN B 599 5 ? 9  
HELX_P HELX_P65  AH2 HIS C 23  ? ASP C 31  ? HIS C 129 ASP C 137 1 ? 9  
HELX_P HELX_P66  AH3 THR C 32  ? ARG C 37  ? THR C 138 ARG C 143 1 ? 6  
HELX_P HELX_P67  AH4 LEU C 38  ? ILE C 41  ? LEU C 144 ILE C 147 5 ? 4  
HELX_P HELX_P68  AH5 LEU C 44  ? VAL C 50  ? LEU C 150 VAL C 156 5 ? 7  
HELX_P HELX_P69  AH6 ASN C 57  ? GLN C 80  ? ASN C 163 GLN C 186 1 ? 24 
HELX_P HELX_P70  AH7 PRO C 81  ? GLN C 84  ? PRO C 187 GLN C 190 5 ? 4  
HELX_P HELX_P71  AH8 SER C 86  ? HIS C 100 ? SER C 192 HIS C 206 1 ? 15 
HELX_P HELX_P72  AH9 SER C 108 ? ARG C 114 ? SER C 214 ARG C 220 1 ? 7  
HELX_P HELX_P73  AI1 ARG C 114 ? ARG C 120 ? ARG C 220 ARG C 226 1 ? 7  
HELX_P HELX_P74  AI2 THR C 126 ? GLY C 143 ? THR C 232 GLY C 249 1 ? 18 
HELX_P HELX_P75  AI3 ILE C 144 ? TYR C 151 ? ILE C 250 TYR C 257 1 ? 8  
HELX_P HELX_P76  AI4 ILE C 154 ? GLY C 168 ? ILE C 260 GLY C 274 1 ? 15 
HELX_P HELX_P77  AI5 PRO C 185 ? ILE C 194 ? PRO C 291 ILE C 300 5 ? 10 
HELX_P HELX_P78  AI6 ASP C 203 ? GLY C 218 ? ASP C 309 GLY C 324 1 ? 16 
HELX_P HELX_P79  AI7 ASP C 224 ? PHE C 231 ? ASP C 330 PHE C 337 1 ? 8  
HELX_P HELX_P80  AI8 GLU C 249 ? ALA C 267 ? GLU C 355 ALA C 373 1 ? 19 
HELX_P HELX_P81  AI9 HIS C 270 ? ASP C 288 ? HIS C 376 ASP C 394 1 ? 19 
HELX_P HELX_P82  AJ1 ASP C 289 ? ILE C 291 ? ASP C 395 ILE C 397 5 ? 3  
HELX_P HELX_P83  AJ2 ALA C 296 ? GLY C 298 ? ALA C 402 GLY C 404 5 ? 3  
HELX_P HELX_P84  AJ3 THR C 305 ? ASP C 308 ? THR C 411 ASP C 414 5 ? 4  
HELX_P HELX_P85  AJ4 ASP C 309 ? THR C 314 ? ASP C 415 THR C 420 1 ? 6  
HELX_P HELX_P86  AJ5 LYS C 315 ? THR C 317 ? LYS C 421 THR C 423 5 ? 3  
HELX_P HELX_P87  AJ6 ASP C 318 ? SER C 327 ? ASP C 424 SER C 433 1 ? 10 
HELX_P HELX_P88  AJ7 ASP C 329 ? LYS C 331 ? ASP C 435 LYS C 437 5 ? 3  
HELX_P HELX_P89  AJ8 LEU C 332 ? ARG C 345 ? LEU C 438 ARG C 451 1 ? 14 
HELX_P HELX_P90  AJ9 LYS C 363 ? GLU C 368 ? LYS C 469 GLU C 474 5 ? 6  
HELX_P HELX_P91  AK1 SER C 369 ? ALA C 377 ? SER C 475 ALA C 483 1 ? 9  
HELX_P HELX_P92  AK2 LYS C 388 ? GLU C 390 ? LYS C 494 GLU C 496 5 ? 3  
HELX_P HELX_P93  AK3 ASN C 407 ? VAL C 412 ? ASN C 513 VAL C 518 5 ? 6  
HELX_P HELX_P94  AK4 ASP C 452 ? ARG C 470 ? ASP C 558 ARG C 576 1 ? 19 
HELX_P HELX_P95  AK5 ASP C 477 ? ALA C 482 ? ASP C 583 ALA C 588 1 ? 6  
HELX_P HELX_P96  AK6 ILE C 485 ? ASN C 493 ? ILE C 591 ASN C 599 5 ? 9  
HELX_P HELX_P97  AK7 HIS D 23  ? ASP D 31  ? HIS D 129 ASP D 137 1 ? 9  
HELX_P HELX_P98  AK8 THR D 32  ? ARG D 37  ? THR D 138 ARG D 143 1 ? 6  
HELX_P HELX_P99  AK9 LEU D 38  ? ILE D 41  ? LEU D 144 ILE D 147 5 ? 4  
HELX_P HELX_P100 AL1 LEU D 44  ? VAL D 50  ? LEU D 150 VAL D 156 5 ? 7  
HELX_P HELX_P101 AL2 ASN D 57  ? GLN D 80  ? ASN D 163 GLN D 186 1 ? 24 
HELX_P HELX_P102 AL3 PRO D 81  ? GLN D 84  ? PRO D 187 GLN D 190 5 ? 4  
HELX_P HELX_P103 AL4 SER D 86  ? HIS D 100 ? SER D 192 HIS D 206 1 ? 15 
HELX_P HELX_P104 AL5 SER D 108 ? ARG D 114 ? SER D 214 ARG D 220 1 ? 7  
HELX_P HELX_P105 AL6 ARG D 114 ? ARG D 120 ? ARG D 220 ARG D 226 1 ? 7  
HELX_P HELX_P106 AL7 THR D 126 ? GLY D 143 ? THR D 232 GLY D 249 1 ? 18 
HELX_P HELX_P107 AL8 ILE D 144 ? TYR D 151 ? ILE D 250 TYR D 257 1 ? 8  
HELX_P HELX_P108 AL9 ILE D 154 ? GLY D 168 ? ILE D 260 GLY D 274 1 ? 15 
HELX_P HELX_P109 AM1 PRO D 185 ? ILE D 194 ? PRO D 291 ILE D 300 5 ? 10 
HELX_P HELX_P110 AM2 ASP D 203 ? GLY D 218 ? ASP D 309 GLY D 324 1 ? 16 
HELX_P HELX_P111 AM3 ASP D 224 ? PHE D 231 ? ASP D 330 PHE D 337 1 ? 8  
HELX_P HELX_P112 AM4 GLU D 249 ? ALA D 267 ? GLU D 355 ALA D 373 1 ? 19 
HELX_P HELX_P113 AM5 HIS D 270 ? ASP D 288 ? HIS D 376 ASP D 394 1 ? 19 
HELX_P HELX_P114 AM6 ASP D 289 ? ILE D 291 ? ASP D 395 ILE D 397 5 ? 3  
HELX_P HELX_P115 AM7 ALA D 296 ? GLY D 298 ? ALA D 402 GLY D 404 5 ? 3  
HELX_P HELX_P116 AM8 THR D 305 ? ASP D 308 ? THR D 411 ASP D 414 5 ? 4  
HELX_P HELX_P117 AM9 ASP D 309 ? THR D 314 ? ASP D 415 THR D 420 1 ? 6  
HELX_P HELX_P118 AN1 LYS D 315 ? THR D 317 ? LYS D 421 THR D 423 5 ? 3  
HELX_P HELX_P119 AN2 ASP D 318 ? SER D 327 ? ASP D 424 SER D 433 1 ? 10 
HELX_P HELX_P120 AN3 ASP D 329 ? LYS D 331 ? ASP D 435 LYS D 437 5 ? 3  
HELX_P HELX_P121 AN4 LEU D 332 ? ARG D 345 ? LEU D 438 ARG D 451 1 ? 14 
HELX_P HELX_P122 AN5 LYS D 363 ? GLU D 368 ? LYS D 469 GLU D 474 5 ? 6  
HELX_P HELX_P123 AN6 SER D 369 ? ALA D 377 ? SER D 475 ALA D 483 1 ? 9  
HELX_P HELX_P124 AN7 LYS D 388 ? GLU D 390 ? LYS D 494 GLU D 496 5 ? 3  
HELX_P HELX_P125 AN8 ASN D 407 ? VAL D 412 ? ASN D 513 VAL D 518 5 ? 6  
HELX_P HELX_P126 AN9 ASP D 452 ? ARG D 470 ? ASP D 558 ARG D 576 1 ? 19 
HELX_P HELX_P127 AO1 ASP D 477 ? ALA D 482 ? ASP D 583 ALA D 588 1 ? 6  
HELX_P HELX_P128 AO2 ILE D 485 ? ASN D 493 ? ILE D 591 ASN D 599 5 ? 9  
HELX_P HELX_P129 AO3 HIS E 23  ? ASP E 31  ? HIS E 129 ASP E 137 1 ? 9  
HELX_P HELX_P130 AO4 THR E 32  ? ARG E 37  ? THR E 138 ARG E 143 1 ? 6  
HELX_P HELX_P131 AO5 LEU E 38  ? ILE E 41  ? LEU E 144 ILE E 147 5 ? 4  
HELX_P HELX_P132 AO6 LEU E 44  ? VAL E 50  ? LEU E 150 VAL E 156 5 ? 7  
HELX_P HELX_P133 AO7 ASN E 57  ? GLN E 80  ? ASN E 163 GLN E 186 1 ? 24 
HELX_P HELX_P134 AO8 PRO E 81  ? GLN E 84  ? PRO E 187 GLN E 190 5 ? 4  
HELX_P HELX_P135 AO9 SER E 86  ? HIS E 100 ? SER E 192 HIS E 206 1 ? 15 
HELX_P HELX_P136 AP1 SER E 108 ? ARG E 114 ? SER E 214 ARG E 220 1 ? 7  
HELX_P HELX_P137 AP2 ARG E 114 ? ARG E 120 ? ARG E 220 ARG E 226 1 ? 7  
HELX_P HELX_P138 AP3 THR E 126 ? GLY E 143 ? THR E 232 GLY E 249 1 ? 18 
HELX_P HELX_P139 AP4 ILE E 144 ? TYR E 151 ? ILE E 250 TYR E 257 1 ? 8  
HELX_P HELX_P140 AP5 ILE E 154 ? GLY E 168 ? ILE E 260 GLY E 274 1 ? 15 
HELX_P HELX_P141 AP6 PRO E 185 ? ILE E 194 ? PRO E 291 ILE E 300 5 ? 10 
HELX_P HELX_P142 AP7 ASP E 203 ? GLY E 218 ? ASP E 309 GLY E 324 1 ? 16 
HELX_P HELX_P143 AP8 ASP E 224 ? PHE E 231 ? ASP E 330 PHE E 337 1 ? 8  
HELX_P HELX_P144 AP9 GLU E 249 ? ALA E 267 ? GLU E 355 ALA E 373 1 ? 19 
HELX_P HELX_P145 AQ1 HIS E 270 ? ASP E 288 ? HIS E 376 ASP E 394 1 ? 19 
HELX_P HELX_P146 AQ2 ASP E 289 ? ILE E 291 ? ASP E 395 ILE E 397 5 ? 3  
HELX_P HELX_P147 AQ3 ALA E 296 ? GLY E 298 ? ALA E 402 GLY E 404 5 ? 3  
HELX_P HELX_P148 AQ4 THR E 305 ? ASP E 308 ? THR E 411 ASP E 414 5 ? 4  
HELX_P HELX_P149 AQ5 ASP E 309 ? THR E 314 ? ASP E 415 THR E 420 1 ? 6  
HELX_P HELX_P150 AQ6 LYS E 315 ? THR E 317 ? LYS E 421 THR E 423 5 ? 3  
HELX_P HELX_P151 AQ7 ASP E 318 ? SER E 327 ? ASP E 424 SER E 433 1 ? 10 
HELX_P HELX_P152 AQ8 ASP E 329 ? LYS E 331 ? ASP E 435 LYS E 437 5 ? 3  
HELX_P HELX_P153 AQ9 LEU E 332 ? ARG E 345 ? LEU E 438 ARG E 451 1 ? 14 
HELX_P HELX_P154 AR1 LYS E 363 ? GLU E 368 ? LYS E 469 GLU E 474 5 ? 6  
HELX_P HELX_P155 AR2 SER E 369 ? ALA E 377 ? SER E 475 ALA E 483 1 ? 9  
HELX_P HELX_P156 AR3 LYS E 388 ? GLU E 390 ? LYS E 494 GLU E 496 5 ? 3  
HELX_P HELX_P157 AR4 ASN E 407 ? VAL E 412 ? ASN E 513 VAL E 518 5 ? 6  
HELX_P HELX_P158 AR5 ASP E 452 ? ARG E 470 ? ASP E 558 ARG E 576 1 ? 19 
HELX_P HELX_P159 AR6 ASP E 477 ? ALA E 482 ? ASP E 583 ALA E 588 1 ? 6  
HELX_P HELX_P160 AR7 ILE E 485 ? ASN E 493 ? ILE E 591 ASN E 599 5 ? 9  
HELX_P HELX_P161 AR8 HIS F 23  ? ASP F 31  ? HIS F 129 ASP F 137 1 ? 9  
HELX_P HELX_P162 AR9 THR F 32  ? ARG F 37  ? THR F 138 ARG F 143 1 ? 6  
HELX_P HELX_P163 AS1 LEU F 38  ? ILE F 41  ? LEU F 144 ILE F 147 5 ? 4  
HELX_P HELX_P164 AS2 LEU F 44  ? VAL F 50  ? LEU F 150 VAL F 156 5 ? 7  
HELX_P HELX_P165 AS3 ASN F 57  ? GLN F 80  ? ASN F 163 GLN F 186 1 ? 24 
HELX_P HELX_P166 AS4 PRO F 81  ? GLN F 84  ? PRO F 187 GLN F 190 5 ? 4  
HELX_P HELX_P167 AS5 SER F 86  ? HIS F 100 ? SER F 192 HIS F 206 1 ? 15 
HELX_P HELX_P168 AS6 SER F 108 ? ARG F 114 ? SER F 214 ARG F 220 1 ? 7  
HELX_P HELX_P169 AS7 ARG F 114 ? ARG F 120 ? ARG F 220 ARG F 226 1 ? 7  
HELX_P HELX_P170 AS8 THR F 126 ? GLY F 143 ? THR F 232 GLY F 249 1 ? 18 
HELX_P HELX_P171 AS9 ILE F 144 ? TYR F 151 ? ILE F 250 TYR F 257 1 ? 8  
HELX_P HELX_P172 AT1 ILE F 154 ? GLY F 168 ? ILE F 260 GLY F 274 1 ? 15 
HELX_P HELX_P173 AT2 PRO F 185 ? ILE F 194 ? PRO F 291 ILE F 300 5 ? 10 
HELX_P HELX_P174 AT3 ASP F 203 ? GLY F 218 ? ASP F 309 GLY F 324 1 ? 16 
HELX_P HELX_P175 AT4 ASP F 224 ? PHE F 231 ? ASP F 330 PHE F 337 1 ? 8  
HELX_P HELX_P176 AT5 GLU F 249 ? ALA F 267 ? GLU F 355 ALA F 373 1 ? 19 
HELX_P HELX_P177 AT6 HIS F 270 ? ASP F 288 ? HIS F 376 ASP F 394 1 ? 19 
HELX_P HELX_P178 AT7 ASP F 289 ? ILE F 291 ? ASP F 395 ILE F 397 5 ? 3  
HELX_P HELX_P179 AT8 ALA F 296 ? GLY F 298 ? ALA F 402 GLY F 404 5 ? 3  
HELX_P HELX_P180 AT9 THR F 305 ? ASP F 308 ? THR F 411 ASP F 414 5 ? 4  
HELX_P HELX_P181 AU1 ASP F 309 ? THR F 314 ? ASP F 415 THR F 420 1 ? 6  
HELX_P HELX_P182 AU2 LYS F 315 ? THR F 317 ? LYS F 421 THR F 423 5 ? 3  
HELX_P HELX_P183 AU3 ASP F 318 ? SER F 327 ? ASP F 424 SER F 433 1 ? 10 
HELX_P HELX_P184 AU4 ASP F 329 ? LYS F 331 ? ASP F 435 LYS F 437 5 ? 3  
HELX_P HELX_P185 AU5 LEU F 332 ? ARG F 345 ? LEU F 438 ARG F 451 1 ? 14 
HELX_P HELX_P186 AU6 LYS F 363 ? GLU F 368 ? LYS F 469 GLU F 474 5 ? 6  
HELX_P HELX_P187 AU7 SER F 369 ? ALA F 377 ? SER F 475 ALA F 483 1 ? 9  
HELX_P HELX_P188 AU8 LYS F 388 ? GLU F 390 ? LYS F 494 GLU F 496 5 ? 3  
HELX_P HELX_P189 AU9 ASN F 407 ? VAL F 412 ? ASN F 513 VAL F 518 5 ? 6  
HELX_P HELX_P190 AV1 ASP F 452 ? ARG F 470 ? ASP F 558 ARG F 576 1 ? 19 
HELX_P HELX_P191 AV2 ASP F 477 ? ALA F 482 ? ASP F 583 ALA F 588 1 ? 6  
HELX_P HELX_P192 AV3 ILE F 485 ? LYS F 489 ? ILE F 591 LYS F 595 5 ? 5  
HELX_P HELX_P193 AV4 HIS G 23  ? ASP G 31  ? HIS G 129 ASP G 137 1 ? 9  
HELX_P HELX_P194 AV5 THR G 32  ? ARG G 37  ? THR G 138 ARG G 143 1 ? 6  
HELX_P HELX_P195 AV6 LEU G 38  ? ILE G 41  ? LEU G 144 ILE G 147 5 ? 4  
HELX_P HELX_P196 AV7 LEU G 44  ? VAL G 50  ? LEU G 150 VAL G 156 5 ? 7  
HELX_P HELX_P197 AV8 ASN G 57  ? GLN G 80  ? ASN G 163 GLN G 186 1 ? 24 
HELX_P HELX_P198 AV9 PRO G 81  ? GLN G 84  ? PRO G 187 GLN G 190 5 ? 4  
HELX_P HELX_P199 AW1 SER G 86  ? HIS G 100 ? SER G 192 HIS G 206 1 ? 15 
HELX_P HELX_P200 AW2 SER G 108 ? ARG G 114 ? SER G 214 ARG G 220 1 ? 7  
HELX_P HELX_P201 AW3 ARG G 114 ? ARG G 120 ? ARG G 220 ARG G 226 1 ? 7  
HELX_P HELX_P202 AW4 THR G 126 ? GLY G 143 ? THR G 232 GLY G 249 1 ? 18 
HELX_P HELX_P203 AW5 ILE G 144 ? TYR G 151 ? ILE G 250 TYR G 257 1 ? 8  
HELX_P HELX_P204 AW6 ILE G 154 ? GLY G 168 ? ILE G 260 GLY G 274 1 ? 15 
HELX_P HELX_P205 AW7 PRO G 185 ? ILE G 194 ? PRO G 291 ILE G 300 5 ? 10 
HELX_P HELX_P206 AW8 ASP G 203 ? GLY G 218 ? ASP G 309 GLY G 324 1 ? 16 
HELX_P HELX_P207 AW9 ASP G 224 ? PHE G 231 ? ASP G 330 PHE G 337 1 ? 8  
HELX_P HELX_P208 AX1 GLU G 249 ? ALA G 267 ? GLU G 355 ALA G 373 1 ? 19 
HELX_P HELX_P209 AX2 HIS G 270 ? ASP G 288 ? HIS G 376 ASP G 394 1 ? 19 
HELX_P HELX_P210 AX3 ASP G 289 ? ILE G 291 ? ASP G 395 ILE G 397 5 ? 3  
HELX_P HELX_P211 AX4 ALA G 296 ? GLY G 298 ? ALA G 402 GLY G 404 5 ? 3  
HELX_P HELX_P212 AX5 THR G 305 ? ASP G 308 ? THR G 411 ASP G 414 5 ? 4  
HELX_P HELX_P213 AX6 ASP G 309 ? THR G 314 ? ASP G 415 THR G 420 1 ? 6  
HELX_P HELX_P214 AX7 LYS G 315 ? THR G 317 ? LYS G 421 THR G 423 5 ? 3  
HELX_P HELX_P215 AX8 ASP G 318 ? SER G 327 ? ASP G 424 SER G 433 1 ? 10 
HELX_P HELX_P216 AX9 ASP G 329 ? LYS G 331 ? ASP G 435 LYS G 437 5 ? 3  
HELX_P HELX_P217 AY1 LEU G 332 ? ARG G 345 ? LEU G 438 ARG G 451 1 ? 14 
HELX_P HELX_P218 AY2 LYS G 363 ? GLU G 368 ? LYS G 469 GLU G 474 5 ? 6  
HELX_P HELX_P219 AY3 SER G 369 ? ALA G 377 ? SER G 475 ALA G 483 1 ? 9  
HELX_P HELX_P220 AY4 LYS G 388 ? GLU G 390 ? LYS G 494 GLU G 496 5 ? 3  
HELX_P HELX_P221 AY5 ASN G 407 ? VAL G 412 ? ASN G 513 VAL G 518 5 ? 6  
HELX_P HELX_P222 AY6 ASP G 452 ? ARG G 470 ? ASP G 558 ARG G 576 1 ? 19 
HELX_P HELX_P223 AY7 ASP G 477 ? ALA G 482 ? ASP G 583 ALA G 588 1 ? 6  
HELX_P HELX_P224 AY8 HIS H 23  ? ASP H 31  ? HIS H 129 ASP H 137 1 ? 9  
HELX_P HELX_P225 AY9 THR H 32  ? ARG H 37  ? THR H 138 ARG H 143 1 ? 6  
HELX_P HELX_P226 AZ1 LEU H 38  ? ILE H 41  ? LEU H 144 ILE H 147 5 ? 4  
HELX_P HELX_P227 AZ2 LEU H 44  ? VAL H 50  ? LEU H 150 VAL H 156 5 ? 7  
HELX_P HELX_P228 AZ3 ASN H 57  ? GLN H 80  ? ASN H 163 GLN H 186 1 ? 24 
HELX_P HELX_P229 AZ4 PRO H 81  ? GLN H 84  ? PRO H 187 GLN H 190 5 ? 4  
HELX_P HELX_P230 AZ5 SER H 86  ? HIS H 100 ? SER H 192 HIS H 206 1 ? 15 
HELX_P HELX_P231 AZ6 SER H 108 ? ARG H 114 ? SER H 214 ARG H 220 1 ? 7  
HELX_P HELX_P232 AZ7 ARG H 114 ? ARG H 120 ? ARG H 220 ARG H 226 1 ? 7  
HELX_P HELX_P233 AZ8 THR H 126 ? GLY H 143 ? THR H 232 GLY H 249 1 ? 18 
HELX_P HELX_P234 AZ9 ILE H 144 ? TYR H 151 ? ILE H 250 TYR H 257 1 ? 8  
HELX_P HELX_P235 BA1 ILE H 154 ? GLY H 168 ? ILE H 260 GLY H 274 1 ? 15 
HELX_P HELX_P236 BA2 PRO H 185 ? ILE H 194 ? PRO H 291 ILE H 300 5 ? 10 
HELX_P HELX_P237 BA3 ASP H 203 ? GLY H 218 ? ASP H 309 GLY H 324 1 ? 16 
HELX_P HELX_P238 BA4 ASP H 224 ? PHE H 231 ? ASP H 330 PHE H 337 1 ? 8  
HELX_P HELX_P239 BA5 GLU H 249 ? ALA H 267 ? GLU H 355 ALA H 373 1 ? 19 
HELX_P HELX_P240 BA6 HIS H 270 ? ASP H 288 ? HIS H 376 ASP H 394 1 ? 19 
HELX_P HELX_P241 BA7 ASP H 289 ? ILE H 291 ? ASP H 395 ILE H 397 5 ? 3  
HELX_P HELX_P242 BA8 ALA H 296 ? GLY H 298 ? ALA H 402 GLY H 404 5 ? 3  
HELX_P HELX_P243 BA9 THR H 305 ? ASP H 308 ? THR H 411 ASP H 414 5 ? 4  
HELX_P HELX_P244 BB1 ASP H 309 ? THR H 314 ? ASP H 415 THR H 420 1 ? 6  
HELX_P HELX_P245 BB2 LYS H 315 ? THR H 317 ? LYS H 421 THR H 423 5 ? 3  
HELX_P HELX_P246 BB3 ASP H 318 ? SER H 327 ? ASP H 424 SER H 433 1 ? 10 
HELX_P HELX_P247 BB4 ASP H 329 ? LYS H 331 ? ASP H 435 LYS H 437 5 ? 3  
HELX_P HELX_P248 BB5 LEU H 332 ? ARG H 345 ? LEU H 438 ARG H 451 1 ? 14 
HELX_P HELX_P249 BB6 LYS H 363 ? GLU H 368 ? LYS H 469 GLU H 474 5 ? 6  
HELX_P HELX_P250 BB7 SER H 369 ? ALA H 377 ? SER H 475 ALA H 483 1 ? 9  
HELX_P HELX_P251 BB8 LYS H 388 ? GLU H 390 ? LYS H 494 GLU H 496 5 ? 3  
HELX_P HELX_P252 BB9 ASN H 407 ? VAL H 412 ? ASN H 513 VAL H 518 5 ? 6  
HELX_P HELX_P253 BC1 ASP H 452 ? ARG H 470 ? ASP H 558 ARG H 576 1 ? 19 
HELX_P HELX_P254 BC2 ASP H 477 ? ALA H 482 ? ASP H 583 ALA H 588 1 ? 6  
HELX_P HELX_P255 BC3 LYS H 489 ? ASN H 493 ? LYS H 595 ASN H 599 5 ? 5  
HELX_P HELX_P256 BC4 HIS I 23  ? ASP I 31  ? HIS I 129 ASP I 137 1 ? 9  
HELX_P HELX_P257 BC5 THR I 32  ? ARG I 37  ? THR I 138 ARG I 143 1 ? 6  
HELX_P HELX_P258 BC6 LEU I 38  ? ILE I 41  ? LEU I 144 ILE I 147 5 ? 4  
HELX_P HELX_P259 BC7 LEU I 44  ? VAL I 50  ? LEU I 150 VAL I 156 5 ? 7  
HELX_P HELX_P260 BC8 ASN I 57  ? GLN I 80  ? ASN I 163 GLN I 186 1 ? 24 
HELX_P HELX_P261 BC9 PRO I 81  ? GLN I 84  ? PRO I 187 GLN I 190 5 ? 4  
HELX_P HELX_P262 BD1 SER I 86  ? HIS I 100 ? SER I 192 HIS I 206 1 ? 15 
HELX_P HELX_P263 BD2 SER I 108 ? ARG I 114 ? SER I 214 ARG I 220 1 ? 7  
HELX_P HELX_P264 BD3 ARG I 114 ? ARG I 120 ? ARG I 220 ARG I 226 1 ? 7  
HELX_P HELX_P265 BD4 THR I 126 ? GLY I 143 ? THR I 232 GLY I 249 1 ? 18 
HELX_P HELX_P266 BD5 ILE I 144 ? TYR I 151 ? ILE I 250 TYR I 257 1 ? 8  
HELX_P HELX_P267 BD6 ILE I 154 ? GLY I 168 ? ILE I 260 GLY I 274 1 ? 15 
HELX_P HELX_P268 BD7 PRO I 185 ? ILE I 194 ? PRO I 291 ILE I 300 5 ? 10 
HELX_P HELX_P269 BD8 ASP I 203 ? GLY I 218 ? ASP I 309 GLY I 324 1 ? 16 
HELX_P HELX_P270 BD9 ASP I 224 ? PHE I 231 ? ASP I 330 PHE I 337 1 ? 8  
HELX_P HELX_P271 BE1 GLU I 249 ? ALA I 267 ? GLU I 355 ALA I 373 1 ? 19 
HELX_P HELX_P272 BE2 HIS I 270 ? ASP I 288 ? HIS I 376 ASP I 394 1 ? 19 
HELX_P HELX_P273 BE3 ASP I 289 ? ILE I 291 ? ASP I 395 ILE I 397 5 ? 3  
HELX_P HELX_P274 BE4 ALA I 296 ? GLY I 298 ? ALA I 402 GLY I 404 5 ? 3  
HELX_P HELX_P275 BE5 THR I 305 ? ASP I 308 ? THR I 411 ASP I 414 5 ? 4  
HELX_P HELX_P276 BE6 ASP I 309 ? THR I 314 ? ASP I 415 THR I 420 1 ? 6  
HELX_P HELX_P277 BE7 LYS I 315 ? THR I 317 ? LYS I 421 THR I 423 5 ? 3  
HELX_P HELX_P278 BE8 ASP I 318 ? SER I 327 ? ASP I 424 SER I 433 1 ? 10 
HELX_P HELX_P279 BE9 ASP I 329 ? LYS I 331 ? ASP I 435 LYS I 437 5 ? 3  
HELX_P HELX_P280 BF1 LEU I 332 ? ARG I 345 ? LEU I 438 ARG I 451 1 ? 14 
HELX_P HELX_P281 BF2 LYS I 363 ? GLU I 368 ? LYS I 469 GLU I 474 5 ? 6  
HELX_P HELX_P282 BF3 SER I 369 ? ALA I 377 ? SER I 475 ALA I 483 1 ? 9  
HELX_P HELX_P283 BF4 LYS I 388 ? GLU I 390 ? LYS I 494 GLU I 496 5 ? 3  
HELX_P HELX_P284 BF5 ASN I 407 ? VAL I 412 ? ASN I 513 VAL I 518 5 ? 6  
HELX_P HELX_P285 BF6 ASP I 452 ? ARG I 470 ? ASP I 558 ARG I 576 1 ? 19 
HELX_P HELX_P286 BF7 ASP I 477 ? ALA I 482 ? ASP I 583 ALA I 588 1 ? 6  
HELX_P HELX_P287 BF8 ILE I 485 ? ASN I 493 ? ILE I 591 ASN I 599 5 ? 9  
HELX_P HELX_P288 BF9 HIS J 23  ? ASP J 31  ? HIS J 129 ASP J 137 1 ? 9  
HELX_P HELX_P289 BG1 THR J 32  ? ARG J 37  ? THR J 138 ARG J 143 1 ? 6  
HELX_P HELX_P290 BG2 LEU J 38  ? ILE J 41  ? LEU J 144 ILE J 147 5 ? 4  
HELX_P HELX_P291 BG3 LEU J 44  ? VAL J 50  ? LEU J 150 VAL J 156 5 ? 7  
HELX_P HELX_P292 BG4 ASN J 57  ? GLN J 80  ? ASN J 163 GLN J 186 1 ? 24 
HELX_P HELX_P293 BG5 PRO J 81  ? GLN J 84  ? PRO J 187 GLN J 190 5 ? 4  
HELX_P HELX_P294 BG6 SER J 86  ? HIS J 100 ? SER J 192 HIS J 206 1 ? 15 
HELX_P HELX_P295 BG7 SER J 108 ? ARG J 114 ? SER J 214 ARG J 220 1 ? 7  
HELX_P HELX_P296 BG8 ARG J 114 ? ARG J 120 ? ARG J 220 ARG J 226 1 ? 7  
HELX_P HELX_P297 BG9 THR J 126 ? GLY J 143 ? THR J 232 GLY J 249 1 ? 18 
HELX_P HELX_P298 BH1 ILE J 144 ? TYR J 151 ? ILE J 250 TYR J 257 1 ? 8  
HELX_P HELX_P299 BH2 ILE J 154 ? GLY J 168 ? ILE J 260 GLY J 274 1 ? 15 
HELX_P HELX_P300 BH3 PRO J 185 ? ILE J 194 ? PRO J 291 ILE J 300 5 ? 10 
HELX_P HELX_P301 BH4 ASP J 203 ? GLY J 218 ? ASP J 309 GLY J 324 1 ? 16 
HELX_P HELX_P302 BH5 ASP J 224 ? PHE J 231 ? ASP J 330 PHE J 337 1 ? 8  
HELX_P HELX_P303 BH6 GLU J 249 ? ALA J 267 ? GLU J 355 ALA J 373 1 ? 19 
HELX_P HELX_P304 BH7 HIS J 270 ? ASP J 288 ? HIS J 376 ASP J 394 1 ? 19 
HELX_P HELX_P305 BH8 ASP J 289 ? ILE J 291 ? ASP J 395 ILE J 397 5 ? 3  
HELX_P HELX_P306 BH9 ALA J 296 ? GLY J 298 ? ALA J 402 GLY J 404 5 ? 3  
HELX_P HELX_P307 BI1 THR J 305 ? ASP J 308 ? THR J 411 ASP J 414 5 ? 4  
HELX_P HELX_P308 BI2 ASP J 309 ? THR J 314 ? ASP J 415 THR J 420 1 ? 6  
HELX_P HELX_P309 BI3 LYS J 315 ? THR J 317 ? LYS J 421 THR J 423 5 ? 3  
HELX_P HELX_P310 BI4 ASP J 318 ? SER J 327 ? ASP J 424 SER J 433 1 ? 10 
HELX_P HELX_P311 BI5 ASP J 329 ? LYS J 331 ? ASP J 435 LYS J 437 5 ? 3  
HELX_P HELX_P312 BI6 LEU J 332 ? ARG J 345 ? LEU J 438 ARG J 451 1 ? 14 
HELX_P HELX_P313 BI7 LYS J 363 ? GLU J 368 ? LYS J 469 GLU J 474 5 ? 6  
HELX_P HELX_P314 BI8 SER J 369 ? ALA J 377 ? SER J 475 ALA J 483 1 ? 9  
HELX_P HELX_P315 BI9 LYS J 388 ? GLU J 390 ? LYS J 494 GLU J 496 5 ? 3  
HELX_P HELX_P316 BJ1 ASN J 407 ? VAL J 412 ? ASN J 513 VAL J 518 5 ? 6  
HELX_P HELX_P317 BJ2 ASP J 452 ? ARG J 470 ? ASP J 558 ARG J 576 1 ? 19 
HELX_P HELX_P318 BJ3 ASP J 477 ? ALA J 482 ? ASP J 583 ALA J 588 1 ? 6  
HELX_P HELX_P319 BJ4 ILE J 485 ? LYS J 489 ? ILE J 591 LYS J 595 5 ? 5  
HELX_P HELX_P320 BJ5 HIS K 23  ? ASP K 31  ? HIS K 129 ASP K 137 1 ? 9  
HELX_P HELX_P321 BJ6 THR K 32  ? ARG K 37  ? THR K 138 ARG K 143 1 ? 6  
HELX_P HELX_P322 BJ7 LEU K 38  ? ILE K 41  ? LEU K 144 ILE K 147 5 ? 4  
HELX_P HELX_P323 BJ8 LEU K 44  ? VAL K 50  ? LEU K 150 VAL K 156 5 ? 7  
HELX_P HELX_P324 BJ9 ASN K 57  ? GLN K 80  ? ASN K 163 GLN K 186 1 ? 24 
HELX_P HELX_P325 BK1 PRO K 81  ? GLN K 84  ? PRO K 187 GLN K 190 5 ? 4  
HELX_P HELX_P326 BK2 SER K 86  ? HIS K 100 ? SER K 192 HIS K 206 1 ? 15 
HELX_P HELX_P327 BK3 SER K 108 ? ARG K 114 ? SER K 214 ARG K 220 1 ? 7  
HELX_P HELX_P328 BK4 ARG K 114 ? ARG K 120 ? ARG K 220 ARG K 226 1 ? 7  
HELX_P HELX_P329 BK5 THR K 126 ? GLY K 143 ? THR K 232 GLY K 249 1 ? 18 
HELX_P HELX_P330 BK6 ILE K 144 ? TYR K 151 ? ILE K 250 TYR K 257 1 ? 8  
HELX_P HELX_P331 BK7 ILE K 154 ? GLY K 168 ? ILE K 260 GLY K 274 1 ? 15 
HELX_P HELX_P332 BK8 PRO K 185 ? ILE K 194 ? PRO K 291 ILE K 300 5 ? 10 
HELX_P HELX_P333 BK9 ASP K 203 ? GLY K 218 ? ASP K 309 GLY K 324 1 ? 16 
HELX_P HELX_P334 BL1 ASP K 224 ? PHE K 231 ? ASP K 330 PHE K 337 1 ? 8  
HELX_P HELX_P335 BL2 GLU K 249 ? ALA K 267 ? GLU K 355 ALA K 373 1 ? 19 
HELX_P HELX_P336 BL3 HIS K 270 ? ASP K 288 ? HIS K 376 ASP K 394 1 ? 19 
HELX_P HELX_P337 BL4 ASP K 289 ? ILE K 291 ? ASP K 395 ILE K 397 5 ? 3  
HELX_P HELX_P338 BL5 ALA K 296 ? GLY K 298 ? ALA K 402 GLY K 404 5 ? 3  
HELX_P HELX_P339 BL6 THR K 305 ? ASP K 308 ? THR K 411 ASP K 414 5 ? 4  
HELX_P HELX_P340 BL7 ASP K 309 ? THR K 314 ? ASP K 415 THR K 420 1 ? 6  
HELX_P HELX_P341 BL8 LYS K 315 ? THR K 317 ? LYS K 421 THR K 423 5 ? 3  
HELX_P HELX_P342 BL9 ASP K 318 ? SER K 327 ? ASP K 424 SER K 433 1 ? 10 
HELX_P HELX_P343 BM1 ASP K 329 ? LYS K 331 ? ASP K 435 LYS K 437 5 ? 3  
HELX_P HELX_P344 BM2 LEU K 332 ? ARG K 345 ? LEU K 438 ARG K 451 1 ? 14 
HELX_P HELX_P345 BM3 LYS K 363 ? GLU K 368 ? LYS K 469 GLU K 474 5 ? 6  
HELX_P HELX_P346 BM4 SER K 369 ? ALA K 377 ? SER K 475 ALA K 483 1 ? 9  
HELX_P HELX_P347 BM5 LYS K 388 ? GLU K 390 ? LYS K 494 GLU K 496 5 ? 3  
HELX_P HELX_P348 BM6 ASN K 407 ? VAL K 412 ? ASN K 513 VAL K 518 5 ? 6  
HELX_P HELX_P349 BM7 ASP K 452 ? ARG K 470 ? ASP K 558 ARG K 576 1 ? 19 
HELX_P HELX_P350 BM8 ASP K 477 ? ALA K 482 ? ASP K 583 ALA K 588 1 ? 6  
HELX_P HELX_P351 BM9 ILE K 485 ? ASN K 493 ? ILE K 591 ASN K 599 5 ? 9  
HELX_P HELX_P352 BN1 HIS L 23  ? ASP L 31  ? HIS L 129 ASP L 137 1 ? 9  
HELX_P HELX_P353 BN2 THR L 32  ? ARG L 37  ? THR L 138 ARG L 143 1 ? 6  
HELX_P HELX_P354 BN3 LEU L 38  ? ILE L 41  ? LEU L 144 ILE L 147 5 ? 4  
HELX_P HELX_P355 BN4 LEU L 44  ? VAL L 50  ? LEU L 150 VAL L 156 5 ? 7  
HELX_P HELX_P356 BN5 ASN L 57  ? GLN L 80  ? ASN L 163 GLN L 186 1 ? 24 
HELX_P HELX_P357 BN6 PRO L 81  ? GLN L 84  ? PRO L 187 GLN L 190 5 ? 4  
HELX_P HELX_P358 BN7 SER L 86  ? HIS L 100 ? SER L 192 HIS L 206 1 ? 15 
HELX_P HELX_P359 BN8 SER L 108 ? ARG L 114 ? SER L 214 ARG L 220 1 ? 7  
HELX_P HELX_P360 BN9 ARG L 114 ? ARG L 120 ? ARG L 220 ARG L 226 1 ? 7  
HELX_P HELX_P361 BO1 THR L 126 ? GLY L 143 ? THR L 232 GLY L 249 1 ? 18 
HELX_P HELX_P362 BO2 ILE L 144 ? TYR L 151 ? ILE L 250 TYR L 257 1 ? 8  
HELX_P HELX_P363 BO3 ILE L 154 ? GLY L 168 ? ILE L 260 GLY L 274 1 ? 15 
HELX_P HELX_P364 BO4 PRO L 185 ? ILE L 194 ? PRO L 291 ILE L 300 5 ? 10 
HELX_P HELX_P365 BO5 ASP L 203 ? GLY L 218 ? ASP L 309 GLY L 324 1 ? 16 
HELX_P HELX_P366 BO6 ASP L 224 ? PHE L 231 ? ASP L 330 PHE L 337 1 ? 8  
HELX_P HELX_P367 BO7 GLU L 249 ? ALA L 267 ? GLU L 355 ALA L 373 1 ? 19 
HELX_P HELX_P368 BO8 HIS L 270 ? ASP L 288 ? HIS L 376 ASP L 394 1 ? 19 
HELX_P HELX_P369 BO9 ASP L 289 ? ILE L 291 ? ASP L 395 ILE L 397 5 ? 3  
HELX_P HELX_P370 BP1 ALA L 296 ? GLY L 298 ? ALA L 402 GLY L 404 5 ? 3  
HELX_P HELX_P371 BP2 THR L 305 ? ASP L 308 ? THR L 411 ASP L 414 5 ? 4  
HELX_P HELX_P372 BP3 ASP L 309 ? THR L 314 ? ASP L 415 THR L 420 1 ? 6  
HELX_P HELX_P373 BP4 LYS L 315 ? THR L 317 ? LYS L 421 THR L 423 5 ? 3  
HELX_P HELX_P374 BP5 ASP L 318 ? SER L 327 ? ASP L 424 SER L 433 1 ? 10 
HELX_P HELX_P375 BP6 ASP L 329 ? LYS L 331 ? ASP L 435 LYS L 437 5 ? 3  
HELX_P HELX_P376 BP7 LEU L 332 ? ARG L 345 ? LEU L 438 ARG L 451 1 ? 14 
HELX_P HELX_P377 BP8 LYS L 363 ? GLU L 368 ? LYS L 469 GLU L 474 5 ? 6  
HELX_P HELX_P378 BP9 SER L 369 ? ALA L 377 ? SER L 475 ALA L 483 1 ? 9  
HELX_P HELX_P379 BQ1 LYS L 388 ? GLU L 390 ? LYS L 494 GLU L 496 5 ? 3  
HELX_P HELX_P380 BQ2 ASN L 407 ? VAL L 412 ? ASN L 513 VAL L 518 5 ? 6  
HELX_P HELX_P381 BQ3 ASP L 452 ? ARG L 470 ? ASP L 558 ARG L 576 1 ? 19 
HELX_P HELX_P382 BQ4 ASP L 477 ? ALA L 482 ? ASP L 583 ALA L 588 1 ? 6  
HELX_P HELX_P383 BQ5 ILE L 485 ? ASN L 493 ? ILE L 591 ASN L 599 5 ? 9  
HELX_P HELX_P384 BQ6 HIS M 23  ? ASP M 31  ? HIS M 129 ASP M 137 1 ? 9  
HELX_P HELX_P385 BQ7 THR M 32  ? ARG M 37  ? THR M 138 ARG M 143 1 ? 6  
HELX_P HELX_P386 BQ8 LEU M 38  ? ILE M 41  ? LEU M 144 ILE M 147 5 ? 4  
HELX_P HELX_P387 BQ9 LEU M 44  ? VAL M 50  ? LEU M 150 VAL M 156 5 ? 7  
HELX_P HELX_P388 BR1 ASN M 57  ? GLN M 80  ? ASN M 163 GLN M 186 1 ? 24 
HELX_P HELX_P389 BR2 PRO M 81  ? GLN M 84  ? PRO M 187 GLN M 190 5 ? 4  
HELX_P HELX_P390 BR3 SER M 86  ? HIS M 100 ? SER M 192 HIS M 206 1 ? 15 
HELX_P HELX_P391 BR4 SER M 108 ? ARG M 114 ? SER M 214 ARG M 220 1 ? 7  
HELX_P HELX_P392 BR5 ARG M 114 ? ARG M 120 ? ARG M 220 ARG M 226 1 ? 7  
HELX_P HELX_P393 BR6 THR M 126 ? GLY M 143 ? THR M 232 GLY M 249 1 ? 18 
HELX_P HELX_P394 BR7 ILE M 144 ? TYR M 151 ? ILE M 250 TYR M 257 1 ? 8  
HELX_P HELX_P395 BR8 ILE M 154 ? GLY M 168 ? ILE M 260 GLY M 274 1 ? 15 
HELX_P HELX_P396 BR9 PRO M 185 ? ILE M 194 ? PRO M 291 ILE M 300 5 ? 10 
HELX_P HELX_P397 BS1 ASP M 203 ? GLY M 218 ? ASP M 309 GLY M 324 1 ? 16 
HELX_P HELX_P398 BS2 ASP M 224 ? PHE M 231 ? ASP M 330 PHE M 337 1 ? 8  
HELX_P HELX_P399 BS3 GLU M 249 ? ALA M 267 ? GLU M 355 ALA M 373 1 ? 19 
HELX_P HELX_P400 BS4 HIS M 270 ? ASP M 288 ? HIS M 376 ASP M 394 1 ? 19 
HELX_P HELX_P401 BS5 ASP M 289 ? ILE M 291 ? ASP M 395 ILE M 397 5 ? 3  
HELX_P HELX_P402 BS6 ALA M 296 ? GLY M 298 ? ALA M 402 GLY M 404 5 ? 3  
HELX_P HELX_P403 BS7 THR M 305 ? ASP M 308 ? THR M 411 ASP M 414 5 ? 4  
HELX_P HELX_P404 BS8 ASP M 309 ? THR M 314 ? ASP M 415 THR M 420 1 ? 6  
HELX_P HELX_P405 BS9 LYS M 315 ? THR M 317 ? LYS M 421 THR M 423 5 ? 3  
HELX_P HELX_P406 BT1 ASP M 318 ? SER M 327 ? ASP M 424 SER M 433 1 ? 10 
HELX_P HELX_P407 BT2 ASP M 329 ? LYS M 331 ? ASP M 435 LYS M 437 5 ? 3  
HELX_P HELX_P408 BT3 LEU M 332 ? ARG M 345 ? LEU M 438 ARG M 451 1 ? 14 
HELX_P HELX_P409 BT4 LYS M 363 ? GLU M 368 ? LYS M 469 GLU M 474 5 ? 6  
HELX_P HELX_P410 BT5 SER M 369 ? ALA M 377 ? SER M 475 ALA M 483 1 ? 9  
HELX_P HELX_P411 BT6 LYS M 388 ? GLU M 390 ? LYS M 494 GLU M 496 5 ? 3  
HELX_P HELX_P412 BT7 ASN M 407 ? VAL M 412 ? ASN M 513 VAL M 518 5 ? 6  
HELX_P HELX_P413 BT8 ASP M 452 ? ARG M 470 ? ASP M 558 ARG M 576 1 ? 19 
HELX_P HELX_P414 BT9 ASP M 477 ? ALA M 482 ? ASP M 583 ALA M 588 1 ? 6  
HELX_P HELX_P415 BU1 ILE M 485 ? LYS M 489 ? ILE M 591 LYS M 595 5 ? 5  
HELX_P HELX_P416 BU2 HIS N 23  ? ASP N 31  ? HIS N 129 ASP N 137 1 ? 9  
HELX_P HELX_P417 BU3 THR N 32  ? ARG N 37  ? THR N 138 ARG N 143 1 ? 6  
HELX_P HELX_P418 BU4 LEU N 38  ? ILE N 41  ? LEU N 144 ILE N 147 5 ? 4  
HELX_P HELX_P419 BU5 LEU N 44  ? VAL N 50  ? LEU N 150 VAL N 156 5 ? 7  
HELX_P HELX_P420 BU6 ASN N 57  ? GLN N 80  ? ASN N 163 GLN N 186 1 ? 24 
HELX_P HELX_P421 BU7 PRO N 81  ? GLN N 84  ? PRO N 187 GLN N 190 5 ? 4  
HELX_P HELX_P422 BU8 SER N 86  ? HIS N 100 ? SER N 192 HIS N 206 1 ? 15 
HELX_P HELX_P423 BU9 SER N 108 ? ARG N 114 ? SER N 214 ARG N 220 1 ? 7  
HELX_P HELX_P424 BV1 ARG N 114 ? ARG N 120 ? ARG N 220 ARG N 226 1 ? 7  
HELX_P HELX_P425 BV2 THR N 126 ? GLY N 143 ? THR N 232 GLY N 249 1 ? 18 
HELX_P HELX_P426 BV3 ILE N 144 ? TYR N 151 ? ILE N 250 TYR N 257 1 ? 8  
HELX_P HELX_P427 BV4 ILE N 154 ? GLY N 168 ? ILE N 260 GLY N 274 1 ? 15 
HELX_P HELX_P428 BV5 PRO N 185 ? ILE N 194 ? PRO N 291 ILE N 300 5 ? 10 
HELX_P HELX_P429 BV6 ASP N 203 ? GLY N 218 ? ASP N 309 GLY N 324 1 ? 16 
HELX_P HELX_P430 BV7 ASP N 224 ? PHE N 231 ? ASP N 330 PHE N 337 1 ? 8  
HELX_P HELX_P431 BV8 GLU N 249 ? ALA N 267 ? GLU N 355 ALA N 373 1 ? 19 
HELX_P HELX_P432 BV9 HIS N 270 ? ASP N 288 ? HIS N 376 ASP N 394 1 ? 19 
HELX_P HELX_P433 BW1 ASP N 289 ? ILE N 291 ? ASP N 395 ILE N 397 5 ? 3  
HELX_P HELX_P434 BW2 ALA N 296 ? GLY N 298 ? ALA N 402 GLY N 404 5 ? 3  
HELX_P HELX_P435 BW3 THR N 305 ? ASP N 308 ? THR N 411 ASP N 414 5 ? 4  
HELX_P HELX_P436 BW4 ASP N 309 ? THR N 314 ? ASP N 415 THR N 420 1 ? 6  
HELX_P HELX_P437 BW5 LYS N 315 ? THR N 317 ? LYS N 421 THR N 423 5 ? 3  
HELX_P HELX_P438 BW6 ASP N 318 ? SER N 327 ? ASP N 424 SER N 433 1 ? 10 
HELX_P HELX_P439 BW7 ASP N 329 ? LYS N 331 ? ASP N 435 LYS N 437 5 ? 3  
HELX_P HELX_P440 BW8 LEU N 332 ? ARG N 345 ? LEU N 438 ARG N 451 1 ? 14 
HELX_P HELX_P441 BW9 LYS N 363 ? GLU N 368 ? LYS N 469 GLU N 474 5 ? 6  
HELX_P HELX_P442 BX1 SER N 369 ? ALA N 377 ? SER N 475 ALA N 483 1 ? 9  
HELX_P HELX_P443 BX2 LYS N 388 ? GLU N 390 ? LYS N 494 GLU N 496 5 ? 3  
HELX_P HELX_P444 BX3 ASN N 407 ? VAL N 412 ? ASN N 513 VAL N 518 5 ? 6  
HELX_P HELX_P445 BX4 ASP N 452 ? ARG N 470 ? ASP N 558 ARG N 576 1 ? 19 
HELX_P HELX_P446 BX5 ASP N 477 ? ALA N 482 ? ASP N 583 ALA N 588 1 ? 6  
HELX_P HELX_P447 BX6 ILE N 485 ? ASN N 493 ? ILE N 591 ASN N 599 5 ? 9  
HELX_P HELX_P448 BX7 HIS O 23  ? ASP O 31  ? HIS O 129 ASP O 137 1 ? 9  
HELX_P HELX_P449 BX8 THR O 32  ? ARG O 37  ? THR O 138 ARG O 143 1 ? 6  
HELX_P HELX_P450 BX9 LEU O 38  ? ILE O 41  ? LEU O 144 ILE O 147 5 ? 4  
HELX_P HELX_P451 BY1 LEU O 44  ? VAL O 50  ? LEU O 150 VAL O 156 5 ? 7  
HELX_P HELX_P452 BY2 ASN O 57  ? GLN O 80  ? ASN O 163 GLN O 186 1 ? 24 
HELX_P HELX_P453 BY3 PRO O 81  ? GLN O 84  ? PRO O 187 GLN O 190 5 ? 4  
HELX_P HELX_P454 BY4 SER O 86  ? HIS O 100 ? SER O 192 HIS O 206 1 ? 15 
HELX_P HELX_P455 BY5 SER O 108 ? ARG O 114 ? SER O 214 ARG O 220 1 ? 7  
HELX_P HELX_P456 BY6 ARG O 114 ? ARG O 120 ? ARG O 220 ARG O 226 1 ? 7  
HELX_P HELX_P457 BY7 THR O 126 ? GLY O 143 ? THR O 232 GLY O 249 1 ? 18 
HELX_P HELX_P458 BY8 ILE O 144 ? TYR O 151 ? ILE O 250 TYR O 257 1 ? 8  
HELX_P HELX_P459 BY9 ILE O 154 ? GLY O 168 ? ILE O 260 GLY O 274 1 ? 15 
HELX_P HELX_P460 BZ1 PRO O 185 ? ILE O 194 ? PRO O 291 ILE O 300 5 ? 10 
HELX_P HELX_P461 BZ2 ASP O 203 ? GLY O 218 ? ASP O 309 GLY O 324 1 ? 16 
HELX_P HELX_P462 BZ3 ASP O 224 ? PHE O 231 ? ASP O 330 PHE O 337 1 ? 8  
HELX_P HELX_P463 BZ4 GLU O 249 ? ALA O 267 ? GLU O 355 ALA O 373 1 ? 19 
HELX_P HELX_P464 BZ5 HIS O 270 ? ASP O 288 ? HIS O 376 ASP O 394 1 ? 19 
HELX_P HELX_P465 BZ6 ASP O 289 ? ILE O 291 ? ASP O 395 ILE O 397 5 ? 3  
HELX_P HELX_P466 BZ7 ALA O 296 ? GLY O 298 ? ALA O 402 GLY O 404 5 ? 3  
HELX_P HELX_P467 BZ8 THR O 305 ? ASP O 308 ? THR O 411 ASP O 414 5 ? 4  
HELX_P HELX_P468 BZ9 ASP O 309 ? THR O 314 ? ASP O 415 THR O 420 1 ? 6  
HELX_P HELX_P469 CA1 LYS O 315 ? THR O 317 ? LYS O 421 THR O 423 5 ? 3  
HELX_P HELX_P470 CA2 ASP O 318 ? SER O 327 ? ASP O 424 SER O 433 1 ? 10 
HELX_P HELX_P471 CA3 ASP O 329 ? LYS O 331 ? ASP O 435 LYS O 437 5 ? 3  
HELX_P HELX_P472 CA4 LEU O 332 ? ARG O 345 ? LEU O 438 ARG O 451 1 ? 14 
HELX_P HELX_P473 CA5 LYS O 363 ? GLU O 368 ? LYS O 469 GLU O 474 5 ? 6  
HELX_P HELX_P474 CA6 SER O 369 ? ALA O 377 ? SER O 475 ALA O 483 1 ? 9  
HELX_P HELX_P475 CA7 LYS O 388 ? GLU O 390 ? LYS O 494 GLU O 496 5 ? 3  
HELX_P HELX_P476 CA8 ASN O 407 ? VAL O 412 ? ASN O 513 VAL O 518 5 ? 6  
HELX_P HELX_P477 CA9 ASP O 452 ? ARG O 470 ? ASP O 558 ARG O 576 1 ? 19 
HELX_P HELX_P478 CB1 ASP O 477 ? ALA O 482 ? ASP O 583 ALA O 588 1 ? 6  
HELX_P HELX_P479 CB2 HIS P 23  ? ASP P 31  ? HIS P 129 ASP P 137 1 ? 9  
HELX_P HELX_P480 CB3 THR P 32  ? ARG P 37  ? THR P 138 ARG P 143 1 ? 6  
HELX_P HELX_P481 CB4 LEU P 38  ? ILE P 41  ? LEU P 144 ILE P 147 5 ? 4  
HELX_P HELX_P482 CB5 LEU P 44  ? VAL P 50  ? LEU P 150 VAL P 156 5 ? 7  
HELX_P HELX_P483 CB6 ASN P 57  ? GLN P 80  ? ASN P 163 GLN P 186 1 ? 24 
HELX_P HELX_P484 CB7 PRO P 81  ? GLN P 84  ? PRO P 187 GLN P 190 5 ? 4  
HELX_P HELX_P485 CB8 SER P 86  ? HIS P 100 ? SER P 192 HIS P 206 1 ? 15 
HELX_P HELX_P486 CB9 SER P 108 ? ARG P 114 ? SER P 214 ARG P 220 1 ? 7  
HELX_P HELX_P487 CC1 ARG P 114 ? ARG P 120 ? ARG P 220 ARG P 226 1 ? 7  
HELX_P HELX_P488 CC2 THR P 126 ? GLY P 143 ? THR P 232 GLY P 249 1 ? 18 
HELX_P HELX_P489 CC3 ILE P 144 ? TYR P 151 ? ILE P 250 TYR P 257 1 ? 8  
HELX_P HELX_P490 CC4 ILE P 154 ? GLY P 168 ? ILE P 260 GLY P 274 1 ? 15 
HELX_P HELX_P491 CC5 PRO P 185 ? ILE P 194 ? PRO P 291 ILE P 300 5 ? 10 
HELX_P HELX_P492 CC6 ASP P 203 ? GLY P 218 ? ASP P 309 GLY P 324 1 ? 16 
HELX_P HELX_P493 CC7 ASP P 224 ? PHE P 231 ? ASP P 330 PHE P 337 1 ? 8  
HELX_P HELX_P494 CC8 GLU P 249 ? ALA P 267 ? GLU P 355 ALA P 373 1 ? 19 
HELX_P HELX_P495 CC9 HIS P 270 ? ASP P 288 ? HIS P 376 ASP P 394 1 ? 19 
HELX_P HELX_P496 CD1 ASP P 289 ? ILE P 291 ? ASP P 395 ILE P 397 5 ? 3  
HELX_P HELX_P497 CD2 ALA P 296 ? GLY P 298 ? ALA P 402 GLY P 404 5 ? 3  
HELX_P HELX_P498 CD3 THR P 305 ? ASP P 308 ? THR P 411 ASP P 414 5 ? 4  
HELX_P HELX_P499 CD4 ASP P 309 ? THR P 314 ? ASP P 415 THR P 420 1 ? 6  
HELX_P HELX_P500 CD5 LYS P 315 ? THR P 317 ? LYS P 421 THR P 423 5 ? 3  
HELX_P HELX_P501 CD6 ASP P 318 ? SER P 327 ? ASP P 424 SER P 433 1 ? 10 
HELX_P HELX_P502 CD7 ASP P 329 ? LYS P 331 ? ASP P 435 LYS P 437 5 ? 3  
HELX_P HELX_P503 CD8 LEU P 332 ? ARG P 345 ? LEU P 438 ARG P 451 1 ? 14 
HELX_P HELX_P504 CD9 LYS P 363 ? GLU P 368 ? LYS P 469 GLU P 474 5 ? 6  
HELX_P HELX_P505 CE1 SER P 369 ? ALA P 377 ? SER P 475 ALA P 483 1 ? 9  
HELX_P HELX_P506 CE2 LYS P 388 ? GLU P 390 ? LYS P 494 GLU P 496 5 ? 3  
HELX_P HELX_P507 CE3 ASN P 407 ? VAL P 412 ? ASN P 513 VAL P 518 5 ? 6  
HELX_P HELX_P508 CE4 ASP P 452 ? ARG P 470 ? ASP P 558 ARG P 576 1 ? 19 
HELX_P HELX_P509 CE5 ASP P 477 ? ALA P 482 ? ASP P 583 ALA P 588 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? A  HIS 61  NE2 ? ? ? 1_555 Q  FE  . FE    ? ? A HIS 167 A FE  701 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
metalc2   metalc ? ? A  HIS 100 NE2 ? ? ? 1_555 Q  FE  . FE    ? ? A HIS 206 A FE  701 1_555 ? ? ? ? ? ? ? 2.455 ? ? 
metalc3   metalc ? ? A  ASP 101 OD2 ? ? ? 1_555 Q  FE  . FE    ? ? A ASP 207 A FE  701 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc4   metalc ? ? A  ASP 203 OD2 ? ? ? 1_555 R  MG  . MG    ? ? A ASP 309 A MG  702 1_555 ? ? ? ? ? ? ? 2.910 ? ? 
metalc5   metalc ? ? A  ASP 205 OD1 ? ? ? 1_555 Q  FE  . FE    ? ? A ASP 311 A FE  701 1_555 ? ? ? ? ? ? ? 1.962 ? ? 
metalc6   metalc ? ? Q  FE  .   FE  ? ? ? 1_555 T  1FZ . O1A   ? ? A FE  701 A 1FZ 704 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc7   metalc ? ? R  MG  .   MG  ? ? ? 1_555 T  1FZ . O2G   ? ? A MG  702 A 1FZ 704 1_555 ? ? ? ? ? ? ? 2.535 ? ? 
metalc8   metalc ? ? R  MG  .   MG  ? ? ? 1_555 T  1FZ . O2B   ? ? A MG  702 A 1FZ 704 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc9   metalc ? ? S  MG  .   MG  ? ? ? 1_555 U  GTP . O3G   ? ? A MG  703 A GTP 705 1_555 ? ? ? ? ? ? ? 2.909 ? ? 
metalc10  metalc ? ? S  MG  .   MG  ? ? ? 1_555 U  GTP . O1B   ? ? A MG  703 A GTP 705 1_555 ? ? ? ? ? ? ? 2.464 ? ? 
metalc11  metalc ? ? S  MG  .   MG  ? ? ? 1_555 DA DTP . O1B   ? ? A MG  703 C DTP 701 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc12  metalc ? ? S  MG  .   MG  ? ? ? 1_555 DA DTP . O1G   ? ? A MG  703 C DTP 701 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc13  metalc ? ? V  DTP .   O1G ? ? ? 1_555 GA MG  . MG    ? ? A DTP 706 C MG  704 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc14  metalc ? ? V  DTP .   O1B ? ? ? 1_555 GA MG  . MG    ? ? A DTP 706 C MG  704 1_555 ? ? ? ? ? ? ? 2.194 ? ? 
metalc15  metalc ? ? B  HIS 61  NE2 ? ? ? 1_555 W  FE  . FE    ? ? B HIS 167 B FE  701 1_555 ? ? ? ? ? ? ? 2.059 ? ? 
metalc16  metalc ? ? B  HIS 100 NE2 ? ? ? 1_555 W  FE  . FE    ? ? B HIS 206 B FE  701 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc17  metalc ? ? B  ASP 101 OD2 ? ? ? 1_555 W  FE  . FE    ? ? B ASP 207 B FE  701 1_555 ? ? ? ? ? ? ? 1.808 ? ? 
metalc18  metalc ? ? B  ASP 203 OD2 ? ? ? 1_555 X  MG  . MG    ? ? B ASP 309 B MG  702 1_555 ? ? ? ? ? ? ? 2.852 ? ? 
metalc19  metalc ? ? B  ASP 205 OD1 ? ? ? 1_555 W  FE  . FE    ? ? B ASP 311 B FE  701 1_555 ? ? ? ? ? ? ? 2.119 ? ? 
metalc20  metalc ? ? W  FE  .   FE  ? ? ? 1_555 Z  1FZ . O1A   ? ? B FE  701 B 1FZ 704 1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc21  metalc ? ? X  MG  .   MG  ? ? ? 1_555 Z  1FZ . O2B   ? ? B MG  702 B 1FZ 704 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc22  metalc ? ? X  MG  .   MG  ? ? ? 1_555 Z  1FZ . O2G   ? ? B MG  702 B 1FZ 704 1_555 ? ? ? ? ? ? ? 2.126 ? ? 
metalc23  metalc ? ? Y  MG  .   MG  ? ? ? 1_555 AA GTP . O1G   ? ? B MG  703 B GTP 705 1_555 ? ? ? ? ? ? ? 1.950 ? ? 
metalc24  metalc ? ? Y  MG  .   MG  ? ? ? 1_555 AA GTP . O1B   ? ? B MG  703 B GTP 705 1_555 ? ? ? ? ? ? ? 2.245 ? ? 
metalc25  metalc ? ? Y  MG  .   MG  ? ? ? 1_555 JA DTP . O3G   ? ? B MG  703 D DTP 701 1_555 ? ? ? ? ? ? ? 2.636 ? ? 
metalc26  metalc ? ? Y  MG  .   MG  ? ? ? 1_555 JA DTP . O1B   ? ? B MG  703 D DTP 701 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc27  metalc ? ? CA DTP .   O1G ? ? ? 1_555 NA MG  . MG    ? ? B DTP 707 D MG  705 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc28  metalc ? ? CA DTP .   O1B ? ? ? 1_555 NA MG  . MG    ? ? B DTP 707 D MG  705 1_555 ? ? ? ? ? ? ? 2.568 ? ? 
metalc29  metalc ? ? C  HIS 61  NE2 ? ? ? 1_555 EA FE  . FE    ? ? C HIS 167 C FE  702 1_555 ? ? ? ? ? ? ? 2.045 ? ? 
metalc30  metalc ? ? C  HIS 100 NE2 ? ? ? 1_555 EA FE  . FE    ? ? C HIS 206 C FE  702 1_555 ? ? ? ? ? ? ? 2.239 ? ? 
metalc31  metalc ? ? C  ASP 101 OD2 ? ? ? 1_555 EA FE  . FE    ? ? C ASP 207 C FE  702 1_555 ? ? ? ? ? ? ? 1.885 ? ? 
metalc32  metalc ? ? C  ASP 205 OD1 ? ? ? 1_555 EA FE  . FE    ? ? C ASP 311 C FE  702 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
metalc33  metalc ? ? EA FE  .   FE  ? ? ? 1_555 HA 1FZ . O1A   ? ? C FE  702 C 1FZ 705 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
metalc34  metalc ? ? FA MG  .   MG  ? ? ? 1_555 HA 1FZ . O2G   ? ? C MG  703 C 1FZ 705 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc35  metalc ? ? FA MG  .   MG  ? ? ? 1_555 HA 1FZ . O2B   ? ? C MG  703 C 1FZ 705 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc36  metalc ? ? GA MG  .   MG  ? ? ? 1_555 KA GTP . O1G   ? ? C MG  704 D GTP 702 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc37  metalc ? ? GA MG  .   MG  ? ? ? 1_555 KA GTP . O1B   ? ? C MG  704 D GTP 702 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
metalc38  metalc ? ? GA MG  .   MG  ? ? ? 1_555 KA GTP . O2A   ? ? C MG  704 D GTP 702 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc39  metalc ? ? D  HIS 61  NE2 ? ? ? 1_555 LA FE  . FE    ? ? D HIS 167 D FE  703 1_555 ? ? ? ? ? ? ? 2.227 ? ? 
metalc40  metalc ? ? D  HIS 100 NE2 ? ? ? 1_555 LA FE  . FE    ? ? D HIS 206 D FE  703 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc41  metalc ? ? D  ASP 101 OD2 ? ? ? 1_555 LA FE  . FE    ? ? D ASP 207 D FE  703 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc42  metalc ? ? D  ASP 203 OD2 ? ? ? 1_555 MA MG  . MG    ? ? D ASP 309 D MG  704 1_555 ? ? ? ? ? ? ? 2.787 ? ? 
metalc43  metalc ? ? D  ASP 205 OD1 ? ? ? 1_555 LA FE  . FE    ? ? D ASP 311 D FE  703 1_555 ? ? ? ? ? ? ? 1.942 ? ? 
metalc44  metalc ? ? LA FE  .   FE  ? ? ? 1_555 OA 1FZ . O1A   ? ? D FE  703 D 1FZ 706 1_555 ? ? ? ? ? ? ? 1.797 ? ? 
metalc45  metalc ? ? MA MG  .   MG  ? ? ? 1_555 OA 1FZ . O2B   ? ? D MG  704 D 1FZ 706 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc46  metalc ? ? MA MG  .   MG  ? ? ? 1_555 OA 1FZ . O2G   ? ? D MG  704 D 1FZ 706 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc47  metalc ? ? NA MG  .   MG  ? ? ? 1_555 PA GTP . O1G   ? ? D MG  705 D GTP 707 1_555 ? ? ? ? ? ? ? 1.887 ? ? 
metalc48  metalc ? ? NA MG  .   MG  ? ? ? 1_555 PA GTP . O1B   ? ? D MG  705 D GTP 707 1_555 ? ? ? ? ? ? ? 2.245 ? ? 
metalc49  metalc ? ? E  HIS 61  NE2 ? ? ? 1_555 RA FE  . FE    ? ? E HIS 167 E FE  701 1_555 ? ? ? ? ? ? ? 1.970 ? ? 
metalc50  metalc ? ? E  HIS 100 NE2 ? ? ? 1_555 RA FE  . FE    ? ? E HIS 206 E FE  701 1_555 ? ? ? ? ? ? ? 2.231 ? ? 
metalc51  metalc ? ? E  ASP 101 OD2 ? ? ? 1_555 RA FE  . FE    ? ? E ASP 207 E FE  701 1_555 ? ? ? ? ? ? ? 1.850 ? ? 
metalc52  metalc ? ? E  ASP 205 OD1 ? ? ? 1_555 RA FE  . FE    ? ? E ASP 311 E FE  701 1_555 ? ? ? ? ? ? ? 2.133 ? ? 
metalc53  metalc ? ? RA FE  .   FE  ? ? ? 1_555 UA 1FZ . O1A   ? ? E FE  701 E 1FZ 704 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc54  metalc ? ? SA MG  .   MG  ? ? ? 1_555 UA 1FZ . O2B   ? ? E MG  702 E 1FZ 704 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
metalc55  metalc ? ? TA MG  .   MG  ? ? ? 1_555 VA GTP . O1B   ? ? E MG  703 E GTP 705 1_555 ? ? ? ? ? ? ? 2.682 ? ? 
metalc56  metalc ? ? TA MG  .   MG  ? ? ? 1_555 VA GTP . O1G   ? ? E MG  703 E GTP 705 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc57  metalc ? ? TA MG  .   MG  ? ? ? 1_555 VA GTP . O2A   ? ? E MG  703 E GTP 705 1_555 ? ? ? ? ? ? ? 2.937 ? ? 
metalc58  metalc ? ? TA MG  .   MG  ? ? ? 1_555 FB DTP . O3G   ? ? E MG  703 G DTP 701 1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc59  metalc ? ? TA MG  .   MG  ? ? ? 1_555 FB DTP . O1B   ? ? E MG  703 G DTP 701 1_555 ? ? ? ? ? ? ? 2.493 ? ? 
metalc60  metalc ? ? XA DTP .   O1G ? ? ? 1_555 IB MG  . MG    ? ? E DTP 707 G MG  704 1_555 ? ? ? ? ? ? ? 2.634 ? ? 
metalc61  metalc ? ? XA DTP .   O1B ? ? ? 1_555 IB MG  . MG    ? ? E DTP 707 G MG  704 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc62  metalc ? ? F  HIS 61  NE2 ? ? ? 1_555 YA FE  . FE    ? ? F HIS 167 F FE  701 1_555 ? ? ? ? ? ? ? 2.124 ? ? 
metalc63  metalc ? ? F  HIS 100 NE2 ? ? ? 1_555 YA FE  . FE    ? ? F HIS 206 F FE  701 1_555 ? ? ? ? ? ? ? 2.469 ? ? 
metalc64  metalc ? ? F  ASP 101 OD2 ? ? ? 1_555 YA FE  . FE    ? ? F ASP 207 F FE  701 1_555 ? ? ? ? ? ? ? 1.833 ? ? 
metalc65  metalc ? ? F  ASP 205 OD1 ? ? ? 1_555 YA FE  . FE    ? ? F ASP 311 F FE  701 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc66  metalc ? ? YA FE  .   FE  ? ? ? 1_555 BB 1FZ . O1A   ? ? F FE  701 F 1FZ 704 1_555 ? ? ? ? ? ? ? 2.199 ? ? 
metalc67  metalc ? ? ZA MG  .   MG  ? ? ? 1_555 BB 1FZ . O3G   ? ? F MG  702 F 1FZ 704 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc68  metalc ? ? ZA MG  .   MG  ? ? ? 1_555 BB 1FZ . O2B   ? ? F MG  702 F 1FZ 704 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc69  metalc ? ? AB MG  .   MG  ? ? ? 1_555 CB GTP . O1B   ? ? F MG  703 F GTP 705 1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc70  metalc ? ? AB MG  .   MG  ? ? ? 1_555 CB GTP . O1G   ? ? F MG  703 F GTP 705 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc71  metalc ? ? AB MG  .   MG  ? ? ? 1_555 LB DTP . O1B   ? ? F MG  703 H DTP 701 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc72  metalc ? ? AB MG  .   MG  ? ? ? 1_555 LB DTP . O1G   ? ? F MG  703 H DTP 701 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc73  metalc ? ? EB DTP .   O1G ? ? ? 1_555 OB MG  . MG    ? ? F DTP 707 H MG  704 1_555 ? ? ? ? ? ? ? 2.433 ? ? 
metalc74  metalc ? ? EB DTP .   O1B ? ? ? 1_555 OB MG  . MG    ? ? F DTP 707 H MG  704 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc75  metalc ? ? G  HIS 61  NE2 ? ? ? 1_555 GB FE  . FE    ? ? G HIS 167 G FE  702 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
metalc76  metalc ? ? G  HIS 100 NE2 ? ? ? 1_555 GB FE  . FE    ? ? G HIS 206 G FE  702 1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc77  metalc ? ? G  ASP 101 OD2 ? ? ? 1_555 GB FE  . FE    ? ? G ASP 207 G FE  702 1_555 ? ? ? ? ? ? ? 1.968 ? ? 
metalc78  metalc ? ? G  ASP 205 OD1 ? ? ? 1_555 GB FE  . FE    ? ? G ASP 311 G FE  702 1_555 ? ? ? ? ? ? ? 1.941 ? ? 
metalc79  metalc ? ? GB FE  .   FE  ? ? ? 1_555 JB 1FZ . O1A   ? ? G FE  702 G 1FZ 705 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc80  metalc ? ? HB MG  .   MG  ? ? ? 1_555 JB 1FZ . O2B   ? ? G MG  703 G 1FZ 705 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc81  metalc ? ? HB MG  .   MG  ? ? ? 1_555 JB 1FZ . O2G   ? ? G MG  703 G 1FZ 705 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc82  metalc ? ? IB MG  .   MG  ? ? ? 1_555 KB GTP . "O3'" ? ? G MG  704 G GTP 706 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc83  metalc ? ? IB MG  .   MG  ? ? ? 1_555 KB GTP . O1G   ? ? G MG  704 G GTP 706 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc84  metalc ? ? IB MG  .   MG  ? ? ? 1_555 KB GTP . O2A   ? ? G MG  704 G GTP 706 1_555 ? ? ? ? ? ? ? 2.288 ? ? 
metalc85  metalc ? ? IB MG  .   MG  ? ? ? 1_555 KB GTP . O1B   ? ? G MG  704 G GTP 706 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc86  metalc ? ? H  HIS 61  NE2 ? ? ? 1_555 MB FE  . FE    ? ? H HIS 167 H FE  702 1_555 ? ? ? ? ? ? ? 2.180 ? ? 
metalc87  metalc ? ? H  HIS 100 NE2 ? ? ? 1_555 MB FE  . FE    ? ? H HIS 206 H FE  702 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc88  metalc ? ? H  ASP 101 OD2 ? ? ? 1_555 MB FE  . FE    ? ? H ASP 207 H FE  702 1_555 ? ? ? ? ? ? ? 1.908 ? ? 
metalc89  metalc ? ? H  ASP 205 OD1 ? ? ? 1_555 MB FE  . FE    ? ? H ASP 311 H FE  702 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
metalc90  metalc ? ? MB FE  .   FE  ? ? ? 1_555 PB 1FZ . O1A   ? ? H FE  702 H 1FZ 705 1_555 ? ? ? ? ? ? ? 1.750 ? ? 
metalc91  metalc ? ? NB MG  .   MG  ? ? ? 1_555 PB 1FZ . O2G   ? ? H MG  703 H 1FZ 705 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc92  metalc ? ? NB MG  .   MG  ? ? ? 1_555 PB 1FZ . O2B   ? ? H MG  703 H 1FZ 705 1_555 ? ? ? ? ? ? ? 2.145 ? ? 
metalc93  metalc ? ? OB MG  .   MG  ? ? ? 1_555 QB GTP . O1G   ? ? H MG  704 H GTP 706 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc94  metalc ? ? OB MG  .   MG  ? ? ? 1_555 QB GTP . O1B   ? ? H MG  704 H GTP 706 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc95  metalc ? ? OB MG  .   MG  ? ? ? 1_555 QB GTP . O2A   ? ? H MG  704 H GTP 706 1_555 ? ? ? ? ? ? ? 1.724 ? ? 
metalc96  metalc ? ? I  HIS 61  NE2 ? ? ? 1_555 SB FE  . FE    ? ? I HIS 167 I FE  701 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc97  metalc ? ? I  HIS 100 NE2 ? ? ? 1_555 SB FE  . FE    ? ? I HIS 206 I FE  701 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc98  metalc ? ? I  ASP 205 OD1 ? ? ? 1_555 SB FE  . FE    ? ? I ASP 311 I FE  701 1_555 ? ? ? ? ? ? ? 2.430 ? ? 
metalc99  metalc ? ? SB FE  .   FE  ? ? ? 1_555 VB 1FZ . O1A   ? ? I FE  701 I 1FZ 704 1_555 ? ? ? ? ? ? ? 1.930 ? ? 
metalc100 metalc ? ? TB MG  .   MG  ? ? ? 1_555 VB 1FZ . O2B   ? ? I MG  702 I 1FZ 704 1_555 ? ? ? ? ? ? ? 2.045 ? ? 
metalc101 metalc ? ? TB MG  .   MG  ? ? ? 1_555 VB 1FZ . O2G   ? ? I MG  702 I 1FZ 704 1_555 ? ? ? ? ? ? ? 2.536 ? ? 
metalc102 metalc ? ? UB MG  .   MG  ? ? ? 1_555 WB GTP . O1B   ? ? I MG  703 I GTP 705 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc103 metalc ? ? UB MG  .   MG  ? ? ? 1_555 WB GTP . O3G   ? ? I MG  703 I GTP 705 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc104 metalc ? ? UB MG  .   MG  ? ? ? 1_555 GC DTP . O1B   ? ? I MG  703 K DTP 701 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc105 metalc ? ? UB MG  .   MG  ? ? ? 1_555 GC DTP . O3G   ? ? I MG  703 K DTP 701 1_555 ? ? ? ? ? ? ? 1.835 ? ? 
metalc106 metalc ? ? YB GTP .   O1G ? ? ? 1_555 CC MG  . MG    ? ? I GTP 707 J MG  703 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc107 metalc ? ? YB GTP .   O1B ? ? ? 1_555 CC MG  . MG    ? ? I GTP 707 J MG  703 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc108 metalc ? ? ZB DTP .   O1G ? ? ? 1_555 JC MG  . MG    ? ? I DTP 708 K MG  704 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc109 metalc ? ? ZB DTP .   O1B ? ? ? 1_555 JC MG  . MG    ? ? I DTP 708 K MG  704 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc110 metalc ? ? J  HIS 61  NE2 ? ? ? 1_555 AC FE  . FE    ? ? J HIS 167 J FE  701 1_555 ? ? ? ? ? ? ? 1.913 ? ? 
metalc111 metalc ? ? J  HIS 100 NE2 ? ? ? 1_555 AC FE  . FE    ? ? J HIS 206 J FE  701 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc112 metalc ? ? J  ASP 205 OD1 ? ? ? 1_555 AC FE  . FE    ? ? J ASP 311 J FE  701 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc113 metalc ? ? AC FE  .   FE  ? ? ? 1_555 DC 1FZ . O1A   ? ? J FE  701 J 1FZ 704 1_555 ? ? ? ? ? ? ? 1.736 ? ? 
metalc114 metalc ? ? BC MG  .   MG  ? ? ? 1_555 DC 1FZ . O2B   ? ? J MG  702 J 1FZ 704 1_555 ? ? ? ? ? ? ? 2.012 ? ? 
metalc115 metalc ? ? BC MG  .   MG  ? ? ? 1_555 DC 1FZ . O2G   ? ? J MG  702 J 1FZ 704 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc116 metalc ? ? CC MG  .   MG  ? ? ? 1_555 NC DTP . O1G   ? ? J MG  703 L DTP 701 1_555 ? ? ? ? ? ? ? 2.642 ? ? 
metalc117 metalc ? ? CC MG  .   MG  ? ? ? 1_555 NC DTP . O1B   ? ? J MG  703 L DTP 701 1_555 ? ? ? ? ? ? ? 1.859 ? ? 
metalc118 metalc ? ? FC DTP .   O1G ? ? ? 1_555 QC MG  . MG    ? ? J DTP 706 L MG  704 1_555 ? ? ? ? ? ? ? 2.594 ? ? 
metalc119 metalc ? ? FC DTP .   O1B ? ? ? 1_555 QC MG  . MG    ? ? J DTP 706 L MG  704 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc120 metalc ? ? K  HIS 61  NE2 ? ? ? 1_555 HC FE  . FE    ? ? K HIS 167 K FE  702 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
metalc121 metalc ? ? K  HIS 100 NE2 ? ? ? 1_555 HC FE  . FE    ? ? K HIS 206 K FE  702 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc122 metalc ? ? K  ASP 101 OD2 ? ? ? 1_555 HC FE  . FE    ? ? K ASP 207 K FE  702 1_555 ? ? ? ? ? ? ? 2.112 ? ? 
metalc123 metalc ? ? K  ASP 205 OD1 ? ? ? 1_555 HC FE  . FE    ? ? K ASP 311 K FE  702 1_555 ? ? ? ? ? ? ? 1.834 ? ? 
metalc124 metalc ? ? HC FE  .   FE  ? ? ? 1_555 KC 1FZ . O1A   ? ? K FE  702 K 1FZ 705 1_555 ? ? ? ? ? ? ? 1.996 ? ? 
metalc125 metalc ? ? IC MG  .   MG  ? ? ? 1_555 KC 1FZ . O2B   ? ? K MG  703 K 1FZ 705 1_555 ? ? ? ? ? ? ? 1.878 ? ? 
metalc126 metalc ? ? IC MG  .   MG  ? ? ? 1_555 KC 1FZ . O2G   ? ? K MG  703 K 1FZ 705 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc127 metalc ? ? JC MG  .   MG  ? ? ? 1_555 LC GTP . O1G   ? ? K MG  704 K GTP 706 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc128 metalc ? ? JC MG  .   MG  ? ? ? 1_555 LC GTP . O1B   ? ? K MG  704 K GTP 706 1_555 ? ? ? ? ? ? ? 2.072 ? ? 
metalc129 metalc ? ? L  HIS 61  NE2 ? ? ? 1_555 OC FE  . FE    ? ? L HIS 167 L FE  702 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc130 metalc ? ? L  HIS 100 NE2 ? ? ? 1_555 OC FE  . FE    ? ? L HIS 206 L FE  702 1_555 ? ? ? ? ? ? ? 2.585 ? ? 
metalc131 metalc ? ? L  ASP 101 OD2 ? ? ? 1_555 OC FE  . FE    ? ? L ASP 207 L FE  702 1_555 ? ? ? ? ? ? ? 2.016 ? ? 
metalc132 metalc ? ? L  ASP 205 OD1 ? ? ? 1_555 OC FE  . FE    ? ? L ASP 311 L FE  702 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc133 metalc ? ? PC MG  .   MG  ? ? ? 1_555 RC 1FZ . O2B   ? ? L MG  703 L 1FZ 705 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc134 metalc ? ? PC MG  .   MG  ? ? ? 1_555 RC 1FZ . O2G   ? ? L MG  703 L 1FZ 705 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc135 metalc ? ? QC MG  .   MG  ? ? ? 1_555 SC GTP . O1G   ? ? L MG  704 L GTP 706 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc136 metalc ? ? QC MG  .   MG  ? ? ? 1_555 SC GTP . O1B   ? ? L MG  704 L GTP 706 1_555 ? ? ? ? ? ? ? 1.842 ? ? 
metalc137 metalc ? ? QC MG  .   MG  ? ? ? 1_555 SC GTP . O2A   ? ? L MG  704 L GTP 706 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc138 metalc ? ? M  HIS 61  NE2 ? ? ? 1_555 TC FE  . FE    ? ? M HIS 167 M FE  701 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc139 metalc ? ? M  HIS 100 NE2 ? ? ? 1_555 TC FE  . FE    ? ? M HIS 206 M FE  701 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc140 metalc ? ? M  ASP 101 OD2 ? ? ? 1_555 TC FE  . FE    ? ? M ASP 207 M FE  701 1_555 ? ? ? ? ? ? ? 1.784 ? ? 
metalc141 metalc ? ? M  ASP 205 OD1 ? ? ? 1_555 TC FE  . FE    ? ? M ASP 311 M FE  701 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc142 metalc ? ? TC FE  .   FE  ? ? ? 1_555 WC 1FZ . O1A   ? ? M FE  701 M 1FZ 704 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc143 metalc ? ? UC MG  .   MG  ? ? ? 1_555 WC 1FZ . O2B   ? ? M MG  702 M 1FZ 704 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc144 metalc ? ? UC MG  .   MG  ? ? ? 1_555 WC 1FZ . O2G   ? ? M MG  702 M 1FZ 704 1_555 ? ? ? ? ? ? ? 2.219 ? ? 
metalc145 metalc ? ? VC MG  .   MG  ? ? ? 1_555 XC GTP . O1G   ? ? M MG  703 M GTP 705 1_555 ? ? ? ? ? ? ? 1.703 ? ? 
metalc146 metalc ? ? VC MG  .   MG  ? ? ? 1_555 XC GTP . O2A   ? ? M MG  703 M GTP 705 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc147 metalc ? ? VC MG  .   MG  ? ? ? 1_555 AD DTP . O3G   ? ? M MG  703 N DTP 701 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc148 metalc ? ? VC MG  .   MG  ? ? ? 1_555 AD DTP . O1B   ? ? M MG  703 N DTP 701 1_555 ? ? ? ? ? ? ? 2.679 ? ? 
metalc149 metalc ? ? YC DTP .   O3G ? ? ? 1_555 DD MG  . MG    ? ? M DTP 706 N MG  704 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc150 metalc ? ? YC DTP .   O1B ? ? ? 1_555 DD MG  . MG    ? ? M DTP 706 N MG  704 1_555 ? ? ? ? ? ? ? 2.085 ? ? 
metalc151 metalc ? ? ZC DTP .   O1B ? ? ? 1_555 KD MG  . MG    ? ? M DTP 707 O MG  703 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc152 metalc ? ? N  HIS 61  NE2 ? ? ? 1_555 BD FE  . FE    ? ? N HIS 167 N FE  702 1_555 ? ? ? ? ? ? ? 1.852 ? ? 
metalc153 metalc ? ? N  HIS 100 NE2 ? ? ? 1_555 BD FE  . FE    ? ? N HIS 206 N FE  702 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc154 metalc ? ? N  ASP 205 OD1 ? ? ? 1_555 BD FE  . FE    ? ? N ASP 311 N FE  702 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc155 metalc ? ? BD FE  .   FE  ? ? ? 1_555 ED 1FZ . O1A   ? ? N FE  702 N 1FZ 705 1_555 ? ? ? ? ? ? ? 1.952 ? ? 
metalc156 metalc ? ? CD MG  .   MG  ? ? ? 1_555 ED 1FZ . O2G   ? ? N MG  703 N 1FZ 705 1_555 ? ? ? ? ? ? ? 2.651 ? ? 
metalc157 metalc ? ? CD MG  .   MG  ? ? ? 1_555 ED 1FZ . O2B   ? ? N MG  703 N 1FZ 705 1_555 ? ? ? ? ? ? ? 1.725 ? ? 
metalc158 metalc ? ? DD MG  .   MG  ? ? ? 1_555 FD GTP . O1G   ? ? N MG  704 N GTP 706 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc159 metalc ? ? DD MG  .   MG  ? ? ? 1_555 FD GTP . O2A   ? ? N MG  704 N GTP 706 1_555 ? ? ? ? ? ? ? 2.900 ? ? 
metalc160 metalc ? ? DD MG  .   MG  ? ? ? 1_555 FD GTP . "O3'" ? ? N MG  704 N GTP 706 1_555 ? ? ? ? ? ? ? 2.792 ? ? 
metalc161 metalc ? ? HD DTP .   O1G ? ? ? 1_555 QD MG  . MG    ? ? N DTP 708 P MG  703 1_555 ? ? ? ? ? ? ? 2.898 ? ? 
metalc162 metalc ? ? HD DTP .   O3G ? ? ? 1_555 QD MG  . MG    ? ? N DTP 708 P MG  703 1_555 ? ? ? ? ? ? ? 2.956 ? ? 
metalc163 metalc ? ? HD DTP .   O1B ? ? ? 1_555 QD MG  . MG    ? ? N DTP 708 P MG  703 1_555 ? ? ? ? ? ? ? 2.493 ? ? 
metalc164 metalc ? ? O  HIS 61  NE2 ? ? ? 1_555 ID FE  . FE    ? ? O HIS 167 O FE  701 1_555 ? ? ? ? ? ? ? 1.898 ? ? 
metalc165 metalc ? ? O  HIS 100 NE2 ? ? ? 1_555 ID FE  . FE    ? ? O HIS 206 O FE  701 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc166 metalc ? ? O  ASP 101 OD2 ? ? ? 1_555 ID FE  . FE    ? ? O ASP 207 O FE  701 1_555 ? ? ? ? ? ? ? 2.063 ? ? 
metalc167 metalc ? ? O  ASP 203 OD2 ? ? ? 1_555 JD MG  . MG    ? ? O ASP 309 O MG  702 1_555 ? ? ? ? ? ? ? 2.938 ? ? 
metalc168 metalc ? ? O  ASP 205 OD1 ? ? ? 1_555 ID FE  . FE    ? ? O ASP 311 O FE  701 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc169 metalc ? ? ID FE  .   FE  ? ? ? 1_555 LD 1FZ . O1A   ? ? O FE  701 O 1FZ 704 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc170 metalc ? ? JD MG  .   MG  ? ? ? 1_555 LD 1FZ . O2G   ? ? O MG  702 O 1FZ 704 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc171 metalc ? ? JD MG  .   MG  ? ? ? 1_555 LD 1FZ . O2B   ? ? O MG  702 O 1FZ 704 1_555 ? ? ? ? ? ? ? 1.982 ? ? 
metalc172 metalc ? ? KD MG  .   MG  ? ? ? 1_555 MD GTP . O1G   ? ? O MG  703 O GTP 705 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc173 metalc ? ? KD MG  .   MG  ? ? ? 1_555 MD GTP . O1B   ? ? O MG  703 O GTP 705 1_555 ? ? ? ? ? ? ? 2.218 ? ? 
metalc174 metalc ? ? KD MG  .   MG  ? ? ? 1_555 MD GTP . O2A   ? ? O MG  703 O GTP 705 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc175 metalc ? ? P  HIS 61  NE2 ? ? ? 1_555 OD FE  . FE    ? ? P HIS 167 P FE  701 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc176 metalc ? ? P  HIS 100 NE2 ? ? ? 1_555 OD FE  . FE    ? ? P HIS 206 P FE  701 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc177 metalc ? ? P  ASP 101 OD2 ? ? ? 1_555 OD FE  . FE    ? ? P ASP 207 P FE  701 1_555 ? ? ? ? ? ? ? 1.999 ? ? 
metalc178 metalc ? ? P  ASP 205 OD1 ? ? ? 1_555 OD FE  . FE    ? ? P ASP 311 P FE  701 1_555 ? ? ? ? ? ? ? 1.907 ? ? 
metalc179 metalc ? ? OD FE  .   FE  ? ? ? 1_555 RD 1FZ . O1A   ? ? P FE  701 P 1FZ 704 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc180 metalc ? ? PD MG  .   MG  ? ? ? 1_555 RD 1FZ . O2B   ? ? P MG  702 P 1FZ 704 1_555 ? ? ? ? ? ? ? 2.532 ? ? 
metalc181 metalc ? ? PD MG  .   MG  ? ? ? 1_555 RD 1FZ . O2G   ? ? P MG  702 P 1FZ 704 1_555 ? ? ? ? ? ? ? 2.599 ? ? 
metalc182 metalc ? ? QD MG  .   MG  ? ? ? 1_555 SD GTP . O3G   ? ? P MG  703 P GTP 705 1_555 ? ? ? ? ? ? ? 1.896 ? ? 
metalc183 metalc ? ? QD MG  .   MG  ? ? ? 1_555 SD GTP . O1B   ? ? P MG  703 P GTP 705 1_555 ? ? ? ? ? ? ? 2.176 ? ? 
metalc184 metalc ? ? QD MG  .   MG  ? ? ? 1_555 SD GTP . O2A   ? ? P MG  703 P GTP 705 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   NE2   ? A  HIS 61  ? A HIS 167 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 NE2   ? A  HIS 100 ? A HIS 206 ? 1_555 93.9  ? 
2   NE2   ? A  HIS 61  ? A HIS 167 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 OD2   ? A  ASP 101 ? A ASP 207 ? 1_555 103.7 ? 
3   NE2   ? A  HIS 100 ? A HIS 206 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 OD2   ? A  ASP 101 ? A ASP 207 ? 1_555 74.6  ? 
4   NE2   ? A  HIS 61  ? A HIS 167 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 OD1   ? A  ASP 205 ? A ASP 311 ? 1_555 91.3  ? 
5   NE2   ? A  HIS 100 ? A HIS 206 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 OD1   ? A  ASP 205 ? A ASP 311 ? 1_555 71.7  ? 
6   OD2   ? A  ASP 101 ? A ASP 207 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 OD1   ? A  ASP 205 ? A ASP 311 ? 1_555 143.9 ? 
7   NE2   ? A  HIS 61  ? A HIS 167 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 O1A   ? T  1FZ .   ? A 1FZ 704 ? 1_555 112.1 ? 
8   NE2   ? A  HIS 100 ? A HIS 206 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 O1A   ? T  1FZ .   ? A 1FZ 704 ? 1_555 153.2 ? 
9   OD2   ? A  ASP 101 ? A ASP 207 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 O1A   ? T  1FZ .   ? A 1FZ 704 ? 1_555 92.3  ? 
10  OD1   ? A  ASP 205 ? A ASP 311 ? 1_555 FE ? Q  FE . ? A FE 701 ? 1_555 O1A   ? T  1FZ .   ? A 1FZ 704 ? 1_555 112.4 ? 
11  OD2   ? A  ASP 203 ? A ASP 309 ? 1_555 MG ? R  MG . ? A MG 702 ? 1_555 O2G   ? T  1FZ .   ? A 1FZ 704 ? 1_555 110.6 ? 
12  OD2   ? A  ASP 203 ? A ASP 309 ? 1_555 MG ? R  MG . ? A MG 702 ? 1_555 O2B   ? T  1FZ .   ? A 1FZ 704 ? 1_555 167.5 ? 
13  O2G   ? T  1FZ .   ? A 1FZ 704 ? 1_555 MG ? R  MG . ? A MG 702 ? 1_555 O2B   ? T  1FZ .   ? A 1FZ 704 ? 1_555 65.1  ? 
14  O3G   ? U  GTP .   ? A GTP 705 ? 1_555 MG ? S  MG . ? A MG 703 ? 1_555 O1B   ? U  GTP .   ? A GTP 705 ? 1_555 59.8  ? 
15  O3G   ? U  GTP .   ? A GTP 705 ? 1_555 MG ? S  MG . ? A MG 703 ? 1_555 O1B   ? DA DTP .   ? C DTP 701 ? 1_555 124.9 ? 
16  O1B   ? U  GTP .   ? A GTP 705 ? 1_555 MG ? S  MG . ? A MG 703 ? 1_555 O1B   ? DA DTP .   ? C DTP 701 ? 1_555 70.9  ? 
17  O3G   ? U  GTP .   ? A GTP 705 ? 1_555 MG ? S  MG . ? A MG 703 ? 1_555 O1G   ? DA DTP .   ? C DTP 701 ? 1_555 62.4  ? 
18  O1B   ? U  GTP .   ? A GTP 705 ? 1_555 MG ? S  MG . ? A MG 703 ? 1_555 O1G   ? DA DTP .   ? C DTP 701 ? 1_555 68.0  ? 
19  O1B   ? DA DTP .   ? C DTP 701 ? 1_555 MG ? S  MG . ? A MG 703 ? 1_555 O1G   ? DA DTP .   ? C DTP 701 ? 1_555 78.0  ? 
20  O1G   ? V  DTP .   ? A DTP 706 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O1B   ? V  DTP .   ? A DTP 706 ? 1_555 85.0  ? 
21  O1G   ? V  DTP .   ? A DTP 706 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O1G   ? KA GTP .   ? D GTP 702 ? 1_555 79.0  ? 
22  O1B   ? V  DTP .   ? A DTP 706 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O1G   ? KA GTP .   ? D GTP 702 ? 1_555 144.3 ? 
23  O1G   ? V  DTP .   ? A DTP 706 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O1B   ? KA GTP .   ? D GTP 702 ? 1_555 63.9  ? 
24  O1B   ? V  DTP .   ? A DTP 706 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O1B   ? KA GTP .   ? D GTP 702 ? 1_555 78.5  ? 
25  O1G   ? KA GTP .   ? D GTP 702 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O1B   ? KA GTP .   ? D GTP 702 ? 1_555 65.8  ? 
26  O1G   ? V  DTP .   ? A DTP 706 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O2A   ? KA GTP .   ? D GTP 702 ? 1_555 123.4 ? 
27  O1B   ? V  DTP .   ? A DTP 706 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O2A   ? KA GTP .   ? D GTP 702 ? 1_555 90.7  ? 
28  O1G   ? KA GTP .   ? D GTP 702 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O2A   ? KA GTP .   ? D GTP 702 ? 1_555 72.5  ? 
29  O1B   ? KA GTP .   ? D GTP 702 ? 1_555 MG ? GA MG . ? C MG 704 ? 1_555 O2A   ? KA GTP .   ? D GTP 702 ? 1_555 59.9  ? 
30  NE2   ? B  HIS 61  ? B HIS 167 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 NE2   ? B  HIS 100 ? B HIS 206 ? 1_555 104.1 ? 
31  NE2   ? B  HIS 61  ? B HIS 167 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 OD2   ? B  ASP 101 ? B ASP 207 ? 1_555 114.8 ? 
32  NE2   ? B  HIS 100 ? B HIS 206 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 OD2   ? B  ASP 101 ? B ASP 207 ? 1_555 89.1  ? 
33  NE2   ? B  HIS 61  ? B HIS 167 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 OD1   ? B  ASP 205 ? B ASP 311 ? 1_555 86.7  ? 
34  NE2   ? B  HIS 100 ? B HIS 206 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 OD1   ? B  ASP 205 ? B ASP 311 ? 1_555 76.0  ? 
35  OD2   ? B  ASP 101 ? B ASP 207 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 OD1   ? B  ASP 205 ? B ASP 311 ? 1_555 156.6 ? 
36  NE2   ? B  HIS 61  ? B HIS 167 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 O1A   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 102.3 ? 
37  NE2   ? B  HIS 100 ? B HIS 206 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 O1A   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 152.9 ? 
38  OD2   ? B  ASP 101 ? B ASP 207 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 O1A   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 85.6  ? 
39  OD1   ? B  ASP 205 ? B ASP 311 ? 1_555 FE ? W  FE . ? B FE 701 ? 1_555 O1A   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 99.4  ? 
40  OD2   ? B  ASP 203 ? B ASP 309 ? 1_555 MG ? X  MG . ? B MG 702 ? 1_555 O2B   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 148.4 ? 
41  OD2   ? B  ASP 203 ? B ASP 309 ? 1_555 MG ? X  MG . ? B MG 702 ? 1_555 O2G   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 117.1 ? 
42  O2B   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 MG ? X  MG . ? B MG 702 ? 1_555 O2G   ? Z  1FZ .   ? B 1FZ 704 ? 1_555 68.9  ? 
43  O1G   ? AA GTP .   ? B GTP 705 ? 1_555 MG ? Y  MG . ? B MG 703 ? 1_555 O1B   ? AA GTP .   ? B GTP 705 ? 1_555 81.8  ? 
44  O1G   ? AA GTP .   ? B GTP 705 ? 1_555 MG ? Y  MG . ? B MG 703 ? 1_555 O3G   ? JA DTP .   ? D DTP 701 ? 1_555 120.4 ? 
45  O1B   ? AA GTP .   ? B GTP 705 ? 1_555 MG ? Y  MG . ? B MG 703 ? 1_555 O3G   ? JA DTP .   ? D DTP 701 ? 1_555 100.2 ? 
46  O1G   ? AA GTP .   ? B GTP 705 ? 1_555 MG ? Y  MG . ? B MG 703 ? 1_555 O1B   ? JA DTP .   ? D DTP 701 ? 1_555 150.9 ? 
47  O1B   ? AA GTP .   ? B GTP 705 ? 1_555 MG ? Y  MG . ? B MG 703 ? 1_555 O1B   ? JA DTP .   ? D DTP 701 ? 1_555 70.2  ? 
48  O3G   ? JA DTP .   ? D DTP 701 ? 1_555 MG ? Y  MG . ? B MG 703 ? 1_555 O1B   ? JA DTP .   ? D DTP 701 ? 1_555 73.8  ? 
49  O1G   ? CA DTP .   ? B DTP 707 ? 1_555 MG ? NA MG . ? D MG 705 ? 1_555 O1B   ? CA DTP .   ? B DTP 707 ? 1_555 96.8  ? 
50  O1G   ? CA DTP .   ? B DTP 707 ? 1_555 MG ? NA MG . ? D MG 705 ? 1_555 O1G   ? PA GTP .   ? D GTP 707 ? 1_555 90.5  ? 
51  O1B   ? CA DTP .   ? B DTP 707 ? 1_555 MG ? NA MG . ? D MG 705 ? 1_555 O1G   ? PA GTP .   ? D GTP 707 ? 1_555 149.7 ? 
52  O1G   ? CA DTP .   ? B DTP 707 ? 1_555 MG ? NA MG . ? D MG 705 ? 1_555 O1B   ? PA GTP .   ? D GTP 707 ? 1_555 86.1  ? 
53  O1B   ? CA DTP .   ? B DTP 707 ? 1_555 MG ? NA MG . ? D MG 705 ? 1_555 O1B   ? PA GTP .   ? D GTP 707 ? 1_555 68.6  ? 
54  O1G   ? PA GTP .   ? D GTP 707 ? 1_555 MG ? NA MG . ? D MG 705 ? 1_555 O1B   ? PA GTP .   ? D GTP 707 ? 1_555 82.7  ? 
55  NE2   ? C  HIS 61  ? C HIS 167 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 NE2   ? C  HIS 100 ? C HIS 206 ? 1_555 100.6 ? 
56  NE2   ? C  HIS 61  ? C HIS 167 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 OD2   ? C  ASP 101 ? C ASP 207 ? 1_555 111.9 ? 
57  NE2   ? C  HIS 100 ? C HIS 206 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 OD2   ? C  ASP 101 ? C ASP 207 ? 1_555 83.9  ? 
58  NE2   ? C  HIS 61  ? C HIS 167 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 OD1   ? C  ASP 205 ? C ASP 311 ? 1_555 88.4  ? 
59  NE2   ? C  HIS 100 ? C HIS 206 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 OD1   ? C  ASP 205 ? C ASP 311 ? 1_555 74.6  ? 
60  OD2   ? C  ASP 101 ? C ASP 207 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 OD1   ? C  ASP 205 ? C ASP 311 ? 1_555 153.0 ? 
61  NE2   ? C  HIS 61  ? C HIS 167 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 O1A   ? HA 1FZ .   ? C 1FZ 705 ? 1_555 96.8  ? 
62  NE2   ? C  HIS 100 ? C HIS 206 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 O1A   ? HA 1FZ .   ? C 1FZ 705 ? 1_555 160.7 ? 
63  OD2   ? C  ASP 101 ? C ASP 207 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 O1A   ? HA 1FZ .   ? C 1FZ 705 ? 1_555 97.3  ? 
64  OD1   ? C  ASP 205 ? C ASP 311 ? 1_555 FE ? EA FE . ? C FE 702 ? 1_555 O1A   ? HA 1FZ .   ? C 1FZ 705 ? 1_555 97.7  ? 
65  O2G   ? HA 1FZ .   ? C 1FZ 705 ? 1_555 MG ? FA MG . ? C MG 703 ? 1_555 O2B   ? HA 1FZ .   ? C 1FZ 705 ? 1_555 70.5  ? 
66  NE2   ? D  HIS 61  ? D HIS 167 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 NE2   ? D  HIS 100 ? D HIS 206 ? 1_555 92.4  ? 
67  NE2   ? D  HIS 61  ? D HIS 167 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 OD2   ? D  ASP 101 ? D ASP 207 ? 1_555 100.4 ? 
68  NE2   ? D  HIS 100 ? D HIS 206 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 OD2   ? D  ASP 101 ? D ASP 207 ? 1_555 78.5  ? 
69  NE2   ? D  HIS 61  ? D HIS 167 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 OD1   ? D  ASP 205 ? D ASP 311 ? 1_555 86.6  ? 
70  NE2   ? D  HIS 100 ? D HIS 206 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 OD1   ? D  ASP 205 ? D ASP 311 ? 1_555 74.5  ? 
71  OD2   ? D  ASP 101 ? D ASP 207 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 OD1   ? D  ASP 205 ? D ASP 311 ? 1_555 152.4 ? 
72  NE2   ? D  HIS 61  ? D HIS 167 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 O1A   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 114.6 ? 
73  NE2   ? D  HIS 100 ? D HIS 206 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 O1A   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 152.6 ? 
74  OD2   ? D  ASP 101 ? D ASP 207 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 O1A   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 99.8  ? 
75  OD1   ? D  ASP 205 ? D ASP 311 ? 1_555 FE ? LA FE . ? D FE 703 ? 1_555 O1A   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 101.5 ? 
76  OD2   ? D  ASP 203 ? D ASP 309 ? 1_555 MG ? MA MG . ? D MG 704 ? 1_555 O2B   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 155.7 ? 
77  OD2   ? D  ASP 203 ? D ASP 309 ? 1_555 MG ? MA MG . ? D MG 704 ? 1_555 O2G   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 116.8 ? 
78  O2B   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 MG ? MA MG . ? D MG 704 ? 1_555 O2G   ? OA 1FZ .   ? D 1FZ 706 ? 1_555 64.4  ? 
79  NE2   ? E  HIS 61  ? E HIS 167 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 NE2   ? E  HIS 100 ? E HIS 206 ? 1_555 103.4 ? 
80  NE2   ? E  HIS 61  ? E HIS 167 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 OD2   ? E  ASP 101 ? E ASP 207 ? 1_555 117.1 ? 
81  NE2   ? E  HIS 100 ? E HIS 206 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 OD2   ? E  ASP 101 ? E ASP 207 ? 1_555 84.9  ? 
82  NE2   ? E  HIS 61  ? E HIS 167 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 OD1   ? E  ASP 205 ? E ASP 311 ? 1_555 88.6  ? 
83  NE2   ? E  HIS 100 ? E HIS 206 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 OD1   ? E  ASP 205 ? E ASP 311 ? 1_555 73.6  ? 
84  OD2   ? E  ASP 101 ? E ASP 207 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 OD1   ? E  ASP 205 ? E ASP 311 ? 1_555 150.0 ? 
85  NE2   ? E  HIS 61  ? E HIS 167 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 O1A   ? UA 1FZ .   ? E 1FZ 704 ? 1_555 102.5 ? 
86  NE2   ? E  HIS 100 ? E HIS 206 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 O1A   ? UA 1FZ .   ? E 1FZ 704 ? 1_555 153.0 ? 
87  OD2   ? E  ASP 101 ? E ASP 207 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 O1A   ? UA 1FZ .   ? E 1FZ 704 ? 1_555 90.1  ? 
88  OD1   ? E  ASP 205 ? E ASP 311 ? 1_555 FE ? RA FE . ? E FE 701 ? 1_555 O1A   ? UA 1FZ .   ? E 1FZ 704 ? 1_555 99.5  ? 
89  O1B   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O1G   ? VA GTP .   ? E GTP 705 ? 1_555 60.0  ? 
90  O1B   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O2A   ? VA GTP .   ? E GTP 705 ? 1_555 55.3  ? 
91  O1G   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O2A   ? VA GTP .   ? E GTP 705 ? 1_555 65.1  ? 
92  O1B   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O3G   ? FB DTP .   ? G DTP 701 ? 1_555 79.3  ? 
93  O1G   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O3G   ? FB DTP .   ? G DTP 701 ? 1_555 110.8 ? 
94  O2A   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O3G   ? FB DTP .   ? G DTP 701 ? 1_555 130.5 ? 
95  O1B   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O1B   ? FB DTP .   ? G DTP 701 ? 1_555 87.0  ? 
96  O1G   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O1B   ? FB DTP .   ? G DTP 701 ? 1_555 137.4 ? 
97  O2A   ? VA GTP .   ? E GTP 705 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O1B   ? FB DTP .   ? G DTP 701 ? 1_555 74.2  ? 
98  O3G   ? FB DTP .   ? G DTP 701 ? 1_555 MG ? TA MG . ? E MG 703 ? 1_555 O1B   ? FB DTP .   ? G DTP 701 ? 1_555 85.9  ? 
99  O1G   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1B   ? XA DTP .   ? E DTP 707 ? 1_555 74.7  ? 
100 O1G   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 "O3'" ? KB GTP .   ? G GTP 706 ? 1_555 128.2 ? 
101 O1B   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 "O3'" ? KB GTP .   ? G GTP 706 ? 1_555 54.5  ? 
102 O1G   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1G   ? KB GTP .   ? G GTP 706 ? 1_555 75.3  ? 
103 O1B   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1G   ? KB GTP .   ? G GTP 706 ? 1_555 145.4 ? 
104 "O3'" ? KB GTP .   ? G GTP 706 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1G   ? KB GTP .   ? G GTP 706 ? 1_555 145.6 ? 
105 O1G   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O2A   ? KB GTP .   ? G GTP 706 ? 1_555 113.3 ? 
106 O1B   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O2A   ? KB GTP .   ? G GTP 706 ? 1_555 104.8 ? 
107 "O3'" ? KB GTP .   ? G GTP 706 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O2A   ? KB GTP .   ? G GTP 706 ? 1_555 74.9  ? 
108 O1G   ? KB GTP .   ? G GTP 706 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O2A   ? KB GTP .   ? G GTP 706 ? 1_555 72.1  ? 
109 O1G   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1B   ? KB GTP .   ? G GTP 706 ? 1_555 47.5  ? 
110 O1B   ? XA DTP .   ? E DTP 707 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1B   ? KB GTP .   ? G GTP 706 ? 1_555 76.8  ? 
111 "O3'" ? KB GTP .   ? G GTP 706 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1B   ? KB GTP .   ? G GTP 706 ? 1_555 105.5 ? 
112 O1G   ? KB GTP .   ? G GTP 706 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1B   ? KB GTP .   ? G GTP 706 ? 1_555 70.3  ? 
113 O2A   ? KB GTP .   ? G GTP 706 ? 1_555 MG ? IB MG . ? G MG 704 ? 1_555 O1B   ? KB GTP .   ? G GTP 706 ? 1_555 67.1  ? 
114 NE2   ? F  HIS 61  ? F HIS 167 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 NE2   ? F  HIS 100 ? F HIS 206 ? 1_555 91.6  ? 
115 NE2   ? F  HIS 61  ? F HIS 167 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 OD2   ? F  ASP 101 ? F ASP 207 ? 1_555 110.7 ? 
116 NE2   ? F  HIS 100 ? F HIS 206 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 OD2   ? F  ASP 101 ? F ASP 207 ? 1_555 78.5  ? 
117 NE2   ? F  HIS 61  ? F HIS 167 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 OD1   ? F  ASP 205 ? F ASP 311 ? 1_555 82.7  ? 
118 NE2   ? F  HIS 100 ? F HIS 206 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 OD1   ? F  ASP 205 ? F ASP 311 ? 1_555 67.7  ? 
119 OD2   ? F  ASP 101 ? F ASP 207 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 OD1   ? F  ASP 205 ? F ASP 311 ? 1_555 144.1 ? 
120 NE2   ? F  HIS 61  ? F HIS 167 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 O1A   ? BB 1FZ .   ? F 1FZ 704 ? 1_555 108.4 ? 
121 NE2   ? F  HIS 100 ? F HIS 206 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 O1A   ? BB 1FZ .   ? F 1FZ 704 ? 1_555 156.3 ? 
122 OD2   ? F  ASP 101 ? F ASP 207 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 O1A   ? BB 1FZ .   ? F 1FZ 704 ? 1_555 105.0 ? 
123 OD1   ? F  ASP 205 ? F ASP 311 ? 1_555 FE ? YA FE . ? F FE 701 ? 1_555 O1A   ? BB 1FZ .   ? F 1FZ 704 ? 1_555 101.5 ? 
124 O3G   ? BB 1FZ .   ? F 1FZ 704 ? 1_555 MG ? ZA MG . ? F MG 702 ? 1_555 O2B   ? BB 1FZ .   ? F 1FZ 704 ? 1_555 76.2  ? 
125 O1B   ? CB GTP .   ? F GTP 705 ? 1_555 MG ? AB MG . ? F MG 703 ? 1_555 O1G   ? CB GTP .   ? F GTP 705 ? 1_555 72.6  ? 
126 O1B   ? CB GTP .   ? F GTP 705 ? 1_555 MG ? AB MG . ? F MG 703 ? 1_555 O1B   ? LB DTP .   ? H DTP 701 ? 1_555 82.5  ? 
127 O1G   ? CB GTP .   ? F GTP 705 ? 1_555 MG ? AB MG . ? F MG 703 ? 1_555 O1B   ? LB DTP .   ? H DTP 701 ? 1_555 153.6 ? 
128 O1B   ? CB GTP .   ? F GTP 705 ? 1_555 MG ? AB MG . ? F MG 703 ? 1_555 O1G   ? LB DTP .   ? H DTP 701 ? 1_555 76.6  ? 
129 O1G   ? CB GTP .   ? F GTP 705 ? 1_555 MG ? AB MG . ? F MG 703 ? 1_555 O1G   ? LB DTP .   ? H DTP 701 ? 1_555 86.5  ? 
130 O1B   ? LB DTP .   ? H DTP 701 ? 1_555 MG ? AB MG . ? F MG 703 ? 1_555 O1G   ? LB DTP .   ? H DTP 701 ? 1_555 96.2  ? 
131 O1G   ? EB DTP .   ? F DTP 707 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O1B   ? EB DTP .   ? F DTP 707 ? 1_555 73.8  ? 
132 O1G   ? EB DTP .   ? F DTP 707 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O1G   ? QB GTP .   ? H GTP 706 ? 1_555 76.4  ? 
133 O1B   ? EB DTP .   ? F DTP 707 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O1G   ? QB GTP .   ? H GTP 706 ? 1_555 147.1 ? 
134 O1G   ? EB DTP .   ? F DTP 707 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O1B   ? QB GTP .   ? H GTP 706 ? 1_555 59.4  ? 
135 O1B   ? EB DTP .   ? F DTP 707 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O1B   ? QB GTP .   ? H GTP 706 ? 1_555 80.5  ? 
136 O1G   ? QB GTP .   ? H GTP 706 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O1B   ? QB GTP .   ? H GTP 706 ? 1_555 72.5  ? 
137 O1G   ? EB DTP .   ? F DTP 707 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O2A   ? QB GTP .   ? H GTP 706 ? 1_555 137.0 ? 
138 O1B   ? EB DTP .   ? F DTP 707 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O2A   ? QB GTP .   ? H GTP 706 ? 1_555 106.1 ? 
139 O1G   ? QB GTP .   ? H GTP 706 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O2A   ? QB GTP .   ? H GTP 706 ? 1_555 86.5  ? 
140 O1B   ? QB GTP .   ? H GTP 706 ? 1_555 MG ? OB MG . ? H MG 704 ? 1_555 O2A   ? QB GTP .   ? H GTP 706 ? 1_555 77.9  ? 
141 NE2   ? G  HIS 61  ? G HIS 167 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 NE2   ? G  HIS 100 ? G HIS 206 ? 1_555 105.0 ? 
142 NE2   ? G  HIS 61  ? G HIS 167 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 OD2   ? G  ASP 101 ? G ASP 207 ? 1_555 107.3 ? 
143 NE2   ? G  HIS 100 ? G HIS 206 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 OD2   ? G  ASP 101 ? G ASP 207 ? 1_555 86.2  ? 
144 NE2   ? G  HIS 61  ? G HIS 167 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 OD1   ? G  ASP 205 ? G ASP 311 ? 1_555 90.9  ? 
145 NE2   ? G  HIS 100 ? G HIS 206 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 OD1   ? G  ASP 205 ? G ASP 311 ? 1_555 81.2  ? 
146 OD2   ? G  ASP 101 ? G ASP 207 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 OD1   ? G  ASP 205 ? G ASP 311 ? 1_555 160.1 ? 
147 NE2   ? G  HIS 61  ? G HIS 167 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 O1A   ? JB 1FZ .   ? G 1FZ 705 ? 1_555 98.0  ? 
148 NE2   ? G  HIS 100 ? G HIS 206 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 O1A   ? JB 1FZ .   ? G 1FZ 705 ? 1_555 156.4 ? 
149 OD2   ? G  ASP 101 ? G ASP 207 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 O1A   ? JB 1FZ .   ? G 1FZ 705 ? 1_555 92.0  ? 
150 OD1   ? G  ASP 205 ? G ASP 311 ? 1_555 FE ? GB FE . ? G FE 702 ? 1_555 O1A   ? JB 1FZ .   ? G 1FZ 705 ? 1_555 93.5  ? 
151 O2B   ? JB 1FZ .   ? G 1FZ 705 ? 1_555 MG ? HB MG . ? G MG 703 ? 1_555 O2G   ? JB 1FZ .   ? G 1FZ 705 ? 1_555 78.0  ? 
152 NE2   ? H  HIS 61  ? H HIS 167 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 NE2   ? H  HIS 100 ? H HIS 206 ? 1_555 96.3  ? 
153 NE2   ? H  HIS 61  ? H HIS 167 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 OD2   ? H  ASP 101 ? H ASP 207 ? 1_555 105.6 ? 
154 NE2   ? H  HIS 100 ? H HIS 206 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 OD2   ? H  ASP 101 ? H ASP 207 ? 1_555 82.9  ? 
155 NE2   ? H  HIS 61  ? H HIS 167 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 OD1   ? H  ASP 205 ? H ASP 311 ? 1_555 85.8  ? 
156 NE2   ? H  HIS 100 ? H HIS 206 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 OD1   ? H  ASP 205 ? H ASP 311 ? 1_555 75.2  ? 
157 OD2   ? H  ASP 101 ? H ASP 207 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 OD1   ? H  ASP 205 ? H ASP 311 ? 1_555 156.3 ? 
158 NE2   ? H  HIS 61  ? H HIS 167 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 O1A   ? PB 1FZ .   ? H 1FZ 705 ? 1_555 103.8 ? 
159 NE2   ? H  HIS 100 ? H HIS 206 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 O1A   ? PB 1FZ .   ? H 1FZ 705 ? 1_555 158.3 ? 
160 OD2   ? H  ASP 101 ? H ASP 207 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 O1A   ? PB 1FZ .   ? H 1FZ 705 ? 1_555 99.3  ? 
161 OD1   ? H  ASP 205 ? H ASP 311 ? 1_555 FE ? MB FE . ? H FE 702 ? 1_555 O1A   ? PB 1FZ .   ? H 1FZ 705 ? 1_555 97.9  ? 
162 O2G   ? PB 1FZ .   ? H 1FZ 705 ? 1_555 MG ? NB MG . ? H MG 703 ? 1_555 O2B   ? PB 1FZ .   ? H 1FZ 705 ? 1_555 76.7  ? 
163 NE2   ? I  HIS 61  ? I HIS 167 ? 1_555 FE ? SB FE . ? I FE 701 ? 1_555 NE2   ? I  HIS 100 ? I HIS 206 ? 1_555 84.9  ? 
164 NE2   ? I  HIS 61  ? I HIS 167 ? 1_555 FE ? SB FE . ? I FE 701 ? 1_555 OD1   ? I  ASP 205 ? I ASP 311 ? 1_555 72.3  ? 
165 NE2   ? I  HIS 100 ? I HIS 206 ? 1_555 FE ? SB FE . ? I FE 701 ? 1_555 OD1   ? I  ASP 205 ? I ASP 311 ? 1_555 64.7  ? 
166 NE2   ? I  HIS 61  ? I HIS 167 ? 1_555 FE ? SB FE . ? I FE 701 ? 1_555 O1A   ? VB 1FZ .   ? I 1FZ 704 ? 1_555 101.3 ? 
167 NE2   ? I  HIS 100 ? I HIS 206 ? 1_555 FE ? SB FE . ? I FE 701 ? 1_555 O1A   ? VB 1FZ .   ? I 1FZ 704 ? 1_555 151.7 ? 
168 OD1   ? I  ASP 205 ? I ASP 311 ? 1_555 FE ? SB FE . ? I FE 701 ? 1_555 O1A   ? VB 1FZ .   ? I 1FZ 704 ? 1_555 90.7  ? 
169 O2B   ? VB 1FZ .   ? I 1FZ 704 ? 1_555 MG ? TB MG . ? I MG 702 ? 1_555 O2G   ? VB 1FZ .   ? I 1FZ 704 ? 1_555 68.0  ? 
170 O1B   ? WB GTP .   ? I GTP 705 ? 1_555 MG ? UB MG . ? I MG 703 ? 1_555 O3G   ? WB GTP .   ? I GTP 705 ? 1_555 66.4  ? 
171 O1B   ? WB GTP .   ? I GTP 705 ? 1_555 MG ? UB MG . ? I MG 703 ? 1_555 O1B   ? GC DTP .   ? K DTP 701 ? 1_555 69.2  ? 
172 O3G   ? WB GTP .   ? I GTP 705 ? 1_555 MG ? UB MG . ? I MG 703 ? 1_555 O1B   ? GC DTP .   ? K DTP 701 ? 1_555 135.6 ? 
173 O1B   ? WB GTP .   ? I GTP 705 ? 1_555 MG ? UB MG . ? I MG 703 ? 1_555 O3G   ? GC DTP .   ? K DTP 701 ? 1_555 109.3 ? 
174 O3G   ? WB GTP .   ? I GTP 705 ? 1_555 MG ? UB MG . ? I MG 703 ? 1_555 O3G   ? GC DTP .   ? K DTP 701 ? 1_555 112.3 ? 
175 O1B   ? GC DTP .   ? K DTP 701 ? 1_555 MG ? UB MG . ? I MG 703 ? 1_555 O3G   ? GC DTP .   ? K DTP 701 ? 1_555 81.3  ? 
176 O1G   ? YB GTP .   ? I GTP 707 ? 1_555 MG ? CC MG . ? J MG 703 ? 1_555 O1B   ? YB GTP .   ? I GTP 707 ? 1_555 73.0  ? 
177 O1G   ? YB GTP .   ? I GTP 707 ? 1_555 MG ? CC MG . ? J MG 703 ? 1_555 O1G   ? NC DTP .   ? L DTP 701 ? 1_555 80.4  ? 
178 O1B   ? YB GTP .   ? I GTP 707 ? 1_555 MG ? CC MG . ? J MG 703 ? 1_555 O1G   ? NC DTP .   ? L DTP 701 ? 1_555 72.1  ? 
179 O1G   ? YB GTP .   ? I GTP 707 ? 1_555 MG ? CC MG . ? J MG 703 ? 1_555 O1B   ? NC DTP .   ? L DTP 701 ? 1_555 151.2 ? 
180 O1B   ? YB GTP .   ? I GTP 707 ? 1_555 MG ? CC MG . ? J MG 703 ? 1_555 O1B   ? NC DTP .   ? L DTP 701 ? 1_555 79.2  ? 
181 O1G   ? NC DTP .   ? L DTP 701 ? 1_555 MG ? CC MG . ? J MG 703 ? 1_555 O1B   ? NC DTP .   ? L DTP 701 ? 1_555 83.9  ? 
182 O1G   ? ZB DTP .   ? I DTP 708 ? 1_555 MG ? JC MG . ? K MG 704 ? 1_555 O1B   ? ZB DTP .   ? I DTP 708 ? 1_555 79.6  ? 
183 O1G   ? ZB DTP .   ? I DTP 708 ? 1_555 MG ? JC MG . ? K MG 704 ? 1_555 O1G   ? LC GTP .   ? K GTP 706 ? 1_555 89.1  ? 
184 O1B   ? ZB DTP .   ? I DTP 708 ? 1_555 MG ? JC MG . ? K MG 704 ? 1_555 O1G   ? LC GTP .   ? K GTP 706 ? 1_555 157.8 ? 
185 O1G   ? ZB DTP .   ? I DTP 708 ? 1_555 MG ? JC MG . ? K MG 704 ? 1_555 O1B   ? LC GTP .   ? K GTP 706 ? 1_555 66.8  ? 
186 O1B   ? ZB DTP .   ? I DTP 708 ? 1_555 MG ? JC MG . ? K MG 704 ? 1_555 O1B   ? LC GTP .   ? K GTP 706 ? 1_555 100.3 ? 
187 O1G   ? LC GTP .   ? K GTP 706 ? 1_555 MG ? JC MG . ? K MG 704 ? 1_555 O1B   ? LC GTP .   ? K GTP 706 ? 1_555 92.6  ? 
188 NE2   ? J  HIS 61  ? J HIS 167 ? 1_555 FE ? AC FE . ? J FE 701 ? 1_555 NE2   ? J  HIS 100 ? J HIS 206 ? 1_555 100.7 ? 
189 NE2   ? J  HIS 61  ? J HIS 167 ? 1_555 FE ? AC FE . ? J FE 701 ? 1_555 OD1   ? J  ASP 205 ? J ASP 311 ? 1_555 80.9  ? 
190 NE2   ? J  HIS 100 ? J HIS 206 ? 1_555 FE ? AC FE . ? J FE 701 ? 1_555 OD1   ? J  ASP 205 ? J ASP 311 ? 1_555 65.7  ? 
191 NE2   ? J  HIS 61  ? J HIS 167 ? 1_555 FE ? AC FE . ? J FE 701 ? 1_555 O1A   ? DC 1FZ .   ? J 1FZ 704 ? 1_555 118.8 ? 
192 NE2   ? J  HIS 100 ? J HIS 206 ? 1_555 FE ? AC FE . ? J FE 701 ? 1_555 O1A   ? DC 1FZ .   ? J 1FZ 704 ? 1_555 129.0 ? 
193 OD1   ? J  ASP 205 ? J ASP 311 ? 1_555 FE ? AC FE . ? J FE 701 ? 1_555 O1A   ? DC 1FZ .   ? J 1FZ 704 ? 1_555 88.8  ? 
194 O2B   ? DC 1FZ .   ? J 1FZ 704 ? 1_555 MG ? BC MG . ? J MG 702 ? 1_555 O2G   ? DC 1FZ .   ? J 1FZ 704 ? 1_555 80.3  ? 
195 O1G   ? FC DTP .   ? J DTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O1B   ? FC DTP .   ? J DTP 706 ? 1_555 78.0  ? 
196 O1G   ? FC DTP .   ? J DTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O1G   ? SC GTP .   ? L GTP 706 ? 1_555 80.9  ? 
197 O1B   ? FC DTP .   ? J DTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O1G   ? SC GTP .   ? L GTP 706 ? 1_555 158.9 ? 
198 O1G   ? FC DTP .   ? J DTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O1B   ? SC GTP .   ? L GTP 706 ? 1_555 70.7  ? 
199 O1B   ? FC DTP .   ? J DTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O1B   ? SC GTP .   ? L GTP 706 ? 1_555 92.8  ? 
200 O1G   ? SC GTP .   ? L GTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O1B   ? SC GTP .   ? L GTP 706 ? 1_555 80.1  ? 
201 O1G   ? FC DTP .   ? J DTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O2A   ? SC GTP .   ? L GTP 706 ? 1_555 143.9 ? 
202 O1B   ? FC DTP .   ? J DTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O2A   ? SC GTP .   ? L GTP 706 ? 1_555 104.6 ? 
203 O1G   ? SC GTP .   ? L GTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O2A   ? SC GTP .   ? L GTP 706 ? 1_555 92.5  ? 
204 O1B   ? SC GTP .   ? L GTP 706 ? 1_555 MG ? QC MG . ? L MG 704 ? 1_555 O2A   ? SC GTP .   ? L GTP 706 ? 1_555 73.2  ? 
205 NE2   ? K  HIS 61  ? K HIS 167 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 NE2   ? K  HIS 100 ? K HIS 206 ? 1_555 102.0 ? 
206 NE2   ? K  HIS 61  ? K HIS 167 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 OD2   ? K  ASP 101 ? K ASP 207 ? 1_555 103.7 ? 
207 NE2   ? K  HIS 100 ? K HIS 206 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 OD2   ? K  ASP 101 ? K ASP 207 ? 1_555 79.6  ? 
208 NE2   ? K  HIS 61  ? K HIS 167 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 OD1   ? K  ASP 205 ? K ASP 311 ? 1_555 95.6  ? 
209 NE2   ? K  HIS 100 ? K HIS 206 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 OD1   ? K  ASP 205 ? K ASP 311 ? 1_555 79.9  ? 
210 OD2   ? K  ASP 101 ? K ASP 207 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 OD1   ? K  ASP 205 ? K ASP 311 ? 1_555 154.3 ? 
211 NE2   ? K  HIS 61  ? K HIS 167 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 O1A   ? KC 1FZ .   ? K 1FZ 705 ? 1_555 109.1 ? 
212 NE2   ? K  HIS 100 ? K HIS 206 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 O1A   ? KC 1FZ .   ? K 1FZ 705 ? 1_555 147.9 ? 
213 OD2   ? K  ASP 101 ? K ASP 207 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 O1A   ? KC 1FZ .   ? K 1FZ 705 ? 1_555 85.4  ? 
214 OD1   ? K  ASP 205 ? K ASP 311 ? 1_555 FE ? HC FE . ? K FE 702 ? 1_555 O1A   ? KC 1FZ .   ? K 1FZ 705 ? 1_555 104.4 ? 
215 O2B   ? KC 1FZ .   ? K 1FZ 705 ? 1_555 MG ? IC MG . ? K MG 703 ? 1_555 O2G   ? KC 1FZ .   ? K 1FZ 705 ? 1_555 69.9  ? 
216 NE2   ? L  HIS 61  ? L HIS 167 ? 1_555 FE ? OC FE . ? L FE 702 ? 1_555 NE2   ? L  HIS 100 ? L HIS 206 ? 1_555 91.6  ? 
217 NE2   ? L  HIS 61  ? L HIS 167 ? 1_555 FE ? OC FE . ? L FE 702 ? 1_555 OD2   ? L  ASP 101 ? L ASP 207 ? 1_555 109.1 ? 
218 NE2   ? L  HIS 100 ? L HIS 206 ? 1_555 FE ? OC FE . ? L FE 702 ? 1_555 OD2   ? L  ASP 101 ? L ASP 207 ? 1_555 72.7  ? 
219 NE2   ? L  HIS 61  ? L HIS 167 ? 1_555 FE ? OC FE . ? L FE 702 ? 1_555 OD1   ? L  ASP 205 ? L ASP 311 ? 1_555 88.0  ? 
220 NE2   ? L  HIS 100 ? L HIS 206 ? 1_555 FE ? OC FE . ? L FE 702 ? 1_555 OD1   ? L  ASP 205 ? L ASP 311 ? 1_555 66.5  ? 
221 OD2   ? L  ASP 101 ? L ASP 207 ? 1_555 FE ? OC FE . ? L FE 702 ? 1_555 OD1   ? L  ASP 205 ? L ASP 311 ? 1_555 136.1 ? 
222 O2B   ? RC 1FZ .   ? L 1FZ 705 ? 1_555 MG ? PC MG . ? L MG 703 ? 1_555 O2G   ? RC 1FZ .   ? L 1FZ 705 ? 1_555 63.0  ? 
223 NE2   ? M  HIS 61  ? M HIS 167 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 NE2   ? M  HIS 100 ? M HIS 206 ? 1_555 90.6  ? 
224 NE2   ? M  HIS 61  ? M HIS 167 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 OD2   ? M  ASP 101 ? M ASP 207 ? 1_555 106.5 ? 
225 NE2   ? M  HIS 100 ? M HIS 206 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 OD2   ? M  ASP 101 ? M ASP 207 ? 1_555 82.1  ? 
226 NE2   ? M  HIS 61  ? M HIS 167 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 OD1   ? M  ASP 205 ? M ASP 311 ? 1_555 80.1  ? 
227 NE2   ? M  HIS 100 ? M HIS 206 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 OD1   ? M  ASP 205 ? M ASP 311 ? 1_555 69.8  ? 
228 OD2   ? M  ASP 101 ? M ASP 207 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 OD1   ? M  ASP 205 ? M ASP 311 ? 1_555 151.3 ? 
229 NE2   ? M  HIS 61  ? M HIS 167 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 O1A   ? WC 1FZ .   ? M 1FZ 704 ? 1_555 107.6 ? 
230 NE2   ? M  HIS 100 ? M HIS 206 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 O1A   ? WC 1FZ .   ? M 1FZ 704 ? 1_555 158.5 ? 
231 OD2   ? M  ASP 101 ? M ASP 207 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 O1A   ? WC 1FZ .   ? M 1FZ 704 ? 1_555 102.8 ? 
232 OD1   ? M  ASP 205 ? M ASP 311 ? 1_555 FE ? TC FE . ? M FE 701 ? 1_555 O1A   ? WC 1FZ .   ? M 1FZ 704 ? 1_555 101.5 ? 
233 O2B   ? WC 1FZ .   ? M 1FZ 704 ? 1_555 MG ? UC MG . ? M MG 702 ? 1_555 O2G   ? WC 1FZ .   ? M 1FZ 704 ? 1_555 72.7  ? 
234 O1G   ? XC GTP .   ? M GTP 705 ? 1_555 MG ? VC MG . ? M MG 703 ? 1_555 O2A   ? XC GTP .   ? M GTP 705 ? 1_555 80.0  ? 
235 O1G   ? XC GTP .   ? M GTP 705 ? 1_555 MG ? VC MG . ? M MG 703 ? 1_555 O3G   ? AD DTP .   ? N DTP 701 ? 1_555 81.3  ? 
236 O2A   ? XC GTP .   ? M GTP 705 ? 1_555 MG ? VC MG . ? M MG 703 ? 1_555 O3G   ? AD DTP .   ? N DTP 701 ? 1_555 119.3 ? 
237 O1G   ? XC GTP .   ? M GTP 705 ? 1_555 MG ? VC MG . ? M MG 703 ? 1_555 O1B   ? AD DTP .   ? N DTP 701 ? 1_555 118.4 ? 
238 O2A   ? XC GTP .   ? M GTP 705 ? 1_555 MG ? VC MG . ? M MG 703 ? 1_555 O1B   ? AD DTP .   ? N DTP 701 ? 1_555 73.7  ? 
239 O3G   ? AD DTP .   ? N DTP 701 ? 1_555 MG ? VC MG . ? M MG 703 ? 1_555 O1B   ? AD DTP .   ? N DTP 701 ? 1_555 66.1  ? 
240 O3G   ? YC DTP .   ? M DTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 O1B   ? YC DTP .   ? M DTP 706 ? 1_555 81.3  ? 
241 O3G   ? YC DTP .   ? M DTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 O1G   ? FD GTP .   ? N GTP 706 ? 1_555 71.4  ? 
242 O1B   ? YC DTP .   ? M DTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 O1G   ? FD GTP .   ? N GTP 706 ? 1_555 108.3 ? 
243 O3G   ? YC DTP .   ? M DTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 O2A   ? FD GTP .   ? N GTP 706 ? 1_555 121.5 ? 
244 O1B   ? YC DTP .   ? M DTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 O2A   ? FD GTP .   ? N GTP 706 ? 1_555 81.5  ? 
245 O1G   ? FD GTP .   ? N GTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 O2A   ? FD GTP .   ? N GTP 706 ? 1_555 62.2  ? 
246 O3G   ? YC DTP .   ? M DTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 "O3'" ? FD GTP .   ? N GTP 706 ? 1_555 138.7 ? 
247 O1B   ? YC DTP .   ? M DTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 "O3'" ? FD GTP .   ? N GTP 706 ? 1_555 62.0  ? 
248 O1G   ? FD GTP .   ? N GTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 "O3'" ? FD GTP .   ? N GTP 706 ? 1_555 135.5 ? 
249 O2A   ? FD GTP .   ? N GTP 706 ? 1_555 MG ? DD MG . ? N MG 704 ? 1_555 "O3'" ? FD GTP .   ? N GTP 706 ? 1_555 73.4  ? 
250 O1B   ? ZC DTP .   ? M DTP 707 ? 1_555 MG ? KD MG . ? O MG 703 ? 1_555 O1G   ? MD GTP .   ? O GTP 705 ? 1_555 156.4 ? 
251 O1B   ? ZC DTP .   ? M DTP 707 ? 1_555 MG ? KD MG . ? O MG 703 ? 1_555 O1B   ? MD GTP .   ? O GTP 705 ? 1_555 84.3  ? 
252 O1G   ? MD GTP .   ? O GTP 705 ? 1_555 MG ? KD MG . ? O MG 703 ? 1_555 O1B   ? MD GTP .   ? O GTP 705 ? 1_555 79.7  ? 
253 O1B   ? ZC DTP .   ? M DTP 707 ? 1_555 MG ? KD MG . ? O MG 703 ? 1_555 O2A   ? MD GTP .   ? O GTP 705 ? 1_555 115.6 ? 
254 O1G   ? MD GTP .   ? O GTP 705 ? 1_555 MG ? KD MG . ? O MG 703 ? 1_555 O2A   ? MD GTP .   ? O GTP 705 ? 1_555 75.0  ? 
255 O1B   ? MD GTP .   ? O GTP 705 ? 1_555 MG ? KD MG . ? O MG 703 ? 1_555 O2A   ? MD GTP .   ? O GTP 705 ? 1_555 70.3  ? 
256 NE2   ? N  HIS 61  ? N HIS 167 ? 1_555 FE ? BD FE . ? N FE 702 ? 1_555 NE2   ? N  HIS 100 ? N HIS 206 ? 1_555 105.2 ? 
257 NE2   ? N  HIS 61  ? N HIS 167 ? 1_555 FE ? BD FE . ? N FE 702 ? 1_555 OD1   ? N  ASP 205 ? N ASP 311 ? 1_555 83.4  ? 
258 NE2   ? N  HIS 100 ? N HIS 206 ? 1_555 FE ? BD FE . ? N FE 702 ? 1_555 OD1   ? N  ASP 205 ? N ASP 311 ? 1_555 67.5  ? 
259 NE2   ? N  HIS 61  ? N HIS 167 ? 1_555 FE ? BD FE . ? N FE 702 ? 1_555 O1A   ? ED 1FZ .   ? N 1FZ 705 ? 1_555 119.3 ? 
260 NE2   ? N  HIS 100 ? N HIS 206 ? 1_555 FE ? BD FE . ? N FE 702 ? 1_555 O1A   ? ED 1FZ .   ? N 1FZ 705 ? 1_555 122.3 ? 
261 OD1   ? N  ASP 205 ? N ASP 311 ? 1_555 FE ? BD FE . ? N FE 702 ? 1_555 O1A   ? ED 1FZ .   ? N 1FZ 705 ? 1_555 82.4  ? 
262 O2G   ? ED 1FZ .   ? N 1FZ 705 ? 1_555 MG ? CD MG . ? N MG 703 ? 1_555 O2B   ? ED 1FZ .   ? N 1FZ 705 ? 1_555 76.4  ? 
263 O1G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O3G   ? HD DTP .   ? N DTP 708 ? 1_555 51.7  ? 
264 O1G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O1B   ? HD DTP .   ? N DTP 708 ? 1_555 81.5  ? 
265 O3G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O1B   ? HD DTP .   ? N DTP 708 ? 1_555 61.7  ? 
266 O1G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O3G   ? SD GTP .   ? P GTP 705 ? 1_555 84.3  ? 
267 O3G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O3G   ? SD GTP .   ? P GTP 705 ? 1_555 124.2 ? 
268 O1B   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O3G   ? SD GTP .   ? P GTP 705 ? 1_555 152.6 ? 
269 O1G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O1B   ? SD GTP .   ? P GTP 705 ? 1_555 57.4  ? 
270 O3G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O1B   ? SD GTP .   ? P GTP 705 ? 1_555 96.8  ? 
271 O1B   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O1B   ? SD GTP .   ? P GTP 705 ? 1_555 70.9  ? 
272 O3G   ? SD GTP .   ? P GTP 705 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O1B   ? SD GTP .   ? P GTP 705 ? 1_555 81.8  ? 
273 O1G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O2A   ? SD GTP .   ? P GTP 705 ? 1_555 119.2 ? 
274 O3G   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O2A   ? SD GTP .   ? P GTP 705 ? 1_555 137.4 ? 
275 O1B   ? HD DTP .   ? N DTP 708 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O2A   ? SD GTP .   ? P GTP 705 ? 1_555 76.2  ? 
276 O3G   ? SD GTP .   ? P GTP 705 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O2A   ? SD GTP .   ? P GTP 705 ? 1_555 90.8  ? 
277 O1B   ? SD GTP .   ? P GTP 705 ? 1_555 MG ? QD MG . ? P MG 703 ? 1_555 O2A   ? SD GTP .   ? P GTP 705 ? 1_555 61.9  ? 
278 NE2   ? O  HIS 61  ? O HIS 167 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 NE2   ? O  HIS 100 ? O HIS 206 ? 1_555 102.4 ? 
279 NE2   ? O  HIS 61  ? O HIS 167 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 OD2   ? O  ASP 101 ? O ASP 207 ? 1_555 110.7 ? 
280 NE2   ? O  HIS 100 ? O HIS 206 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 OD2   ? O  ASP 101 ? O ASP 207 ? 1_555 77.9  ? 
281 NE2   ? O  HIS 61  ? O HIS 167 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 OD1   ? O  ASP 205 ? O ASP 311 ? 1_555 95.6  ? 
282 NE2   ? O  HIS 100 ? O HIS 206 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 OD1   ? O  ASP 205 ? O ASP 311 ? 1_555 74.5  ? 
283 OD2   ? O  ASP 101 ? O ASP 207 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 OD1   ? O  ASP 205 ? O ASP 311 ? 1_555 145.3 ? 
284 NE2   ? O  HIS 61  ? O HIS 167 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 O1A   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 105.9 ? 
285 NE2   ? O  HIS 100 ? O HIS 206 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 O1A   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 151.3 ? 
286 OD2   ? O  ASP 101 ? O ASP 207 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 O1A   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 87.6  ? 
287 OD1   ? O  ASP 205 ? O ASP 311 ? 1_555 FE ? ID FE . ? O FE 701 ? 1_555 O1A   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 107.1 ? 
288 OD2   ? O  ASP 203 ? O ASP 309 ? 1_555 MG ? JD MG . ? O MG 702 ? 1_555 O2G   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 126.2 ? 
289 OD2   ? O  ASP 203 ? O ASP 309 ? 1_555 MG ? JD MG . ? O MG 702 ? 1_555 O2B   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 144.2 ? 
290 O2G   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 MG ? JD MG . ? O MG 702 ? 1_555 O2B   ? LD 1FZ .   ? O 1FZ 704 ? 1_555 65.0  ? 
291 NE2   ? P  HIS 61  ? P HIS 167 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 NE2   ? P  HIS 100 ? P HIS 206 ? 1_555 103.1 ? 
292 NE2   ? P  HIS 61  ? P HIS 167 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 OD2   ? P  ASP 101 ? P ASP 207 ? 1_555 104.8 ? 
293 NE2   ? P  HIS 100 ? P HIS 206 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 OD2   ? P  ASP 101 ? P ASP 207 ? 1_555 84.8  ? 
294 NE2   ? P  HIS 61  ? P HIS 167 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 OD1   ? P  ASP 205 ? P ASP 311 ? 1_555 90.9  ? 
295 NE2   ? P  HIS 100 ? P HIS 206 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 OD1   ? P  ASP 205 ? P ASP 311 ? 1_555 81.4  ? 
296 OD2   ? P  ASP 101 ? P ASP 207 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 OD1   ? P  ASP 205 ? P ASP 311 ? 1_555 161.1 ? 
297 NE2   ? P  HIS 61  ? P HIS 167 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 O1A   ? RD 1FZ .   ? P 1FZ 704 ? 1_555 94.5  ? 
298 NE2   ? P  HIS 100 ? P HIS 206 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 O1A   ? RD 1FZ .   ? P 1FZ 704 ? 1_555 159.9 ? 
299 OD2   ? P  ASP 101 ? P ASP 207 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 O1A   ? RD 1FZ .   ? P 1FZ 704 ? 1_555 99.9  ? 
300 OD1   ? P  ASP 205 ? P ASP 311 ? 1_555 FE ? OD FE . ? P FE 701 ? 1_555 O1A   ? RD 1FZ .   ? P 1FZ 704 ? 1_555 89.0  ? 
301 O2B   ? RD 1FZ .   ? P 1FZ 704 ? 1_555 MG ? PD MG . ? P MG 702 ? 1_555 O2G   ? RD 1FZ .   ? P 1FZ 704 ? 1_555 70.2  ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 4 ? 
AC5 ? 2 ? 
AC6 ? 3 ? 
AC7 ? 2 ? 
AC8 ? 4 ? 
AC9 ? 2 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 4 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 4 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 4 ? 
AE3 ? 2 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 4 ? 
AE7 ? 2 ? 
AE8 ? 3 ? 
AE9 ? 2 ? 
AF1 ? 4 ? 
AF2 ? 2 ? 
AF3 ? 3 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 2 ? 
AF7 ? 3 ? 
AF8 ? 2 ? 
AF9 ? 4 ? 
AG1 ? 2 ? 
AG2 ? 3 ? 
AG3 ? 2 ? 
AG4 ? 4 ? 
AG5 ? 2 ? 
AG6 ? 3 ? 
AG7 ? 2 ? 
AG8 ? 4 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? parallel      
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? parallel      
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? parallel      
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? parallel      
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? parallel      
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? parallel      
AE6 3 4 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? parallel      
AF1 3 4 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? parallel      
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? parallel      
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? parallel      
AG4 3 4 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG8 2 3 ? parallel      
AG8 3 4 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH1 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 10  ? ASP A 14  ? LYS A 116 ASP A 120 
AA1 2 GLY A 18  ? LEU A 22  ? GLY A 124 LEU A 128 
AA2 1 ALA A 232 ? GLU A 236 ? ALA A 338 GLU A 342 
AA2 2 LEU A 241 ? ARG A 246 ? LEU A 347 ARG A 352 
AA2 3 PHE A 414 ? CYS A 416 ? PHE A 520 CYS A 522 
AA2 4 ALA A 419 ? ILE A 424 ? ALA A 525 ILE A 530 
AA3 1 ILE A 293 ? THR A 294 ? ILE A 399 THR A 400 
AA3 2 LYS A 300 ? TYR A 301 ? LYS A 406 TYR A 407 
AA4 1 LYS A 349 ? THR A 354 ? LYS A 455 THR A 460 
AA4 2 ALA A 440 ? CYS A 448 ? ALA A 546 CYS A 554 
AA4 3 PHE A 392 ? ASP A 400 ? PHE A 498 ASP A 506 
AA5 1 LYS B 10  ? ASP B 14  ? LYS B 116 ASP B 120 
AA5 2 GLY B 18  ? LEU B 22  ? GLY B 124 LEU B 128 
AA6 1 ALA B 232 ? GLU B 236 ? ALA B 338 GLU B 342 
AA6 2 LEU B 241 ? ARG B 246 ? LEU B 347 ARG B 352 
AA6 3 PHE B 414 ? CYS B 416 ? PHE B 520 CYS B 522 
AA6 4 ALA B 419 ? ILE B 424 ? ALA B 525 ILE B 530 
AA7 1 ILE B 293 ? THR B 294 ? ILE B 399 THR B 400 
AA7 2 LYS B 300 ? TYR B 301 ? LYS B 406 TYR B 407 
AA8 1 LYS B 349 ? THR B 354 ? LYS B 455 THR B 460 
AA8 2 ALA B 440 ? CYS B 448 ? ALA B 546 CYS B 554 
AA8 3 PHE B 392 ? ASP B 400 ? PHE B 498 ASP B 506 
AA9 1 LYS C 10  ? ASP C 14  ? LYS C 116 ASP C 120 
AA9 2 GLY C 18  ? LEU C 22  ? GLY C 124 LEU C 128 
AB1 1 ALA C 232 ? GLU C 236 ? ALA C 338 GLU C 342 
AB1 2 LEU C 241 ? ARG C 246 ? LEU C 347 ARG C 352 
AB1 3 PHE C 414 ? CYS C 416 ? PHE C 520 CYS C 522 
AB1 4 ALA C 419 ? ILE C 424 ? ALA C 525 ILE C 530 
AB2 1 ILE C 293 ? THR C 294 ? ILE C 399 THR C 400 
AB2 2 LYS C 300 ? TYR C 301 ? LYS C 406 TYR C 407 
AB3 1 LYS C 349 ? THR C 354 ? LYS C 455 THR C 460 
AB3 2 ALA C 440 ? CYS C 448 ? ALA C 546 CYS C 554 
AB3 3 PHE C 392 ? ASP C 400 ? PHE C 498 ASP C 506 
AB4 1 LYS D 10  ? ASP D 14  ? LYS D 116 ASP D 120 
AB4 2 GLY D 18  ? LEU D 22  ? GLY D 124 LEU D 128 
AB5 1 ALA D 232 ? GLU D 236 ? ALA D 338 GLU D 342 
AB5 2 LEU D 241 ? ARG D 246 ? LEU D 347 ARG D 352 
AB5 3 PHE D 414 ? CYS D 416 ? PHE D 520 CYS D 522 
AB5 4 ALA D 419 ? ILE D 424 ? ALA D 525 ILE D 530 
AB6 1 ILE D 293 ? THR D 294 ? ILE D 399 THR D 400 
AB6 2 LYS D 300 ? TYR D 301 ? LYS D 406 TYR D 407 
AB7 1 LYS D 349 ? THR D 354 ? LYS D 455 THR D 460 
AB7 2 ALA D 440 ? CYS D 448 ? ALA D 546 CYS D 554 
AB7 3 PHE D 392 ? ASP D 400 ? PHE D 498 ASP D 506 
AB8 1 LYS E 10  ? ASP E 14  ? LYS E 116 ASP E 120 
AB8 2 GLY E 18  ? LEU E 22  ? GLY E 124 LEU E 128 
AB9 1 ALA E 232 ? GLU E 236 ? ALA E 338 GLU E 342 
AB9 2 LEU E 241 ? ARG E 246 ? LEU E 347 ARG E 352 
AB9 3 PHE E 414 ? CYS E 416 ? PHE E 520 CYS E 522 
AB9 4 ALA E 419 ? ILE E 424 ? ALA E 525 ILE E 530 
AC1 1 ILE E 293 ? THR E 294 ? ILE E 399 THR E 400 
AC1 2 LYS E 300 ? TYR E 301 ? LYS E 406 TYR E 407 
AC2 1 LYS E 349 ? THR E 354 ? LYS E 455 THR E 460 
AC2 2 ALA E 440 ? CYS E 448 ? ALA E 546 CYS E 554 
AC2 3 PHE E 392 ? ASP E 400 ? PHE E 498 ASP E 506 
AC3 1 LYS F 10  ? ASP F 14  ? LYS F 116 ASP F 120 
AC3 2 GLY F 18  ? LEU F 22  ? GLY F 124 LEU F 128 
AC4 1 ALA F 232 ? GLU F 236 ? ALA F 338 GLU F 342 
AC4 2 LEU F 241 ? ARG F 246 ? LEU F 347 ARG F 352 
AC4 3 SER F 413 ? CYS F 416 ? SER F 519 CYS F 522 
AC4 4 ALA F 419 ? ILE F 424 ? ALA F 525 ILE F 530 
AC5 1 ILE F 293 ? THR F 294 ? ILE F 399 THR F 400 
AC5 2 LYS F 300 ? TYR F 301 ? LYS F 406 TYR F 407 
AC6 1 LYS F 349 ? THR F 354 ? LYS F 455 THR F 460 
AC6 2 ALA F 440 ? CYS F 448 ? ALA F 546 CYS F 554 
AC6 3 PHE F 392 ? ASP F 400 ? PHE F 498 ASP F 506 
AC7 1 LYS G 10  ? ASP G 14  ? LYS G 116 ASP G 120 
AC7 2 GLY G 18  ? LEU G 22  ? GLY G 124 LEU G 128 
AC8 1 ALA G 232 ? GLU G 236 ? ALA G 338 GLU G 342 
AC8 2 LEU G 241 ? ARG G 246 ? LEU G 347 ARG G 352 
AC8 3 SER G 413 ? CYS G 416 ? SER G 519 CYS G 522 
AC8 4 ALA G 419 ? ILE G 424 ? ALA G 525 ILE G 530 
AC9 1 ILE G 293 ? THR G 294 ? ILE G 399 THR G 400 
AC9 2 LYS G 300 ? TYR G 301 ? LYS G 406 TYR G 407 
AD1 1 LYS G 349 ? THR G 354 ? LYS G 455 THR G 460 
AD1 2 ALA G 440 ? CYS G 448 ? ALA G 546 CYS G 554 
AD1 3 PHE G 392 ? ASP G 400 ? PHE G 498 ASP G 506 
AD2 1 LYS H 10  ? ASP H 14  ? LYS H 116 ASP H 120 
AD2 2 GLY H 18  ? LEU H 22  ? GLY H 124 LEU H 128 
AD3 1 ALA H 232 ? GLU H 236 ? ALA H 338 GLU H 342 
AD3 2 LEU H 241 ? ARG H 246 ? LEU H 347 ARG H 352 
AD3 3 PHE H 414 ? CYS H 416 ? PHE H 520 CYS H 522 
AD3 4 ALA H 419 ? ILE H 424 ? ALA H 525 ILE H 530 
AD4 1 ILE H 293 ? THR H 294 ? ILE H 399 THR H 400 
AD4 2 LYS H 300 ? TYR H 301 ? LYS H 406 TYR H 407 
AD5 1 LYS H 349 ? THR H 354 ? LYS H 455 THR H 460 
AD5 2 ALA H 440 ? CYS H 448 ? ALA H 546 CYS H 554 
AD5 3 PHE H 392 ? ASP H 400 ? PHE H 498 ASP H 506 
AD6 1 LYS I 10  ? ASP I 14  ? LYS I 116 ASP I 120 
AD6 2 GLY I 18  ? LEU I 22  ? GLY I 124 LEU I 128 
AD7 1 ALA I 232 ? GLU I 236 ? ALA I 338 GLU I 342 
AD7 2 LEU I 241 ? ARG I 246 ? LEU I 347 ARG I 352 
AD7 3 SER I 413 ? CYS I 416 ? SER I 519 CYS I 522 
AD7 4 ALA I 419 ? ILE I 424 ? ALA I 525 ILE I 530 
AD8 1 ILE I 293 ? THR I 294 ? ILE I 399 THR I 400 
AD8 2 LYS I 300 ? TYR I 301 ? LYS I 406 TYR I 407 
AD9 1 LYS I 349 ? THR I 354 ? LYS I 455 THR I 460 
AD9 2 ALA I 440 ? CYS I 448 ? ALA I 546 CYS I 554 
AD9 3 PHE I 392 ? ASP I 400 ? PHE I 498 ASP I 506 
AE1 1 LYS J 10  ? ASP J 14  ? LYS J 116 ASP J 120 
AE1 2 GLY J 18  ? LEU J 22  ? GLY J 124 LEU J 128 
AE2 1 ALA J 232 ? GLU J 236 ? ALA J 338 GLU J 342 
AE2 2 LEU J 241 ? ARG J 246 ? LEU J 347 ARG J 352 
AE2 3 PHE J 414 ? CYS J 416 ? PHE J 520 CYS J 522 
AE2 4 ALA J 419 ? ILE J 424 ? ALA J 525 ILE J 530 
AE3 1 ILE J 293 ? THR J 294 ? ILE J 399 THR J 400 
AE3 2 LYS J 300 ? TYR J 301 ? LYS J 406 TYR J 407 
AE4 1 LYS J 349 ? THR J 354 ? LYS J 455 THR J 460 
AE4 2 ALA J 440 ? CYS J 448 ? ALA J 546 CYS J 554 
AE4 3 PHE J 392 ? ASP J 400 ? PHE J 498 ASP J 506 
AE5 1 LYS K 10  ? ASP K 14  ? LYS K 116 ASP K 120 
AE5 2 GLY K 18  ? LEU K 22  ? GLY K 124 LEU K 128 
AE6 1 ALA K 232 ? GLU K 236 ? ALA K 338 GLU K 342 
AE6 2 LEU K 241 ? ARG K 246 ? LEU K 347 ARG K 352 
AE6 3 PHE K 414 ? CYS K 416 ? PHE K 520 CYS K 522 
AE6 4 ALA K 419 ? ILE K 424 ? ALA K 525 ILE K 530 
AE7 1 ILE K 293 ? THR K 294 ? ILE K 399 THR K 400 
AE7 2 LYS K 300 ? TYR K 301 ? LYS K 406 TYR K 407 
AE8 1 LYS K 349 ? THR K 354 ? LYS K 455 THR K 460 
AE8 2 ALA K 440 ? CYS K 448 ? ALA K 546 CYS K 554 
AE8 3 PHE K 392 ? ASP K 400 ? PHE K 498 ASP K 506 
AE9 1 LYS L 10  ? ASP L 14  ? LYS L 116 ASP L 120 
AE9 2 GLY L 18  ? LEU L 22  ? GLY L 124 LEU L 128 
AF1 1 ALA L 232 ? GLU L 236 ? ALA L 338 GLU L 342 
AF1 2 LEU L 241 ? ARG L 246 ? LEU L 347 ARG L 352 
AF1 3 SER L 413 ? CYS L 416 ? SER L 519 CYS L 522 
AF1 4 ALA L 419 ? ILE L 424 ? ALA L 525 ILE L 530 
AF2 1 ILE L 293 ? THR L 294 ? ILE L 399 THR L 400 
AF2 2 LYS L 300 ? TYR L 301 ? LYS L 406 TYR L 407 
AF3 1 LYS L 349 ? THR L 354 ? LYS L 455 THR L 460 
AF3 2 ALA L 440 ? CYS L 448 ? ALA L 546 CYS L 554 
AF3 3 PHE L 392 ? ASP L 400 ? PHE L 498 ASP L 506 
AF4 1 LYS M 10  ? ASP M 14  ? LYS M 116 ASP M 120 
AF4 2 GLY M 18  ? LEU M 22  ? GLY M 124 LEU M 128 
AF5 1 ALA M 232 ? GLU M 236 ? ALA M 338 GLU M 342 
AF5 2 LEU M 241 ? ARG M 246 ? LEU M 347 ARG M 352 
AF5 3 SER M 413 ? CYS M 416 ? SER M 519 CYS M 522 
AF5 4 ALA M 419 ? ILE M 424 ? ALA M 525 ILE M 530 
AF6 1 ILE M 293 ? THR M 294 ? ILE M 399 THR M 400 
AF6 2 LYS M 300 ? TYR M 301 ? LYS M 406 TYR M 407 
AF7 1 LYS M 349 ? THR M 354 ? LYS M 455 THR M 460 
AF7 2 ALA M 440 ? CYS M 448 ? ALA M 546 CYS M 554 
AF7 3 PHE M 392 ? ASP M 400 ? PHE M 498 ASP M 506 
AF8 1 LYS N 10  ? ASP N 14  ? LYS N 116 ASP N 120 
AF8 2 GLY N 18  ? LEU N 22  ? GLY N 124 LEU N 128 
AF9 1 ALA N 232 ? GLU N 236 ? ALA N 338 GLU N 342 
AF9 2 LEU N 241 ? ARG N 246 ? LEU N 347 ARG N 352 
AF9 3 PHE N 414 ? CYS N 416 ? PHE N 520 CYS N 522 
AF9 4 ALA N 419 ? ILE N 424 ? ALA N 525 ILE N 530 
AG1 1 ILE N 293 ? THR N 294 ? ILE N 399 THR N 400 
AG1 2 LYS N 300 ? TYR N 301 ? LYS N 406 TYR N 407 
AG2 1 LYS N 349 ? THR N 354 ? LYS N 455 THR N 460 
AG2 2 ALA N 440 ? CYS N 448 ? ALA N 546 CYS N 554 
AG2 3 PHE N 392 ? ASP N 400 ? PHE N 498 ASP N 506 
AG3 1 LYS O 10  ? ASP O 14  ? LYS O 116 ASP O 120 
AG3 2 GLY O 18  ? LEU O 22  ? GLY O 124 LEU O 128 
AG4 1 ALA O 232 ? GLU O 236 ? ALA O 338 GLU O 342 
AG4 2 LEU O 241 ? ARG O 246 ? LEU O 347 ARG O 352 
AG4 3 PHE O 414 ? CYS O 416 ? PHE O 520 CYS O 522 
AG4 4 ALA O 419 ? ILE O 424 ? ALA O 525 ILE O 530 
AG5 1 ILE O 293 ? THR O 294 ? ILE O 399 THR O 400 
AG5 2 LYS O 300 ? TYR O 301 ? LYS O 406 TYR O 407 
AG6 1 LYS O 349 ? THR O 354 ? LYS O 455 THR O 460 
AG6 2 ALA O 440 ? CYS O 448 ? ALA O 546 CYS O 554 
AG6 3 PHE O 392 ? ASP O 400 ? PHE O 498 ASP O 506 
AG7 1 LYS P 10  ? ASP P 14  ? LYS P 116 ASP P 120 
AG7 2 GLY P 18  ? LEU P 22  ? GLY P 124 LEU P 128 
AG8 1 ALA P 232 ? GLU P 236 ? ALA P 338 GLU P 342 
AG8 2 LEU P 241 ? ARG P 246 ? LEU P 347 ARG P 352 
AG8 3 SER P 413 ? CYS P 416 ? SER P 519 CYS P 522 
AG8 4 ALA P 419 ? ILE P 424 ? ALA P 525 ILE P 530 
AG9 1 ILE P 293 ? THR P 294 ? ILE P 399 THR P 400 
AG9 2 LYS P 300 ? TYR P 301 ? LYS P 406 TYR P 407 
AH1 1 LYS P 349 ? THR P 354 ? LYS P 455 THR P 460 
AH1 2 ALA P 440 ? CYS P 448 ? ALA P 546 CYS P 554 
AH1 3 PHE P 392 ? ASP P 400 ? PHE P 498 ASP P 506 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 10  ? N LYS A 116 O LEU A 22  ? O LEU A 128 
AA2 1 2 N ARG A 233 ? N ARG A 339 O CYS A 244 ? O CYS A 350 
AA2 2 3 N ALA A 245 ? N ALA A 351 O TYR A 415 ? O TYR A 521 
AA2 3 4 N PHE A 414 ? N PHE A 520 O ILE A 424 ? O ILE A 530 
AA3 1 2 N ILE A 293 ? N ILE A 399 O TYR A 301 ? O TYR A 407 
AA4 1 2 N THR A 354 ? N THR A 460 O ILE A 444 ? O ILE A 550 
AA4 2 3 O ARG A 445 ? O ARG A 551 N ASP A 395 ? N ASP A 501 
AA5 1 2 N LYS B 10  ? N LYS B 116 O LEU B 22  ? O LEU B 128 
AA6 1 2 N ARG B 233 ? N ARG B 339 O CYS B 244 ? O CYS B 350 
AA6 2 3 N ALA B 245 ? N ALA B 351 O TYR B 415 ? O TYR B 521 
AA6 3 4 N PHE B 414 ? N PHE B 520 O ILE B 424 ? O ILE B 530 
AA7 1 2 N ILE B 293 ? N ILE B 399 O TYR B 301 ? O TYR B 407 
AA8 1 2 N THR B 354 ? N THR B 460 O ILE B 444 ? O ILE B 550 
AA8 2 3 O ARG B 445 ? O ARG B 551 N ASP B 395 ? N ASP B 501 
AA9 1 2 N LYS C 10  ? N LYS C 116 O LEU C 22  ? O LEU C 128 
AB1 1 2 N ARG C 233 ? N ARG C 339 O CYS C 244 ? O CYS C 350 
AB1 2 3 N ALA C 245 ? N ALA C 351 O TYR C 415 ? O TYR C 521 
AB1 3 4 N PHE C 414 ? N PHE C 520 O ILE C 424 ? O ILE C 530 
AB2 1 2 N ILE C 293 ? N ILE C 399 O TYR C 301 ? O TYR C 407 
AB3 1 2 N THR C 354 ? N THR C 460 O ILE C 444 ? O ILE C 550 
AB3 2 3 O ARG C 445 ? O ARG C 551 N ASP C 395 ? N ASP C 501 
AB4 1 2 N LYS D 10  ? N LYS D 116 O LEU D 22  ? O LEU D 128 
AB5 1 2 N ARG D 233 ? N ARG D 339 O CYS D 244 ? O CYS D 350 
AB5 2 3 N ALA D 245 ? N ALA D 351 O TYR D 415 ? O TYR D 521 
AB5 3 4 N PHE D 414 ? N PHE D 520 O ILE D 424 ? O ILE D 530 
AB6 1 2 N ILE D 293 ? N ILE D 399 O TYR D 301 ? O TYR D 407 
AB7 1 2 N THR D 354 ? N THR D 460 O ILE D 444 ? O ILE D 550 
AB7 2 3 O ARG D 445 ? O ARG D 551 N ASP D 395 ? N ASP D 501 
AB8 1 2 N LYS E 10  ? N LYS E 116 O LEU E 22  ? O LEU E 128 
AB9 1 2 N ARG E 233 ? N ARG E 339 O CYS E 244 ? O CYS E 350 
AB9 2 3 N ALA E 245 ? N ALA E 351 O TYR E 415 ? O TYR E 521 
AB9 3 4 N PHE E 414 ? N PHE E 520 O ILE E 424 ? O ILE E 530 
AC1 1 2 N ILE E 293 ? N ILE E 399 O TYR E 301 ? O TYR E 407 
AC2 1 2 N THR E 354 ? N THR E 460 O ILE E 444 ? O ILE E 550 
AC2 2 3 O ARG E 445 ? O ARG E 551 N ASP E 395 ? N ASP E 501 
AC3 1 2 N LYS F 10  ? N LYS F 116 O LEU F 22  ? O LEU F 128 
AC4 1 2 N ARG F 233 ? N ARG F 339 O CYS F 244 ? O CYS F 350 
AC4 2 3 N ALA F 245 ? N ALA F 351 O SER F 413 ? O SER F 519 
AC4 3 4 N PHE F 414 ? N PHE F 520 O ILE F 424 ? O ILE F 530 
AC5 1 2 N ILE F 293 ? N ILE F 399 O TYR F 301 ? O TYR F 407 
AC6 1 2 N THR F 354 ? N THR F 460 O ILE F 444 ? O ILE F 550 
AC6 2 3 O ARG F 445 ? O ARG F 551 N ASP F 395 ? N ASP F 501 
AC7 1 2 N LYS G 10  ? N LYS G 116 O LEU G 22  ? O LEU G 128 
AC8 1 2 N ARG G 233 ? N ARG G 339 O CYS G 244 ? O CYS G 350 
AC8 2 3 N ALA G 245 ? N ALA G 351 O SER G 413 ? O SER G 519 
AC8 3 4 N PHE G 414 ? N PHE G 520 O ILE G 424 ? O ILE G 530 
AC9 1 2 N ILE G 293 ? N ILE G 399 O TYR G 301 ? O TYR G 407 
AD1 1 2 N THR G 354 ? N THR G 460 O ILE G 444 ? O ILE G 550 
AD1 2 3 O ARG G 445 ? O ARG G 551 N ASP G 395 ? N ASP G 501 
AD2 1 2 N LYS H 10  ? N LYS H 116 O LEU H 22  ? O LEU H 128 
AD3 1 2 N ARG H 233 ? N ARG H 339 O CYS H 244 ? O CYS H 350 
AD3 2 3 N ALA H 245 ? N ALA H 351 O TYR H 415 ? O TYR H 521 
AD3 3 4 N PHE H 414 ? N PHE H 520 O ILE H 424 ? O ILE H 530 
AD4 1 2 N ILE H 293 ? N ILE H 399 O TYR H 301 ? O TYR H 407 
AD5 1 2 N THR H 354 ? N THR H 460 O ILE H 444 ? O ILE H 550 
AD5 2 3 O ARG H 445 ? O ARG H 551 N ASP H 395 ? N ASP H 501 
AD6 1 2 N LYS I 10  ? N LYS I 116 O LEU I 22  ? O LEU I 128 
AD7 1 2 N ARG I 233 ? N ARG I 339 O CYS I 244 ? O CYS I 350 
AD7 2 3 N ALA I 245 ? N ALA I 351 O SER I 413 ? O SER I 519 
AD7 3 4 N PHE I 414 ? N PHE I 520 O ILE I 424 ? O ILE I 530 
AD8 1 2 N ILE I 293 ? N ILE I 399 O TYR I 301 ? O TYR I 407 
AD9 1 2 N THR I 354 ? N THR I 460 O ILE I 444 ? O ILE I 550 
AD9 2 3 O ARG I 445 ? O ARG I 551 N ASP I 395 ? N ASP I 501 
AE1 1 2 N LYS J 10  ? N LYS J 116 O LEU J 22  ? O LEU J 128 
AE2 1 2 N ARG J 233 ? N ARG J 339 O CYS J 244 ? O CYS J 350 
AE2 2 3 N ALA J 245 ? N ALA J 351 O TYR J 415 ? O TYR J 521 
AE2 3 4 N PHE J 414 ? N PHE J 520 O ILE J 424 ? O ILE J 530 
AE3 1 2 N ILE J 293 ? N ILE J 399 O TYR J 301 ? O TYR J 407 
AE4 1 2 N THR J 354 ? N THR J 460 O ILE J 444 ? O ILE J 550 
AE4 2 3 O ARG J 445 ? O ARG J 551 N ASP J 395 ? N ASP J 501 
AE5 1 2 N LYS K 10  ? N LYS K 116 O LEU K 22  ? O LEU K 128 
AE6 1 2 N ARG K 233 ? N ARG K 339 O CYS K 244 ? O CYS K 350 
AE6 2 3 N ALA K 245 ? N ALA K 351 O TYR K 415 ? O TYR K 521 
AE6 3 4 N PHE K 414 ? N PHE K 520 O ILE K 424 ? O ILE K 530 
AE7 1 2 N ILE K 293 ? N ILE K 399 O TYR K 301 ? O TYR K 407 
AE8 1 2 N THR K 354 ? N THR K 460 O ILE K 444 ? O ILE K 550 
AE8 2 3 O ARG K 445 ? O ARG K 551 N ASP K 395 ? N ASP K 501 
AE9 1 2 N LYS L 10  ? N LYS L 116 O LEU L 22  ? O LEU L 128 
AF1 1 2 N ARG L 233 ? N ARG L 339 O CYS L 244 ? O CYS L 350 
AF1 2 3 N ALA L 245 ? N ALA L 351 O SER L 413 ? O SER L 519 
AF1 3 4 N PHE L 414 ? N PHE L 520 O ILE L 424 ? O ILE L 530 
AF2 1 2 N ILE L 293 ? N ILE L 399 O TYR L 301 ? O TYR L 407 
AF3 1 2 N THR L 354 ? N THR L 460 O ILE L 444 ? O ILE L 550 
AF3 2 3 O ARG L 445 ? O ARG L 551 N ASP L 395 ? N ASP L 501 
AF4 1 2 N LYS M 10  ? N LYS M 116 O LEU M 22  ? O LEU M 128 
AF5 1 2 N ARG M 233 ? N ARG M 339 O CYS M 244 ? O CYS M 350 
AF5 2 3 N ALA M 245 ? N ALA M 351 O SER M 413 ? O SER M 519 
AF5 3 4 N PHE M 414 ? N PHE M 520 O ILE M 424 ? O ILE M 530 
AF6 1 2 N ILE M 293 ? N ILE M 399 O TYR M 301 ? O TYR M 407 
AF7 1 2 N THR M 354 ? N THR M 460 O ILE M 444 ? O ILE M 550 
AF7 2 3 O ARG M 445 ? O ARG M 551 N ASP M 395 ? N ASP M 501 
AF8 1 2 N LYS N 10  ? N LYS N 116 O LEU N 22  ? O LEU N 128 
AF9 1 2 N ARG N 233 ? N ARG N 339 O CYS N 244 ? O CYS N 350 
AF9 2 3 N ALA N 245 ? N ALA N 351 O TYR N 415 ? O TYR N 521 
AF9 3 4 N PHE N 414 ? N PHE N 520 O ILE N 424 ? O ILE N 530 
AG1 1 2 N ILE N 293 ? N ILE N 399 O TYR N 301 ? O TYR N 407 
AG2 1 2 N THR N 354 ? N THR N 460 O ILE N 444 ? O ILE N 550 
AG2 2 3 O ARG N 445 ? O ARG N 551 N ASP N 395 ? N ASP N 501 
AG3 1 2 N LYS O 10  ? N LYS O 116 O LEU O 22  ? O LEU O 128 
AG4 1 2 N ARG O 233 ? N ARG O 339 O CYS O 244 ? O CYS O 350 
AG4 2 3 N ALA O 245 ? N ALA O 351 O TYR O 415 ? O TYR O 521 
AG4 3 4 N PHE O 414 ? N PHE O 520 O ILE O 424 ? O ILE O 530 
AG5 1 2 N ILE O 293 ? N ILE O 399 O TYR O 301 ? O TYR O 407 
AG6 1 2 N THR O 354 ? N THR O 460 O ILE O 444 ? O ILE O 550 
AG6 2 3 O ARG O 445 ? O ARG O 551 N ASP O 395 ? N ASP O 501 
AG7 1 2 N LYS P 10  ? N LYS P 116 O LEU P 22  ? O LEU P 128 
AG8 1 2 N ARG P 233 ? N ARG P 339 O CYS P 244 ? O CYS P 350 
AG8 2 3 N ALA P 245 ? N ALA P 351 O SER P 413 ? O SER P 519 
AG8 3 4 N PHE P 414 ? N PHE P 520 O ILE P 424 ? O ILE P 530 
AG9 1 2 N ILE P 293 ? N ILE P 399 O TYR P 301 ? O TYR P 407 
AH1 1 2 N THR P 354 ? N THR P 460 O ILE P 444 ? O ILE P 550 
AH1 2 3 O ARG P 445 ? O ARG P 551 N ASP P 395 ? N ASP P 501 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FE  701 ? 6  'binding site for residue FE A 701'  
AC2 Software A MG  702 ? 3  'binding site for residue MG A 702'  
AC3 Software A MG  703 ? 3  'binding site for residue MG A 703'  
AC4 Software A 1FZ 704 ? 17 'binding site for residue 1FZ A 704' 
AC5 Software A GTP 705 ? 16 'binding site for residue GTP A 705' 
AC6 Software A DTP 706 ? 16 'binding site for residue DTP A 706' 
AC7 Software B FE  701 ? 6  'binding site for residue FE B 701'  
AC8 Software B MG  702 ? 3  'binding site for residue MG B 702'  
AC9 Software B MG  703 ? 2  'binding site for residue MG B 703'  
AD1 Software B 1FZ 704 ? 17 'binding site for residue 1FZ B 704' 
AD2 Software B GTP 705 ? 14 'binding site for residue GTP B 705' 
AD3 Software B SO4 706 ? 4  'binding site for residue SO4 B 706' 
AD4 Software B DTP 707 ? 14 'binding site for residue DTP B 707' 
AD5 Software C DTP 701 ? 15 'binding site for residue DTP C 701' 
AD6 Software C FE  702 ? 6  'binding site for residue FE C 702'  
AD7 Software C MG  703 ? 3  'binding site for residue MG C 703'  
AD8 Software C MG  704 ? 2  'binding site for residue MG C 704'  
AD9 Software C 1FZ 705 ? 18 'binding site for residue 1FZ C 705' 
AE1 Software C SO4 706 ? 4  'binding site for residue SO4 C 706' 
AE2 Software D DTP 701 ? 14 'binding site for residue DTP D 701' 
AE3 Software D GTP 702 ? 14 'binding site for residue GTP D 702' 
AE4 Software D FE  703 ? 6  'binding site for residue FE D 703'  
AE5 Software D MG  704 ? 3  'binding site for residue MG D 704'  
AE6 Software D MG  705 ? 2  'binding site for residue MG D 705'  
AE7 Software D 1FZ 706 ? 17 'binding site for residue 1FZ D 706' 
AE8 Software D GTP 707 ? 15 'binding site for residue GTP D 707' 
AE9 Software D SO4 708 ? 4  'binding site for residue SO4 D 708' 
AF1 Software E FE  701 ? 6  'binding site for residue FE E 701'  
AF2 Software E MG  702 ? 3  'binding site for residue MG E 702'  
AF3 Software E MG  703 ? 2  'binding site for residue MG E 703'  
AF4 Software E 1FZ 704 ? 18 'binding site for residue 1FZ E 704' 
AF5 Software E GTP 705 ? 15 'binding site for residue GTP E 705' 
AF6 Software E SO4 706 ? 4  'binding site for residue SO4 E 706' 
AF7 Software E DTP 707 ? 16 'binding site for residue DTP E 707' 
AF8 Software F FE  701 ? 6  'binding site for residue FE F 701'  
AF9 Software F MG  702 ? 3  'binding site for residue MG F 702'  
AG1 Software F MG  703 ? 2  'binding site for residue MG F 703'  
AG2 Software F 1FZ 704 ? 18 'binding site for residue 1FZ F 704' 
AG3 Software F GTP 705 ? 15 'binding site for residue GTP F 705' 
AG4 Software F SO4 706 ? 4  'binding site for residue SO4 F 706' 
AG5 Software F DTP 707 ? 14 'binding site for residue DTP F 707' 
AG6 Software G DTP 701 ? 15 'binding site for residue DTP G 701' 
AG7 Software G FE  702 ? 6  'binding site for residue FE G 702'  
AG8 Software G MG  703 ? 3  'binding site for residue MG G 703'  
AG9 Software G MG  704 ? 2  'binding site for residue MG G 704'  
AH1 Software G 1FZ 705 ? 18 'binding site for residue 1FZ G 705' 
AH2 Software G GTP 706 ? 15 'binding site for residue GTP G 706' 
AH3 Software H DTP 701 ? 16 'binding site for residue DTP H 701' 
AH4 Software H FE  702 ? 6  'binding site for residue FE H 702'  
AH5 Software H MG  703 ? 2  'binding site for residue MG H 703'  
AH6 Software H MG  704 ? 3  'binding site for residue MG H 704'  
AH7 Software H 1FZ 705 ? 17 'binding site for residue 1FZ H 705' 
AH8 Software H GTP 706 ? 15 'binding site for residue GTP H 706' 
AH9 Software H SO4 707 ? 4  'binding site for residue SO4 H 707' 
AI1 Software I FE  701 ? 6  'binding site for residue FE I 701'  
AI2 Software I MG  702 ? 2  'binding site for residue MG I 702'  
AI3 Software I MG  703 ? 2  'binding site for residue MG I 703'  
AI4 Software I 1FZ 704 ? 19 'binding site for residue 1FZ I 704' 
AI5 Software I GTP 705 ? 15 'binding site for residue GTP I 705' 
AI6 Software I SO4 706 ? 3  'binding site for residue SO4 I 706' 
AI7 Software I GTP 707 ? 14 'binding site for residue GTP I 707' 
AI8 Software I DTP 708 ? 16 'binding site for residue DTP I 708' 
AI9 Software J FE  701 ? 6  'binding site for residue FE J 701'  
AJ1 Software J MG  702 ? 4  'binding site for residue MG J 702'  
AJ2 Software J MG  703 ? 3  'binding site for residue MG J 703'  
AJ3 Software J 1FZ 704 ? 17 'binding site for residue 1FZ J 704' 
AJ4 Software J SO4 705 ? 4  'binding site for residue SO4 J 705' 
AJ5 Software J DTP 706 ? 16 'binding site for residue DTP J 706' 
AJ6 Software K DTP 701 ? 14 'binding site for residue DTP K 701' 
AJ7 Software K FE  702 ? 6  'binding site for residue FE K 702'  
AJ8 Software K MG  703 ? 3  'binding site for residue MG K 703'  
AJ9 Software K MG  704 ? 3  'binding site for residue MG K 704'  
AK1 Software K 1FZ 705 ? 17 'binding site for residue 1FZ K 705' 
AK2 Software K GTP 706 ? 15 'binding site for residue GTP K 706' 
AK3 Software K SO4 707 ? 4  'binding site for residue SO4 K 707' 
AK4 Software L DTP 701 ? 15 'binding site for residue DTP L 701' 
AK5 Software L FE  702 ? 6  'binding site for residue FE L 702'  
AK6 Software L MG  703 ? 2  'binding site for residue MG L 703'  
AK7 Software L MG  704 ? 3  'binding site for residue MG L 704'  
AK8 Software L 1FZ 705 ? 19 'binding site for residue 1FZ L 705' 
AK9 Software L GTP 706 ? 15 'binding site for residue GTP L 706' 
AL1 Software M FE  701 ? 6  'binding site for residue FE M 701'  
AL2 Software M MG  702 ? 3  'binding site for residue MG M 702'  
AL3 Software M MG  703 ? 3  'binding site for residue MG M 703'  
AL4 Software M 1FZ 704 ? 16 'binding site for residue 1FZ M 704' 
AL5 Software M GTP 705 ? 15 'binding site for residue GTP M 705' 
AL6 Software M DTP 706 ? 15 'binding site for residue DTP M 706' 
AL7 Software M DTP 707 ? 15 'binding site for residue DTP M 707' 
AL8 Software N DTP 701 ? 14 'binding site for residue DTP N 701' 
AL9 Software N FE  702 ? 6  'binding site for residue FE N 702'  
AM1 Software N MG  703 ? 4  'binding site for residue MG N 703'  
AM2 Software N MG  704 ? 3  'binding site for residue MG N 704'  
AM3 Software N 1FZ 705 ? 18 'binding site for residue 1FZ N 705' 
AM4 Software N GTP 706 ? 13 'binding site for residue GTP N 706' 
AM5 Software N SO4 707 ? 2  'binding site for residue SO4 N 707' 
AM6 Software N DTP 708 ? 15 'binding site for residue DTP N 708' 
AM7 Software O FE  701 ? 6  'binding site for residue FE O 701'  
AM8 Software O MG  702 ? 3  'binding site for residue MG O 702'  
AM9 Software O MG  703 ? 3  'binding site for residue MG O 703'  
AN1 Software O 1FZ 704 ? 19 'binding site for residue 1FZ O 704' 
AN2 Software O GTP 705 ? 14 'binding site for residue GTP O 705' 
AN3 Software O SO4 706 ? 2  'binding site for residue SO4 O 706' 
AN4 Software P FE  701 ? 6  'binding site for residue FE P 701'  
AN5 Software P MG  702 ? 3  'binding site for residue MG P 702'  
AN6 Software P MG  703 ? 2  'binding site for residue MG P 703'  
AN7 Software P 1FZ 704 ? 18 'binding site for residue 1FZ P 704' 
AN8 Software P GTP 705 ? 15 'binding site for residue GTP P 705' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ARG A  58  ? ARG A 164 . ? 1_555 ? 
2   AC1 6  HIS A  61  ? HIS A 167 . ? 1_555 ? 
3   AC1 6  HIS A  100 ? HIS A 206 . ? 1_555 ? 
4   AC1 6  ASP A  101 ? ASP A 207 . ? 1_555 ? 
5   AC1 6  ASP A  205 ? ASP A 311 . ? 1_555 ? 
6   AC1 6  1FZ T  .   ? 1FZ A 704 . ? 1_555 ? 
7   AC2 3  ASP A  203 ? ASP A 309 . ? 1_555 ? 
8   AC2 3  LYS A  206 ? LYS A 312 . ? 1_555 ? 
9   AC2 3  1FZ T  .   ? 1FZ A 704 . ? 1_555 ? 
10  AC3 3  LYS A  10  ? LYS A 116 . ? 1_555 ? 
11  AC3 3  GTP U  .   ? GTP A 705 . ? 1_555 ? 
12  AC3 3  DTP DA .   ? DTP C 701 . ? 1_555 ? 
13  AC4 17 GLN A  43  ? GLN A 149 . ? 1_555 ? 
14  AC4 17 LEU A  44  ? LEU A 150 . ? 1_555 ? 
15  AC4 17 ARG A  58  ? ARG A 164 . ? 1_555 ? 
16  AC4 17 HIS A  61  ? HIS A 167 . ? 1_555 ? 
17  AC4 17 ASP A  101 ? ASP A 207 . ? 1_555 ? 
18  AC4 17 HIS A  104 ? HIS A 210 . ? 1_555 ? 
19  AC4 17 HIS A  109 ? HIS A 215 . ? 1_555 ? 
20  AC4 17 HIS A  127 ? HIS A 233 . ? 1_555 ? 
21  AC4 17 ASP A  205 ? ASP A 311 . ? 1_555 ? 
22  AC4 17 LYS A  206 ? LYS A 312 . ? 1_555 ? 
23  AC4 17 TYR A  209 ? TYR A 315 . ? 1_555 ? 
24  AC4 17 ASP A  213 ? ASP A 319 . ? 1_555 ? 
25  AC4 17 ARG A  260 ? ARG A 366 . ? 1_555 ? 
26  AC4 17 TYR A  268 ? TYR A 374 . ? 1_555 ? 
27  AC4 17 GLN A  269 ? GLN A 375 . ? 1_555 ? 
28  AC4 17 FE  Q  .   ? FE  A 701 . ? 1_555 ? 
29  AC4 17 MG  R  .   ? MG  A 702 . ? 1_555 ? 
30  AC5 16 LYS A  10  ? LYS A 116 . ? 1_555 ? 
31  AC5 16 VAL A  11  ? VAL A 117 . ? 1_555 ? 
32  AC5 16 ILE A  12  ? ILE A 118 . ? 1_555 ? 
33  AC5 16 ILE A  30  ? ILE A 136 . ? 1_555 ? 
34  AC5 16 ASP A  31  ? ASP A 137 . ? 1_555 ? 
35  AC5 16 GLN A  36  ? GLN A 142 . ? 1_555 ? 
36  AC5 16 ARG A  39  ? ARG A 145 . ? 1_555 ? 
37  AC5 16 PHE A  59  ? PHE A 165 . ? 1_555 ? 
38  AC5 16 MG  S  .   ? MG  A 703 . ? 1_555 ? 
39  AC5 16 TYR B  49  ? TYR B 155 . ? 1_555 ? 
40  AC5 16 VAL B  50  ? VAL B 156 . ? 1_555 ? 
41  AC5 16 VAL B  272 ? VAL B 378 . ? 1_555 ? 
42  AC5 16 ARG B  345 ? ARG B 451 . ? 1_555 ? 
43  AC5 16 LYS B  349 ? LYS B 455 . ? 1_555 ? 
44  AC5 16 LYS C  417 ? LYS C 523 . ? 1_555 ? 
45  AC5 16 DTP DA .   ? DTP C 701 . ? 1_555 ? 
46  AC6 16 ARG A  227 ? ARG A 333 . ? 1_555 ? 
47  AC6 16 ARG A  246 ? ARG A 352 . ? 1_555 ? 
48  AC6 16 LYS A  248 ? LYS A 354 . ? 1_555 ? 
49  AC6 16 ASN A  252 ? ASN A 358 . ? 1_555 ? 
50  AC6 16 LYS A  417 ? LYS A 523 . ? 1_555 ? 
51  AC6 16 VAL C  11  ? VAL C 117 . ? 1_555 ? 
52  AC6 16 ILE C  12  ? ILE C 118 . ? 1_555 ? 
53  AC6 16 ASN C  13  ? ASN C 119 . ? 1_555 ? 
54  AC6 16 MG  GA .   ? MG  C 704 . ? 1_555 ? 
55  AC6 16 VAL D  50  ? VAL D 156 . ? 1_555 ? 
56  AC6 16 PHE D  51  ? PHE D 157 . ? 1_555 ? 
57  AC6 16 ARG D  266 ? ARG D 372 . ? 1_555 ? 
58  AC6 16 HIS D  270 ? HIS D 376 . ? 1_555 ? 
59  AC6 16 LYS D  271 ? LYS D 377 . ? 1_555 ? 
60  AC6 16 VAL D  272 ? VAL D 378 . ? 1_555 ? 
61  AC6 16 GTP KA .   ? GTP D 702 . ? 1_555 ? 
62  AC7 6  ARG B  58  ? ARG B 164 . ? 1_555 ? 
63  AC7 6  HIS B  61  ? HIS B 167 . ? 1_555 ? 
64  AC7 6  HIS B  100 ? HIS B 206 . ? 1_555 ? 
65  AC7 6  ASP B  101 ? ASP B 207 . ? 1_555 ? 
66  AC7 6  ASP B  205 ? ASP B 311 . ? 1_555 ? 
67  AC7 6  1FZ Z  .   ? 1FZ B 704 . ? 1_555 ? 
68  AC8 3  ASP B  203 ? ASP B 309 . ? 1_555 ? 
69  AC8 3  LYS B  206 ? LYS B 312 . ? 1_555 ? 
70  AC8 3  1FZ Z  .   ? 1FZ B 704 . ? 1_555 ? 
71  AC9 2  GTP AA .   ? GTP B 705 . ? 1_555 ? 
72  AC9 2  DTP JA .   ? DTP D 701 . ? 1_555 ? 
73  AD1 17 GLN B  43  ? GLN B 149 . ? 1_555 ? 
74  AD1 17 LEU B  44  ? LEU B 150 . ? 1_555 ? 
75  AD1 17 ARG B  58  ? ARG B 164 . ? 1_555 ? 
76  AD1 17 HIS B  61  ? HIS B 167 . ? 1_555 ? 
77  AD1 17 ASP B  101 ? ASP B 207 . ? 1_555 ? 
78  AD1 17 HIS B  104 ? HIS B 210 . ? 1_555 ? 
79  AD1 17 HIS B  109 ? HIS B 215 . ? 1_555 ? 
80  AD1 17 HIS B  127 ? HIS B 233 . ? 1_555 ? 
81  AD1 17 ASP B  205 ? ASP B 311 . ? 1_555 ? 
82  AD1 17 LYS B  206 ? LYS B 312 . ? 1_555 ? 
83  AD1 17 TYR B  209 ? TYR B 315 . ? 1_555 ? 
84  AD1 17 ASP B  213 ? ASP B 319 . ? 1_555 ? 
85  AD1 17 ARG B  260 ? ARG B 366 . ? 1_555 ? 
86  AD1 17 TYR B  268 ? TYR B 374 . ? 1_555 ? 
87  AD1 17 GLN B  269 ? GLN B 375 . ? 1_555 ? 
88  AD1 17 FE  W  .   ? FE  B 701 . ? 1_555 ? 
89  AD1 17 MG  X  .   ? MG  B 702 . ? 1_555 ? 
90  AD2 14 TYR A  49  ? TYR A 155 . ? 1_555 ? 
91  AD2 14 VAL A  50  ? VAL A 156 . ? 1_555 ? 
92  AD2 14 VAL A  272 ? VAL A 378 . ? 1_555 ? 
93  AD2 14 ARG A  345 ? ARG A 451 . ? 1_555 ? 
94  AD2 14 LYS B  10  ? LYS B 116 . ? 1_555 ? 
95  AD2 14 VAL B  11  ? VAL B 117 . ? 1_555 ? 
96  AD2 14 ILE B  12  ? ILE B 118 . ? 1_555 ? 
97  AD2 14 ASP B  31  ? ASP B 137 . ? 1_555 ? 
98  AD2 14 GLN B  36  ? GLN B 142 . ? 1_555 ? 
99  AD2 14 ARG B  39  ? ARG B 145 . ? 1_555 ? 
100 AD2 14 PHE B  59  ? PHE B 165 . ? 1_555 ? 
101 AD2 14 MG  Y  .   ? MG  B 703 . ? 1_555 ? 
102 AD2 14 LYS D  417 ? LYS D 523 . ? 1_555 ? 
103 AD2 14 DTP JA .   ? DTP D 701 . ? 1_555 ? 
104 AD3 4  ARG B  199 ? ARG B 305 . ? 1_555 ? 
105 AD3 4  ARG B  242 ? ARG B 348 . ? 1_555 ? 
106 AD3 4  HIS B  411 ? HIS B 517 . ? 1_555 ? 
107 AD3 4  ARG B  425 ? ARG B 531 . ? 1_555 ? 
108 AD4 14 ARG B  227 ? ARG B 333 . ? 1_555 ? 
109 AD4 14 ARG B  246 ? ARG B 352 . ? 1_555 ? 
110 AD4 14 LYS B  248 ? LYS B 354 . ? 1_555 ? 
111 AD4 14 ASN B  252 ? ASN B 358 . ? 1_555 ? 
112 AD4 14 LYS B  417 ? LYS B 523 . ? 1_555 ? 
113 AD4 14 VAL C  50  ? VAL C 156 . ? 1_555 ? 
114 AD4 14 PHE C  51  ? PHE C 157 . ? 1_555 ? 
115 AD4 14 ARG C  266 ? ARG C 372 . ? 1_555 ? 
116 AD4 14 HIS C  270 ? HIS C 376 . ? 1_555 ? 
117 AD4 14 LYS C  271 ? LYS C 377 . ? 1_555 ? 
118 AD4 14 VAL D  11  ? VAL D 117 . ? 1_555 ? 
119 AD4 14 ASN D  13  ? ASN D 119 . ? 1_555 ? 
120 AD4 14 MG  NA .   ? MG  D 705 . ? 1_555 ? 
121 AD4 14 GTP PA .   ? GTP D 707 . ? 1_555 ? 
122 AD5 15 VAL A  11  ? VAL A 117 . ? 1_555 ? 
123 AD5 15 ILE A  12  ? ILE A 118 . ? 1_555 ? 
124 AD5 15 ASN A  13  ? ASN A 119 . ? 1_555 ? 
125 AD5 15 MG  S  .   ? MG  A 703 . ? 1_555 ? 
126 AD5 15 GTP U  .   ? GTP A 705 . ? 1_555 ? 
127 AD5 15 VAL B  50  ? VAL B 156 . ? 1_555 ? 
128 AD5 15 PHE B  51  ? PHE B 157 . ? 1_555 ? 
129 AD5 15 ARG B  266 ? ARG B 372 . ? 1_555 ? 
130 AD5 15 HIS B  270 ? HIS B 376 . ? 1_555 ? 
131 AD5 15 LYS B  271 ? LYS B 377 . ? 1_555 ? 
132 AD5 15 ARG C  227 ? ARG C 333 . ? 1_555 ? 
133 AD5 15 ARG C  246 ? ARG C 352 . ? 1_555 ? 
134 AD5 15 LYS C  248 ? LYS C 354 . ? 1_555 ? 
135 AD5 15 ASN C  252 ? ASN C 358 . ? 1_555 ? 
136 AD5 15 LYS C  417 ? LYS C 523 . ? 1_555 ? 
137 AD6 6  ARG C  58  ? ARG C 164 . ? 1_555 ? 
138 AD6 6  HIS C  61  ? HIS C 167 . ? 1_555 ? 
139 AD6 6  HIS C  100 ? HIS C 206 . ? 1_555 ? 
140 AD6 6  ASP C  101 ? ASP C 207 . ? 1_555 ? 
141 AD6 6  ASP C  205 ? ASP C 311 . ? 1_555 ? 
142 AD6 6  1FZ HA .   ? 1FZ C 705 . ? 1_555 ? 
143 AD7 3  ASP C  203 ? ASP C 309 . ? 1_555 ? 
144 AD7 3  LYS C  206 ? LYS C 312 . ? 1_555 ? 
145 AD7 3  1FZ HA .   ? 1FZ C 705 . ? 1_555 ? 
146 AD8 2  DTP V  .   ? DTP A 706 . ? 1_555 ? 
147 AD8 2  GTP KA .   ? GTP D 702 . ? 1_555 ? 
148 AD9 18 GLN C  43  ? GLN C 149 . ? 1_555 ? 
149 AD9 18 LEU C  44  ? LEU C 150 . ? 1_555 ? 
150 AD9 18 ARG C  58  ? ARG C 164 . ? 1_555 ? 
151 AD9 18 HIS C  61  ? HIS C 167 . ? 1_555 ? 
152 AD9 18 ASP C  101 ? ASP C 207 . ? 1_555 ? 
153 AD9 18 HIS C  104 ? HIS C 210 . ? 1_555 ? 
154 AD9 18 HIS C  109 ? HIS C 215 . ? 1_555 ? 
155 AD9 18 HIS C  127 ? HIS C 233 . ? 1_555 ? 
156 AD9 18 ASP C  205 ? ASP C 311 . ? 1_555 ? 
157 AD9 18 LYS C  206 ? LYS C 312 . ? 1_555 ? 
158 AD9 18 TYR C  209 ? TYR C 315 . ? 1_555 ? 
159 AD9 18 ASP C  213 ? ASP C 319 . ? 1_555 ? 
160 AD9 18 ARG C  260 ? ARG C 366 . ? 1_555 ? 
161 AD9 18 TYR C  268 ? TYR C 374 . ? 1_555 ? 
162 AD9 18 GLN C  269 ? GLN C 375 . ? 1_555 ? 
163 AD9 18 ASP C  277 ? ASP C 383 . ? 1_555 ? 
164 AD9 18 FE  EA .   ? FE  C 702 . ? 1_555 ? 
165 AD9 18 MG  FA .   ? MG  C 703 . ? 1_555 ? 
166 AE1 4  ARG C  199 ? ARG C 305 . ? 1_555 ? 
167 AE1 4  ARG C  242 ? ARG C 348 . ? 1_555 ? 
168 AE1 4  HIS C  411 ? HIS C 517 . ? 1_555 ? 
169 AE1 4  ARG C  425 ? ARG C 531 . ? 1_555 ? 
170 AE2 14 VAL A  50  ? VAL A 156 . ? 1_555 ? 
171 AE2 14 PHE A  51  ? PHE A 157 . ? 1_555 ? 
172 AE2 14 ARG A  266 ? ARG A 372 . ? 1_555 ? 
173 AE2 14 HIS A  270 ? HIS A 376 . ? 1_555 ? 
174 AE2 14 LYS A  271 ? LYS A 377 . ? 1_555 ? 
175 AE2 14 VAL B  11  ? VAL B 117 . ? 1_555 ? 
176 AE2 14 ASN B  13  ? ASN B 119 . ? 1_555 ? 
177 AE2 14 MG  Y  .   ? MG  B 703 . ? 1_555 ? 
178 AE2 14 GTP AA .   ? GTP B 705 . ? 1_555 ? 
179 AE2 14 ARG D  227 ? ARG D 333 . ? 1_555 ? 
180 AE2 14 ARG D  246 ? ARG D 352 . ? 1_555 ? 
181 AE2 14 LYS D  248 ? LYS D 354 . ? 1_555 ? 
182 AE2 14 ASN D  252 ? ASN D 358 . ? 1_555 ? 
183 AE2 14 LYS D  417 ? LYS D 523 . ? 1_555 ? 
184 AE3 14 LYS A  417 ? LYS A 523 . ? 1_555 ? 
185 AE3 14 DTP V  .   ? DTP A 706 . ? 1_555 ? 
186 AE3 14 LYS C  10  ? LYS C 116 . ? 1_555 ? 
187 AE3 14 VAL C  11  ? VAL C 117 . ? 1_555 ? 
188 AE3 14 ILE C  12  ? ILE C 118 . ? 1_555 ? 
189 AE3 14 ASP C  31  ? ASP C 137 . ? 1_555 ? 
190 AE3 14 GLN C  36  ? GLN C 142 . ? 1_555 ? 
191 AE3 14 ARG C  39  ? ARG C 145 . ? 1_555 ? 
192 AE3 14 PHE C  59  ? PHE C 165 . ? 1_555 ? 
193 AE3 14 MG  GA .   ? MG  C 704 . ? 1_555 ? 
194 AE3 14 TYR D  49  ? TYR D 155 . ? 1_555 ? 
195 AE3 14 VAL D  50  ? VAL D 156 . ? 1_555 ? 
196 AE3 14 VAL D  272 ? VAL D 378 . ? 1_555 ? 
197 AE3 14 ARG D  345 ? ARG D 451 . ? 1_555 ? 
198 AE4 6  ARG D  58  ? ARG D 164 . ? 1_555 ? 
199 AE4 6  HIS D  61  ? HIS D 167 . ? 1_555 ? 
200 AE4 6  HIS D  100 ? HIS D 206 . ? 1_555 ? 
201 AE4 6  ASP D  101 ? ASP D 207 . ? 1_555 ? 
202 AE4 6  ASP D  205 ? ASP D 311 . ? 1_555 ? 
203 AE4 6  1FZ OA .   ? 1FZ D 706 . ? 1_555 ? 
204 AE5 3  ASP D  203 ? ASP D 309 . ? 1_555 ? 
205 AE5 3  LYS D  206 ? LYS D 312 . ? 1_555 ? 
206 AE5 3  1FZ OA .   ? 1FZ D 706 . ? 1_555 ? 
207 AE6 2  DTP CA .   ? DTP B 707 . ? 1_555 ? 
208 AE6 2  GTP PA .   ? GTP D 707 . ? 1_555 ? 
209 AE7 17 GLN D  43  ? GLN D 149 . ? 1_555 ? 
210 AE7 17 LEU D  44  ? LEU D 150 . ? 1_555 ? 
211 AE7 17 ARG D  58  ? ARG D 164 . ? 1_555 ? 
212 AE7 17 HIS D  61  ? HIS D 167 . ? 1_555 ? 
213 AE7 17 ASP D  101 ? ASP D 207 . ? 1_555 ? 
214 AE7 17 HIS D  104 ? HIS D 210 . ? 1_555 ? 
215 AE7 17 HIS D  109 ? HIS D 215 . ? 1_555 ? 
216 AE7 17 HIS D  127 ? HIS D 233 . ? 1_555 ? 
217 AE7 17 ASP D  205 ? ASP D 311 . ? 1_555 ? 
218 AE7 17 LYS D  206 ? LYS D 312 . ? 1_555 ? 
219 AE7 17 TYR D  209 ? TYR D 315 . ? 1_555 ? 
220 AE7 17 ASP D  213 ? ASP D 319 . ? 1_555 ? 
221 AE7 17 ARG D  260 ? ARG D 366 . ? 1_555 ? 
222 AE7 17 TYR D  268 ? TYR D 374 . ? 1_555 ? 
223 AE7 17 GLN D  269 ? GLN D 375 . ? 1_555 ? 
224 AE7 17 FE  LA .   ? FE  D 703 . ? 1_555 ? 
225 AE7 17 MG  MA .   ? MG  D 704 . ? 1_555 ? 
226 AE8 15 LYS B  417 ? LYS B 523 . ? 1_555 ? 
227 AE8 15 DTP CA .   ? DTP B 707 . ? 1_555 ? 
228 AE8 15 TYR C  49  ? TYR C 155 . ? 1_555 ? 
229 AE8 15 VAL C  50  ? VAL C 156 . ? 1_555 ? 
230 AE8 15 VAL C  272 ? VAL C 378 . ? 1_555 ? 
231 AE8 15 ARG C  345 ? ARG C 451 . ? 1_555 ? 
232 AE8 15 LYS D  10  ? LYS D 116 . ? 1_555 ? 
233 AE8 15 VAL D  11  ? VAL D 117 . ? 1_555 ? 
234 AE8 15 ILE D  12  ? ILE D 118 . ? 1_555 ? 
235 AE8 15 ILE D  30  ? ILE D 136 . ? 1_555 ? 
236 AE8 15 ASP D  31  ? ASP D 137 . ? 1_555 ? 
237 AE8 15 GLN D  36  ? GLN D 142 . ? 1_555 ? 
238 AE8 15 ARG D  39  ? ARG D 145 . ? 1_555 ? 
239 AE8 15 PHE D  59  ? PHE D 165 . ? 1_555 ? 
240 AE8 15 MG  NA .   ? MG  D 705 . ? 1_555 ? 
241 AE9 4  ARG D  199 ? ARG D 305 . ? 1_555 ? 
242 AE9 4  ARG D  242 ? ARG D 348 . ? 1_555 ? 
243 AE9 4  HIS D  411 ? HIS D 517 . ? 1_555 ? 
244 AE9 4  ARG D  425 ? ARG D 531 . ? 1_555 ? 
245 AF1 6  ARG E  58  ? ARG E 164 . ? 1_555 ? 
246 AF1 6  HIS E  61  ? HIS E 167 . ? 1_555 ? 
247 AF1 6  HIS E  100 ? HIS E 206 . ? 1_555 ? 
248 AF1 6  ASP E  101 ? ASP E 207 . ? 1_555 ? 
249 AF1 6  ASP E  205 ? ASP E 311 . ? 1_555 ? 
250 AF1 6  1FZ UA .   ? 1FZ E 704 . ? 1_555 ? 
251 AF2 3  SER E  196 ? SER E 302 . ? 1_555 ? 
252 AF2 3  ASP E  203 ? ASP E 309 . ? 1_555 ? 
253 AF2 3  1FZ UA .   ? 1FZ E 704 . ? 1_555 ? 
254 AF3 2  GTP VA .   ? GTP E 705 . ? 1_555 ? 
255 AF3 2  DTP FB .   ? DTP G 701 . ? 1_555 ? 
256 AF4 18 GLN E  43  ? GLN E 149 . ? 1_555 ? 
257 AF4 18 LEU E  44  ? LEU E 150 . ? 1_555 ? 
258 AF4 18 ARG E  58  ? ARG E 164 . ? 1_555 ? 
259 AF4 18 HIS E  61  ? HIS E 167 . ? 1_555 ? 
260 AF4 18 ASP E  101 ? ASP E 207 . ? 1_555 ? 
261 AF4 18 HIS E  104 ? HIS E 210 . ? 1_555 ? 
262 AF4 18 HIS E  109 ? HIS E 215 . ? 1_555 ? 
263 AF4 18 HIS E  127 ? HIS E 233 . ? 1_555 ? 
264 AF4 18 ASP E  205 ? ASP E 311 . ? 1_555 ? 
265 AF4 18 LYS E  206 ? LYS E 312 . ? 1_555 ? 
266 AF4 18 TYR E  209 ? TYR E 315 . ? 1_555 ? 
267 AF4 18 ASP E  213 ? ASP E 319 . ? 1_555 ? 
268 AF4 18 ARG E  260 ? ARG E 366 . ? 1_555 ? 
269 AF4 18 TYR E  268 ? TYR E 374 . ? 1_555 ? 
270 AF4 18 GLN E  269 ? GLN E 375 . ? 1_555 ? 
271 AF4 18 ASP E  277 ? ASP E 383 . ? 1_555 ? 
272 AF4 18 FE  RA .   ? FE  E 701 . ? 1_555 ? 
273 AF4 18 MG  SA .   ? MG  E 702 . ? 1_555 ? 
274 AF5 15 LYS E  10  ? LYS E 116 . ? 1_555 ? 
275 AF5 15 VAL E  11  ? VAL E 117 . ? 1_555 ? 
276 AF5 15 ILE E  12  ? ILE E 118 . ? 1_555 ? 
277 AF5 15 ILE E  30  ? ILE E 136 . ? 1_555 ? 
278 AF5 15 ASP E  31  ? ASP E 137 . ? 1_555 ? 
279 AF5 15 GLN E  36  ? GLN E 142 . ? 1_555 ? 
280 AF5 15 ARG E  39  ? ARG E 145 . ? 1_555 ? 
281 AF5 15 PHE E  59  ? PHE E 165 . ? 1_555 ? 
282 AF5 15 MG  TA .   ? MG  E 703 . ? 1_555 ? 
283 AF5 15 TYR F  49  ? TYR F 155 . ? 1_555 ? 
284 AF5 15 VAL F  50  ? VAL F 156 . ? 1_555 ? 
285 AF5 15 VAL F  272 ? VAL F 378 . ? 1_555 ? 
286 AF5 15 ARG F  345 ? ARG F 451 . ? 1_555 ? 
287 AF5 15 LYS G  417 ? LYS G 523 . ? 1_555 ? 
288 AF5 15 DTP FB .   ? DTP G 701 . ? 1_555 ? 
289 AF6 4  ARG E  199 ? ARG E 305 . ? 1_555 ? 
290 AF6 4  ARG E  242 ? ARG E 348 . ? 1_555 ? 
291 AF6 4  HIS E  411 ? HIS E 517 . ? 1_555 ? 
292 AF6 4  ARG E  425 ? ARG E 531 . ? 1_555 ? 
293 AF7 16 ARG E  227 ? ARG E 333 . ? 1_555 ? 
294 AF7 16 ARG E  246 ? ARG E 352 . ? 1_555 ? 
295 AF7 16 LYS E  248 ? LYS E 354 . ? 1_555 ? 
296 AF7 16 ASN E  252 ? ASN E 358 . ? 1_555 ? 
297 AF7 16 LYS E  417 ? LYS E 523 . ? 1_555 ? 
298 AF7 16 VAL G  11  ? VAL G 117 . ? 1_555 ? 
299 AF7 16 ILE G  12  ? ILE G 118 . ? 1_555 ? 
300 AF7 16 ASN G  13  ? ASN G 119 . ? 1_555 ? 
301 AF7 16 MG  IB .   ? MG  G 704 . ? 1_555 ? 
302 AF7 16 GTP KB .   ? GTP G 706 . ? 1_555 ? 
303 AF7 16 VAL H  50  ? VAL H 156 . ? 1_555 ? 
304 AF7 16 PHE H  51  ? PHE H 157 . ? 1_555 ? 
305 AF7 16 ILE H  219 ? ILE H 325 . ? 1_555 ? 
306 AF7 16 ARG H  266 ? ARG H 372 . ? 1_555 ? 
307 AF7 16 HIS H  270 ? HIS H 376 . ? 1_555 ? 
308 AF7 16 LYS H  271 ? LYS H 377 . ? 1_555 ? 
309 AF8 6  ARG F  58  ? ARG F 164 . ? 1_555 ? 
310 AF8 6  HIS F  61  ? HIS F 167 . ? 1_555 ? 
311 AF8 6  HIS F  100 ? HIS F 206 . ? 1_555 ? 
312 AF8 6  ASP F  101 ? ASP F 207 . ? 1_555 ? 
313 AF8 6  ASP F  205 ? ASP F 311 . ? 1_555 ? 
314 AF8 6  1FZ BB .   ? 1FZ F 704 . ? 1_555 ? 
315 AF9 3  ASP F  203 ? ASP F 309 . ? 1_555 ? 
316 AF9 3  LYS F  206 ? LYS F 312 . ? 1_555 ? 
317 AF9 3  1FZ BB .   ? 1FZ F 704 . ? 1_555 ? 
318 AG1 2  GTP CB .   ? GTP F 705 . ? 1_555 ? 
319 AG1 2  DTP LB .   ? DTP H 701 . ? 1_555 ? 
320 AG2 18 GLN F  43  ? GLN F 149 . ? 1_555 ? 
321 AG2 18 LEU F  44  ? LEU F 150 . ? 1_555 ? 
322 AG2 18 ARG F  58  ? ARG F 164 . ? 1_555 ? 
323 AG2 18 HIS F  61  ? HIS F 167 . ? 1_555 ? 
324 AG2 18 ASP F  101 ? ASP F 207 . ? 1_555 ? 
325 AG2 18 HIS F  104 ? HIS F 210 . ? 1_555 ? 
326 AG2 18 HIS F  109 ? HIS F 215 . ? 1_555 ? 
327 AG2 18 HIS F  127 ? HIS F 233 . ? 1_555 ? 
328 AG2 18 ASP F  205 ? ASP F 311 . ? 1_555 ? 
329 AG2 18 LYS F  206 ? LYS F 312 . ? 1_555 ? 
330 AG2 18 TYR F  209 ? TYR F 315 . ? 1_555 ? 
331 AG2 18 ASP F  213 ? ASP F 319 . ? 1_555 ? 
332 AG2 18 ARG F  260 ? ARG F 366 . ? 1_555 ? 
333 AG2 18 TYR F  268 ? TYR F 374 . ? 1_555 ? 
334 AG2 18 GLN F  269 ? GLN F 375 . ? 1_555 ? 
335 AG2 18 ASP F  277 ? ASP F 383 . ? 1_555 ? 
336 AG2 18 FE  YA .   ? FE  F 701 . ? 1_555 ? 
337 AG2 18 MG  ZA .   ? MG  F 702 . ? 1_555 ? 
338 AG3 15 TYR E  49  ? TYR E 155 . ? 1_555 ? 
339 AG3 15 VAL E  50  ? VAL E 156 . ? 1_555 ? 
340 AG3 15 ARG E  345 ? ARG E 451 . ? 1_555 ? 
341 AG3 15 LYS E  349 ? LYS E 455 . ? 1_555 ? 
342 AG3 15 LYS F  10  ? LYS F 116 . ? 1_555 ? 
343 AG3 15 VAL F  11  ? VAL F 117 . ? 1_555 ? 
344 AG3 15 ILE F  12  ? ILE F 118 . ? 1_555 ? 
345 AG3 15 ILE F  30  ? ILE F 136 . ? 1_555 ? 
346 AG3 15 ASP F  31  ? ASP F 137 . ? 1_555 ? 
347 AG3 15 GLN F  36  ? GLN F 142 . ? 1_555 ? 
348 AG3 15 ARG F  39  ? ARG F 145 . ? 1_555 ? 
349 AG3 15 PHE F  59  ? PHE F 165 . ? 1_555 ? 
350 AG3 15 MG  AB .   ? MG  F 703 . ? 1_555 ? 
351 AG3 15 LYS H  417 ? LYS H 523 . ? 1_555 ? 
352 AG3 15 DTP LB .   ? DTP H 701 . ? 1_555 ? 
353 AG4 4  ARG F  199 ? ARG F 305 . ? 1_555 ? 
354 AG4 4  ARG F  242 ? ARG F 348 . ? 1_555 ? 
355 AG4 4  HIS F  411 ? HIS F 517 . ? 1_555 ? 
356 AG4 4  ARG F  425 ? ARG F 531 . ? 1_555 ? 
357 AG5 14 ARG F  227 ? ARG F 333 . ? 1_555 ? 
358 AG5 14 ARG F  246 ? ARG F 352 . ? 1_555 ? 
359 AG5 14 LYS F  248 ? LYS F 354 . ? 1_555 ? 
360 AG5 14 ASN F  252 ? ASN F 358 . ? 1_555 ? 
361 AG5 14 LYS F  417 ? LYS F 523 . ? 1_555 ? 
362 AG5 14 VAL G  50  ? VAL G 156 . ? 1_555 ? 
363 AG5 14 PHE G  51  ? PHE G 157 . ? 1_555 ? 
364 AG5 14 ARG G  266 ? ARG G 372 . ? 1_555 ? 
365 AG5 14 HIS G  270 ? HIS G 376 . ? 1_555 ? 
366 AG5 14 LYS G  271 ? LYS G 377 . ? 1_555 ? 
367 AG5 14 VAL H  11  ? VAL H 117 . ? 1_555 ? 
368 AG5 14 ASN H  13  ? ASN H 119 . ? 1_555 ? 
369 AG5 14 MG  OB .   ? MG  H 704 . ? 1_555 ? 
370 AG5 14 GTP QB .   ? GTP H 706 . ? 1_555 ? 
371 AG6 15 VAL E  11  ? VAL E 117 . ? 1_555 ? 
372 AG6 15 ASN E  13  ? ASN E 119 . ? 1_555 ? 
373 AG6 15 HIS E  19  ? HIS E 125 . ? 1_555 ? 
374 AG6 15 MG  TA .   ? MG  E 703 . ? 1_555 ? 
375 AG6 15 GTP VA .   ? GTP E 705 . ? 1_555 ? 
376 AG6 15 VAL F  50  ? VAL F 156 . ? 1_555 ? 
377 AG6 15 PHE F  51  ? PHE F 157 . ? 1_555 ? 
378 AG6 15 ARG F  266 ? ARG F 372 . ? 1_555 ? 
379 AG6 15 HIS F  270 ? HIS F 376 . ? 1_555 ? 
380 AG6 15 LYS F  271 ? LYS F 377 . ? 1_555 ? 
381 AG6 15 ARG G  227 ? ARG G 333 . ? 1_555 ? 
382 AG6 15 ARG G  246 ? ARG G 352 . ? 1_555 ? 
383 AG6 15 LYS G  248 ? LYS G 354 . ? 1_555 ? 
384 AG6 15 ASN G  252 ? ASN G 358 . ? 1_555 ? 
385 AG6 15 LYS G  417 ? LYS G 523 . ? 1_555 ? 
386 AG7 6  ARG G  58  ? ARG G 164 . ? 1_555 ? 
387 AG7 6  HIS G  61  ? HIS G 167 . ? 1_555 ? 
388 AG7 6  HIS G  100 ? HIS G 206 . ? 1_555 ? 
389 AG7 6  ASP G  101 ? ASP G 207 . ? 1_555 ? 
390 AG7 6  ASP G  205 ? ASP G 311 . ? 1_555 ? 
391 AG7 6  1FZ JB .   ? 1FZ G 705 . ? 1_555 ? 
392 AG8 3  ASP G  203 ? ASP G 309 . ? 1_555 ? 
393 AG8 3  LYS G  206 ? LYS G 312 . ? 1_555 ? 
394 AG8 3  1FZ JB .   ? 1FZ G 705 . ? 1_555 ? 
395 AG9 2  DTP XA .   ? DTP E 707 . ? 1_555 ? 
396 AG9 2  GTP KB .   ? GTP G 706 . ? 1_555 ? 
397 AH1 18 GLN G  43  ? GLN G 149 . ? 1_555 ? 
398 AH1 18 LEU G  44  ? LEU G 150 . ? 1_555 ? 
399 AH1 18 ARG G  58  ? ARG G 164 . ? 1_555 ? 
400 AH1 18 HIS G  61  ? HIS G 167 . ? 1_555 ? 
401 AH1 18 ASP G  101 ? ASP G 207 . ? 1_555 ? 
402 AH1 18 HIS G  104 ? HIS G 210 . ? 1_555 ? 
403 AH1 18 HIS G  109 ? HIS G 215 . ? 1_555 ? 
404 AH1 18 HIS G  127 ? HIS G 233 . ? 1_555 ? 
405 AH1 18 ASP G  205 ? ASP G 311 . ? 1_555 ? 
406 AH1 18 LYS G  206 ? LYS G 312 . ? 1_555 ? 
407 AH1 18 TYR G  209 ? TYR G 315 . ? 1_555 ? 
408 AH1 18 ASP G  213 ? ASP G 319 . ? 1_555 ? 
409 AH1 18 ARG G  260 ? ARG G 366 . ? 1_555 ? 
410 AH1 18 HIS G  264 ? HIS G 370 . ? 1_555 ? 
411 AH1 18 TYR G  268 ? TYR G 374 . ? 1_555 ? 
412 AH1 18 GLN G  269 ? GLN G 375 . ? 1_555 ? 
413 AH1 18 FE  GB .   ? FE  G 702 . ? 1_555 ? 
414 AH1 18 MG  HB .   ? MG  G 703 . ? 1_555 ? 
415 AH2 15 LYS E  417 ? LYS E 523 . ? 1_555 ? 
416 AH2 15 DTP XA .   ? DTP E 707 . ? 1_555 ? 
417 AH2 15 LYS G  10  ? LYS G 116 . ? 1_555 ? 
418 AH2 15 VAL G  11  ? VAL G 117 . ? 1_555 ? 
419 AH2 15 ILE G  12  ? ILE G 118 . ? 1_555 ? 
420 AH2 15 ILE G  30  ? ILE G 136 . ? 1_555 ? 
421 AH2 15 ASP G  31  ? ASP G 137 . ? 1_555 ? 
422 AH2 15 GLN G  36  ? GLN G 142 . ? 1_555 ? 
423 AH2 15 ARG G  39  ? ARG G 145 . ? 1_555 ? 
424 AH2 15 PHE G  59  ? PHE G 165 . ? 1_555 ? 
425 AH2 15 MG  IB .   ? MG  G 704 . ? 1_555 ? 
426 AH2 15 TYR H  49  ? TYR H 155 . ? 1_555 ? 
427 AH2 15 VAL H  50  ? VAL H 156 . ? 1_555 ? 
428 AH2 15 VAL H  272 ? VAL H 378 . ? 1_555 ? 
429 AH2 15 ARG H  345 ? ARG H 451 . ? 1_555 ? 
430 AH3 16 VAL E  50  ? VAL E 156 . ? 1_555 ? 
431 AH3 16 PHE E  51  ? PHE E 157 . ? 1_555 ? 
432 AH3 16 ARG E  266 ? ARG E 372 . ? 1_555 ? 
433 AH3 16 HIS E  270 ? HIS E 376 . ? 1_555 ? 
434 AH3 16 LYS E  271 ? LYS E 377 . ? 1_555 ? 
435 AH3 16 VAL F  11  ? VAL F 117 . ? 1_555 ? 
436 AH3 16 ILE F  12  ? ILE F 118 . ? 1_555 ? 
437 AH3 16 ASN F  13  ? ASN F 119 . ? 1_555 ? 
438 AH3 16 HIS F  19  ? HIS F 125 . ? 1_555 ? 
439 AH3 16 MG  AB .   ? MG  F 703 . ? 1_555 ? 
440 AH3 16 GTP CB .   ? GTP F 705 . ? 1_555 ? 
441 AH3 16 ARG H  227 ? ARG H 333 . ? 1_555 ? 
442 AH3 16 ARG H  246 ? ARG H 352 . ? 1_555 ? 
443 AH3 16 LYS H  248 ? LYS H 354 . ? 1_555 ? 
444 AH3 16 ASN H  252 ? ASN H 358 . ? 1_555 ? 
445 AH3 16 LYS H  417 ? LYS H 523 . ? 1_555 ? 
446 AH4 6  ARG H  58  ? ARG H 164 . ? 1_555 ? 
447 AH4 6  HIS H  61  ? HIS H 167 . ? 1_555 ? 
448 AH4 6  HIS H  100 ? HIS H 206 . ? 1_555 ? 
449 AH4 6  ASP H  101 ? ASP H 207 . ? 1_555 ? 
450 AH4 6  ASP H  205 ? ASP H 311 . ? 1_555 ? 
451 AH4 6  1FZ PB .   ? 1FZ H 705 . ? 1_555 ? 
452 AH5 2  ASP H  203 ? ASP H 309 . ? 1_555 ? 
453 AH5 2  1FZ PB .   ? 1FZ H 705 . ? 1_555 ? 
454 AH6 3  DTP EB .   ? DTP F 707 . ? 1_555 ? 
455 AH6 3  LYS H  10  ? LYS H 116 . ? 1_555 ? 
456 AH6 3  GTP QB .   ? GTP H 706 . ? 1_555 ? 
457 AH7 17 GLN H  43  ? GLN H 149 . ? 1_555 ? 
458 AH7 17 LEU H  44  ? LEU H 150 . ? 1_555 ? 
459 AH7 17 ARG H  58  ? ARG H 164 . ? 1_555 ? 
460 AH7 17 HIS H  61  ? HIS H 167 . ? 1_555 ? 
461 AH7 17 ASP H  101 ? ASP H 207 . ? 1_555 ? 
462 AH7 17 HIS H  104 ? HIS H 210 . ? 1_555 ? 
463 AH7 17 HIS H  109 ? HIS H 215 . ? 1_555 ? 
464 AH7 17 HIS H  127 ? HIS H 233 . ? 1_555 ? 
465 AH7 17 ASP H  205 ? ASP H 311 . ? 1_555 ? 
466 AH7 17 LYS H  206 ? LYS H 312 . ? 1_555 ? 
467 AH7 17 TYR H  209 ? TYR H 315 . ? 1_555 ? 
468 AH7 17 ASP H  213 ? ASP H 319 . ? 1_555 ? 
469 AH7 17 ARG H  260 ? ARG H 366 . ? 1_555 ? 
470 AH7 17 TYR H  268 ? TYR H 374 . ? 1_555 ? 
471 AH7 17 GLN H  269 ? GLN H 375 . ? 1_555 ? 
472 AH7 17 FE  MB .   ? FE  H 702 . ? 1_555 ? 
473 AH7 17 MG  NB .   ? MG  H 703 . ? 1_555 ? 
474 AH8 15 LYS F  417 ? LYS F 523 . ? 1_555 ? 
475 AH8 15 DTP EB .   ? DTP F 707 . ? 1_555 ? 
476 AH8 15 TYR G  49  ? TYR G 155 . ? 1_555 ? 
477 AH8 15 VAL G  50  ? VAL G 156 . ? 1_555 ? 
478 AH8 15 VAL G  272 ? VAL G 378 . ? 1_555 ? 
479 AH8 15 ARG G  345 ? ARG G 451 . ? 1_555 ? 
480 AH8 15 LYS H  10  ? LYS H 116 . ? 1_555 ? 
481 AH8 15 VAL H  11  ? VAL H 117 . ? 1_555 ? 
482 AH8 15 ILE H  12  ? ILE H 118 . ? 1_555 ? 
483 AH8 15 ILE H  30  ? ILE H 136 . ? 1_555 ? 
484 AH8 15 ASP H  31  ? ASP H 137 . ? 1_555 ? 
485 AH8 15 GLN H  36  ? GLN H 142 . ? 1_555 ? 
486 AH8 15 ARG H  39  ? ARG H 145 . ? 1_555 ? 
487 AH8 15 PHE H  59  ? PHE H 165 . ? 1_555 ? 
488 AH8 15 MG  OB .   ? MG  H 704 . ? 1_555 ? 
489 AH9 4  ARG H  199 ? ARG H 305 . ? 1_555 ? 
490 AH9 4  ARG H  242 ? ARG H 348 . ? 1_555 ? 
491 AH9 4  HIS H  411 ? HIS H 517 . ? 1_555 ? 
492 AH9 4  ARG H  425 ? ARG H 531 . ? 1_555 ? 
493 AI1 6  ARG I  58  ? ARG I 164 . ? 1_555 ? 
494 AI1 6  HIS I  61  ? HIS I 167 . ? 1_555 ? 
495 AI1 6  HIS I  100 ? HIS I 206 . ? 1_555 ? 
496 AI1 6  ASP I  101 ? ASP I 207 . ? 1_555 ? 
497 AI1 6  ASP I  205 ? ASP I 311 . ? 1_555 ? 
498 AI1 6  1FZ VB .   ? 1FZ I 704 . ? 1_555 ? 
499 AI2 2  ASP I  203 ? ASP I 309 . ? 1_555 ? 
500 AI2 2  1FZ VB .   ? 1FZ I 704 . ? 1_555 ? 
501 AI3 2  GTP WB .   ? GTP I 705 . ? 1_555 ? 
502 AI3 2  DTP GC .   ? DTP K 701 . ? 1_555 ? 
503 AI4 19 GLN I  43  ? GLN I 149 . ? 1_555 ? 
504 AI4 19 LEU I  44  ? LEU I 150 . ? 1_555 ? 
505 AI4 19 ARG I  58  ? ARG I 164 . ? 1_555 ? 
506 AI4 19 HIS I  61  ? HIS I 167 . ? 1_555 ? 
507 AI4 19 ASP I  101 ? ASP I 207 . ? 1_555 ? 
508 AI4 19 HIS I  104 ? HIS I 210 . ? 1_555 ? 
509 AI4 19 HIS I  109 ? HIS I 215 . ? 1_555 ? 
510 AI4 19 HIS I  127 ? HIS I 233 . ? 1_555 ? 
511 AI4 19 ASP I  205 ? ASP I 311 . ? 1_555 ? 
512 AI4 19 LYS I  206 ? LYS I 312 . ? 1_555 ? 
513 AI4 19 TYR I  209 ? TYR I 315 . ? 1_555 ? 
514 AI4 19 ASP I  213 ? ASP I 319 . ? 1_555 ? 
515 AI4 19 ARG I  260 ? ARG I 366 . ? 1_555 ? 
516 AI4 19 HIS I  264 ? HIS I 370 . ? 1_555 ? 
517 AI4 19 TYR I  268 ? TYR I 374 . ? 1_555 ? 
518 AI4 19 GLN I  269 ? GLN I 375 . ? 1_555 ? 
519 AI4 19 ASP I  277 ? ASP I 383 . ? 1_555 ? 
520 AI4 19 FE  SB .   ? FE  I 701 . ? 1_555 ? 
521 AI4 19 MG  TB .   ? MG  I 702 . ? 1_555 ? 
522 AI5 15 LYS I  10  ? LYS I 116 . ? 1_555 ? 
523 AI5 15 VAL I  11  ? VAL I 117 . ? 1_555 ? 
524 AI5 15 ILE I  12  ? ILE I 118 . ? 1_555 ? 
525 AI5 15 ILE I  30  ? ILE I 136 . ? 1_555 ? 
526 AI5 15 ASP I  31  ? ASP I 137 . ? 1_555 ? 
527 AI5 15 GLN I  36  ? GLN I 142 . ? 1_555 ? 
528 AI5 15 ARG I  39  ? ARG I 145 . ? 1_555 ? 
529 AI5 15 PHE I  59  ? PHE I 165 . ? 1_555 ? 
530 AI5 15 MG  UB .   ? MG  I 703 . ? 1_555 ? 
531 AI5 15 TYR J  49  ? TYR J 155 . ? 1_555 ? 
532 AI5 15 VAL J  50  ? VAL J 156 . ? 1_555 ? 
533 AI5 15 VAL J  272 ? VAL J 378 . ? 1_555 ? 
534 AI5 15 ARG J  345 ? ARG J 451 . ? 1_555 ? 
535 AI5 15 LYS K  417 ? LYS K 523 . ? 1_555 ? 
536 AI5 15 DTP GC .   ? DTP K 701 . ? 1_555 ? 
537 AI6 3  ARG I  199 ? ARG I 305 . ? 1_555 ? 
538 AI6 3  HIS I  411 ? HIS I 517 . ? 1_555 ? 
539 AI6 3  ARG I  425 ? ARG I 531 . ? 1_555 ? 
540 AI7 14 TYR I  49  ? TYR I 155 . ? 1_555 ? 
541 AI7 14 VAL I  50  ? VAL I 156 . ? 1_555 ? 
542 AI7 14 VAL I  272 ? VAL I 378 . ? 1_555 ? 
543 AI7 14 ARG I  345 ? ARG I 451 . ? 1_555 ? 
544 AI7 14 LYS J  10  ? LYS J 116 . ? 1_555 ? 
545 AI7 14 VAL J  11  ? VAL J 117 . ? 1_555 ? 
546 AI7 14 ILE J  12  ? ILE J 118 . ? 1_555 ? 
547 AI7 14 ASP J  31  ? ASP J 137 . ? 1_555 ? 
548 AI7 14 GLN J  36  ? GLN J 142 . ? 1_555 ? 
549 AI7 14 ARG J  39  ? ARG J 145 . ? 1_555 ? 
550 AI7 14 PHE J  59  ? PHE J 165 . ? 1_555 ? 
551 AI7 14 MG  CC .   ? MG  J 703 . ? 1_555 ? 
552 AI7 14 LYS L  417 ? LYS L 523 . ? 1_555 ? 
553 AI7 14 DTP NC .   ? DTP L 701 . ? 1_555 ? 
554 AI8 16 ARG I  227 ? ARG I 333 . ? 1_555 ? 
555 AI8 16 ARG I  246 ? ARG I 352 . ? 1_555 ? 
556 AI8 16 LYS I  248 ? LYS I 354 . ? 1_555 ? 
557 AI8 16 ASN I  252 ? ASN I 358 . ? 1_555 ? 
558 AI8 16 LYS I  417 ? LYS I 523 . ? 1_555 ? 
559 AI8 16 VAL K  11  ? VAL K 117 . ? 1_555 ? 
560 AI8 16 ILE K  12  ? ILE K 118 . ? 1_555 ? 
561 AI8 16 ASN K  13  ? ASN K 119 . ? 1_555 ? 
562 AI8 16 HIS K  19  ? HIS K 125 . ? 1_555 ? 
563 AI8 16 MG  JC .   ? MG  K 704 . ? 1_555 ? 
564 AI8 16 GTP LC .   ? GTP K 706 . ? 1_555 ? 
565 AI8 16 VAL L  50  ? VAL L 156 . ? 1_555 ? 
566 AI8 16 PHE L  51  ? PHE L 157 . ? 1_555 ? 
567 AI8 16 ARG L  266 ? ARG L 372 . ? 1_555 ? 
568 AI8 16 HIS L  270 ? HIS L 376 . ? 1_555 ? 
569 AI8 16 LYS L  271 ? LYS L 377 . ? 1_555 ? 
570 AI9 6  ARG J  58  ? ARG J 164 . ? 1_555 ? 
571 AI9 6  HIS J  61  ? HIS J 167 . ? 1_555 ? 
572 AI9 6  HIS J  100 ? HIS J 206 . ? 1_555 ? 
573 AI9 6  ASP J  101 ? ASP J 207 . ? 1_555 ? 
574 AI9 6  ASP J  205 ? ASP J 311 . ? 1_555 ? 
575 AI9 6  1FZ DC .   ? 1FZ J 704 . ? 1_555 ? 
576 AJ1 4  ASP J  203 ? ASP J 309 . ? 1_555 ? 
577 AJ1 4  ASP J  205 ? ASP J 311 . ? 1_555 ? 
578 AJ1 4  LYS J  206 ? LYS J 312 . ? 1_555 ? 
579 AJ1 4  1FZ DC .   ? 1FZ J 704 . ? 1_555 ? 
580 AJ2 3  GTP YB .   ? GTP I 707 . ? 1_555 ? 
581 AJ2 3  LYS J  10  ? LYS J 116 . ? 1_555 ? 
582 AJ2 3  DTP NC .   ? DTP L 701 . ? 1_555 ? 
583 AJ3 17 GLN J  43  ? GLN J 149 . ? 1_555 ? 
584 AJ3 17 LEU J  44  ? LEU J 150 . ? 1_555 ? 
585 AJ3 17 ARG J  58  ? ARG J 164 . ? 1_555 ? 
586 AJ3 17 HIS J  61  ? HIS J 167 . ? 1_555 ? 
587 AJ3 17 ASP J  101 ? ASP J 207 . ? 1_555 ? 
588 AJ3 17 HIS J  104 ? HIS J 210 . ? 1_555 ? 
589 AJ3 17 HIS J  109 ? HIS J 215 . ? 1_555 ? 
590 AJ3 17 HIS J  127 ? HIS J 233 . ? 1_555 ? 
591 AJ3 17 ASP J  205 ? ASP J 311 . ? 1_555 ? 
592 AJ3 17 LYS J  206 ? LYS J 312 . ? 1_555 ? 
593 AJ3 17 TYR J  209 ? TYR J 315 . ? 1_555 ? 
594 AJ3 17 ASP J  213 ? ASP J 319 . ? 1_555 ? 
595 AJ3 17 ARG J  260 ? ARG J 366 . ? 1_555 ? 
596 AJ3 17 TYR J  268 ? TYR J 374 . ? 1_555 ? 
597 AJ3 17 GLN J  269 ? GLN J 375 . ? 1_555 ? 
598 AJ3 17 FE  AC .   ? FE  J 701 . ? 1_555 ? 
599 AJ3 17 MG  BC .   ? MG  J 702 . ? 1_555 ? 
600 AJ4 4  ARG J  199 ? ARG J 305 . ? 1_555 ? 
601 AJ4 4  ARG J  242 ? ARG J 348 . ? 1_555 ? 
602 AJ4 4  HIS J  411 ? HIS J 517 . ? 1_555 ? 
603 AJ4 4  ARG J  425 ? ARG J 531 . ? 1_555 ? 
604 AJ5 16 ARG J  227 ? ARG J 333 . ? 1_555 ? 
605 AJ5 16 ARG J  246 ? ARG J 352 . ? 1_555 ? 
606 AJ5 16 LYS J  248 ? LYS J 354 . ? 1_555 ? 
607 AJ5 16 ASN J  252 ? ASN J 358 . ? 1_555 ? 
608 AJ5 16 LYS J  417 ? LYS J 523 . ? 1_555 ? 
609 AJ5 16 VAL K  50  ? VAL K 156 . ? 1_555 ? 
610 AJ5 16 PHE K  51  ? PHE K 157 . ? 1_555 ? 
611 AJ5 16 ARG K  266 ? ARG K 372 . ? 1_555 ? 
612 AJ5 16 HIS K  270 ? HIS K 376 . ? 1_555 ? 
613 AJ5 16 LYS K  271 ? LYS K 377 . ? 1_555 ? 
614 AJ5 16 VAL L  11  ? VAL L 117 . ? 1_555 ? 
615 AJ5 16 ILE L  12  ? ILE L 118 . ? 1_555 ? 
616 AJ5 16 ASN L  13  ? ASN L 119 . ? 1_555 ? 
617 AJ5 16 HIS L  19  ? HIS L 125 . ? 1_555 ? 
618 AJ5 16 MG  QC .   ? MG  L 704 . ? 1_555 ? 
619 AJ5 16 GTP SC .   ? GTP L 706 . ? 1_555 ? 
620 AJ6 14 VAL I  11  ? VAL I 117 . ? 1_555 ? 
621 AJ6 14 ASN I  13  ? ASN I 119 . ? 1_555 ? 
622 AJ6 14 MG  UB .   ? MG  I 703 . ? 1_555 ? 
623 AJ6 14 GTP WB .   ? GTP I 705 . ? 1_555 ? 
624 AJ6 14 VAL J  50  ? VAL J 156 . ? 1_555 ? 
625 AJ6 14 PHE J  51  ? PHE J 157 . ? 1_555 ? 
626 AJ6 14 ARG J  266 ? ARG J 372 . ? 1_555 ? 
627 AJ6 14 HIS J  270 ? HIS J 376 . ? 1_555 ? 
628 AJ6 14 LYS J  271 ? LYS J 377 . ? 1_555 ? 
629 AJ6 14 ARG K  227 ? ARG K 333 . ? 1_555 ? 
630 AJ6 14 ARG K  246 ? ARG K 352 . ? 1_555 ? 
631 AJ6 14 LYS K  248 ? LYS K 354 . ? 1_555 ? 
632 AJ6 14 ASN K  252 ? ASN K 358 . ? 1_555 ? 
633 AJ6 14 LYS K  417 ? LYS K 523 . ? 1_555 ? 
634 AJ7 6  ARG K  58  ? ARG K 164 . ? 1_555 ? 
635 AJ7 6  HIS K  61  ? HIS K 167 . ? 1_555 ? 
636 AJ7 6  HIS K  100 ? HIS K 206 . ? 1_555 ? 
637 AJ7 6  ASP K  101 ? ASP K 207 . ? 1_555 ? 
638 AJ7 6  ASP K  205 ? ASP K 311 . ? 1_555 ? 
639 AJ7 6  1FZ KC .   ? 1FZ K 705 . ? 1_555 ? 
640 AJ8 3  ASP K  203 ? ASP K 309 . ? 1_555 ? 
641 AJ8 3  ASP K  205 ? ASP K 311 . ? 1_555 ? 
642 AJ8 3  1FZ KC .   ? 1FZ K 705 . ? 1_555 ? 
643 AJ9 3  DTP ZB .   ? DTP I 708 . ? 1_555 ? 
644 AJ9 3  LYS K  10  ? LYS K 116 . ? 1_555 ? 
645 AJ9 3  GTP LC .   ? GTP K 706 . ? 1_555 ? 
646 AK1 17 GLN K  43  ? GLN K 149 . ? 1_555 ? 
647 AK1 17 LEU K  44  ? LEU K 150 . ? 1_555 ? 
648 AK1 17 ARG K  58  ? ARG K 164 . ? 1_555 ? 
649 AK1 17 HIS K  61  ? HIS K 167 . ? 1_555 ? 
650 AK1 17 ASP K  101 ? ASP K 207 . ? 1_555 ? 
651 AK1 17 HIS K  109 ? HIS K 215 . ? 1_555 ? 
652 AK1 17 HIS K  127 ? HIS K 233 . ? 1_555 ? 
653 AK1 17 ASP K  205 ? ASP K 311 . ? 1_555 ? 
654 AK1 17 LYS K  206 ? LYS K 312 . ? 1_555 ? 
655 AK1 17 TYR K  209 ? TYR K 315 . ? 1_555 ? 
656 AK1 17 ASP K  213 ? ASP K 319 . ? 1_555 ? 
657 AK1 17 ARG K  260 ? ARG K 366 . ? 1_555 ? 
658 AK1 17 TYR K  268 ? TYR K 374 . ? 1_555 ? 
659 AK1 17 GLN K  269 ? GLN K 375 . ? 1_555 ? 
660 AK1 17 ASP K  277 ? ASP K 383 . ? 1_555 ? 
661 AK1 17 FE  HC .   ? FE  K 702 . ? 1_555 ? 
662 AK1 17 MG  IC .   ? MG  K 703 . ? 1_555 ? 
663 AK2 15 LYS I  417 ? LYS I 523 . ? 1_555 ? 
664 AK2 15 DTP ZB .   ? DTP I 708 . ? 1_555 ? 
665 AK2 15 LYS K  10  ? LYS K 116 . ? 1_555 ? 
666 AK2 15 VAL K  11  ? VAL K 117 . ? 1_555 ? 
667 AK2 15 ILE K  12  ? ILE K 118 . ? 1_555 ? 
668 AK2 15 ILE K  30  ? ILE K 136 . ? 1_555 ? 
669 AK2 15 ASP K  31  ? ASP K 137 . ? 1_555 ? 
670 AK2 15 GLN K  36  ? GLN K 142 . ? 1_555 ? 
671 AK2 15 ARG K  39  ? ARG K 145 . ? 1_555 ? 
672 AK2 15 PHE K  59  ? PHE K 165 . ? 1_555 ? 
673 AK2 15 MG  JC .   ? MG  K 704 . ? 1_555 ? 
674 AK2 15 TYR L  49  ? TYR L 155 . ? 1_555 ? 
675 AK2 15 VAL L  50  ? VAL L 156 . ? 1_555 ? 
676 AK2 15 VAL L  272 ? VAL L 378 . ? 1_555 ? 
677 AK2 15 ARG L  345 ? ARG L 451 . ? 1_555 ? 
678 AK3 4  ARG K  199 ? ARG K 305 . ? 1_555 ? 
679 AK3 4  ARG K  242 ? ARG K 348 . ? 1_555 ? 
680 AK3 4  HIS K  411 ? HIS K 517 . ? 1_555 ? 
681 AK3 4  ARG K  425 ? ARG K 531 . ? 1_555 ? 
682 AK4 15 VAL I  50  ? VAL I 156 . ? 1_555 ? 
683 AK4 15 PHE I  51  ? PHE I 157 . ? 1_555 ? 
684 AK4 15 ARG I  266 ? ARG I 372 . ? 1_555 ? 
685 AK4 15 HIS I  270 ? HIS I 376 . ? 1_555 ? 
686 AK4 15 LYS I  271 ? LYS I 377 . ? 1_555 ? 
687 AK4 15 VAL I  272 ? VAL I 378 . ? 1_555 ? 
688 AK4 15 GTP YB .   ? GTP I 707 . ? 1_555 ? 
689 AK4 15 VAL J  11  ? VAL J 117 . ? 1_555 ? 
690 AK4 15 ASN J  13  ? ASN J 119 . ? 1_555 ? 
691 AK4 15 MG  CC .   ? MG  J 703 . ? 1_555 ? 
692 AK4 15 ARG L  227 ? ARG L 333 . ? 1_555 ? 
693 AK4 15 ARG L  246 ? ARG L 352 . ? 1_555 ? 
694 AK4 15 LYS L  248 ? LYS L 354 . ? 1_555 ? 
695 AK4 15 ASN L  252 ? ASN L 358 . ? 1_555 ? 
696 AK4 15 LYS L  417 ? LYS L 523 . ? 1_555 ? 
697 AK5 6  ARG L  58  ? ARG L 164 . ? 1_555 ? 
698 AK5 6  HIS L  61  ? HIS L 167 . ? 1_555 ? 
699 AK5 6  HIS L  100 ? HIS L 206 . ? 1_555 ? 
700 AK5 6  ASP L  101 ? ASP L 207 . ? 1_555 ? 
701 AK5 6  ASP L  205 ? ASP L 311 . ? 1_555 ? 
702 AK5 6  1FZ RC .   ? 1FZ L 705 . ? 1_555 ? 
703 AK6 2  ASP L  203 ? ASP L 309 . ? 1_555 ? 
704 AK6 2  1FZ RC .   ? 1FZ L 705 . ? 1_555 ? 
705 AK7 3  DTP FC .   ? DTP J 706 . ? 1_555 ? 
706 AK7 3  LYS L  10  ? LYS L 116 . ? 1_555 ? 
707 AK7 3  GTP SC .   ? GTP L 706 . ? 1_555 ? 
708 AK8 19 LEU L  44  ? LEU L 150 . ? 1_555 ? 
709 AK8 19 ARG L  58  ? ARG L 164 . ? 1_555 ? 
710 AK8 19 HIS L  61  ? HIS L 167 . ? 1_555 ? 
711 AK8 19 HIS L  100 ? HIS L 206 . ? 1_555 ? 
712 AK8 19 ASP L  101 ? ASP L 207 . ? 1_555 ? 
713 AK8 19 HIS L  104 ? HIS L 210 . ? 1_555 ? 
714 AK8 19 HIS L  109 ? HIS L 215 . ? 1_555 ? 
715 AK8 19 HIS L  127 ? HIS L 233 . ? 1_555 ? 
716 AK8 19 ASP L  205 ? ASP L 311 . ? 1_555 ? 
717 AK8 19 LYS L  206 ? LYS L 312 . ? 1_555 ? 
718 AK8 19 TYR L  209 ? TYR L 315 . ? 1_555 ? 
719 AK8 19 ASP L  213 ? ASP L 319 . ? 1_555 ? 
720 AK8 19 ARG L  260 ? ARG L 366 . ? 1_555 ? 
721 AK8 19 HIS L  264 ? HIS L 370 . ? 1_555 ? 
722 AK8 19 TYR L  268 ? TYR L 374 . ? 1_555 ? 
723 AK8 19 GLN L  269 ? GLN L 375 . ? 1_555 ? 
724 AK8 19 ASP L  277 ? ASP L 383 . ? 1_555 ? 
725 AK8 19 FE  OC .   ? FE  L 702 . ? 1_555 ? 
726 AK8 19 MG  PC .   ? MG  L 703 . ? 1_555 ? 
727 AK9 15 LYS J  417 ? LYS J 523 . ? 1_555 ? 
728 AK9 15 DTP FC .   ? DTP J 706 . ? 1_555 ? 
729 AK9 15 TYR K  49  ? TYR K 155 . ? 1_555 ? 
730 AK9 15 VAL K  50  ? VAL K 156 . ? 1_555 ? 
731 AK9 15 VAL K  272 ? VAL K 378 . ? 1_555 ? 
732 AK9 15 ARG K  345 ? ARG K 451 . ? 1_555 ? 
733 AK9 15 LYS L  10  ? LYS L 116 . ? 1_555 ? 
734 AK9 15 VAL L  11  ? VAL L 117 . ? 1_555 ? 
735 AK9 15 ILE L  12  ? ILE L 118 . ? 1_555 ? 
736 AK9 15 ILE L  30  ? ILE L 136 . ? 1_555 ? 
737 AK9 15 ASP L  31  ? ASP L 137 . ? 1_555 ? 
738 AK9 15 GLN L  36  ? GLN L 142 . ? 1_555 ? 
739 AK9 15 ARG L  39  ? ARG L 145 . ? 1_555 ? 
740 AK9 15 PHE L  59  ? PHE L 165 . ? 1_555 ? 
741 AK9 15 MG  QC .   ? MG  L 704 . ? 1_555 ? 
742 AL1 6  ARG M  58  ? ARG M 164 . ? 1_555 ? 
743 AL1 6  HIS M  61  ? HIS M 167 . ? 1_555 ? 
744 AL1 6  HIS M  100 ? HIS M 206 . ? 1_555 ? 
745 AL1 6  ASP M  101 ? ASP M 207 . ? 1_555 ? 
746 AL1 6  ASP M  205 ? ASP M 311 . ? 1_555 ? 
747 AL1 6  1FZ WC .   ? 1FZ M 704 . ? 1_555 ? 
748 AL2 3  ASP M  203 ? ASP M 309 . ? 1_555 ? 
749 AL2 3  LYS M  206 ? LYS M 312 . ? 1_555 ? 
750 AL2 3  1FZ WC .   ? 1FZ M 704 . ? 1_555 ? 
751 AL3 3  LYS M  10  ? LYS M 116 . ? 1_555 ? 
752 AL3 3  GTP XC .   ? GTP M 705 . ? 1_555 ? 
753 AL3 3  DTP AD .   ? DTP N 701 . ? 1_555 ? 
754 AL4 16 LEU M  44  ? LEU M 150 . ? 1_555 ? 
755 AL4 16 ARG M  58  ? ARG M 164 . ? 1_555 ? 
756 AL4 16 HIS M  61  ? HIS M 167 . ? 1_555 ? 
757 AL4 16 ASP M  101 ? ASP M 207 . ? 1_555 ? 
758 AL4 16 HIS M  104 ? HIS M 210 . ? 1_555 ? 
759 AL4 16 HIS M  109 ? HIS M 215 . ? 1_555 ? 
760 AL4 16 HIS M  127 ? HIS M 233 . ? 1_555 ? 
761 AL4 16 ASP M  205 ? ASP M 311 . ? 1_555 ? 
762 AL4 16 LYS M  206 ? LYS M 312 . ? 1_555 ? 
763 AL4 16 TYR M  209 ? TYR M 315 . ? 1_555 ? 
764 AL4 16 ASP M  213 ? ASP M 319 . ? 1_555 ? 
765 AL4 16 ARG M  260 ? ARG M 366 . ? 1_555 ? 
766 AL4 16 TYR M  268 ? TYR M 374 . ? 1_555 ? 
767 AL4 16 ASP M  277 ? ASP M 383 . ? 1_555 ? 
768 AL4 16 FE  TC .   ? FE  M 701 . ? 1_555 ? 
769 AL4 16 MG  UC .   ? MG  M 702 . ? 1_555 ? 
770 AL5 15 LYS M  10  ? LYS M 116 . ? 1_555 ? 
771 AL5 15 VAL M  11  ? VAL M 117 . ? 1_555 ? 
772 AL5 15 ILE M  12  ? ILE M 118 . ? 1_555 ? 
773 AL5 15 ILE M  30  ? ILE M 136 . ? 1_555 ? 
774 AL5 15 ASP M  31  ? ASP M 137 . ? 1_555 ? 
775 AL5 15 GLN M  36  ? GLN M 142 . ? 1_555 ? 
776 AL5 15 ARG M  39  ? ARG M 145 . ? 1_555 ? 
777 AL5 15 PHE M  59  ? PHE M 165 . ? 1_555 ? 
778 AL5 15 MG  VC .   ? MG  M 703 . ? 1_555 ? 
779 AL5 15 TYR N  49  ? TYR N 155 . ? 1_555 ? 
780 AL5 15 VAL N  50  ? VAL N 156 . ? 1_555 ? 
781 AL5 15 ARG N  345 ? ARG N 451 . ? 1_555 ? 
782 AL5 15 LYS N  349 ? LYS N 455 . ? 1_555 ? 
783 AL5 15 DTP AD .   ? DTP N 701 . ? 1_555 ? 
784 AL5 15 LYS O  417 ? LYS O 523 . ? 1_555 ? 
785 AL6 15 VAL M  50  ? VAL M 156 . ? 1_555 ? 
786 AL6 15 PHE M  51  ? PHE M 157 . ? 1_555 ? 
787 AL6 15 ARG M  266 ? ARG M 372 . ? 1_555 ? 
788 AL6 15 HIS M  270 ? HIS M 376 . ? 1_555 ? 
789 AL6 15 LYS M  271 ? LYS M 377 . ? 1_555 ? 
790 AL6 15 VAL M  272 ? VAL M 378 . ? 1_555 ? 
791 AL6 15 VAL N  11  ? VAL N 117 . ? 1_555 ? 
792 AL6 15 ASN N  13  ? ASN N 119 . ? 1_555 ? 
793 AL6 15 MG  DD .   ? MG  N 704 . ? 1_555 ? 
794 AL6 15 GTP FD .   ? GTP N 706 . ? 1_555 ? 
795 AL6 15 ARG P  227 ? ARG P 333 . ? 1_555 ? 
796 AL6 15 ARG P  246 ? ARG P 352 . ? 1_555 ? 
797 AL6 15 LYS P  248 ? LYS P 354 . ? 1_555 ? 
798 AL6 15 ASN P  252 ? ASN P 358 . ? 1_555 ? 
799 AL6 15 LYS P  417 ? LYS P 523 . ? 1_555 ? 
800 AL7 15 ARG M  227 ? ARG M 333 . ? 1_555 ? 
801 AL7 15 ARG M  246 ? ARG M 352 . ? 1_555 ? 
802 AL7 15 LYS M  248 ? LYS M 354 . ? 1_555 ? 
803 AL7 15 ASN M  252 ? ASN M 358 . ? 1_555 ? 
804 AL7 15 LYS M  417 ? LYS M 523 . ? 1_555 ? 
805 AL7 15 VAL O  11  ? VAL O 117 . ? 1_555 ? 
806 AL7 15 ASN O  13  ? ASN O 119 . ? 1_555 ? 
807 AL7 15 HIS O  19  ? HIS O 125 . ? 1_555 ? 
808 AL7 15 MG  KD .   ? MG  O 703 . ? 1_555 ? 
809 AL7 15 GTP MD .   ? GTP O 705 . ? 1_555 ? 
810 AL7 15 VAL P  50  ? VAL P 156 . ? 1_555 ? 
811 AL7 15 PHE P  51  ? PHE P 157 . ? 1_555 ? 
812 AL7 15 ARG P  266 ? ARG P 372 . ? 1_555 ? 
813 AL7 15 HIS P  270 ? HIS P 376 . ? 1_555 ? 
814 AL7 15 LYS P  271 ? LYS P 377 . ? 1_555 ? 
815 AL8 14 VAL M  11  ? VAL M 117 . ? 1_555 ? 
816 AL8 14 ASN M  13  ? ASN M 119 . ? 1_555 ? 
817 AL8 14 MG  VC .   ? MG  M 703 . ? 1_555 ? 
818 AL8 14 GTP XC .   ? GTP M 705 . ? 1_555 ? 
819 AL8 14 VAL N  50  ? VAL N 156 . ? 1_555 ? 
820 AL8 14 PHE N  51  ? PHE N 157 . ? 1_555 ? 
821 AL8 14 ARG N  266 ? ARG N 372 . ? 1_555 ? 
822 AL8 14 HIS N  270 ? HIS N 376 . ? 1_555 ? 
823 AL8 14 LYS N  271 ? LYS N 377 . ? 1_555 ? 
824 AL8 14 ARG O  227 ? ARG O 333 . ? 1_555 ? 
825 AL8 14 ARG O  246 ? ARG O 352 . ? 1_555 ? 
826 AL8 14 LYS O  248 ? LYS O 354 . ? 1_555 ? 
827 AL8 14 ASN O  252 ? ASN O 358 . ? 1_555 ? 
828 AL8 14 LYS O  417 ? LYS O 523 . ? 1_555 ? 
829 AL9 6  ARG N  58  ? ARG N 164 . ? 1_555 ? 
830 AL9 6  HIS N  61  ? HIS N 167 . ? 1_555 ? 
831 AL9 6  HIS N  100 ? HIS N 206 . ? 1_555 ? 
832 AL9 6  ASP N  101 ? ASP N 207 . ? 1_555 ? 
833 AL9 6  ASP N  205 ? ASP N 311 . ? 1_555 ? 
834 AL9 6  1FZ ED .   ? 1FZ N 705 . ? 1_555 ? 
835 AM1 4  ASP N  203 ? ASP N 309 . ? 1_555 ? 
836 AM1 4  ASP N  205 ? ASP N 311 . ? 1_555 ? 
837 AM1 4  LYS N  206 ? LYS N 312 . ? 1_555 ? 
838 AM1 4  1FZ ED .   ? 1FZ N 705 . ? 1_555 ? 
839 AM2 3  DTP YC .   ? DTP M 706 . ? 1_555 ? 
840 AM2 3  LYS N  10  ? LYS N 116 . ? 1_555 ? 
841 AM2 3  GTP FD .   ? GTP N 706 . ? 1_555 ? 
842 AM3 18 GLN N  43  ? GLN N 149 . ? 1_555 ? 
843 AM3 18 LEU N  44  ? LEU N 150 . ? 1_555 ? 
844 AM3 18 ARG N  58  ? ARG N 164 . ? 1_555 ? 
845 AM3 18 HIS N  61  ? HIS N 167 . ? 1_555 ? 
846 AM3 18 ASP N  101 ? ASP N 207 . ? 1_555 ? 
847 AM3 18 HIS N  104 ? HIS N 210 . ? 1_555 ? 
848 AM3 18 HIS N  109 ? HIS N 215 . ? 1_555 ? 
849 AM3 18 HIS N  127 ? HIS N 233 . ? 1_555 ? 
850 AM3 18 ASP N  205 ? ASP N 311 . ? 1_555 ? 
851 AM3 18 LYS N  206 ? LYS N 312 . ? 1_555 ? 
852 AM3 18 TYR N  209 ? TYR N 315 . ? 1_555 ? 
853 AM3 18 ASP N  213 ? ASP N 319 . ? 1_555 ? 
854 AM3 18 ARG N  260 ? ARG N 366 . ? 1_555 ? 
855 AM3 18 TYR N  268 ? TYR N 374 . ? 1_555 ? 
856 AM3 18 GLN N  269 ? GLN N 375 . ? 1_555 ? 
857 AM3 18 ASP N  277 ? ASP N 383 . ? 1_555 ? 
858 AM3 18 FE  BD .   ? FE  N 702 . ? 1_555 ? 
859 AM3 18 MG  CD .   ? MG  N 703 . ? 1_555 ? 
860 AM4 13 TYR M  49  ? TYR M 155 . ? 1_555 ? 
861 AM4 13 VAL M  50  ? VAL M 156 . ? 1_555 ? 
862 AM4 13 ARG M  345 ? ARG M 451 . ? 1_555 ? 
863 AM4 13 DTP YC .   ? DTP M 706 . ? 1_555 ? 
864 AM4 13 LYS N  10  ? LYS N 116 . ? 1_555 ? 
865 AM4 13 VAL N  11  ? VAL N 117 . ? 1_555 ? 
866 AM4 13 ILE N  12  ? ILE N 118 . ? 1_555 ? 
867 AM4 13 ASP N  31  ? ASP N 137 . ? 1_555 ? 
868 AM4 13 GLN N  36  ? GLN N 142 . ? 1_555 ? 
869 AM4 13 ARG N  39  ? ARG N 145 . ? 1_555 ? 
870 AM4 13 PHE N  59  ? PHE N 165 . ? 1_555 ? 
871 AM4 13 MG  DD .   ? MG  N 704 . ? 1_555 ? 
872 AM4 13 LYS P  417 ? LYS P 523 . ? 1_555 ? 
873 AM5 2  ARG N  242 ? ARG N 348 . ? 1_555 ? 
874 AM5 2  HIS N  411 ? HIS N 517 . ? 1_555 ? 
875 AM6 15 ARG N  227 ? ARG N 333 . ? 1_555 ? 
876 AM6 15 ARG N  246 ? ARG N 352 . ? 1_555 ? 
877 AM6 15 LYS N  248 ? LYS N 354 . ? 1_555 ? 
878 AM6 15 ASN N  252 ? ASN N 358 . ? 1_555 ? 
879 AM6 15 LYS N  417 ? LYS N 523 . ? 1_555 ? 
880 AM6 15 VAL O  50  ? VAL O 156 . ? 1_555 ? 
881 AM6 15 PHE O  51  ? PHE O 157 . ? 1_555 ? 
882 AM6 15 ILE O  219 ? ILE O 325 . ? 1_555 ? 
883 AM6 15 ARG O  266 ? ARG O 372 . ? 1_555 ? 
884 AM6 15 HIS O  270 ? HIS O 376 . ? 1_555 ? 
885 AM6 15 LYS O  271 ? LYS O 377 . ? 1_555 ? 
886 AM6 15 VAL P  11  ? VAL P 117 . ? 1_555 ? 
887 AM6 15 ASN P  13  ? ASN P 119 . ? 1_555 ? 
888 AM6 15 MG  QD .   ? MG  P 703 . ? 1_555 ? 
889 AM6 15 GTP SD .   ? GTP P 705 . ? 1_555 ? 
890 AM7 6  ARG O  58  ? ARG O 164 . ? 1_555 ? 
891 AM7 6  HIS O  61  ? HIS O 167 . ? 1_555 ? 
892 AM7 6  HIS O  100 ? HIS O 206 . ? 1_555 ? 
893 AM7 6  ASP O  101 ? ASP O 207 . ? 1_555 ? 
894 AM7 6  ASP O  205 ? ASP O 311 . ? 1_555 ? 
895 AM7 6  1FZ LD .   ? 1FZ O 704 . ? 1_555 ? 
896 AM8 3  ASP O  203 ? ASP O 309 . ? 1_555 ? 
897 AM8 3  LYS O  206 ? LYS O 312 . ? 1_555 ? 
898 AM8 3  1FZ LD .   ? 1FZ O 704 . ? 1_555 ? 
899 AM9 3  DTP ZC .   ? DTP M 707 . ? 1_555 ? 
900 AM9 3  LYS O  10  ? LYS O 116 . ? 1_555 ? 
901 AM9 3  GTP MD .   ? GTP O 705 . ? 1_555 ? 
902 AN1 19 GLN O  43  ? GLN O 149 . ? 1_555 ? 
903 AN1 19 LEU O  44  ? LEU O 150 . ? 1_555 ? 
904 AN1 19 ARG O  58  ? ARG O 164 . ? 1_555 ? 
905 AN1 19 HIS O  61  ? HIS O 167 . ? 1_555 ? 
906 AN1 19 ASP O  101 ? ASP O 207 . ? 1_555 ? 
907 AN1 19 HIS O  104 ? HIS O 210 . ? 1_555 ? 
908 AN1 19 HIS O  109 ? HIS O 215 . ? 1_555 ? 
909 AN1 19 HIS O  127 ? HIS O 233 . ? 1_555 ? 
910 AN1 19 ASP O  205 ? ASP O 311 . ? 1_555 ? 
911 AN1 19 LYS O  206 ? LYS O 312 . ? 1_555 ? 
912 AN1 19 TYR O  209 ? TYR O 315 . ? 1_555 ? 
913 AN1 19 ASP O  213 ? ASP O 319 . ? 1_555 ? 
914 AN1 19 ARG O  260 ? ARG O 366 . ? 1_555 ? 
915 AN1 19 HIS O  264 ? HIS O 370 . ? 1_555 ? 
916 AN1 19 TYR O  268 ? TYR O 374 . ? 1_555 ? 
917 AN1 19 GLN O  269 ? GLN O 375 . ? 1_555 ? 
918 AN1 19 ASP O  277 ? ASP O 383 . ? 1_555 ? 
919 AN1 19 FE  ID .   ? FE  O 701 . ? 1_555 ? 
920 AN1 19 MG  JD .   ? MG  O 702 . ? 1_555 ? 
921 AN2 14 LYS M  417 ? LYS M 523 . ? 1_555 ? 
922 AN2 14 DTP ZC .   ? DTP M 707 . ? 1_555 ? 
923 AN2 14 LYS O  10  ? LYS O 116 . ? 1_555 ? 
924 AN2 14 VAL O  11  ? VAL O 117 . ? 1_555 ? 
925 AN2 14 ILE O  12  ? ILE O 118 . ? 1_555 ? 
926 AN2 14 ILE O  30  ? ILE O 136 . ? 1_555 ? 
927 AN2 14 ASP O  31  ? ASP O 137 . ? 1_555 ? 
928 AN2 14 GLN O  36  ? GLN O 142 . ? 1_555 ? 
929 AN2 14 ARG O  39  ? ARG O 145 . ? 1_555 ? 
930 AN2 14 PHE O  59  ? PHE O 165 . ? 1_555 ? 
931 AN2 14 MG  KD .   ? MG  O 703 . ? 1_555 ? 
932 AN2 14 TYR P  49  ? TYR P 155 . ? 1_555 ? 
933 AN2 14 VAL P  50  ? VAL P 156 . ? 1_555 ? 
934 AN2 14 ARG P  345 ? ARG P 451 . ? 1_555 ? 
935 AN3 2  ARG O  199 ? ARG O 305 . ? 1_555 ? 
936 AN3 2  HIS O  411 ? HIS O 517 . ? 1_555 ? 
937 AN4 6  ARG P  58  ? ARG P 164 . ? 1_555 ? 
938 AN4 6  HIS P  61  ? HIS P 167 . ? 1_555 ? 
939 AN4 6  HIS P  100 ? HIS P 206 . ? 1_555 ? 
940 AN4 6  ASP P  101 ? ASP P 207 . ? 1_555 ? 
941 AN4 6  ASP P  205 ? ASP P 311 . ? 1_555 ? 
942 AN4 6  1FZ RD .   ? 1FZ P 704 . ? 1_555 ? 
943 AN5 3  SER P  196 ? SER P 302 . ? 1_555 ? 
944 AN5 3  ASP P  203 ? ASP P 309 . ? 1_555 ? 
945 AN5 3  1FZ RD .   ? 1FZ P 704 . ? 1_555 ? 
946 AN6 2  DTP HD .   ? DTP N 708 . ? 1_555 ? 
947 AN6 2  GTP SD .   ? GTP P 705 . ? 1_555 ? 
948 AN7 18 GLN P  43  ? GLN P 149 . ? 1_555 ? 
949 AN7 18 ARG P  58  ? ARG P 164 . ? 1_555 ? 
950 AN7 18 HIS P  61  ? HIS P 167 . ? 1_555 ? 
951 AN7 18 ASP P  101 ? ASP P 207 . ? 1_555 ? 
952 AN7 18 HIS P  104 ? HIS P 210 . ? 1_555 ? 
953 AN7 18 HIS P  109 ? HIS P 215 . ? 1_555 ? 
954 AN7 18 HIS P  127 ? HIS P 233 . ? 1_555 ? 
955 AN7 18 ASP P  205 ? ASP P 311 . ? 1_555 ? 
956 AN7 18 LYS P  206 ? LYS P 312 . ? 1_555 ? 
957 AN7 18 TYR P  209 ? TYR P 315 . ? 1_555 ? 
958 AN7 18 ASP P  213 ? ASP P 319 . ? 1_555 ? 
959 AN7 18 ARG P  260 ? ARG P 366 . ? 1_555 ? 
960 AN7 18 HIS P  264 ? HIS P 370 . ? 1_555 ? 
961 AN7 18 TYR P  268 ? TYR P 374 . ? 1_555 ? 
962 AN7 18 GLN P  269 ? GLN P 375 . ? 1_555 ? 
963 AN7 18 ASP P  277 ? ASP P 383 . ? 1_555 ? 
964 AN7 18 FE  OD .   ? FE  P 701 . ? 1_555 ? 
965 AN7 18 MG  PD .   ? MG  P 702 . ? 1_555 ? 
966 AN8 15 LYS N  417 ? LYS N 523 . ? 1_555 ? 
967 AN8 15 DTP HD .   ? DTP N 708 . ? 1_555 ? 
968 AN8 15 TYR O  49  ? TYR O 155 . ? 1_555 ? 
969 AN8 15 VAL O  50  ? VAL O 156 . ? 1_555 ? 
970 AN8 15 VAL O  272 ? VAL O 378 . ? 1_555 ? 
971 AN8 15 ARG O  345 ? ARG O 451 . ? 1_555 ? 
972 AN8 15 LYS P  10  ? LYS P 116 . ? 1_555 ? 
973 AN8 15 VAL P  11  ? VAL P 117 . ? 1_555 ? 
974 AN8 15 ILE P  12  ? ILE P 118 . ? 1_555 ? 
975 AN8 15 ILE P  30  ? ILE P 136 . ? 1_555 ? 
976 AN8 15 ASP P  31  ? ASP P 137 . ? 1_555 ? 
977 AN8 15 GLN P  36  ? GLN P 142 . ? 1_555 ? 
978 AN8 15 ARG P  39  ? ARG P 145 . ? 1_555 ? 
979 AN8 15 PHE P  59  ? PHE P 165 . ? 1_555 ? 
980 AN8 15 MG  QD .   ? MG  P 703 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OD2 I ASP 207 ? ? FE    I FE  701 ? ? 1.56 
2  1 OD2 J ASP 207 ? ? FE    J FE  701 ? ? 1.63 
3  1 MG  K MG  704 ? ? O2A   K GTP 706 ? ? 1.68 
4  1 OD2 N ASP 207 ? ? FE    N FE  702 ? ? 1.68 
5  1 FE  L FE  702 ? ? O1A   L 1FZ 705 ? ? 1.68 
6  1 OD2 A ASP 490 ? ? OE1   I GLU 263 ? ? 2.00 
7  1 O1B E DTP 707 ? ? "O3'" G GTP 706 ? ? 2.04 
8  1 O1B I DTP 708 ? ? "O3'" K GTP 706 ? ? 2.12 
9  1 O1G E DTP 707 ? ? O1B   G GTP 706 ? ? 2.15 
10 1 NZ  M LYS 523 ? ? O3G   O GTP 705 ? ? 2.16 
11 1 O1B B GTP 705 ? ? O1G   D DTP 701 ? ? 2.17 
12 1 NH2 P ARG 352 ? ? O2G   M DTP 706 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OD1 C ASP 472 ? ? 1_555 OH P TYR 396 ? ? 1_565 1.29 
2 1 OG  I SER 475 ? ? 1_555 CB L PRO 436 ? ? 2_754 1.70 
3 1 CB  I SER 475 ? ? 1_555 CB L PRO 436 ? ? 2_754 2.11 
4 1 OE1 L GLN 190 ? ? 1_555 N  P GLY 403 ? ? 2_654 2.12 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 164 ? ? CZ A ARG 164 ? ? NH1 A ARG 164 ? ? 116.17 120.30 -4.13 0.50 N 
2  1 NE A ARG 164 ? ? CZ A ARG 164 ? ? NH2 A ARG 164 ? ? 124.30 120.30 4.00  0.50 N 
3  1 NE A ARG 290 ? ? CZ A ARG 290 ? ? NH2 A ARG 290 ? ? 124.16 120.30 3.86  0.50 N 
4  1 NE A ARG 352 ? ? CZ A ARG 352 ? ? NH1 A ARG 352 ? ? 115.92 120.30 -4.38 0.50 N 
5  1 NE B ARG 164 ? ? CZ B ARG 164 ? ? NH1 B ARG 164 ? ? 116.38 120.30 -3.92 0.50 N 
6  1 NE B ARG 164 ? ? CZ B ARG 164 ? ? NH2 B ARG 164 ? ? 124.28 120.30 3.98  0.50 N 
7  1 NE C ARG 164 ? ? CZ C ARG 164 ? ? NH1 C ARG 164 ? ? 116.35 120.30 -3.95 0.50 N 
8  1 NE C ARG 164 ? ? CZ C ARG 164 ? ? NH2 C ARG 164 ? ? 124.44 120.30 4.14  0.50 N 
9  1 NE C ARG 371 ? ? CZ C ARG 371 ? ? NH2 C ARG 371 ? ? 116.98 120.30 -3.32 0.50 N 
10 1 NE D ARG 164 ? ? CZ D ARG 164 ? ? NH1 D ARG 164 ? ? 127.59 120.30 7.29  0.50 N 
11 1 NE D ARG 164 ? ? CZ D ARG 164 ? ? NH2 D ARG 164 ? ? 113.32 120.30 -6.98 0.50 N 
12 1 NE E ARG 164 ? ? CZ E ARG 164 ? ? NH1 E ARG 164 ? ? 116.14 120.30 -4.16 0.50 N 
13 1 NE E ARG 164 ? ? CZ E ARG 164 ? ? NH2 E ARG 164 ? ? 124.20 120.30 3.90  0.50 N 
14 1 NE F ARG 164 ? ? CZ F ARG 164 ? ? NH1 F ARG 164 ? ? 116.24 120.30 -4.06 0.50 N 
15 1 NE F ARG 164 ? ? CZ F ARG 164 ? ? NH2 F ARG 164 ? ? 124.46 120.30 4.16  0.50 N 
16 1 NE F ARG 290 ? ? CZ F ARG 290 ? ? NH2 F ARG 290 ? ? 124.40 120.30 4.10  0.50 N 
17 1 NE G ARG 164 ? ? CZ G ARG 164 ? ? NH1 G ARG 164 ? ? 116.27 120.30 -4.03 0.50 N 
18 1 NE G ARG 164 ? ? CZ G ARG 164 ? ? NH2 G ARG 164 ? ? 124.56 120.30 4.26  0.50 N 
19 1 NE H ARG 164 ? ? CZ H ARG 164 ? ? NH1 H ARG 164 ? ? 127.44 120.30 7.14  0.50 N 
20 1 NE H ARG 164 ? ? CZ H ARG 164 ? ? NH2 H ARG 164 ? ? 113.03 120.30 -7.27 0.50 N 
21 1 CA H ASN 599 ? ? C  H ASN 599 ? ? O   H ASN 599 ? ? 133.28 120.10 13.18 2.10 N 
22 1 NE I ARG 164 ? ? CZ I ARG 164 ? ? NH1 I ARG 164 ? ? 116.02 120.30 -4.28 0.50 N 
23 1 NE I ARG 164 ? ? CZ I ARG 164 ? ? NH2 I ARG 164 ? ? 124.45 120.30 4.15  0.50 N 
24 1 CB I ASP 490 ? ? CG I ASP 490 ? ? OD2 I ASP 490 ? ? 111.17 118.30 -7.13 0.90 N 
25 1 NE J ARG 164 ? ? CZ J ARG 164 ? ? NH1 J ARG 164 ? ? 127.35 120.30 7.05  0.50 N 
26 1 NE J ARG 164 ? ? CZ J ARG 164 ? ? NH2 J ARG 164 ? ? 113.22 120.30 -7.08 0.50 N 
27 1 NE K ARG 164 ? ? CZ K ARG 164 ? ? NH1 K ARG 164 ? ? 116.27 120.30 -4.03 0.50 N 
28 1 NE K ARG 164 ? ? CZ K ARG 164 ? ? NH2 K ARG 164 ? ? 124.46 120.30 4.16  0.50 N 
29 1 NE K ARG 290 ? ? CZ K ARG 290 ? ? NH2 K ARG 290 ? ? 124.30 120.30 4.00  0.50 N 
30 1 CB K ASP 415 ? ? CG K ASP 415 ? ? OD1 K ASP 415 ? ? 124.29 118.30 5.99  0.90 N 
31 1 NE L ARG 164 ? ? CZ L ARG 164 ? ? NH1 L ARG 164 ? ? 127.73 120.30 7.43  0.50 N 
32 1 NE L ARG 164 ? ? CZ L ARG 164 ? ? NH2 L ARG 164 ? ? 113.21 120.30 -7.09 0.50 N 
33 1 NE M ARG 164 ? ? CZ M ARG 164 ? ? NH1 M ARG 164 ? ? 116.13 120.30 -4.17 0.50 N 
34 1 NE M ARG 164 ? ? CZ M ARG 164 ? ? NH2 M ARG 164 ? ? 124.49 120.30 4.19  0.50 N 
35 1 NE N ARG 164 ? ? CZ N ARG 164 ? ? NH1 N ARG 164 ? ? 127.21 120.30 6.91  0.50 N 
36 1 NE N ARG 164 ? ? CZ N ARG 164 ? ? NH2 N ARG 164 ? ? 113.07 120.30 -7.23 0.50 N 
37 1 NE O ARG 164 ? ? CZ O ARG 164 ? ? NH1 O ARG 164 ? ? 116.09 120.30 -4.21 0.50 N 
38 1 NE O ARG 164 ? ? CZ O ARG 164 ? ? NH2 O ARG 164 ? ? 124.57 120.30 4.27  0.50 N 
39 1 NE P ARG 164 ? ? CZ P ARG 164 ? ? NH1 P ARG 164 ? ? 127.56 120.30 7.26  0.50 N 
40 1 NE P ARG 164 ? ? CZ P ARG 164 ? ? NH2 P ARG 164 ? ? 113.30 120.30 -7.00 0.50 N 
41 1 NE P ARG 290 ? ? CZ P ARG 290 ? ? NH2 P ARG 290 ? ? 124.26 120.30 3.96  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ALA A 160 ? ? -77.22  43.71   
2   1 SER A 214 ? ? 50.54   -102.12 
3   1 ARG A 451 ? ? 78.30   31.03   
4   1 TYR A 507 ? ? -99.31  33.85   
5   1 MET A 509 ? ? -140.21 52.50   
6   1 GLN A 510 ? ? 44.85   -122.16 
7   1 VAL A 537 ? ? -98.30  -63.05  
8   1 ALA B 160 ? ? -78.46  44.91   
9   1 SER B 214 ? ? 50.60   -102.19 
10  1 ARG B 451 ? ? 78.43   31.36   
11  1 TYR B 507 ? ? -98.89  32.77   
12  1 GLN B 510 ? ? 42.40   -121.04 
13  1 VAL B 537 ? ? -98.32  -62.83  
14  1 ALA C 160 ? ? -77.91  44.44   
15  1 SER C 214 ? ? 50.58   -102.25 
16  1 ARG C 451 ? ? 78.87   30.99   
17  1 TYR C 507 ? ? -99.46  33.95   
18  1 GLN C 510 ? ? 45.17   -122.49 
19  1 VAL C 537 ? ? -98.26  -62.79  
20  1 ALA D 160 ? ? -78.06  44.90   
21  1 SER D 214 ? ? 50.57   -102.27 
22  1 ARG D 451 ? ? 78.58   31.07   
23  1 TYR D 507 ? ? -98.67  31.97   
24  1 GLN D 510 ? ? 45.67   -122.09 
25  1 VAL D 537 ? ? -98.53  -62.51  
26  1 ALA E 160 ? ? -77.37  43.99   
27  1 SER E 214 ? ? 50.51   -102.04 
28  1 ARG E 451 ? ? 78.56   31.29   
29  1 TYR E 507 ? ? -98.97  33.34   
30  1 GLN E 510 ? ? 43.61   -121.59 
31  1 VAL E 537 ? ? -98.36  -62.86  
32  1 ALA F 160 ? ? -77.38  44.61   
33  1 SER F 214 ? ? 50.81   -102.24 
34  1 ASN F 425 ? ? -38.72  -39.84  
35  1 ARG F 451 ? ? 78.80   31.06   
36  1 TYR F 507 ? ? -99.10  33.59   
37  1 GLN F 510 ? ? 45.70   -122.50 
38  1 VAL F 537 ? ? -98.48  -62.95  
39  1 ALA G 160 ? ? -77.50  44.35   
40  1 SER G 214 ? ? 50.85   -102.20 
41  1 ARG G 451 ? ? 78.58   31.26   
42  1 TYR G 507 ? ? -99.06  32.83   
43  1 GLN G 510 ? ? 45.64   -122.48 
44  1 VAL G 537 ? ? -98.38  -62.85  
45  1 LYS G 596 ? ? -31.19  125.65  
46  1 ALA H 160 ? ? -78.06  44.65   
47  1 SER H 214 ? ? 50.69   -102.10 
48  1 ASN H 425 ? ? -38.59  -39.86  
49  1 ARG H 451 ? ? 78.91   31.01   
50  1 TYR H 507 ? ? -99.09  32.91   
51  1 GLN H 510 ? ? 45.91   -122.54 
52  1 VAL H 537 ? ? -98.35  -62.71  
53  1 ALA I 160 ? ? -77.67  44.47   
54  1 SER I 214 ? ? 50.65   -102.07 
55  1 ARG I 451 ? ? 78.39   31.16   
56  1 TYR I 507 ? ? -98.99  32.77   
57  1 GLN I 510 ? ? 46.21   -122.47 
58  1 VAL I 537 ? ? -98.35  -62.57  
59  1 ALA J 160 ? ? -77.59  44.30   
60  1 SER J 214 ? ? 51.04   -102.38 
61  1 ARG J 451 ? ? 78.76   30.87   
62  1 TYR J 507 ? ? -99.14  33.22   
63  1 GLN J 510 ? ? 44.69   -121.96 
64  1 VAL J 537 ? ? -98.43  -62.72  
65  1 ALA K 160 ? ? -77.85  44.78   
66  1 SER K 214 ? ? 50.49   -102.09 
67  1 ASN K 425 ? ? -38.61  -39.84  
68  1 ARG K 451 ? ? 78.67   31.17   
69  1 TYR K 507 ? ? -98.89  32.00   
70  1 GLN K 510 ? ? 46.35   -122.54 
71  1 VAL K 537 ? ? -98.48  -62.67  
72  1 ALA L 160 ? ? -78.07  44.68   
73  1 SER L 214 ? ? 51.12   -102.40 
74  1 ARG L 451 ? ? 78.23   31.22   
75  1 TYR L 507 ? ? -99.05  33.03   
76  1 GLN L 510 ? ? 45.35   -122.32 
77  1 VAL L 537 ? ? -98.41  -62.74  
78  1 ALA M 160 ? ? -77.83  44.58   
79  1 SER M 214 ? ? 50.72   -102.14 
80  1 ASN M 425 ? ? -38.72  -39.81  
81  1 ARG M 451 ? ? 78.40   31.18   
82  1 TYR M 507 ? ? -99.05  33.28   
83  1 GLN M 510 ? ? 45.17   -122.02 
84  1 VAL M 537 ? ? -98.39  -62.99  
85  1 ALA N 160 ? ? -76.78  43.86   
86  1 SER N 214 ? ? 50.79   -102.20 
87  1 ASN N 425 ? ? -38.53  -39.72  
88  1 ARG N 451 ? ? 78.37   31.37   
89  1 TYR N 507 ? ? -98.91  32.95   
90  1 GLN N 510 ? ? 46.06   -122.46 
91  1 VAL N 537 ? ? -98.43  -62.92  
92  1 ALA O 160 ? ? -77.62  44.62   
93  1 SER O 214 ? ? 50.71   -102.28 
94  1 VAL O 280 ? ? -89.84  -101.97 
95  1 ASP O 282 ? ? -104.05 -61.11  
96  1 SER O 283 ? ? 59.77   4.87    
97  1 ARG O 451 ? ? 78.91   31.12   
98  1 TYR O 507 ? ? -98.78  32.54   
99  1 GLN O 510 ? ? 45.72   -122.19 
100 1 VAL O 537 ? ? -98.51  -62.84  
101 1 ALA P 160 ? ? -78.00  44.85   
102 1 SER P 214 ? ? 50.99   -102.44 
103 1 ASN P 425 ? ? -38.27  -39.84  
104 1 ARG P 451 ? ? 78.43   31.20   
105 1 TYR P 507 ? ? -98.80  31.65   
106 1 GLN P 510 ? ? 46.06   -122.16 
107 1 VAL P 537 ? ? -98.41  -62.68  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   G 
_pdbx_validate_peptide_omega.auth_seq_id_1    595 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   G 
_pdbx_validate_peptide_omega.auth_seq_id_2    596 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            148.53 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined 85.9745  39.7079  -58.0129  0.1275 ? 0.0112  ? -0.0706 ? 0.1325 ? 0.0215  ? 0.2887 ? 0.1966 ? 
-0.0265 ? -0.0960 ? 0.1712 ? 0.1534  ? 0.3570 ? -0.0487 ? -0.0117 ? 0.0584  ? 0.0705  ? 0.0735  ? -0.0415 ? 0.1361  ? 0.0507  ? 
-0.0247 ? 
2  'X-RAY DIFFRACTION' ? refined 89.6764  70.4494  -75.4430  0.1455 ? -0.0213 ? 0.0791  ? 0.1326 ? -0.0024 ? 0.3036 ? 0.0684 ? 
-0.0681 ? -0.0896 ? 0.1903 ? -0.0232 ? 0.3898 ? 0.0723  ? -0.0350 ? -0.0018 ? -0.0876 ? 0.0723  ? -0.0563 ? -0.1247 ? 0.0500  ? 
-0.1446 ? 
3  'X-RAY DIFFRACTION' ? refined 52.4725  75.5577  -64.3109  0.2044 ? 0.0582  ? 0.0133  ? 0.1700 ? 0.0056  ? 0.2023 ? 0.0585 ? 
-0.0365 ? -0.0870 ? 0.2296 ? 0.1406  ? 0.2924 ? 0.0947  ? 0.0148  ? -0.0141 ? 0.0060  ? -0.0145 ? -0.0497 ? -0.1310 ? -0.1205 ? 
-0.0802 ? 
4  'X-RAY DIFFRACTION' ? refined 49.8693  41.1190  -73.5280  0.0972 ? -0.0308 ? -0.0341 ? 0.2032 ? -0.0220 ? 0.2337 ? 0.0781 ? 
-0.0378 ? -0.1163 ? 0.2352 ? 0.0831  ? 0.4625 ? 0.0060  ? 0.0379  ? 0.0045  ? -0.0136 ? -0.0985 ? -0.0109 ? 0.0431  ? -0.1110 ? 
0.0925  ? 
5  'X-RAY DIFFRACTION' ? refined 45.9747  11.9546  0.6563    0.2385 ? -0.0069 ? -0.0197 ? 0.0634 ? 0.0376  ? 0.2708 ? 0.0702 ? 
0.0099  ? -0.1264 ? 0.3132 ? 0.0603  ? 0.2824 ? -0.0348 ? 0.0070  ? 0.0201  ? 0.0162  ? 0.0305  ? -0.0897 ? 0.1311  ? 0.0111  ? 
0.0043  ? 
6  'X-RAY DIFFRACTION' ? refined 12.0472  6.5269   9.1999    0.2938 ? -0.1160 ? 0.0959  ? 0.0752 ? 0.0040  ? 0.2316 ? 0.2560 ? 
-0.1400 ? -0.0899 ? 0.1291 ? 0.0563  ? 0.2673 ? -0.0549 ? 0.0336  ? -0.0715 ? 0.1311  ? -0.0575 ? 0.1130  ? 0.0833  ? 0.0397  ? 
0.1124  ? 
7  'X-RAY DIFFRACTION' ? refined 6.5379   37.3714  -14.7599  0.1948 ? -0.0022 ? -0.0125 ? 0.1226 ? -0.0610 ? 0.2650 ? 0.1296 ? 
0.1047  ? 0.2043  ? 0.2055 ? 0.2452  ? 0.3952 ? -0.0066 ? 0.0123  ? 0.0279  ? -0.0652 ? -0.0998 ? 0.0574  ? -0.0013 ? -0.0739 ? 
0.1065  ? 
8  'X-RAY DIFFRACTION' ? refined 35.2146  49.8014  2.1748    0.2258 ? -0.0325 ? 0.0074  ? 0.1071 ? 0.0030  ? 0.2161 ? 0.1761 ? 
0.1327  ? -0.1080 ? 0.2400 ? 0.0809  ? 0.2864 ? 0.0817  ? -0.0270 ? 0.0211  ? 0.0006  ? -0.0162 ? -0.0128 ? -0.0530 ? -0.0057 ? 
-0.0655 ? 
9  'X-RAY DIFFRACTION' ? refined 94.7254  28.5176  -125.9519 0.3370 ? -0.1612 ? -0.1153 ? 0.1009 ? 0.0195  ? 0.1615 ? 0.0387 ? 
-0.0440 ? -0.0034 ? 0.2853 ? -0.0384 ? 0.3613 ? 0.0801  ? -0.0256 ? -0.0704 ? 0.0598  ? -0.0228 ? 0.0603  ? -0.2000 ? 0.1712  ? 
-0.0573 ? 
10 'X-RAY DIFFRACTION' ? refined 62.5813  17.8508  -136.5317 0.2630 ? -0.0352 ? -0.0468 ? 0.0634 ? 0.0139  ? 0.2193 ? 0.0410 ? 
-0.0172 ? -0.1023 ? 0.3659 ? 0.0624  ? 0.4349 ? 0.0072  ? -0.0291 ? -0.0236 ? -0.0280 ? 0.0076  ? 0.0500  ? -0.0517 ? 0.0044  ? 
-0.0148 ? 
11 'X-RAY DIFFRACTION' ? refined 78.7454  -17.5825 -133.2222 0.3520 ? -0.0421 ? -0.0661 ? 0.0094 ? 0.0221  ? 0.2066 ? 0.0794 ? 
0.1458  ? -0.0579 ? 0.2923 ? -0.1008 ? 0.1991 ? -0.0042 ? -0.0116 ? -0.0228 ? 0.0675  ? -0.0269 ? -0.0578 ? 0.1598  ? -0.0202 ? 
0.0311  ? 
12 'X-RAY DIFFRACTION' ? refined 106.3959 -1.3258  -148.1979 0.1250 ? -0.0240 ? -0.0352 ? 0.1495 ? 0.0151  ? 0.3187 ? 0.1105 ? 
0.0245  ? 0.1289  ? 0.1376 ? -0.1494 ? 0.4308 ? -0.0364 ? 0.0950  ? -0.0983 ? -0.0618 ? -0.0016 ? -0.0730 ? -0.0272 ? 0.1631  ? 
0.0380  ? 
13 'X-RAY DIFFRACTION' ? refined 33.5566  -12.6031 -58.4145  0.2364 ? -0.0303 ? 0.0680  ? 0.2375 ? -0.0419 ? 0.1321 ? 0.1483 ? 
-0.0414 ? -0.1979 ? 0.5780 ? -0.1990 ? 0.4799 ? 0.1365  ? -0.1449 ? 0.0642  ? -0.0053 ? 0.0529  ? 0.0627  ? -0.1238 ? 0.2426  ? 
-0.1894 ? 
14 'X-RAY DIFFRACTION' ? refined -0.0934  -16.1936 -67.8890  0.2658 ? 0.1852  ? 0.0852  ? 0.2187 ? 0.1105  ? 0.1322 ? 0.2059 ? 
0.0814  ? 0.0269  ? 0.1301 ? 0.0541  ? 0.4299 ? 0.1615  ? 0.1533  ? 0.0070  ? 0.0862  ? 0.0390  ? -0.0584 ? -0.1048 ? -0.1849 ? 
-0.2006 ? 
15 'X-RAY DIFFRACTION' ? refined 8.2546   -54.3459 -63.5652  0.3395 ? 0.0783  ? 0.1103  ? 0.0943 ? 0.0468  ? 0.1627 ? 0.1792 ? 
0.0410  ? -0.1871 ? 0.0571 ? 0.0103  ? 0.6604 ? -0.1753 ? -0.0257 ? 0.0068  ? 0.0312  ? -0.0167 ? 0.0447  ? 0.2298  ? 0.0022  ? 
0.1920  ? 
16 'X-RAY DIFFRACTION' ? refined 37.7161  -44.6167 -80.5184  0.2574 ? 0.1613  ? 0.1336  ? 0.2972 ? 0.0586  ? 0.1123 ? 0.0538 ? 
-0.0468 ? -0.1531 ? 0.0855 ? 0.1278  ? 0.4620 ? -0.0200 ? -0.0250 ? -0.0146 ? -0.0636 ? -0.0128 ? -0.0031 ? 0.0697  ? 0.1498  ? 
0.0328  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? A 114 ? ? A 803 ? ? 
2  'X-RAY DIFFRACTION' 2  ? ? B 114 ? ? B 901 ? ? 
3  'X-RAY DIFFRACTION' 3  ? ? C 115 ? ? C 901 ? ? 
4  'X-RAY DIFFRACTION' 4  ? ? D 114 ? ? D 901 ? ? 
5  'X-RAY DIFFRACTION' 5  ? ? E 114 ? ? E 901 ? ? 
6  'X-RAY DIFFRACTION' 6  ? ? F 114 ? ? F 901 ? ? 
7  'X-RAY DIFFRACTION' 7  ? ? G 114 ? ? G 803 ? ? 
8  'X-RAY DIFFRACTION' 8  ? ? H 114 ? ? H 901 ? ? 
9  'X-RAY DIFFRACTION' 9  ? ? I 115 ? ? I 901 ? ? 
10 'X-RAY DIFFRACTION' 10 ? ? J 115 ? ? J 901 ? ? 
11 'X-RAY DIFFRACTION' 11 ? ? K 115 ? ? K 901 ? ? 
12 'X-RAY DIFFRACTION' 12 ? ? L 115 ? ? L 803 ? ? 
13 'X-RAY DIFFRACTION' 13 ? ? M 115 ? ? M 803 ? ? 
14 'X-RAY DIFFRACTION' 14 ? ? N 115 ? ? N 901 ? ? 
15 'X-RAY DIFFRACTION' 15 ? ? O 114 ? ? O 901 ? ? 
16 'X-RAY DIFFRACTION' 16 ? ? P 114 ? ? P 803 ? ? 
# 
_pdbx_phasing_MR.entry_id                     6TXE 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          9.520 
_pdbx_phasing_MR.d_res_low_rotation           274.090 
_pdbx_phasing_MR.d_res_high_translation       9.520 
_pdbx_phasing_MR.d_res_low_translation        274.090 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
_pdbx_entry_details.entry_id                 6TXE 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 107 ? A GLY 1   
2   1 Y 1 A SER 108 ? A SER 2   
3   1 Y 1 A GLN 109 ? A GLN 3   
4   1 Y 1 A ILE 110 ? A ILE 4   
5   1 Y 1 A HIS 111 ? A HIS 5   
6   1 Y 1 A VAL 112 ? A VAL 6   
7   1 Y 1 A ASP 113 ? A ASP 7   
8   1 Y 1 A SER 278 ? A SER 172 
9   1 Y 1 A PRO 279 ? A PRO 173 
10  1 Y 1 A VAL 280 ? A VAL 174 
11  1 Y 1 A GLU 281 ? A GLU 175 
12  1 Y 1 A ASP 282 ? A ASP 176 
13  1 Y 1 A SER 283 ? A SER 177 
14  1 Y 1 A ASP 600 ? A ASP 494 
15  1 Y 1 A SER 601 ? A SER 495 
16  1 Y 1 A THR 602 ? A THR 496 
17  1 Y 1 A SER 603 ? A SER 497 
18  1 Y 1 A VAL 604 ? A VAL 498 
19  1 Y 1 A GLN 605 ? A GLN 499 
20  1 Y 1 A ASN 606 ? A ASN 500 
21  1 Y 1 A PRO 607 ? A PRO 501 
22  1 Y 1 A THR 608 ? A THR 502 
23  1 Y 1 A ARG 609 ? A ARG 503 
24  1 Y 1 A LEU 610 ? A LEU 504 
25  1 Y 1 A ARG 611 ? A ARG 505 
26  1 Y 1 A GLU 612 ? A GLU 506 
27  1 Y 1 A ALA 613 ? A ALA 507 
28  1 Y 1 A SER 614 ? A SER 508 
29  1 Y 1 A LYS 615 ? A LYS 509 
30  1 Y 1 A SER 616 ? A SER 510 
31  1 Y 1 A ARG 617 ? A ARG 511 
32  1 Y 1 A VAL 618 ? A VAL 512 
33  1 Y 1 A GLN 619 ? A GLN 513 
34  1 Y 1 A LEU 620 ? A LEU 514 
35  1 Y 1 A PHE 621 ? A PHE 515 
36  1 Y 1 A LYS 622 ? A LYS 516 
37  1 Y 1 A ASP 623 ? A ASP 517 
38  1 Y 1 A ASP 624 ? A ASP 518 
39  1 Y 1 A PRO 625 ? A PRO 519 
40  1 Y 1 A MET 626 ? A MET 520 
41  1 Y 1 B GLY 107 ? B GLY 1   
42  1 Y 1 B SER 108 ? B SER 2   
43  1 Y 1 B GLN 109 ? B GLN 3   
44  1 Y 1 B ILE 110 ? B ILE 4   
45  1 Y 1 B HIS 111 ? B HIS 5   
46  1 Y 1 B VAL 112 ? B VAL 6   
47  1 Y 1 B ASP 113 ? B ASP 7   
48  1 Y 1 B GLU 277 ? B GLU 171 
49  1 Y 1 B SER 278 ? B SER 172 
50  1 Y 1 B PRO 279 ? B PRO 173 
51  1 Y 1 B VAL 280 ? B VAL 174 
52  1 Y 1 B GLU 281 ? B GLU 175 
53  1 Y 1 B ASP 282 ? B ASP 176 
54  1 Y 1 B SER 283 ? B SER 177 
55  1 Y 1 B ASP 600 ? B ASP 494 
56  1 Y 1 B SER 601 ? B SER 495 
57  1 Y 1 B THR 602 ? B THR 496 
58  1 Y 1 B SER 603 ? B SER 497 
59  1 Y 1 B VAL 604 ? B VAL 498 
60  1 Y 1 B GLN 605 ? B GLN 499 
61  1 Y 1 B ASN 606 ? B ASN 500 
62  1 Y 1 B PRO 607 ? B PRO 501 
63  1 Y 1 B THR 608 ? B THR 502 
64  1 Y 1 B ARG 609 ? B ARG 503 
65  1 Y 1 B LEU 610 ? B LEU 504 
66  1 Y 1 B ARG 611 ? B ARG 505 
67  1 Y 1 B GLU 612 ? B GLU 506 
68  1 Y 1 B ALA 613 ? B ALA 507 
69  1 Y 1 B SER 614 ? B SER 508 
70  1 Y 1 B LYS 615 ? B LYS 509 
71  1 Y 1 B SER 616 ? B SER 510 
72  1 Y 1 B ARG 617 ? B ARG 511 
73  1 Y 1 B VAL 618 ? B VAL 512 
74  1 Y 1 B GLN 619 ? B GLN 513 
75  1 Y 1 B LEU 620 ? B LEU 514 
76  1 Y 1 B PHE 621 ? B PHE 515 
77  1 Y 1 B LYS 622 ? B LYS 516 
78  1 Y 1 B ASP 623 ? B ASP 517 
79  1 Y 1 B ASP 624 ? B ASP 518 
80  1 Y 1 B PRO 625 ? B PRO 519 
81  1 Y 1 B MET 626 ? B MET 520 
82  1 Y 1 C GLY 107 ? C GLY 1   
83  1 Y 1 C SER 108 ? C SER 2   
84  1 Y 1 C GLN 109 ? C GLN 3   
85  1 Y 1 C ILE 110 ? C ILE 4   
86  1 Y 1 C HIS 111 ? C HIS 5   
87  1 Y 1 C VAL 112 ? C VAL 6   
88  1 Y 1 C ASP 113 ? C ASP 7   
89  1 Y 1 C THR 114 ? C THR 8   
90  1 Y 1 C SER 278 ? C SER 172 
91  1 Y 1 C PRO 279 ? C PRO 173 
92  1 Y 1 C VAL 280 ? C VAL 174 
93  1 Y 1 C GLU 281 ? C GLU 175 
94  1 Y 1 C ASP 282 ? C ASP 176 
95  1 Y 1 C ASP 600 ? C ASP 494 
96  1 Y 1 C SER 601 ? C SER 495 
97  1 Y 1 C THR 602 ? C THR 496 
98  1 Y 1 C SER 603 ? C SER 497 
99  1 Y 1 C VAL 604 ? C VAL 498 
100 1 Y 1 C GLN 605 ? C GLN 499 
101 1 Y 1 C ASN 606 ? C ASN 500 
102 1 Y 1 C PRO 607 ? C PRO 501 
103 1 Y 1 C THR 608 ? C THR 502 
104 1 Y 1 C ARG 609 ? C ARG 503 
105 1 Y 1 C LEU 610 ? C LEU 504 
106 1 Y 1 C ARG 611 ? C ARG 505 
107 1 Y 1 C GLU 612 ? C GLU 506 
108 1 Y 1 C ALA 613 ? C ALA 507 
109 1 Y 1 C SER 614 ? C SER 508 
110 1 Y 1 C LYS 615 ? C LYS 509 
111 1 Y 1 C SER 616 ? C SER 510 
112 1 Y 1 C ARG 617 ? C ARG 511 
113 1 Y 1 C VAL 618 ? C VAL 512 
114 1 Y 1 C GLN 619 ? C GLN 513 
115 1 Y 1 C LEU 620 ? C LEU 514 
116 1 Y 1 C PHE 621 ? C PHE 515 
117 1 Y 1 C LYS 622 ? C LYS 516 
118 1 Y 1 C ASP 623 ? C ASP 517 
119 1 Y 1 C ASP 624 ? C ASP 518 
120 1 Y 1 C PRO 625 ? C PRO 519 
121 1 Y 1 C MET 626 ? C MET 520 
122 1 Y 1 D GLY 107 ? D GLY 1   
123 1 Y 1 D SER 108 ? D SER 2   
124 1 Y 1 D GLN 109 ? D GLN 3   
125 1 Y 1 D ILE 110 ? D ILE 4   
126 1 Y 1 D HIS 111 ? D HIS 5   
127 1 Y 1 D VAL 112 ? D VAL 6   
128 1 Y 1 D ASP 113 ? D ASP 7   
129 1 Y 1 D SER 278 ? D SER 172 
130 1 Y 1 D PRO 279 ? D PRO 173 
131 1 Y 1 D VAL 280 ? D VAL 174 
132 1 Y 1 D GLU 281 ? D GLU 175 
133 1 Y 1 D ASP 282 ? D ASP 176 
134 1 Y 1 D ASP 600 ? D ASP 494 
135 1 Y 1 D SER 601 ? D SER 495 
136 1 Y 1 D THR 602 ? D THR 496 
137 1 Y 1 D SER 603 ? D SER 497 
138 1 Y 1 D VAL 604 ? D VAL 498 
139 1 Y 1 D GLN 605 ? D GLN 499 
140 1 Y 1 D ASN 606 ? D ASN 500 
141 1 Y 1 D PRO 607 ? D PRO 501 
142 1 Y 1 D THR 608 ? D THR 502 
143 1 Y 1 D ARG 609 ? D ARG 503 
144 1 Y 1 D LEU 610 ? D LEU 504 
145 1 Y 1 D ARG 611 ? D ARG 505 
146 1 Y 1 D GLU 612 ? D GLU 506 
147 1 Y 1 D ALA 613 ? D ALA 507 
148 1 Y 1 D SER 614 ? D SER 508 
149 1 Y 1 D LYS 615 ? D LYS 509 
150 1 Y 1 D SER 616 ? D SER 510 
151 1 Y 1 D ARG 617 ? D ARG 511 
152 1 Y 1 D VAL 618 ? D VAL 512 
153 1 Y 1 D GLN 619 ? D GLN 513 
154 1 Y 1 D LEU 620 ? D LEU 514 
155 1 Y 1 D PHE 621 ? D PHE 515 
156 1 Y 1 D LYS 622 ? D LYS 516 
157 1 Y 1 D ASP 623 ? D ASP 517 
158 1 Y 1 D ASP 624 ? D ASP 518 
159 1 Y 1 D PRO 625 ? D PRO 519 
160 1 Y 1 D MET 626 ? D MET 520 
161 1 Y 1 E GLY 107 ? E GLY 1   
162 1 Y 1 E SER 108 ? E SER 2   
163 1 Y 1 E GLN 109 ? E GLN 3   
164 1 Y 1 E ILE 110 ? E ILE 4   
165 1 Y 1 E HIS 111 ? E HIS 5   
166 1 Y 1 E VAL 112 ? E VAL 6   
167 1 Y 1 E ASP 113 ? E ASP 7   
168 1 Y 1 E GLU 277 ? E GLU 171 
169 1 Y 1 E SER 278 ? E SER 172 
170 1 Y 1 E PRO 279 ? E PRO 173 
171 1 Y 1 E VAL 280 ? E VAL 174 
172 1 Y 1 E GLU 281 ? E GLU 175 
173 1 Y 1 E ASP 282 ? E ASP 176 
174 1 Y 1 E SER 283 ? E SER 177 
175 1 Y 1 E ASP 600 ? E ASP 494 
176 1 Y 1 E SER 601 ? E SER 495 
177 1 Y 1 E THR 602 ? E THR 496 
178 1 Y 1 E SER 603 ? E SER 497 
179 1 Y 1 E VAL 604 ? E VAL 498 
180 1 Y 1 E GLN 605 ? E GLN 499 
181 1 Y 1 E ASN 606 ? E ASN 500 
182 1 Y 1 E PRO 607 ? E PRO 501 
183 1 Y 1 E THR 608 ? E THR 502 
184 1 Y 1 E ARG 609 ? E ARG 503 
185 1 Y 1 E LEU 610 ? E LEU 504 
186 1 Y 1 E ARG 611 ? E ARG 505 
187 1 Y 1 E GLU 612 ? E GLU 506 
188 1 Y 1 E ALA 613 ? E ALA 507 
189 1 Y 1 E SER 614 ? E SER 508 
190 1 Y 1 E LYS 615 ? E LYS 509 
191 1 Y 1 E SER 616 ? E SER 510 
192 1 Y 1 E ARG 617 ? E ARG 511 
193 1 Y 1 E VAL 618 ? E VAL 512 
194 1 Y 1 E GLN 619 ? E GLN 513 
195 1 Y 1 E LEU 620 ? E LEU 514 
196 1 Y 1 E PHE 621 ? E PHE 515 
197 1 Y 1 E LYS 622 ? E LYS 516 
198 1 Y 1 E ASP 623 ? E ASP 517 
199 1 Y 1 E ASP 624 ? E ASP 518 
200 1 Y 1 E PRO 625 ? E PRO 519 
201 1 Y 1 E MET 626 ? E MET 520 
202 1 Y 1 F GLY 107 ? F GLY 1   
203 1 Y 1 F SER 108 ? F SER 2   
204 1 Y 1 F GLN 109 ? F GLN 3   
205 1 Y 1 F ILE 110 ? F ILE 4   
206 1 Y 1 F HIS 111 ? F HIS 5   
207 1 Y 1 F VAL 112 ? F VAL 6   
208 1 Y 1 F ASP 113 ? F ASP 7   
209 1 Y 1 F GLU 277 ? F GLU 171 
210 1 Y 1 F SER 278 ? F SER 172 
211 1 Y 1 F PRO 279 ? F PRO 173 
212 1 Y 1 F VAL 280 ? F VAL 174 
213 1 Y 1 F GLU 281 ? F GLU 175 
214 1 Y 1 F ASP 282 ? F ASP 176 
215 1 Y 1 F SER 283 ? F SER 177 
216 1 Y 1 F ASN 599 ? F ASN 493 
217 1 Y 1 F ASP 600 ? F ASP 494 
218 1 Y 1 F SER 601 ? F SER 495 
219 1 Y 1 F THR 602 ? F THR 496 
220 1 Y 1 F SER 603 ? F SER 497 
221 1 Y 1 F VAL 604 ? F VAL 498 
222 1 Y 1 F GLN 605 ? F GLN 499 
223 1 Y 1 F ASN 606 ? F ASN 500 
224 1 Y 1 F PRO 607 ? F PRO 501 
225 1 Y 1 F THR 608 ? F THR 502 
226 1 Y 1 F ARG 609 ? F ARG 503 
227 1 Y 1 F LEU 610 ? F LEU 504 
228 1 Y 1 F ARG 611 ? F ARG 505 
229 1 Y 1 F GLU 612 ? F GLU 506 
230 1 Y 1 F ALA 613 ? F ALA 507 
231 1 Y 1 F SER 614 ? F SER 508 
232 1 Y 1 F LYS 615 ? F LYS 509 
233 1 Y 1 F SER 616 ? F SER 510 
234 1 Y 1 F ARG 617 ? F ARG 511 
235 1 Y 1 F VAL 618 ? F VAL 512 
236 1 Y 1 F GLN 619 ? F GLN 513 
237 1 Y 1 F LEU 620 ? F LEU 514 
238 1 Y 1 F PHE 621 ? F PHE 515 
239 1 Y 1 F LYS 622 ? F LYS 516 
240 1 Y 1 F ASP 623 ? F ASP 517 
241 1 Y 1 F ASP 624 ? F ASP 518 
242 1 Y 1 F PRO 625 ? F PRO 519 
243 1 Y 1 F MET 626 ? F MET 520 
244 1 Y 1 G GLY 107 ? G GLY 1   
245 1 Y 1 G SER 108 ? G SER 2   
246 1 Y 1 G GLN 109 ? G GLN 3   
247 1 Y 1 G ILE 110 ? G ILE 4   
248 1 Y 1 G HIS 111 ? G HIS 5   
249 1 Y 1 G VAL 112 ? G VAL 6   
250 1 Y 1 G ASP 113 ? G ASP 7   
251 1 Y 1 G SER 278 ? G SER 172 
252 1 Y 1 G PRO 279 ? G PRO 173 
253 1 Y 1 G VAL 280 ? G VAL 174 
254 1 Y 1 G GLU 281 ? G GLU 175 
255 1 Y 1 G ASP 282 ? G ASP 176 
256 1 Y 1 G SER 283 ? G SER 177 
257 1 Y 1 G ASN 599 ? G ASN 493 
258 1 Y 1 G ASP 600 ? G ASP 494 
259 1 Y 1 G SER 601 ? G SER 495 
260 1 Y 1 G THR 602 ? G THR 496 
261 1 Y 1 G SER 603 ? G SER 497 
262 1 Y 1 G VAL 604 ? G VAL 498 
263 1 Y 1 G GLN 605 ? G GLN 499 
264 1 Y 1 G ASN 606 ? G ASN 500 
265 1 Y 1 G PRO 607 ? G PRO 501 
266 1 Y 1 G THR 608 ? G THR 502 
267 1 Y 1 G ARG 609 ? G ARG 503 
268 1 Y 1 G LEU 610 ? G LEU 504 
269 1 Y 1 G ARG 611 ? G ARG 505 
270 1 Y 1 G GLU 612 ? G GLU 506 
271 1 Y 1 G ALA 613 ? G ALA 507 
272 1 Y 1 G SER 614 ? G SER 508 
273 1 Y 1 G LYS 615 ? G LYS 509 
274 1 Y 1 G SER 616 ? G SER 510 
275 1 Y 1 G ARG 617 ? G ARG 511 
276 1 Y 1 G VAL 618 ? G VAL 512 
277 1 Y 1 G GLN 619 ? G GLN 513 
278 1 Y 1 G LEU 620 ? G LEU 514 
279 1 Y 1 G PHE 621 ? G PHE 515 
280 1 Y 1 G LYS 622 ? G LYS 516 
281 1 Y 1 G ASP 623 ? G ASP 517 
282 1 Y 1 G ASP 624 ? G ASP 518 
283 1 Y 1 G PRO 625 ? G PRO 519 
284 1 Y 1 G MET 626 ? G MET 520 
285 1 Y 1 H GLY 107 ? H GLY 1   
286 1 Y 1 H SER 108 ? H SER 2   
287 1 Y 1 H GLN 109 ? H GLN 3   
288 1 Y 1 H ILE 110 ? H ILE 4   
289 1 Y 1 H HIS 111 ? H HIS 5   
290 1 Y 1 H VAL 112 ? H VAL 6   
291 1 Y 1 H ASP 113 ? H ASP 7   
292 1 Y 1 H SER 278 ? H SER 172 
293 1 Y 1 H PRO 279 ? H PRO 173 
294 1 Y 1 H VAL 280 ? H VAL 174 
295 1 Y 1 H GLU 281 ? H GLU 175 
296 1 Y 1 H ASP 282 ? H ASP 176 
297 1 Y 1 H SER 283 ? H SER 177 
298 1 Y 1 H ASP 600 ? H ASP 494 
299 1 Y 1 H SER 601 ? H SER 495 
300 1 Y 1 H THR 602 ? H THR 496 
301 1 Y 1 H SER 603 ? H SER 497 
302 1 Y 1 H VAL 604 ? H VAL 498 
303 1 Y 1 H GLN 605 ? H GLN 499 
304 1 Y 1 H ASN 606 ? H ASN 500 
305 1 Y 1 H PRO 607 ? H PRO 501 
306 1 Y 1 H THR 608 ? H THR 502 
307 1 Y 1 H ARG 609 ? H ARG 503 
308 1 Y 1 H LEU 610 ? H LEU 504 
309 1 Y 1 H ARG 611 ? H ARG 505 
310 1 Y 1 H GLU 612 ? H GLU 506 
311 1 Y 1 H ALA 613 ? H ALA 507 
312 1 Y 1 H SER 614 ? H SER 508 
313 1 Y 1 H LYS 615 ? H LYS 509 
314 1 Y 1 H SER 616 ? H SER 510 
315 1 Y 1 H ARG 617 ? H ARG 511 
316 1 Y 1 H VAL 618 ? H VAL 512 
317 1 Y 1 H GLN 619 ? H GLN 513 
318 1 Y 1 H LEU 620 ? H LEU 514 
319 1 Y 1 H PHE 621 ? H PHE 515 
320 1 Y 1 H LYS 622 ? H LYS 516 
321 1 Y 1 H ASP 623 ? H ASP 517 
322 1 Y 1 H ASP 624 ? H ASP 518 
323 1 Y 1 H PRO 625 ? H PRO 519 
324 1 Y 1 H MET 626 ? H MET 520 
325 1 Y 1 I GLY 107 ? I GLY 1   
326 1 Y 1 I SER 108 ? I SER 2   
327 1 Y 1 I GLN 109 ? I GLN 3   
328 1 Y 1 I ILE 110 ? I ILE 4   
329 1 Y 1 I HIS 111 ? I HIS 5   
330 1 Y 1 I VAL 112 ? I VAL 6   
331 1 Y 1 I ASP 113 ? I ASP 7   
332 1 Y 1 I THR 114 ? I THR 8   
333 1 Y 1 I GLU 277 ? I GLU 171 
334 1 Y 1 I SER 278 ? I SER 172 
335 1 Y 1 I PRO 279 ? I PRO 173 
336 1 Y 1 I VAL 280 ? I VAL 174 
337 1 Y 1 I GLU 281 ? I GLU 175 
338 1 Y 1 I ASP 282 ? I ASP 176 
339 1 Y 1 I SER 283 ? I SER 177 
340 1 Y 1 I LEU 284 ? I LEU 178 
341 1 Y 1 I ASP 600 ? I ASP 494 
342 1 Y 1 I SER 601 ? I SER 495 
343 1 Y 1 I THR 602 ? I THR 496 
344 1 Y 1 I SER 603 ? I SER 497 
345 1 Y 1 I VAL 604 ? I VAL 498 
346 1 Y 1 I GLN 605 ? I GLN 499 
347 1 Y 1 I ASN 606 ? I ASN 500 
348 1 Y 1 I PRO 607 ? I PRO 501 
349 1 Y 1 I THR 608 ? I THR 502 
350 1 Y 1 I ARG 609 ? I ARG 503 
351 1 Y 1 I LEU 610 ? I LEU 504 
352 1 Y 1 I ARG 611 ? I ARG 505 
353 1 Y 1 I GLU 612 ? I GLU 506 
354 1 Y 1 I ALA 613 ? I ALA 507 
355 1 Y 1 I SER 614 ? I SER 508 
356 1 Y 1 I LYS 615 ? I LYS 509 
357 1 Y 1 I SER 616 ? I SER 510 
358 1 Y 1 I ARG 617 ? I ARG 511 
359 1 Y 1 I VAL 618 ? I VAL 512 
360 1 Y 1 I GLN 619 ? I GLN 513 
361 1 Y 1 I LEU 620 ? I LEU 514 
362 1 Y 1 I PHE 621 ? I PHE 515 
363 1 Y 1 I LYS 622 ? I LYS 516 
364 1 Y 1 I ASP 623 ? I ASP 517 
365 1 Y 1 I ASP 624 ? I ASP 518 
366 1 Y 1 I PRO 625 ? I PRO 519 
367 1 Y 1 I MET 626 ? I MET 520 
368 1 Y 1 J GLY 107 ? J GLY 1   
369 1 Y 1 J SER 108 ? J SER 2   
370 1 Y 1 J GLN 109 ? J GLN 3   
371 1 Y 1 J ILE 110 ? J ILE 4   
372 1 Y 1 J HIS 111 ? J HIS 5   
373 1 Y 1 J VAL 112 ? J VAL 6   
374 1 Y 1 J ASP 113 ? J ASP 7   
375 1 Y 1 J THR 114 ? J THR 8   
376 1 Y 1 J SER 278 ? J SER 172 
377 1 Y 1 J PRO 279 ? J PRO 173 
378 1 Y 1 J VAL 280 ? J VAL 174 
379 1 Y 1 J GLU 281 ? J GLU 175 
380 1 Y 1 J ASP 282 ? J ASP 176 
381 1 Y 1 J SER 283 ? J SER 177 
382 1 Y 1 J ASN 599 ? J ASN 493 
383 1 Y 1 J ASP 600 ? J ASP 494 
384 1 Y 1 J SER 601 ? J SER 495 
385 1 Y 1 J THR 602 ? J THR 496 
386 1 Y 1 J SER 603 ? J SER 497 
387 1 Y 1 J VAL 604 ? J VAL 498 
388 1 Y 1 J GLN 605 ? J GLN 499 
389 1 Y 1 J ASN 606 ? J ASN 500 
390 1 Y 1 J PRO 607 ? J PRO 501 
391 1 Y 1 J THR 608 ? J THR 502 
392 1 Y 1 J ARG 609 ? J ARG 503 
393 1 Y 1 J LEU 610 ? J LEU 504 
394 1 Y 1 J ARG 611 ? J ARG 505 
395 1 Y 1 J GLU 612 ? J GLU 506 
396 1 Y 1 J ALA 613 ? J ALA 507 
397 1 Y 1 J SER 614 ? J SER 508 
398 1 Y 1 J LYS 615 ? J LYS 509 
399 1 Y 1 J SER 616 ? J SER 510 
400 1 Y 1 J ARG 617 ? J ARG 511 
401 1 Y 1 J VAL 618 ? J VAL 512 
402 1 Y 1 J GLN 619 ? J GLN 513 
403 1 Y 1 J LEU 620 ? J LEU 514 
404 1 Y 1 J PHE 621 ? J PHE 515 
405 1 Y 1 J LYS 622 ? J LYS 516 
406 1 Y 1 J ASP 623 ? J ASP 517 
407 1 Y 1 J ASP 624 ? J ASP 518 
408 1 Y 1 J PRO 625 ? J PRO 519 
409 1 Y 1 J MET 626 ? J MET 520 
410 1 Y 1 K GLY 107 ? K GLY 1   
411 1 Y 1 K SER 108 ? K SER 2   
412 1 Y 1 K GLN 109 ? K GLN 3   
413 1 Y 1 K ILE 110 ? K ILE 4   
414 1 Y 1 K HIS 111 ? K HIS 5   
415 1 Y 1 K VAL 112 ? K VAL 6   
416 1 Y 1 K ASP 113 ? K ASP 7   
417 1 Y 1 K THR 114 ? K THR 8   
418 1 Y 1 K GLU 277 ? K GLU 171 
419 1 Y 1 K SER 278 ? K SER 172 
420 1 Y 1 K PRO 279 ? K PRO 173 
421 1 Y 1 K VAL 280 ? K VAL 174 
422 1 Y 1 K GLU 281 ? K GLU 175 
423 1 Y 1 K ASP 282 ? K ASP 176 
424 1 Y 1 K SER 283 ? K SER 177 
425 1 Y 1 K ASP 600 ? K ASP 494 
426 1 Y 1 K SER 601 ? K SER 495 
427 1 Y 1 K THR 602 ? K THR 496 
428 1 Y 1 K SER 603 ? K SER 497 
429 1 Y 1 K VAL 604 ? K VAL 498 
430 1 Y 1 K GLN 605 ? K GLN 499 
431 1 Y 1 K ASN 606 ? K ASN 500 
432 1 Y 1 K PRO 607 ? K PRO 501 
433 1 Y 1 K THR 608 ? K THR 502 
434 1 Y 1 K ARG 609 ? K ARG 503 
435 1 Y 1 K LEU 610 ? K LEU 504 
436 1 Y 1 K ARG 611 ? K ARG 505 
437 1 Y 1 K GLU 612 ? K GLU 506 
438 1 Y 1 K ALA 613 ? K ALA 507 
439 1 Y 1 K SER 614 ? K SER 508 
440 1 Y 1 K LYS 615 ? K LYS 509 
441 1 Y 1 K SER 616 ? K SER 510 
442 1 Y 1 K ARG 617 ? K ARG 511 
443 1 Y 1 K VAL 618 ? K VAL 512 
444 1 Y 1 K GLN 619 ? K GLN 513 
445 1 Y 1 K LEU 620 ? K LEU 514 
446 1 Y 1 K PHE 621 ? K PHE 515 
447 1 Y 1 K LYS 622 ? K LYS 516 
448 1 Y 1 K ASP 623 ? K ASP 517 
449 1 Y 1 K ASP 624 ? K ASP 518 
450 1 Y 1 K PRO 625 ? K PRO 519 
451 1 Y 1 K MET 626 ? K MET 520 
452 1 Y 1 L GLY 107 ? L GLY 1   
453 1 Y 1 L SER 108 ? L SER 2   
454 1 Y 1 L GLN 109 ? L GLN 3   
455 1 Y 1 L ILE 110 ? L ILE 4   
456 1 Y 1 L HIS 111 ? L HIS 5   
457 1 Y 1 L VAL 112 ? L VAL 6   
458 1 Y 1 L ASP 113 ? L ASP 7   
459 1 Y 1 L THR 114 ? L THR 8   
460 1 Y 1 L LEU 276 ? L LEU 170 
461 1 Y 1 L GLU 277 ? L GLU 171 
462 1 Y 1 L SER 278 ? L SER 172 
463 1 Y 1 L PRO 279 ? L PRO 173 
464 1 Y 1 L VAL 280 ? L VAL 174 
465 1 Y 1 L GLU 281 ? L GLU 175 
466 1 Y 1 L ASP 282 ? L ASP 176 
467 1 Y 1 L SER 283 ? L SER 177 
468 1 Y 1 L SER 601 ? L SER 495 
469 1 Y 1 L THR 602 ? L THR 496 
470 1 Y 1 L SER 603 ? L SER 497 
471 1 Y 1 L VAL 604 ? L VAL 498 
472 1 Y 1 L GLN 605 ? L GLN 499 
473 1 Y 1 L ASN 606 ? L ASN 500 
474 1 Y 1 L PRO 607 ? L PRO 501 
475 1 Y 1 L THR 608 ? L THR 502 
476 1 Y 1 L ARG 609 ? L ARG 503 
477 1 Y 1 L LEU 610 ? L LEU 504 
478 1 Y 1 L ARG 611 ? L ARG 505 
479 1 Y 1 L GLU 612 ? L GLU 506 
480 1 Y 1 L ALA 613 ? L ALA 507 
481 1 Y 1 L SER 614 ? L SER 508 
482 1 Y 1 L LYS 615 ? L LYS 509 
483 1 Y 1 L SER 616 ? L SER 510 
484 1 Y 1 L ARG 617 ? L ARG 511 
485 1 Y 1 L VAL 618 ? L VAL 512 
486 1 Y 1 L GLN 619 ? L GLN 513 
487 1 Y 1 L LEU 620 ? L LEU 514 
488 1 Y 1 L PHE 621 ? L PHE 515 
489 1 Y 1 L LYS 622 ? L LYS 516 
490 1 Y 1 L ASP 623 ? L ASP 517 
491 1 Y 1 L ASP 624 ? L ASP 518 
492 1 Y 1 L PRO 625 ? L PRO 519 
493 1 Y 1 L MET 626 ? L MET 520 
494 1 Y 1 M GLY 107 ? M GLY 1   
495 1 Y 1 M SER 108 ? M SER 2   
496 1 Y 1 M GLN 109 ? M GLN 3   
497 1 Y 1 M ILE 110 ? M ILE 4   
498 1 Y 1 M HIS 111 ? M HIS 5   
499 1 Y 1 M VAL 112 ? M VAL 6   
500 1 Y 1 M ASP 113 ? M ASP 7   
501 1 Y 1 M THR 114 ? M THR 8   
502 1 Y 1 M LEU 276 ? M LEU 170 
503 1 Y 1 M GLU 277 ? M GLU 171 
504 1 Y 1 M SER 278 ? M SER 172 
505 1 Y 1 M PRO 279 ? M PRO 173 
506 1 Y 1 M VAL 280 ? M VAL 174 
507 1 Y 1 M GLU 281 ? M GLU 175 
508 1 Y 1 M ASP 282 ? M ASP 176 
509 1 Y 1 M SER 283 ? M SER 177 
510 1 Y 1 M LEU 284 ? M LEU 178 
511 1 Y 1 M ASN 599 ? M ASN 493 
512 1 Y 1 M ASP 600 ? M ASP 494 
513 1 Y 1 M SER 601 ? M SER 495 
514 1 Y 1 M THR 602 ? M THR 496 
515 1 Y 1 M SER 603 ? M SER 497 
516 1 Y 1 M VAL 604 ? M VAL 498 
517 1 Y 1 M GLN 605 ? M GLN 499 
518 1 Y 1 M ASN 606 ? M ASN 500 
519 1 Y 1 M PRO 607 ? M PRO 501 
520 1 Y 1 M THR 608 ? M THR 502 
521 1 Y 1 M ARG 609 ? M ARG 503 
522 1 Y 1 M LEU 610 ? M LEU 504 
523 1 Y 1 M ARG 611 ? M ARG 505 
524 1 Y 1 M GLU 612 ? M GLU 506 
525 1 Y 1 M ALA 613 ? M ALA 507 
526 1 Y 1 M SER 614 ? M SER 508 
527 1 Y 1 M LYS 615 ? M LYS 509 
528 1 Y 1 M SER 616 ? M SER 510 
529 1 Y 1 M ARG 617 ? M ARG 511 
530 1 Y 1 M VAL 618 ? M VAL 512 
531 1 Y 1 M GLN 619 ? M GLN 513 
532 1 Y 1 M LEU 620 ? M LEU 514 
533 1 Y 1 M PHE 621 ? M PHE 515 
534 1 Y 1 M LYS 622 ? M LYS 516 
535 1 Y 1 M ASP 623 ? M ASP 517 
536 1 Y 1 M ASP 624 ? M ASP 518 
537 1 Y 1 M PRO 625 ? M PRO 519 
538 1 Y 1 M MET 626 ? M MET 520 
539 1 Y 1 N GLY 107 ? N GLY 1   
540 1 Y 1 N SER 108 ? N SER 2   
541 1 Y 1 N GLN 109 ? N GLN 3   
542 1 Y 1 N ILE 110 ? N ILE 4   
543 1 Y 1 N HIS 111 ? N HIS 5   
544 1 Y 1 N VAL 112 ? N VAL 6   
545 1 Y 1 N ASP 113 ? N ASP 7   
546 1 Y 1 N THR 114 ? N THR 8   
547 1 Y 1 N GLU 277 ? N GLU 171 
548 1 Y 1 N SER 278 ? N SER 172 
549 1 Y 1 N PRO 279 ? N PRO 173 
550 1 Y 1 N VAL 280 ? N VAL 174 
551 1 Y 1 N GLU 281 ? N GLU 175 
552 1 Y 1 N ASP 282 ? N ASP 176 
553 1 Y 1 N SER 283 ? N SER 177 
554 1 Y 1 N LEU 284 ? N LEU 178 
555 1 Y 1 N ASP 600 ? N ASP 494 
556 1 Y 1 N SER 601 ? N SER 495 
557 1 Y 1 N THR 602 ? N THR 496 
558 1 Y 1 N SER 603 ? N SER 497 
559 1 Y 1 N VAL 604 ? N VAL 498 
560 1 Y 1 N GLN 605 ? N GLN 499 
561 1 Y 1 N ASN 606 ? N ASN 500 
562 1 Y 1 N PRO 607 ? N PRO 501 
563 1 Y 1 N THR 608 ? N THR 502 
564 1 Y 1 N ARG 609 ? N ARG 503 
565 1 Y 1 N LEU 610 ? N LEU 504 
566 1 Y 1 N ARG 611 ? N ARG 505 
567 1 Y 1 N GLU 612 ? N GLU 506 
568 1 Y 1 N ALA 613 ? N ALA 507 
569 1 Y 1 N SER 614 ? N SER 508 
570 1 Y 1 N LYS 615 ? N LYS 509 
571 1 Y 1 N SER 616 ? N SER 510 
572 1 Y 1 N ARG 617 ? N ARG 511 
573 1 Y 1 N VAL 618 ? N VAL 512 
574 1 Y 1 N GLN 619 ? N GLN 513 
575 1 Y 1 N LEU 620 ? N LEU 514 
576 1 Y 1 N PHE 621 ? N PHE 515 
577 1 Y 1 N LYS 622 ? N LYS 516 
578 1 Y 1 N ASP 623 ? N ASP 517 
579 1 Y 1 N ASP 624 ? N ASP 518 
580 1 Y 1 N PRO 625 ? N PRO 519 
581 1 Y 1 N MET 626 ? N MET 520 
582 1 Y 1 O GLY 107 ? O GLY 1   
583 1 Y 1 O SER 108 ? O SER 2   
584 1 Y 1 O GLN 109 ? O GLN 3   
585 1 Y 1 O ILE 110 ? O ILE 4   
586 1 Y 1 O HIS 111 ? O HIS 5   
587 1 Y 1 O VAL 112 ? O VAL 6   
588 1 Y 1 O ASP 113 ? O ASP 7   
589 1 Y 1 O LYS 595 ? O LYS 489 
590 1 Y 1 O LYS 596 ? O LYS 490 
591 1 Y 1 O GLU 597 ? O GLU 491 
592 1 Y 1 O TRP 598 ? O TRP 492 
593 1 Y 1 O ASN 599 ? O ASN 493 
594 1 Y 1 O ASP 600 ? O ASP 494 
595 1 Y 1 O SER 601 ? O SER 495 
596 1 Y 1 O THR 602 ? O THR 496 
597 1 Y 1 O SER 603 ? O SER 497 
598 1 Y 1 O VAL 604 ? O VAL 498 
599 1 Y 1 O GLN 605 ? O GLN 499 
600 1 Y 1 O ASN 606 ? O ASN 500 
601 1 Y 1 O PRO 607 ? O PRO 501 
602 1 Y 1 O THR 608 ? O THR 502 
603 1 Y 1 O ARG 609 ? O ARG 503 
604 1 Y 1 O LEU 610 ? O LEU 504 
605 1 Y 1 O ARG 611 ? O ARG 505 
606 1 Y 1 O GLU 612 ? O GLU 506 
607 1 Y 1 O ALA 613 ? O ALA 507 
608 1 Y 1 O SER 614 ? O SER 508 
609 1 Y 1 O LYS 615 ? O LYS 509 
610 1 Y 1 O SER 616 ? O SER 510 
611 1 Y 1 O ARG 617 ? O ARG 511 
612 1 Y 1 O VAL 618 ? O VAL 512 
613 1 Y 1 O GLN 619 ? O GLN 513 
614 1 Y 1 O LEU 620 ? O LEU 514 
615 1 Y 1 O PHE 621 ? O PHE 515 
616 1 Y 1 O LYS 622 ? O LYS 516 
617 1 Y 1 O ASP 623 ? O ASP 517 
618 1 Y 1 O ASP 624 ? O ASP 518 
619 1 Y 1 O PRO 625 ? O PRO 519 
620 1 Y 1 O MET 626 ? O MET 520 
621 1 Y 1 P GLY 107 ? P GLY 1   
622 1 Y 1 P SER 108 ? P SER 2   
623 1 Y 1 P GLN 109 ? P GLN 3   
624 1 Y 1 P ILE 110 ? P ILE 4   
625 1 Y 1 P HIS 111 ? P HIS 5   
626 1 Y 1 P VAL 112 ? P VAL 6   
627 1 Y 1 P ASP 113 ? P ASP 7   
628 1 Y 1 P GLU 277 ? P GLU 171 
629 1 Y 1 P SER 278 ? P SER 172 
630 1 Y 1 P PRO 279 ? P PRO 173 
631 1 Y 1 P VAL 280 ? P VAL 174 
632 1 Y 1 P GLU 281 ? P GLU 175 
633 1 Y 1 P ASP 282 ? P ASP 176 
634 1 Y 1 P SER 283 ? P SER 177 
635 1 Y 1 P LYS 595 ? P LYS 489 
636 1 Y 1 P LYS 596 ? P LYS 490 
637 1 Y 1 P GLU 597 ? P GLU 491 
638 1 Y 1 P TRP 598 ? P TRP 492 
639 1 Y 1 P ASN 599 ? P ASN 493 
640 1 Y 1 P ASP 600 ? P ASP 494 
641 1 Y 1 P SER 601 ? P SER 495 
642 1 Y 1 P THR 602 ? P THR 496 
643 1 Y 1 P SER 603 ? P SER 497 
644 1 Y 1 P VAL 604 ? P VAL 498 
645 1 Y 1 P GLN 605 ? P GLN 499 
646 1 Y 1 P ASN 606 ? P ASN 500 
647 1 Y 1 P PRO 607 ? P PRO 501 
648 1 Y 1 P THR 608 ? P THR 502 
649 1 Y 1 P ARG 609 ? P ARG 503 
650 1 Y 1 P LEU 610 ? P LEU 504 
651 1 Y 1 P ARG 611 ? P ARG 505 
652 1 Y 1 P GLU 612 ? P GLU 506 
653 1 Y 1 P ALA 613 ? P ALA 507 
654 1 Y 1 P SER 614 ? P SER 508 
655 1 Y 1 P LYS 615 ? P LYS 509 
656 1 Y 1 P SER 616 ? P SER 510 
657 1 Y 1 P ARG 617 ? P ARG 511 
658 1 Y 1 P VAL 618 ? P VAL 512 
659 1 Y 1 P GLN 619 ? P GLN 513 
660 1 Y 1 P LEU 620 ? P LEU 514 
661 1 Y 1 P PHE 621 ? P PHE 515 
662 1 Y 1 P LYS 622 ? P LYS 516 
663 1 Y 1 P ASP 623 ? P ASP 517 
664 1 Y 1 P ASP 624 ? P ASP 518 
665 1 Y 1 P PRO 625 ? P PRO 519 
666 1 Y 1 P MET 626 ? P MET 520 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
1FZ O2     O  N N 1   
1FZ O4     O  N N 2   
1FZ C4     C  N N 3   
1FZ C5     C  N N 4   
1FZ C6     C  N N 5   
1FZ C5M    C  N N 6   
1FZ N3     N  N N 7   
1FZ C2     C  N N 8   
1FZ N1     N  N N 9   
1FZ "C1'"  C  N R 10  
1FZ "C2'"  C  N N 11  
1FZ "C3'"  C  N S 12  
1FZ "O3'"  O  N N 13  
1FZ "O4'"  O  N N 14  
1FZ "C4'"  C  N R 15  
1FZ "C5'"  C  N N 16  
1FZ "O5'"  O  N N 17  
1FZ PA     P  N N 18  
1FZ O1A    O  N N 19  
1FZ O2A    O  N N 20  
1FZ N3A    N  N N 21  
1FZ PB     P  N N 22  
1FZ O1B    O  N N 23  
1FZ O2B    O  N N 24  
1FZ O3B    O  N N 25  
1FZ PG     P  N N 26  
1FZ O1G    O  N N 27  
1FZ O3G    O  N N 28  
1FZ O2G    O  N N 29  
1FZ H1     H  N N 30  
1FZ H2     H  N N 31  
1FZ H3     H  N N 32  
1FZ H4     H  N N 33  
1FZ H5     H  N N 34  
1FZ H6     H  N N 35  
1FZ H7     H  N N 36  
1FZ H8     H  N N 37  
1FZ H9     H  N N 38  
1FZ H10    H  N N 39  
1FZ H11    H  N N 40  
1FZ H12    H  N N 41  
1FZ H13    H  N N 42  
1FZ H14    H  N N 43  
1FZ H15    H  N N 44  
1FZ H16    H  N N 45  
1FZ H17    H  N N 46  
1FZ H18    H  N N 47  
ALA N      N  N N 48  
ALA CA     C  N S 49  
ALA C      C  N N 50  
ALA O      O  N N 51  
ALA CB     C  N N 52  
ALA OXT    O  N N 53  
ALA H      H  N N 54  
ALA H2     H  N N 55  
ALA HA     H  N N 56  
ALA HB1    H  N N 57  
ALA HB2    H  N N 58  
ALA HB3    H  N N 59  
ALA HXT    H  N N 60  
ARG N      N  N N 61  
ARG CA     C  N S 62  
ARG C      C  N N 63  
ARG O      O  N N 64  
ARG CB     C  N N 65  
ARG CG     C  N N 66  
ARG CD     C  N N 67  
ARG NE     N  N N 68  
ARG CZ     C  N N 69  
ARG NH1    N  N N 70  
ARG NH2    N  N N 71  
ARG OXT    O  N N 72  
ARG H      H  N N 73  
ARG H2     H  N N 74  
ARG HA     H  N N 75  
ARG HB2    H  N N 76  
ARG HB3    H  N N 77  
ARG HG2    H  N N 78  
ARG HG3    H  N N 79  
ARG HD2    H  N N 80  
ARG HD3    H  N N 81  
ARG HE     H  N N 82  
ARG HH11   H  N N 83  
ARG HH12   H  N N 84  
ARG HH21   H  N N 85  
ARG HH22   H  N N 86  
ARG HXT    H  N N 87  
ASN N      N  N N 88  
ASN CA     C  N S 89  
ASN C      C  N N 90  
ASN O      O  N N 91  
ASN CB     C  N N 92  
ASN CG     C  N N 93  
ASN OD1    O  N N 94  
ASN ND2    N  N N 95  
ASN OXT    O  N N 96  
ASN H      H  N N 97  
ASN H2     H  N N 98  
ASN HA     H  N N 99  
ASN HB2    H  N N 100 
ASN HB3    H  N N 101 
ASN HD21   H  N N 102 
ASN HD22   H  N N 103 
ASN HXT    H  N N 104 
ASP N      N  N N 105 
ASP CA     C  N S 106 
ASP C      C  N N 107 
ASP O      O  N N 108 
ASP CB     C  N N 109 
ASP CG     C  N N 110 
ASP OD1    O  N N 111 
ASP OD2    O  N N 112 
ASP OXT    O  N N 113 
ASP H      H  N N 114 
ASP H2     H  N N 115 
ASP HA     H  N N 116 
ASP HB2    H  N N 117 
ASP HB3    H  N N 118 
ASP HD2    H  N N 119 
ASP HXT    H  N N 120 
CYS N      N  N N 121 
CYS CA     C  N R 122 
CYS C      C  N N 123 
CYS O      O  N N 124 
CYS CB     C  N N 125 
CYS SG     S  N N 126 
CYS OXT    O  N N 127 
CYS H      H  N N 128 
CYS H2     H  N N 129 
CYS HA     H  N N 130 
CYS HB2    H  N N 131 
CYS HB3    H  N N 132 
CYS HG     H  N N 133 
CYS HXT    H  N N 134 
DTP PG     P  N N 135 
DTP O1G    O  N N 136 
DTP O2G    O  N N 137 
DTP O3G    O  N N 138 
DTP PB     P  N S 139 
DTP O1B    O  N N 140 
DTP O2B    O  N N 141 
DTP O3B    O  N N 142 
DTP PA     P  N S 143 
DTP O1A    O  N N 144 
DTP O2A    O  N N 145 
DTP O3A    O  N N 146 
DTP "O5'"  O  N N 147 
DTP "C5'"  C  N N 148 
DTP "C4'"  C  N R 149 
DTP "O4'"  O  N N 150 
DTP "C3'"  C  N S 151 
DTP "O3'"  O  N N 152 
DTP "C2'"  C  N N 153 
DTP "C1'"  C  N R 154 
DTP N9     N  Y N 155 
DTP C8     C  Y N 156 
DTP N7     N  Y N 157 
DTP C5     C  Y N 158 
DTP C6     C  Y N 159 
DTP N6     N  N N 160 
DTP N1     N  Y N 161 
DTP C2     C  Y N 162 
DTP N3     N  Y N 163 
DTP C4     C  Y N 164 
DTP HOG2   H  N N 165 
DTP HOG3   H  N N 166 
DTP HOB2   H  N N 167 
DTP HOA2   H  N N 168 
DTP "H5'1" H  N N 169 
DTP "H5'2" H  N N 170 
DTP "H4'"  H  N N 171 
DTP "H3'"  H  N N 172 
DTP "HO3'" H  N N 173 
DTP "H2'1" H  N N 174 
DTP "H2'2" H  N N 175 
DTP "H1'"  H  N N 176 
DTP H8     H  N N 177 
DTP HN61   H  N N 178 
DTP HN62   H  N N 179 
DTP H2     H  N N 180 
FE  FE     FE N N 181 
GLN N      N  N N 182 
GLN CA     C  N S 183 
GLN C      C  N N 184 
GLN O      O  N N 185 
GLN CB     C  N N 186 
GLN CG     C  N N 187 
GLN CD     C  N N 188 
GLN OE1    O  N N 189 
GLN NE2    N  N N 190 
GLN OXT    O  N N 191 
GLN H      H  N N 192 
GLN H2     H  N N 193 
GLN HA     H  N N 194 
GLN HB2    H  N N 195 
GLN HB3    H  N N 196 
GLN HG2    H  N N 197 
GLN HG3    H  N N 198 
GLN HE21   H  N N 199 
GLN HE22   H  N N 200 
GLN HXT    H  N N 201 
GLU N      N  N N 202 
GLU CA     C  N S 203 
GLU C      C  N N 204 
GLU O      O  N N 205 
GLU CB     C  N N 206 
GLU CG     C  N N 207 
GLU CD     C  N N 208 
GLU OE1    O  N N 209 
GLU OE2    O  N N 210 
GLU OXT    O  N N 211 
GLU H      H  N N 212 
GLU H2     H  N N 213 
GLU HA     H  N N 214 
GLU HB2    H  N N 215 
GLU HB3    H  N N 216 
GLU HG2    H  N N 217 
GLU HG3    H  N N 218 
GLU HE2    H  N N 219 
GLU HXT    H  N N 220 
GLY N      N  N N 221 
GLY CA     C  N N 222 
GLY C      C  N N 223 
GLY O      O  N N 224 
GLY OXT    O  N N 225 
GLY H      H  N N 226 
GLY H2     H  N N 227 
GLY HA2    H  N N 228 
GLY HA3    H  N N 229 
GLY HXT    H  N N 230 
GTP PG     P  N N 231 
GTP O1G    O  N N 232 
GTP O2G    O  N N 233 
GTP O3G    O  N N 234 
GTP O3B    O  N N 235 
GTP PB     P  N N 236 
GTP O1B    O  N N 237 
GTP O2B    O  N N 238 
GTP O3A    O  N N 239 
GTP PA     P  N N 240 
GTP O1A    O  N N 241 
GTP O2A    O  N N 242 
GTP "O5'"  O  N N 243 
GTP "C5'"  C  N N 244 
GTP "C4'"  C  N R 245 
GTP "O4'"  O  N N 246 
GTP "C3'"  C  N S 247 
GTP "O3'"  O  N N 248 
GTP "C2'"  C  N R 249 
GTP "O2'"  O  N N 250 
GTP "C1'"  C  N R 251 
GTP N9     N  Y N 252 
GTP C8     C  Y N 253 
GTP N7     N  Y N 254 
GTP C5     C  Y N 255 
GTP C6     C  N N 256 
GTP O6     O  N N 257 
GTP N1     N  N N 258 
GTP C2     C  N N 259 
GTP N2     N  N N 260 
GTP N3     N  N N 261 
GTP C4     C  Y N 262 
GTP HOG2   H  N N 263 
GTP HOG3   H  N N 264 
GTP HOB2   H  N N 265 
GTP HOA2   H  N N 266 
GTP "H5'"  H  N N 267 
GTP "H5''" H  N N 268 
GTP "H4'"  H  N N 269 
GTP "H3'"  H  N N 270 
GTP "HO3'" H  N N 271 
GTP "H2'"  H  N N 272 
GTP "HO2'" H  N N 273 
GTP "H1'"  H  N N 274 
GTP H8     H  N N 275 
GTP HN1    H  N N 276 
GTP HN21   H  N N 277 
GTP HN22   H  N N 278 
HIS N      N  N N 279 
HIS CA     C  N S 280 
HIS C      C  N N 281 
HIS O      O  N N 282 
HIS CB     C  N N 283 
HIS CG     C  Y N 284 
HIS ND1    N  Y N 285 
HIS CD2    C  Y N 286 
HIS CE1    C  Y N 287 
HIS NE2    N  Y N 288 
HIS OXT    O  N N 289 
HIS H      H  N N 290 
HIS H2     H  N N 291 
HIS HA     H  N N 292 
HIS HB2    H  N N 293 
HIS HB3    H  N N 294 
HIS HD1    H  N N 295 
HIS HD2    H  N N 296 
HIS HE1    H  N N 297 
HIS HE2    H  N N 298 
HIS HXT    H  N N 299 
ILE N      N  N N 300 
ILE CA     C  N S 301 
ILE C      C  N N 302 
ILE O      O  N N 303 
ILE CB     C  N S 304 
ILE CG1    C  N N 305 
ILE CG2    C  N N 306 
ILE CD1    C  N N 307 
ILE OXT    O  N N 308 
ILE H      H  N N 309 
ILE H2     H  N N 310 
ILE HA     H  N N 311 
ILE HB     H  N N 312 
ILE HG12   H  N N 313 
ILE HG13   H  N N 314 
ILE HG21   H  N N 315 
ILE HG22   H  N N 316 
ILE HG23   H  N N 317 
ILE HD11   H  N N 318 
ILE HD12   H  N N 319 
ILE HD13   H  N N 320 
ILE HXT    H  N N 321 
LEU N      N  N N 322 
LEU CA     C  N S 323 
LEU C      C  N N 324 
LEU O      O  N N 325 
LEU CB     C  N N 326 
LEU CG     C  N N 327 
LEU CD1    C  N N 328 
LEU CD2    C  N N 329 
LEU OXT    O  N N 330 
LEU H      H  N N 331 
LEU H2     H  N N 332 
LEU HA     H  N N 333 
LEU HB2    H  N N 334 
LEU HB3    H  N N 335 
LEU HG     H  N N 336 
LEU HD11   H  N N 337 
LEU HD12   H  N N 338 
LEU HD13   H  N N 339 
LEU HD21   H  N N 340 
LEU HD22   H  N N 341 
LEU HD23   H  N N 342 
LEU HXT    H  N N 343 
LYS N      N  N N 344 
LYS CA     C  N S 345 
LYS C      C  N N 346 
LYS O      O  N N 347 
LYS CB     C  N N 348 
LYS CG     C  N N 349 
LYS CD     C  N N 350 
LYS CE     C  N N 351 
LYS NZ     N  N N 352 
LYS OXT    O  N N 353 
LYS H      H  N N 354 
LYS H2     H  N N 355 
LYS HA     H  N N 356 
LYS HB2    H  N N 357 
LYS HB3    H  N N 358 
LYS HG2    H  N N 359 
LYS HG3    H  N N 360 
LYS HD2    H  N N 361 
LYS HD3    H  N N 362 
LYS HE2    H  N N 363 
LYS HE3    H  N N 364 
LYS HZ1    H  N N 365 
LYS HZ2    H  N N 366 
LYS HZ3    H  N N 367 
LYS HXT    H  N N 368 
MET N      N  N N 369 
MET CA     C  N S 370 
MET C      C  N N 371 
MET O      O  N N 372 
MET CB     C  N N 373 
MET CG     C  N N 374 
MET SD     S  N N 375 
MET CE     C  N N 376 
MET OXT    O  N N 377 
MET H      H  N N 378 
MET H2     H  N N 379 
MET HA     H  N N 380 
MET HB2    H  N N 381 
MET HB3    H  N N 382 
MET HG2    H  N N 383 
MET HG3    H  N N 384 
MET HE1    H  N N 385 
MET HE2    H  N N 386 
MET HE3    H  N N 387 
MET HXT    H  N N 388 
MG  MG     MG N N 389 
PHE N      N  N N 390 
PHE CA     C  N S 391 
PHE C      C  N N 392 
PHE O      O  N N 393 
PHE CB     C  N N 394 
PHE CG     C  Y N 395 
PHE CD1    C  Y N 396 
PHE CD2    C  Y N 397 
PHE CE1    C  Y N 398 
PHE CE2    C  Y N 399 
PHE CZ     C  Y N 400 
PHE OXT    O  N N 401 
PHE H      H  N N 402 
PHE H2     H  N N 403 
PHE HA     H  N N 404 
PHE HB2    H  N N 405 
PHE HB3    H  N N 406 
PHE HD1    H  N N 407 
PHE HD2    H  N N 408 
PHE HE1    H  N N 409 
PHE HE2    H  N N 410 
PHE HZ     H  N N 411 
PHE HXT    H  N N 412 
PRO N      N  N N 413 
PRO CA     C  N S 414 
PRO C      C  N N 415 
PRO O      O  N N 416 
PRO CB     C  N N 417 
PRO CG     C  N N 418 
PRO CD     C  N N 419 
PRO OXT    O  N N 420 
PRO H      H  N N 421 
PRO HA     H  N N 422 
PRO HB2    H  N N 423 
PRO HB3    H  N N 424 
PRO HG2    H  N N 425 
PRO HG3    H  N N 426 
PRO HD2    H  N N 427 
PRO HD3    H  N N 428 
PRO HXT    H  N N 429 
SER N      N  N N 430 
SER CA     C  N S 431 
SER C      C  N N 432 
SER O      O  N N 433 
SER CB     C  N N 434 
SER OG     O  N N 435 
SER OXT    O  N N 436 
SER H      H  N N 437 
SER H2     H  N N 438 
SER HA     H  N N 439 
SER HB2    H  N N 440 
SER HB3    H  N N 441 
SER HG     H  N N 442 
SER HXT    H  N N 443 
SO4 S      S  N N 444 
SO4 O1     O  N N 445 
SO4 O2     O  N N 446 
SO4 O3     O  N N 447 
SO4 O4     O  N N 448 
THR N      N  N N 449 
THR CA     C  N S 450 
THR C      C  N N 451 
THR O      O  N N 452 
THR CB     C  N R 453 
THR OG1    O  N N 454 
THR CG2    C  N N 455 
THR OXT    O  N N 456 
THR H      H  N N 457 
THR H2     H  N N 458 
THR HA     H  N N 459 
THR HB     H  N N 460 
THR HG1    H  N N 461 
THR HG21   H  N N 462 
THR HG22   H  N N 463 
THR HG23   H  N N 464 
THR HXT    H  N N 465 
TRP N      N  N N 466 
TRP CA     C  N S 467 
TRP C      C  N N 468 
TRP O      O  N N 469 
TRP CB     C  N N 470 
TRP CG     C  Y N 471 
TRP CD1    C  Y N 472 
TRP CD2    C  Y N 473 
TRP NE1    N  Y N 474 
TRP CE2    C  Y N 475 
TRP CE3    C  Y N 476 
TRP CZ2    C  Y N 477 
TRP CZ3    C  Y N 478 
TRP CH2    C  Y N 479 
TRP OXT    O  N N 480 
TRP H      H  N N 481 
TRP H2     H  N N 482 
TRP HA     H  N N 483 
TRP HB2    H  N N 484 
TRP HB3    H  N N 485 
TRP HD1    H  N N 486 
TRP HE1    H  N N 487 
TRP HE3    H  N N 488 
TRP HZ2    H  N N 489 
TRP HZ3    H  N N 490 
TRP HH2    H  N N 491 
TRP HXT    H  N N 492 
TYR N      N  N N 493 
TYR CA     C  N S 494 
TYR C      C  N N 495 
TYR O      O  N N 496 
TYR CB     C  N N 497 
TYR CG     C  Y N 498 
TYR CD1    C  Y N 499 
TYR CD2    C  Y N 500 
TYR CE1    C  Y N 501 
TYR CE2    C  Y N 502 
TYR CZ     C  Y N 503 
TYR OH     O  N N 504 
TYR OXT    O  N N 505 
TYR H      H  N N 506 
TYR H2     H  N N 507 
TYR HA     H  N N 508 
TYR HB2    H  N N 509 
TYR HB3    H  N N 510 
TYR HD1    H  N N 511 
TYR HD2    H  N N 512 
TYR HE1    H  N N 513 
TYR HE2    H  N N 514 
TYR HH     H  N N 515 
TYR HXT    H  N N 516 
VAL N      N  N N 517 
VAL CA     C  N S 518 
VAL C      C  N N 519 
VAL O      O  N N 520 
VAL CB     C  N N 521 
VAL CG1    C  N N 522 
VAL CG2    C  N N 523 
VAL OXT    O  N N 524 
VAL H      H  N N 525 
VAL H2     H  N N 526 
VAL HA     H  N N 527 
VAL HB     H  N N 528 
VAL HG11   H  N N 529 
VAL HG12   H  N N 530 
VAL HG13   H  N N 531 
VAL HG21   H  N N 532 
VAL HG22   H  N N 533 
VAL HG23   H  N N 534 
VAL HXT    H  N N 535 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
1FZ O3G   PG     doub N N 1   
1FZ O1G   PG     sing N N 2   
1FZ O2G   PG     sing N N 3   
1FZ PG    O3B    sing N N 4   
1FZ O1A   PA     doub N N 5   
1FZ O3B   PB     sing N N 6   
1FZ O2B   PB     doub N N 7   
1FZ PB    N3A    sing N N 8   
1FZ PB    O1B    sing N N 9   
1FZ PA    N3A    sing N N 10  
1FZ PA    O2A    sing N N 11  
1FZ PA    "O5'"  sing N N 12  
1FZ "C5'" "O5'"  sing N N 13  
1FZ "C5'" "C4'"  sing N N 14  
1FZ "O3'" "C3'"  sing N N 15  
1FZ "C4'" "C3'"  sing N N 16  
1FZ "C4'" "O4'"  sing N N 17  
1FZ "C3'" "C2'"  sing N N 18  
1FZ "O4'" "C1'"  sing N N 19  
1FZ C5M   C5     sing N N 20  
1FZ "C2'" "C1'"  sing N N 21  
1FZ C6    C5     doub N N 22  
1FZ C6    N1     sing N N 23  
1FZ "C1'" N1     sing N N 24  
1FZ C5    C4     sing N N 25  
1FZ N1    C2     sing N N 26  
1FZ C4    O4     doub N N 27  
1FZ C4    N3     sing N N 28  
1FZ C2    N3     sing N N 29  
1FZ C2    O2     doub N N 30  
1FZ C6    H1     sing N N 31  
1FZ C5M   H2     sing N N 32  
1FZ C5M   H3     sing N N 33  
1FZ C5M   H4     sing N N 34  
1FZ N3    H5     sing N N 35  
1FZ "C1'" H6     sing N N 36  
1FZ "C2'" H7     sing N N 37  
1FZ "C2'" H8     sing N N 38  
1FZ "C3'" H9     sing N N 39  
1FZ "O3'" H10    sing N N 40  
1FZ "C4'" H11    sing N N 41  
1FZ "C5'" H12    sing N N 42  
1FZ "C5'" H13    sing N N 43  
1FZ O2A   H14    sing N N 44  
1FZ N3A   H15    sing N N 45  
1FZ O1B   H16    sing N N 46  
1FZ O1G   H17    sing N N 47  
1FZ O2G   H18    sing N N 48  
ALA N     CA     sing N N 49  
ALA N     H      sing N N 50  
ALA N     H2     sing N N 51  
ALA CA    C      sing N N 52  
ALA CA    CB     sing N N 53  
ALA CA    HA     sing N N 54  
ALA C     O      doub N N 55  
ALA C     OXT    sing N N 56  
ALA CB    HB1    sing N N 57  
ALA CB    HB2    sing N N 58  
ALA CB    HB3    sing N N 59  
ALA OXT   HXT    sing N N 60  
ARG N     CA     sing N N 61  
ARG N     H      sing N N 62  
ARG N     H2     sing N N 63  
ARG CA    C      sing N N 64  
ARG CA    CB     sing N N 65  
ARG CA    HA     sing N N 66  
ARG C     O      doub N N 67  
ARG C     OXT    sing N N 68  
ARG CB    CG     sing N N 69  
ARG CB    HB2    sing N N 70  
ARG CB    HB3    sing N N 71  
ARG CG    CD     sing N N 72  
ARG CG    HG2    sing N N 73  
ARG CG    HG3    sing N N 74  
ARG CD    NE     sing N N 75  
ARG CD    HD2    sing N N 76  
ARG CD    HD3    sing N N 77  
ARG NE    CZ     sing N N 78  
ARG NE    HE     sing N N 79  
ARG CZ    NH1    sing N N 80  
ARG CZ    NH2    doub N N 81  
ARG NH1   HH11   sing N N 82  
ARG NH1   HH12   sing N N 83  
ARG NH2   HH21   sing N N 84  
ARG NH2   HH22   sing N N 85  
ARG OXT   HXT    sing N N 86  
ASN N     CA     sing N N 87  
ASN N     H      sing N N 88  
ASN N     H2     sing N N 89  
ASN CA    C      sing N N 90  
ASN CA    CB     sing N N 91  
ASN CA    HA     sing N N 92  
ASN C     O      doub N N 93  
ASN C     OXT    sing N N 94  
ASN CB    CG     sing N N 95  
ASN CB    HB2    sing N N 96  
ASN CB    HB3    sing N N 97  
ASN CG    OD1    doub N N 98  
ASN CG    ND2    sing N N 99  
ASN ND2   HD21   sing N N 100 
ASN ND2   HD22   sing N N 101 
ASN OXT   HXT    sing N N 102 
ASP N     CA     sing N N 103 
ASP N     H      sing N N 104 
ASP N     H2     sing N N 105 
ASP CA    C      sing N N 106 
ASP CA    CB     sing N N 107 
ASP CA    HA     sing N N 108 
ASP C     O      doub N N 109 
ASP C     OXT    sing N N 110 
ASP CB    CG     sing N N 111 
ASP CB    HB2    sing N N 112 
ASP CB    HB3    sing N N 113 
ASP CG    OD1    doub N N 114 
ASP CG    OD2    sing N N 115 
ASP OD2   HD2    sing N N 116 
ASP OXT   HXT    sing N N 117 
CYS N     CA     sing N N 118 
CYS N     H      sing N N 119 
CYS N     H2     sing N N 120 
CYS CA    C      sing N N 121 
CYS CA    CB     sing N N 122 
CYS CA    HA     sing N N 123 
CYS C     O      doub N N 124 
CYS C     OXT    sing N N 125 
CYS CB    SG     sing N N 126 
CYS CB    HB2    sing N N 127 
CYS CB    HB3    sing N N 128 
CYS SG    HG     sing N N 129 
CYS OXT   HXT    sing N N 130 
DTP PG    O1G    doub N N 131 
DTP PG    O2G    sing N N 132 
DTP PG    O3G    sing N N 133 
DTP PG    O3B    sing N N 134 
DTP O2G   HOG2   sing N N 135 
DTP O3G   HOG3   sing N N 136 
DTP PB    O1B    doub N N 137 
DTP PB    O2B    sing N N 138 
DTP PB    O3B    sing N N 139 
DTP PB    O3A    sing N N 140 
DTP O2B   HOB2   sing N N 141 
DTP PA    O1A    doub N N 142 
DTP PA    O2A    sing N N 143 
DTP PA    O3A    sing N N 144 
DTP PA    "O5'"  sing N N 145 
DTP O2A   HOA2   sing N N 146 
DTP "O5'" "C5'"  sing N N 147 
DTP "C5'" "C4'"  sing N N 148 
DTP "C5'" "H5'1" sing N N 149 
DTP "C5'" "H5'2" sing N N 150 
DTP "C4'" "O4'"  sing N N 151 
DTP "C4'" "C3'"  sing N N 152 
DTP "C4'" "H4'"  sing N N 153 
DTP "O4'" "C1'"  sing N N 154 
DTP "C3'" "O3'"  sing N N 155 
DTP "C3'" "C2'"  sing N N 156 
DTP "C3'" "H3'"  sing N N 157 
DTP "O3'" "HO3'" sing N N 158 
DTP "C2'" "C1'"  sing N N 159 
DTP "C2'" "H2'1" sing N N 160 
DTP "C2'" "H2'2" sing N N 161 
DTP "C1'" N9     sing N N 162 
DTP "C1'" "H1'"  sing N N 163 
DTP N9    C8     sing Y N 164 
DTP N9    C4     sing Y N 165 
DTP C8    N7     doub Y N 166 
DTP C8    H8     sing N N 167 
DTP N7    C5     sing Y N 168 
DTP C5    C6     sing Y N 169 
DTP C5    C4     doub Y N 170 
DTP C6    N6     sing N N 171 
DTP C6    N1     doub Y N 172 
DTP N6    HN61   sing N N 173 
DTP N6    HN62   sing N N 174 
DTP N1    C2     sing Y N 175 
DTP C2    N3     doub Y N 176 
DTP C2    H2     sing N N 177 
DTP N3    C4     sing Y N 178 
GLN N     CA     sing N N 179 
GLN N     H      sing N N 180 
GLN N     H2     sing N N 181 
GLN CA    C      sing N N 182 
GLN CA    CB     sing N N 183 
GLN CA    HA     sing N N 184 
GLN C     O      doub N N 185 
GLN C     OXT    sing N N 186 
GLN CB    CG     sing N N 187 
GLN CB    HB2    sing N N 188 
GLN CB    HB3    sing N N 189 
GLN CG    CD     sing N N 190 
GLN CG    HG2    sing N N 191 
GLN CG    HG3    sing N N 192 
GLN CD    OE1    doub N N 193 
GLN CD    NE2    sing N N 194 
GLN NE2   HE21   sing N N 195 
GLN NE2   HE22   sing N N 196 
GLN OXT   HXT    sing N N 197 
GLU N     CA     sing N N 198 
GLU N     H      sing N N 199 
GLU N     H2     sing N N 200 
GLU CA    C      sing N N 201 
GLU CA    CB     sing N N 202 
GLU CA    HA     sing N N 203 
GLU C     O      doub N N 204 
GLU C     OXT    sing N N 205 
GLU CB    CG     sing N N 206 
GLU CB    HB2    sing N N 207 
GLU CB    HB3    sing N N 208 
GLU CG    CD     sing N N 209 
GLU CG    HG2    sing N N 210 
GLU CG    HG3    sing N N 211 
GLU CD    OE1    doub N N 212 
GLU CD    OE2    sing N N 213 
GLU OE2   HE2    sing N N 214 
GLU OXT   HXT    sing N N 215 
GLY N     CA     sing N N 216 
GLY N     H      sing N N 217 
GLY N     H2     sing N N 218 
GLY CA    C      sing N N 219 
GLY CA    HA2    sing N N 220 
GLY CA    HA3    sing N N 221 
GLY C     O      doub N N 222 
GLY C     OXT    sing N N 223 
GLY OXT   HXT    sing N N 224 
GTP PG    O1G    doub N N 225 
GTP PG    O2G    sing N N 226 
GTP PG    O3G    sing N N 227 
GTP PG    O3B    sing N N 228 
GTP O2G   HOG2   sing N N 229 
GTP O3G   HOG3   sing N N 230 
GTP O3B   PB     sing N N 231 
GTP PB    O1B    doub N N 232 
GTP PB    O2B    sing N N 233 
GTP PB    O3A    sing N N 234 
GTP O2B   HOB2   sing N N 235 
GTP O3A   PA     sing N N 236 
GTP PA    O1A    doub N N 237 
GTP PA    O2A    sing N N 238 
GTP PA    "O5'"  sing N N 239 
GTP O2A   HOA2   sing N N 240 
GTP "O5'" "C5'"  sing N N 241 
GTP "C5'" "C4'"  sing N N 242 
GTP "C5'" "H5'"  sing N N 243 
GTP "C5'" "H5''" sing N N 244 
GTP "C4'" "O4'"  sing N N 245 
GTP "C4'" "C3'"  sing N N 246 
GTP "C4'" "H4'"  sing N N 247 
GTP "O4'" "C1'"  sing N N 248 
GTP "C3'" "O3'"  sing N N 249 
GTP "C3'" "C2'"  sing N N 250 
GTP "C3'" "H3'"  sing N N 251 
GTP "O3'" "HO3'" sing N N 252 
GTP "C2'" "O2'"  sing N N 253 
GTP "C2'" "C1'"  sing N N 254 
GTP "C2'" "H2'"  sing N N 255 
GTP "O2'" "HO2'" sing N N 256 
GTP "C1'" N9     sing N N 257 
GTP "C1'" "H1'"  sing N N 258 
GTP N9    C8     sing Y N 259 
GTP N9    C4     sing Y N 260 
GTP C8    N7     doub Y N 261 
GTP C8    H8     sing N N 262 
GTP N7    C5     sing Y N 263 
GTP C5    C6     sing N N 264 
GTP C5    C4     doub Y N 265 
GTP C6    O6     doub N N 266 
GTP C6    N1     sing N N 267 
GTP N1    C2     sing N N 268 
GTP N1    HN1    sing N N 269 
GTP C2    N2     sing N N 270 
GTP C2    N3     doub N N 271 
GTP N2    HN21   sing N N 272 
GTP N2    HN22   sing N N 273 
GTP N3    C4     sing N N 274 
HIS N     CA     sing N N 275 
HIS N     H      sing N N 276 
HIS N     H2     sing N N 277 
HIS CA    C      sing N N 278 
HIS CA    CB     sing N N 279 
HIS CA    HA     sing N N 280 
HIS C     O      doub N N 281 
HIS C     OXT    sing N N 282 
HIS CB    CG     sing N N 283 
HIS CB    HB2    sing N N 284 
HIS CB    HB3    sing N N 285 
HIS CG    ND1    sing Y N 286 
HIS CG    CD2    doub Y N 287 
HIS ND1   CE1    doub Y N 288 
HIS ND1   HD1    sing N N 289 
HIS CD2   NE2    sing Y N 290 
HIS CD2   HD2    sing N N 291 
HIS CE1   NE2    sing Y N 292 
HIS CE1   HE1    sing N N 293 
HIS NE2   HE2    sing N N 294 
HIS OXT   HXT    sing N N 295 
ILE N     CA     sing N N 296 
ILE N     H      sing N N 297 
ILE N     H2     sing N N 298 
ILE CA    C      sing N N 299 
ILE CA    CB     sing N N 300 
ILE CA    HA     sing N N 301 
ILE C     O      doub N N 302 
ILE C     OXT    sing N N 303 
ILE CB    CG1    sing N N 304 
ILE CB    CG2    sing N N 305 
ILE CB    HB     sing N N 306 
ILE CG1   CD1    sing N N 307 
ILE CG1   HG12   sing N N 308 
ILE CG1   HG13   sing N N 309 
ILE CG2   HG21   sing N N 310 
ILE CG2   HG22   sing N N 311 
ILE CG2   HG23   sing N N 312 
ILE CD1   HD11   sing N N 313 
ILE CD1   HD12   sing N N 314 
ILE CD1   HD13   sing N N 315 
ILE OXT   HXT    sing N N 316 
LEU N     CA     sing N N 317 
LEU N     H      sing N N 318 
LEU N     H2     sing N N 319 
LEU CA    C      sing N N 320 
LEU CA    CB     sing N N 321 
LEU CA    HA     sing N N 322 
LEU C     O      doub N N 323 
LEU C     OXT    sing N N 324 
LEU CB    CG     sing N N 325 
LEU CB    HB2    sing N N 326 
LEU CB    HB3    sing N N 327 
LEU CG    CD1    sing N N 328 
LEU CG    CD2    sing N N 329 
LEU CG    HG     sing N N 330 
LEU CD1   HD11   sing N N 331 
LEU CD1   HD12   sing N N 332 
LEU CD1   HD13   sing N N 333 
LEU CD2   HD21   sing N N 334 
LEU CD2   HD22   sing N N 335 
LEU CD2   HD23   sing N N 336 
LEU OXT   HXT    sing N N 337 
LYS N     CA     sing N N 338 
LYS N     H      sing N N 339 
LYS N     H2     sing N N 340 
LYS CA    C      sing N N 341 
LYS CA    CB     sing N N 342 
LYS CA    HA     sing N N 343 
LYS C     O      doub N N 344 
LYS C     OXT    sing N N 345 
LYS CB    CG     sing N N 346 
LYS CB    HB2    sing N N 347 
LYS CB    HB3    sing N N 348 
LYS CG    CD     sing N N 349 
LYS CG    HG2    sing N N 350 
LYS CG    HG3    sing N N 351 
LYS CD    CE     sing N N 352 
LYS CD    HD2    sing N N 353 
LYS CD    HD3    sing N N 354 
LYS CE    NZ     sing N N 355 
LYS CE    HE2    sing N N 356 
LYS CE    HE3    sing N N 357 
LYS NZ    HZ1    sing N N 358 
LYS NZ    HZ2    sing N N 359 
LYS NZ    HZ3    sing N N 360 
LYS OXT   HXT    sing N N 361 
MET N     CA     sing N N 362 
MET N     H      sing N N 363 
MET N     H2     sing N N 364 
MET CA    C      sing N N 365 
MET CA    CB     sing N N 366 
MET CA    HA     sing N N 367 
MET C     O      doub N N 368 
MET C     OXT    sing N N 369 
MET CB    CG     sing N N 370 
MET CB    HB2    sing N N 371 
MET CB    HB3    sing N N 372 
MET CG    SD     sing N N 373 
MET CG    HG2    sing N N 374 
MET CG    HG3    sing N N 375 
MET SD    CE     sing N N 376 
MET CE    HE1    sing N N 377 
MET CE    HE2    sing N N 378 
MET CE    HE3    sing N N 379 
MET OXT   HXT    sing N N 380 
PHE N     CA     sing N N 381 
PHE N     H      sing N N 382 
PHE N     H2     sing N N 383 
PHE CA    C      sing N N 384 
PHE CA    CB     sing N N 385 
PHE CA    HA     sing N N 386 
PHE C     O      doub N N 387 
PHE C     OXT    sing N N 388 
PHE CB    CG     sing N N 389 
PHE CB    HB2    sing N N 390 
PHE CB    HB3    sing N N 391 
PHE CG    CD1    doub Y N 392 
PHE CG    CD2    sing Y N 393 
PHE CD1   CE1    sing Y N 394 
PHE CD1   HD1    sing N N 395 
PHE CD2   CE2    doub Y N 396 
PHE CD2   HD2    sing N N 397 
PHE CE1   CZ     doub Y N 398 
PHE CE1   HE1    sing N N 399 
PHE CE2   CZ     sing Y N 400 
PHE CE2   HE2    sing N N 401 
PHE CZ    HZ     sing N N 402 
PHE OXT   HXT    sing N N 403 
PRO N     CA     sing N N 404 
PRO N     CD     sing N N 405 
PRO N     H      sing N N 406 
PRO CA    C      sing N N 407 
PRO CA    CB     sing N N 408 
PRO CA    HA     sing N N 409 
PRO C     O      doub N N 410 
PRO C     OXT    sing N N 411 
PRO CB    CG     sing N N 412 
PRO CB    HB2    sing N N 413 
PRO CB    HB3    sing N N 414 
PRO CG    CD     sing N N 415 
PRO CG    HG2    sing N N 416 
PRO CG    HG3    sing N N 417 
PRO CD    HD2    sing N N 418 
PRO CD    HD3    sing N N 419 
PRO OXT   HXT    sing N N 420 
SER N     CA     sing N N 421 
SER N     H      sing N N 422 
SER N     H2     sing N N 423 
SER CA    C      sing N N 424 
SER CA    CB     sing N N 425 
SER CA    HA     sing N N 426 
SER C     O      doub N N 427 
SER C     OXT    sing N N 428 
SER CB    OG     sing N N 429 
SER CB    HB2    sing N N 430 
SER CB    HB3    sing N N 431 
SER OG    HG     sing N N 432 
SER OXT   HXT    sing N N 433 
SO4 S     O1     doub N N 434 
SO4 S     O2     doub N N 435 
SO4 S     O3     sing N N 436 
SO4 S     O4     sing N N 437 
THR N     CA     sing N N 438 
THR N     H      sing N N 439 
THR N     H2     sing N N 440 
THR CA    C      sing N N 441 
THR CA    CB     sing N N 442 
THR CA    HA     sing N N 443 
THR C     O      doub N N 444 
THR C     OXT    sing N N 445 
THR CB    OG1    sing N N 446 
THR CB    CG2    sing N N 447 
THR CB    HB     sing N N 448 
THR OG1   HG1    sing N N 449 
THR CG2   HG21   sing N N 450 
THR CG2   HG22   sing N N 451 
THR CG2   HG23   sing N N 452 
THR OXT   HXT    sing N N 453 
TRP N     CA     sing N N 454 
TRP N     H      sing N N 455 
TRP N     H2     sing N N 456 
TRP CA    C      sing N N 457 
TRP CA    CB     sing N N 458 
TRP CA    HA     sing N N 459 
TRP C     O      doub N N 460 
TRP C     OXT    sing N N 461 
TRP CB    CG     sing N N 462 
TRP CB    HB2    sing N N 463 
TRP CB    HB3    sing N N 464 
TRP CG    CD1    doub Y N 465 
TRP CG    CD2    sing Y N 466 
TRP CD1   NE1    sing Y N 467 
TRP CD1   HD1    sing N N 468 
TRP CD2   CE2    doub Y N 469 
TRP CD2   CE3    sing Y N 470 
TRP NE1   CE2    sing Y N 471 
TRP NE1   HE1    sing N N 472 
TRP CE2   CZ2    sing Y N 473 
TRP CE3   CZ3    doub Y N 474 
TRP CE3   HE3    sing N N 475 
TRP CZ2   CH2    doub Y N 476 
TRP CZ2   HZ2    sing N N 477 
TRP CZ3   CH2    sing Y N 478 
TRP CZ3   HZ3    sing N N 479 
TRP CH2   HH2    sing N N 480 
TRP OXT   HXT    sing N N 481 
TYR N     CA     sing N N 482 
TYR N     H      sing N N 483 
TYR N     H2     sing N N 484 
TYR CA    C      sing N N 485 
TYR CA    CB     sing N N 486 
TYR CA    HA     sing N N 487 
TYR C     O      doub N N 488 
TYR C     OXT    sing N N 489 
TYR CB    CG     sing N N 490 
TYR CB    HB2    sing N N 491 
TYR CB    HB3    sing N N 492 
TYR CG    CD1    doub Y N 493 
TYR CG    CD2    sing Y N 494 
TYR CD1   CE1    sing Y N 495 
TYR CD1   HD1    sing N N 496 
TYR CD2   CE2    doub Y N 497 
TYR CD2   HD2    sing N N 498 
TYR CE1   CZ     doub Y N 499 
TYR CE1   HE1    sing N N 500 
TYR CE2   CZ     sing Y N 501 
TYR CE2   HE2    sing N N 502 
TYR CZ    OH     sing N N 503 
TYR OH    HH     sing N N 504 
TYR OXT   HXT    sing N N 505 
VAL N     CA     sing N N 506 
VAL N     H      sing N N 507 
VAL N     H2     sing N N 508 
VAL CA    C      sing N N 509 
VAL CA    CB     sing N N 510 
VAL CA    HA     sing N N 511 
VAL C     O      doub N N 512 
VAL C     OXT    sing N N 513 
VAL CB    CG1    sing N N 514 
VAL CB    CG2    sing N N 515 
VAL CB    HB     sing N N 516 
VAL CG1   HG11   sing N N 517 
VAL CG1   HG12   sing N N 518 
VAL CG1   HG13   sing N N 519 
VAL CG2   HG21   sing N N 520 
VAL CG2   HG22   sing N N 521 
VAL CG2   HG23   sing N N 522 
VAL OXT   HXT    sing N N 523 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Wellcome Trust'                                 'United Kingdom' 108014/Z/15/Z 1 
'Wellcome Trust'                                 'United Kingdom' FC001029      2 
'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' FC001029      3 
'Cancer Research UK'                             'United Kingdom' FC001029      4 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 DTP ? ? DTP ? ? 'SUBJECT OF INVESTIGATION' ? 
2 FE  ? ? FE  ? ? 'SUBJECT OF INVESTIGATION' ? 
3 GTP ? ? GTP ? ? 'SUBJECT OF INVESTIGATION' ? 
4 MG  ? ? MG  ? ? 'SUBJECT OF INVESTIGATION' ? 
5 1FZ ? ? 1FZ ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   6TXA 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    6TXE 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010258 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000953 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005806 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003648 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1 8   ? 84.202  69.724  -40.987  1.00 92.62  ?  114 THR A N     1 
ATOM   2     C  CA    . THR A  1 8   ? 82.995  69.727  -41.884  1.00 92.24  ?  114 THR A CA    1 
ATOM   3     C  C     . THR A  1 8   ? 83.056  68.552  -42.877  1.00 92.05  ?  114 THR A C     1 
ATOM   4     O  O     . THR A  1 8   ? 84.152  68.115  -43.271  1.00 90.76  ?  114 THR A O     1 
ATOM   5     C  CB    . THR A  1 8   ? 82.791  71.114  -42.578  1.00 92.37  ?  114 THR A CB    1 
ATOM   6     O  OG1   . THR A  1 8   ? 81.412  71.288  -42.933  1.00 93.18  ?  114 THR A OG1   1 
ATOM   7     C  CG2   . THR A  1 8   ? 83.709  71.314  -43.809  1.00 91.72  ?  114 THR A CG2   1 
ATOM   8     N  N     . MET A  1 9   ? 81.874  68.044  -43.257  1.00 91.58  ?  115 MET A N     1 
ATOM   9     C  CA    . MET A  1 9   ? 81.740  66.907  -44.212  1.00 86.48  ?  115 MET A CA    1 
ATOM   10    C  C     . MET A  1 9   ? 82.242  67.349  -45.565  1.00 78.22  ?  115 MET A C     1 
ATOM   11    O  O     . MET A  1 9   ? 82.285  68.550  -45.896  1.00 78.00  ?  115 MET A O     1 
ATOM   12    C  CB    . MET A  1 9   ? 80.261  66.492  -44.403  1.00 89.93  ?  115 MET A CB    1 
ATOM   13    C  CG    . MET A  1 9   ? 79.562  65.955  -43.160  1.00 93.83  ?  115 MET A CG    1 
ATOM   14    S  SD    . MET A  1 9   ? 79.840  64.193  -42.817  1.00 95.92  ?  115 MET A SD    1 
ATOM   15    C  CE    . MET A  1 9   ? 79.463  64.167  -41.052  1.00 97.05  ?  115 MET A CE    1 
ATOM   16    N  N     . LYS A  1 10  ? 82.594  66.370  -46.378  1.00 70.21  ?  116 LYS A N     1 
ATOM   17    C  CA    . LYS A  1 10  ? 82.975  66.650  -47.740  1.00 65.00  ?  116 LYS A CA    1 
ATOM   18    C  C     . LYS A  1 10  ? 82.030  65.925  -48.676  1.00 59.44  ?  116 LYS A C     1 
ATOM   19    O  O     . LYS A  1 10  ? 81.684  64.774  -48.448  1.00 57.66  ?  116 LYS A O     1 
ATOM   20    C  CB    . LYS A  1 10  ? 84.395  66.210  -47.966  1.00 64.79  ?  116 LYS A CB    1 
ATOM   21    C  CG    . LYS A  1 10  ? 84.985  66.728  -49.255  1.00 65.35  ?  116 LYS A CG    1 
ATOM   22    C  CD    . LYS A  1 10  ? 86.491  66.641  -49.214  1.00 66.72  ?  116 LYS A CD    1 
ATOM   23    C  CE    . LYS A  1 10  ? 87.118  67.813  -48.478  1.00 68.02  ?  116 LYS A CE    1 
ATOM   24    N  NZ    . LYS A  1 10  ? 88.578  67.757  -48.683  1.00 70.10  ?  116 LYS A NZ    1 
ATOM   25    N  N     . VAL A  1 11  ? 81.601  66.629  -49.717  1.00 54.86  ?  117 VAL A N     1 
ATOM   26    C  CA    . VAL A  1 11  ? 80.666  66.077  -50.694  1.00 51.46  ?  117 VAL A CA    1 
ATOM   27    C  C     . VAL A  1 11  ? 81.431  65.736  -51.971  1.00 48.94  ?  117 VAL A C     1 
ATOM   28    O  O     . VAL A  1 11  ? 82.263  66.523  -52.434  1.00 49.15  ?  117 VAL A O     1 
ATOM   29    C  CB    . VAL A  1 11  ? 79.543  67.056  -51.032  1.00 50.82  ?  117 VAL A CB    1 
ATOM   30    C  CG1   . VAL A  1 11  ? 78.526  66.393  -51.929  1.00 49.85  ?  117 VAL A CG1   1 
ATOM   31    C  CG2   . VAL A  1 11  ? 78.876  67.568  -49.760  1.00 51.20  ?  117 VAL A CG2   1 
ATOM   32    N  N     . ILE A  1 12  ? 81.108  64.580  -52.545  1.00 44.69  ?  118 ILE A N     1 
ATOM   33    C  CA    . ILE A  1 12  ? 81.794  64.060  -53.718  1.00 41.32  ?  118 ILE A CA    1 
ATOM   34    C  C     . ILE A  1 12  ? 80.752  63.487  -54.677  1.00 39.67  ?  118 ILE A C     1 
ATOM   35    O  O     . ILE A  1 12  ? 79.823  62.818  -54.225  1.00 39.41  ?  118 ILE A O     1 
ATOM   36    C  CB    . ILE A  1 12  ? 82.869  63.012  -53.302  1.00 40.02  ?  118 ILE A CB    1 
ATOM   37    C  CG1   . ILE A  1 12  ? 83.725  62.571  -54.490  1.00 39.39  ?  118 ILE A CG1   1 
ATOM   38    C  CG2   . ILE A  1 12  ? 82.249  61.776  -52.645  1.00 39.78  ?  118 ILE A CG2   1 
ATOM   39    C  CD1   . ILE A  1 12  ? 85.051  61.957  -54.082  1.00 39.55  ?  118 ILE A CD1   1 
ATOM   40    N  N     . ASN A  1 13  ? 80.899  63.771  -55.982  1.00 37.36  ?  119 ASN A N     1 
ATOM   41    C  CA    . ASN A  1 13  ? 79.902  63.375  -56.999  1.00 35.69  ?  119 ASN A CA    1 
ATOM   42    C  C     . ASN A  1 13  ? 80.300  62.130  -57.808  1.00 34.17  ?  119 ASN A C     1 
ATOM   43    O  O     . ASN A  1 13  ? 80.998  62.204  -58.838  1.00 35.65  ?  119 ASN A O     1 
ATOM   44    C  CB    . ASN A  1 13  ? 79.604  64.529  -57.956  1.00 35.82  ?  119 ASN A CB    1 
ATOM   45    C  CG    . ASN A  1 13  ? 78.451  64.213  -58.926  1.00 35.49  ?  119 ASN A CG    1 
ATOM   46    O  OD1   . ASN A  1 13  ? 77.998  63.066  -59.048  1.00 34.89  ?  119 ASN A OD1   1 
ATOM   47    N  ND2   . ASN A  1 13  ? 77.975  65.241  -59.618  1.00 35.10  ?  119 ASN A ND2   1 
ATOM   48    N  N     . ASP A  1 14  ? 79.787  60.998  -57.344  1.00 32.25  ?  120 ASP A N     1 
ATOM   49    C  CA    . ASP A  1 14  ? 79.899  59.714  -58.019  1.00 31.21  ?  120 ASP A CA    1 
ATOM   50    C  C     . ASP A  1 14  ? 78.770  59.621  -59.043  1.00 30.77  ?  120 ASP A C     1 
ATOM   51    O  O     . ASP A  1 14  ? 77.627  59.936  -58.711  1.00 30.76  ?  120 ASP A O     1 
ATOM   52    C  CB    . ASP A  1 14  ? 79.772  58.596  -56.978  1.00 30.75  ?  120 ASP A CB    1 
ATOM   53    C  CG    . ASP A  1 14  ? 79.967  57.219  -57.551  1.00 30.21  ?  120 ASP A CG    1 
ATOM   54    O  OD1   . ASP A  1 14  ? 81.048  56.954  -58.136  1.00 29.84  ?  120 ASP A OD1   1 
ATOM   55    O  OD2   . ASP A  1 14  ? 79.056  56.376  -57.386  1.00 29.85  ?  120 ASP A OD2   1 
ATOM   56    N  N     . PRO A  1 15  ? 79.072  59.194  -60.291  1.00 30.45  ?  121 PRO A N     1 
ATOM   57    C  CA    . PRO A  1 15  ? 78.005  59.091  -61.291  1.00 30.01  ?  121 PRO A CA    1 
ATOM   58    C  C     . PRO A  1 15  ? 76.975  58.021  -61.006  1.00 29.40  ?  121 PRO A C     1 
ATOM   59    O  O     . PRO A  1 15  ? 75.890  58.078  -61.562  1.00 30.03  ?  121 PRO A O     1 
ATOM   60    C  CB    . PRO A  1 15  ? 78.755  58.738  -62.576  1.00 30.35  ?  121 PRO A CB    1 
ATOM   61    C  CG    . PRO A  1 15  ? 79.983  58.049  -62.102  1.00 30.64  ?  121 PRO A CG    1 
ATOM   62    C  CD    . PRO A  1 15  ? 80.375  58.832  -60.876  1.00 30.76  ?  121 PRO A CD    1 
ATOM   63    N  N     . ILE A  1 16  ? 77.316  57.036  -60.180  1.00 28.71  ?  122 ILE A N     1 
ATOM   64    C  CA    . ILE A  1 16  ? 76.379  55.975  -59.854  1.00 28.77  ?  122 ILE A CA    1 
ATOM   65    C  C     . ILE A  1 16  ? 75.461  56.408  -58.728  1.00 29.09  ?  122 ILE A C     1 
ATOM   66    O  O     . ILE A  1 16  ? 74.246  56.387  -58.883  1.00 29.76  ?  122 ILE A O     1 
ATOM   67    C  CB    . ILE A  1 16  ? 77.087  54.669  -59.453  1.00 28.50  ?  122 ILE A CB    1 
ATOM   68    C  CG1   . ILE A  1 16  ? 78.131  54.264  -60.501  1.00 28.40  ?  122 ILE A CG1   1 
ATOM   69    C  CG2   . ILE A  1 16  ? 76.067  53.547  -59.239  1.00 28.36  ?  122 ILE A CG2   1 
ATOM   70    C  CD1   . ILE A  1 16  ? 77.641  54.179  -61.932  1.00 28.50  ?  122 ILE A CD1   1 
ATOM   71    N  N     . HIS A  1 17  ? 76.046  56.782  -57.594  1.00 28.91  ?  123 HIS A N     1 
ATOM   72    C  CA    . HIS A  1 17  ? 75.269  57.030  -56.377  1.00 29.13  ?  123 HIS A CA    1 
ATOM   73    C  C     . HIS A  1 17  ? 74.919  58.492  -56.146  1.00 30.08  ?  123 HIS A C     1 
ATOM   74    O  O     . HIS A  1 17  ? 74.166  58.783  -55.209  1.00 31.14  ?  123 HIS A O     1 
ATOM   75    C  CB    . HIS A  1 17  ? 76.011  56.482  -55.174  1.00 29.01  ?  123 HIS A CB    1 
ATOM   76    C  CG    . HIS A  1 17  ? 76.330  55.033  -55.305  1.00 28.67  ?  123 HIS A CG    1 
ATOM   77    N  ND1   . HIS A  1 17  ? 75.348  54.081  -55.499  1.00 28.49  ?  123 HIS A ND1   1 
ATOM   78    C  CD2   . HIS A  1 17  ? 77.519  54.381  -55.318  1.00 28.45  ?  123 HIS A CD2   1 
ATOM   79    C  CE1   . HIS A  1 17  ? 75.932  52.893  -55.600  1.00 28.29  ?  123 HIS A CE1   1 
ATOM   80    N  NE2   . HIS A  1 17  ? 77.247  53.052  -55.497  1.00 28.27  ?  123 HIS A NE2   1 
ATOM   81    N  N     . GLY A  1 18  ? 75.431  59.397  -56.979  1.00 30.41  ?  124 GLY A N     1 
ATOM   82    C  CA    . GLY A  1 18  ? 75.104  60.820  -56.895  1.00 31.00  ?  124 GLY A CA    1 
ATOM   83    C  C     . GLY A  1 18  ? 76.056  61.530  -55.955  1.00 31.62  ?  124 GLY A C     1 
ATOM   84    O  O     . GLY A  1 18  ? 77.256  61.279  -56.000  1.00 31.74  ?  124 GLY A O     1 
ATOM   85    N  N     . HIS A  1 19  ? 75.523  62.401  -55.099  1.00 32.38  ?  125 HIS A N     1 
ATOM   86    C  CA    . HIS A  1 19  ? 76.334  63.165  -54.157  1.00 33.47  ?  125 HIS A CA    1 
ATOM   87    C  C     . HIS A  1 19  ? 76.437  62.478  -52.804  1.00 35.12  ?  125 HIS A C     1 
ATOM   88    O  O     . HIS A  1 19  ? 75.510  62.493  -51.998  1.00 35.32  ?  125 HIS A O     1 
ATOM   89    C  CB    . HIS A  1 19  ? 75.811  64.588  -54.035  1.00 33.19  ?  125 HIS A CB    1 
ATOM   90    C  CG    . HIS A  1 19  ? 76.100  65.415  -55.251  1.00 32.79  ?  125 HIS A CG    1 
ATOM   91    N  ND1   . HIS A  1 19  ? 75.552  65.130  -56.482  1.00 32.28  ?  125 HIS A ND1   1 
ATOM   92    C  CD2   . HIS A  1 19  ? 76.895  66.495  -55.435  1.00 32.60  ?  125 HIS A CD2   1 
ATOM   93    C  CE1   . HIS A  1 19  ? 75.977  66.021  -57.360  1.00 32.37  ?  125 HIS A CE1   1 
ATOM   94    N  NE2   . HIS A  1 19  ? 76.793  66.858  -56.747  1.00 32.40  ?  125 HIS A NE2   1 
ATOM   95    N  N     . ILE A  1 20  ? 77.588  61.861  -52.592  1.00 36.79  ?  126 ILE A N     1 
ATOM   96    C  CA    . ILE A  1 20  ? 77.898  61.182  -51.359  1.00 37.94  ?  126 ILE A CA    1 
ATOM   97    C  C     . ILE A  1 20  ? 78.474  62.203  -50.381  1.00 38.83  ?  126 ILE A C     1 
ATOM   98    O  O     . ILE A  1 20  ? 79.250  63.070  -50.787  1.00 38.20  ?  126 ILE A O     1 
ATOM   99    C  CB    . ILE A  1 20  ? 78.949  60.081  -51.621  1.00 38.24  ?  126 ILE A CB    1 
ATOM   100   C  CG1   . ILE A  1 20  ? 78.418  59.041  -52.610  1.00 38.08  ?  126 ILE A CG1   1 
ATOM   101   C  CG2   . ILE A  1 20  ? 79.351  59.399  -50.314  1.00 38.68  ?  126 ILE A CG2   1 
ATOM   102   C  CD1   . ILE A  1 20  ? 79.513  58.183  -53.232  1.00 38.12  ?  126 ILE A CD1   1 
ATOM   103   N  N     . GLU A  1 21  ? 78.111  62.093  -49.108  1.00 39.99  ?  127 GLU A N     1 
ATOM   104   C  CA    . GLU A  1 21  ? 78.827  62.808  -48.046  1.00 41.16  ?  127 GLU A CA    1 
ATOM   105   C  C     . GLU A  1 21  ? 79.907  61.897  -47.459  1.00 40.65  ?  127 GLU A C     1 
ATOM   106   O  O     . GLU A  1 21  ? 79.699  60.690  -47.301  1.00 40.78  ?  127 GLU A O     1 
ATOM   107   C  CB    . GLU A  1 21  ? 77.872  63.266  -46.947  1.00 42.76  ?  127 GLU A CB    1 
ATOM   108   C  CG    . GLU A  1 21  ? 76.867  64.313  -47.373  1.00 44.73  ?  127 GLU A CG    1 
ATOM   109   C  CD    . GLU A  1 21  ? 76.072  64.902  -46.208  1.00 46.98  ?  127 GLU A CD    1 
ATOM   110   O  OE1   . GLU A  1 21  ? 76.559  64.890  -45.049  1.00 48.62  ?  127 GLU A OE1   1 
ATOM   111   O  OE2   . GLU A  1 21  ? 74.944  65.424  -46.449  1.00 49.03  ?  127 GLU A OE2   1 
ATOM   112   N  N     . LEU A  1 22  ? 81.057  62.485  -47.139  1.00 39.75  ?  128 LEU A N     1 
ATOM   113   C  CA    . LEU A  1 22  ? 82.180  61.740  -46.589  1.00 38.19  ?  128 LEU A CA    1 
ATOM   114   C  C     . LEU A  1 22  ? 82.566  62.362  -45.245  1.00 37.41  ?  128 LEU A C     1 
ATOM   115   O  O     . LEU A  1 22  ? 82.865  63.564  -45.153  1.00 37.02  ?  128 LEU A O     1 
ATOM   116   C  CB    . LEU A  1 22  ? 83.361  61.764  -47.559  1.00 37.86  ?  128 LEU A CB    1 
ATOM   117   C  CG    . LEU A  1 22  ? 83.232  60.969  -48.864  1.00 36.89  ?  128 LEU A CG    1 
ATOM   118   C  CD1   . LEU A  1 22  ? 84.401  61.292  -49.811  1.00 36.64  ?  128 LEU A CD1   1 
ATOM   119   C  CD2   . LEU A  1 22  ? 83.137  59.483  -48.625  1.00 36.41  ?  128 LEU A CD2   1 
ATOM   120   N  N     . HIS A  1 23  ? 82.537  61.529  -44.210  1.00 36.78  ?  129 HIS A N     1 
ATOM   121   C  CA    . HIS A  1 23  ? 82.945  61.931  -42.882  1.00 37.38  ?  129 HIS A CA    1 
ATOM   122   C  C     . HIS A  1 23  ? 84.448  62.236  -42.826  1.00 37.42  ?  129 HIS A C     1 
ATOM   123   O  O     . HIS A  1 23  ? 85.235  61.527  -43.449  1.00 36.98  ?  129 HIS A O     1 
ATOM   124   C  CB    . HIS A  1 23  ? 82.581  60.835  -41.897  1.00 37.37  ?  129 HIS A CB    1 
ATOM   125   C  CG    . HIS A  1 23  ? 82.808  61.203  -40.470  1.00 37.33  ?  129 HIS A CG    1 
ATOM   126   N  ND1   . HIS A  1 23  ? 84.038  61.102  -39.877  1.00 37.60  ?  129 HIS A ND1   1 
ATOM   127   C  CD2   . HIS A  1 23  ? 81.960  61.672  -39.527  1.00 37.48  ?  129 HIS A CD2   1 
ATOM   128   C  CE1   . HIS A  1 23  ? 83.942  61.497  -38.622  1.00 38.16  ?  129 HIS A CE1   1 
ATOM   129   N  NE2   . HIS A  1 23  ? 82.692  61.846  -38.382  1.00 38.15  ?  129 HIS A NE2   1 
ATOM   130   N  N     . PRO A  1 24  ? 84.854  63.295  -42.083  1.00 37.90  ?  130 PRO A N     1 
ATOM   131   C  CA    . PRO A  1 24  ? 86.265  63.701  -42.114  1.00 38.40  ?  130 PRO A CA    1 
ATOM   132   C  C     . PRO A  1 24  ? 87.287  62.573  -41.880  1.00 38.47  ?  130 PRO A C     1 
ATOM   133   O  O     . PRO A  1 24  ? 88.359  62.590  -42.489  1.00 39.03  ?  130 PRO A O     1 
ATOM   134   C  CB    . PRO A  1 24  ? 86.341  64.768  -41.034  1.00 38.79  ?  130 PRO A CB    1 
ATOM   135   C  CG    . PRO A  1 24  ? 84.992  65.389  -41.045  1.00 38.71  ?  130 PRO A CG    1 
ATOM   136   C  CD    . PRO A  1 24  ? 84.050  64.235  -41.272  1.00 38.33  ?  130 PRO A CD    1 
ATOM   137   N  N     . LEU A  1 25  ? 86.948  61.625  -41.008  1.00 38.03  ?  131 LEU A N     1 
ATOM   138   C  CA    . LEU A  1 25  ? 87.734  60.408  -40.800  1.00 38.53  ?  131 LEU A CA    1 
ATOM   139   C  C     . LEU A  1 25  ? 87.947  59.619  -42.083  1.00 38.27  ?  131 LEU A C     1 
ATOM   140   O  O     . LEU A  1 25  ? 89.049  59.140  -42.352  1.00 38.90  ?  131 LEU A O     1 
ATOM   141   C  CB    . LEU A  1 25  ? 87.061  59.503  -39.763  1.00 39.08  ?  131 LEU A CB    1 
ATOM   142   C  CG    . LEU A  1 25  ? 87.716  58.150  -39.438  1.00 39.65  ?  131 LEU A CG    1 
ATOM   143   C  CD1   . LEU A  1 25  ? 89.192  58.295  -39.088  1.00 40.27  ?  131 LEU A CD1   1 
ATOM   144   C  CD2   . LEU A  1 25  ? 86.965  57.488  -38.295  1.00 39.97  ?  131 LEU A CD2   1 
ATOM   145   N  N     . LEU A  1 26  ? 86.886  59.487  -42.872  1.00 37.63  ?  132 LEU A N     1 
ATOM   146   C  CA    . LEU A  1 26  ? 86.959  58.772  -44.145  1.00 37.44  ?  132 LEU A CA    1 
ATOM   147   C  C     . LEU A  1 26  ? 87.860  59.511  -45.130  1.00 37.22  ?  132 LEU A C     1 
ATOM   148   O  O     . LEU A  1 26  ? 88.728  58.906  -45.755  1.00 37.23  ?  132 LEU A O     1 
ATOM   149   C  CB    . LEU A  1 26  ? 85.571  58.579  -44.753  1.00 37.37  ?  132 LEU A CB    1 
ATOM   150   C  CG    . LEU A  1 26  ? 84.528  57.875  -43.873  1.00 37.47  ?  132 LEU A CG    1 
ATOM   151   C  CD1   . LEU A  1 26  ? 83.150  57.842  -44.528  1.00 36.88  ?  132 LEU A CD1   1 
ATOM   152   C  CD2   . LEU A  1 26  ? 84.984  56.460  -43.530  1.00 37.71  ?  132 LEU A CD2   1 
ATOM   153   N  N     . VAL A  1 27  ? 87.662  60.819  -45.230  1.00 37.50  ?  133 VAL A N     1 
ATOM   154   C  CA    . VAL A  1 27  ? 88.478  61.675  -46.096  1.00 38.17  ?  133 VAL A CA    1 
ATOM   155   C  C     . VAL A  1 27  ? 89.965  61.512  -45.761  1.00 39.35  ?  133 VAL A C     1 
ATOM   156   O  O     . VAL A  1 27  ? 90.812  61.437  -46.649  1.00 39.34  ?  133 VAL A O     1 
ATOM   157   C  CB    . VAL A  1 27  ? 88.072  63.168  -45.960  1.00 38.08  ?  133 VAL A CB    1 
ATOM   158   C  CG1   . VAL A  1 27  ? 89.033  64.089  -46.702  1.00 37.89  ?  133 VAL A CG1   1 
ATOM   159   C  CG2   . VAL A  1 27  ? 86.661  63.383  -46.475  1.00 37.85  ?  133 VAL A CG2   1 
ATOM   160   N  N     . ARG A  1 28  ? 90.252  61.456  -44.469  1.00 40.86  ?  134 ARG A N     1 
ATOM   161   C  CA    . ARG A  1 28  ? 91.610  61.305  -43.966  1.00 42.06  ?  134 ARG A CA    1 
ATOM   162   C  C     . ARG A  1 28  ? 92.221  59.960  -44.357  1.00 40.08  ?  134 ARG A C     1 
ATOM   163   O  O     . ARG A  1 28  ? 93.424  59.874  -44.593  1.00 39.91  ?  134 ARG A O     1 
ATOM   164   C  CB    . ARG A  1 28  ? 91.600  61.436  -42.450  1.00 45.01  ?  134 ARG A CB    1 
ATOM   165   C  CG    . ARG A  1 28  ? 92.940  61.832  -41.874  1.00 47.63  ?  134 ARG A CG    1 
ATOM   166   C  CD    . ARG A  1 28  ? 93.337  63.278  -42.197  1.00 49.98  ?  134 ARG A CD    1 
ATOM   167   N  NE    . ARG A  1 28  ? 93.853  63.932  -41.007  1.00 53.11  ?  134 ARG A NE    1 
ATOM   168   C  CZ    . ARG A  1 28  ? 94.991  63.616  -40.380  1.00 55.53  ?  134 ARG A CZ    1 
ATOM   169   N  NH1   . ARG A  1 28  ? 95.804  62.658  -40.834  1.00 56.56  ?  134 ARG A NH1   1 
ATOM   170   N  NH2   . ARG A  1 28  ? 95.339  64.284  -39.275  1.00 56.59  ?  134 ARG A NH2   1 
ATOM   171   N  N     . ILE A  1 29  ? 91.386  58.920  -44.394  1.00 37.54  ?  135 ILE A N     1 
ATOM   172   C  CA    . ILE A  1 29  ? 91.779  57.593  -44.889  1.00 35.92  ?  135 ILE A CA    1 
ATOM   173   C  C     . ILE A  1 29  ? 91.946  57.584  -46.412  1.00 35.61  ?  135 ILE A C     1 
ATOM   174   O  O     . ILE A  1 29  ? 92.884  56.988  -46.941  1.00 35.03  ?  135 ILE A O     1 
ATOM   175   C  CB    . ILE A  1 29  ? 90.765  56.508  -44.458  1.00 34.64  ?  135 ILE A CB    1 
ATOM   176   C  CG1   . ILE A  1 29  ? 90.864  56.278  -42.954  1.00 34.40  ?  135 ILE A CG1   1 
ATOM   177   C  CG2   . ILE A  1 29  ? 91.018  55.185  -45.177  1.00 34.34  ?  135 ILE A CG2   1 
ATOM   178   C  CD1   . ILE A  1 29  ? 89.693  55.537  -42.347  1.00 34.22  ?  135 ILE A CD1   1 
ATOM   179   N  N     . ILE A  1 30  ? 91.017  58.224  -47.108  1.00 36.16  ?  136 ILE A N     1 
ATOM   180   C  CA    . ILE A  1 30  ? 91.053  58.306  -48.568  1.00 37.05  ?  136 ILE A CA    1 
ATOM   181   C  C     . ILE A  1 30  ? 92.308  58.998  -49.089  1.00 38.07  ?  136 ILE A C     1 
ATOM   182   O  O     . ILE A  1 30  ? 92.911  58.537  -50.052  1.00 37.45  ?  136 ILE A O     1 
ATOM   183   C  CB    . ILE A  1 30  ? 89.804  59.034  -49.101  1.00 37.33  ?  136 ILE A CB    1 
ATOM   184   C  CG1   . ILE A  1 30  ? 88.589  58.116  -48.966  1.00 37.44  ?  136 ILE A CG1   1 
ATOM   185   C  CG2   . ILE A  1 30  ? 89.975  59.467  -50.557  1.00 37.15  ?  136 ILE A CG2   1 
ATOM   186   C  CD1   . ILE A  1 30  ? 87.264  58.852  -48.956  1.00 37.40  ?  136 ILE A CD1   1 
ATOM   187   N  N     . ASP A  1 31  ? 92.693  60.104  -48.464  1.00 40.26  ?  137 ASP A N     1 
ATOM   188   C  CA    . ASP A  1 31  ? 93.853  60.884  -48.916  1.00 41.97  ?  137 ASP A CA    1 
ATOM   189   C  C     . ASP A  1 31  ? 95.164  60.329  -48.358  1.00 43.22  ?  137 ASP A C     1 
ATOM   190   O  O     . ASP A  1 31  ? 95.874  60.993  -47.593  1.00 43.57  ?  137 ASP A O     1 
ATOM   191   C  CB    . ASP A  1 31  ? 93.673  62.364  -48.564  1.00 42.60  ?  137 ASP A CB    1 
ATOM   192   C  CG    . ASP A  1 31  ? 92.520  63.003  -49.314  1.00 42.23  ?  137 ASP A CG    1 
ATOM   193   O  OD1   . ASP A  1 31  ? 92.200  62.549  -50.431  1.00 42.00  ?  137 ASP A OD1   1 
ATOM   194   O  OD2   . ASP A  1 31  ? 91.921  63.970  -48.809  1.00 41.93  ?  137 ASP A OD2   1 
ATOM   195   N  N     . THR A  1 32  ? 95.467  59.098  -48.768  1.00 44.01  ?  138 THR A N     1 
ATOM   196   C  CA    . THR A  1 32  ? 96.703  58.401  -48.416  1.00 44.77  ?  138 THR A CA    1 
ATOM   197   C  C     . THR A  1 32  ? 97.211  57.671  -49.660  1.00 44.86  ?  138 THR A C     1 
ATOM   198   O  O     . THR A  1 32  ? 96.398  57.270  -50.493  1.00 45.56  ?  138 THR A O     1 
ATOM   199   C  CB    . THR A  1 32  ? 96.473  57.358  -47.309  1.00 44.62  ?  138 THR A CB    1 
ATOM   200   O  OG1   . THR A  1 32  ? 95.552  56.362  -47.770  1.00 43.06  ?  138 THR A OG1   1 
ATOM   201   C  CG2   . THR A  1 32  ? 95.926  58.012  -46.048  1.00 45.15  ?  138 THR A CG2   1 
ATOM   202   N  N     . PRO A  1 33  ? 98.543  57.477  -49.792  1.00 44.60  ?  139 PRO A N     1 
ATOM   203   C  CA    . PRO A  1 33  ? 99.048  56.737  -50.958  1.00 43.51  ?  139 PRO A CA    1 
ATOM   204   C  C     . PRO A  1 33  ? 98.500  55.313  -51.105  1.00 41.59  ?  139 PRO A C     1 
ATOM   205   O  O     . PRO A  1 33  ? 98.369  54.828  -52.228  1.00 41.65  ?  139 PRO A O     1 
ATOM   206   C  CB    . PRO A  1 33  ? 100.567 56.712  -50.725  1.00 44.92  ?  139 PRO A CB    1 
ATOM   207   C  CG    . PRO A  1 33  ? 100.840 57.928  -49.916  1.00 45.71  ?  139 PRO A CG    1 
ATOM   208   C  CD    . PRO A  1 33  ? 99.656  58.021  -48.984  1.00 45.58  ?  139 PRO A CD    1 
ATOM   209   N  N     . GLN A  1 34  ? 98.152  54.679  -49.989  1.00 40.27  ?  140 GLN A N     1 
ATOM   210   C  CA    . GLN A  1 34  ? 97.670  53.297  -49.983  1.00 40.14  ?  140 GLN A CA    1 
ATOM   211   C  C     . GLN A  1 34  ? 96.278  53.169  -50.638  1.00 38.96  ?  140 GLN A C     1 
ATOM   212   O  O     . GLN A  1 34  ? 95.988  52.173  -51.334  1.00 37.87  ?  140 GLN A O     1 
ATOM   213   C  CB    . GLN A  1 34  ? 97.645  52.758  -48.543  1.00 41.48  ?  140 GLN A CB    1 
ATOM   214   C  CG    . GLN A  1 34  ? 99.025  52.516  -47.932  1.00 42.75  ?  140 GLN A CG    1 
ATOM   215   C  CD    . GLN A  1 34  ? 99.785  53.789  -47.589  1.00 43.78  ?  140 GLN A CD    1 
ATOM   216   O  OE1   . GLN A  1 34  ? 99.195  54.846  -47.319  1.00 44.57  ?  140 GLN A OE1   1 
ATOM   217   N  NE2   . GLN A  1 34  ? 101.116 53.694  -47.619  1.00 44.90  ?  140 GLN A NE2   1 
ATOM   218   N  N     . PHE A  1 35  ? 95.441  54.188  -50.408  1.00 38.60  ?  141 PHE A N     1 
ATOM   219   C  CA    . PHE A  1 35  ? 94.091  54.259  -50.967  1.00 37.75  ?  141 PHE A CA    1 
ATOM   220   C  C     . PHE A  1 35  ? 94.061  54.874  -52.360  1.00 37.89  ?  141 PHE A C     1 
ATOM   221   O  O     . PHE A  1 35  ? 93.428  54.315  -53.253  1.00 37.59  ?  141 PHE A O     1 
ATOM   222   C  CB    . PHE A  1 35  ? 93.148  55.064  -50.063  1.00 37.01  ?  141 PHE A CB    1 
ATOM   223   C  CG    . PHE A  1 35  ? 91.695  54.891  -50.416  1.00 35.93  ?  141 PHE A CG    1 
ATOM   224   C  CD1   . PHE A  1 35  ? 91.096  55.672  -51.405  1.00 35.35  ?  141 PHE A CD1   1 
ATOM   225   C  CD2   . PHE A  1 35  ? 90.934  53.904  -49.799  1.00 35.33  ?  141 PHE A CD2   1 
ATOM   226   C  CE1   . PHE A  1 35  ? 89.763  55.487  -51.746  1.00 34.70  ?  141 PHE A CE1   1 
ATOM   227   C  CE2   . PHE A  1 35  ? 89.596  53.725  -50.140  1.00 34.71  ?  141 PHE A CE2   1 
ATOM   228   C  CZ    . PHE A  1 35  ? 89.011  54.520  -51.116  1.00 34.37  ?  141 PHE A CZ    1 
ATOM   229   N  N     . GLN A  1 36  ? 94.711  56.027  -52.543  1.00 38.89  ?  142 GLN A N     1 
ATOM   230   C  CA    . GLN A  1 36  ? 94.755  56.690  -53.867  1.00 39.54  ?  142 GLN A CA    1 
ATOM   231   C  C     . GLN A  1 36  ? 95.405  55.781  -54.920  1.00 39.82  ?  142 GLN A C     1 
ATOM   232   O  O     . GLN A  1 36  ? 95.143  55.938  -56.103  1.00 40.89  ?  142 GLN A O     1 
ATOM   233   C  CB    . GLN A  1 36  ? 95.501  58.037  -53.836  1.00 40.00  ?  142 GLN A CB    1 
ATOM   234   C  CG    . GLN A  1 36  ? 94.903  59.100  -52.913  1.00 39.82  ?  142 GLN A CG    1 
ATOM   235   C  CD    . GLN A  1 36  ? 94.002  60.112  -53.589  1.00 39.57  ?  142 GLN A CD    1 
ATOM   236   O  OE1   . GLN A  1 36  ? 94.264  60.578  -54.710  1.00 39.63  ?  142 GLN A OE1   1 
ATOM   237   N  NE2   . GLN A  1 36  ? 92.934  60.483  -52.892  1.00 39.04  ?  142 GLN A NE2   1 
ATOM   238   N  N     . ARG A  1 37  ? 96.258  54.853  -54.481  1.00 39.28  ?  143 ARG A N     1 
ATOM   239   C  CA    . ARG A  1 37  ? 96.726  53.716  -55.290  1.00 38.92  ?  143 ARG A CA    1 
ATOM   240   C  C     . ARG A  1 37  ? 95.640  53.059  -56.148  1.00 38.57  ?  143 ARG A C     1 
ATOM   241   O  O     . ARG A  1 37  ? 95.894  52.681  -57.292  1.00 38.94  ?  143 ARG A O     1 
ATOM   242   C  CB    . ARG A  1 37  ? 97.343  52.663  -54.373  1.00 38.96  ?  143 ARG A CB    1 
ATOM   243   C  CG    . ARG A  1 37  ? 97.437  51.268  -54.953  1.00 38.85  ?  143 ARG A CG    1 
ATOM   244   C  CD    . ARG A  1 37  ? 98.222  50.369  -54.041  1.00 39.33  ?  143 ARG A CD    1 
ATOM   245   N  NE    . ARG A  1 37  ? 98.385  49.058  -54.663  1.00 39.15  ?  143 ARG A NE    1 
ATOM   246   C  CZ    . ARG A  1 37  ? 97.489  48.070  -54.603  1.00 39.02  ?  143 ARG A CZ    1 
ATOM   247   N  NH1   . ARG A  1 37  ? 96.342  48.211  -53.929  1.00 39.37  ?  143 ARG A NH1   1 
ATOM   248   N  NH2   . ARG A  1 37  ? 97.753  46.917  -55.213  1.00 38.46  ?  143 ARG A NH2   1 
ATOM   249   N  N     . LEU A  1 38  ? 94.448  52.913  -55.589  1.00 38.88  ?  144 LEU A N     1 
ATOM   250   C  CA    . LEU A  1 38  ? 93.336  52.281  -56.302  1.00 39.89  ?  144 LEU A CA    1 
ATOM   251   C  C     . LEU A  1 38  ? 92.853  53.045  -57.534  1.00 40.18  ?  144 LEU A C     1 
ATOM   252   O  O     . LEU A  1 38  ? 92.149  52.472  -58.356  1.00 39.69  ?  144 LEU A O     1 
ATOM   253   C  CB    . LEU A  1 38  ? 92.147  52.036  -55.362  1.00 40.95  ?  144 LEU A CB    1 
ATOM   254   C  CG    . LEU A  1 38  ? 92.386  51.151  -54.126  1.00 41.89  ?  144 LEU A CG    1 
ATOM   255   C  CD1   . LEU A  1 38  ? 91.077  50.968  -53.364  1.00 42.27  ?  144 LEU A CD1   1 
ATOM   256   C  CD2   . LEU A  1 38  ? 92.994  49.791  -54.474  1.00 41.97  ?  144 LEU A CD2   1 
ATOM   257   N  N     . ARG A  1 39  ? 93.215  54.323  -57.661  1.00 42.05  ?  145 ARG A N     1 
ATOM   258   C  CA    . ARG A  1 39  ? 92.981  55.088  -58.905  1.00 43.70  ?  145 ARG A CA    1 
ATOM   259   C  C     . ARG A  1 39  ? 93.679  54.473  -60.120  1.00 43.72  ?  145 ARG A C     1 
ATOM   260   O  O     . ARG A  1 39  ? 93.257  54.683  -61.254  1.00 45.11  ?  145 ARG A O     1 
ATOM   261   C  CB    . ARG A  1 39  ? 93.452  56.551  -58.769  1.00 45.34  ?  145 ARG A CB    1 
ATOM   262   C  CG    . ARG A  1 39  ? 92.548  57.456  -57.941  1.00 45.99  ?  145 ARG A CG    1 
ATOM   263   C  CD    . ARG A  1 39  ? 93.122  58.862  -57.789  1.00 47.60  ?  145 ARG A CD    1 
ATOM   264   N  NE    . ARG A  1 39  ? 92.271  59.751  -56.990  1.00 49.31  ?  145 ARG A NE    1 
ATOM   265   C  CZ    . ARG A  1 39  ? 91.148  60.345  -57.415  1.00 51.54  ?  145 ARG A CZ    1 
ATOM   266   N  NH1   . ARG A  1 39  ? 90.681  60.162  -58.662  1.00 52.00  ?  145 ARG A NH1   1 
ATOM   267   N  NH2   . ARG A  1 39  ? 90.467  61.135  -56.578  1.00 52.55  ?  145 ARG A NH2   1 
ATOM   268   N  N     . TYR A  1 40  ? 94.742  53.710  -59.886  1.00 42.88  ?  146 TYR A N     1 
ATOM   269   C  CA    . TYR A  1 40  ? 95.572  53.214  -60.967  1.00 42.45  ?  146 TYR A CA    1 
ATOM   270   C  C     . TYR A  1 40  ? 95.441  51.693  -61.150  1.00 40.87  ?  146 TYR A C     1 
ATOM   271   O  O     . TYR A  1 40  ? 96.365  51.037  -61.621  1.00 40.46  ?  146 TYR A O     1 
ATOM   272   C  CB    . TYR A  1 40  ? 97.013  53.665  -60.699  1.00 44.34  ?  146 TYR A CB    1 
ATOM   273   C  CG    . TYR A  1 40  ? 97.089  55.094  -60.140  1.00 46.58  ?  146 TYR A CG    1 
ATOM   274   C  CD1   . TYR A  1 40  ? 96.823  56.211  -60.945  1.00 47.76  ?  146 TYR A CD1   1 
ATOM   275   C  CD2   . TYR A  1 40  ? 97.394  55.324  -58.803  1.00 48.82  ?  146 TYR A CD2   1 
ATOM   276   C  CE1   . TYR A  1 40  ? 96.881  57.509  -60.433  1.00 48.82  ?  146 TYR A CE1   1 
ATOM   277   C  CE2   . TYR A  1 40  ? 97.457  56.620  -58.276  1.00 50.66  ?  146 TYR A CE2   1 
ATOM   278   C  CZ    . TYR A  1 40  ? 97.201  57.720  -59.083  1.00 50.52  ?  146 TYR A CZ    1 
ATOM   279   O  OH    . TYR A  1 40  ? 97.274  58.986  -58.496  1.00 51.29  ?  146 TYR A OH    1 
ATOM   280   N  N     . ILE A  1 41  ? 94.274  51.145  -60.795  1.00 39.41  ?  147 ILE A N     1 
ATOM   281   C  CA    . ILE A  1 41  ? 93.958  49.722  -60.980  1.00 38.45  ?  147 ILE A CA    1 
ATOM   282   C  C     . ILE A  1 41  ? 92.530  49.618  -61.523  1.00 36.20  ?  147 ILE A C     1 
ATOM   283   O  O     . ILE A  1 41  ? 91.586  49.991  -60.826  1.00 35.54  ?  147 ILE A O     1 
ATOM   284   C  CB    . ILE A  1 41  ? 94.067  48.935  -59.646  1.00 39.69  ?  147 ILE A CB    1 
ATOM   285   C  CG1   . ILE A  1 41  ? 95.515  48.967  -59.116  1.00 41.12  ?  147 ILE A CG1   1 
ATOM   286   C  CG2   . ILE A  1 41  ? 93.606  47.483  -59.822  1.00 39.72  ?  147 ILE A CG2   1 
ATOM   287   C  CD1   . ILE A  1 41  ? 95.702  48.386  -57.720  1.00 41.81  ?  147 ILE A CD1   1 
ATOM   288   N  N     . LYS A  1 42  ? 92.370  49.100  -62.743  1.00 34.64  ?  148 LYS A N     1 
ATOM   289   C  CA    . LYS A  1 42  ? 91.045  49.008  -63.384  1.00 33.29  ?  148 LYS A CA    1 
ATOM   290   C  C     . LYS A  1 42  ? 90.179  47.928  -62.768  1.00 32.36  ?  148 LYS A C     1 
ATOM   291   O  O     . LYS A  1 42  ? 90.682  46.889  -62.350  1.00 31.26  ?  148 LYS A O     1 
ATOM   292   C  CB    . LYS A  1 42  ? 91.169  48.765  -64.881  1.00 32.97  ?  148 LYS A CB    1 
ATOM   293   C  CG    . LYS A  1 42  ? 91.793  49.950  -65.571  1.00 33.04  ?  148 LYS A CG    1 
ATOM   294   C  CD    . LYS A  1 42  ? 91.881  49.721  -67.068  1.00 33.59  ?  148 LYS A CD    1 
ATOM   295   C  CE    . LYS A  1 42  ? 93.066  50.461  -67.685  1.00 34.45  ?  148 LYS A CE    1 
ATOM   296   N  NZ    . LYS A  1 42  ? 94.359  49.750  -67.484  1.00 34.69  ?  148 LYS A NZ    1 
ATOM   297   N  N     . GLN A  1 43  ? 88.876  48.187  -62.714  1.00 32.05  ?  149 GLN A N     1 
ATOM   298   C  CA    . GLN A  1 43  ? 87.924  47.269  -62.091  1.00 31.84  ?  149 GLN A CA    1 
ATOM   299   C  C     . GLN A  1 43  ? 87.939  45.936  -62.812  1.00 31.24  ?  149 GLN A C     1 
ATOM   300   O  O     . GLN A  1 43  ? 88.090  44.873  -62.194  1.00 30.61  ?  149 GLN A O     1 
ATOM   301   C  CB    . GLN A  1 43  ? 86.502  47.859  -62.135  1.00 31.82  ?  149 GLN A CB    1 
ATOM   302   C  CG    . GLN A  1 43  ? 85.391  47.068  -61.419  1.00 31.58  ?  149 GLN A CG    1 
ATOM   303   C  CD    . GLN A  1 43  ? 85.440  47.239  -59.926  1.00 31.87  ?  149 GLN A CD    1 
ATOM   304   O  OE1   . GLN A  1 43  ? 86.510  47.495  -59.403  1.00 32.29  ?  149 GLN A OE1   1 
ATOM   305   N  NE2   . GLN A  1 43  ? 84.304  47.091  -59.243  1.00 31.83  ?  149 GLN A NE2   1 
ATOM   306   N  N     . LEU A  1 44  ? 87.813  46.018  -64.132  1.00 31.04  ?  150 LEU A N     1 
ATOM   307   C  CA    . LEU A  1 44  ? 87.599  44.845  -64.964  1.00 30.86  ?  150 LEU A CA    1 
ATOM   308   C  C     . LEU A  1 44  ? 88.838  44.385  -65.705  1.00 30.61  ?  150 LEU A C     1 
ATOM   309   O  O     . LEU A  1 44  ? 88.747  43.637  -66.685  1.00 30.45  ?  150 LEU A O     1 
ATOM   310   C  CB    . LEU A  1 44  ? 86.460  45.131  -65.930  1.00 30.86  ?  150 LEU A CB    1 
ATOM   311   C  CG    . LEU A  1 44  ? 85.169  45.556  -65.217  1.00 31.01  ?  150 LEU A CG    1 
ATOM   312   C  CD1   . LEU A  1 44  ? 84.047  45.702  -66.240  1.00 31.17  ?  150 LEU A CD1   1 
ATOM   313   C  CD2   . LEU A  1 44  ? 84.755  44.583  -64.112  1.00 30.92  ?  150 LEU A CD2   1 
ATOM   314   N  N     . GLY A  1 45  ? 89.998  44.797  -65.202  1.00 30.05  ?  151 GLY A N     1 
ATOM   315   C  CA    . GLY A  1 45  ? 91.264  44.336  -65.724  1.00 28.92  ?  151 GLY A CA    1 
ATOM   316   C  C     . GLY A  1 45  ? 91.303  44.462  -67.245  1.00 27.91  ?  151 GLY A C     1 
ATOM   317   O  O     . GLY A  1 45  ? 91.103  45.543  -67.820  1.00 27.08  ?  151 GLY A O     1 
ATOM   318   N  N     . GLY A  1 46  ? 91.517  43.316  -67.879  1.00 27.10  ?  152 GLY A N     1 
ATOM   319   C  CA    . GLY A  1 46  ? 91.609  43.212  -69.331  1.00 26.35  ?  152 GLY A CA    1 
ATOM   320   C  C     . GLY A  1 46  ? 90.298  43.398  -70.066  1.00 25.78  ?  152 GLY A C     1 
ATOM   321   O  O     . GLY A  1 46  ? 90.289  43.495  -71.295  1.00 25.37  ?  152 GLY A O     1 
ATOM   322   N  N     . GLY A  1 47  ? 89.182  43.439  -69.333  1.00 25.44  ?  153 GLY A N     1 
ATOM   323   C  CA    . GLY A  1 47  ? 87.881  43.774  -69.905  1.00 25.21  ?  153 GLY A CA    1 
ATOM   324   C  C     . GLY A  1 47  ? 87.809  45.094  -70.656  1.00 25.05  ?  153 GLY A C     1 
ATOM   325   O  O     . GLY A  1 47  ? 87.049  45.211  -71.617  1.00 24.53  ?  153 GLY A O     1 
ATOM   326   N  N     . TYR A  1 48  ? 88.596  46.084  -70.232  1.00 25.10  ?  154 TYR A N     1 
ATOM   327   C  CA    . TYR A  1 48  ? 88.696  47.361  -70.952  1.00 24.78  ?  154 TYR A CA    1 
ATOM   328   C  C     . TYR A  1 48  ? 89.084  47.182  -72.425  1.00 24.28  ?  154 TYR A C     1 
ATOM   329   O  O     . TYR A  1 48  ? 88.622  47.925  -73.294  1.00 24.26  ?  154 TYR A O     1 
ATOM   330   C  CB    . TYR A  1 48  ? 89.679  48.299  -70.234  1.00 24.98  ?  154 TYR A CB    1 
ATOM   331   C  CG    . TYR A  1 48  ? 89.869  49.679  -70.864  1.00 24.93  ?  154 TYR A CG    1 
ATOM   332   C  CD1   . TYR A  1 48  ? 88.787  50.436  -71.292  1.00 24.72  ?  154 TYR A CD1   1 
ATOM   333   C  CD2   . TYR A  1 48  ? 91.151  50.242  -70.993  1.00 25.03  ?  154 TYR A CD2   1 
ATOM   334   C  CE1   . TYR A  1 48  ? 88.968  51.706  -71.858  1.00 24.63  ?  154 TYR A CE1   1 
ATOM   335   C  CE2   . TYR A  1 48  ? 91.333  51.497  -71.589  1.00 24.89  ?  154 TYR A CE2   1 
ATOM   336   C  CZ    . TYR A  1 48  ? 90.238  52.230  -72.019  1.00 24.62  ?  154 TYR A CZ    1 
ATOM   337   O  OH    . TYR A  1 48  ? 90.401  53.489  -72.565  1.00 24.29  ?  154 TYR A OH    1 
ATOM   338   N  N     . TYR A  1 49  ? 89.902  46.173  -72.700  1.00 23.89  ?  155 TYR A N     1 
ATOM   339   C  CA    . TYR A  1 49  ? 90.324  45.867  -74.069  1.00 23.93  ?  155 TYR A CA    1 
ATOM   340   C  C     . TYR A  1 49  ? 89.234  45.164  -74.921  1.00 24.02  ?  155 TYR A C     1 
ATOM   341   O  O     . TYR A  1 49  ? 89.446  44.915  -76.099  1.00 23.93  ?  155 TYR A O     1 
ATOM   342   C  CB    . TYR A  1 49  ? 91.670  45.097  -74.023  1.00 23.79  ?  155 TYR A CB    1 
ATOM   343   C  CG    . TYR A  1 49  ? 92.823  45.916  -73.425  1.00 23.60  ?  155 TYR A CG    1 
ATOM   344   C  CD1   . TYR A  1 49  ? 93.076  45.921  -72.044  1.00 23.67  ?  155 TYR A CD1   1 
ATOM   345   C  CD2   . TYR A  1 49  ? 93.660  46.682  -74.246  1.00 23.38  ?  155 TYR A CD2   1 
ATOM   346   C  CE1   . TYR A  1 49  ? 94.123  46.693  -71.504  1.00 23.66  ?  155 TYR A CE1   1 
ATOM   347   C  CE2   . TYR A  1 49  ? 94.709  47.447  -73.708  1.00 23.48  ?  155 TYR A CE2   1 
ATOM   348   C  CZ    . TYR A  1 49  ? 94.930  47.449  -72.346  1.00 23.49  ?  155 TYR A CZ    1 
ATOM   349   O  OH    . TYR A  1 49  ? 95.934  48.210  -71.803  1.00 23.45  ?  155 TYR A OH    1 
ATOM   350   N  N     . VAL A  1 50  ? 88.085  44.857  -74.323  1.00 24.45  ?  156 VAL A N     1 
ATOM   351   C  CA    . VAL A  1 50  ? 86.887  44.376  -75.051  1.00 24.83  ?  156 VAL A CA    1 
ATOM   352   C  C     . VAL A  1 50  ? 85.701  45.346  -74.941  1.00 25.35  ?  156 VAL A C     1 
ATOM   353   O  O     . VAL A  1 50  ? 85.013  45.573  -75.926  1.00 25.07  ?  156 VAL A O     1 
ATOM   354   C  CB    . VAL A  1 50  ? 86.453  42.975  -74.543  1.00 24.70  ?  156 VAL A CB    1 
ATOM   355   C  CG1   . VAL A  1 50  ? 85.150  42.514  -75.191  1.00 24.36  ?  156 VAL A CG1   1 
ATOM   356   C  CG2   . VAL A  1 50  ? 87.552  41.955  -74.783  1.00 24.89  ?  156 VAL A CG2   1 
ATOM   357   N  N     . PHE A  1 51  ? 85.435  45.866  -73.741  1.00 26.43  ?  157 PHE A N     1 
ATOM   358   C  CA    . PHE A  1 51  ? 84.357  46.850  -73.524  1.00 27.50  ?  157 PHE A CA    1 
ATOM   359   C  C     . PHE A  1 51  ? 84.994  48.207  -73.338  1.00 28.54  ?  157 PHE A C     1 
ATOM   360   O  O     . PHE A  1 51  ? 85.477  48.506  -72.249  1.00 28.48  ?  157 PHE A O     1 
ATOM   361   C  CB    . PHE A  1 51  ? 83.570  46.514  -72.268  1.00 27.75  ?  157 PHE A CB    1 
ATOM   362   C  CG    . PHE A  1 51  ? 82.641  45.354  -72.426  1.00 27.72  ?  157 PHE A CG    1 
ATOM   363   C  CD1   . PHE A  1 51  ? 83.092  44.052  -72.212  1.00 27.61  ?  157 PHE A CD1   1 
ATOM   364   C  CD2   . PHE A  1 51  ? 81.310  45.553  -72.751  1.00 27.66  ?  157 PHE A CD2   1 
ATOM   365   C  CE1   . PHE A  1 51  ? 82.231  42.969  -72.332  1.00 27.55  ?  157 PHE A CE1   1 
ATOM   366   C  CE2   . PHE A  1 51  ? 80.438  44.483  -72.885  1.00 27.65  ?  157 PHE A CE2   1 
ATOM   367   C  CZ    . PHE A  1 51  ? 80.901  43.186  -72.681  1.00 27.69  ?  157 PHE A CZ    1 
ATOM   368   N  N     . PRO A  1 52  ? 84.997  49.044  -74.386  1.00 29.78  ?  158 PRO A N     1 
ATOM   369   C  CA    . PRO A  1 52  ? 85.755  50.287  -74.301  1.00 30.39  ?  158 PRO A CA    1 
ATOM   370   C  C     . PRO A  1 52  ? 85.193  51.308  -73.321  1.00 31.30  ?  158 PRO A C     1 
ATOM   371   O  O     . PRO A  1 52  ? 85.858  52.311  -73.073  1.00 32.93  ?  158 PRO A O     1 
ATOM   372   C  CB    . PRO A  1 52  ? 85.699  50.837  -75.723  1.00 30.24  ?  158 PRO A CB    1 
ATOM   373   C  CG    . PRO A  1 52  ? 84.436  50.295  -76.266  1.00 30.18  ?  158 PRO A CG    1 
ATOM   374   C  CD    . PRO A  1 52  ? 84.324  48.918  -75.686  1.00 30.03  ?  158 PRO A CD    1 
ATOM   375   N  N     . GLY A  1 53  ? 83.996  51.083  -72.781  1.00 31.19  ?  159 GLY A N     1 
ATOM   376   C  CA    . GLY A  1 53  ? 83.516  51.921  -71.686  1.00 31.21  ?  159 GLY A CA    1 
ATOM   377   C  C     . GLY A  1 53  ? 84.206  51.712  -70.342  1.00 31.13  ?  159 GLY A C     1 
ATOM   378   O  O     . GLY A  1 53  ? 84.308  52.674  -69.570  1.00 31.29  ?  159 GLY A O     1 
ATOM   379   N  N     . ALA A  1 54  ? 84.723  50.491  -70.108  1.00 31.20  ?  160 ALA A N     1 
ATOM   380   C  CA    . ALA A  1 54  ? 85.185  49.972  -68.782  1.00 31.89  ?  160 ALA A CA    1 
ATOM   381   C  C     . ALA A  1 54  ? 86.557  50.456  -68.253  1.00 32.26  ?  160 ALA A C     1 
ATOM   382   O  O     . ALA A  1 54  ? 87.363  49.687  -67.685  1.00 31.91  ?  160 ALA A O     1 
ATOM   383   C  CB    . ALA A  1 54  ? 85.146  48.446  -68.789  1.00 31.86  ?  160 ALA A CB    1 
ATOM   384   N  N     . SER A  1 55  ? 86.761  51.764  -68.409  1.00 32.43  ?  161 SER A N     1 
ATOM   385   C  CA    . SER A  1 55  ? 87.945  52.485  -67.954  1.00 32.03  ?  161 SER A CA    1 
ATOM   386   C  C     . SER A  1 55  ? 87.977  52.625  -66.431  1.00 31.22  ?  161 SER A C     1 
ATOM   387   O  O     . SER A  1 55  ? 89.045  52.853  -65.857  1.00 31.41  ?  161 SER A O     1 
ATOM   388   C  CB    . SER A  1 55  ? 87.951  53.890  -68.579  1.00 32.39  ?  161 SER A CB    1 
ATOM   389   O  OG    . SER A  1 55  ? 86.730  54.584  -68.330  1.00 32.45  ?  161 SER A OG    1 
ATOM   390   N  N     . HIS A  1 56  ? 86.806  52.522  -65.805  1.00 30.17  ?  162 HIS A N     1 
ATOM   391   C  CA    . HIS A  1 56  ? 86.659  52.666  -64.356  1.00 29.83  ?  162 HIS A CA    1 
ATOM   392   C  C     . HIS A  1 56  ? 87.596  51.799  -63.505  1.00 28.51  ?  162 HIS A C     1 
ATOM   393   O  O     . HIS A  1 56  ? 87.946  50.664  -63.873  1.00 28.21  ?  162 HIS A O     1 
ATOM   394   C  CB    . HIS A  1 56  ? 85.196  52.456  -63.927  1.00 30.44  ?  162 HIS A CB    1 
ATOM   395   C  CG    . HIS A  1 56  ? 84.701  51.053  -64.091  1.00 31.02  ?  162 HIS A CG    1 
ATOM   396   N  ND1   . HIS A  1 56  ? 84.785  50.363  -65.287  1.00 30.97  ?  162 HIS A ND1   1 
ATOM   397   C  CD2   . HIS A  1 56  ? 84.093  50.217  -63.211  1.00 31.26  ?  162 HIS A CD2   1 
ATOM   398   C  CE1   . HIS A  1 56  ? 84.264  49.157  -65.129  1.00 31.10  ?  162 HIS A CE1   1 
ATOM   399   N  NE2   . HIS A  1 56  ? 83.828  49.046  -63.880  1.00 31.28  ?  162 HIS A NE2   1 
ATOM   400   N  N     . ASN A  1 57  ? 87.965  52.376  -62.364  1.00 27.33  ?  163 ASN A N     1 
ATOM   401   C  CA    . ASN A  1 57  ? 88.991  51.896  -61.465  1.00 27.02  ?  163 ASN A CA    1 
ATOM   402   C  C     . ASN A  1 57  ? 88.407  51.551  -60.101  1.00 26.68  ?  163 ASN A C     1 
ATOM   403   O  O     . ASN A  1 57  ? 87.303  51.953  -59.766  1.00 26.83  ?  163 ASN A O     1 
ATOM   404   C  CB    . ASN A  1 57  ? 90.035  53.001  -61.277  1.00 27.19  ?  163 ASN A CB    1 
ATOM   405   C  CG    . ASN A  1 57  ? 90.691  53.416  -62.571  1.00 27.32  ?  163 ASN A CG    1 
ATOM   406   O  OD1   . ASN A  1 57  ? 91.301  52.594  -63.265  1.00 27.89  ?  163 ASN A OD1   1 
ATOM   407   N  ND2   . ASN A  1 57  ? 90.597  54.702  -62.894  1.00 27.22  ?  163 ASN A ND2   1 
ATOM   408   N  N     . ARG A  1 58  ? 89.184  50.830  -59.306  1.00 26.37  ?  164 ARG A N     1 
ATOM   409   C  CA    . ARG A  1 58  ? 88.757  50.436  -57.964  1.00 26.23  ?  164 ARG A CA    1 
ATOM   410   C  C     . ARG A  1 58  ? 88.424  51.617  -57.053  1.00 26.58  ?  164 ARG A C     1 
ATOM   411   O  O     . ARG A  1 58  ? 87.475  51.553  -56.270  1.00 27.01  ?  164 ARG A O     1 
ATOM   412   C  CB    . ARG A  1 58  ? 89.823  49.571  -57.302  1.00 26.17  ?  164 ARG A CB    1 
ATOM   413   C  CG    . ARG A  1 58  ? 89.922  48.186  -57.907  1.00 25.99  ?  164 ARG A CG    1 
ATOM   414   C  CD    . ARG A  1 58  ? 88.823  47.283  -57.370  1.00 26.17  ?  164 ARG A CD    1 
ATOM   415   N  NE    . ARG A  1 58  ? 88.565  46.165  -58.260  1.00 25.93  ?  164 ARG A NE    1 
ATOM   416   C  CZ    . ARG A  1 58  ? 87.604  45.248  -58.107  1.00 26.24  ?  164 ARG A CZ    1 
ATOM   417   N  NH1   . ARG A  1 58  ? 87.535  44.332  -59.025  1.00 25.90  ?  164 ARG A NH1   1 
ATOM   418   N  NH2   . ARG A  1 58  ? 86.708  45.237  -57.077  1.00 26.68  ?  164 ARG A NH2   1 
ATOM   419   N  N     . PHE A  1 59  ? 89.200  52.690  -57.169  1.00 26.63  ?  165 PHE A N     1 
ATOM   420   C  CA    . PHE A  1 59  ? 88.998  53.884  -56.359  1.00 26.73  ?  165 PHE A CA    1 
ATOM   421   C  C     . PHE A  1 59  ? 87.514  54.220  -56.180  1.00 27.05  ?  165 PHE A C     1 
ATOM   422   O  O     . PHE A  1 59  ? 87.000  54.226  -55.055  1.00 27.55  ?  165 PHE A O     1 
ATOM   423   C  CB    . PHE A  1 59  ? 89.720  55.067  -56.991  1.00 26.47  ?  165 PHE A CB    1 
ATOM   424   C  CG    . PHE A  1 59  ? 89.611  56.338  -56.200  1.00 26.26  ?  165 PHE A CG    1 
ATOM   425   C  CD1   . PHE A  1 59  ? 90.354  56.513  -55.037  1.00 26.30  ?  165 PHE A CD1   1 
ATOM   426   C  CD2   . PHE A  1 59  ? 88.778  57.367  -56.622  1.00 26.07  ?  165 PHE A CD2   1 
ATOM   427   C  CE1   . PHE A  1 59  ? 90.273  57.693  -54.311  1.00 26.43  ?  165 PHE A CE1   1 
ATOM   428   C  CE2   . PHE A  1 59  ? 88.686  58.545  -55.898  1.00 25.95  ?  165 PHE A CE2   1 
ATOM   429   C  CZ    . PHE A  1 59  ? 89.427  58.707  -54.745  1.00 26.18  ?  165 PHE A CZ    1 
ATOM   430   N  N     . GLU A  1 60  ? 86.834  54.460  -57.302  1.00 26.67  ?  166 GLU A N     1 
ATOM   431   C  CA    . GLU A  1 60  ? 85.428  54.889  -57.270  1.00 26.20  ?  166 GLU A CA    1 
ATOM   432   C  C     . GLU A  1 60  ? 84.467  53.779  -56.821  1.00 24.93  ?  166 GLU A C     1 
ATOM   433   O  O     . GLU A  1 60  ? 83.448  54.074  -56.193  1.00 24.63  ?  166 GLU A O     1 
ATOM   434   C  CB    . GLU A  1 60  ? 84.986  55.524  -58.597  1.00 26.96  ?  166 GLU A CB    1 
ATOM   435   C  CG    . GLU A  1 60  ? 85.176  54.689  -59.858  1.00 27.57  ?  166 GLU A CG    1 
ATOM   436   C  CD    . GLU A  1 60  ? 86.352  55.136  -60.713  1.00 28.24  ?  166 GLU A CD    1 
ATOM   437   O  OE1   . GLU A  1 60  ? 87.486  55.254  -60.137  1.00 28.77  ?  166 GLU A OE1   1 
ATOM   438   O  OE2   . GLU A  1 60  ? 86.123  55.340  -61.960  1.00 27.93  ?  166 GLU A OE2   1 
ATOM   439   N  N     . HIS A  1 61  ? 84.800  52.521  -57.132  1.00 23.73  ?  167 HIS A N     1 
ATOM   440   C  CA    . HIS A  1 61  ? 84.085  51.347  -56.589  1.00 23.13  ?  167 HIS A CA    1 
ATOM   441   C  C     . HIS A  1 61  ? 84.197  51.346  -55.062  1.00 23.03  ?  167 HIS A C     1 
ATOM   442   O  O     . HIS A  1 61  ? 83.183  51.282  -54.359  1.00 22.43  ?  167 HIS A O     1 
ATOM   443   C  CB    . HIS A  1 61  ? 84.622  50.028  -57.204  1.00 22.80  ?  167 HIS A CB    1 
ATOM   444   C  CG    . HIS A  1 61  ? 84.167  48.784  -56.500  1.00 22.85  ?  167 HIS A CG    1 
ATOM   445   N  ND1   . HIS A  1 61  ? 82.873  48.315  -56.566  1.00 22.58  ?  167 HIS A ND1   1 
ATOM   446   C  CD2   . HIS A  1 61  ? 84.844  47.901  -55.726  1.00 23.06  ?  167 HIS A CD2   1 
ATOM   447   C  CE1   . HIS A  1 61  ? 82.768  47.207  -55.851  1.00 22.64  ?  167 HIS A CE1   1 
ATOM   448   N  NE2   . HIS A  1 61  ? 83.951  46.935  -55.332  1.00 22.94  ?  167 HIS A NE2   1 
ATOM   449   N  N     . SER A  1 62  ? 85.429  51.455  -54.569  1.00 23.23  ?  168 SER A N     1 
ATOM   450   C  CA    . SER A  1 62  ? 85.681  51.504  -53.130  1.00 23.55  ?  168 SER A CA    1 
ATOM   451   C  C     . SER A  1 62  ? 84.852  52.617  -52.455  1.00 23.62  ?  168 SER A C     1 
ATOM   452   O  O     . SER A  1 62  ? 84.235  52.377  -51.418  1.00 23.73  ?  168 SER A O     1 
ATOM   453   C  CB    . SER A  1 62  ? 87.196  51.615  -52.818  1.00 23.77  ?  168 SER A CB    1 
ATOM   454   O  OG    . SER A  1 62  ? 87.815  50.336  -52.693  1.00 23.75  ?  168 SER A OG    1 
ATOM   455   N  N     . LEU A  1 63  ? 84.797  53.801  -53.062  1.00 23.55  ?  169 LEU A N     1 
ATOM   456   C  CA    . LEU A  1 63  ? 83.935  54.883  -52.555  1.00 23.58  ?  169 LEU A CA    1 
ATOM   457   C  C     . LEU A  1 63  ? 82.473  54.445  -52.446  1.00 23.43  ?  169 LEU A C     1 
ATOM   458   O  O     . LEU A  1 63  ? 81.832  54.629  -51.409  1.00 23.64  ?  169 LEU A O     1 
ATOM   459   C  CB    . LEU A  1 63  ? 83.982  56.107  -53.456  1.00 23.52  ?  169 LEU A CB    1 
ATOM   460   C  CG    . LEU A  1 63  ? 85.279  56.897  -53.510  1.00 23.74  ?  169 LEU A CG    1 
ATOM   461   C  CD1   . LEU A  1 63  ? 85.099  57.999  -54.557  1.00 23.90  ?  169 LEU A CD1   1 
ATOM   462   C  CD2   . LEU A  1 63  ? 85.703  57.458  -52.155  1.00 23.85  ?  169 LEU A CD2   1 
ATOM   463   N  N     . GLY A  1 64  ? 81.964  53.874  -53.531  1.00 22.89  ?  170 GLY A N     1 
ATOM   464   C  CA    . GLY A  1 64  ? 80.572  53.451  -53.595  1.00 22.39  ?  170 GLY A CA    1 
ATOM   465   C  C     . GLY A  1 64  ? 80.206  52.373  -52.594  1.00 22.07  ?  170 GLY A C     1 
ATOM   466   O  O     . GLY A  1 64  ? 79.124  52.400  -52.021  1.00 21.68  ?  170 GLY A O     1 
ATOM   467   N  N     . VAL A  1 65  ? 81.112  51.428  -52.372  1.00 21.95  ?  171 VAL A N     1 
ATOM   468   C  CA    . VAL A  1 65  ? 80.873  50.368  -51.401  1.00 21.91  ?  171 VAL A CA    1 
ATOM   469   C  C     . VAL A  1 65  ? 80.817  50.949  -49.992  1.00 22.12  ?  171 VAL A C     1 
ATOM   470   O  O     . VAL A  1 65  ? 79.954  50.573  -49.191  1.00 22.16  ?  171 VAL A O     1 
ATOM   471   C  CB    . VAL A  1 65  ? 81.930  49.256  -51.523  1.00 21.88  ?  171 VAL A CB    1 
ATOM   472   C  CG1   . VAL A  1 65  ? 81.794  48.226  -50.405  1.00 21.81  ?  171 VAL A CG1   1 
ATOM   473   C  CG2   . VAL A  1 65  ? 81.787  48.560  -52.878  1.00 21.82  ?  171 VAL A CG2   1 
ATOM   474   N  N     . GLY A  1 66  ? 81.727  51.875  -49.699  1.00 22.50  ?  172 GLY A N     1 
ATOM   475   C  CA    . GLY A  1 66  ? 81.688  52.623  -48.446  1.00 23.03  ?  172 GLY A CA    1 
ATOM   476   C  C     . GLY A  1 66  ? 80.353  53.329  -48.264  1.00 23.30  ?  172 GLY A C     1 
ATOM   477   O  O     . GLY A  1 66  ? 79.759  53.279  -47.190  1.00 23.04  ?  172 GLY A O     1 
ATOM   478   N  N     . TYR A  1 67  ? 79.884  53.975  -49.329  1.00 23.84  ?  173 TYR A N     1 
ATOM   479   C  CA    . TYR A  1 67  ? 78.625  54.719  -49.292  1.00 24.34  ?  173 TYR A CA    1 
ATOM   480   C  C     . TYR A  1 67  ? 77.431  53.826  -48.980  1.00 24.71  ?  173 TYR A C     1 
ATOM   481   O  O     . TYR A  1 67  ? 76.646  54.132  -48.086  1.00 25.19  ?  173 TYR A O     1 
ATOM   482   C  CB    . TYR A  1 67  ? 78.389  55.451  -50.611  1.00 24.25  ?  173 TYR A CB    1 
ATOM   483   C  CG    . TYR A  1 67  ? 76.997  56.015  -50.760  1.00 24.26  ?  173 TYR A CG    1 
ATOM   484   C  CD1   . TYR A  1 67  ? 76.577  57.098  -49.991  1.00 24.62  ?  173 TYR A CD1   1 
ATOM   485   C  CD2   . TYR A  1 67  ? 76.083  55.452  -51.665  1.00 24.07  ?  173 TYR A CD2   1 
ATOM   486   C  CE1   . TYR A  1 67  ? 75.293  57.611  -50.113  1.00 24.76  ?  173 TYR A CE1   1 
ATOM   487   C  CE2   . TYR A  1 67  ? 74.805  55.961  -51.801  1.00 24.34  ?  173 TYR A CE2   1 
ATOM   488   C  CZ    . TYR A  1 67  ? 74.414  57.037  -51.030  1.00 24.74  ?  173 TYR A CZ    1 
ATOM   489   O  OH    . TYR A  1 67  ? 73.136  57.540  -51.158  1.00 25.20  ?  173 TYR A OH    1 
ATOM   490   N  N     . LEU A  1 68  ? 77.310  52.734  -49.729  1.00 24.87  ?  174 LEU A N     1 
ATOM   491   C  CA    . LEU A  1 68  ? 76.192  51.802  -49.575  1.00 25.14  ?  174 LEU A CA    1 
ATOM   492   C  C     . LEU A  1 68  ? 76.220  51.073  -48.250  1.00 26.01  ?  174 LEU A C     1 
ATOM   493   O  O     . LEU A  1 68  ? 75.174  50.788  -47.667  1.00 25.95  ?  174 LEU A O     1 
ATOM   494   C  CB    . LEU A  1 68  ? 76.188  50.774  -50.704  1.00 24.74  ?  174 LEU A CB    1 
ATOM   495   C  CG    . LEU A  1 68  ? 75.956  51.310  -52.115  1.00 24.39  ?  174 LEU A CG    1 
ATOM   496   C  CD1   . LEU A  1 68  ? 75.937  50.156  -53.095  1.00 24.19  ?  174 LEU A CD1   1 
ATOM   497   C  CD2   . LEU A  1 68  ? 74.656  52.095  -52.206  1.00 24.46  ?  174 LEU A CD2   1 
ATOM   498   N  N     . ALA A  1 69  ? 77.416  50.760  -47.780  1.00 27.27  ?  175 ALA A N     1 
ATOM   499   C  CA    . ALA A  1 69  ? 77.569  50.240  -46.436  1.00 28.62  ?  175 ALA A CA    1 
ATOM   500   C  C     . ALA A  1 69  ? 76.897  51.198  -45.436  1.00 29.62  ?  175 ALA A C     1 
ATOM   501   O  O     . ALA A  1 69  ? 76.090  50.770  -44.605  1.00 29.07  ?  175 ALA A O     1 
ATOM   502   C  CB    . ALA A  1 69  ? 79.045  50.058  -46.118  1.00 28.87  ?  175 ALA A CB    1 
ATOM   503   N  N     . GLY A  1 70  ? 77.215  52.490  -45.563  1.00 30.83  ?  176 GLY A N     1 
ATOM   504   C  CA    . GLY A  1 70  ? 76.613  53.551  -44.756  1.00 31.39  ?  176 GLY A CA    1 
ATOM   505   C  C     . GLY A  1 70  ? 75.101  53.603  -44.878  1.00 31.87  ?  176 GLY A C     1 
ATOM   506   O  O     . GLY A  1 70  ? 74.398  53.738  -43.885  1.00 32.03  ?  176 GLY A O     1 
ATOM   507   N  N     . CYS A  1 71  ? 74.606  53.480  -46.104  1.00 32.43  ?  177 CYS A N     1 
ATOM   508   C  CA    . CYS A  1 71  ? 73.168  53.494  -46.359  1.00 33.05  ?  177 CYS A CA    1 
ATOM   509   C  C     . CYS A  1 71  ? 72.437  52.380  -45.633  1.00 33.57  ?  177 CYS A C     1 
ATOM   510   O  O     . CYS A  1 71  ? 71.437  52.624  -44.964  1.00 34.69  ?  177 CYS A O     1 
ATOM   511   C  CB    . CYS A  1 71  ? 72.880  53.367  -47.856  1.00 33.11  ?  177 CYS A CB    1 
ATOM   512   S  SG    . CYS A  1 71  ? 73.428  54.775  -48.848  1.00 33.49  ?  177 CYS A SG    1 
ATOM   513   N  N     . LEU A  1 72  ? 72.939  51.159  -45.774  1.00 33.53  ?  178 LEU A N     1 
ATOM   514   C  CA    . LEU A  1 72  ? 72.249  50.005  -45.234  1.00 33.98  ?  178 LEU A CA    1 
ATOM   515   C  C     . LEU A  1 72  ? 72.254  50.023  -43.712  1.00 35.46  ?  178 LEU A C     1 
ATOM   516   O  O     . LEU A  1 72  ? 71.208  49.873  -43.083  1.00 35.96  ?  178 LEU A O     1 
ATOM   517   C  CB    . LEU A  1 72  ? 72.874  48.717  -45.752  1.00 33.43  ?  178 LEU A CB    1 
ATOM   518   C  CG    . LEU A  1 72  ? 72.324  47.401  -45.190  1.00 33.28  ?  178 LEU A CG    1 
ATOM   519   C  CD1   . LEU A  1 72  ? 70.820  47.293  -45.287  1.00 32.96  ?  178 LEU A CD1   1 
ATOM   520   C  CD2   . LEU A  1 72  ? 72.975  46.249  -45.923  1.00 33.46  ?  178 LEU A CD2   1 
ATOM   521   N  N     . VAL A  1 73  ? 73.429  50.214  -43.124  1.00 36.57  ?  179 VAL A N     1 
ATOM   522   C  CA    . VAL A  1 73  ? 73.543  50.231  -41.668  1.00 38.02  ?  179 VAL A CA    1 
ATOM   523   C  C     . VAL A  1 73  ? 72.730  51.380  -41.048  1.00 39.39  ?  179 VAL A C     1 
ATOM   524   O  O     . VAL A  1 73  ? 72.046  51.184  -40.040  1.00 39.16  ?  179 VAL A O     1 
ATOM   525   C  CB    . VAL A  1 73  ? 75.024  50.248  -41.205  1.00 38.09  ?  179 VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1 73  ? 75.697  51.590  -41.455  1.00 38.29  ?  179 VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1 73  ? 75.135  49.869  -39.738  1.00 38.06  ?  179 VAL A CG2   1 
ATOM   528   N  N     . HIS A  1 74  ? 72.788  52.558  -41.676  1.00 40.90  ?  180 HIS A N     1 
ATOM   529   C  CA    . HIS A  1 74  ? 72.064  53.739  -41.207  1.00 42.50  ?  180 HIS A CA    1 
ATOM   530   C  C     . HIS A  1 74  ? 70.545  53.509  -41.337  1.00 41.38  ?  180 HIS A C     1 
ATOM   531   O  O     . HIS A  1 74  ? 69.776  53.917  -40.471  1.00 41.67  ?  180 HIS A O     1 
ATOM   532   C  CB    . HIS A  1 74  ? 72.544  54.986  -41.967  1.00 44.84  ?  180 HIS A CB    1 
ATOM   533   C  CG    . HIS A  1 74  ? 72.009  56.274  -41.436  1.00 48.92  ?  180 HIS A CG    1 
ATOM   534   N  ND1   . HIS A  1 74  ? 70.782  56.784  -41.816  1.00 52.23  ?  180 HIS A ND1   1 
ATOM   535   C  CD2   . HIS A  1 74  ? 72.540  57.169  -40.574  1.00 51.25  ?  180 HIS A CD2   1 
ATOM   536   C  CE1   . HIS A  1 74  ? 70.569  57.929  -41.196  1.00 52.92  ?  180 HIS A CE1   1 
ATOM   537   N  NE2   . HIS A  1 74  ? 71.621  58.188  -40.434  1.00 53.30  ?  180 HIS A NE2   1 
ATOM   538   N  N     . ALA A  1 75  ? 70.130  52.812  -42.391  1.00 40.62  ?  181 ALA A N     1 
ATOM   539   C  CA    . ALA A  1 75  ? 68.720  52.490  -42.604  1.00 40.95  ?  181 ALA A CA    1 
ATOM   540   C  C     . ALA A  1 75  ? 68.174  51.509  -41.572  1.00 41.23  ?  181 ALA A C     1 
ATOM   541   O  O     . ALA A  1 75  ? 67.052  51.669  -41.093  1.00 42.51  ?  181 ALA A O     1 
ATOM   542   C  CB    . ALA A  1 75  ? 68.517  51.933  -44.004  1.00 41.04  ?  181 ALA A CB    1 
ATOM   543   N  N     . LEU A  1 76  ? 68.956  50.488  -41.244  1.00 40.99  ?  182 LEU A N     1 
ATOM   544   C  CA    . LEU A  1 76  ? 68.549  49.522  -40.230  1.00 41.53  ?  182 LEU A CA    1 
ATOM   545   C  C     . LEU A  1 76  ? 68.358  50.215  -38.898  1.00 42.33  ?  182 LEU A C     1 
ATOM   546   O  O     . LEU A  1 76  ? 67.391  49.935  -38.201  1.00 41.17  ?  182 LEU A O     1 
ATOM   547   C  CB    . LEU A  1 76  ? 69.576  48.411  -40.095  1.00 41.02  ?  182 LEU A CB    1 
ATOM   548   C  CG    . LEU A  1 76  ? 69.639  47.491  -41.316  1.00 40.11  ?  182 LEU A CG    1 
ATOM   549   C  CD1   . LEU A  1 76  ? 70.898  46.630  -41.300  1.00 39.65  ?  182 LEU A CD1   1 
ATOM   550   C  CD2   . LEU A  1 76  ? 68.384  46.621  -41.405  1.00 40.31  ?  182 LEU A CD2   1 
ATOM   551   N  N     . GLY A  1 77  ? 69.273  51.132  -38.579  1.00 44.53  ?  183 GLY A N     1 
ATOM   552   C  CA    . GLY A  1 77  ? 69.223  51.935  -37.356  1.00 46.57  ?  183 GLY A CA    1 
ATOM   553   C  C     . GLY A  1 77  ? 67.993  52.810  -37.212  1.00 48.61  ?  183 GLY A C     1 
ATOM   554   O  O     . GLY A  1 77  ? 67.419  52.901  -36.122  1.00 48.94  ?  183 GLY A O     1 
ATOM   555   N  N     . GLU A  1 78  ? 67.588  53.451  -38.307  1.00 52.07  ?  184 GLU A N     1 
ATOM   556   C  CA    . GLU A  1 78  ? 66.362  54.262  -38.333  1.00 55.67  ?  184 GLU A CA    1 
ATOM   557   C  C     . GLU A  1 78  ? 65.149  53.352  -38.146  1.00 53.73  ?  184 GLU A C     1 
ATOM   558   O  O     . GLU A  1 78  ? 64.297  53.625  -37.303  1.00 54.84  ?  184 GLU A O     1 
ATOM   559   C  CB    . GLU A  1 78  ? 66.198  55.030  -39.656  1.00 60.89  ?  184 GLU A CB    1 
ATOM   560   C  CG    . GLU A  1 78  ? 67.317  56.001  -40.035  1.00 65.18  ?  184 GLU A CG    1 
ATOM   561   C  CD    . GLU A  1 78  ? 67.305  57.295  -39.239  1.00 69.53  ?  184 GLU A CD    1 
ATOM   562   O  OE1   . GLU A  1 78  ? 66.556  58.202  -39.639  1.00 73.00  ?  184 GLU A OE1   1 
ATOM   563   O  OE2   . GLU A  1 78  ? 68.086  57.406  -38.259  1.00 71.91  ?  184 GLU A OE2   1 
ATOM   564   N  N     . LYS A  1 79  ? 65.093  52.278  -38.935  1.00 51.13  ?  185 LYS A N     1 
ATOM   565   C  CA    . LYS A  1 79  ? 63.997  51.302  -38.889  1.00 49.73  ?  185 LYS A CA    1 
ATOM   566   C  C     . LYS A  1 79  ? 63.875  50.603  -37.524  1.00 48.97  ?  185 LYS A C     1 
ATOM   567   O  O     . LYS A  1 79  ? 62.764  50.345  -37.062  1.00 49.35  ?  185 LYS A O     1 
ATOM   568   C  CB    . LYS A  1 79  ? 64.134  50.257  -40.021  1.00 48.78  ?  185 LYS A CB    1 
ATOM   569   N  N     . GLN A  1 80  ? 65.003  50.325  -36.870  1.00 47.27  ?  186 GLN A N     1 
ATOM   570   C  CA    . GLN A  1 80  ? 65.015  49.544  -35.613  1.00 46.31  ?  186 GLN A CA    1 
ATOM   571   C  C     . GLN A  1 80  ? 65.979  50.135  -34.564  1.00 47.44  ?  186 GLN A C     1 
ATOM   572   O  O     . GLN A  1 80  ? 67.135  49.703  -34.460  1.00 47.43  ?  186 GLN A O     1 
ATOM   573   C  CB    . GLN A  1 80  ? 65.381  48.091  -35.911  1.00 45.04  ?  186 GLN A CB    1 
ATOM   574   C  CG    . GLN A  1 80  ? 64.452  47.403  -36.889  1.00 44.09  ?  186 GLN A CG    1 
ATOM   575   C  CD    . GLN A  1 80  ? 64.802  45.934  -37.077  1.00 43.44  ?  186 GLN A CD    1 
ATOM   576   O  OE1   . GLN A  1 80  ? 65.497  45.569  -38.005  1.00 42.78  ?  186 GLN A OE1   1 
ATOM   577   N  NE2   . GLN A  1 80  ? 64.324  45.095  -36.184  1.00 43.28  ?  186 GLN A NE2   1 
ATOM   578   N  N     . PRO A  1 81  ? 65.506  51.123  -33.781  1.00 48.89  ?  187 PRO A N     1 
ATOM   579   C  CA    . PRO A  1 81  ? 66.336  51.695  -32.713  1.00 48.70  ?  187 PRO A CA    1 
ATOM   580   C  C     . PRO A  1 81  ? 66.772  50.680  -31.659  1.00 47.52  ?  187 PRO A C     1 
ATOM   581   O  O     . PRO A  1 81  ? 67.867  50.803  -31.121  1.00 47.98  ?  187 PRO A O     1 
ATOM   582   C  CB    . PRO A  1 81  ? 65.417  52.758  -32.081  1.00 49.34  ?  187 PRO A CB    1 
ATOM   583   C  CG    . PRO A  1 81  ? 64.462  53.113  -33.159  1.00 49.86  ?  187 PRO A CG    1 
ATOM   584   C  CD    . PRO A  1 81  ? 64.217  51.824  -33.892  1.00 49.67  ?  187 PRO A CD    1 
ATOM   585   N  N     . GLU A  1 82  ? 65.925  49.684  -31.399  1.00 46.00  ?  188 GLU A N     1 
ATOM   586   C  CA    . GLU A  1 82  ? 66.239  48.579  -30.479  1.00 45.11  ?  188 GLU A CA    1 
ATOM   587   C  C     . GLU A  1 82  ? 67.614  47.930  -30.678  1.00 44.24  ?  188 GLU A C     1 
ATOM   588   O  O     . GLU A  1 82  ? 68.172  47.372  -29.742  1.00 43.90  ?  188 GLU A O     1 
ATOM   589   C  CB    . GLU A  1 82  ? 65.153  47.486  -30.533  1.00 44.92  ?  188 GLU A CB    1 
ATOM   590   C  CG    . GLU A  1 82  ? 64.994  46.753  -31.863  1.00 44.25  ?  188 GLU A CG    1 
ATOM   591   C  CD    . GLU A  1 82  ? 63.867  47.314  -32.736  1.00 44.41  ?  188 GLU A CD    1 
ATOM   592   O  OE1   . GLU A  1 82  ? 63.603  48.539  -32.706  1.00 45.28  ?  188 GLU A OE1   1 
ATOM   593   O  OE2   . GLU A  1 82  ? 63.251  46.523  -33.483  1.00 43.85  ?  188 GLU A OE2   1 
ATOM   594   N  N     . LEU A  1 83  ? 68.152  48.002  -31.899  1.00 43.72  ?  189 LEU A N     1 
ATOM   595   C  CA    . LEU A  1 83  ? 69.456  47.419  -32.219  1.00 43.06  ?  189 LEU A CA    1 
ATOM   596   C  C     . LEU A  1 83  ? 70.638  48.194  -31.603  1.00 42.98  ?  189 LEU A C     1 
ATOM   597   O  O     . LEU A  1 83  ? 71.733  47.627  -31.430  1.00 41.57  ?  189 LEU A O     1 
ATOM   598   C  CB    . LEU A  1 83  ? 69.635  47.351  -33.728  1.00 42.39  ?  189 LEU A CB    1 
ATOM   599   C  CG    . LEU A  1 83  ? 68.580  46.531  -34.488  1.00 42.12  ?  189 LEU A CG    1 
ATOM   600   C  CD1   . LEU A  1 83  ? 68.767  46.686  -35.993  1.00 42.14  ?  189 LEU A CD1   1 
ATOM   601   C  CD2   . LEU A  1 83  ? 68.601  45.062  -34.102  1.00 42.25  ?  189 LEU A CD2   1 
ATOM   602   N  N     . GLN A  1 84  ? 70.409  49.474  -31.291  1.00 43.79  ?  190 GLN A N     1 
ATOM   603   C  CA    . GLN A  1 84  ? 71.415  50.367  -30.736  1.00 44.78  ?  190 GLN A CA    1 
ATOM   604   C  C     . GLN A  1 84  ? 72.685  50.342  -31.553  1.00 44.93  ?  190 GLN A C     1 
ATOM   605   O  O     . GLN A  1 84  ? 73.750  49.915  -31.114  1.00 45.72  ?  190 GLN A O     1 
ATOM   606   C  CB    . GLN A  1 84  ? 71.652  50.056  -29.258  1.00 45.95  ?  190 GLN A CB    1 
ATOM   607   C  CG    . GLN A  1 84  ? 70.467  50.474  -28.407  1.00 46.60  ?  190 GLN A CG    1 
ATOM   608   C  CD    . GLN A  1 84  ? 70.268  49.700  -27.152  1.00 47.96  ?  190 GLN A CD    1 
ATOM   609   O  OE1   . GLN A  1 84  ? 71.234  49.258  -26.538  1.00 49.72  ?  190 GLN A OE1   1 
ATOM   610   N  NE2   . GLN A  1 84  ? 69.021  49.571  -26.737  1.00 49.17  ?  190 GLN A NE2   1 
ATOM   611   N  N     . ILE A  1 85  ? 72.507  50.780  -32.789  1.00 44.81  ?  191 ILE A N     1 
ATOM   612   C  CA    . ILE A  1 85  ? 73.582  50.956  -33.725  1.00 44.62  ?  191 ILE A CA    1 
ATOM   613   C  C     . ILE A  1 85  ? 74.116  52.357  -33.469  1.00 46.76  ?  191 ILE A C     1 
ATOM   614   O  O     . ILE A  1 85  ? 73.399  53.332  -33.669  1.00 48.00  ?  191 ILE A O     1 
ATOM   615   C  CB    . ILE A  1 85  ? 73.056  50.803  -35.166  1.00 42.89  ?  191 ILE A CB    1 
ATOM   616   C  CG1   . ILE A  1 85  ? 72.500  49.381  -35.374  1.00 41.91  ?  191 ILE A CG1   1 
ATOM   617   C  CG2   . ILE A  1 85  ? 74.168  51.077  -36.173  1.00 43.17  ?  191 ILE A CG2   1 
ATOM   618   C  CD1   . ILE A  1 85  ? 71.703  49.214  -36.655  1.00 41.41  ?  191 ILE A CD1   1 
ATOM   619   N  N     . SER A  1 86  ? 75.360  52.452  -33.001  1.00 48.77  ?  192 SER A N     1 
ATOM   620   C  CA    . SER A  1 86  ? 76.008  53.744  -32.706  1.00 50.64  ?  192 SER A CA    1 
ATOM   621   C  C     . SER A  1 86  ? 76.628  54.343  -33.964  1.00 52.83  ?  192 SER A C     1 
ATOM   622   O  O     . SER A  1 86  ? 76.970  53.612  -34.888  1.00 51.79  ?  192 SER A O     1 
ATOM   623   C  CB    . SER A  1 86  ? 77.094  53.577  -31.643  1.00 50.92  ?  192 SER A CB    1 
ATOM   624   O  OG    . SER A  1 86  ? 78.079  52.643  -32.057  1.00 51.55  ?  192 SER A OG    1 
ATOM   625   N  N     . GLU A  1 87  ? 76.820  55.660  -33.979  1.00 56.36  ?  193 GLU A N     1 
ATOM   626   C  CA    . GLU A  1 87  ? 77.542  56.304  -35.091  1.00 58.93  ?  193 GLU A CA    1 
ATOM   627   C  C     . GLU A  1 87  ? 78.990  55.836  -35.142  1.00 57.42  ?  193 GLU A C     1 
ATOM   628   O  O     . GLU A  1 87  ? 79.671  56.046  -36.137  1.00 54.72  ?  193 GLU A O     1 
ATOM   629   C  CB    . GLU A  1 87  ? 77.555  57.824  -34.991  1.00 64.33  ?  193 GLU A CB    1 
ATOM   630   C  CG    . GLU A  1 87  ? 76.258  58.546  -34.765  1.00 70.42  ?  193 GLU A CG    1 
ATOM   631   C  CD    . GLU A  1 87  ? 76.443  59.746  -33.807  1.00 77.90  ?  193 GLU A CD    1 
ATOM   632   O  OE1   . GLU A  1 87  ? 77.435  60.495  -34.030  1.00 83.98  ?  193 GLU A OE1   1 
ATOM   633   O  OE2   . GLU A  1 87  ? 75.638  59.948  -32.842  1.00 84.13  ?  193 GLU A OE2   1 
ATOM   634   N  N     . ARG A  1 88  ? 79.467  55.236  -34.050  1.00 57.51  ?  194 ARG A N     1 
ATOM   635   C  CA    . ARG A  1 88  ? 80.725  54.512  -34.047  1.00 56.23  ?  194 ARG A CA    1 
ATOM   636   C  C     . ARG A  1 88  ? 80.635  53.259  -34.921  1.00 53.82  ?  194 ARG A C     1 
ATOM   637   O  O     . ARG A  1 88  ? 81.520  53.019  -35.737  1.00 54.58  ?  194 ARG A O     1 
ATOM   638   C  CB    . ARG A  1 88  ? 81.116  54.139  -32.619  1.00 57.93  ?  194 ARG A CB    1 
ATOM   639   C  CG    . ARG A  1 88  ? 82.550  53.638  -32.471  1.00 58.84  ?  194 ARG A CG    1 
ATOM   640   C  CD    . ARG A  1 88  ? 82.791  53.181  -31.044  1.00 59.92  ?  194 ARG A CD    1 
ATOM   641   N  NE    . ARG A  1 88  ? 83.450  51.891  -30.973  1.00 59.67  ?  194 ARG A NE    1 
ATOM   642   C  CZ    . ARG A  1 88  ? 83.563  51.155  -29.867  1.00 60.88  ?  194 ARG A CZ    1 
ATOM   643   N  NH1   . ARG A  1 88  ? 83.057  51.545  -28.712  1.00 62.74  ?  194 ARG A NH1   1 
ATOM   644   N  NH2   . ARG A  1 88  ? 84.168  49.984  -29.932  1.00 60.28  ?  194 ARG A NH2   1 
ATOM   645   N  N     . ASP A  1 89  ? 79.577  52.471  -34.745  1.00 51.08  ?  195 ASP A N     1 
ATOM   646   C  CA    . ASP A  1 89  ? 79.345  51.295  -35.598  1.00 48.73  ?  195 ASP A CA    1 
ATOM   647   C  C     . ASP A  1 89  ? 79.241  51.691  -37.061  1.00 45.85  ?  195 ASP A C     1 
ATOM   648   O  O     . ASP A  1 89  ? 79.868  51.074  -37.909  1.00 44.98  ?  195 ASP A O     1 
ATOM   649   C  CB    . ASP A  1 89  ? 78.071  50.530  -35.198  1.00 50.25  ?  195 ASP A CB    1 
ATOM   650   C  CG    . ASP A  1 89  ? 78.175  49.862  -33.846  1.00 53.25  ?  195 ASP A CG    1 
ATOM   651   O  OD1   . ASP A  1 89  ? 79.257  49.346  -33.504  1.00 57.01  ?  195 ASP A OD1   1 
ATOM   652   O  OD2   . ASP A  1 89  ? 77.163  49.838  -33.117  1.00 53.97  ?  195 ASP A OD2   1 
ATOM   653   N  N     . VAL A  1 90  ? 78.459  52.735  -37.339  1.00 42.86  ?  196 VAL A N     1 
ATOM   654   C  CA    . VAL A  1 90  ? 78.244  53.231  -38.715  1.00 39.60  ?  196 VAL A CA    1 
ATOM   655   C  C     . VAL A  1 90  ? 79.576  53.560  -39.371  1.00 37.89  ?  196 VAL A C     1 
ATOM   656   O  O     . VAL A  1 90  ? 79.863  53.097  -40.464  1.00 38.19  ?  196 VAL A O     1 
ATOM   657   C  CB    . VAL A  1 90  ? 77.325  54.489  -38.743  1.00 38.96  ?  196 VAL A CB    1 
ATOM   658   C  CG1   . VAL A  1 90  ? 77.291  55.162  -40.114  1.00 38.24  ?  196 VAL A CG1   1 
ATOM   659   C  CG2   . VAL A  1 90  ? 75.904  54.138  -38.317  1.00 38.75  ?  196 VAL A CG2   1 
ATOM   660   N  N     . LEU A  1 91  ? 80.380  54.367  -38.695  1.00 36.33  ?  197 LEU A N     1 
ATOM   661   C  CA    . LEU A  1 91  ? 81.685  54.745  -39.225  1.00 35.15  ?  197 LEU A CA    1 
ATOM   662   C  C     . LEU A  1 91  ? 82.552  53.545  -39.514  1.00 34.11  ?  197 LEU A C     1 
ATOM   663   O  O     . LEU A  1 91  ? 83.193  53.493  -40.550  1.00 32.97  ?  197 LEU A O     1 
ATOM   664   C  CB    . LEU A  1 91  ? 82.430  55.690  -38.285  1.00 35.71  ?  197 LEU A CB    1 
ATOM   665   C  CG    . LEU A  1 91  ? 82.294  57.172  -38.613  1.00 36.30  ?  197 LEU A CG    1 
ATOM   666   C  CD1   . LEU A  1 91  ? 83.001  57.985  -37.535  1.00 37.53  ?  197 LEU A CD1   1 
ATOM   667   C  CD2   . LEU A  1 91  ? 82.875  57.510  -39.972  1.00 36.02  ?  197 LEU A CD2   1 
ATOM   668   N  N     . CYS A  1 92  ? 82.566  52.587  -38.595  1.00 34.01  ?  198 CYS A N     1 
ATOM   669   C  CA    . CYS A  1 92  ? 83.366  51.371  -38.765  1.00 34.15  ?  198 CYS A CA    1 
ATOM   670   C  C     . CYS A  1 92  ? 82.950  50.553  -39.990  1.00 33.60  ?  198 CYS A C     1 
ATOM   671   O  O     . CYS A  1 92  ? 83.790  50.011  -40.706  1.00 33.34  ?  198 CYS A O     1 
ATOM   672   C  CB    . CYS A  1 92  ? 83.292  50.500  -37.515  1.00 34.48  ?  198 CYS A CB    1 
ATOM   673   S  SG    . CYS A  1 92  ? 84.140  51.181  -36.073  1.00 35.33  ?  198 CYS A SG    1 
ATOM   674   N  N     . VAL A  1 93  ? 81.646  50.479  -40.223  1.00 33.66  ?  199 VAL A N     1 
ATOM   675   C  CA    . VAL A  1 93  ? 81.105  49.776  -41.382  1.00 33.21  ?  199 VAL A CA    1 
ATOM   676   C  C     . VAL A  1 93  ? 81.466  50.514  -42.672  1.00 32.36  ?  199 VAL A C     1 
ATOM   677   O  O     . VAL A  1 93  ? 81.887  49.890  -43.644  1.00 32.26  ?  199 VAL A O     1 
ATOM   678   C  CB    . VAL A  1 93  ? 79.578  49.606  -41.252  1.00 34.03  ?  199 VAL A CB    1 
ATOM   679   C  CG1   . VAL A  1 93  ? 78.966  49.048  -42.529  1.00 33.79  ?  199 VAL A CG1   1 
ATOM   680   C  CG2   . VAL A  1 93  ? 79.243  48.685  -40.080  1.00 34.76  ?  199 VAL A CG2   1 
ATOM   681   N  N     . GLN A  1 94  ? 81.294  51.832  -42.680  1.00 32.02  ?  200 GLN A N     1 
ATOM   682   C  CA    . GLN A  1 94  ? 81.709  52.666  -43.813  1.00 31.72  ?  200 GLN A CA    1 
ATOM   683   C  C     . GLN A  1 94  ? 83.189  52.462  -44.131  1.00 31.13  ?  200 GLN A C     1 
ATOM   684   O  O     . GLN A  1 94  ? 83.545  52.231  -45.281  1.00 30.18  ?  200 GLN A O     1 
ATOM   685   C  CB    . GLN A  1 94  ? 81.444  54.153  -43.537  1.00 32.15  ?  200 GLN A CB    1 
ATOM   686   C  CG    . GLN A  1 94  ? 79.979  54.563  -43.637  1.00 32.13  ?  200 GLN A CG    1 
ATOM   687   C  CD    . GLN A  1 94  ? 79.771  56.030  -43.274  1.00 32.60  ?  200 GLN A CD    1 
ATOM   688   O  OE1   . GLN A  1 94  ? 79.930  56.432  -42.119  1.00 33.10  ?  200 GLN A OE1   1 
ATOM   689   N  NE2   . GLN A  1 94  ? 79.402  56.837  -44.259  1.00 33.18  ?  200 GLN A NE2   1 
ATOM   690   N  N     . ILE A  1 95  ? 84.040  52.534  -43.102  1.00 31.01  ?  201 ILE A N     1 
ATOM   691   C  CA    . ILE A  1 95  ? 85.488  52.361  -43.271  1.00 31.30  ?  201 ILE A CA    1 
ATOM   692   C  C     . ILE A  1 95  ? 85.803  50.993  -43.881  1.00 31.69  ?  201 ILE A C     1 
ATOM   693   O  O     . ILE A  1 95  ? 86.660  50.888  -44.758  1.00 32.43  ?  201 ILE A O     1 
ATOM   694   C  CB    . ILE A  1 95  ? 86.271  52.550  -41.945  1.00 31.56  ?  201 ILE A CB    1 
ATOM   695   C  CG1   . ILE A  1 95  ? 86.241  54.009  -41.494  1.00 31.82  ?  201 ILE A CG1   1 
ATOM   696   C  CG2   . ILE A  1 95  ? 87.746  52.135  -42.097  1.00 31.90  ?  201 ILE A CG2   1 
ATOM   697   C  CD1   . ILE A  1 95  ? 86.648  54.248  -40.051  1.00 32.31  ?  201 ILE A CD1   1 
ATOM   698   N  N     . ALA A  1 96  ? 85.114  49.958  -43.415  1.00 31.72  ?  202 ALA A N     1 
ATOM   699   C  CA    . ALA A  1 96  ? 85.312  48.612  -43.946  1.00 31.60  ?  202 ALA A CA    1 
ATOM   700   C  C     . ALA A  1 96  ? 84.977  48.568  -45.426  1.00 31.36  ?  202 ALA A C     1 
ATOM   701   O  O     . ALA A  1 96  ? 85.785  48.125  -46.244  1.00 30.97  ?  202 ALA A O     1 
ATOM   702   C  CB    . ALA A  1 96  ? 84.468  47.608  -43.188  1.00 31.68  ?  202 ALA A CB    1 
ATOM   703   N  N     . GLY A  1 97  ? 83.786  49.055  -45.756  1.00 31.38  ?  203 GLY A N     1 
ATOM   704   C  CA    . GLY A  1 97  ? 83.343  49.148  -47.143  1.00 31.35  ?  203 GLY A CA    1 
ATOM   705   C  C     . GLY A  1 97  ? 84.308  49.917  -48.018  1.00 31.35  ?  203 GLY A C     1 
ATOM   706   O  O     . GLY A  1 97  ? 84.655  49.482  -49.114  1.00 31.02  ?  203 GLY A O     1 
ATOM   707   N  N     . LEU A  1 98  ? 84.759  51.054  -47.507  1.00 31.82  ?  204 LEU A N     1 
ATOM   708   C  CA    . LEU A  1 98  ? 85.705  51.909  -48.213  1.00 32.26  ?  204 LEU A CA    1 
ATOM   709   C  C     . LEU A  1 98  ? 87.017  51.173  -48.544  1.00 33.04  ?  204 LEU A C     1 
ATOM   710   O  O     . LEU A  1 98  ? 87.509  51.202  -49.676  1.00 32.87  ?  204 LEU A O     1 
ATOM   711   C  CB    . LEU A  1 98  ? 85.966  53.142  -47.355  1.00 32.50  ?  204 LEU A CB    1 
ATOM   712   C  CG    . LEU A  1 98  ? 86.652  54.346  -47.978  1.00 32.43  ?  204 LEU A CG    1 
ATOM   713   C  CD1   . LEU A  1 98  ? 85.899  54.860  -49.185  1.00 31.99  ?  204 LEU A CD1   1 
ATOM   714   C  CD2   . LEU A  1 98  ? 86.764  55.435  -46.902  1.00 32.99  ?  204 LEU A CD2   1 
ATOM   715   N  N     . CYS A  1 99  ? 87.536  50.466  -47.551  1.00 34.31  ?  205 CYS A N     1 
ATOM   716   C  CA    . CYS A  1 99  ? 88.831  49.797  -47.656  1.00 35.79  ?  205 CYS A CA    1 
ATOM   717   C  C     . CYS A  1 99  ? 88.770  48.336  -48.087  1.00 36.51  ?  205 CYS A C     1 
ATOM   718   O  O     . CYS A  1 99  ? 89.790  47.658  -48.079  1.00 36.71  ?  205 CYS A O     1 
ATOM   719   C  CB    . CYS A  1 99  ? 89.523  49.875  -46.297  1.00 36.27  ?  205 CYS A CB    1 
ATOM   720   S  SG    . CYS A  1 99  ? 89.899  51.570  -45.823  1.00 36.86  ?  205 CYS A SG    1 
ATOM   721   N  N     . HIS A  1 100 ? 87.593  47.845  -48.465  1.00 36.61  ?  206 HIS A N     1 
ATOM   722   C  CA    . HIS A  1 100 ? 87.401  46.397  -48.603  1.00 36.33  ?  206 HIS A CA    1 
ATOM   723   C  C     . HIS A  1 100 ? 88.218  45.776  -49.748  1.00 35.80  ?  206 HIS A C     1 
ATOM   724   O  O     . HIS A  1 100 ? 88.590  44.604  -49.664  1.00 34.79  ?  206 HIS A O     1 
ATOM   725   C  CB    . HIS A  1 100 ? 85.930  46.063  -48.800  1.00 36.31  ?  206 HIS A CB    1 
ATOM   726   C  CG    . HIS A  1 100 ? 85.466  46.210  -50.211  1.00 36.84  ?  206 HIS A CG    1 
ATOM   727   N  ND1   . HIS A  1 100 ? 85.469  47.424  -50.861  1.00 37.37  ?  206 HIS A ND1   1 
ATOM   728   C  CD2   . HIS A  1 100 ? 85.020  45.296  -51.110  1.00 36.87  ?  206 HIS A CD2   1 
ATOM   729   C  CE1   . HIS A  1 100 ? 85.026  47.258  -52.098  1.00 37.27  ?  206 HIS A CE1   1 
ATOM   730   N  NE2   . HIS A  1 100 ? 84.745  45.979  -52.271  1.00 36.81  ?  206 HIS A NE2   1 
ATOM   731   N  N     . ASP A  1 101 ? 88.470  46.559  -50.803  1.00 35.70  ?  207 ASP A N     1 
ATOM   732   C  CA    . ASP A  1 101 ? 89.274  46.109  -51.940  1.00 35.92  ?  207 ASP A CA    1 
ATOM   733   C  C     . ASP A  1 101 ? 90.565  46.897  -52.052  1.00 37.40  ?  207 ASP A C     1 
ATOM   734   O  O     . ASP A  1 101 ? 91.073  47.096  -53.153  1.00 37.47  ?  207 ASP A O     1 
ATOM   735   C  CB    . ASP A  1 101 ? 88.479  46.207  -53.259  1.00 34.62  ?  207 ASP A CB    1 
ATOM   736   C  CG    . ASP A  1 101 ? 87.442  45.115  -53.418  1.00 33.58  ?  207 ASP A CG    1 
ATOM   737   O  OD1   . ASP A  1 101 ? 87.493  44.076  -52.731  1.00 33.00  ?  207 ASP A OD1   1 
ATOM   738   O  OD2   . ASP A  1 101 ? 86.556  45.307  -54.255  1.00 32.41  ?  207 ASP A OD2   1 
ATOM   739   N  N     . LEU A  1 102 ? 91.126  47.280  -50.907  1.00 38.95  ?  208 LEU A N     1 
ATOM   740   C  CA    . LEU A  1 102 ? 92.449  47.919  -50.865  1.00 40.19  ?  208 LEU A CA    1 
ATOM   741   C  C     . LEU A  1 102 ? 93.597  47.049  -51.393  1.00 39.59  ?  208 LEU A C     1 
ATOM   742   O  O     . LEU A  1 102 ? 94.618  47.584  -51.846  1.00 39.29  ?  208 LEU A O     1 
ATOM   743   C  CB    . LEU A  1 102 ? 92.815  48.351  -49.438  1.00 41.61  ?  208 LEU A CB    1 
ATOM   744   C  CG    . LEU A  1 102 ? 92.572  49.805  -49.046  1.00 42.17  ?  208 LEU A CG    1 
ATOM   745   C  CD1   . LEU A  1 102 ? 92.882  50.000  -47.571  1.00 42.31  ?  208 LEU A CD1   1 
ATOM   746   C  CD2   . LEU A  1 102 ? 93.425  50.746  -49.888  1.00 42.95  ?  208 LEU A CD2   1 
ATOM   747   N  N     . GLY A  1 103 ? 93.417  45.732  -51.307  1.00 39.31  ?  209 GLY A N     1 
ATOM   748   C  CA    . GLY A  1 103 ? 94.447  44.773  -51.644  1.00 40.06  ?  209 GLY A CA    1 
ATOM   749   C  C     . GLY A  1 103 ? 94.393  44.106  -53.009  1.00 40.13  ?  209 GLY A C     1 
ATOM   750   O  O     . GLY A  1 103 ? 95.066  43.092  -53.209  1.00 40.66  ?  209 GLY A O     1 
ATOM   751   N  N     . HIS A  1 104 ? 93.628  44.638  -53.953  1.00 39.97  ?  210 HIS A N     1 
ATOM   752   C  CA    . HIS A  1 104 ? 93.686  44.087  -55.315  1.00 39.73  ?  210 HIS A CA    1 
ATOM   753   C  C     . HIS A  1 104 ? 94.996  44.407  -55.961  1.00 39.60  ?  210 HIS A C     1 
ATOM   754   O  O     . HIS A  1 104 ? 95.557  45.480  -55.733  1.00 38.54  ?  210 HIS A O     1 
ATOM   755   C  CB    . HIS A  1 104 ? 92.588  44.613  -56.227  1.00 39.88  ?  210 HIS A CB    1 
ATOM   756   C  CG    . HIS A  1 104 ? 91.391  43.733  -56.267  1.00 40.27  ?  210 HIS A CG    1 
ATOM   757   N  ND1   . HIS A  1 104 ? 91.467  42.371  -56.454  1.00 40.78  ?  210 HIS A ND1   1 
ATOM   758   C  CD2   . HIS A  1 104 ? 90.081  44.026  -56.177  1.00 40.04  ?  210 HIS A CD2   1 
ATOM   759   C  CE1   . HIS A  1 104 ? 90.245  41.866  -56.438  1.00 40.51  ?  210 HIS A CE1   1 
ATOM   760   N  NE2   . HIS A  1 104 ? 89.390  42.847  -56.221  1.00 39.82  ?  210 HIS A NE2   1 
ATOM   761   N  N     . GLY A  1 105 ? 95.467  43.476  -56.779  1.00 40.80  ?  211 GLY A N     1 
ATOM   762   C  CA    . GLY A  1 105 ? 96.676  43.700  -57.559  1.00 42.51  ?  211 GLY A CA    1 
ATOM   763   C  C     . GLY A  1 105 ? 96.418  44.399  -58.883  1.00 43.13  ?  211 GLY A C     1 
ATOM   764   O  O     . GLY A  1 105 ? 95.284  44.795  -59.169  1.00 43.04  ?  211 GLY A O     1 
ATOM   765   N  N     . PRO A  1 106 ? 97.483  44.574  -59.695  1.00 44.09  ?  212 PRO A N     1 
ATOM   766   C  CA    . PRO A  1 106 ? 97.354  45.039  -61.071  1.00 44.25  ?  212 PRO A CA    1 
ATOM   767   C  C     . PRO A  1 106 ? 96.335  44.213  -61.840  1.00 43.12  ?  212 PRO A C     1 
ATOM   768   O  O     . PRO A  1 106 ? 96.357  42.988  -61.775  1.00 41.90  ?  212 PRO A O     1 
ATOM   769   C  CB    . PRO A  1 106 ? 98.757  44.830  -61.643  1.00 44.79  ?  212 PRO A CB    1 
ATOM   770   C  CG    . PRO A  1 106 ? 99.657  44.999  -60.477  1.00 44.64  ?  212 PRO A CG    1 
ATOM   771   C  CD    . PRO A  1 106 ? 98.896  44.518  -59.273  1.00 44.49  ?  212 PRO A CD    1 
ATOM   772   N  N     . PHE A  1 107 ? 95.435  44.904  -62.529  1.00 42.43  ?  213 PHE A N     1 
ATOM   773   C  CA    . PHE A  1 107 ? 94.330  44.280  -63.266  1.00 42.02  ?  213 PHE A CA    1 
ATOM   774   C  C     . PHE A  1 107 ? 93.410  43.412  -62.379  1.00 41.16  ?  213 PHE A C     1 
ATOM   775   O  O     . PHE A  1 107 ? 92.881  42.377  -62.802  1.00 41.55  ?  213 PHE A O     1 
ATOM   776   C  CB    . PHE A  1 107 ? 94.864  43.560  -64.509  1.00 42.55  ?  213 PHE A CB    1 
ATOM   777   C  CG    . PHE A  1 107 ? 95.541  44.489  -65.488  1.00 44.21  ?  213 PHE A CG    1 
ATOM   778   C  CD1   . PHE A  1 107 ? 94.794  45.238  -66.398  1.00 45.26  ?  213 PHE A CD1   1 
ATOM   779   C  CD2   . PHE A  1 107 ? 96.916  44.652  -65.477  1.00 45.46  ?  213 PHE A CD2   1 
ATOM   780   C  CE1   . PHE A  1 107 ? 95.399  46.098  -67.298  1.00 45.93  ?  213 PHE A CE1   1 
ATOM   781   C  CE2   . PHE A  1 107 ? 97.531  45.512  -66.368  1.00 46.20  ?  213 PHE A CE2   1 
ATOM   782   C  CZ    . PHE A  1 107 ? 96.773  46.240  -67.286  1.00 46.17  ?  213 PHE A CZ    1 
ATOM   783   N  N     . SER A  1 108 ? 93.207  43.891  -61.149  1.00 39.89  ?  214 SER A N     1 
ATOM   784   C  CA    . SER A  1 108 ? 92.219  43.361  -60.211  1.00 39.75  ?  214 SER A CA    1 
ATOM   785   C  C     . SER A  1 108 ? 92.286  41.851  -60.023  1.00 38.48  ?  214 SER A C     1 
ATOM   786   O  O     . SER A  1 108 ? 93.180  41.358  -59.320  1.00 38.19  ?  214 SER A O     1 
ATOM   787   C  CB    . SER A  1 108 ? 90.804  43.833  -60.606  1.00 40.57  ?  214 SER A CB    1 
ATOM   788   O  OG    . SER A  1 108 ? 90.587  45.178  -60.221  1.00 42.44  ?  214 SER A OG    1 
ATOM   789   N  N     . HIS A  1 109 ? 91.364  41.125  -60.665  1.00 37.14  ?  215 HIS A N     1 
ATOM   790   C  CA    . HIS A  1 109 ? 91.163  39.709  -60.372  1.00 36.39  ?  215 HIS A CA    1 
ATOM   791   C  C     . HIS A  1 109 ? 92.124  38.833  -61.170  1.00 35.96  ?  215 HIS A C     1 
ATOM   792   O  O     . HIS A  1 109 ? 92.404  37.699  -60.783  1.00 35.31  ?  215 HIS A O     1 
ATOM   793   C  CB    . HIS A  1 109 ? 89.690  39.298  -60.573  1.00 35.63  ?  215 HIS A CB    1 
ATOM   794   C  CG    . HIS A  1 109 ? 88.865  39.360  -59.320  1.00 34.90  ?  215 HIS A CG    1 
ATOM   795   N  ND1   . HIS A  1 109 ? 88.979  38.436  -58.299  1.00 34.66  ?  215 HIS A ND1   1 
ATOM   796   C  CD2   . HIS A  1 109 ? 87.922  40.238  -58.920  1.00 34.35  ?  215 HIS A CD2   1 
ATOM   797   C  CE1   . HIS A  1 109 ? 88.139  38.746  -57.324  1.00 34.48  ?  215 HIS A CE1   1 
ATOM   798   N  NE2   . HIS A  1 109 ? 87.484  39.836  -57.677  1.00 34.38  ?  215 HIS A NE2   1 
ATOM   799   N  N     . MET A  1 110 ? 92.638  39.364  -62.275  1.00 36.12  ?  216 MET A N     1 
ATOM   800   C  CA    . MET A  1 110 ? 93.767  38.753  -62.972  1.00 36.45  ?  216 MET A CA    1 
ATOM   801   C  C     . MET A  1 110 ? 94.913  38.438  -62.008  1.00 37.31  ?  216 MET A C     1 
ATOM   802   O  O     . MET A  1 110 ? 95.513  37.374  -62.102  1.00 38.05  ?  216 MET A O     1 
ATOM   803   C  CB    . MET A  1 110 ? 94.269  39.685  -64.075  1.00 36.32  ?  216 MET A CB    1 
ATOM   804   C  CG    . MET A  1 110 ? 95.284  39.050  -65.007  1.00 36.52  ?  216 MET A CG    1 
ATOM   805   S  SD    . MET A  1 110 ? 96.417  40.256  -65.733  1.00 36.42  ?  216 MET A SD    1 
ATOM   806   C  CE    . MET A  1 110 ? 97.534  40.519  -64.350  1.00 37.56  ?  216 MET A CE    1 
ATOM   807   N  N     . PHE A  1 111 ? 95.202  39.350  -61.082  1.00 37.55  ?  217 PHE A N     1 
ATOM   808   C  CA    . PHE A  1 111 ? 96.352  39.202  -60.178  1.00 37.66  ?  217 PHE A CA    1 
ATOM   809   C  C     . PHE A  1 111 ? 96.193  38.062  -59.176  1.00 37.86  ?  217 PHE A C     1 
ATOM   810   O  O     . PHE A  1 111 ? 97.004  37.139  -59.158  1.00 37.37  ?  217 PHE A O     1 
ATOM   811   C  CB    . PHE A  1 111 ? 96.628  40.507  -59.431  1.00 37.96  ?  217 PHE A CB    1 
ATOM   812   C  CG    . PHE A  1 111 ? 98.031  40.616  -58.927  1.00 38.27  ?  217 PHE A CG    1 
ATOM   813   C  CD1   . PHE A  1 111 ? 99.078  40.851  -59.807  1.00 38.29  ?  217 PHE A CD1   1 
ATOM   814   C  CD2   . PHE A  1 111 ? 98.310  40.492  -57.564  1.00 38.99  ?  217 PHE A CD2   1 
ATOM   815   C  CE1   . PHE A  1 111 ? 100.382 40.959  -59.349  1.00 39.03  ?  217 PHE A CE1   1 
ATOM   816   C  CE2   . PHE A  1 111 ? 99.613  40.604  -57.101  1.00 39.38  ?  217 PHE A CE2   1 
ATOM   817   C  CZ    . PHE A  1 111 ? 100.649 40.835  -57.995  1.00 39.39  ?  217 PHE A CZ    1 
ATOM   818   N  N     . ASP A  1 112 ? 95.151  38.134  -58.349  1.00 38.10  ?  218 ASP A N     1 
ATOM   819   C  CA    . ASP A  1 112 ? 94.904  37.111  -57.328  1.00 37.78  ?  218 ASP A CA    1 
ATOM   820   C  C     . ASP A  1 112 ? 94.340  35.803  -57.924  1.00 37.99  ?  218 ASP A C     1 
ATOM   821   O  O     . ASP A  1 112 ? 94.464  34.743  -57.307  1.00 38.03  ?  218 ASP A O     1 
ATOM   822   C  CB    . ASP A  1 112 ? 94.042  37.677  -56.159  1.00 37.04  ?  218 ASP A CB    1 
ATOM   823   C  CG    . ASP A  1 112 ? 92.548  37.721  -56.447  1.00 36.12  ?  218 ASP A CG    1 
ATOM   824   O  OD1   . ASP A  1 112 ? 92.161  37.796  -57.626  1.00 35.67  ?  218 ASP A OD1   1 
ATOM   825   O  OD2   . ASP A  1 112 ? 91.746  37.695  -55.480  1.00 35.67  ?  218 ASP A OD2   1 
ATOM   826   N  N     . GLY A  1 113 ? 93.761  35.887  -59.126  1.00 38.05  ?  219 GLY A N     1 
ATOM   827   C  CA    . GLY A  1 113 ? 93.092  34.758  -59.776  1.00 38.59  ?  219 GLY A CA    1 
ATOM   828   C  C     . GLY A  1 113 ? 93.885  33.958  -60.792  1.00 38.95  ?  219 GLY A C     1 
ATOM   829   O  O     . GLY A  1 113 ? 93.629  32.767  -60.963  1.00 39.42  ?  219 GLY A O     1 
ATOM   830   N  N     . ARG A  1 114 ? 94.822  34.601  -61.491  1.00 39.23  ?  220 ARG A N     1 
ATOM   831   C  CA    . ARG A  1 114 ? 95.666  33.929  -62.510  1.00 39.80  ?  220 ARG A CA    1 
ATOM   832   C  C     . ARG A  1 114 ? 97.152  33.975  -62.163  1.00 41.19  ?  220 ARG A C     1 
ATOM   833   O  O     . ARG A  1 114 ? 97.796  32.937  -62.084  1.00 42.44  ?  220 ARG A O     1 
ATOM   834   C  CB    . ARG A  1 114 ? 95.466  34.543  -63.890  1.00 39.57  ?  220 ARG A CB    1 
ATOM   835   C  CG    . ARG A  1 114 ? 94.064  34.386  -64.455  1.00 39.65  ?  220 ARG A CG    1 
ATOM   836   C  CD    . ARG A  1 114 ? 93.928  35.114  -65.803  1.00 39.54  ?  220 ARG A CD    1 
ATOM   837   N  NE    . ARG A  1 114 ? 92.627  34.922  -66.421  1.00 38.80  ?  220 ARG A NE    1 
ATOM   838   C  CZ    . ARG A  1 114 ? 92.206  33.815  -67.026  1.00 38.27  ?  220 ARG A CZ    1 
ATOM   839   N  NH1   . ARG A  1 114 ? 92.974  32.727  -67.109  1.00 38.47  ?  220 ARG A NH1   1 
ATOM   840   N  NH2   . ARG A  1 114 ? 90.980  33.778  -67.551  1.00 37.94  ?  220 ARG A NH2   1 
ATOM   841   N  N     . PHE A  1 115 ? 97.684  35.183  -61.978  1.00 42.07  ?  221 PHE A N     1 
ATOM   842   C  CA    . PHE A  1 115 ? 99.131  35.408  -61.843  1.00 42.53  ?  221 PHE A CA    1 
ATOM   843   C  C     . PHE A  1 115 ? 99.774  34.790  -60.600  1.00 43.00  ?  221 PHE A C     1 
ATOM   844   O  O     . PHE A  1 115 ? 100.685 33.975  -60.722  1.00 43.10  ?  221 PHE A O     1 
ATOM   845   C  CB    . PHE A  1 115 ? 99.439  36.907  -61.889  1.00 42.46  ?  221 PHE A CB    1 
ATOM   846   C  CG    . PHE A  1 115 ? 100.894 37.235  -61.694  1.00 42.92  ?  221 PHE A CG    1 
ATOM   847   C  CD1   . PHE A  1 115 ? 101.834 36.871  -62.639  1.00 42.76  ?  221 PHE A CD1   1 
ATOM   848   C  CD2   . PHE A  1 115 ? 101.324 37.907  -60.551  1.00 43.72  ?  221 PHE A CD2   1 
ATOM   849   C  CE1   . PHE A  1 115 ? 103.176 37.162  -62.461  1.00 43.57  ?  221 PHE A CE1   1 
ATOM   850   C  CE2   . PHE A  1 115 ? 102.666 38.207  -60.367  1.00 43.87  ?  221 PHE A CE2   1 
ATOM   851   C  CZ    . PHE A  1 115 ? 103.596 37.838  -61.324  1.00 43.98  ?  221 PHE A CZ    1 
ATOM   852   N  N     . ILE A  1 116 ? 99.318  35.188  -59.417  1.00 43.30  ?  222 ILE A N     1 
ATOM   853   C  CA    . ILE A  1 116 ? 99.904  34.696  -58.158  1.00 44.42  ?  222 ILE A CA    1 
ATOM   854   C  C     . ILE A  1 116 ? 99.836  33.168  -58.030  1.00 45.88  ?  222 ILE A C     1 
ATOM   855   O  O     . ILE A  1 116 ? 100.824 32.557  -57.626  1.00 46.54  ?  222 ILE A O     1 
ATOM   856   C  CB    . ILE A  1 116 ? 99.293  35.414  -56.913  1.00 44.27  ?  222 ILE A CB    1 
ATOM   857   C  CG1   . ILE A  1 116 ? 99.748  36.882  -56.862  1.00 44.40  ?  222 ILE A CG1   1 
ATOM   858   C  CG2   . ILE A  1 116 ? 99.622  34.700  -55.599  1.00 44.15  ?  222 ILE A CG2   1 
ATOM   859   C  CD1   . ILE A  1 116 ? 101.237 37.114  -56.708  1.00 44.81  ?  222 ILE A CD1   1 
ATOM   860   N  N     . PRO A  1 117 ? 98.681  32.549  -58.365  1.00 47.54  ?  223 PRO A N     1 
ATOM   861   C  CA    . PRO A  1 117 ? 98.631  31.081  -58.431  1.00 47.75  ?  223 PRO A CA    1 
ATOM   862   C  C     . PRO A  1 117 ? 99.673  30.405  -59.329  1.00 46.87  ?  223 PRO A C     1 
ATOM   863   O  O     . PRO A  1 117 ? 100.132 29.308  -59.005  1.00 47.61  ?  223 PRO A O     1 
ATOM   864   C  CB    . PRO A  1 117 ? 97.218  30.814  -58.956  1.00 48.09  ?  223 PRO A CB    1 
ATOM   865   C  CG    . PRO A  1 117 ? 96.417  31.920  -58.358  1.00 48.30  ?  223 PRO A CG    1 
ATOM   866   C  CD    . PRO A  1 117 ? 97.319  33.124  -58.356  1.00 48.02  ?  223 PRO A CD    1 
ATOM   867   N  N     . LEU A  1 118 ? 100.038 31.045  -60.439  1.00 45.64  ?  224 LEU A N     1 
ATOM   868   C  CA    . LEU A  1 118 ? 101.067 30.507  -61.343  1.00 44.81  ?  224 LEU A CA    1 
ATOM   869   C  C     . LEU A  1 118 ? 102.476 30.851  -60.868  1.00 45.22  ?  224 LEU A C     1 
ATOM   870   O  O     . LEU A  1 118 ? 103.337 29.982  -60.813  1.00 44.26  ?  224 LEU A O     1 
ATOM   871   C  CB    . LEU A  1 118 ? 100.846 31.000  -62.775  1.00 43.41  ?  224 LEU A CB    1 
ATOM   872   C  CG    . LEU A  1 118 ? 99.528  30.567  -63.426  1.00 42.47  ?  224 LEU A CG    1 
ATOM   873   C  CD1   . LEU A  1 118 ? 99.330  31.257  -64.766  1.00 42.16  ?  224 LEU A CD1   1 
ATOM   874   C  CD2   . LEU A  1 118 ? 99.416  29.056  -63.579  1.00 42.46  ?  224 LEU A CD2   1 
ATOM   875   N  N     . ALA A  1 119 ? 102.698 32.113  -60.520  1.00 46.60  ?  225 ALA A N     1 
ATOM   876   C  CA    . ALA A  1 119 ? 104.018 32.577  -60.090  1.00 48.84  ?  225 ALA A CA    1 
ATOM   877   C  C     . ALA A  1 119 ? 104.488 31.944  -58.778  1.00 51.35  ?  225 ALA A C     1 
ATOM   878   O  O     . ALA A  1 119 ? 105.662 31.623  -58.640  1.00 51.80  ?  225 ALA A O     1 
ATOM   879   C  CB    . ALA A  1 119 ? 104.032 34.091  -59.967  1.00 48.75  ?  225 ALA A CB    1 
ATOM   880   N  N     . ARG A  1 120 ? 103.576 31.772  -57.823  1.00 54.61  ?  226 ARG A N     1 
ATOM   881   C  CA    . ARG A  1 120 ? 103.912 31.244  -56.494  1.00 56.95  ?  226 ARG A CA    1 
ATOM   882   C  C     . ARG A  1 120 ? 102.853 30.246  -56.021  1.00 56.62  ?  226 ARG A C     1 
ATOM   883   O  O     . ARG A  1 120 ? 102.038 30.568  -55.149  1.00 56.05  ?  226 ARG A O     1 
ATOM   884   C  CB    . ARG A  1 120 ? 104.055 32.391  -55.499  1.00 59.70  ?  226 ARG A CB    1 
ATOM   885   C  CG    . ARG A  1 120 ? 105.206 33.324  -55.825  1.00 61.84  ?  226 ARG A CG    1 
ATOM   886   C  CD    . ARG A  1 120 ? 105.254 34.484  -54.850  1.00 64.30  ?  226 ARG A CD    1 
ATOM   887   N  NE    . ARG A  1 120 ? 105.505 34.029  -53.491  1.00 66.79  ?  226 ARG A NE    1 
ATOM   888   C  CZ    . ARG A  1 120 ? 105.431 34.800  -52.407  1.00 68.18  ?  226 ARG A CZ    1 
ATOM   889   N  NH1   . ARG A  1 120 ? 105.108 36.092  -52.491  1.00 69.62  ?  226 ARG A NH1   1 
ATOM   890   N  NH2   . ARG A  1 120 ? 105.670 34.273  -51.209  1.00 68.00  ?  226 ARG A NH2   1 
ATOM   891   N  N     . PRO A  1 121 ? 102.873 29.021  -56.596  1.00 56.22  ?  227 PRO A N     1 
ATOM   892   C  CA    . PRO A  1 121 ? 101.892 27.971  -56.276  1.00 56.60  ?  227 PRO A CA    1 
ATOM   893   C  C     . PRO A  1 121 ? 101.840 27.546  -54.810  1.00 57.95  ?  227 PRO A C     1 
ATOM   894   O  O     . PRO A  1 121 ? 100.818 27.030  -54.365  1.00 57.60  ?  227 PRO A O     1 
ATOM   895   C  CB    . PRO A  1 121 ? 102.352 26.788  -57.140  1.00 56.39  ?  227 PRO A CB    1 
ATOM   896   C  CG    . PRO A  1 121 ? 103.166 27.390  -58.221  1.00 55.53  ?  227 PRO A CG    1 
ATOM   897   C  CD    . PRO A  1 121 ? 103.853 28.548  -57.590  1.00 55.38  ?  227 PRO A CD    1 
ATOM   898   N  N     . GLU A  1 122 ? 102.946 27.731  -54.089  1.00 60.11  ?  228 GLU A N     1 
ATOM   899   C  CA    . GLU A  1 122 ? 103.009 27.451  -52.653  1.00 61.96  ?  228 GLU A CA    1 
ATOM   900   C  C     . GLU A  1 122 ? 102.054 28.288  -51.784  1.00 63.10  ?  228 GLU A C     1 
ATOM   901   O  O     . GLU A  1 122 ? 101.546 27.779  -50.787  1.00 66.30  ?  228 GLU A O     1 
ATOM   902   C  CB    . GLU A  1 122 ? 104.456 27.564  -52.128  1.00 62.87  ?  228 GLU A CB    1 
ATOM   903   C  CG    . GLU A  1 122 ? 105.041 28.976  -51.984  1.00 62.65  ?  228 GLU A CG    1 
ATOM   904   C  CD    . GLU A  1 122 ? 105.658 29.539  -53.258  1.00 61.12  ?  228 GLU A CD    1 
ATOM   905   O  OE1   . GLU A  1 122 ? 105.433 28.986  -54.359  1.00 58.41  ?  228 GLU A OE1   1 
ATOM   906   O  OE2   . GLU A  1 122 ? 106.375 30.556  -53.156  1.00 60.68  ?  228 GLU A OE2   1 
ATOM   907   N  N     . VAL A  1 123 ? 101.796 29.542  -52.166  1.00 63.08  ?  229 VAL A N     1 
ATOM   908   C  CA    . VAL A  1 123 ? 101.039 30.483  -51.315  1.00 63.97  ?  229 VAL A CA    1 
ATOM   909   C  C     . VAL A  1 123 ? 99.536  30.357  -51.563  1.00 62.87  ?  229 VAL A C     1 
ATOM   910   O  O     . VAL A  1 123 ? 99.117  30.123  -52.691  1.00 62.54  ?  229 VAL A O     1 
ATOM   911   C  CB    . VAL A  1 123 ? 101.451 31.958  -51.545  1.00 64.85  ?  229 VAL A CB    1 
ATOM   912   C  CG1   . VAL A  1 123 ? 100.913 32.844  -50.413  1.00 65.39  ?  229 VAL A CG1   1 
ATOM   913   C  CG2   . VAL A  1 123 ? 102.969 32.102  -51.632  1.00 65.12  ?  229 VAL A CG2   1 
ATOM   914   N  N     . LYS A  1 124 ? 98.739  30.485  -50.501  1.00 61.95  ?  230 LYS A N     1 
ATOM   915   C  CA    . LYS A  1 124 ? 97.298  30.717  -50.611  1.00 61.71  ?  230 LYS A CA    1 
ATOM   916   C  C     . LYS A  1 124 ? 97.099  32.194  -50.268  1.00 62.47  ?  230 LYS A C     1 
ATOM   917   O  O     . LYS A  1 124 ? 97.151  32.576  -49.094  1.00 64.31  ?  230 LYS A O     1 
ATOM   918   C  CB    . LYS A  1 124 ? 96.503  29.805  -49.669  1.00 60.71  ?  230 LYS A CB    1 
ATOM   919   N  N     . TRP A  1 125 ? 96.921  33.019  -51.310  1.00 61.30  ?  231 TRP A N     1 
ATOM   920   C  CA    . TRP A  1 125 ? 96.784  34.476  -51.175  1.00 59.80  ?  231 TRP A CA    1 
ATOM   921   C  C     . TRP A  1 125 ? 95.558  34.985  -51.946  1.00 58.98  ?  231 TRP A C     1 
ATOM   922   O  O     . TRP A  1 125 ? 95.317  34.554  -53.071  1.00 59.43  ?  231 TRP A O     1 
ATOM   923   C  CB    . TRP A  1 125 ? 98.039  35.177  -51.689  1.00 58.10  ?  231 TRP A CB    1 
ATOM   924   C  CG    . TRP A  1 125 ? 98.019  36.668  -51.487  1.00 56.84  ?  231 TRP A CG    1 
ATOM   925   C  CD1   . TRP A  1 125 ? 98.360  37.353  -50.350  1.00 56.54  ?  231 TRP A CD1   1 
ATOM   926   C  CD2   . TRP A  1 125 ? 97.625  37.652  -52.442  1.00 55.88  ?  231 TRP A CD2   1 
ATOM   927   N  NE1   . TRP A  1 125 ? 98.203  38.705  -50.542  1.00 56.01  ?  231 TRP A NE1   1 
ATOM   928   C  CE2   . TRP A  1 125 ? 97.756  38.915  -51.819  1.00 56.30  ?  231 TRP A CE2   1 
ATOM   929   C  CE3   . TRP A  1 125 ? 97.172  37.592  -53.763  1.00 54.94  ?  231 TRP A CE3   1 
ATOM   930   C  CZ2   . TRP A  1 125 ? 97.446  40.113  -52.479  1.00 56.79  ?  231 TRP A CZ2   1 
ATOM   931   C  CZ3   . TRP A  1 125 ? 96.866  38.781  -54.420  1.00 54.82  ?  231 TRP A CZ3   1 
ATOM   932   C  CH2   . TRP A  1 125 ? 97.004  40.022  -53.778  1.00 55.86  ?  231 TRP A CH2   1 
ATOM   933   N  N     . THR A  1 126 ? 94.812  35.909  -51.328  1.00 58.33  ?  232 THR A N     1 
ATOM   934   C  CA    . THR A  1 126 ? 93.611  36.519  -51.913  1.00 57.90  ?  232 THR A CA    1 
ATOM   935   C  C     . THR A  1 126 ? 93.663  38.039  -51.815  1.00 58.44  ?  232 THR A C     1 
ATOM   936   O  O     . THR A  1 126 ? 94.386  38.594  -50.980  1.00 57.84  ?  232 THR A O     1 
ATOM   937   C  CB    . THR A  1 126 ? 92.321  36.059  -51.202  1.00 58.26  ?  232 THR A CB    1 
ATOM   938   O  OG1   . THR A  1 126 ? 92.274  36.602  -49.877  1.00 58.18  ?  232 THR A OG1   1 
ATOM   939   C  CG2   . THR A  1 126 ? 92.246  34.543  -51.127  1.00 58.96  ?  232 THR A CG2   1 
ATOM   940   N  N     . HIS A  1 127 ? 92.867  38.709  -52.644  1.00 61.12  ?  233 HIS A N     1 
ATOM   941   C  CA    . HIS A  1 127 ? 92.814  40.170  -52.618  1.00 65.90  ?  233 HIS A CA    1 
ATOM   942   C  C     . HIS A  1 127 ? 92.362  40.689  -51.229  1.00 70.05  ?  233 HIS A C     1 
ATOM   943   O  O     . HIS A  1 127 ? 92.834  41.738  -50.771  1.00 73.19  ?  233 HIS A O     1 
ATOM   944   C  CB    . HIS A  1 127 ? 91.991  40.735  -53.805  1.00 68.16  ?  233 HIS A CB    1 
ATOM   945   C  CG    . HIS A  1 127 ? 90.501  40.745  -53.606  1.00 70.89  ?  233 HIS A CG    1 
ATOM   946   N  ND1   . HIS A  1 127 ? 89.683  39.699  -53.991  1.00 70.53  ?  233 HIS A ND1   1 
ATOM   947   C  CD2   . HIS A  1 127 ? 89.676  41.708  -53.139  1.00 73.06  ?  233 HIS A CD2   1 
ATOM   948   C  CE1   . HIS A  1 127 ? 88.425  40.004  -53.726  1.00 71.14  ?  233 HIS A CE1   1 
ATOM   949   N  NE2   . HIS A  1 127 ? 88.390  41.220  -53.213  1.00 71.91  ?  233 HIS A NE2   1 
ATOM   950   N  N     . GLU A  1 128 ? 91.508  39.918  -50.553  1.00 71.79  ?  234 GLU A N     1 
ATOM   951   C  CA    . GLU A  1 128 ? 91.016  40.256  -49.211  1.00 70.08  ?  234 GLU A CA    1 
ATOM   952   C  C     . GLU A  1 128 ? 92.137  40.275  -48.176  1.00 67.82  ?  234 GLU A C     1 
ATOM   953   O  O     . GLU A  1 128 ? 92.283  41.246  -47.430  1.00 70.18  ?  234 GLU A O     1 
ATOM   954   C  CB    . GLU A  1 128 ? 89.900  39.290  -48.754  1.00 71.87  ?  234 GLU A CB    1 
ATOM   955   C  CG    . GLU A  1 128 ? 88.565  39.444  -49.500  1.00 73.20  ?  234 GLU A CG    1 
ATOM   956   C  CD    . GLU A  1 128 ? 88.343  38.425  -50.610  1.00 74.69  ?  234 GLU A CD    1 
ATOM   957   O  OE1   . GLU A  1 128 ? 89.317  37.771  -51.063  1.00 76.75  ?  234 GLU A OE1   1 
ATOM   958   O  OE2   . GLU A  1 128 ? 87.174  38.295  -51.037  1.00 74.81  ?  234 GLU A OE2   1 
ATOM   959   N  N     . GLN A  1 129 ? 92.933  39.213  -48.143  1.00 63.61  ?  235 GLN A N     1 
ATOM   960   C  CA    . GLN A  1 129 ? 94.076  39.148  -47.226  1.00 61.04  ?  235 GLN A CA    1 
ATOM   961   C  C     . GLN A  1 129 ? 94.972  40.351  -47.426  1.00 57.30  ?  235 GLN A C     1 
ATOM   962   O  O     . GLN A  1 129 ? 95.443  40.943  -46.452  1.00 56.35  ?  235 GLN A O     1 
ATOM   963   C  CB    . GLN A  1 129 ? 94.889  37.875  -47.432  1.00 61.82  ?  235 GLN A CB    1 
ATOM   964   C  CG    . GLN A  1 129 ? 94.307  36.651  -46.752  1.00 63.52  ?  235 GLN A CG    1 
ATOM   965   C  CD    . GLN A  1 129 ? 94.875  35.353  -47.286  1.00 64.36  ?  235 GLN A CD    1 
ATOM   966   O  OE1   . GLN A  1 129 ? 94.136  34.414  -47.579  1.00 66.82  ?  235 GLN A OE1   1 
ATOM   967   N  NE2   . GLN A  1 129 ? 96.182  35.295  -47.429  1.00 64.20  ?  235 GLN A NE2   1 
ATOM   968   N  N     . GLY A  1 130 ? 95.187  40.696  -48.693  1.00 53.86  ?  236 GLY A N     1 
ATOM   969   C  CA    . GLY A  1 130 ? 95.924  41.889  -49.059  1.00 53.03  ?  236 GLY A CA    1 
ATOM   970   C  C     . GLY A  1 130 ? 95.314  43.157  -48.475  1.00 52.16  ?  236 GLY A C     1 
ATOM   971   O  O     . GLY A  1 130 ? 96.028  44.004  -47.940  1.00 52.02  ?  236 GLY A O     1 
ATOM   972   N  N     . SER A  1 131 ? 93.993  43.277  -48.579  1.00 51.50  ?  237 SER A N     1 
ATOM   973   C  CA    . SER A  1 131 ? 93.288  44.444  -48.058  1.00 51.73  ?  237 SER A CA    1 
ATOM   974   C  C     . SER A  1 131 ? 93.511  44.639  -46.551  1.00 52.15  ?  237 SER A C     1 
ATOM   975   O  O     . SER A  1 131 ? 93.740  45.762  -46.096  1.00 53.02  ?  237 SER A O     1 
ATOM   976   C  CB    . SER A  1 131 ? 91.793  44.374  -48.377  1.00 51.33  ?  237 SER A CB    1 
ATOM   977   O  OG    . SER A  1 131 ? 91.589  44.303  -49.774  1.00 51.07  ?  237 SER A OG    1 
ATOM   978   N  N     . VAL A  1 132 ? 93.478  43.548  -45.792  1.00 52.02  ?  238 VAL A N     1 
ATOM   979   C  CA    . VAL A  1 132 ? 93.738  43.602  -44.351  1.00 52.68  ?  238 VAL A CA    1 
ATOM   980   C  C     . VAL A  1 132 ? 95.125  44.149  -44.058  1.00 52.76  ?  238 VAL A C     1 
ATOM   981   O  O     . VAL A  1 132 ? 95.280  45.061  -43.244  1.00 53.19  ?  238 VAL A O     1 
ATOM   982   C  CB    . VAL A  1 132 ? 93.579  42.218  -43.703  1.00 53.43  ?  238 VAL A CB    1 
ATOM   983   C  CG1   . VAL A  1 132 ? 94.200  42.173  -42.297  1.00 55.07  ?  238 VAL A CG1   1 
ATOM   984   C  CG2   . VAL A  1 132 ? 92.099  41.900  -43.622  1.00 52.94  ?  238 VAL A CG2   1 
ATOM   985   N  N     . MET A  1 133 ? 96.124  43.560  -44.713  1.00 53.09  ?  239 MET A N     1 
ATOM   986   C  CA    . MET A  1 133 ? 97.499  43.996  -44.545  1.00 54.97  ?  239 MET A CA    1 
ATOM   987   C  C     . MET A  1 133 ? 97.709  45.432  -44.993  1.00 53.89  ?  239 MET A C     1 
ATOM   988   O  O     . MET A  1 133 ? 98.376  46.202  -44.307  1.00 52.87  ?  239 MET A O     1 
ATOM   989   C  CB    . MET A  1 133 ? 98.437  43.110  -45.342  1.00 58.08  ?  239 MET A CB    1 
ATOM   990   C  CG    . MET A  1 133 ? 98.657  41.739  -44.817  1.00 61.65  ?  239 MET A CG    1 
ATOM   991   S  SD    . MET A  1 133 ? 99.887  40.929  -45.909  1.00 66.94  ?  239 MET A SD    1 
ATOM   992   C  CE    . MET A  1 133 ? 101.385 41.650  -45.233  1.00 66.84  ?  239 MET A CE    1 
ATOM   993   N  N     . MET A  1 134 ? 97.150  45.772  -46.148  1.00 54.09  ?  240 MET A N     1 
ATOM   994   C  CA    . MET A  1 134 ? 97.245  47.130  -46.682  1.00 55.15  ?  240 MET A CA    1 
ATOM   995   C  C     . MET A  1 134 ? 96.530  48.140  -45.762  1.00 55.75  ?  240 MET A C     1 
ATOM   996   O  O     . MET A  1 134 ? 97.002  49.269  -45.591  1.00 57.82  ?  240 MET A O     1 
ATOM   997   C  CB    . MET A  1 134 ? 96.701  47.174  -48.121  1.00 54.62  ?  240 MET A CB    1 
ATOM   998   C  CG    . MET A  1 134 ? 96.795  48.513  -48.844  1.00 54.92  ?  240 MET A CG    1 
ATOM   999   S  SD    . MET A  1 134 ? 98.442  49.202  -49.071  1.00 55.85  ?  240 MET A SD    1 
ATOM   1000  C  CE    . MET A  1 134 ? 99.110  48.167  -50.368  1.00 55.10  ?  240 MET A CE    1 
ATOM   1001  N  N     . PHE A  1 135 ? 95.419  47.722  -45.153  1.00 54.63  ?  241 PHE A N     1 
ATOM   1002  C  CA    . PHE A  1 135 ? 94.702  48.567  -44.198  1.00 54.03  ?  241 PHE A CA    1 
ATOM   1003  C  C     . PHE A  1 135 ? 95.586  48.890  -42.994  1.00 55.56  ?  241 PHE A C     1 
ATOM   1004  O  O     . PHE A  1 135 ? 95.733  50.058  -42.619  1.00 56.90  ?  241 PHE A O     1 
ATOM   1005  C  CB    . PHE A  1 135 ? 93.406  47.891  -43.745  1.00 53.11  ?  241 PHE A CB    1 
ATOM   1006  C  CG    . PHE A  1 135 ? 92.602  48.712  -42.777  1.00 52.38  ?  241 PHE A CG    1 
ATOM   1007  C  CD1   . PHE A  1 135 ? 92.127  49.970  -43.144  1.00 52.18  ?  241 PHE A CD1   1 
ATOM   1008  C  CD2   . PHE A  1 135 ? 92.315  48.235  -41.508  1.00 51.75  ?  241 PHE A CD2   1 
ATOM   1009  C  CE1   . PHE A  1 135 ? 91.381  50.736  -42.251  1.00 51.16  ?  241 PHE A CE1   1 
ATOM   1010  C  CE2   . PHE A  1 135 ? 91.568  48.999  -40.621  1.00 51.73  ?  241 PHE A CE2   1 
ATOM   1011  C  CZ    . PHE A  1 135 ? 91.102  50.251  -40.995  1.00 51.04  ?  241 PHE A CZ    1 
ATOM   1012  N  N     . GLU A  1 136 ? 96.180  47.844  -42.414  1.00 55.74  ?  242 GLU A N     1 
ATOM   1013  C  CA    . GLU A  1 136 ? 97.153  47.977  -41.319  1.00 55.41  ?  242 GLU A CA    1 
ATOM   1014  C  C     . GLU A  1 136 ? 98.251  48.981  -41.706  1.00 55.13  ?  242 GLU A C     1 
ATOM   1015  O  O     . GLU A  1 136 ? 98.489  49.942  -40.966  1.00 56.32  ?  242 GLU A O     1 
ATOM   1016  C  CB    . GLU A  1 136 ? 97.748  46.601  -40.956  1.00 55.12  ?  242 GLU A CB    1 
ATOM   1017  C  CG    . GLU A  1 136 ? 98.740  46.557  -39.784  1.00 55.29  ?  242 GLU A CG    1 
ATOM   1018  C  CD    . GLU A  1 136 ? 98.124  46.723  -38.410  1.00 56.06  ?  242 GLU A CD    1 
ATOM   1019  O  OE1   . GLU A  1 136 ? 96.972  46.312  -38.196  1.00 57.77  ?  242 GLU A OE1   1 
ATOM   1020  O  OE2   . GLU A  1 136 ? 98.806  47.251  -37.503  1.00 55.77  ?  242 GLU A OE2   1 
ATOM   1021  N  N     . HIS A  1 137 ? 98.875  48.777  -42.871  1.00 53.41  ?  243 HIS A N     1 
ATOM   1022  C  CA    . HIS A  1 137 ? 99.934  49.677  -43.366  1.00 52.69  ?  243 HIS A CA    1 
ATOM   1023  C  C     . HIS A  1 137 ? 99.435  51.112  -43.537  1.00 54.13  ?  243 HIS A C     1 
ATOM   1024  O  O     . HIS A  1 137 ? 100.159 52.049  -43.211  1.00 57.03  ?  243 HIS A O     1 
ATOM   1025  C  CB    . HIS A  1 137 ? 100.547 49.168  -44.685  1.00 50.01  ?  243 HIS A CB    1 
ATOM   1026  C  CG    . HIS A  1 137 ? 101.657 50.027  -45.219  1.00 48.13  ?  243 HIS A CG    1 
ATOM   1027  N  ND1   . HIS A  1 137 ? 102.659 50.542  -44.422  1.00 48.05  ?  243 HIS A ND1   1 
ATOM   1028  C  CD2   . HIS A  1 137 ? 101.930 50.447  -46.477  1.00 46.92  ?  243 HIS A CD2   1 
ATOM   1029  C  CE1   . HIS A  1 137 ? 103.490 51.254  -45.162  1.00 47.88  ?  243 HIS A CE1   1 
ATOM   1030  N  NE2   . HIS A  1 137 ? 103.077 51.201  -46.416  1.00 47.16  ?  243 HIS A NE2   1 
ATOM   1031  N  N     . LEU A  1 138 ? 98.209  51.272  -44.031  1.00 53.76  ?  244 LEU A N     1 
ATOM   1032  C  CA    . LEU A  1 138 ? 97.612  52.600  -44.203  1.00 53.33  ?  244 LEU A CA    1 
ATOM   1033  C  C     . LEU A  1 138 ? 97.475  53.324  -42.874  1.00 53.37  ?  244 LEU A C     1 
ATOM   1034  O  O     . LEU A  1 138 ? 97.872  54.485  -42.750  1.00 53.77  ?  244 LEU A O     1 
ATOM   1035  C  CB    . LEU A  1 138 ? 96.241  52.502  -44.867  1.00 53.10  ?  244 LEU A CB    1 
ATOM   1036  C  CG    . LEU A  1 138 ? 95.659  53.804  -45.420  1.00 53.83  ?  244 LEU A CG    1 
ATOM   1037  C  CD1   . LEU A  1 138 ? 94.617  53.478  -46.480  1.00 54.34  ?  244 LEU A CD1   1 
ATOM   1038  C  CD2   . LEU A  1 138 ? 95.032  54.698  -44.349  1.00 54.26  ?  244 LEU A CD2   1 
ATOM   1039  N  N     . ILE A  1 139 ? 96.908  52.629  -41.893  1.00 53.62  ?  245 ILE A N     1 
ATOM   1040  C  CA    . ILE A  1 139 ? 96.659  53.203  -40.572  1.00 54.88  ?  245 ILE A CA    1 
ATOM   1041  C  C     . ILE A  1 139 ? 97.973  53.645  -39.913  1.00 56.43  ?  245 ILE A C     1 
ATOM   1042  O  O     . ILE A  1 139 ? 98.071  54.771  -39.399  1.00 59.23  ?  245 ILE A O     1 
ATOM   1043  C  CB    . ILE A  1 139 ? 95.920  52.196  -39.653  1.00 54.21  ?  245 ILE A CB    1 
ATOM   1044  C  CG1   . ILE A  1 139 ? 94.497  51.913  -40.176  1.00 54.55  ?  245 ILE A CG1   1 
ATOM   1045  C  CG2   . ILE A  1 139 ? 95.858  52.702  -38.206  1.00 53.66  ?  245 ILE A CG2   1 
ATOM   1046  C  CD1   . ILE A  1 139 ? 93.508  53.069  -40.074  1.00 55.73  ?  245 ILE A CD1   1 
ATOM   1047  N  N     . ASN A  1 140 ? 98.972  52.765  -39.950  1.00 55.36  ?  246 ASN A N     1 
ATOM   1048  C  CA    . ASN A  1 140 ? 100.225 52.995  -39.243  1.00 55.21  ?  246 ASN A CA    1 
ATOM   1049  C  C     . ASN A  1 140 ? 101.083 54.064  -39.902  1.00 55.71  ?  246 ASN A C     1 
ATOM   1050  O  O     . ASN A  1 140 ? 101.580 54.967  -39.224  1.00 58.40  ?  246 ASN A O     1 
ATOM   1051  C  CB    . ASN A  1 140 ? 101.017 51.699  -39.128  1.00 55.16  ?  246 ASN A CB    1 
ATOM   1052  C  CG    . ASN A  1 140 ? 100.275 50.638  -38.356  1.00 55.29  ?  246 ASN A CG    1 
ATOM   1053  O  OD1   . ASN A  1 140 ? 99.431  50.938  -37.500  1.00 56.00  ?  246 ASN A OD1   1 
ATOM   1054  N  ND2   . ASN A  1 140 ? 100.570 49.382  -38.669  1.00 55.89  ?  246 ASN A ND2   1 
ATOM   1055  N  N     . SER A  1 141 ? 101.245 53.971  -41.217  1.00 54.92  ?  247 SER A N     1 
ATOM   1056  C  CA    . SER A  1 141 ? 102.068 54.932  -41.944  1.00 54.90  ?  247 SER A CA    1 
ATOM   1057  C  C     . SER A  1 141 ? 101.458 56.351  -42.035  1.00 52.31  ?  247 SER A C     1 
ATOM   1058  O  O     . SER A  1 141 ? 102.179 57.296  -42.343  1.00 51.99  ?  247 SER A O     1 
ATOM   1059  C  CB    . SER A  1 141 ? 102.420 54.393  -43.337  1.00 56.37  ?  247 SER A CB    1 
ATOM   1060  O  OG    . SER A  1 141 ? 101.258 54.270  -44.135  1.00 58.47  ?  247 SER A OG    1 
ATOM   1061  N  N     . ASN A  1 142 ? 100.163 56.509  -41.756  1.00 49.73  ?  248 ASN A N     1 
ATOM   1062  C  CA    . ASN A  1 142 ? 99.509  57.827  -41.838  1.00 49.16  ?  248 ASN A CA    1 
ATOM   1063  C  C     . ASN A  1 142 ? 98.950  58.377  -40.517  1.00 49.31  ?  248 ASN A C     1 
ATOM   1064  O  O     . ASN A  1 142 ? 98.283  59.406  -40.526  1.00 50.23  ?  248 ASN A O     1 
ATOM   1065  C  CB    . ASN A  1 142 ? 98.404  57.780  -42.892  1.00 48.37  ?  248 ASN A CB    1 
ATOM   1066  C  CG    . ASN A  1 142 ? 98.932  57.414  -44.260  1.00 47.62  ?  248 ASN A CG    1 
ATOM   1067  O  OD1   . ASN A  1 142 ? 99.650  58.191  -44.880  1.00 47.40  ?  248 ASN A OD1   1 
ATOM   1068  N  ND2   . ASN A  1 142 ? 98.584  56.225  -44.739  1.00 47.18  ?  248 ASN A ND2   1 
ATOM   1069  N  N     . GLY A  1 143 ? 99.224  57.708  -39.399  1.00 48.92  ?  249 GLY A N     1 
ATOM   1070  C  CA    . GLY A  1 143 ? 98.816  58.186  -38.069  1.00 48.40  ?  249 GLY A CA    1 
ATOM   1071  C  C     . GLY A  1 143 ? 97.317  58.383  -37.919  1.00 47.30  ?  249 GLY A C     1 
ATOM   1072  O  O     . GLY A  1 143 ? 96.855  59.429  -37.447  1.00 47.47  ?  249 GLY A O     1 
ATOM   1073  N  N     . ILE A  1 144 ? 96.565  57.371  -38.326  1.00 46.82  ?  250 ILE A N     1 
ATOM   1074  C  CA    . ILE A  1 144 ? 95.113  57.435  -38.341  1.00 47.45  ?  250 ILE A CA    1 
ATOM   1075  C  C     . ILE A  1 144 ? 94.523  57.121  -36.975  1.00 49.00  ?  250 ILE A C     1 
ATOM   1076  O  O     . ILE A  1 144 ? 93.490  57.680  -36.606  1.00 49.55  ?  250 ILE A O     1 
ATOM   1077  C  CB    . ILE A  1 144 ? 94.540  56.486  -39.416  1.00 46.96  ?  250 ILE A CB    1 
ATOM   1078  C  CG1   . ILE A  1 144 ? 95.067  56.868  -40.808  1.00 46.82  ?  250 ILE A CG1   1 
ATOM   1079  C  CG2   . ILE A  1 144 ? 93.013  56.478  -39.412  1.00 46.69  ?  250 ILE A CG2   1 
ATOM   1080  C  CD1   . ILE A  1 144 ? 94.827  58.317  -41.228  1.00 46.55  ?  250 ILE A CD1   1 
ATOM   1081  N  N     . LYS A  1 145 ? 95.172  56.225  -36.236  1.00 50.53  ?  251 LYS A N     1 
ATOM   1082  C  CA    . LYS A  1 145 ? 94.739  55.866  -34.883  1.00 51.73  ?  251 LYS A CA    1 
ATOM   1083  C  C     . LYS A  1 145 ? 94.316  57.064  -33.991  1.00 54.10  ?  251 LYS A C     1 
ATOM   1084  O  O     . LYS A  1 145 ? 93.245  57.025  -33.391  1.00 55.84  ?  251 LYS A O     1 
ATOM   1085  C  CB    . LYS A  1 145 ? 95.818  55.032  -34.185  1.00 51.73  ?  251 LYS A CB    1 
ATOM   1086  C  CG    . LYS A  1 145 ? 95.816  53.549  -34.493  1.00 51.13  ?  251 LYS A CG    1 
ATOM   1087  C  CD    . LYS A  1 145 ? 96.576  52.784  -33.416  1.00 52.23  ?  251 LYS A CD    1 
ATOM   1088  C  CE    . LYS A  1 145 ? 96.513  51.280  -33.562  1.00 52.56  ?  251 LYS A CE    1 
ATOM   1089  N  NZ    . LYS A  1 145 ? 97.281  50.731  -34.726  1.00 53.13  ?  251 LYS A NZ    1 
ATOM   1090  N  N     . PRO A  1 146 ? 95.153  58.125  -33.895  1.00 55.51  ?  252 PRO A N     1 
ATOM   1091  C  CA    . PRO A  1 146 ? 94.748  59.355  -33.188  1.00 55.96  ?  252 PRO A CA    1 
ATOM   1092  C  C     . PRO A  1 146 ? 93.444  59.986  -33.685  1.00 55.73  ?  252 PRO A C     1 
ATOM   1093  O  O     . PRO A  1 146 ? 92.649  60.484  -32.885  1.00 54.99  ?  252 PRO A O     1 
ATOM   1094  C  CB    . PRO A  1 146 ? 95.899  60.320  -33.477  1.00 56.87  ?  252 PRO A CB    1 
ATOM   1095  C  CG    . PRO A  1 146 ? 97.081  59.465  -33.738  1.00 57.18  ?  252 PRO A CG    1 
ATOM   1096  C  CD    . PRO A  1 146 ? 96.589  58.144  -34.242  1.00 56.50  ?  252 PRO A CD    1 
ATOM   1097  N  N     . VAL A  1 147 ? 93.255  59.967  -35.003  1.00 56.07  ?  253 VAL A N     1 
ATOM   1098  C  CA    . VAL A  1 147 ? 92.083  60.566  -35.644  1.00 56.45  ?  253 VAL A CA    1 
ATOM   1099  C  C     . VAL A  1 147 ? 90.846  59.720  -35.370  1.00 56.46  ?  253 VAL A C     1 
ATOM   1100  O  O     . VAL A  1 147 ? 89.759  60.256  -35.184  1.00 56.85  ?  253 VAL A O     1 
ATOM   1101  C  CB    . VAL A  1 147 ? 92.252  60.730  -37.181  1.00 56.46  ?  253 VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1 147 ? 91.114  61.568  -37.760  1.00 56.30  ?  253 VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1 147 ? 93.595  61.377  -37.541  1.00 56.50  ?  253 VAL A CG2   1 
ATOM   1104  N  N     . MET A  1 148 ? 91.008  58.400  -35.349  1.00 57.91  ?  254 MET A N     1 
ATOM   1105  C  CA    . MET A  1 148 ? 89.902  57.506  -35.017  1.00 60.52  ?  254 MET A CA    1 
ATOM   1106  C  C     . MET A  1 148 ? 89.396  57.806  -33.610  1.00 62.11  ?  254 MET A C     1 
ATOM   1107  O  O     . MET A  1 148 ? 88.191  57.977  -33.397  1.00 60.50  ?  254 MET A O     1 
ATOM   1108  C  CB    . MET A  1 148 ? 90.337  56.051  -35.128  1.00 62.27  ?  254 MET A CB    1 
ATOM   1109  C  CG    . MET A  1 148 ? 90.610  55.624  -36.552  1.00 63.93  ?  254 MET A CG    1 
ATOM   1110  S  SD    . MET A  1 148 ? 91.242  53.967  -36.732  1.00 65.45  ?  254 MET A SD    1 
ATOM   1111  C  CE    . MET A  1 148 ? 89.746  53.015  -36.522  1.00 65.27  ?  254 MET A CE    1 
ATOM   1112  N  N     . GLU A  1 149 ? 90.340  57.902  -32.670  1.00 64.35  ?  255 GLU A N     1 
ATOM   1113  C  CA    . GLU A  1 149 ? 90.044  58.280  -31.284  1.00 65.13  ?  255 GLU A CA    1 
ATOM   1114  C  C     . GLU A  1 149 ? 89.317  59.618  -31.208  1.00 64.23  ?  255 GLU A C     1 
ATOM   1115  O  O     . GLU A  1 149 ? 88.308  59.727  -30.518  1.00 65.02  ?  255 GLU A O     1 
ATOM   1116  C  CB    . GLU A  1 149 ? 91.320  58.318  -30.436  1.00 66.95  ?  255 GLU A CB    1 
ATOM   1117  C  CG    . GLU A  1 149 ? 91.836  56.945  -30.040  1.00 68.95  ?  255 GLU A CG    1 
ATOM   1118  C  CD    . GLU A  1 149 ? 93.214  56.971  -29.377  1.00 71.98  ?  255 GLU A CD    1 
ATOM   1119  O  OE1   . GLU A  1 149 ? 93.873  58.040  -29.351  1.00 73.97  ?  255 GLU A OE1   1 
ATOM   1120  O  OE2   . GLU A  1 149 ? 93.701  55.868  -29.051  1.00 76.15  ?  255 GLU A OE2   1 
ATOM   1121  N  N     . GLN A  1 150 ? 89.819  60.609  -31.942  1.00 64.04  ?  256 GLN A N     1 
ATOM   1122  C  CA    . GLN A  1 150 ? 89.199  61.937  -32.008  1.00 64.53  ?  256 GLN A CA    1 
ATOM   1123  C  C     . GLN A  1 150 ? 87.707  61.892  -32.368  1.00 63.58  ?  256 GLN A C     1 
ATOM   1124  O  O     . GLN A  1 150 ? 86.933  62.703  -31.861  1.00 64.48  ?  256 GLN A O     1 
ATOM   1125  C  CB    . GLN A  1 150 ? 89.959  62.828  -33.003  1.00 66.61  ?  256 GLN A CB    1 
ATOM   1126  C  CG    . GLN A  1 150 ? 89.539  64.300  -33.023  1.00 68.01  ?  256 GLN A CG    1 
ATOM   1127  C  CD    . GLN A  1 150 ? 90.011  65.043  -34.259  1.00 69.48  ?  256 GLN A CD    1 
ATOM   1128  O  OE1   . GLN A  1 150 ? 91.001  64.674  -34.894  1.00 69.86  ?  256 GLN A OE1   1 
ATOM   1129  N  NE2   . GLN A  1 150 ? 89.235  66.029  -34.669  1.00 71.44  ?  256 GLN A NE2   1 
ATOM   1130  N  N     . TYR A  1 151 ? 87.305  60.948  -33.219  1.00 63.91  ?  257 TYR A N     1 
ATOM   1131  C  CA    . TYR A  1 151 ? 85.888  60.783  -33.606  1.00 63.88  ?  257 TYR A CA    1 
ATOM   1132  C  C     . TYR A  1 151 ? 85.184  59.613  -32.904  1.00 64.08  ?  257 TYR A C     1 
ATOM   1133  O  O     . TYR A  1 151 ? 84.252  59.024  -33.449  1.00 62.58  ?  257 TYR A O     1 
ATOM   1134  C  CB    . TYR A  1 151 ? 85.775  60.664  -35.131  1.00 62.62  ?  257 TYR A CB    1 
ATOM   1135  C  CG    . TYR A  1 151 ? 86.163  61.933  -35.842  1.00 62.00  ?  257 TYR A CG    1 
ATOM   1136  C  CD1   . TYR A  1 151 ? 85.324  63.045  -35.824  1.00 62.74  ?  257 TYR A CD1   1 
ATOM   1137  C  CD2   . TYR A  1 151 ? 87.368  62.031  -36.533  1.00 60.76  ?  257 TYR A CD2   1 
ATOM   1138  C  CE1   . TYR A  1 151 ? 85.669  64.218  -36.484  1.00 62.81  ?  257 TYR A CE1   1 
ATOM   1139  C  CE2   . TYR A  1 151 ? 87.737  63.212  -37.178  1.00 60.89  ?  257 TYR A CE2   1 
ATOM   1140  C  CZ    . TYR A  1 151 ? 86.878  64.291  -37.156  1.00 61.93  ?  257 TYR A CZ    1 
ATOM   1141  O  OH    . TYR A  1 151 ? 87.244  65.460  -37.793  1.00 62.02  ?  257 TYR A OH    1 
ATOM   1142  N  N     . GLY A  1 152 ? 85.619  59.296  -31.688  1.00 65.03  ?  258 GLY A N     1 
ATOM   1143  C  CA    . GLY A  1 152 ? 84.901  58.363  -30.830  1.00 64.55  ?  258 GLY A CA    1 
ATOM   1144  C  C     . GLY A  1 152 ? 85.092  56.884  -31.090  1.00 63.08  ?  258 GLY A C     1 
ATOM   1145  O  O     . GLY A  1 152 ? 84.341  56.077  -30.554  1.00 62.24  ?  258 GLY A O     1 
ATOM   1146  N  N     . LEU A  1 153 ? 86.088  56.511  -31.895  1.00 62.21  ?  259 LEU A N     1 
ATOM   1147  C  CA    . LEU A  1 153 ? 86.394  55.094  -32.101  1.00 62.78  ?  259 LEU A CA    1 
ATOM   1148  C  C     . LEU A  1 153 ? 87.382  54.593  -31.056  1.00 63.19  ?  259 LEU A C     1 
ATOM   1149  O  O     . LEU A  1 153 ? 88.048  55.385  -30.376  1.00 63.50  ?  259 LEU A O     1 
ATOM   1150  C  CB    . LEU A  1 153 ? 86.946  54.837  -33.506  1.00 62.74  ?  259 LEU A CB    1 
ATOM   1151  C  CG    . LEU A  1 153 ? 85.880  54.612  -34.587  1.00 62.11  ?  259 LEU A CG    1 
ATOM   1152  C  CD1   . LEU A  1 153 ? 85.031  55.866  -34.761  1.00 62.26  ?  259 LEU A CD1   1 
ATOM   1153  C  CD2   . LEU A  1 153 ? 86.535  54.212  -35.894  1.00 61.36  ?  259 LEU A CD2   1 
ATOM   1154  N  N     . ILE A  1 154 ? 87.464  53.267  -30.946  1.00 63.55  ?  260 ILE A N     1 
ATOM   1155  C  CA    . ILE A  1 154 ? 88.416  52.582  -30.077  1.00 64.58  ?  260 ILE A CA    1 
ATOM   1156  C  C     . ILE A  1 154 ? 89.265  51.670  -30.964  1.00 63.17  ?  260 ILE A C     1 
ATOM   1157  O  O     . ILE A  1 154 ? 88.854  50.550  -31.262  1.00 62.38  ?  260 ILE A O     1 
ATOM   1158  C  CB    . ILE A  1 154 ? 87.697  51.765  -28.988  1.00 66.81  ?  260 ILE A CB    1 
ATOM   1159  C  CG1   . ILE A  1 154 ? 86.824  52.699  -28.139  1.00 69.14  ?  260 ILE A CG1   1 
ATOM   1160  C  CG2   . ILE A  1 154 ? 88.688  51.027  -28.100  1.00 67.53  ?  260 ILE A CG2   1 
ATOM   1161  C  CD1   . ILE A  1 154 ? 85.916  52.017  -27.144  1.00 70.41  ?  260 ILE A CD1   1 
ATOM   1162  N  N     . PRO A  1 155 ? 90.449  52.145  -31.398  1.00 63.21  ?  261 PRO A N     1 
ATOM   1163  C  CA    . PRO A  1 155 ? 91.294  51.394  -32.333  1.00 63.48  ?  261 PRO A CA    1 
ATOM   1164  C  C     . PRO A  1 155 ? 91.516  49.910  -32.006  1.00 63.52  ?  261 PRO A C     1 
ATOM   1165  O  O     . PRO A  1 155 ? 91.449  49.089  -32.912  1.00 60.74  ?  261 PRO A O     1 
ATOM   1166  C  CB    . PRO A  1 155 ? 92.611  52.164  -32.288  1.00 64.51  ?  261 PRO A CB    1 
ATOM   1167  C  CG    . PRO A  1 155 ? 92.225  53.551  -31.979  1.00 64.53  ?  261 PRO A CG    1 
ATOM   1168  C  CD    . PRO A  1 155 ? 91.010  53.482  -31.114  1.00 64.10  ?  261 PRO A CD    1 
ATOM   1169  N  N     . GLU A  1 156 ? 91.758  49.576  -30.743  1.00 66.69  ?  262 GLU A N     1 
ATOM   1170  C  CA    . GLU A  1 156 ? 91.902  48.160  -30.327  1.00 68.12  ?  262 GLU A CA    1 
ATOM   1171  C  C     . GLU A  1 156 ? 90.759  47.323  -30.853  1.00 64.79  ?  262 GLU A C     1 
ATOM   1172  O  O     . GLU A  1 156 ? 90.964  46.449  -31.688  1.00 62.43  ?  262 GLU A O     1 
ATOM   1173  C  CB    . GLU A  1 156 ? 92.035  48.017  -28.803  1.00 73.93  ?  262 GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1 156 ? 93.382  48.523  -28.260  1.00 78.38  ?  262 GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1 156 ? 94.582  47.746  -28.763  1.00 81.49  ?  262 GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1 156 ? 94.506  46.492  -28.798  1.00 83.71  ?  262 GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1 156 ? 95.583  48.412  -29.105  1.00 84.99  ?  262 GLU A OE2   1 
ATOM   1178  N  N     . GLU A  1 157 ? 89.564  47.637  -30.394  1.00 63.27  ?  263 GLU A N     1 
ATOM   1179  C  CA    . GLU A  1 157 ? 88.339  46.906  -30.780  1.00 60.57  ?  263 GLU A CA    1 
ATOM   1180  C  C     . GLU A  1 157 ? 87.985  47.094  -32.244  1.00 58.12  ?  263 GLU A C     1 
ATOM   1181  O  O     . GLU A  1 157 ? 87.693  46.144  -32.937  1.00 57.20  ?  263 GLU A O     1 
ATOM   1182  C  CB    . GLU A  1 157 ? 87.146  47.355  -29.914  1.00 59.83  ?  263 GLU A CB    1 
ATOM   1183  C  CG    . GLU A  1 157 ? 87.212  46.860  -28.481  1.00 60.54  ?  263 GLU A CG    1 
ATOM   1184  C  CD    . GLU A  1 157 ? 86.147  47.431  -27.582  1.00 60.53  ?  263 GLU A CD    1 
ATOM   1185  O  OE1   . GLU A  1 157 ? 85.232  48.149  -28.035  1.00 60.23  ?  263 GLU A OE1   1 
ATOM   1186  O  OE2   . GLU A  1 157 ? 86.235  47.142  -26.385  1.00 59.45  ?  263 GLU A OE2   1 
ATOM   1187  N  N     . ASP A  1 158 ? 88.003  48.338  -32.701  1.00 56.52  ?  264 ASP A N     1 
ATOM   1188  C  CA    . ASP A  1 158 ? 87.396  48.685  -33.994  1.00 55.35  ?  264 ASP A CA    1 
ATOM   1189  C  C     . ASP A  1 158 ? 88.237  48.316  -35.206  1.00 54.23  ?  264 ASP A C     1 
ATOM   1190  O  O     . ASP A  1 158 ? 87.678  47.936  -36.226  1.00 54.08  ?  264 ASP A O     1 
ATOM   1191  C  CB    . ASP A  1 158 ? 87.050  50.153  -34.040  1.00 55.73  ?  264 ASP A CB    1 
ATOM   1192  C  CG    . ASP A  1 158 ? 85.948  50.519  -33.051  1.00 56.53  ?  264 ASP A CG    1 
ATOM   1193  O  OD1   . ASP A  1 158 ? 85.041  49.758  -32.797  1.00 57.15  ?  264 ASP A OD1   1 
ATOM   1194  O  OD2   . ASP A  1 158 ? 85.994  51.681  -32.558  1.00 57.75  ?  264 ASP A OD2   1 
ATOM   1195  N  N     . ILE A  1 159 ? 89.561  48.433  -35.120  1.00 52.79  ?  265 ILE A N     1 
ATOM   1196  C  CA    . ILE A  1 159 ? 90.422  48.016  -36.235  1.00 50.88  ?  265 ILE A CA    1 
ATOM   1197  C  C     . ILE A  1 159 ? 90.313  46.508  -36.457  1.00 50.46  ?  265 ILE A C     1 
ATOM   1198  O  O     . ILE A  1 159 ? 90.430  46.048  -37.584  1.00 48.80  ?  265 ILE A O     1 
ATOM   1199  C  CB    . ILE A  1 159 ? 91.896  48.467  -36.050  1.00 50.49  ?  265 ILE A CB    1 
ATOM   1200  C  CG1   . ILE A  1 159 ? 92.008  49.964  -36.270  1.00 49.91  ?  265 ILE A CG1   1 
ATOM   1201  C  CG2   . ILE A  1 159 ? 92.851  47.728  -37.003  1.00 50.38  ?  265 ILE A CG2   1 
ATOM   1202  C  CD1   . ILE A  1 159 ? 93.267  50.600  -35.730  1.00 50.82  ?  265 ILE A CD1   1 
ATOM   1203  N  N     . CYS A  1 160 ? 90.078  45.746  -35.401  1.00 51.57  ?  266 CYS A N     1 
ATOM   1204  C  CA    . CYS A  1 160 ? 89.754  44.322  -35.532  1.00 51.20  ?  266 CYS A CA    1 
ATOM   1205  C  C     . CYS A  1 160 ? 88.419  44.138  -36.250  1.00 48.69  ?  266 CYS A C     1 
ATOM   1206  O  O     . CYS A  1 160 ? 88.324  43.367  -37.201  1.00 47.17  ?  266 CYS A O     1 
ATOM   1207  C  CB    . CYS A  1 160 ? 89.704  43.646  -34.159  1.00 52.91  ?  266 CYS A CB    1 
ATOM   1208  S  SG    . CYS A  1 160 ? 89.238  41.917  -34.166  1.00 54.90  ?  266 CYS A SG    1 
ATOM   1209  N  N     . PHE A  1 161 ? 87.399  44.861  -35.787  1.00 47.50  ?  267 PHE A N     1 
ATOM   1210  C  CA    . PHE A  1 161 ? 86.055  44.818  -36.372  1.00 46.96  ?  267 PHE A CA    1 
ATOM   1211  C  C     . PHE A  1 161 ? 86.067  45.117  -37.869  1.00 47.56  ?  267 PHE A C     1 
ATOM   1212  O  O     . PHE A  1 161 ? 85.378  44.455  -38.636  1.00 48.33  ?  267 PHE A O     1 
ATOM   1213  C  CB    . PHE A  1 161 ? 85.127  45.798  -35.636  1.00 46.66  ?  267 PHE A CB    1 
ATOM   1214  C  CG    . PHE A  1 161 ? 83.747  45.933  -36.251  1.00 46.01  ?  267 PHE A CG    1 
ATOM   1215  C  CD1   . PHE A  1 161 ? 83.002  44.805  -36.570  1.00 45.14  ?  267 PHE A CD1   1 
ATOM   1216  C  CD2   . PHE A  1 161 ? 83.175  47.195  -36.475  1.00 45.66  ?  267 PHE A CD2   1 
ATOM   1217  C  CE1   . PHE A  1 161 ? 81.738  44.916  -37.108  1.00 44.15  ?  267 PHE A CE1   1 
ATOM   1218  C  CE2   . PHE A  1 161 ? 81.915  47.317  -37.007  1.00 44.60  ?  267 PHE A CE2   1 
ATOM   1219  C  CZ    . PHE A  1 161 ? 81.195  46.176  -37.328  1.00 43.93  ?  267 PHE A CZ    1 
ATOM   1220  N  N     . ILE A  1 162 ? 86.847  46.116  -38.267  1.00 47.98  ?  268 ILE A N     1 
ATOM   1221  C  CA    . ILE A  1 162 ? 86.979  46.490  -39.678  1.00 47.30  ?  268 ILE A CA    1 
ATOM   1222  C  C     . ILE A  1 162 ? 87.639  45.351  -40.474  1.00 47.41  ?  268 ILE A C     1 
ATOM   1223  O  O     . ILE A  1 162 ? 87.121  44.937  -41.508  1.00 45.69  ?  268 ILE A O     1 
ATOM   1224  C  CB    . ILE A  1 162 ? 87.740  47.838  -39.834  1.00 46.85  ?  268 ILE A CB    1 
ATOM   1225  C  CG1   . ILE A  1 162 ? 86.869  48.994  -39.343  1.00 46.71  ?  268 ILE A CG1   1 
ATOM   1226  C  CG2   . ILE A  1 162 ? 88.158  48.102  -41.277  1.00 46.43  ?  268 ILE A CG2   1 
ATOM   1227  C  CD1   . ILE A  1 162 ? 87.628  50.242  -38.946  1.00 46.95  ?  268 ILE A CD1   1 
ATOM   1228  N  N     . LYS A  1 163 ? 88.766  44.847  -39.979  1.00 49.47  ?  269 LYS A N     1 
ATOM   1229  C  CA    . LYS A  1 163 ? 89.469  43.726  -40.621  1.00 50.55  ?  269 LYS A CA    1 
ATOM   1230  C  C     . LYS A  1 163 ? 88.564  42.516  -40.731  1.00 50.07  ?  269 LYS A C     1 
ATOM   1231  O  O     . LYS A  1 163 ? 88.495  41.879  -41.771  1.00 48.00  ?  269 LYS A O     1 
ATOM   1232  C  CB    . LYS A  1 163 ? 90.735  43.342  -39.838  1.00 52.58  ?  269 LYS A CB    1 
ATOM   1233  C  CG    . LYS A  1 163 ? 91.899  44.321  -39.968  1.00 54.11  ?  269 LYS A CG    1 
ATOM   1234  C  CD    . LYS A  1 163 ? 93.046  43.935  -39.045  1.00 56.00  ?  269 LYS A CD    1 
ATOM   1235  C  CE    . LYS A  1 163 ? 94.291  44.786  -39.269  1.00 57.51  ?  269 LYS A CE    1 
ATOM   1236  N  NZ    . LYS A  1 163 ? 95.505  44.122  -38.686  1.00 58.98  ?  269 LYS A NZ    1 
ATOM   1237  N  N     . GLU A  1 164 ? 87.854  42.222  -39.652  1.00 51.87  ?  270 GLU A N     1 
ATOM   1238  C  CA    . GLU A  1 164 ? 86.938  41.093  -39.623  1.00 53.36  ?  270 GLU A CA    1 
ATOM   1239  C  C     . GLU A  1 164 ? 85.807  41.210  -40.644  1.00 52.08  ?  270 GLU A C     1 
ATOM   1240  O  O     . GLU A  1 164 ? 85.411  40.201  -41.224  1.00 53.13  ?  270 GLU A O     1 
ATOM   1241  C  CB    . GLU A  1 164 ? 86.357  40.902  -38.228  1.00 56.19  ?  270 GLU A CB    1 
ATOM   1242  C  CG    . GLU A  1 164 ? 87.313  40.291  -37.229  1.00 58.44  ?  270 GLU A CG    1 
ATOM   1243  C  CD    . GLU A  1 164 ? 86.711  40.160  -35.835  1.00 60.18  ?  270 GLU A CD    1 
ATOM   1244  O  OE1   . GLU A  1 164 ? 85.808  40.948  -35.471  1.00 58.96  ?  270 GLU A OE1   1 
ATOM   1245  O  OE2   . GLU A  1 164 ? 87.144  39.252  -35.096  1.00 62.51  ?  270 GLU A OE2   1 
ATOM   1246  N  N     . GLN A  1 165 ? 85.284  42.418  -40.857  1.00 49.56  ?  271 GLN A N     1 
ATOM   1247  C  CA    . GLN A  1 165 ? 84.268  42.636  -41.903  1.00 47.42  ?  271 GLN A CA    1 
ATOM   1248  C  C     . GLN A  1 165 ? 84.795  42.197  -43.273  1.00 48.10  ?  271 GLN A C     1 
ATOM   1249  O  O     . GLN A  1 165 ? 84.064  41.577  -44.053  1.00 46.94  ?  271 GLN A O     1 
ATOM   1250  C  CB    . GLN A  1 165 ? 83.794  44.103  -41.958  1.00 44.83  ?  271 GLN A CB    1 
ATOM   1251  C  CG    . GLN A  1 165 ? 82.721  44.438  -40.934  1.00 43.26  ?  271 GLN A CG    1 
ATOM   1252  C  CD    . GLN A  1 165 ? 82.378  45.923  -40.910  1.00 41.91  ?  271 GLN A CD    1 
ATOM   1253  O  OE1   . GLN A  1 165 ? 83.132  46.747  -40.389  1.00 41.31  ?  271 GLN A OE1   1 
ATOM   1254  N  NE2   . GLN A  1 165 ? 81.229  46.268  -41.461  1.00 40.65  ?  271 GLN A NE2   1 
ATOM   1255  N  N     . ILE A  1 166 ? 86.072  42.488  -43.529  1.00 49.90  ?  272 ILE A N     1 
ATOM   1256  C  CA    . ILE A  1 166 ? 86.687  42.275  -44.838  1.00 51.52  ?  272 ILE A CA    1 
ATOM   1257  C  C     . ILE A  1 166 ? 86.982  40.808  -45.116  1.00 52.53  ?  272 ILE A C     1 
ATOM   1258  O  O     . ILE A  1 166 ? 86.540  40.275  -46.133  1.00 50.37  ?  272 ILE A O     1 
ATOM   1259  C  CB    . ILE A  1 166 ? 87.970  43.133  -45.001  1.00 52.68  ?  272 ILE A CB    1 
ATOM   1260  C  CG1   . ILE A  1 166 ? 87.604  44.629  -44.922  1.00 54.63  ?  272 ILE A CG1   1 
ATOM   1261  C  CG2   . ILE A  1 166 ? 88.632  42.865  -46.358  1.00 51.69  ?  272 ILE A CG2   1 
ATOM   1262  C  CD1   . ILE A  1 166 ? 88.787  45.561  -44.746  1.00 55.07  ?  272 ILE A CD1   1 
ATOM   1263  N  N     . VAL A  1 167 ? 87.732  40.172  -44.218  1.00 56.64  ?  273 VAL A N     1 
ATOM   1264  C  CA    . VAL A  1 167 ? 88.205  38.773  -44.411  1.00 59.91  ?  273 VAL A CA    1 
ATOM   1265  C  C     . VAL A  1 167 ? 87.462  37.701  -43.625  1.00 62.13  ?  273 VAL A C     1 
ATOM   1266  O  O     . VAL A  1 167 ? 87.710  36.513  -43.821  1.00 61.77  ?  273 VAL A O     1 
ATOM   1267  C  CB    . VAL A  1 167 ? 89.714  38.585  -44.094  1.00 61.50  ?  273 VAL A CB    1 
ATOM   1268  C  CG1   . VAL A  1 167 ? 90.571  39.356  -45.102  1.00 62.02  ?  273 VAL A CG1   1 
ATOM   1269  C  CG2   . VAL A  1 167 ? 90.046  38.965  -42.647  1.00 61.61  ?  273 VAL A CG2   1 
ATOM   1270  N  N     . GLY A  1 168 ? 86.564  38.103  -42.734  1.00 64.51  ?  274 GLY A N     1 
ATOM   1271  C  CA    . GLY A  1 168 ? 85.941  37.155  -41.803  1.00 66.12  ?  274 GLY A CA    1 
ATOM   1272  C  C     . GLY A  1 168 ? 86.808  37.016  -40.560  1.00 68.61  ?  274 GLY A C     1 
ATOM   1273  O  O     . GLY A  1 168 ? 87.665  37.880  -40.311  1.00 69.61  ?  274 GLY A O     1 
ATOM   1274  N  N     . PRO A  1 169 ? 86.613  35.949  -39.775  1.00 70.07  ?  275 PRO A N     1 
ATOM   1275  C  CA    . PRO A  1 169 ? 87.255  35.898  -38.451  1.00 70.68  ?  275 PRO A CA    1 
ATOM   1276  C  C     . PRO A  1 169 ? 88.761  35.701  -38.465  1.00 72.44  ?  275 PRO A C     1 
ATOM   1277  O  O     . PRO A  1 169 ? 89.267  34.877  -39.234  1.00 74.83  ?  275 PRO A O     1 
ATOM   1278  C  CB    . PRO A  1 169 ? 86.566  34.716  -37.745  1.00 69.67  ?  275 PRO A CB    1 
ATOM   1279  C  CG    . PRO A  1 169 ? 85.375  34.375  -38.582  1.00 69.36  ?  275 PRO A CG    1 
ATOM   1280  C  CD    . PRO A  1 169 ? 85.720  34.797  -39.989  1.00 69.19  ?  275 PRO A CD    1 
ATOM   1281  N  N     . LEU A  1 170 ? 89.466  36.442  -37.618  1.00 73.53  ?  276 LEU A N     1 
ATOM   1282  C  CA    . LEU A  1 170 ? 90.917  36.345  -37.546  1.00 75.53  ?  276 LEU A CA    1 
ATOM   1283  C  C     . LEU A  1 170 ? 91.426  35.110  -36.760  1.00 79.68  ?  276 LEU A C     1 
ATOM   1284  O  O     . LEU A  1 170 ? 92.624  35.035  -36.543  1.00 81.87  ?  276 LEU A O     1 
ATOM   1285  C  CB    . LEU A  1 170 ? 91.517  37.676  -37.032  1.00 74.76  ?  276 LEU A CB    1 
ATOM   1286  C  CG    . LEU A  1 170 ? 91.079  38.991  -37.678  1.00 73.00  ?  276 LEU A CG    1 
ATOM   1287  C  CD1   . LEU A  1 170 ? 91.665  40.190  -36.957  1.00 73.26  ?  276 LEU A CD1   1 
ATOM   1288  C  CD2   . LEU A  1 170 ? 91.463  39.032  -39.117  1.00 72.11  ?  276 LEU A CD2   1 
ATOM   1289  N  N     . GLU A  1 171 ? 90.565  34.147  -36.378  1.00 81.66  ?  277 GLU A N     1 
ATOM   1290  C  CA    . GLU A  1 171 ? 91.046  32.920  -35.678  1.00 80.32  ?  277 GLU A CA    1 
ATOM   1291  C  C     . GLU A  1 171 ? 90.166  31.741  -36.079  1.00 79.13  ?  277 GLU A C     1 
ATOM   1292  O  O     . GLU A  1 171 ? 90.294  30.634  -35.558  1.00 76.72  ?  277 GLU A O     1 
ATOM   1293  C  CB    . GLU A  1 171 ? 91.072  33.023  -34.148  1.00 79.60  ?  277 GLU A CB    1 
ATOM   1294  C  CG    . GLU A  1 171 ? 92.202  33.836  -33.529  1.00 78.87  ?  277 GLU A CG    1 
ATOM   1295  C  CD    . GLU A  1 171 ? 91.706  35.081  -32.809  1.00 77.53  ?  277 GLU A CD    1 
ATOM   1296  O  OE1   . GLU A  1 171 ? 92.452  35.638  -31.973  1.00 76.34  ?  277 GLU A OE1   1 
ATOM   1297  O  OE2   . GLU A  1 171 ? 90.562  35.515  -33.048  1.00 76.22  ?  277 GLU A OE2   1 
ATOM   1298  N  N     . LEU A  1 178 ? 80.511  28.213  -31.232  1.00 65.66  ?  284 LEU A N     1 
ATOM   1299  C  CA    . LEU A  1 178 ? 80.681  29.464  -30.444  1.00 67.77  ?  284 LEU A CA    1 
ATOM   1300  C  C     . LEU A  1 178 ? 80.971  30.668  -31.363  1.00 70.14  ?  284 LEU A C     1 
ATOM   1301  O  O     . LEU A  1 178 ? 81.278  30.499  -32.537  1.00 73.74  ?  284 LEU A O     1 
ATOM   1302  C  CB    . LEU A  1 178 ? 81.795  29.359  -29.397  1.00 66.99  ?  284 LEU A CB    1 
ATOM   1303  C  CG    . LEU A  1 178 ? 81.678  28.237  -28.361  1.00 66.29  ?  284 LEU A CG    1 
ATOM   1304  C  CD1   . LEU A  1 178 ? 83.008  27.941  -27.687  1.00 65.74  ?  284 LEU A CD1   1 
ATOM   1305  C  CD2   . LEU A  1 178 ? 80.602  28.610  -27.361  1.00 65.98  ?  284 LEU A CD2   1 
ATOM   1306  N  N     . TRP A  1 179 ? 80.796  31.866  -30.818  1.00 72.14  ?  285 TRP A N     1 
ATOM   1307  C  CA    . TRP A  1 179 ? 80.884  33.129  -31.583  1.00 73.39  ?  285 TRP A CA    1 
ATOM   1308  C  C     . TRP A  1 179 ? 82.335  33.460  -31.989  1.00 74.40  ?  285 TRP A C     1 
ATOM   1309  O  O     . TRP A  1 179 ? 83.147  33.795  -31.124  1.00 75.16  ?  285 TRP A O     1 
ATOM   1310  C  CB    . TRP A  1 179 ? 80.308  34.271  -30.737  1.00 74.41  ?  285 TRP A CB    1 
ATOM   1311  C  CG    . TRP A  1 179 ? 80.357  35.650  -31.353  1.00 74.82  ?  285 TRP A CG    1 
ATOM   1312  C  CD1   . TRP A  1 179 ? 81.010  36.755  -30.866  1.00 75.71  ?  285 TRP A CD1   1 
ATOM   1313  C  CD2   . TRP A  1 179 ? 79.716  36.073  -32.558  1.00 74.90  ?  285 TRP A CD2   1 
ATOM   1314  N  NE1   . TRP A  1 179 ? 80.817  37.832  -31.692  1.00 74.94  ?  285 TRP A NE1   1 
ATOM   1315  C  CE2   . TRP A  1 179 ? 80.026  37.442  -32.741  1.00 75.44  ?  285 TRP A CE2   1 
ATOM   1316  C  CE3   . TRP A  1 179 ? 78.903  35.432  -33.504  1.00 75.29  ?  285 TRP A CE3   1 
ATOM   1317  C  CZ2   . TRP A  1 179 ? 79.561  38.173  -33.836  1.00 76.17  ?  285 TRP A CZ2   1 
ATOM   1318  C  CZ3   . TRP A  1 179 ? 78.457  36.161  -34.584  1.00 76.37  ?  285 TRP A CZ3   1 
ATOM   1319  C  CH2   . TRP A  1 179 ? 78.787  37.528  -34.736  1.00 76.34  ?  285 TRP A CH2   1 
ATOM   1320  N  N     . PRO A  1 180 ? 82.657  33.406  -33.294  1.00 74.58  ?  286 PRO A N     1 
ATOM   1321  C  CA    . PRO A  1 180 ? 84.054  33.552  -33.732  1.00 73.12  ?  286 PRO A CA    1 
ATOM   1322  C  C     . PRO A  1 180 ? 84.662  34.968  -33.760  1.00 71.59  ?  286 PRO A C     1 
ATOM   1323  O  O     . PRO A  1 180 ? 85.876  35.079  -33.938  1.00 76.41  ?  286 PRO A O     1 
ATOM   1324  C  CB    . PRO A  1 180 ? 84.029  32.996  -35.166  1.00 74.71  ?  286 PRO A CB    1 
ATOM   1325  C  CG    . PRO A  1 180 ? 82.659  33.294  -35.653  1.00 75.25  ?  286 PRO A CG    1 
ATOM   1326  C  CD    . PRO A  1 180 ? 81.751  33.199  -34.445  1.00 75.80  ?  286 PRO A CD    1 
ATOM   1327  N  N     . TYR A  1 181 ? 83.863  36.024  -33.600  1.00 66.68  ?  287 TYR A N     1 
ATOM   1328  C  CA    . TYR A  1 181 ? 84.362  37.390  -33.777  1.00 63.12  ?  287 TYR A CA    1 
ATOM   1329  C  C     . TYR A  1 181 ? 84.776  38.014  -32.442  1.00 60.94  ?  287 TYR A C     1 
ATOM   1330  O  O     . TYR A  1 181 ? 84.083  37.862  -31.439  1.00 60.45  ?  287 TYR A O     1 
ATOM   1331  C  CB    . TYR A  1 181 ? 83.319  38.255  -34.495  1.00 61.67  ?  287 TYR A CB    1 
ATOM   1332  C  CG    . TYR A  1 181 ? 83.036  37.803  -35.921  1.00 60.59  ?  287 TYR A CG    1 
ATOM   1333  C  CD1   . TYR A  1 181 ? 83.858  38.181  -36.980  1.00 59.93  ?  287 TYR A CD1   1 
ATOM   1334  C  CD2   . TYR A  1 181 ? 81.948  36.981  -36.213  1.00 60.25  ?  287 TYR A CD2   1 
ATOM   1335  C  CE1   . TYR A  1 181 ? 83.608  37.770  -38.286  1.00 59.35  ?  287 TYR A CE1   1 
ATOM   1336  C  CE2   . TYR A  1 181 ? 81.684  36.557  -37.517  1.00 60.03  ?  287 TYR A CE2   1 
ATOM   1337  C  CZ    . TYR A  1 181 ? 82.515  36.961  -38.552  1.00 59.26  ?  287 TYR A CZ    1 
ATOM   1338  O  OH    . TYR A  1 181 ? 82.248  36.534  -39.839  1.00 59.29  ?  287 TYR A OH    1 
ATOM   1339  N  N     . LYS A  1 182 ? 85.934  38.682  -32.442  1.00 58.56  ?  288 LYS A N     1 
ATOM   1340  C  CA    . LYS A  1 182 ? 86.406  39.452  -31.300  1.00 58.14  ?  288 LYS A CA    1 
ATOM   1341  C  C     . LYS A  1 182 ? 86.046  40.947  -31.432  1.00 59.01  ?  288 LYS A C     1 
ATOM   1342  O  O     . LYS A  1 182 ? 86.078  41.667  -30.440  1.00 61.67  ?  288 LYS A O     1 
ATOM   1343  C  CB    . LYS A  1 182 ? 87.913  39.283  -31.126  1.00 55.91  ?  288 LYS A CB    1 
ATOM   1344  N  N     . GLY A  1 183 ? 85.671  41.398  -32.632  1.00 58.76  ?  289 GLY A N     1 
ATOM   1345  C  CA    . GLY A  1 183 ? 85.421  42.811  -32.896  1.00 58.49  ?  289 GLY A CA    1 
ATOM   1346  C  C     . GLY A  1 183 ? 84.110  43.337  -32.337  1.00 58.04  ?  289 GLY A C     1 
ATOM   1347  O  O     . GLY A  1 183 ? 84.060  44.444  -31.805  1.00 57.70  ?  289 GLY A O     1 
ATOM   1348  N  N     . ARG A  1 184 ? 83.050  42.550  -32.487  1.00 57.11  ?  290 ARG A N     1 
ATOM   1349  C  CA    . ARG A  1 184 ? 81.726  42.887  -31.950  1.00 56.37  ?  290 ARG A CA    1 
ATOM   1350  C  C     . ARG A  1 184 ? 81.057  41.663  -31.345  1.00 59.44  ?  290 ARG A C     1 
ATOM   1351  O  O     . ARG A  1 184 ? 81.355  40.544  -31.749  1.00 59.12  ?  290 ARG A O     1 
ATOM   1352  C  CB    . ARG A  1 184 ? 80.815  43.444  -33.051  1.00 52.62  ?  290 ARG A CB    1 
ATOM   1353  C  CG    . ARG A  1 184 ? 81.154  44.853  -33.519  1.00 50.57  ?  290 ARG A CG    1 
ATOM   1354  C  CD    . ARG A  1 184 ? 80.785  45.882  -32.477  1.00 50.02  ?  290 ARG A CD    1 
ATOM   1355  N  NE    . ARG A  1 184 ? 80.997  47.240  -32.962  1.00 49.17  ?  290 ARG A NE    1 
ATOM   1356  C  CZ    . ARG A  1 184 ? 82.180  47.849  -33.150  1.00 49.14  ?  290 ARG A CZ    1 
ATOM   1357  N  NH1   . ARG A  1 184 ? 82.181  49.095  -33.609  1.00 48.92  ?  290 ARG A NH1   1 
ATOM   1358  N  NH2   . ARG A  1 184 ? 83.386  47.261  -32.926  1.00 49.50  ?  290 ARG A NH2   1 
ATOM   1359  N  N     . PRO A  1 185 ? 80.140  41.865  -30.384  1.00 63.63  ?  291 PRO A N     1 
ATOM   1360  C  CA    . PRO A  1 185 ? 79.372  40.754  -29.791  1.00 66.60  ?  291 PRO A CA    1 
ATOM   1361  C  C     . PRO A  1 185 ? 78.289  40.176  -30.717  1.00 69.77  ?  291 PRO A C     1 
ATOM   1362  O  O     . PRO A  1 185 ? 78.051  40.718  -31.797  1.00 73.44  ?  291 PRO A O     1 
ATOM   1363  C  CB    . PRO A  1 185 ? 78.731  41.397  -28.562  1.00 66.70  ?  291 PRO A CB    1 
ATOM   1364  C  CG    . PRO A  1 185 ? 78.605  42.844  -28.921  1.00 65.55  ?  291 PRO A CG    1 
ATOM   1365  C  CD    . PRO A  1 185 ? 79.819  43.156  -29.743  1.00 63.96  ?  291 PRO A CD    1 
ATOM   1366  N  N     . GLU A  1 186 ? 77.642  39.096  -30.276  1.00 72.17  ?  292 GLU A N     1 
ATOM   1367  C  CA    . GLU A  1 186 ? 76.601  38.399  -31.067  1.00 74.10  ?  292 GLU A CA    1 
ATOM   1368  C  C     . GLU A  1 186 ? 75.361  39.221  -31.382  1.00 69.46  ?  292 GLU A C     1 
ATOM   1369  O  O     . GLU A  1 186 ? 74.691  38.993  -32.389  1.00 64.48  ?  292 GLU A O     1 
ATOM   1370  C  CB    . GLU A  1 186 ? 76.125  37.127  -30.379  1.00 80.39  ?  292 GLU A CB    1 
ATOM   1371  C  CG    . GLU A  1 186 ? 77.138  36.014  -30.268  1.00 85.51  ?  292 GLU A CG    1 
ATOM   1372  C  CD    . GLU A  1 186 ? 76.625  34.834  -29.464  1.00 89.87  ?  292 GLU A CD    1 
ATOM   1373  O  OE1   . GLU A  1 186 ? 75.385  34.671  -29.312  1.00 92.81  ?  292 GLU A OE1   1 
ATOM   1374  O  OE2   . GLU A  1 186 ? 77.444  34.050  -28.965  1.00 93.63  ?  292 GLU A OE2   1 
ATOM   1375  N  N     . ASN A  1 187 ? 75.042  40.146  -30.485  1.00 68.73  ?  293 ASN A N     1 
ATOM   1376  C  CA    . ASN A  1 187 ? 73.892  41.051  -30.655  1.00 68.71  ?  293 ASN A CA    1 
ATOM   1377  C  C     . ASN A  1 187 ? 74.092  42.116  -31.745  1.00 64.12  ?  293 ASN A C     1 
ATOM   1378  O  O     . ASN A  1 187 ? 73.191  42.921  -31.976  1.00 64.07  ?  293 ASN A O     1 
ATOM   1379  C  CB    . ASN A  1 187 ? 73.477  41.693  -29.312  1.00 71.92  ?  293 ASN A CB    1 
ATOM   1380  C  CG    . ASN A  1 187 ? 74.568  42.574  -28.699  1.00 75.22  ?  293 ASN A CG    1 
ATOM   1381  O  OD1   . ASN A  1 187 ? 75.219  43.364  -29.378  1.00 77.06  ?  293 ASN A OD1   1 
ATOM   1382  N  ND2   . ASN A  1 187 ? 74.747  42.448  -27.392  1.00 77.44  ?  293 ASN A ND2   1 
ATOM   1383  N  N     . LYS A  1 188 ? 75.264  42.148  -32.371  1.00 59.86  ?  294 LYS A N     1 
ATOM   1384  C  CA    . LYS A  1 188 ? 75.510  42.973  -33.544  1.00 57.76  ?  294 LYS A CA    1 
ATOM   1385  C  C     . LYS A  1 188 ? 76.161  42.166  -34.685  1.00 55.63  ?  294 LYS A C     1 
ATOM   1386  O  O     . LYS A  1 188 ? 76.989  42.694  -35.431  1.00 54.58  ?  294 LYS A O     1 
ATOM   1387  C  CB    . LYS A  1 188 ? 76.366  44.178  -33.168  1.00 58.22  ?  294 LYS A CB    1 
ATOM   1388  C  CG    . LYS A  1 188 ? 75.627  45.247  -32.390  1.00 58.05  ?  294 LYS A CG    1 
ATOM   1389  C  CD    . LYS A  1 188 ? 76.605  46.347  -31.993  1.00 58.04  ?  294 LYS A CD    1 
ATOM   1390  C  CE    . LYS A  1 188 ? 75.917  47.531  -31.364  1.00 57.20  ?  294 LYS A CE    1 
ATOM   1391  N  NZ    . LYS A  1 188 ? 76.929  48.411  -30.734  1.00 56.26  ?  294 LYS A NZ    1 
ATOM   1392  N  N     . SER A  1 189 ? 75.768  40.900  -34.843  1.00 53.01  ?  295 SER A N     1 
ATOM   1393  C  CA    . SER A  1 189 ? 76.287  40.064  -35.932  1.00 50.80  ?  295 SER A CA    1 
ATOM   1394  C  C     . SER A  1 189 ? 75.850  40.538  -37.322  1.00 48.84  ?  295 SER A C     1 
ATOM   1395  O  O     . SER A  1 189 ? 76.538  40.326  -38.318  1.00 47.33  ?  295 SER A O     1 
ATOM   1396  C  CB    . SER A  1 189 ? 75.857  38.613  -35.757  1.00 51.12  ?  295 SER A CB    1 
ATOM   1397  O  OG    . SER A  1 189 ? 74.475  38.479  -35.893  1.00 50.94  ?  295 SER A OG    1 
ATOM   1398  N  N     . PHE A  1 190 ? 74.675  41.150  -37.379  1.00 47.93  ?  296 PHE A N     1 
ATOM   1399  C  CA    . PHE A  1 190 ? 74.154  41.732  -38.619  1.00 47.30  ?  296 PHE A CA    1 
ATOM   1400  C  C     . PHE A  1 190 ? 75.124  42.684  -39.302  1.00 45.90  ?  296 PHE A C     1 
ATOM   1401  O  O     . PHE A  1 190 ? 75.153  42.756  -40.520  1.00 44.64  ?  296 PHE A O     1 
ATOM   1402  C  CB    . PHE A  1 190 ? 72.795  42.413  -38.400  1.00 47.70  ?  296 PHE A CB    1 
ATOM   1403  C  CG    . PHE A  1 190 ? 72.817  43.535  -37.406  1.00 48.27  ?  296 PHE A CG    1 
ATOM   1404  C  CD1   . PHE A  1 190 ? 73.147  44.830  -37.809  1.00 48.56  ?  296 PHE A CD1   1 
ATOM   1405  C  CD2   . PHE A  1 190 ? 72.462  43.316  -36.083  1.00 49.30  ?  296 PHE A CD2   1 
ATOM   1406  C  CE1   . PHE A  1 190 ? 73.150  45.874  -36.891  1.00 49.56  ?  296 PHE A CE1   1 
ATOM   1407  C  CE2   . PHE A  1 190 ? 72.460  44.367  -35.173  1.00 49.85  ?  296 PHE A CE2   1 
ATOM   1408  C  CZ    . PHE A  1 190 ? 72.829  45.636  -35.568  1.00 49.97  ?  296 PHE A CZ    1 
ATOM   1409  N  N     . LEU A  1 191 ? 75.938  43.398  -38.519  1.00 45.13  ?  297 LEU A N     1 
ATOM   1410  C  CA    . LEU A  1 191 ? 76.939  44.295  -39.091  1.00 45.07  ?  297 LEU A CA    1 
ATOM   1411  C  C     . LEU A  1 191 ? 77.954  43.577  -39.999  1.00 45.31  ?  297 LEU A C     1 
ATOM   1412  O  O     . LEU A  1 191 ? 78.415  44.146  -40.996  1.00 45.50  ?  297 LEU A O     1 
ATOM   1413  C  CB    . LEU A  1 191 ? 77.648  45.073  -37.992  1.00 44.60  ?  297 LEU A CB    1 
ATOM   1414  C  CG    . LEU A  1 191 ? 76.822  46.010  -37.108  1.00 44.09  ?  297 LEU A CG    1 
ATOM   1415  C  CD1   . LEU A  1 191 ? 77.679  46.706  -36.051  1.00 44.23  ?  297 LEU A CD1   1 
ATOM   1416  C  CD2   . LEU A  1 191 ? 76.105  47.053  -37.934  1.00 43.76  ?  297 LEU A CD2   1 
ATOM   1417  N  N     . TYR A  1 192 ? 78.284  42.330  -39.670  1.00 45.66  ?  298 TYR A N     1 
ATOM   1418  C  CA    . TYR A  1 192 ? 79.217  41.536  -40.485  1.00 45.34  ?  298 TYR A CA    1 
ATOM   1419  C  C     . TYR A  1 192 ? 78.659  41.105  -41.845  1.00 43.73  ?  298 TYR A C     1 
ATOM   1420  O  O     . TYR A  1 192 ? 79.424  40.740  -42.747  1.00 41.88  ?  298 TYR A O     1 
ATOM   1421  C  CB    . TYR A  1 192 ? 79.729  40.311  -39.715  1.00 46.62  ?  298 TYR A CB    1 
ATOM   1422  C  CG    . TYR A  1 192 ? 80.657  40.661  -38.560  1.00 47.86  ?  298 TYR A CG    1 
ATOM   1423  C  CD1   . TYR A  1 192 ? 81.975  41.009  -38.776  1.00 48.69  ?  298 TYR A CD1   1 
ATOM   1424  C  CD2   . TYR A  1 192 ? 80.210  40.607  -37.246  1.00 48.96  ?  298 TYR A CD2   1 
ATOM   1425  C  CE1   . TYR A  1 192 ? 82.823  41.330  -37.730  1.00 49.88  ?  298 TYR A CE1   1 
ATOM   1426  C  CE2   . TYR A  1 192 ? 81.035  40.927  -36.168  1.00 50.23  ?  298 TYR A CE2   1 
ATOM   1427  C  CZ    . TYR A  1 192 ? 82.351  41.288  -36.412  1.00 50.83  ?  298 TYR A CZ    1 
ATOM   1428  O  OH    . TYR A  1 192 ? 83.192  41.605  -35.366  1.00 53.15  ?  298 TYR A OH    1 
ATOM   1429  N  N     . GLU A  1 193 ? 77.335  41.146  -41.981  1.00 43.16  ?  299 GLU A N     1 
ATOM   1430  C  CA    . GLU A  1 193 ? 76.644  40.819  -43.238  1.00 42.37  ?  299 GLU A CA    1 
ATOM   1431  C  C     . GLU A  1 193 ? 76.526  41.992  -44.247  1.00 39.31  ?  299 GLU A C     1 
ATOM   1432  O  O     . GLU A  1 193 ? 75.934  41.799  -45.316  1.00 37.92  ?  299 GLU A O     1 
ATOM   1433  C  CB    . GLU A  1 193 ? 75.236  40.274  -42.930  1.00 44.94  ?  299 GLU A CB    1 
ATOM   1434  C  CG    . GLU A  1 193 ? 75.203  39.033  -42.033  1.00 47.24  ?  299 GLU A CG    1 
ATOM   1435  C  CD    . GLU A  1 193 ? 73.783  38.472  -41.828  1.00 48.36  ?  299 GLU A CD    1 
ATOM   1436  O  OE1   . GLU A  1 193 ? 72.819  39.261  -41.793  1.00 48.85  ?  299 GLU A OE1   1 
ATOM   1437  O  OE2   . GLU A  1 193 ? 73.603  37.246  -41.678  1.00 49.05  ?  299 GLU A OE2   1 
ATOM   1438  N  N     . ILE A  1 194 ? 77.079  43.175  -43.952  1.00 37.16  ?  300 ILE A N     1 
ATOM   1439  C  CA    . ILE A  1 194 ? 76.898  44.333  -44.834  1.00 36.08  ?  300 ILE A CA    1 
ATOM   1440  C  C     . ILE A  1 194 ? 77.933  44.410  -45.962  1.00 36.48  ?  300 ILE A C     1 
ATOM   1441  O  O     . ILE A  1 194 ? 77.581  44.457  -47.140  1.00 35.93  ?  300 ILE A O     1 
ATOM   1442  C  CB    . ILE A  1 194 ? 76.878  45.642  -44.032  1.00 35.28  ?  300 ILE A CB    1 
ATOM   1443  C  CG1   . ILE A  1 194 ? 75.632  45.649  -43.149  1.00 35.32  ?  300 ILE A CG1   1 
ATOM   1444  C  CG2   . ILE A  1 194 ? 76.883  46.872  -44.958  1.00 34.85  ?  300 ILE A CG2   1 
ATOM   1445  C  CD1   . ILE A  1 194 ? 75.563  46.795  -42.159  1.00 35.61  ?  300 ILE A CD1   1 
ATOM   1446  N  N     . VAL A  1 195 ? 79.204  44.421  -45.592  1.00 37.16  ?  301 VAL A N     1 
ATOM   1447  C  CA    . VAL A  1 195 ? 80.281  44.689  -46.550  1.00 37.25  ?  301 VAL A CA    1 
ATOM   1448  C  C     . VAL A  1 195 ? 80.637  43.429  -47.338  1.00 38.40  ?  301 VAL A C     1 
ATOM   1449  O  O     . VAL A  1 195 ? 80.806  43.474  -48.562  1.00 38.50  ?  301 VAL A O     1 
ATOM   1450  C  CB    . VAL A  1 195 ? 81.534  45.230  -45.831  1.00 36.92  ?  301 VAL A CB    1 
ATOM   1451  C  CG1   . VAL A  1 195 ? 82.618  45.597  -46.825  1.00 36.35  ?  301 VAL A CG1   1 
ATOM   1452  C  CG2   . VAL A  1 195 ? 81.177  46.451  -44.976  1.00 37.21  ?  301 VAL A CG2   1 
ATOM   1453  N  N     . SER A  1 196 ? 80.777  42.308  -46.630  1.00 40.38  ?  302 SER A N     1 
ATOM   1454  C  CA    . SER A  1 196 ? 81.146  41.036  -47.233  1.00 41.88  ?  302 SER A CA    1 
ATOM   1455  C  C     . SER A  1 196 ? 80.442  39.909  -46.463  1.00 42.21  ?  302 SER A C     1 
ATOM   1456  O  O     . SER A  1 196 ? 80.867  39.500  -45.372  1.00 41.31  ?  302 SER A O     1 
ATOM   1457  C  CB    . SER A  1 196 ? 82.674  40.888  -47.201  1.00 43.09  ?  302 SER A CB    1 
ATOM   1458  O  OG    . SER A  1 196 ? 83.108  39.885  -48.120  1.00 44.27  ?  302 SER A OG    1 
ATOM   1459  N  N     . ASN A  1 197 ? 79.356  39.425  -47.068  1.00 43.37  ?  303 ASN A N     1 
ATOM   1460  C  CA    . ASN A  1 197 ? 78.395  38.512  -46.440  1.00 44.90  ?  303 ASN A CA    1 
ATOM   1461  C  C     . ASN A  1 197 ? 78.866  37.080  -46.646  1.00 44.95  ?  303 ASN A C     1 
ATOM   1462  O  O     . ASN A  1 197 ? 78.713  36.519  -47.732  1.00 44.45  ?  303 ASN A O     1 
ATOM   1463  C  CB    . ASN A  1 197 ? 76.977  38.743  -47.020  1.00 45.60  ?  303 ASN A CB    1 
ATOM   1464  C  CG    . ASN A  1 197 ? 75.883  37.977  -46.273  1.00 46.73  ?  303 ASN A CG    1 
ATOM   1465  O  OD1   . ASN A  1 197 ? 76.050  36.804  -45.935  1.00 49.41  ?  303 ASN A OD1   1 
ATOM   1466  N  ND2   . ASN A  1 197 ? 74.738  38.637  -46.046  1.00 46.37  ?  303 ASN A ND2   1 
ATOM   1467  N  N     . LYS A  1 198 ? 79.419  36.495  -45.598  1.00 45.94  ?  304 LYS A N     1 
ATOM   1468  C  CA    . LYS A  1 198 ? 79.944  35.127  -45.635  1.00 47.14  ?  304 LYS A CA    1 
ATOM   1469  C  C     . LYS A  1 198 ? 78.814  34.090  -45.679  1.00 47.17  ?  304 LYS A C     1 
ATOM   1470  O  O     . LYS A  1 198 ? 79.020  32.985  -46.160  1.00 45.89  ?  304 LYS A O     1 
ATOM   1471  C  CB    . LYS A  1 198 ? 80.849  34.840  -44.417  1.00 49.35  ?  304 LYS A CB    1 
ATOM   1472  C  CG    . LYS A  1 198 ? 81.904  35.896  -44.066  1.00 51.82  ?  304 LYS A CG    1 
ATOM   1473  C  CD    . LYS A  1 198 ? 82.956  36.016  -45.163  1.00 53.75  ?  304 LYS A CD    1 
ATOM   1474  C  CE    . LYS A  1 198 ? 83.904  37.189  -44.939  1.00 55.08  ?  304 LYS A CE    1 
ATOM   1475  N  NZ    . LYS A  1 198 ? 84.923  37.276  -46.021  1.00 55.81  ?  304 LYS A NZ    1 
ATOM   1476  N  N     . ARG A  1 199 ? 77.626  34.452  -45.174  1.00 49.82  ?  305 ARG A N     1 
ATOM   1477  C  CA    . ARG A  1 199 ? 76.497  33.517  -45.030  1.00 51.53  ?  305 ARG A CA    1 
ATOM   1478  C  C     . ARG A  1 199 ? 75.894  33.127  -46.377  1.00 50.21  ?  305 ARG A C     1 
ATOM   1479  O  O     . ARG A  1 199 ? 75.766  31.937  -46.679  1.00 53.10  ?  305 ARG A O     1 
ATOM   1480  C  CB    . ARG A  1 199 ? 75.404  34.121  -44.132  1.00 54.30  ?  305 ARG A CB    1 
ATOM   1481  C  CG    . ARG A  1 199 ? 74.571  33.117  -43.367  1.00 56.94  ?  305 ARG A CG    1 
ATOM   1482  C  CD    . ARG A  1 199 ? 73.969  33.617  -42.077  1.00 59.73  ?  305 ARG A CD    1 
ATOM   1483  N  NE    . ARG A  1 199 ? 74.882  33.798  -40.951  1.00 63.89  ?  305 ARG A NE    1 
ATOM   1484  C  CZ    . ARG A  1 199 ? 75.551  32.822  -40.297  1.00 67.73  ?  305 ARG A CZ    1 
ATOM   1485  N  NH1   . ARG A  1 199 ? 75.378  31.523  -40.591  1.00 70.00  ?  305 ARG A NH1   1 
ATOM   1486  N  NH2   . ARG A  1 199 ? 76.349  33.130  -39.275  1.00 68.28  ?  305 ARG A NH2   1 
ATOM   1487  N  N     . ASN A  1 200 ? 75.515  34.145  -47.152  1.00 46.69  ?  306 ASN A N     1 
ATOM   1488  C  CA    . ASN A  1 200 ? 74.820  33.961  -48.437  1.00 43.67  ?  306 ASN A CA    1 
ATOM   1489  C  C     . ASN A  1 200 ? 75.408  34.723  -49.631  1.00 41.20  ?  306 ASN A C     1 
ATOM   1490  O  O     . ASN A  1 200 ? 75.073  34.414  -50.779  1.00 41.22  ?  306 ASN A O     1 
ATOM   1491  C  CB    . ASN A  1 200 ? 73.329  34.292  -48.290  1.00 43.30  ?  306 ASN A CB    1 
ATOM   1492  C  CG    . ASN A  1 200 ? 73.086  35.660  -47.661  1.00 43.03  ?  306 ASN A CG    1 
ATOM   1493  O  OD1   . ASN A  1 200 ? 73.669  36.654  -48.086  1.00 42.77  ?  306 ASN A OD1   1 
ATOM   1494  N  ND2   . ASN A  1 200 ? 72.213  35.712  -46.648  1.00 41.97  ?  306 ASN A ND2   1 
ATOM   1495  N  N     . GLY A  1 201 ? 76.262  35.715  -49.378  1.00 38.87  ?  307 GLY A N     1 
ATOM   1496  C  CA    . GLY A  1 201 ? 76.872  36.487  -50.454  1.00 37.01  ?  307 GLY A CA    1 
ATOM   1497  C  C     . GLY A  1 201 ? 76.145  37.766  -50.833  1.00 35.02  ?  307 GLY A C     1 
ATOM   1498  O  O     . GLY A  1 201 ? 76.654  38.530  -51.647  1.00 33.82  ?  307 GLY A O     1 
ATOM   1499  N  N     . ILE A  1 202 ? 74.969  38.022  -50.256  1.00 33.77  ?  308 ILE A N     1 
ATOM   1500  C  CA    . ILE A  1 202 ? 74.241  39.262  -50.530  1.00 32.99  ?  308 ILE A CA    1 
ATOM   1501  C  C     . ILE A  1 202 ? 74.901  40.379  -49.712  1.00 32.71  ?  308 ILE A C     1 
ATOM   1502  O  O     . ILE A  1 202 ? 74.689  40.473  -48.500  1.00 33.21  ?  308 ILE A O     1 
ATOM   1503  C  CB    . ILE A  1 202 ? 72.740  39.120  -50.204  1.00 32.99  ?  308 ILE A CB    1 
ATOM   1504  C  CG1   . ILE A  1 202 ? 72.125  37.988  -51.050  1.00 32.58  ?  308 ILE A CG1   1 
ATOM   1505  C  CG2   . ILE A  1 202 ? 71.990  40.430  -50.472  1.00 33.22  ?  308 ILE A CG2   1 
ATOM   1506  C  CD1   . ILE A  1 202 ? 70.840  37.431  -50.480  1.00 32.67  ?  308 ILE A CD1   1 
ATOM   1507  N  N     . ASP A  1 203 ? 75.726  41.194  -50.385  1.00 31.98  ?  309 ASP A N     1 
ATOM   1508  C  CA    . ASP A  1 203 ? 76.452  42.316  -49.756  1.00 31.53  ?  309 ASP A CA    1 
ATOM   1509  C  C     . ASP A  1 203 ? 76.424  43.570  -50.643  1.00 30.51  ?  309 ASP A C     1 
ATOM   1510  O  O     . ASP A  1 203 ? 76.049  43.499  -51.823  1.00 30.01  ?  309 ASP A O     1 
ATOM   1511  C  CB    . ASP A  1 203 ? 77.896  41.919  -49.364  1.00 32.02  ?  309 ASP A CB    1 
ATOM   1512  C  CG    . ASP A  1 203 ? 78.709  41.248  -50.518  1.00 32.45  ?  309 ASP A CG    1 
ATOM   1513  O  OD1   . ASP A  1 203 ? 78.790  41.810  -51.632  1.00 32.44  ?  309 ASP A OD1   1 
ATOM   1514  O  OD2   . ASP A  1 203 ? 79.319  40.170  -50.300  1.00 33.04  ?  309 ASP A OD2   1 
ATOM   1515  N  N     . VAL A  1 204 ? 76.812  44.712  -50.078  1.00 29.83  ?  310 VAL A N     1 
ATOM   1516  C  CA    . VAL A  1 204 ? 76.806  45.973  -50.835  1.00 29.77  ?  310 VAL A CA    1 
ATOM   1517  C  C     . VAL A  1 204 ? 77.959  46.063  -51.851  1.00 29.91  ?  310 VAL A C     1 
ATOM   1518  O  O     . VAL A  1 204 ? 77.907  46.880  -52.765  1.00 30.26  ?  310 VAL A O     1 
ATOM   1519  C  CB    . VAL A  1 204 ? 76.788  47.238  -49.921  1.00 29.79  ?  310 VAL A CB    1 
ATOM   1520  C  CG1   . VAL A  1 204 ? 75.660  47.173  -48.906  1.00 29.93  ?  310 VAL A CG1   1 
ATOM   1521  C  CG2   . VAL A  1 204 ? 78.115  47.466  -49.210  1.00 30.06  ?  310 VAL A CG2   1 
ATOM   1522  N  N     . ASP A  1 205 ? 78.995  45.238  -51.674  1.00 29.81  ?  311 ASP A N     1 
ATOM   1523  C  CA    . ASP A  1 205 ? 80.068  45.073  -52.675  1.00 29.14  ?  311 ASP A CA    1 
ATOM   1524  C  C     . ASP A  1 205 ? 79.421  44.749  -54.021  1.00 28.45  ?  311 ASP A C     1 
ATOM   1525  O  O     . ASP A  1 205 ? 79.651  45.446  -55.006  1.00 28.52  ?  311 ASP A O     1 
ATOM   1526  C  CB    . ASP A  1 205 ? 81.054  43.961  -52.240  1.00 29.23  ?  311 ASP A CB    1 
ATOM   1527  C  CG    . ASP A  1 205 ? 82.339  43.916  -53.062  1.00 29.28  ?  311 ASP A CG    1 
ATOM   1528  O  OD1   . ASP A  1 205 ? 82.771  44.941  -53.642  1.00 28.38  ?  311 ASP A OD1   1 
ATOM   1529  O  OD2   . ASP A  1 205 ? 82.944  42.829  -53.115  1.00 30.21  ?  311 ASP A OD2   1 
ATOM   1530  N  N     . LYS A  1 206 ? 78.570  43.721  -54.027  1.00 27.76  ?  312 LYS A N     1 
ATOM   1531  C  CA    . LYS A  1 206 ? 77.827  43.326  -55.239  1.00 27.20  ?  312 LYS A CA    1 
ATOM   1532  C  C     . LYS A  1 206 ? 76.957  44.446  -55.785  1.00 26.17  ?  312 LYS A C     1 
ATOM   1533  O  O     . LYS A  1 206 ? 76.967  44.711  -56.983  1.00 25.18  ?  312 LYS A O     1 
ATOM   1534  C  CB    . LYS A  1 206 ? 76.990  42.060  -55.010  1.00 27.74  ?  312 LYS A CB    1 
ATOM   1535  C  CG    . LYS A  1 206 ? 77.819  40.782  -55.016  1.00 28.12  ?  312 LYS A CG    1 
ATOM   1536  C  CD    . LYS A  1 206 ? 76.981  39.526  -54.782  1.00 28.45  ?  312 LYS A CD    1 
ATOM   1537  C  CE    . LYS A  1 206 ? 77.843  38.268  -54.570  1.00 28.61  ?  312 LYS A CE    1 
ATOM   1538  N  NZ    . LYS A  1 206 ? 78.735  38.305  -53.348  1.00 28.75  ?  312 LYS A NZ    1 
ATOM   1539  N  N     . TRP A  1 207 ? 76.238  45.118  -54.896  1.00 25.72  ?  313 TRP A N     1 
ATOM   1540  C  CA    . TRP A  1 207 ? 75.264  46.119  -55.321  1.00 25.46  ?  313 TRP A CA    1 
ATOM   1541  C  C     . TRP A  1 207 ? 75.911  47.276  -56.062  1.00 25.43  ?  313 TRP A C     1 
ATOM   1542  O  O     . TRP A  1 207 ? 75.357  47.761  -57.050  1.00 25.21  ?  313 TRP A O     1 
ATOM   1543  C  CB    . TRP A  1 207 ? 74.471  46.656  -54.132  1.00 25.29  ?  313 TRP A CB    1 
ATOM   1544  C  CG    . TRP A  1 207 ? 73.710  45.606  -53.373  1.00 25.26  ?  313 TRP A CG    1 
ATOM   1545  C  CD1   . TRP A  1 207 ? 73.484  44.306  -53.738  1.00 25.08  ?  313 TRP A CD1   1 
ATOM   1546  C  CD2   . TRP A  1 207 ? 73.053  45.788  -52.120  1.00 25.52  ?  313 TRP A CD2   1 
ATOM   1547  N  NE1   . TRP A  1 207 ? 72.737  43.671  -52.779  1.00 25.26  ?  313 TRP A NE1   1 
ATOM   1548  C  CE2   . TRP A  1 207 ? 72.455  44.556  -51.776  1.00 25.50  ?  313 TRP A CE2   1 
ATOM   1549  C  CE3   . TRP A  1 207 ? 72.910  46.886  -51.246  1.00 25.70  ?  313 TRP A CE3   1 
ATOM   1550  C  CZ2   . TRP A  1 207 ? 71.738  44.375  -50.585  1.00 25.71  ?  313 TRP A CZ2   1 
ATOM   1551  C  CZ3   . TRP A  1 207 ? 72.186  46.711  -50.068  1.00 25.86  ?  313 TRP A CZ3   1 
ATOM   1552  C  CH2   . TRP A  1 207 ? 71.605  45.463  -49.750  1.00 25.87  ?  313 TRP A CH2   1 
ATOM   1553  N  N     . ASP A  1 208 ? 77.081  47.708  -55.592  1.00 25.61  ?  314 ASP A N     1 
ATOM   1554  C  CA    . ASP A  1 208 ? 77.814  48.776  -56.259  1.00 25.88  ?  314 ASP A CA    1 
ATOM   1555  C  C     . ASP A  1 208 ? 78.281  48.327  -57.630  1.00 25.43  ?  314 ASP A C     1 
ATOM   1556  O  O     . ASP A  1 208 ? 77.992  49.001  -58.620  1.00 26.01  ?  314 ASP A O     1 
ATOM   1557  C  CB    . ASP A  1 208 ? 79.044  49.234  -55.474  1.00 26.74  ?  314 ASP A CB    1 
ATOM   1558  C  CG    . ASP A  1 208 ? 79.812  50.347  -56.197  1.00 27.54  ?  314 ASP A CG    1 
ATOM   1559  O  OD1   . ASP A  1 208 ? 79.377  51.507  -56.089  1.00 28.52  ?  314 ASP A OD1   1 
ATOM   1560  O  OD2   . ASP A  1 208 ? 80.830  50.074  -56.896  1.00 27.49  ?  314 ASP A OD2   1 
ATOM   1561  N  N     . TYR A  1 209 ? 79.023  47.216  -57.693  1.00 24.49  ?  315 TYR A N     1 
ATOM   1562  C  CA    . TYR A  1 209 ? 79.664  46.817  -58.960  1.00 23.74  ?  315 TYR A CA    1 
ATOM   1563  C  C     . TYR A  1 209 ? 78.661  46.399  -60.028  1.00 24.18  ?  315 TYR A C     1 
ATOM   1564  O  O     . TYR A  1 209 ? 78.949  46.536  -61.204  1.00 23.90  ?  315 TYR A O     1 
ATOM   1565  C  CB    . TYR A  1 209 ? 80.812  45.803  -58.784  1.00 22.89  ?  315 TYR A CB    1 
ATOM   1566  C  CG    . TYR A  1 209 ? 80.472  44.313  -58.637  1.00 22.26  ?  315 TYR A CG    1 
ATOM   1567  C  CD1   . TYR A  1 209 ? 79.936  43.561  -59.700  1.00 21.78  ?  315 TYR A CD1   1 
ATOM   1568  C  CD2   . TYR A  1 209 ? 80.780  43.632  -57.458  1.00 22.18  ?  315 TYR A CD2   1 
ATOM   1569  C  CE1   . TYR A  1 209 ? 79.672  42.204  -59.557  1.00 21.59  ?  315 TYR A CE1   1 
ATOM   1570  C  CE2   . TYR A  1 209 ? 80.526  42.277  -57.312  1.00 21.96  ?  315 TYR A CE2   1 
ATOM   1571  C  CZ    . TYR A  1 209 ? 79.966  41.558  -58.348  1.00 21.63  ?  315 TYR A CZ    1 
ATOM   1572  O  OH    . TYR A  1 209 ? 79.724  40.209  -58.164  1.00 21.44  ?  315 TYR A OH    1 
ATOM   1573  N  N     . PHE A  1 210 ? 77.487  45.906  -59.635  1.00 25.07  ?  316 PHE A N     1 
ATOM   1574  C  CA    . PHE A  1 210 ? 76.396  45.707  -60.597  1.00 25.41  ?  316 PHE A CA    1 
ATOM   1575  C  C     . PHE A  1 210 ? 76.083  47.022  -61.284  1.00 24.66  ?  316 PHE A C     1 
ATOM   1576  O  O     . PHE A  1 210 ? 76.181  47.131  -62.499  1.00 24.37  ?  316 PHE A O     1 
ATOM   1577  C  CB    . PHE A  1 210 ? 75.136  45.218  -59.894  1.00 26.65  ?  316 PHE A CB    1 
ATOM   1578  C  CG    . PHE A  1 210 ? 75.153  43.776  -59.491  1.00 27.87  ?  316 PHE A CG    1 
ATOM   1579  C  CD1   . PHE A  1 210 ? 76.294  42.979  -59.586  1.00 28.29  ?  316 PHE A CD1   1 
ATOM   1580  C  CD2   . PHE A  1 210 ? 74.000  43.218  -58.964  1.00 28.65  ?  316 PHE A CD2   1 
ATOM   1581  C  CE1   . PHE A  1 210 ? 76.270  41.648  -59.189  1.00 28.78  ?  316 PHE A CE1   1 
ATOM   1582  C  CE2   . PHE A  1 210 ? 73.961  41.890  -58.580  1.00 29.03  ?  316 PHE A CE2   1 
ATOM   1583  C  CZ    . PHE A  1 210 ? 75.097  41.108  -58.674  1.00 29.06  ?  316 PHE A CZ    1 
ATOM   1584  N  N     . ALA A  1 211 ? 75.732  48.017  -60.478  1.00 24.19  ?  317 ALA A N     1 
ATOM   1585  C  CA    . ALA A  1 211 ? 75.367  49.335  -60.976  1.00 23.94  ?  317 ALA A CA    1 
ATOM   1586  C  C     . ALA A  1 211 ? 76.528  49.983  -61.743  1.00 23.75  ?  317 ALA A C     1 
ATOM   1587  O  O     . ALA A  1 211 ? 76.334  50.523  -62.834  1.00 23.27  ?  317 ALA A O     1 
ATOM   1588  C  CB    . ALA A  1 211 ? 74.941  50.230  -59.822  1.00 23.86  ?  317 ALA A CB    1 
ATOM   1589  N  N     . ARG A  1 212 ? 77.726  49.897  -61.166  1.00 24.05  ?  318 ARG A N     1 
ATOM   1590  C  CA    . ARG A  1 212 ? 78.900  50.549  -61.723  1.00 24.49  ?  318 ARG A CA    1 
ATOM   1591  C  C     . ARG A  1 212 ? 79.372  49.904  -63.000  1.00 24.93  ?  318 ARG A C     1 
ATOM   1592  O  O     . ARG A  1 212 ? 79.568  50.583  -64.003  1.00 24.47  ?  318 ARG A O     1 
ATOM   1593  C  CB    . ARG A  1 212 ? 80.061  50.557  -60.728  1.00 24.41  ?  318 ARG A CB    1 
ATOM   1594  C  CG    . ARG A  1 212 ? 81.211  51.472  -61.165  1.00 24.17  ?  318 ARG A CG    1 
ATOM   1595  C  CD    . ARG A  1 212 ? 82.183  51.724  -60.040  1.00 24.10  ?  318 ARG A CD    1 
ATOM   1596  N  NE    . ARG A  1 212 ? 81.487  52.232  -58.853  1.00 23.84  ?  318 ARG A NE    1 
ATOM   1597  C  CZ    . ARG A  1 212 ? 81.066  53.476  -58.686  1.00 23.74  ?  318 ARG A CZ    1 
ATOM   1598  N  NH1   . ARG A  1 212 ? 81.276  54.421  -59.627  1.00 23.84  ?  318 ARG A NH1   1 
ATOM   1599  N  NH2   . ARG A  1 212 ? 80.434  53.782  -57.557  1.00 23.57  ?  318 ARG A NH2   1 
ATOM   1600  N  N     . ASP A  1 213 ? 79.578  48.591  -62.955  1.00 25.89  ?  319 ASP A N     1 
ATOM   1601  C  CA    . ASP A  1 213 ? 80.081  47.880  -64.127  1.00 26.78  ?  319 ASP A CA    1 
ATOM   1602  C  C     . ASP A  1 213 ? 79.094  48.061  -65.286  1.00 27.66  ?  319 ASP A C     1 
ATOM   1603  O  O     . ASP A  1 213 ? 79.499  48.435  -66.382  1.00 28.90  ?  319 ASP A O     1 
ATOM   1604  C  CB    . ASP A  1 213 ? 80.374  46.401  -63.834  1.00 26.69  ?  319 ASP A CB    1 
ATOM   1605  C  CG    . ASP A  1 213 ? 81.414  46.200  -62.711  1.00 26.96  ?  319 ASP A CG    1 
ATOM   1606  O  OD1   . ASP A  1 213 ? 82.035  47.195  -62.246  1.00 26.74  ?  319 ASP A OD1   1 
ATOM   1607  O  OD2   . ASP A  1 213 ? 81.582  45.032  -62.283  1.00 27.54  ?  319 ASP A OD2   1 
ATOM   1608  N  N     . CYS A  1 214 ? 77.804  47.872  -65.031  1.00 28.10  ?  320 CYS A N     1 
ATOM   1609  C  CA    . CYS A  1 214 ? 76.771  48.093  -66.055  1.00 28.52  ?  320 CYS A CA    1 
ATOM   1610  C  C     . CYS A  1 214 ? 76.837  49.487  -66.711  1.00 28.38  ?  320 CYS A C     1 
ATOM   1611  O  O     . CYS A  1 214 ? 76.817  49.605  -67.941  1.00 28.43  ?  320 CYS A O     1 
ATOM   1612  C  CB    . CYS A  1 214 ? 75.381  47.850  -65.463  1.00 29.44  ?  320 CYS A CB    1 
ATOM   1613  S  SG    . CYS A  1 214 ? 74.994  46.089  -65.265  1.00 31.01  ?  320 CYS A SG    1 
ATOM   1614  N  N     . HIS A  1 215 ? 76.929  50.528  -65.882  1.00 28.18  ?  321 HIS A N     1 
ATOM   1615  C  CA    . HIS A  1 215 ? 76.998  51.922  -66.350  1.00 28.41  ?  321 HIS A CA    1 
ATOM   1616  C  C     . HIS A  1 215 ? 78.115  52.104  -67.372  1.00 28.70  ?  321 HIS A C     1 
ATOM   1617  O  O     . HIS A  1 215 ? 77.893  52.646  -68.460  1.00 28.30  ?  321 HIS A O     1 
ATOM   1618  C  CB    . HIS A  1 215 ? 77.214  52.848  -65.149  1.00 28.27  ?  321 HIS A CB    1 
ATOM   1619  C  CG    . HIS A  1 215 ? 77.306  54.312  -65.485  1.00 28.18  ?  321 HIS A CG    1 
ATOM   1620  N  ND1   . HIS A  1 215 ? 76.195  55.099  -65.678  1.00 28.07  ?  321 HIS A ND1   1 
ATOM   1621  C  CD2   . HIS A  1 215 ? 78.374  55.137  -65.599  1.00 28.00  ?  321 HIS A CD2   1 
ATOM   1622  C  CE1   . HIS A  1 215 ? 76.578  56.348  -65.891  1.00 28.11  ?  321 HIS A CE1   1 
ATOM   1623  N  NE2   . HIS A  1 215 ? 77.897  56.386  -65.887  1.00 28.04  ?  321 HIS A NE2   1 
ATOM   1624  N  N     . HIS A  1 216 ? 79.300  51.614  -67.001  1.00 29.31  ?  322 HIS A N     1 
ATOM   1625  C  CA    . HIS A  1 216 ? 80.515  51.754  -67.806  1.00 29.85  ?  322 HIS A CA    1 
ATOM   1626  C  C     . HIS A  1 216 ? 80.591  50.705  -68.957  1.00 29.48  ?  322 HIS A C     1 
ATOM   1627  O  O     . HIS A  1 216 ? 81.090  51.026  -70.030  1.00 29.90  ?  322 HIS A O     1 
ATOM   1628  C  CB    . HIS A  1 216 ? 81.781  51.724  -66.900  1.00 30.09  ?  322 HIS A CB    1 
ATOM   1629  C  CG    . HIS A  1 216 ? 81.974  52.959  -66.048  1.00 30.58  ?  322 HIS A CG    1 
ATOM   1630  N  ND1   . HIS A  1 216 ? 81.514  53.062  -64.750  1.00 31.04  ?  322 HIS A ND1   1 
ATOM   1631  C  CD2   . HIS A  1 216 ? 82.613  54.128  -66.303  1.00 30.84  ?  322 HIS A CD2   1 
ATOM   1632  C  CE1   . HIS A  1 216 ? 81.846  54.243  -64.247  1.00 31.30  ?  322 HIS A CE1   1 
ATOM   1633  N  NE2   . HIS A  1 216 ? 82.513  54.912  -65.173  1.00 31.21  ?  322 HIS A NE2   1 
ATOM   1634  N  N     . LEU A  1 217 ? 80.082  49.483  -68.754  1.00 28.68  ?  323 LEU A N     1 
ATOM   1635  C  CA    . LEU A  1 217 ? 80.148  48.430  -69.795  1.00 28.27  ?  323 LEU A CA    1 
ATOM   1636  C  C     . LEU A  1 217 ? 79.324  48.742  -71.044  1.00 28.65  ?  323 LEU A C     1 
ATOM   1637  O  O     . LEU A  1 217 ? 79.810  48.618  -72.187  1.00 28.14  ?  323 LEU A O     1 
ATOM   1638  C  CB    . LEU A  1 217 ? 79.681  47.076  -69.247  1.00 27.51  ?  323 LEU A CB    1 
ATOM   1639  C  CG    . LEU A  1 217 ? 80.638  46.277  -68.371  1.00 26.99  ?  323 LEU A CG    1 
ATOM   1640  C  CD1   . LEU A  1 217 ? 79.890  45.137  -67.688  1.00 27.06  ?  323 LEU A CD1   1 
ATOM   1641  C  CD2   . LEU A  1 217 ? 81.824  45.747  -69.189  1.00 26.63  ?  323 LEU A CD2   1 
ATOM   1642  N  N     . GLY A  1 218 ? 78.083  49.164  -70.792  1.00 28.79  ?  324 GLY A N     1 
ATOM   1643  C  CA    . GLY A  1 218 ? 77.040  49.262  -71.816  1.00 28.80  ?  324 GLY A CA    1 
ATOM   1644  C  C     . GLY A  1 218 ? 76.076  48.094  -71.741  1.00 28.73  ?  324 GLY A C     1 
ATOM   1645  O  O     . GLY A  1 218 ? 75.748  47.481  -72.754  1.00 28.52  ?  324 GLY A O     1 
ATOM   1646  N  N     . ILE A  1 219 ? 75.649  47.781  -70.521  1.00 29.11  ?  325 ILE A N     1 
ATOM   1647  C  CA    . ILE A  1 219 ? 74.641  46.766  -70.240  1.00 29.57  ?  325 ILE A CA    1 
ATOM   1648  C  C     . ILE A  1 219 ? 73.730  47.389  -69.176  1.00 30.26  ?  325 ILE A C     1 
ATOM   1649  O  O     . ILE A  1 219 ? 74.203  48.170  -68.355  1.00 31.08  ?  325 ILE A O     1 
ATOM   1650  C  CB    . ILE A  1 219 ? 75.312  45.478  -69.714  1.00 29.18  ?  325 ILE A CB    1 
ATOM   1651  C  CG1   . ILE A  1 219 ? 76.026  44.767  -70.874  1.00 28.66  ?  325 ILE A CG1   1 
ATOM   1652  C  CG2   . ILE A  1 219 ? 74.305  44.523  -69.060  1.00 29.23  ?  325 ILE A CG2   1 
ATOM   1653  C  CD1   . ILE A  1 219 ? 77.045  43.749  -70.418  1.00 28.68  ?  325 ILE A CD1   1 
ATOM   1654  N  N     . GLN A  1 220 ? 72.437  47.078  -69.212  1.00 30.56  ?  326 GLN A N     1 
ATOM   1655  C  CA    . GLN A  1 220 ? 71.513  47.571  -68.181  1.00 31.00  ?  326 GLN A CA    1 
ATOM   1656  C  C     . GLN A  1 220 ? 71.424  46.570  -67.037  1.00 30.66  ?  326 GLN A C     1 
ATOM   1657  O  O     . GLN A  1 220 ? 71.448  45.348  -67.235  1.00 30.21  ?  326 GLN A O     1 
ATOM   1658  C  CB    . GLN A  1 220 ? 70.122  47.910  -68.752  1.00 31.75  ?  326 GLN A CB    1 
ATOM   1659  N  N     . ASN A  1 221 ? 71.343  47.112  -65.832  1.00 30.64  ?  327 ASN A N     1 
ATOM   1660  C  CA    . ASN A  1 221 ? 71.369  46.333  -64.596  1.00 30.97  ?  327 ASN A CA    1 
ATOM   1661  C  C     . ASN A  1 221 ? 69.926  46.028  -64.208  1.00 32.03  ?  327 ASN A C     1 
ATOM   1662  O  O     . ASN A  1 221 ? 69.079  46.937  -64.212  1.00 32.80  ?  327 ASN A O     1 
ATOM   1663  C  CB    . ASN A  1 221 ? 72.054  47.158  -63.501  1.00 30.32  ?  327 ASN A CB    1 
ATOM   1664  C  CG    . ASN A  1 221 ? 71.973  46.526  -62.135  1.00 29.70  ?  327 ASN A CG    1 
ATOM   1665  O  OD1   . ASN A  1 221 ? 71.860  45.308  -61.997  1.00 28.88  ?  327 ASN A OD1   1 
ATOM   1666  N  ND2   . ASN A  1 221 ? 72.039  47.359  -61.106  1.00 29.47  ?  327 ASN A ND2   1 
ATOM   1667  N  N     . ASN A  1 222 ? 69.663  44.773  -63.835  1.00 32.46  ?  328 ASN A N     1 
ATOM   1668  C  CA    . ASN A  1 222 ? 68.295  44.333  -63.514  1.00 33.09  ?  328 ASN A CA    1 
ATOM   1669  C  C     . ASN A  1 222 ? 68.030  44.122  -62.005  1.00 33.69  ?  328 ASN A C     1 
ATOM   1670  O  O     . ASN A  1 222 ? 67.127  43.368  -61.627  1.00 33.34  ?  328 ASN A O     1 
ATOM   1671  C  CB    . ASN A  1 222 ? 67.957  43.098  -64.385  1.00 33.31  ?  328 ASN A CB    1 
ATOM   1672  C  CG    . ASN A  1 222 ? 66.530  42.590  -64.193  1.00 33.73  ?  328 ASN A CG    1 
ATOM   1673  O  OD1   . ASN A  1 222 ? 66.337  41.475  -63.709  1.00 34.43  ?  328 ASN A OD1   1 
ATOM   1674  N  ND2   . ASN A  1 222 ? 65.529  43.377  -64.609  1.00 33.40  ?  328 ASN A ND2   1 
ATOM   1675  N  N     . PHE A  1 223 ? 68.779  44.811  -61.142  1.00 34.74  ?  329 PHE A N     1 
ATOM   1676  C  CA    . PHE A  1 223 ? 68.637  44.628  -59.683  1.00 35.82  ?  329 PHE A CA    1 
ATOM   1677  C  C     . PHE A  1 223 ? 68.556  45.957  -58.940  1.00 36.21  ?  329 PHE A C     1 
ATOM   1678  O  O     . PHE A  1 223 ? 69.433  46.814  -59.106  1.00 35.46  ?  329 PHE A O     1 
ATOM   1679  C  CB    . PHE A  1 223 ? 69.793  43.821  -59.106  1.00 35.90  ?  329 PHE A CB    1 
ATOM   1680  C  CG    . PHE A  1 223 ? 69.707  43.644  -57.615  1.00 35.67  ?  329 PHE A CG    1 
ATOM   1681  C  CD1   . PHE A  1 223 ? 68.796  42.745  -57.061  1.00 35.38  ?  329 PHE A CD1   1 
ATOM   1682  C  CD2   . PHE A  1 223 ? 70.514  44.396  -56.758  1.00 35.81  ?  329 PHE A CD2   1 
ATOM   1683  C  CE1   . PHE A  1 223 ? 68.709  42.591  -55.694  1.00 35.78  ?  329 PHE A CE1   1 
ATOM   1684  C  CE2   . PHE A  1 223 ? 70.432  44.243  -55.384  1.00 35.79  ?  329 PHE A CE2   1 
ATOM   1685  C  CZ    . PHE A  1 223 ? 69.536  43.342  -54.847  1.00 35.95  ?  329 PHE A CZ    1 
ATOM   1686  N  N     . ASP A  1 224 ? 67.535  46.091  -58.087  1.00 37.06  ?  330 ASP A N     1 
ATOM   1687  C  CA    . ASP A  1 224 ? 67.261  47.330  -57.359  1.00 37.66  ?  330 ASP A CA    1 
ATOM   1688  C  C     . ASP A  1 224 ? 67.701  47.176  -55.909  1.00 37.62  ?  330 ASP A C     1 
ATOM   1689  O  O     . ASP A  1 224 ? 66.983  46.609  -55.079  1.00 36.64  ?  330 ASP A O     1 
ATOM   1690  C  CB    . ASP A  1 224 ? 65.765  47.662  -57.438  1.00 38.29  ?  330 ASP A CB    1 
ATOM   1691  C  CG    . ASP A  1 224 ? 65.455  49.095  -57.022  1.00 39.04  ?  330 ASP A CG    1 
ATOM   1692  O  OD1   . ASP A  1 224 ? 66.300  49.758  -56.383  1.00 39.49  ?  330 ASP A OD1   1 
ATOM   1693  O  OD2   . ASP A  1 224 ? 64.352  49.559  -57.345  1.00 40.12  ?  330 ASP A OD2   1 
ATOM   1694  N  N     . TYR A  1 225 ? 68.894  47.686  -55.618  1.00 37.72  ?  331 TYR A N     1 
ATOM   1695  C  CA    . TYR A  1 225 ? 69.459  47.607  -54.269  1.00 37.36  ?  331 TYR A CA    1 
ATOM   1696  C  C     . TYR A  1 225 ? 68.676  48.476  -53.286  1.00 37.02  ?  331 TYR A C     1 
ATOM   1697  O  O     . TYR A  1 225 ? 68.476  48.092  -52.137  1.00 37.40  ?  331 TYR A O     1 
ATOM   1698  C  CB    . TYR A  1 225 ? 70.957  47.971  -54.276  1.00 38.17  ?  331 TYR A CB    1 
ATOM   1699  C  CG    . TYR A  1 225 ? 71.286  49.456  -54.381  1.00 39.51  ?  331 TYR A CG    1 
ATOM   1700  C  CD1   . TYR A  1 225 ? 71.324  50.261  -53.230  1.00 39.94  ?  331 TYR A CD1   1 
ATOM   1701  C  CD2   . TYR A  1 225 ? 71.592  50.041  -55.621  1.00 39.51  ?  331 TYR A CD2   1 
ATOM   1702  C  CE1   . TYR A  1 225 ? 71.625  51.613  -53.305  1.00 40.26  ?  331 TYR A CE1   1 
ATOM   1703  C  CE2   . TYR A  1 225 ? 71.920  51.399  -55.713  1.00 39.55  ?  331 TYR A CE2   1 
ATOM   1704  C  CZ    . TYR A  1 225 ? 71.928  52.196  -54.560  1.00 40.30  ?  331 TYR A CZ    1 
ATOM   1705  O  OH    . TYR A  1 225 ? 72.236  53.537  -54.623  1.00 40.02  ?  331 TYR A OH    1 
ATOM   1706  N  N     . LYS A  1 226 ? 68.231  49.635  -53.753  1.00 37.20  ?  332 LYS A N     1 
ATOM   1707  C  CA    . LYS A  1 226 ? 67.467  50.563  -52.926  1.00 38.26  ?  332 LYS A CA    1 
ATOM   1708  C  C     . LYS A  1 226 ? 66.207  49.926  -52.368  1.00 37.25  ?  332 LYS A C     1 
ATOM   1709  O  O     . LYS A  1 226 ? 65.863  50.132  -51.205  1.00 36.22  ?  332 LYS A O     1 
ATOM   1710  C  CB    . LYS A  1 226 ? 67.087  51.813  -53.723  1.00 40.12  ?  332 LYS A CB    1 
ATOM   1711  C  CG    . LYS A  1 226 ? 68.279  52.733  -54.008  1.00 41.60  ?  332 LYS A CG    1 
ATOM   1712  C  CD    . LYS A  1 226 ? 67.886  54.209  -54.157  1.00 43.35  ?  332 LYS A CD    1 
ATOM   1713  C  CE    . LYS A  1 226 ? 69.060  55.125  -53.829  1.00 44.96  ?  332 LYS A CE    1 
ATOM   1714  N  NZ    . LYS A  1 226 ? 68.563  56.525  -53.601  1.00 46.01  ?  332 LYS A NZ    1 
ATOM   1715  N  N     . ARG A  1 227 ? 65.535  49.147  -53.207  1.00 37.16  ?  333 ARG A N     1 
ATOM   1716  C  CA    . ARG A  1 227 ? 64.320  48.464  -52.823  1.00 37.69  ?  333 ARG A CA    1 
ATOM   1717  C  C     . ARG A  1 227 ? 64.596  47.399  -51.766  1.00 37.43  ?  333 ARG A C     1 
ATOM   1718  O  O     . ARG A  1 227 ? 63.849  47.274  -50.792  1.00 37.76  ?  333 ARG A O     1 
ATOM   1719  C  CB    . ARG A  1 227 ? 63.663  47.813  -54.038  1.00 38.18  ?  333 ARG A CB    1 
ATOM   1720  C  CG    . ARG A  1 227 ? 62.321  47.154  -53.731  1.00 38.55  ?  333 ARG A CG    1 
ATOM   1721  C  CD    . ARG A  1 227 ? 61.763  46.433  -54.932  1.00 38.91  ?  333 ARG A CD    1 
ATOM   1722  N  NE    . ARG A  1 227 ? 60.807  45.414  -54.522  1.00 39.40  ?  333 ARG A NE    1 
ATOM   1723  C  CZ    . ARG A  1 227 ? 59.518  45.613  -54.260  1.00 40.34  ?  333 ARG A CZ    1 
ATOM   1724  N  NH1   . ARG A  1 227 ? 58.962  46.820  -54.359  1.00 41.32  ?  333 ARG A NH1   1 
ATOM   1725  N  NH2   . ARG A  1 227 ? 58.759  44.583  -53.883  1.00 40.40  ?  333 ARG A NH2   1 
ATOM   1726  N  N     . PHE A  1 228 ? 65.655  46.626  -51.961  1.00 36.75  ?  334 PHE A N     1 
ATOM   1727  C  CA    . PHE A  1 228 ? 65.984  45.594  -51.005  1.00 36.78  ?  334 PHE A CA    1 
ATOM   1728  C  C     . PHE A  1 228 ? 66.253  46.163  -49.608  1.00 37.94  ?  334 PHE A C     1 
ATOM   1729  O  O     . PHE A  1 228 ? 65.876  45.547  -48.599  1.00 37.92  ?  334 PHE A O     1 
ATOM   1730  C  CB    . PHE A  1 228 ? 67.176  44.781  -51.488  1.00 35.90  ?  334 PHE A CB    1 
ATOM   1731  C  CG    . PHE A  1 228 ? 67.590  43.738  -50.530  1.00 35.85  ?  334 PHE A CG    1 
ATOM   1732  C  CD1   . PHE A  1 228 ? 68.481  44.041  -49.532  1.00 35.59  ?  334 PHE A CD1   1 
ATOM   1733  C  CD2   . PHE A  1 228 ? 67.009  42.483  -50.571  1.00 36.33  ?  334 PHE A CD2   1 
ATOM   1734  C  CE1   . PHE A  1 228 ? 68.834  43.086  -48.598  1.00 35.86  ?  334 PHE A CE1   1 
ATOM   1735  C  CE2   . PHE A  1 228 ? 67.337  41.529  -49.635  1.00 36.51  ?  334 PHE A CE2   1 
ATOM   1736  C  CZ    . PHE A  1 228 ? 68.265  41.818  -48.663  1.00 36.17  ?  334 PHE A CZ    1 
ATOM   1737  N  N     . ILE A  1 229 ? 66.905  47.331  -49.579  1.00 38.63  ?  335 ILE A N     1 
ATOM   1738  C  CA    . ILE A  1 229 ? 67.145  48.092  -48.349  1.00 39.47  ?  335 ILE A CA    1 
ATOM   1739  C  C     . ILE A  1 229 ? 65.837  48.487  -47.669  1.00 40.06  ?  335 ILE A C     1 
ATOM   1740  O  O     . ILE A  1 229 ? 65.721  48.367  -46.464  1.00 41.20  ?  335 ILE A O     1 
ATOM   1741  C  CB    . ILE A  1 229 ? 68.042  49.341  -48.607  1.00 39.27  ?  335 ILE A CB    1 
ATOM   1742  C  CG1   . ILE A  1 229 ? 69.488  48.899  -48.866  1.00 39.10  ?  335 ILE A CG1   1 
ATOM   1743  C  CG2   . ILE A  1 229 ? 67.998  50.326  -47.434  1.00 39.54  ?  335 ILE A CG2   1 
ATOM   1744  C  CD1   . ILE A  1 229 ? 70.440  49.986  -49.322  1.00 38.98  ?  335 ILE A CD1   1 
ATOM   1745  N  N     . LYS A  1 230 ? 64.853  48.952  -48.425  1.00 40.36  ?  336 LYS A N     1 
ATOM   1746  C  CA    . LYS A  1 230 ? 63.551  49.306  -47.828  1.00 41.23  ?  336 LYS A CA    1 
ATOM   1747  C  C     . LYS A  1 230 ? 62.861  48.095  -47.187  1.00 42.08  ?  336 LYS A C     1 
ATOM   1748  O  O     . LYS A  1 230 ? 62.108  48.270  -46.229  1.00 43.20  ?  336 LYS A O     1 
ATOM   1749  C  CB    . LYS A  1 230 ? 62.605  49.966  -48.828  1.00 41.55  ?  336 LYS A CB    1 
ATOM   1750  C  CG    . LYS A  1 230 ? 63.119  51.299  -49.395  1.00 42.45  ?  336 LYS A CG    1 
ATOM   1751  C  CD    . LYS A  1 230 ? 63.122  52.462  -48.411  1.00 42.94  ?  336 LYS A CD    1 
ATOM   1752  C  CE    . LYS A  1 230 ? 63.935  53.570  -49.069  1.00 43.37  ?  336 LYS A CE    1 
ATOM   1753  N  NZ    . LYS A  1 230 ? 64.472  54.624  -48.173  1.00 43.35  ?  336 LYS A NZ    1 
ATOM   1754  N  N     . PHE A  1 231 ? 63.112  46.887  -47.709  1.00 41.65  ?  337 PHE A N     1 
ATOM   1755  C  CA    . PHE A  1 231 ? 62.543  45.641  -47.148  1.00 41.93  ?  337 PHE A CA    1 
ATOM   1756  C  C     . PHE A  1 231 ? 63.572  44.749  -46.465  1.00 42.22  ?  337 PHE A C     1 
ATOM   1757  O  O     . PHE A  1 231 ? 63.445  43.525  -46.458  1.00 42.36  ?  337 PHE A O     1 
ATOM   1758  C  CB    . PHE A  1 231 ? 61.783  44.859  -48.233  1.00 41.33  ?  337 PHE A CB    1 
ATOM   1759  C  CG    . PHE A  1 231 ? 60.729  45.677  -48.914  1.00 40.74  ?  337 PHE A CG    1 
ATOM   1760  C  CD1   . PHE A  1 231 ? 59.699  46.245  -48.167  1.00 41.16  ?  337 PHE A CD1   1 
ATOM   1761  C  CD2   . PHE A  1 231 ? 60.777  45.910  -50.273  1.00 40.35  ?  337 PHE A CD2   1 
ATOM   1762  C  CE1   . PHE A  1 231 ? 58.728  47.024  -48.777  1.00 41.18  ?  337 PHE A CE1   1 
ATOM   1763  C  CE2   . PHE A  1 231 ? 59.806  46.681  -50.890  1.00 40.45  ?  337 PHE A CE2   1 
ATOM   1764  C  CZ    . PHE A  1 231 ? 58.776  47.239  -50.146  1.00 40.68  ?  337 PHE A CZ    1 
ATOM   1765  N  N     . ALA A  1 232 ? 64.579  45.374  -45.869  1.00 43.02  ?  338 ALA A N     1 
ATOM   1766  C  CA    . ALA A  1 232 ? 65.544  44.672  -45.049  1.00 44.36  ?  338 ALA A CA    1 
ATOM   1767  C  C     . ALA A  1 232 ? 65.207  44.934  -43.588  1.00 45.29  ?  338 ALA A C     1 
ATOM   1768  O  O     . ALA A  1 232 ? 64.602  45.953  -43.242  1.00 45.82  ?  338 ALA A O     1 
ATOM   1769  C  CB    . ALA A  1 232 ? 66.949  45.130  -45.374  1.00 44.27  ?  338 ALA A CB    1 
ATOM   1770  N  N     . ARG A  1 233 ? 65.608  43.997  -42.735  1.00 46.29  ?  339 ARG A N     1 
ATOM   1771  C  CA    . ARG A  1 233 ? 65.217  44.008  -41.338  1.00 47.57  ?  339 ARG A CA    1 
ATOM   1772  C  C     . ARG A  1 233 ? 66.011  42.973  -40.547  1.00 45.35  ?  339 ARG A C     1 
ATOM   1773  O  O     . ARG A  1 233 ? 66.316  41.901  -41.061  1.00 42.56  ?  339 ARG A O     1 
ATOM   1774  C  CB    . ARG A  1 233 ? 63.726  43.691  -41.240  1.00 50.98  ?  339 ARG A CB    1 
ATOM   1775  C  CG    . ARG A  1 233 ? 63.103  44.117  -39.943  1.00 53.86  ?  339 ARG A CG    1 
ATOM   1776  C  CD    . ARG A  1 233 ? 61.612  43.924  -39.974  1.00 56.34  ?  339 ARG A CD    1 
ATOM   1777  N  NE    . ARG A  1 233 ? 61.119  43.844  -38.607  1.00 60.20  ?  339 ARG A NE    1 
ATOM   1778  C  CZ    . ARG A  1 233 ? 60.999  44.875  -37.769  1.00 62.99  ?  339 ARG A CZ    1 
ATOM   1779  N  NH1   . ARG A  1 233 ? 61.331  46.111  -38.139  1.00 65.47  ?  339 ARG A NH1   1 
ATOM   1780  N  NH2   . ARG A  1 233 ? 60.549  44.663  -36.536  1.00 63.52  ?  339 ARG A NH2   1 
ATOM   1781  N  N     . VAL A  1 234 ? 66.363  43.302  -39.309  1.00 45.08  ?  340 VAL A N     1 
ATOM   1782  C  CA    . VAL A  1 234 ? 67.105  42.393  -38.439  1.00 45.27  ?  340 VAL A CA    1 
ATOM   1783  C  C     . VAL A  1 234 ? 66.125  41.597  -37.599  1.00 45.81  ?  340 VAL A C     1 
ATOM   1784  O  O     . VAL A  1 234 ? 65.205  42.169  -37.011  1.00 45.74  ?  340 VAL A O     1 
ATOM   1785  C  CB    . VAL A  1 234 ? 68.080  43.151  -37.517  1.00 45.43  ?  340 VAL A CB    1 
ATOM   1786  C  CG1   . VAL A  1 234 ? 68.899  42.178  -36.678  1.00 45.82  ?  340 VAL A CG1   1 
ATOM   1787  C  CG2   . VAL A  1 234 ? 69.014  44.029  -38.348  1.00 45.29  ?  340 VAL A CG2   1 
ATOM   1788  N  N     . CYS A  1 235 ? 66.323  40.280  -37.562  1.00 47.28  ?  341 CYS A N     1 
ATOM   1789  C  CA    . CYS A  1 235 ? 65.544  39.365  -36.723  1.00 50.22  ?  341 CYS A CA    1 
ATOM   1790  C  C     . CYS A  1 235 ? 66.477  38.397  -36.031  1.00 52.49  ?  341 CYS A C     1 
ATOM   1791  O  O     . CYS A  1 235 ? 67.616  38.226  -36.451  1.00 51.94  ?  341 CYS A O     1 
ATOM   1792  C  CB    . CYS A  1 235 ? 64.571  38.545  -37.563  1.00 50.22  ?  341 CYS A CB    1 
ATOM   1793  S  SG    . CYS A  1 235 ? 63.518  39.483  -38.671  1.00 50.51  ?  341 CYS A SG    1 
ATOM   1794  N  N     . GLU A  1 236 ? 65.977  37.739  -34.991  1.00 56.04  ?  342 GLU A N     1 
ATOM   1795  C  CA    . GLU A  1 236 ? 66.742  36.698  -34.313  1.00 57.95  ?  342 GLU A CA    1 
ATOM   1796  C  C     . GLU A  1 236 ? 66.679  35.411  -35.121  1.00 57.86  ?  342 GLU A C     1 
ATOM   1797  O  O     . GLU A  1 236 ? 65.603  34.988  -35.522  1.00 57.64  ?  342 GLU A O     1 
ATOM   1798  C  CB    . GLU A  1 236 ? 66.223  36.445  -32.903  1.00 60.33  ?  342 GLU A CB    1 
ATOM   1799  C  CG    . GLU A  1 236 ? 67.115  35.507  -32.105  1.00 62.56  ?  342 GLU A CG    1 
ATOM   1800  C  CD    . GLU A  1 236 ? 66.731  35.403  -30.643  1.00 66.03  ?  342 GLU A CD    1 
ATOM   1801  O  OE1   . GLU A  1 236 ? 65.858  36.161  -30.128  1.00 68.91  ?  342 GLU A OE1   1 
ATOM   1802  O  OE2   . GLU A  1 236 ? 67.326  34.527  -29.978  1.00 69.76  ?  342 GLU A OE2   1 
ATOM   1803  N  N     . VAL A  1 237 ? 67.841  34.808  -35.358  1.00 58.71  ?  343 VAL A N     1 
ATOM   1804  C  CA    . VAL A  1 237 ? 67.947  33.503  -36.017  1.00 60.13  ?  343 VAL A CA    1 
ATOM   1805  C  C     . VAL A  1 237 ? 69.025  32.703  -35.292  1.00 62.03  ?  343 VAL A C     1 
ATOM   1806  O  O     . VAL A  1 237 ? 70.209  33.069  -35.354  1.00 61.29  ?  343 VAL A O     1 
ATOM   1807  C  CB    . VAL A  1 237 ? 68.325  33.615  -37.520  1.00 60.10  ?  343 VAL A CB    1 
ATOM   1808  C  CG1   . VAL A  1 237 ? 68.059  32.289  -38.221  1.00 60.36  ?  343 VAL A CG1   1 
ATOM   1809  C  CG2   . VAL A  1 237 ? 67.564  34.737  -38.206  1.00 60.62  ?  343 VAL A CG2   1 
ATOM   1810  N  N     . ASP A  1 238 ? 68.625  31.632  -34.599  1.00 64.04  ?  344 ASP A N     1 
ATOM   1811  C  CA    . ASP A  1 238 ? 69.575  30.758  -33.884  1.00 64.39  ?  344 ASP A CA    1 
ATOM   1812  C  C     . ASP A  1 238 ? 70.474  31.546  -32.939  1.00 65.09  ?  344 ASP A C     1 
ATOM   1813  O  O     . ASP A  1 238 ? 71.686  31.540  -33.075  1.00 62.34  ?  344 ASP A O     1 
ATOM   1814  C  CB    . ASP A  1 238 ? 70.423  29.928  -34.858  1.00 63.58  ?  344 ASP A CB    1 
ATOM   1815  C  CG    . ASP A  1 238 ? 69.567  29.101  -35.813  1.00 63.77  ?  344 ASP A CG    1 
ATOM   1816  O  OD1   . ASP A  1 238 ? 68.384  28.840  -35.519  1.00 64.28  ?  344 ASP A OD1   1 
ATOM   1817  O  OD2   . ASP A  1 238 ? 70.056  28.681  -36.869  1.00 64.18  ?  344 ASP A OD2   1 
ATOM   1818  N  N     . ASN A  1 239 ? 69.846  32.249  -31.997  1.00 67.87  ?  345 ASN A N     1 
ATOM   1819  C  CA    . ASN A  1 239 ? 70.545  32.955  -30.894  1.00 70.66  ?  345 ASN A CA    1 
ATOM   1820  C  C     . ASN A  1 239 ? 71.510  34.047  -31.376  1.00 68.93  ?  345 ASN A C     1 
ATOM   1821  O  O     . ASN A  1 239 ? 72.577  34.273  -30.771  1.00 70.26  ?  345 ASN A O     1 
ATOM   1822  C  CB    . ASN A  1 239 ? 71.274  31.953  -29.997  1.00 74.51  ?  345 ASN A CB    1 
ATOM   1823  C  CG    . ASN A  1 239 ? 70.367  30.814  -29.537  1.00 78.09  ?  345 ASN A CG    1 
ATOM   1824  O  OD1   . ASN A  1 239 ? 69.199  31.041  -29.166  1.00 82.82  ?  345 ASN A OD1   1 
ATOM   1825  N  ND2   . ASN A  1 239 ? 70.888  29.580  -29.568  1.00 80.06  ?  345 ASN A ND2   1 
ATOM   1826  N  N     . GLU A  1 240 ? 71.122  34.729  -32.448  1.00 65.58  ?  346 GLU A N     1 
ATOM   1827  C  CA    . GLU A  1 240 ? 72.013  35.640  -33.155  1.00 63.09  ?  346 GLU A CA    1 
ATOM   1828  C  C     . GLU A  1 240 ? 71.164  36.567  -34.021  1.00 59.61  ?  346 GLU A C     1 
ATOM   1829  O  O     . GLU A  1 240 ? 70.241  36.103  -34.685  1.00 56.51  ?  346 GLU A O     1 
ATOM   1830  C  CB    . GLU A  1 240 ? 72.970  34.809  -34.022  1.00 64.23  ?  346 GLU A CB    1 
ATOM   1831  C  CG    . GLU A  1 240 ? 74.051  35.575  -34.748  1.00 64.87  ?  346 GLU A CG    1 
ATOM   1832  C  CD    . GLU A  1 240 ? 74.996  34.683  -35.546  1.00 64.50  ?  346 GLU A CD    1 
ATOM   1833  O  OE1   . GLU A  1 240 ? 74.748  33.461  -35.664  1.00 63.66  ?  346 GLU A OE1   1 
ATOM   1834  O  OE2   . GLU A  1 240 ? 75.982  35.201  -36.110  1.00 65.09  ?  346 GLU A OE2   1 
ATOM   1835  N  N     . LEU A  1 241 ? 71.464  37.860  -34.012  1.00 58.34  ?  347 LEU A N     1 
ATOM   1836  C  CA    . LEU A  1 241 ? 70.685  38.859  -34.765  1.00 57.76  ?  347 LEU A CA    1 
ATOM   1837  C  C     . LEU A  1 241 ? 71.210  39.092  -36.200  1.00 57.18  ?  347 LEU A C     1 
ATOM   1838  O  O     . LEU A  1 241 ? 72.249  39.712  -36.377  1.00 57.62  ?  347 LEU A O     1 
ATOM   1839  C  CB    . LEU A  1 241 ? 70.667  40.191  -34.013  1.00 58.03  ?  347 LEU A CB    1 
ATOM   1840  C  CG    . LEU A  1 241 ? 69.875  40.238  -32.716  1.00 60.28  ?  347 LEU A CG    1 
ATOM   1841  C  CD1   . LEU A  1 241 ? 70.075  41.602  -32.056  1.00 60.98  ?  347 LEU A CD1   1 
ATOM   1842  C  CD2   . LEU A  1 241 ? 68.381  40.039  -32.946  1.00 61.27  ?  347 LEU A CD2   1 
ATOM   1843  N  N     . ARG A  1 242 ? 70.469  38.628  -37.210  1.00 55.69  ?  348 ARG A N     1 
ATOM   1844  C  CA    . ARG A  1 242 ? 70.917  38.695  -38.608  1.00 54.24  ?  348 ARG A CA    1 
ATOM   1845  C  C     . ARG A  1 242 ? 69.912  39.382  -39.521  1.00 51.99  ?  348 ARG A C     1 
ATOM   1846  O  O     . ARG A  1 242 ? 68.715  39.397  -39.253  1.00 51.95  ?  348 ARG A O     1 
ATOM   1847  C  CB    . ARG A  1 242 ? 71.220  37.300  -39.154  1.00 56.41  ?  348 ARG A CB    1 
ATOM   1848  C  CG    . ARG A  1 242 ? 71.756  36.334  -38.127  1.00 59.97  ?  348 ARG A CG    1 
ATOM   1849  C  CD    . ARG A  1 242 ? 72.205  35.043  -38.777  1.00 63.04  ?  348 ARG A CD    1 
ATOM   1850  N  NE    . ARG A  1 242 ? 72.564  34.024  -37.807  1.00 66.65  ?  348 ARG A NE    1 
ATOM   1851  C  CZ    . ARG A  1 242 ? 72.516  32.718  -38.018  1.00 68.33  ?  348 ARG A CZ    1 
ATOM   1852  N  NH1   . ARG A  1 242 ? 72.034  32.247  -39.159  1.00 67.53  ?  348 ARG A NH1   1 
ATOM   1853  N  NH2   . ARG A  1 242 ? 72.866  31.878  -37.044  1.00 71.43  ?  348 ARG A NH2   1 
ATOM   1854  N  N     . ILE A  1 243 ? 70.426  39.918  -40.620  1.00 50.80  ?  349 ILE A N     1 
ATOM   1855  C  CA    . ILE A  1 243 ? 69.612  40.618  -41.599  1.00 49.69  ?  349 ILE A CA    1 
ATOM   1856  C  C     . ILE A  1 243 ? 68.708  39.614  -42.298  1.00 47.29  ?  349 ILE A C     1 
ATOM   1857  O  O     . ILE A  1 243 ? 69.142  38.513  -42.670  1.00 45.83  ?  349 ILE A O     1 
ATOM   1858  C  CB    . ILE A  1 243 ? 70.470  41.382  -42.643  1.00 50.46  ?  349 ILE A CB    1 
ATOM   1859  C  CG1   . ILE A  1 243 ? 71.317  42.453  -41.936  1.00 50.54  ?  349 ILE A CG1   1 
ATOM   1860  C  CG2   . ILE A  1 243 ? 69.590  42.041  -43.700  1.00 50.99  ?  349 ILE A CG2   1 
ATOM   1861  C  CD1   . ILE A  1 243 ? 72.283  43.204  -42.821  1.00 49.48  ?  349 ILE A CD1   1 
ATOM   1862  N  N     . CYS A  1 244 ? 67.447  40.015  -42.452  1.00 45.77  ?  350 CYS A N     1 
ATOM   1863  C  CA    . CYS A  1 244 ? 66.427  39.240  -43.147  1.00 45.01  ?  350 CYS A CA    1 
ATOM   1864  C  C     . CYS A  1 244 ? 65.715  40.124  -44.159  1.00 43.77  ?  350 CYS A C     1 
ATOM   1865  O  O     . CYS A  1 244 ? 65.523  41.319  -43.914  1.00 44.88  ?  350 CYS A O     1 
ATOM   1866  C  CB    . CYS A  1 244 ? 65.399  38.712  -42.159  1.00 45.25  ?  350 CYS A CB    1 
ATOM   1867  S  SG    . CYS A  1 244 ? 66.122  37.754  -40.819  1.00 45.93  ?  350 CYS A SG    1 
ATOM   1868  N  N     . ALA A  1 245 ? 65.318  39.527  -45.285  1.00 41.53  ?  351 ALA A N     1 
ATOM   1869  C  CA    . ALA A  1 245 ? 64.528  40.211  -46.312  1.00 40.18  ?  351 ALA A CA    1 
ATOM   1870  C  C     . ALA A  1 245 ? 63.087  39.782  -46.204  1.00 40.31  ?  351 ALA A C     1 
ATOM   1871  O  O     . ALA A  1 245 ? 62.781  38.759  -45.612  1.00 40.93  ?  351 ALA A O     1 
ATOM   1872  C  CB    . ALA A  1 245 ? 65.056  39.894  -47.694  1.00 39.51  ?  351 ALA A CB    1 
ATOM   1873  N  N     . ARG A  1 246 ? 62.198  40.573  -46.785  1.00 40.36  ?  352 ARG A N     1 
ATOM   1874  C  CA    . ARG A  1 246 ? 60.779  40.254  -46.766  1.00 40.73  ?  352 ARG A CA    1 
ATOM   1875  C  C     . ARG A  1 246 ? 60.498  39.044  -47.665  1.00 38.97  ?  352 ARG A C     1 
ATOM   1876  O  O     . ARG A  1 246 ? 61.123  38.879  -48.706  1.00 37.15  ?  352 ARG A O     1 
ATOM   1877  C  CB    . ARG A  1 246 ? 59.971  41.479  -47.204  1.00 42.61  ?  352 ARG A CB    1 
ATOM   1878  C  CG    . ARG A  1 246 ? 58.488  41.192  -47.433  1.00 43.89  ?  352 ARG A CG    1 
ATOM   1879  C  CD    . ARG A  1 246 ? 57.573  41.949  -46.458  1.00 44.21  ?  352 ARG A CD    1 
ATOM   1880  N  NE    . ARG A  1 246 ? 56.212  41.549  -46.795  1.00 45.41  ?  352 ARG A NE    1 
ATOM   1881  C  CZ    . ARG A  1 246 ? 55.170  42.275  -47.164  1.00 47.36  ?  352 ARG A CZ    1 
ATOM   1882  N  NH1   . ARG A  1 246 ? 54.088  41.591  -47.548  1.00 48.58  ?  352 ARG A NH1   1 
ATOM   1883  N  NH2   . ARG A  1 246 ? 55.094  43.578  -46.927  1.00 48.46  ?  352 ARG A NH2   1 
ATOM   1884  N  N     . ASP A  1 247 ? 59.559  38.207  -47.246  1.00 39.28  ?  353 ASP A N     1 
ATOM   1885  C  CA    . ASP A  1 247 ? 59.142  37.029  -48.019  1.00 39.88  ?  353 ASP A CA    1 
ATOM   1886  C  C     . ASP A  1 247 ? 58.920  37.268  -49.528  1.00 41.46  ?  353 ASP A C     1 
ATOM   1887  O  O     . ASP A  1 247 ? 59.342  36.464  -50.335  1.00 39.61  ?  353 ASP A O     1 
ATOM   1888  C  CB    . ASP A  1 247 ? 57.895  36.352  -47.387  1.00 38.87  ?  353 ASP A CB    1 
ATOM   1889  C  CG    . ASP A  1 247 ? 56.728  37.292  -47.156  1.00 37.70  ?  353 ASP A CG    1 
ATOM   1890  O  OD1   . ASP A  1 247 ? 56.797  38.481  -47.485  1.00 36.98  ?  353 ASP A OD1   1 
ATOM   1891  O  OD2   . ASP A  1 247 ? 55.709  36.842  -46.623  1.00 37.00  ?  353 ASP A OD2   1 
ATOM   1892  N  N     . LYS A  1 248 ? 58.277  38.373  -49.897  1.00 45.29  ?  354 LYS A N     1 
ATOM   1893  C  CA    . LYS A  1 248 ? 58.019  38.692  -51.315  1.00 48.23  ?  354 LYS A CA    1 
ATOM   1894  C  C     . LYS A  1 248 ? 59.304  38.924  -52.144  1.00 47.25  ?  354 LYS A C     1 
ATOM   1895  O  O     . LYS A  1 248 ? 59.334  38.622  -53.341  1.00 47.09  ?  354 LYS A O     1 
ATOM   1896  C  CB    . LYS A  1 248 ? 57.055  39.892  -51.450  1.00 51.85  ?  354 LYS A CB    1 
ATOM   1897  C  CG    . LYS A  1 248 ? 57.689  41.260  -51.251  1.00 55.00  ?  354 LYS A CG    1 
ATOM   1898  C  CD    . LYS A  1 248 ? 56.692  42.364  -50.991  1.00 56.52  ?  354 LYS A CD    1 
ATOM   1899  C  CE    . LYS A  1 248 ? 57.375  43.653  -50.519  1.00 57.81  ?  354 LYS A CE    1 
ATOM   1900  N  NZ    . LYS A  1 248 ? 56.393  44.725  -50.179  1.00 58.83  ?  354 LYS A NZ    1 
ATOM   1901  N  N     . GLU A  1 249 ? 60.357  39.442  -51.507  1.00 45.68  ?  355 GLU A N     1 
ATOM   1902  C  CA    . GLU A  1 249 ? 61.630  39.700  -52.191  1.00 44.64  ?  355 GLU A CA    1 
ATOM   1903  C  C     . GLU A  1 249 ? 62.383  38.452  -52.654  1.00 42.86  ?  355 GLU A C     1 
ATOM   1904  O  O     . GLU A  1 249 ? 63.322  38.574  -53.436  1.00 43.75  ?  355 GLU A O     1 
ATOM   1905  C  CB    . GLU A  1 249 ? 62.575  40.532  -51.300  1.00 45.69  ?  355 GLU A CB    1 
ATOM   1906  C  CG    . GLU A  1 249 ? 62.105  41.949  -51.031  1.00 46.51  ?  355 GLU A CG    1 
ATOM   1907  C  CD    . GLU A  1 249 ? 61.928  42.748  -52.302  1.00 46.47  ?  355 GLU A CD    1 
ATOM   1908  O  OE1   . GLU A  1 249 ? 62.952  43.269  -52.818  1.00 47.99  ?  355 GLU A OE1   1 
ATOM   1909  O  OE2   . GLU A  1 249 ? 60.771  42.844  -52.784  1.00 44.23  ?  355 GLU A OE2   1 
ATOM   1910  N  N     . VAL A  1 250 ? 61.999  37.270  -52.183  1.00 40.36  ?  356 VAL A N     1 
ATOM   1911  C  CA    . VAL A  1 250 ? 62.683  36.033  -52.565  1.00 39.10  ?  356 VAL A CA    1 
ATOM   1912  C  C     . VAL A  1 250 ? 62.910  35.936  -54.084  1.00 37.60  ?  356 VAL A C     1 
ATOM   1913  O  O     . VAL A  1 250 ? 63.993  35.551  -54.512  1.00 36.71  ?  356 VAL A O     1 
ATOM   1914  C  CB    . VAL A  1 250 ? 61.969  34.773  -52.006  1.00 39.12  ?  356 VAL A CB    1 
ATOM   1915  C  CG1   . VAL A  1 250 ? 60.616  34.552  -52.670  1.00 39.25  ?  356 VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A  1 250 ? 62.851  33.544  -52.130  1.00 39.21  ?  356 VAL A CG2   1 
ATOM   1917  N  N     . GLY A  1 251 ? 61.911  36.322  -54.876  1.00 36.30  ?  357 GLY A N     1 
ATOM   1918  C  CA    . GLY A  1 251 ? 62.030  36.331  -56.340  1.00 35.22  ?  357 GLY A CA    1 
ATOM   1919  C  C     . GLY A  1 251 ? 63.170  37.210  -56.829  1.00 33.64  ?  357 GLY A C     1 
ATOM   1920  O  O     . GLY A  1 251 ? 63.996  36.790  -57.640  1.00 32.06  ?  357 GLY A O     1 
ATOM   1921  N  N     . ASN A  1 252 ? 63.223  38.426  -56.296  1.00 32.95  ?  358 ASN A N     1 
ATOM   1922  C  CA    . ASN A  1 252 ? 64.254  39.400  -56.670  1.00 32.00  ?  358 ASN A CA    1 
ATOM   1923  C  C     . ASN A  1 252 ? 65.647  38.948  -56.278  1.00 30.65  ?  358 ASN A C     1 
ATOM   1924  O  O     . ASN A  1 252 ? 66.624  39.294  -56.954  1.00 29.71  ?  358 ASN A O     1 
ATOM   1925  C  CB    . ASN A  1 252 ? 63.968  40.762  -56.029  1.00 32.51  ?  358 ASN A CB    1 
ATOM   1926  C  CG    . ASN A  1 252 ? 62.661  41.369  -56.505  1.00 33.14  ?  358 ASN A CG    1 
ATOM   1927  O  OD1   . ASN A  1 252 ? 62.162  41.064  -57.588  1.00 34.11  ?  358 ASN A OD1   1 
ATOM   1928  N  ND2   . ASN A  1 252 ? 62.098  42.231  -55.689  1.00 33.33  ?  358 ASN A ND2   1 
ATOM   1929  N  N     . LEU A  1 253 ? 65.732  38.189  -55.185  1.00 29.57  ?  359 LEU A N     1 
ATOM   1930  C  CA    . LEU A  1 253 ? 67.004  37.653  -54.721  1.00 28.49  ?  359 LEU A CA    1 
ATOM   1931  C  C     . LEU A  1 253 ? 67.549  36.568  -55.628  1.00 27.82  ?  359 LEU A C     1 
ATOM   1932  O  O     . LEU A  1 253 ? 68.747  36.555  -55.881  1.00 27.48  ?  359 LEU A O     1 
ATOM   1933  C  CB    . LEU A  1 253 ? 66.907  37.162  -53.273  1.00 28.24  ?  359 LEU A CB    1 
ATOM   1934  C  CG    . LEU A  1 253 ? 66.823  38.264  -52.218  1.00 28.01  ?  359 LEU A CG    1 
ATOM   1935  C  CD1   . LEU A  1 253 ? 66.695  37.635  -50.843  1.00 28.16  ?  359 LEU A CD1   1 
ATOM   1936  C  CD2   . LEU A  1 253 ? 68.046  39.187  -52.276  1.00 27.70  ?  359 LEU A CD2   1 
ATOM   1937  N  N     . TYR A  1 254 ? 66.702  35.672  -56.136  1.00 27.34  ?  360 TYR A N     1 
ATOM   1938  C  CA    . TYR A  1 254 ? 67.178  34.709  -57.153  1.00 27.00  ?  360 TYR A CA    1 
ATOM   1939  C  C     . TYR A  1 254 ? 67.626  35.470  -58.405  1.00 26.83  ?  360 TYR A C     1 
ATOM   1940  O  O     . TYR A  1 254 ? 68.618  35.100  -59.038  1.00 26.81  ?  360 TYR A O     1 
ATOM   1941  C  CB    . TYR A  1 254 ? 66.128  33.641  -57.526  1.00 26.91  ?  360 TYR A CB    1 
ATOM   1942  C  CG    . TYR A  1 254 ? 66.008  32.454  -56.573  1.00 26.81  ?  360 TYR A CG    1 
ATOM   1943  C  CD1   . TYR A  1 254 ? 66.860  31.350  -56.656  1.00 26.59  ?  360 TYR A CD1   1 
ATOM   1944  C  CD2   . TYR A  1 254 ? 64.993  32.414  -55.626  1.00 26.93  ?  360 TYR A CD2   1 
ATOM   1945  C  CE1   . TYR A  1 254 ? 66.726  30.261  -55.786  1.00 26.73  ?  360 TYR A CE1   1 
ATOM   1946  C  CE2   . TYR A  1 254 ? 64.845  31.331  -54.753  1.00 27.25  ?  360 TYR A CE2   1 
ATOM   1947  C  CZ    . TYR A  1 254 ? 65.713  30.258  -54.833  1.00 27.07  ?  360 TYR A CZ    1 
ATOM   1948  O  OH    . TYR A  1 254 ? 65.546  29.198  -53.956  1.00 27.52  ?  360 TYR A OH    1 
ATOM   1949  N  N     . ASP A  1 255 ? 66.890  36.532  -58.740  1.00 26.77  ?  361 ASP A N     1 
ATOM   1950  C  CA    . ASP A  1 255 ? 67.207  37.393  -59.893  1.00 26.35  ?  361 ASP A CA    1 
ATOM   1951  C  C     . ASP A  1 255 ? 68.505  38.193  -59.689  1.00 25.76  ?  361 ASP A C     1 
ATOM   1952  O  O     . ASP A  1 255 ? 69.173  38.533  -60.665  1.00 25.18  ?  361 ASP A O     1 
ATOM   1953  C  CB    . ASP A  1 255 ? 66.019  38.327  -60.245  1.00 26.32  ?  361 ASP A CB    1 
ATOM   1954  C  CG    . ASP A  1 255 ? 64.876  37.621  -61.025  1.00 26.49  ?  361 ASP A CG    1 
ATOM   1955  O  OD1   . ASP A  1 255 ? 64.746  36.379  -61.026  1.00 26.63  ?  361 ASP A OD1   1 
ATOM   1956  O  OD2   . ASP A  1 255 ? 64.106  38.347  -61.686  1.00 26.77  ?  361 ASP A OD2   1 
ATOM   1957  N  N     . MET A  1 256 ? 68.858  38.488  -58.436  1.00 25.44  ?  362 MET A N     1 
ATOM   1958  C  CA    . MET A  1 256 ? 70.161  39.091  -58.131  1.00 25.21  ?  362 MET A CA    1 
ATOM   1959  C  C     . MET A  1 256 ? 71.295  38.170  -58.574  1.00 25.71  ?  362 MET A C     1 
ATOM   1960  O  O     . MET A  1 256 ? 72.188  38.610  -59.301  1.00 25.98  ?  362 MET A O     1 
ATOM   1961  C  CB    . MET A  1 256 ? 70.313  39.429  -56.638  1.00 24.84  ?  362 MET A CB    1 
ATOM   1962  C  CG    . MET A  1 256 ? 71.481  40.392  -56.361  1.00 24.24  ?  362 MET A CG    1 
ATOM   1963  S  SD    . MET A  1 256 ? 72.197  40.420  -54.725  1.00 23.64  ?  362 MET A SD    1 
ATOM   1964  C  CE    . MET A  1 256 ? 73.393  39.098  -54.793  1.00 23.83  ?  362 MET A CE    1 
ATOM   1965  N  N     . PHE A  1 257 ? 71.259  36.905  -58.151  1.00 26.43  ?  363 PHE A N     1 
ATOM   1966  C  CA    . PHE A  1 257 ? 72.319  35.957  -58.523  1.00 27.30  ?  363 PHE A CA    1 
ATOM   1967  C  C     . PHE A  1 257 ? 72.276  35.564  -60.008  1.00 27.93  ?  363 PHE A C     1 
ATOM   1968  O  O     . PHE A  1 257 ? 73.312  35.196  -60.569  1.00 28.20  ?  363 PHE A O     1 
ATOM   1969  C  CB    . PHE A  1 257 ? 72.316  34.709  -57.631  1.00 27.73  ?  363 PHE A CB    1 
ATOM   1970  C  CG    . PHE A  1 257 ? 72.697  34.975  -56.201  1.00 28.11  ?  363 PHE A CG    1 
ATOM   1971  C  CD1   . PHE A  1 257 ? 74.031  35.006  -55.796  1.00 28.13  ?  363 PHE A CD1   1 
ATOM   1972  C  CD2   . PHE A  1 257 ? 71.713  35.181  -55.252  1.00 28.79  ?  363 PHE A CD2   1 
ATOM   1973  C  CE1   . PHE A  1 257 ? 74.373  35.251  -54.469  1.00 28.34  ?  363 PHE A CE1   1 
ATOM   1974  C  CE2   . PHE A  1 257 ? 72.042  35.431  -53.918  1.00 29.19  ?  363 PHE A CE2   1 
ATOM   1975  C  CZ    . PHE A  1 257 ? 73.383  35.464  -53.534  1.00 28.96  ?  363 PHE A CZ    1 
ATOM   1976  N  N     . HIS A  1 258 ? 71.099  35.636  -60.636  1.00 28.52  ?  364 HIS A N     1 
ATOM   1977  C  CA    . HIS A  1 258 ? 70.989  35.483  -62.096  1.00 29.05  ?  364 HIS A CA    1 
ATOM   1978  C  C     . HIS A  1 258 ? 71.704  36.625  -62.813  1.00 28.79  ?  364 HIS A C     1 
ATOM   1979  O  O     . HIS A  1 258 ? 72.483  36.398  -63.737  1.00 27.35  ?  364 HIS A O     1 
ATOM   1980  C  CB    . HIS A  1 258 ? 69.527  35.440  -62.556  1.00 30.05  ?  364 HIS A CB    1 
ATOM   1981  C  CG    . HIS A  1 258 ? 69.363  35.231  -64.030  1.00 31.19  ?  364 HIS A CG    1 
ATOM   1982  N  ND1   . HIS A  1 258 ? 69.244  33.980  -64.594  1.00 31.77  ?  364 HIS A ND1   1 
ATOM   1983  C  CD2   . HIS A  1 258 ? 69.318  36.112  -65.057  1.00 31.82  ?  364 HIS A CD2   1 
ATOM   1984  C  CE1   . HIS A  1 258 ? 69.080  34.094  -65.900  1.00 32.05  ?  364 HIS A CE1   1 
ATOM   1985  N  NE2   . HIS A  1 258 ? 69.128  35.379  -66.210  1.00 32.29  ?  364 HIS A NE2   1 
ATOM   1986  N  N     . THR A  1 259 ? 71.414  37.851  -62.385  1.00 29.81  ?  365 THR A N     1 
ATOM   1987  C  CA    . THR A  1 259 ? 72.082  39.053  -62.897  1.00 30.63  ?  365 THR A CA    1 
ATOM   1988  C  C     . THR A  1 259 ? 73.602  38.924  -62.733  1.00 30.92  ?  365 THR A C     1 
ATOM   1989  O  O     . THR A  1 259 ? 74.349  39.257  -63.655  1.00 30.73  ?  365 THR A O     1 
ATOM   1990  C  CB    . THR A  1 259 ? 71.508  40.349  -62.246  1.00 31.36  ?  365 THR A CB    1 
ATOM   1991  O  OG1   . THR A  1 259 ? 70.151  40.546  -62.721  1.00 32.24  ?  365 THR A OG1   1 
ATOM   1992  C  CG2   . THR A  1 259 ? 72.325  41.600  -62.595  1.00 31.35  ?  365 THR A CG2   1 
ATOM   1993  N  N     . ARG A  1 260 ? 74.061  38.415  -61.589  1.00 31.69  ?  366 ARG A N     1 
ATOM   1994  C  CA    . ARG A  1 260 ? 75.502  38.191  -61.367  1.00 32.50  ?  366 ARG A CA    1 
ATOM   1995  C  C     . ARG A  1 260 ? 76.086  37.242  -62.405  1.00 32.86  ?  366 ARG A C     1 
ATOM   1996  O  O     . ARG A  1 260 ? 77.079  37.566  -63.063  1.00 31.85  ?  366 ARG A O     1 
ATOM   1997  C  CB    . ARG A  1 260 ? 75.780  37.631  -59.974  1.00 32.80  ?  366 ARG A CB    1 
ATOM   1998  C  CG    . ARG A  1 260 ? 77.262  37.510  -59.666  1.00 33.15  ?  366 ARG A CG    1 
ATOM   1999  C  CD    . ARG A  1 260 ? 77.517  37.356  -58.163  1.00 33.70  ?  366 ARG A CD    1 
ATOM   2000  N  NE    . ARG A  1 260 ? 78.871  36.847  -57.917  1.00 33.89  ?  366 ARG A NE    1 
ATOM   2001  C  CZ    . ARG A  1 260 ? 79.266  35.584  -58.108  1.00 33.94  ?  366 ARG A CZ    1 
ATOM   2002  N  NH1   . ARG A  1 260 ? 78.413  34.640  -58.541  1.00 33.88  ?  366 ARG A NH1   1 
ATOM   2003  N  NH2   . ARG A  1 260 ? 80.534  35.269  -57.865  1.00 34.06  ?  366 ARG A NH2   1 
ATOM   2004  N  N     . ASN A  1 261 ? 75.470  36.070  -62.526  1.00 33.86  ?  367 ASN A N     1 
ATOM   2005  C  CA    . ASN A  1 261 ? 75.912  35.047  -63.468  1.00 34.39  ?  367 ASN A CA    1 
ATOM   2006  C  C     . ASN A  1 261 ? 75.869  35.561  -64.903  1.00 33.30  ?  367 ASN A C     1 
ATOM   2007  O  O     . ASN A  1 261 ? 76.769  35.291  -65.690  1.00 32.74  ?  367 ASN A O     1 
ATOM   2008  C  CB    . ASN A  1 261 ? 75.047  33.784  -63.346  1.00 35.57  ?  367 ASN A CB    1 
ATOM   2009  C  CG    . ASN A  1 261 ? 75.577  32.632  -64.178  1.00 36.64  ?  367 ASN A CG    1 
ATOM   2010  O  OD1   . ASN A  1 261 ? 76.612  32.084  -63.884  1.00 36.38  ?  367 ASN A OD1   1 
ATOM   2011  N  ND2   . ASN A  1 261 ? 74.846  32.259  -65.216  1.00 38.14  ?  367 ASN A ND2   1 
ATOM   2012  N  N     . SER A  1 262 ? 74.820  36.309  -65.225  1.00 31.96  ?  368 SER A N     1 
ATOM   2013  C  CA    . SER A  1 262 ? 74.659  36.915  -66.546  1.00 30.78  ?  368 SER A CA    1 
ATOM   2014  C  C     . SER A  1 262 ? 75.824  37.887  -66.869  1.00 29.88  ?  368 SER A C     1 
ATOM   2015  O  O     . SER A  1 262 ? 76.385  37.837  -67.957  1.00 29.69  ?  368 SER A O     1 
ATOM   2016  C  CB    . SER A  1 262 ? 73.293  37.605  -66.636  1.00 30.61  ?  368 SER A CB    1 
ATOM   2017  O  OG    . SER A  1 262 ? 72.974  37.984  -67.963  1.00 29.78  ?  368 SER A OG    1 
ATOM   2018  N  N     . LEU A  1 263 ? 76.201  38.730  -65.907  1.00 29.32  ?  369 LEU A N     1 
ATOM   2019  C  CA    . LEU A  1 263 ? 77.334  39.649  -66.083  1.00 29.43  ?  369 LEU A CA    1 
ATOM   2020  C  C     . LEU A  1 263 ? 78.680  38.956  -66.265  1.00 29.84  ?  369 LEU A C     1 
ATOM   2021  O  O     . LEU A  1 263 ? 79.544  39.440  -66.999  1.00 28.81  ?  369 LEU A O     1 
ATOM   2022  C  CB    . LEU A  1 263 ? 77.433  40.626  -64.904  1.00 29.13  ?  369 LEU A CB    1 
ATOM   2023  C  CG    . LEU A  1 263 ? 76.390  41.737  -64.857  1.00 29.02  ?  369 LEU A CG    1 
ATOM   2024  C  CD1   . LEU A  1 263 ? 76.413  42.415  -63.496  1.00 29.44  ?  369 LEU A CD1   1 
ATOM   2025  C  CD2   . LEU A  1 263 ? 76.668  42.756  -65.983  1.00 28.90  ?  369 LEU A CD2   1 
ATOM   2026  N  N     . HIS A  1 264 ? 78.859  37.841  -65.567  1.00 30.83  ?  370 HIS A N     1 
ATOM   2027  C  CA    . HIS A  1 264 ? 80.041  37.000  -65.771  1.00 31.29  ?  370 HIS A CA    1 
ATOM   2028  C  C     . HIS A  1 264 ? 80.061  36.431  -67.182  1.00 32.18  ?  370 HIS A C     1 
ATOM   2029  O  O     . HIS A  1 264 ? 81.096  36.476  -67.846  1.00 32.21  ?  370 HIS A O     1 
ATOM   2030  C  CB    . HIS A  1 264 ? 80.132  35.874  -64.730  1.00 31.07  ?  370 HIS A CB    1 
ATOM   2031  C  CG    . HIS A  1 264 ? 80.860  36.274  -63.490  1.00 30.82  ?  370 HIS A CG    1 
ATOM   2032  N  ND1   . HIS A  1 264 ? 82.226  36.274  -63.399  1.00 30.69  ?  370 HIS A ND1   1 
ATOM   2033  C  CD2   . HIS A  1 264 ? 80.411  36.724  -62.295  1.00 31.06  ?  370 HIS A CD2   1 
ATOM   2034  C  CE1   . HIS A  1 264 ? 82.595  36.693  -62.202  1.00 31.09  ?  370 HIS A CE1   1 
ATOM   2035  N  NE2   . HIS A  1 264 ? 81.507  36.974  -61.510  1.00 31.22  ?  370 HIS A NE2   1 
ATOM   2036  N  N     . ARG A  1 265 ? 78.919  35.921  -67.637  1.00 33.46  ?  371 ARG A N     1 
ATOM   2037  C  CA    . ARG A  1 265 ? 78.821  35.335  -68.974  1.00 34.68  ?  371 ARG A CA    1 
ATOM   2038  C  C     . ARG A  1 265 ? 79.109  36.370  -70.053  1.00 33.97  ?  371 ARG A C     1 
ATOM   2039  O  O     . ARG A  1 265 ? 79.943  36.138  -70.918  1.00 33.75  ?  371 ARG A O     1 
ATOM   2040  C  CB    . ARG A  1 265 ? 77.455  34.667  -69.232  1.00 36.92  ?  371 ARG A CB    1 
ATOM   2041  C  CG    . ARG A  1 265 ? 77.387  33.210  -68.785  1.00 39.60  ?  371 ARG A CG    1 
ATOM   2042  C  CD    . ARG A  1 265 ? 76.235  32.440  -69.440  1.00 41.94  ?  371 ARG A CD    1 
ATOM   2043  N  NE    . ARG A  1 265 ? 76.311  31.017  -69.052  1.00 44.03  ?  371 ARG A NE    1 
ATOM   2044  C  CZ    . ARG A  1 265 ? 77.008  30.069  -69.690  1.00 44.64  ?  371 ARG A CZ    1 
ATOM   2045  N  NH1   . ARG A  1 265 ? 77.721  30.328  -70.791  1.00 44.96  ?  371 ARG A NH1   1 
ATOM   2046  N  NH2   . ARG A  1 265 ? 76.989  28.835  -69.205  1.00 45.29  ?  371 ARG A NH2   1 
ATOM   2047  N  N     . ARG A  1 266 ? 78.447  37.516  -69.980  1.00 34.18  ?  372 ARG A N     1 
ATOM   2048  C  CA    . ARG A  1 266 ? 78.562  38.526  -71.031  1.00 34.21  ?  372 ARG A CA    1 
ATOM   2049  C  C     . ARG A  1 266 ? 79.890  39.288  -70.995  1.00 31.93  ?  372 ARG A C     1 
ATOM   2050  O  O     . ARG A  1 266 ? 80.476  39.569  -72.052  1.00 31.37  ?  372 ARG A O     1 
ATOM   2051  C  CB    . ARG A  1 266 ? 77.444  39.541  -70.929  1.00 37.07  ?  372 ARG A CB    1 
ATOM   2052  C  CG    . ARG A  1 266 ? 76.046  38.979  -71.063  1.00 40.19  ?  372 ARG A CG    1 
ATOM   2053  C  CD    . ARG A  1 266 ? 75.040  40.097  -70.797  1.00 43.18  ?  372 ARG A CD    1 
ATOM   2054  N  NE    . ARG A  1 266 ? 73.665  39.667  -71.008  1.00 46.94  ?  372 ARG A NE    1 
ATOM   2055  C  CZ    . ARG A  1 266 ? 72.581  40.381  -70.701  1.00 49.86  ?  372 ARG A CZ    1 
ATOM   2056  N  NH1   . ARG A  1 266 ? 72.681  41.576  -70.123  1.00 51.49  ?  372 ARG A NH1   1 
ATOM   2057  N  NH2   . ARG A  1 266 ? 71.364  39.882  -70.945  1.00 50.59  ?  372 ARG A NH2   1 
ATOM   2058  N  N     . ALA A  1 267 ? 80.353  39.624  -69.785  1.00 29.81  ?  373 ALA A N     1 
ATOM   2059  C  CA    . ALA A  1 267 ? 81.447  40.564  -69.614  1.00 28.01  ?  373 ALA A CA    1 
ATOM   2060  C  C     . ALA A  1 267 ? 82.685  39.989  -68.947  1.00 26.57  ?  373 ALA A C     1 
ATOM   2061  O  O     . ALA A  1 267 ? 83.726  39.844  -69.590  1.00 25.76  ?  373 ALA A O     1 
ATOM   2062  C  CB    . ALA A  1 267 ? 80.956  41.785  -68.849  1.00 27.69  ?  373 ALA A CB    1 
ATOM   2063  N  N     . TYR A  1 268 ? 82.575  39.644  -67.670  1.00 25.74  ?  374 TYR A N     1 
ATOM   2064  C  CA    . TYR A  1 268 ? 83.767  39.383  -66.842  1.00 25.38  ?  374 TYR A CA    1 
ATOM   2065  C  C     . TYR A  1 268 ? 84.587  38.188  -67.336  1.00 25.61  ?  374 TYR A C     1 
ATOM   2066  O  O     . TYR A  1 268 ? 85.836  38.221  -67.322  1.00 26.05  ?  374 TYR A O     1 
ATOM   2067  C  CB    . TYR A  1 268 ? 83.375  39.165  -65.379  1.00 24.92  ?  374 TYR A CB    1 
ATOM   2068  C  CG    . TYR A  1 268 ? 82.445  40.219  -64.781  1.00 24.31  ?  374 TYR A CG    1 
ATOM   2069  C  CD1   . TYR A  1 268 ? 82.629  41.582  -65.037  1.00 24.07  ?  374 TYR A CD1   1 
ATOM   2070  C  CD2   . TYR A  1 268 ? 81.395  39.850  -63.932  1.00 23.76  ?  374 TYR A CD2   1 
ATOM   2071  C  CE1   . TYR A  1 268 ? 81.796  42.530  -64.475  1.00 23.68  ?  374 TYR A CE1   1 
ATOM   2072  C  CE2   . TYR A  1 268 ? 80.555  40.798  -63.360  1.00 23.36  ?  374 TYR A CE2   1 
ATOM   2073  C  CZ    . TYR A  1 268 ? 80.750  42.135  -63.632  1.00 23.26  ?  374 TYR A CZ    1 
ATOM   2074  O  OH    . TYR A  1 268 ? 79.930  43.082  -63.072  1.00 22.92  ?  374 TYR A OH    1 
ATOM   2075  N  N     . GLN A  1 269 ? 83.870  37.152  -67.780  1.00 25.60  ?  375 GLN A N     1 
ATOM   2076  C  CA    . GLN A  1 269 ? 84.459  35.962  -68.387  1.00 25.71  ?  375 GLN A CA    1 
ATOM   2077  C  C     . GLN A  1 269 ? 84.353  35.952  -69.919  1.00 25.70  ?  375 GLN A C     1 
ATOM   2078  O  O     . GLN A  1 269 ? 84.370  34.881  -70.529  1.00 25.74  ?  375 GLN A O     1 
ATOM   2079  C  CB    . GLN A  1 269 ? 83.829  34.694  -67.792  1.00 25.60  ?  375 GLN A CB    1 
ATOM   2080  C  CG    . GLN A  1 269 ? 83.889  34.620  -66.280  1.00 25.60  ?  375 GLN A CG    1 
ATOM   2081  C  CD    . GLN A  1 269 ? 85.275  34.923  -65.732  1.00 25.76  ?  375 GLN A CD    1 
ATOM   2082  O  OE1   . GLN A  1 269 ? 85.440  35.735  -64.829  1.00 26.28  ?  375 GLN A OE1   1 
ATOM   2083  N  NE2   . GLN A  1 269 ? 86.278  34.288  -66.298  1.00 25.45  ?  375 GLN A NE2   1 
ATOM   2084  N  N     . HIS A  1 270 ? 84.323  37.127  -70.540  1.00 25.57  ?  376 HIS A N     1 
ATOM   2085  C  CA    . HIS A  1 270 ? 84.277  37.215  -71.995  1.00 25.68  ?  376 HIS A CA    1 
ATOM   2086  C  C     . HIS A  1 270 ? 85.500  36.547  -72.610  1.00 26.76  ?  376 HIS A C     1 
ATOM   2087  O  O     . HIS A  1 270 ? 86.624  36.780  -72.156  1.00 27.13  ?  376 HIS A O     1 
ATOM   2088  C  CB    . HIS A  1 270 ? 84.189  38.662  -72.458  1.00 24.79  ?  376 HIS A CB    1 
ATOM   2089  C  CG    . HIS A  1 270 ? 84.041  38.796  -73.933  1.00 23.96  ?  376 HIS A CG    1 
ATOM   2090  N  ND1   . HIS A  1 270 ? 85.114  39.000  -74.772  1.00 23.47  ?  376 HIS A ND1   1 
ATOM   2091  C  CD2   . HIS A  1 270 ? 82.951  38.717  -74.725  1.00 23.59  ?  376 HIS A CD2   1 
ATOM   2092  C  CE1   . HIS A  1 270 ? 84.689  39.053  -76.018  1.00 23.41  ?  376 HIS A CE1   1 
ATOM   2093  N  NE2   . HIS A  1 270 ? 83.381  38.880  -76.018  1.00 23.36  ?  376 HIS A NE2   1 
ATOM   2094  N  N     . LYS A  1 271 ? 85.260  35.721  -73.624  1.00 28.05  ?  377 LYS A N     1 
ATOM   2095  C  CA    . LYS A  1 271 ? 86.296  34.841  -74.202  1.00 29.30  ?  377 LYS A CA    1 
ATOM   2096  C  C     . LYS A  1 271 ? 87.621  35.552  -74.551  1.00 28.67  ?  377 LYS A C     1 
ATOM   2097  O  O     . LYS A  1 271 ? 88.704  35.018  -74.314  1.00 28.53  ?  377 LYS A O     1 
ATOM   2098  C  CB    . LYS A  1 271 ? 85.737  34.073  -75.420  1.00 30.86  ?  377 LYS A CB    1 
ATOM   2099  C  CG    . LYS A  1 271 ? 85.295  34.959  -76.575  1.00 32.10  ?  377 LYS A CG    1 
ATOM   2100  C  CD    . LYS A  1 271 ? 84.718  34.126  -77.723  1.00 33.56  ?  377 LYS A CD    1 
ATOM   2101  C  CE    . LYS A  1 271 ? 84.752  34.849  -79.076  1.00 34.60  ?  377 LYS A CE    1 
ATOM   2102  N  NZ    . LYS A  1 271 ? 83.811  36.005  -79.137  1.00 35.24  ?  377 LYS A NZ    1 
ATOM   2103  N  N     . VAL A  1 272 ? 87.505  36.764  -75.081  1.00 27.96  ?  378 VAL A N     1 
ATOM   2104  C  CA    . VAL A  1 272 ? 88.651  37.602  -75.444  1.00 27.61  ?  378 VAL A CA    1 
ATOM   2105  C  C     . VAL A  1 272 ? 89.196  38.357  -74.229  1.00 27.04  ?  378 VAL A C     1 
ATOM   2106  O  O     . VAL A  1 272 ? 90.409  38.549  -74.094  1.00 26.77  ?  378 VAL A O     1 
ATOM   2107  C  CB    . VAL A  1 272 ? 88.268  38.605  -76.556  1.00 27.73  ?  378 VAL A CB    1 
ATOM   2108  C  CG1   . VAL A  1 272 ? 89.477  39.422  -77.002  1.00 27.83  ?  378 VAL A CG1   1 
ATOM   2109  C  CG2   . VAL A  1 272 ? 87.659  37.886  -77.758  1.00 27.77  ?  378 VAL A CG2   1 
ATOM   2110  N  N     . GLY A  1 273 ? 88.302  38.801  -73.351  1.00 26.79  ?  379 GLY A N     1 
ATOM   2111  C  CA    . GLY A  1 273 ? 88.714  39.467  -72.115  1.00 27.09  ?  379 GLY A CA    1 
ATOM   2112  C  C     . GLY A  1 273 ? 89.610  38.569  -71.290  1.00 27.46  ?  379 GLY A C     1 
ATOM   2113  O  O     . GLY A  1 273 ? 90.640  39.008  -70.770  1.00 27.44  ?  379 GLY A O     1 
ATOM   2114  N  N     . ASN A  1 274 ? 89.210  37.303  -71.204  1.00 27.84  ?  380 ASN A N     1 
ATOM   2115  C  CA    . ASN A  1 274 ? 89.993  36.270  -70.535  1.00 28.28  ?  380 ASN A CA    1 
ATOM   2116  C  C     . ASN A  1 274 ? 91.302  35.926  -71.236  1.00 28.92  ?  380 ASN A C     1 
ATOM   2117  O  O     . ASN A  1 274 ? 92.300  35.651  -70.560  1.00 29.75  ?  380 ASN A O     1 
ATOM   2118  C  CB    . ASN A  1 274 ? 89.152  34.999  -70.354  1.00 27.86  ?  380 ASN A CB    1 
ATOM   2119  C  CG    . ASN A  1 274 ? 88.093  35.138  -69.286  1.00 27.35  ?  380 ASN A CG    1 
ATOM   2120  O  OD1   . ASN A  1 274 ? 87.369  34.181  -69.037  1.00 27.61  ?  380 ASN A OD1   1 
ATOM   2121  N  ND2   . ASN A  1 274 ? 88.002  36.310  -68.645  1.00 26.68  ?  380 ASN A ND2   1 
ATOM   2122  N  N     . ILE A  1 275 ? 91.320  35.918  -72.566  1.00 29.36  ?  381 ILE A N     1 
ATOM   2123  C  CA    . ILE A  1 275 ? 92.575  35.625  -73.264  1.00 30.30  ?  381 ILE A CA    1 
ATOM   2124  C  C     . ILE A  1 275 ? 93.567  36.770  -73.101  1.00 31.05  ?  381 ILE A C     1 
ATOM   2125  O  O     . ILE A  1 275 ? 94.767  36.541  -73.021  1.00 31.84  ?  381 ILE A O     1 
ATOM   2126  C  CB    . ILE A  1 275 ? 92.379  35.221  -74.750  1.00 30.22  ?  381 ILE A CB    1 
ATOM   2127  C  CG1   . ILE A  1 275 ? 93.526  34.307  -75.213  1.00 30.48  ?  381 ILE A CG1   1 
ATOM   2128  C  CG2   . ILE A  1 275 ? 92.293  36.425  -75.673  1.00 30.00  ?  381 ILE A CG2   1 
ATOM   2129  C  CD1   . ILE A  1 275 ? 93.616  32.972  -74.506  1.00 30.61  ?  381 ILE A CD1   1 
ATOM   2130  N  N     . ILE A  1 276 ? 93.067  37.996  -73.032  1.00 31.56  ?  382 ILE A N     1 
ATOM   2131  C  CA    . ILE A  1 276 ? 93.929  39.143  -72.768  1.00 32.30  ?  382 ILE A CA    1 
ATOM   2132  C  C     . ILE A  1 276 ? 94.477  39.114  -71.338  1.00 33.16  ?  382 ILE A C     1 
ATOM   2133  O  O     . ILE A  1 276 ? 95.656  39.394  -71.121  1.00 32.77  ?  382 ILE A O     1 
ATOM   2134  C  CB    . ILE A  1 276 ? 93.201  40.446  -73.103  1.00 32.35  ?  382 ILE A CB    1 
ATOM   2135  C  CG1   . ILE A  1 276 ? 93.056  40.523  -74.636  1.00 32.29  ?  382 ILE A CG1   1 
ATOM   2136  C  CG2   . ILE A  1 276 ? 93.982  41.652  -72.590  1.00 32.42  ?  382 ILE A CG2   1 
ATOM   2137  C  CD1   . ILE A  1 276 ? 92.145  41.631  -75.116  1.00 32.61  ?  382 ILE A CD1   1 
ATOM   2138  N  N     . ASP A  1 277 ? 93.618  38.777  -70.378  1.00 34.39  ?  383 ASP A N     1 
ATOM   2139  C  CA    . ASP A  1 277 ? 94.042  38.505  -68.989  1.00 35.54  ?  383 ASP A CA    1 
ATOM   2140  C  C     . ASP A  1 277 ? 95.199  37.463  -68.980  1.00 35.76  ?  383 ASP A C     1 
ATOM   2141  O  O     . ASP A  1 277 ? 96.258  37.740  -68.408  1.00 35.76  ?  383 ASP A O     1 
ATOM   2142  C  CB    . ASP A  1 277 ? 92.854  38.049  -68.082  1.00 36.55  ?  383 ASP A CB    1 
ATOM   2143  C  CG    . ASP A  1 277 ? 92.011  39.239  -67.489  1.00 37.84  ?  383 ASP A CG    1 
ATOM   2144  O  OD1   . ASP A  1 277 ? 92.291  40.425  -67.793  1.00 38.66  ?  383 ASP A OD1   1 
ATOM   2145  O  OD2   . ASP A  1 277 ? 91.037  38.973  -66.710  1.00 39.08  ?  383 ASP A OD2   1 
ATOM   2146  N  N     . THR A  1 278 ? 95.016  36.306  -69.635  1.00 35.64  ?  384 THR A N     1 
ATOM   2147  C  CA    . THR A  1 278 ? 96.062  35.239  -69.664  1.00 35.59  ?  384 THR A CA    1 
ATOM   2148  C  C     . THR A  1 278 ? 97.346  35.735  -70.338  1.00 35.78  ?  384 THR A C     1 
ATOM   2149  O  O     . THR A  1 278 ? 98.444  35.370  -69.913  1.00 36.50  ?  384 THR A O     1 
ATOM   2150  C  CB    . THR A  1 278 ? 95.642  33.905  -70.366  1.00 35.16  ?  384 THR A CB    1 
ATOM   2151  O  OG1   . THR A  1 278 ? 95.201  34.172  -71.684  1.00 34.43  ?  384 THR A OG1   1 
ATOM   2152  C  CG2   . THR A  1 278 ? 94.551  33.146  -69.617  1.00 35.05  ?  384 THR A CG2   1 
ATOM   2153  N  N     . MET A  1 279 ? 97.198  36.564  -71.372  1.00 35.83  ?  385 MET A N     1 
ATOM   2154  C  CA    . MET A  1 279 ? 98.344  37.136  -72.088  1.00 36.77  ?  385 MET A CA    1 
ATOM   2155  C  C     . MET A  1 279 ? 99.112  38.140  -71.240  1.00 38.72  ?  385 MET A C     1 
ATOM   2156  O  O     . MET A  1 279 ? 100.344 38.137  -71.238  1.00 39.09  ?  385 MET A O     1 
ATOM   2157  C  CB    . MET A  1 279 ? 97.907  37.786  -73.413  1.00 35.65  ?  385 MET A CB    1 
ATOM   2158  C  CG    . MET A  1 279 ? 97.691  36.802  -74.525  1.00 34.97  ?  385 MET A CG    1 
ATOM   2159  S  SD    . MET A  1 279 ? 97.068  37.476  -76.054  1.00 34.18  ?  385 MET A SD    1 
ATOM   2160  C  CE    . MET A  1 279 ? 98.565  38.113  -76.769  1.00 34.91  ?  385 MET A CE    1 
ATOM   2161  N  N     . ILE A  1 280 ? 98.394  38.992  -70.519  1.00 40.56  ?  386 ILE A N     1 
ATOM   2162  C  CA    . ILE A  1 280 ? 99.038  39.923  -69.597  1.00 42.69  ?  386 ILE A CA    1 
ATOM   2163  C  C     . ILE A  1 280 ? 99.715  39.162  -68.453  1.00 44.68  ?  386 ILE A C     1 
ATOM   2164  O  O     . ILE A  1 280 ? 100.855 39.469  -68.100  1.00 46.03  ?  386 ILE A O     1 
ATOM   2165  C  CB    . ILE A  1 280 ? 98.050  40.976  -69.070  1.00 42.63  ?  386 ILE A CB    1 
ATOM   2166  C  CG1   . ILE A  1 280 ? 97.607  41.881  -70.237  1.00 41.73  ?  386 ILE A CG1   1 
ATOM   2167  C  CG2   . ILE A  1 280 ? 98.690  41.827  -67.976  1.00 43.50  ?  386 ILE A CG2   1 
ATOM   2168  C  CD1   . ILE A  1 280 ? 96.353  42.684  -69.936  1.00 41.40  ?  386 ILE A CD1   1 
ATOM   2169  N  N     . THR A  1 281 ? 99.016  38.174  -67.891  1.00 46.34  ?  387 THR A N     1 
ATOM   2170  C  CA    . THR A  1 281 ? 99.582  37.263  -66.884  1.00 48.76  ?  387 THR A CA    1 
ATOM   2171  C  C     . THR A  1 281 ? 100.878 36.608  -67.389  1.00 49.58  ?  387 THR A C     1 
ATOM   2172  O  O     . THR A  1 281 ? 101.890 36.575  -66.680  1.00 50.24  ?  387 THR A O     1 
ATOM   2173  C  CB    . THR A  1 281 ? 98.556  36.173  -66.479  1.00 49.95  ?  387 THR A CB    1 
ATOM   2174  O  OG1   . THR A  1 281 ? 97.467  36.785  -65.786  1.00 50.00  ?  387 THR A OG1   1 
ATOM   2175  C  CG2   . THR A  1 281 ? 99.177  35.098  -65.561  1.00 51.29  ?  387 THR A CG2   1 
ATOM   2176  N  N     . ASP A  1 282 ? 100.823 36.104  -68.616  1.00 50.84  ?  388 ASP A N     1 
ATOM   2177  C  CA    . ASP A  1 282 ? 101.976 35.477  -69.267  1.00 52.17  ?  388 ASP A CA    1 
ATOM   2178  C  C     . ASP A  1 282 ? 103.167 36.432  -69.320  1.00 50.34  ?  388 ASP A C     1 
ATOM   2179  O  O     . ASP A  1 282 ? 104.278 36.066  -68.955  1.00 48.36  ?  388 ASP A O     1 
ATOM   2180  C  CB    . ASP A  1 282 ? 101.585 35.029  -70.704  1.00 54.24  ?  388 ASP A CB    1 
ATOM   2181  C  CG    . ASP A  1 282 ? 102.276 33.778  -71.178  1.00 56.78  ?  388 ASP A CG    1 
ATOM   2182  O  OD1   . ASP A  1 282 ? 103.193 33.270  -70.470  1.00 58.91  ?  388 ASP A OD1   1 
ATOM   2183  O  OD2   . ASP A  1 282 ? 101.869 33.374  -72.306  1.00 58.94  ?  388 ASP A OD2   1 
ATOM   2184  N  N     . ALA A  1 283 ? 102.912 37.664  -69.750  1.00 49.44  ?  389 ALA A N     1 
ATOM   2185  C  CA    . ALA A  1 283 ? 103.940 38.710  -69.819  1.00 50.13  ?  389 ALA A CA    1 
ATOM   2186  C  C     . ALA A  1 283 ? 104.519 39.062  -68.456  1.00 50.52  ?  389 ALA A C     1 
ATOM   2187  O  O     . ALA A  1 283 ? 105.717 39.326  -68.344  1.00 50.13  ?  389 ALA A O     1 
ATOM   2188  C  CB    . ALA A  1 283 ? 103.375 39.953  -70.483  1.00 49.72  ?  389 ALA A CB    1 
ATOM   2189  N  N     . PHE A  1 284 ? 103.675 39.080  -67.429  1.00 51.76  ?  390 PHE A N     1 
ATOM   2190  C  CA    . PHE A  1 284 ? 104.132 39.340  -66.062  1.00 53.64  ?  390 PHE A CA    1 
ATOM   2191  C  C     . PHE A  1 284 ? 105.043 38.227  -65.594  1.00 57.06  ?  390 PHE A C     1 
ATOM   2192  O  O     . PHE A  1 284 ? 106.074 38.499  -64.989  1.00 61.72  ?  390 PHE A O     1 
ATOM   2193  C  CB    . PHE A  1 284 ? 102.967 39.455  -65.080  1.00 52.39  ?  390 PHE A CB    1 
ATOM   2194  C  CG    . PHE A  1 284 ? 102.254 40.773  -65.098  1.00 51.70  ?  390 PHE A CG    1 
ATOM   2195  C  CD1   . PHE A  1 284 ? 102.334 41.650  -66.187  1.00 51.49  ?  390 PHE A CD1   1 
ATOM   2196  C  CD2   . PHE A  1 284 ? 101.454 41.127  -64.023  1.00 51.56  ?  390 PHE A CD2   1 
ATOM   2197  C  CE1   . PHE A  1 284 ? 101.653 42.852  -66.179  1.00 51.49  ?  390 PHE A CE1   1 
ATOM   2198  C  CE2   . PHE A  1 284 ? 100.769 42.328  -64.007  1.00 51.75  ?  390 PHE A CE2   1 
ATOM   2199  C  CZ    . PHE A  1 284 ? 100.856 43.184  -65.089  1.00 51.94  ?  390 PHE A CZ    1 
ATOM   2200  N  N     . LEU A  1 285 ? 104.662 36.982  -65.868  1.00 58.67  ?  391 LEU A N     1 
ATOM   2201  C  CA    . LEU A  1 285 ? 105.490 35.836  -65.492  1.00 60.87  ?  391 LEU A CA    1 
ATOM   2202  C  C     . LEU A  1 285 ? 106.889 35.921  -66.104  1.00 60.86  ?  391 LEU A C     1 
ATOM   2203  O  O     . LEU A  1 285 ? 107.885 35.668  -65.420  1.00 61.76  ?  391 LEU A O     1 
ATOM   2204  C  CB    . LEU A  1 285 ? 104.807 34.510  -65.867  1.00 62.61  ?  391 LEU A CB    1 
ATOM   2205  C  CG    . LEU A  1 285 ? 103.573 34.114  -65.039  1.00 64.03  ?  391 LEU A CG    1 
ATOM   2206  C  CD1   . LEU A  1 285 ? 102.830 32.984  -65.734  1.00 64.98  ?  391 LEU A CD1   1 
ATOM   2207  C  CD2   . LEU A  1 285 ? 103.926 33.718  -63.609  1.00 64.82  ?  391 LEU A CD2   1 
ATOM   2208  N  N     . LYS A  1 286 ? 106.965 36.314  -67.374  1.00 59.56  ?  392 LYS A N     1 
ATOM   2209  C  CA    . LYS A  1 286 ? 108.256 36.451  -68.060  1.00 59.96  ?  392 LYS A CA    1 
ATOM   2210  C  C     . LYS A  1 286 ? 109.055 37.663  -67.594  1.00 59.37  ?  392 LYS A C     1 
ATOM   2211  O  O     . LYS A  1 286 ? 110.275 37.635  -67.616  1.00 59.45  ?  392 LYS A O     1 
ATOM   2212  C  CB    . LYS A  1 286 ? 108.063 36.477  -69.574  1.00 60.22  ?  392 LYS A CB    1 
ATOM   2213  C  CG    . LYS A  1 286 ? 107.517 35.176  -70.129  1.00 61.10  ?  392 LYS A CG    1 
ATOM   2214  C  CD    . LYS A  1 286 ? 107.593 35.252  -71.646  1.00 61.40  ?  392 LYS A CD    1 
ATOM   2215  C  CE    . LYS A  1 286 ? 107.412 33.949  -72.433  1.00 62.86  ?  392 LYS A CE    1 
ATOM   2216  N  NZ    . LYS A  1 286 ? 106.254 33.130  -71.999  1.00 63.99  ?  392 LYS A NZ    1 
ATOM   2217  N  N     . ALA A  1 287 ? 108.361 38.712  -67.175  1.00 59.60  ?  393 ALA A N     1 
ATOM   2218  C  CA    . ALA A  1 287 ? 109.012 39.906  -66.644  1.00 60.11  ?  393 ALA A CA    1 
ATOM   2219  C  C     . ALA A  1 287 ? 109.378 39.828  -65.151  1.00 59.52  ?  393 ALA A C     1 
ATOM   2220  O  O     . ALA A  1 287 ? 110.142 40.661  -64.671  1.00 60.24  ?  393 ALA A O     1 
ATOM   2221  C  CB    . ALA A  1 287 ? 108.129 41.118  -66.888  1.00 60.36  ?  393 ALA A CB    1 
ATOM   2222  N  N     . ASP A  1 288 ? 108.835 38.854  -64.423  1.00 58.84  ?  394 ASP A N     1 
ATOM   2223  C  CA    . ASP A  1 288 ? 108.887 38.848  -62.944  1.00 59.08  ?  394 ASP A CA    1 
ATOM   2224  C  C     . ASP A  1 288 ? 110.300 38.897  -62.388  1.00 59.01  ?  394 ASP A C     1 
ATOM   2225  O  O     . ASP A  1 288 ? 110.575 39.660  -61.446  1.00 58.98  ?  394 ASP A O     1 
ATOM   2226  C  CB    . ASP A  1 288 ? 108.178 37.610  -62.380  1.00 59.31  ?  394 ASP A CB    1 
ATOM   2227  C  CG    . ASP A  1 288 ? 107.936 37.696  -60.876  1.00 60.76  ?  394 ASP A CG    1 
ATOM   2228  O  OD1   . ASP A  1 288 ? 107.965 38.808  -60.281  1.00 61.51  ?  394 ASP A OD1   1 
ATOM   2229  O  OD2   . ASP A  1 288 ? 107.708 36.622  -60.279  1.00 62.60  ?  394 ASP A OD2   1 
ATOM   2230  N  N     . ASP A  1 289 ? 111.178 38.104  -62.988  1.00 59.30  ?  395 ASP A N     1 
ATOM   2231  C  CA    . ASP A  1 289 ? 112.562 37.958  -62.542  1.00 60.62  ?  395 ASP A CA    1 
ATOM   2232  C  C     . ASP A  1 289 ? 113.370 39.248  -62.639  1.00 62.31  ?  395 ASP A C     1 
ATOM   2233  O  O     . ASP A  1 289 ? 114.257 39.472  -61.817  1.00 65.47  ?  395 ASP A O     1 
ATOM   2234  C  CB    . ASP A  1 289 ? 113.297 36.885  -63.349  1.00 60.26  ?  395 ASP A CB    1 
ATOM   2235  C  CG    . ASP A  1 289 ? 112.693 35.522  -63.244  1.00 60.92  ?  395 ASP A CG    1 
ATOM   2236  O  OD1   . ASP A  1 289 ? 112.155 35.196  -62.166  1.00 61.75  ?  395 ASP A OD1   1 
ATOM   2237  O  OD2   . ASP A  1 289 ? 112.784 34.777  -64.242  1.00 60.76  ?  395 ASP A OD2   1 
ATOM   2238  N  N     . TYR A  1 290 ? 113.063 40.093  -63.623  1.00 63.25  ?  396 TYR A N     1 
ATOM   2239  C  CA    . TYR A  1 290 ? 113.893 41.257  -63.936  1.00 65.42  ?  396 TYR A CA    1 
ATOM   2240  C  C     . TYR A  1 290 ? 113.306 42.609  -63.504  1.00 67.12  ?  396 TYR A C     1 
ATOM   2241  O  O     . TYR A  1 290 ? 113.912 43.647  -63.778  1.00 67.65  ?  396 TYR A O     1 
ATOM   2242  C  CB    . TYR A  1 290 ? 114.206 41.288  -65.434  1.00 65.75  ?  396 TYR A CB    1 
ATOM   2243  C  CG    . TYR A  1 290 ? 114.460 39.914  -66.007  1.00 66.75  ?  396 TYR A CG    1 
ATOM   2244  C  CD1   . TYR A  1 290 ? 115.692 39.283  -65.847  1.00 67.82  ?  396 TYR A CD1   1 
ATOM   2245  C  CD2   . TYR A  1 290 ? 113.456 39.231  -66.681  1.00 66.94  ?  396 TYR A CD2   1 
ATOM   2246  C  CE1   . TYR A  1 290 ? 115.923 38.023  -66.372  1.00 67.78  ?  396 TYR A CE1   1 
ATOM   2247  C  CE2   . TYR A  1 290 ? 113.678 37.965  -67.203  1.00 66.54  ?  396 TYR A CE2   1 
ATOM   2248  C  CZ    . TYR A  1 290 ? 114.902 37.370  -67.046  1.00 66.70  ?  396 TYR A CZ    1 
ATOM   2249  O  OH    . TYR A  1 290 ? 115.101 36.116  -67.552  1.00 65.75  ?  396 TYR A OH    1 
ATOM   2250  N  N     . ILE A  1 291 ? 112.148 42.611  -62.841  1.00 68.46  ?  397 ILE A N     1 
ATOM   2251  C  CA    . ILE A  1 291 ? 111.583 43.848  -62.310  1.00 68.10  ?  397 ILE A CA    1 
ATOM   2252  C  C     . ILE A  1 291 ? 111.748 43.881  -60.805  1.00 69.27  ?  397 ILE A C     1 
ATOM   2253  O  O     . ILE A  1 291 ? 111.322 42.959  -60.106  1.00 68.38  ?  397 ILE A O     1 
ATOM   2254  C  CB    . ILE A  1 291 ? 110.110 44.029  -62.695  1.00 66.68  ?  397 ILE A CB    1 
ATOM   2255  C  CG1   . ILE A  1 291 ? 110.035 44.495  -64.146  1.00 66.14  ?  397 ILE A CG1   1 
ATOM   2256  C  CG2   . ILE A  1 291 ? 109.434 45.075  -61.816  1.00 66.85  ?  397 ILE A CG2   1 
ATOM   2257  C  CD1   . ILE A  1 291 ? 108.672 44.347  -64.783  1.00 65.25  ?  397 ILE A CD1   1 
ATOM   2258  N  N     . GLU A  1 292 ? 112.367 44.965  -60.340  1.00 71.50  ?  398 GLU A N     1 
ATOM   2259  C  CA    . GLU A  1 292 ? 112.571 45.240  -58.927  1.00 72.84  ?  398 GLU A CA    1 
ATOM   2260  C  C     . GLU A  1 292 ? 111.611 46.353  -58.490  1.00 70.34  ?  398 GLU A C     1 
ATOM   2261  O  O     . GLU A  1 292 ? 111.331 47.285  -59.258  1.00 70.46  ?  398 GLU A O     1 
ATOM   2262  C  CB    . GLU A  1 292 ? 114.026 45.670  -58.681  1.00 75.97  ?  398 GLU A CB    1 
ATOM   2263  C  CG    . GLU A  1 292 ? 115.094 44.617  -58.981  1.00 78.38  ?  398 GLU A CG    1 
ATOM   2264  C  CD    . GLU A  1 292 ? 116.492 45.011  -58.489  1.00 81.17  ?  398 GLU A CD    1 
ATOM   2265  O  OE1   . GLU A  1 292 ? 116.847 46.206  -58.550  1.00 83.73  ?  398 GLU A OE1   1 
ATOM   2266  O  OE2   . GLU A  1 292 ? 117.256 44.127  -58.040  1.00 82.49  ?  398 GLU A OE2   1 
ATOM   2267  N  N     . ILE A  1 293 ? 111.088 46.232  -57.271  1.00 67.29  ?  399 ILE A N     1 
ATOM   2268  C  CA    . ILE A  1 293 ? 110.256 47.265  -56.658  1.00 66.99  ?  399 ILE A CA    1 
ATOM   2269  C  C     . ILE A  1 293 ? 110.771 47.522  -55.245  1.00 67.31  ?  399 ILE A C     1 
ATOM   2270  O  O     . ILE A  1 293 ? 110.923 46.590  -54.450  1.00 65.96  ?  399 ILE A O     1 
ATOM   2271  C  CB    . ILE A  1 293 ? 108.768 46.862  -56.590  1.00 67.03  ?  399 ILE A CB    1 
ATOM   2272  C  CG1   . ILE A  1 293 ? 108.262 46.379  -57.954  1.00 66.83  ?  399 ILE A CG1   1 
ATOM   2273  C  CG2   . ILE A  1 293 ? 107.916 48.040  -56.123  1.00 67.20  ?  399 ILE A CG2   1 
ATOM   2274  C  CD1   . ILE A  1 293 ? 107.082 45.446  -57.877  1.00 66.35  ?  399 ILE A CD1   1 
ATOM   2275  N  N     . THR A  1 294 ? 111.033 48.792  -54.950  1.00 67.86  ?  400 THR A N     1 
ATOM   2276  C  CA    . THR A  1 294 ? 111.578 49.208  -53.669  1.00 67.90  ?  400 THR A CA    1 
ATOM   2277  C  C     . THR A  1 294 ? 110.527 49.049  -52.605  1.00 66.02  ?  400 THR A C     1 
ATOM   2278  O  O     . THR A  1 294 ? 109.426 49.561  -52.751  1.00 62.21  ?  400 THR A O     1 
ATOM   2279  C  CB    . THR A  1 294 ? 112.008 50.680  -53.683  1.00 70.08  ?  400 THR A CB    1 
ATOM   2280  O  OG1   . THR A  1 294 ? 112.904 50.929  -54.767  1.00 72.90  ?  400 THR A OG1   1 
ATOM   2281  C  CG2   . THR A  1 294 ? 112.627 51.117  -52.345  1.00 71.42  ?  400 THR A CG2   1 
ATOM   2282  N  N     . GLY A  1 295 ? 110.884 48.357  -51.530  1.00 69.97  ?  401 GLY A N     1 
ATOM   2283  C  CA    . GLY A  1 295 ? 109.992 48.116  -50.408  1.00 73.01  ?  401 GLY A CA    1 
ATOM   2284  C  C     . GLY A  1 295 ? 110.434 48.811  -49.136  1.00 74.29  ?  401 GLY A C     1 
ATOM   2285  O  O     . GLY A  1 295 ? 111.069 49.865  -49.179  1.00 74.80  ?  401 GLY A O     1 
ATOM   2286  N  N     . ALA A  1 296 ? 110.100 48.190  -48.009  1.00 75.95  ?  402 ALA A N     1 
ATOM   2287  C  CA    . ALA A  1 296 ? 110.378 48.735  -46.689  1.00 78.41  ?  402 ALA A CA    1 
ATOM   2288  C  C     . ALA A  1 296 ? 111.858 48.605  -46.382  1.00 81.07  ?  402 ALA A C     1 
ATOM   2289  O  O     . ALA A  1 296 ? 112.452 47.532  -46.575  1.00 83.46  ?  402 ALA A O     1 
ATOM   2290  C  CB    . ALA A  1 296 ? 109.546 48.033  -45.629  1.00 77.88  ?  402 ALA A CB    1 
ATOM   2291  N  N     . GLY A  1 297 ? 112.444 49.714  -45.926  1.00 82.17  ?  403 GLY A N     1 
ATOM   2292  C  CA    . GLY A  1 297 ? 113.878 49.812  -45.698  1.00 83.91  ?  403 GLY A CA    1 
ATOM   2293  C  C     . GLY A  1 297 ? 114.702 49.645  -46.963  1.00 84.66  ?  403 GLY A C     1 
ATOM   2294  O  O     . GLY A  1 297 ? 115.878 49.303  -46.886  1.00 87.86  ?  403 GLY A O     1 
ATOM   2295  N  N     . GLY A  1 298 ? 114.090 49.885  -48.123  1.00 81.07  ?  404 GLY A N     1 
ATOM   2296  C  CA    . GLY A  1 298 ? 114.753 49.701  -49.401  1.00 78.58  ?  404 GLY A CA    1 
ATOM   2297  C  C     . GLY A  1 298 ? 114.922 48.280  -49.947  1.00 77.29  ?  404 GLY A C     1 
ATOM   2298  O  O     . GLY A  1 298 ? 115.517 48.131  -51.017  1.00 78.02  ?  404 GLY A O     1 
ATOM   2299  N  N     . LYS A  1 299 ? 114.415 47.245  -49.266  1.00 75.21  ?  405 LYS A N     1 
ATOM   2300  C  CA    . LYS A  1 299 ? 114.583 45.868  -49.761  1.00 75.27  ?  405 LYS A CA    1 
ATOM   2301  C  C     . LYS A  1 299 ? 113.960 45.706  -51.163  1.00 74.94  ?  405 LYS A C     1 
ATOM   2302  O  O     . LYS A  1 299 ? 112.942 46.324  -51.456  1.00 76.20  ?  405 LYS A O     1 
ATOM   2303  C  CB    . LYS A  1 299 ? 113.999 44.836  -48.783  1.00 74.76  ?  405 LYS A CB    1 
ATOM   2304  C  CG    . LYS A  1 299 ? 114.869 43.564  -48.816  1.00 74.85  ?  405 LYS A CG    1 
ATOM   2305  C  CD    . LYS A  1 299 ? 114.163 42.271  -48.432  1.00 73.04  ?  405 LYS A CD    1 
ATOM   2306  C  CE    . LYS A  1 299 ? 114.199 41.195  -49.515  1.00 71.42  ?  405 LYS A CE    1 
ATOM   2307  N  NZ    . LYS A  1 299 ? 113.147 40.187  -49.228  1.00 70.62  ?  405 LYS A NZ    1 
ATOM   2308  N  N     . LYS A  1 300 ? 114.585 44.907  -52.020  1.00 74.88  ?  406 LYS A N     1 
ATOM   2309  C  CA    . LYS A  1 300 ? 114.109 44.703  -53.390  1.00 75.67  ?  406 LYS A CA    1 
ATOM   2310  C  C     . LYS A  1 300 ? 113.070 43.584  -53.457  1.00 73.24  ?  406 LYS A C     1 
ATOM   2311  O  O     . LYS A  1 300 ? 113.332 42.459  -53.003  1.00 75.63  ?  406 LYS A O     1 
ATOM   2312  C  CB    . LYS A  1 300 ? 115.279 44.373  -54.324  1.00 78.95  ?  406 LYS A CB    1 
ATOM   2313  C  CG    . LYS A  1 300 ? 116.374 45.410  -54.364  1.00 82.21  ?  406 LYS A CG    1 
ATOM   2314  C  CD    . LYS A  1 300 ? 115.928 46.616  -55.152  1.00 84.58  ?  406 LYS A CD    1 
ATOM   2315  C  CE    . LYS A  1 300 ? 116.906 47.748  -55.103  1.00 88.30  ?  406 LYS A CE    1 
ATOM   2316  N  NZ    . LYS A  1 300 ? 116.321 48.858  -55.911  1.00 89.93  ?  406 LYS A NZ    1 
ATOM   2317  N  N     . TYR A  1 301 ? 111.895 43.889  -54.011  1.00 68.50  ?  407 TYR A N     1 
ATOM   2318  C  CA    . TYR A  1 301 ? 110.844 42.886  -54.221  1.00 65.72  ?  407 TYR A CA    1 
ATOM   2319  C  C     . TYR A  1 301 ? 110.485 42.746  -55.694  1.00 62.68  ?  407 TYR A C     1 
ATOM   2320  O  O     . TYR A  1 301 ? 110.571 43.711  -56.450  1.00 60.13  ?  407 TYR A O     1 
ATOM   2321  C  CB    . TYR A  1 301 ? 109.597 43.233  -53.390  1.00 66.42  ?  407 TYR A CB    1 
ATOM   2322  C  CG    . TYR A  1 301 ? 109.839 43.215  -51.901  1.00 66.77  ?  407 TYR A CG    1 
ATOM   2323  C  CD1   . TYR A  1 301 ? 109.768 42.026  -51.177  1.00 66.96  ?  407 TYR A CD1   1 
ATOM   2324  C  CD2   . TYR A  1 301 ? 110.211 44.375  -51.221  1.00 67.32  ?  407 TYR A CD2   1 
ATOM   2325  C  CE1   . TYR A  1 301 ? 109.949 42.016  -49.800  1.00 67.73  ?  407 TYR A CE1   1 
ATOM   2326  C  CE2   . TYR A  1 301 ? 110.472 44.350  -49.859  1.00 68.07  ?  407 TYR A CE2   1 
ATOM   2327  C  CZ    . TYR A  1 301 ? 110.330 43.175  -49.153  1.00 68.03  ?  407 TYR A CZ    1 
ATOM   2328  O  OH    . TYR A  1 301 ? 110.564 43.152  -47.802  1.00 69.12  ?  407 TYR A OH    1 
ATOM   2329  N  N     . ARG A  1 302 ? 110.098 41.536  -56.092  1.00 61.22  ?  408 ARG A N     1 
ATOM   2330  C  CA    . ARG A  1 302 ? 109.619 41.243  -57.448  1.00 60.00  ?  408 ARG A CA    1 
ATOM   2331  C  C     . ARG A  1 302 ? 108.114 41.412  -57.501  1.00 55.06  ?  408 ARG A C     1 
ATOM   2332  O  O     . ARG A  1 302 ? 107.474 41.636  -56.469  1.00 55.63  ?  408 ARG A O     1 
ATOM   2333  C  CB    . ARG A  1 302 ? 110.006 39.822  -57.854  1.00 63.52  ?  408 ARG A CB    1 
ATOM   2334  C  CG    . ARG A  1 302 ? 111.464 39.689  -58.222  1.00 68.15  ?  408 ARG A CG    1 
ATOM   2335  C  CD    . ARG A  1 302 ? 111.799 38.247  -58.504  1.00 72.24  ?  408 ARG A CD    1 
ATOM   2336  N  NE    . ARG A  1 302 ? 113.240 38.049  -58.474  1.00 77.15  ?  408 ARG A NE    1 
ATOM   2337  C  CZ    . ARG A  1 302 ? 113.828 36.859  -58.535  1.00 82.87  ?  408 ARG A CZ    1 
ATOM   2338  N  NH1   . ARG A  1 302 ? 115.160 36.782  -58.488  1.00 85.17  ?  408 ARG A NH1   1 
ATOM   2339  N  NH2   . ARG A  1 302 ? 113.097 35.741  -58.642  1.00 85.74  ?  408 ARG A NH2   1 
ATOM   2340  N  N     . ILE A  1 303 ? 107.540 41.300  -58.695  1.00 50.20  ?  409 ILE A N     1 
ATOM   2341  C  CA    . ILE A  1 303 ? 106.096 41.485  -58.858  1.00 48.42  ?  409 ILE A CA    1 
ATOM   2342  C  C     . ILE A  1 303 ? 105.366 40.476  -57.986  1.00 48.26  ?  409 ILE A C     1 
ATOM   2343  O  O     . ILE A  1 303 ? 104.462 40.838  -57.247  1.00 46.56  ?  409 ILE A O     1 
ATOM   2344  C  CB    . ILE A  1 303 ? 105.636 41.346  -60.322  1.00 47.43  ?  409 ILE A CB    1 
ATOM   2345  C  CG1   . ILE A  1 303 ? 106.264 42.445  -61.171  1.00 47.74  ?  409 ILE A CG1   1 
ATOM   2346  C  CG2   . ILE A  1 303 ? 104.120 41.452  -60.431  1.00 46.98  ?  409 ILE A CG2   1 
ATOM   2347  C  CD1   . ILE A  1 303 ? 105.983 42.329  -62.658  1.00 47.83  ?  409 ILE A CD1   1 
ATOM   2348  N  N     . SER A  1 304 ? 105.787 39.219  -58.074  1.00 49.55  ?  410 SER A N     1 
ATOM   2349  C  CA    . SER A  1 304 ? 105.172 38.132  -57.312  1.00 51.25  ?  410 SER A CA    1 
ATOM   2350  C  C     . SER A  1 304 ? 105.373 38.211  -55.792  1.00 52.23  ?  410 SER A C     1 
ATOM   2351  O  O     . SER A  1 304 ? 104.550 37.694  -55.045  1.00 52.29  ?  410 SER A O     1 
ATOM   2352  C  CB    . SER A  1 304 ? 105.689 36.790  -57.819  1.00 51.83  ?  410 SER A CB    1 
ATOM   2353  O  OG    . SER A  1 304 ? 107.108 36.742  -57.706  1.00 53.36  ?  410 SER A OG    1 
ATOM   2354  N  N     . THR A  1 305 ? 106.463 38.833  -55.343  1.00 53.56  ?  411 THR A N     1 
ATOM   2355  C  CA    . THR A  1 305 ? 106.786 38.933  -53.905  1.00 54.32  ?  411 THR A CA    1 
ATOM   2356  C  C     . THR A  1 305 ? 106.406 40.260  -53.240  1.00 53.93  ?  411 THR A C     1 
ATOM   2357  O  O     . THR A  1 305 ? 106.510 40.390  -52.016  1.00 55.22  ?  411 THR A O     1 
ATOM   2358  C  CB    . THR A  1 305 ? 108.280 38.663  -53.657  1.00 55.60  ?  411 THR A CB    1 
ATOM   2359  O  OG1   . THR A  1 305 ? 109.063 39.552  -54.458  1.00 55.92  ?  411 THR A OG1   1 
ATOM   2360  C  CG2   . THR A  1 305 ? 108.624 37.223  -54.008  1.00 56.24  ?  411 THR A CG2   1 
ATOM   2361  N  N     . ALA A  1 306 ? 105.962 41.233  -54.028  1.00 52.71  ?  412 ALA A N     1 
ATOM   2362  C  CA    . ALA A  1 306 ? 105.521 42.518  -53.490  1.00 51.85  ?  412 ALA A CA    1 
ATOM   2363  C  C     . ALA A  1 306 ? 104.362 42.370  -52.516  1.00 50.51  ?  412 ALA A C     1 
ATOM   2364  O  O     . ALA A  1 306 ? 104.241 43.152  -51.594  1.00 52.23  ?  412 ALA A O     1 
ATOM   2365  C  CB    . ALA A  1 306 ? 105.148 43.470  -54.609  1.00 51.98  ?  412 ALA A CB    1 
ATOM   2366  N  N     . ILE A  1 307 ? 103.525 41.354  -52.715  1.00 48.45  ?  413 ILE A N     1 
ATOM   2367  C  CA    . ILE A  1 307 ? 102.425 41.043  -51.782  1.00 47.44  ?  413 ILE A CA    1 
ATOM   2368  C  C     . ILE A  1 307 ? 102.870 40.790  -50.335  1.00 48.11  ?  413 ILE A C     1 
ATOM   2369  O  O     . ILE A  1 307 ? 102.071 40.935  -49.410  1.00 48.53  ?  413 ILE A O     1 
ATOM   2370  C  CB    . ILE A  1 307 ? 101.569 39.840  -52.247  1.00 46.47  ?  413 ILE A CB    1 
ATOM   2371  C  CG1   . ILE A  1 307 ? 102.398 38.560  -52.376  1.00 46.12  ?  413 ILE A CG1   1 
ATOM   2372  C  CG2   . ILE A  1 307 ? 100.852 40.175  -53.551  1.00 45.85  ?  413 ILE A CG2   1 
ATOM   2373  C  CD1   . ILE A  1 307 ? 101.560 37.315  -52.595  1.00 45.93  ?  413 ILE A CD1   1 
ATOM   2374  N  N     . ASP A  1 308 ? 104.126 40.396  -50.142  1.00 48.03  ?  414 ASP A N     1 
ATOM   2375  C  CA    . ASP A  1 308 ? 104.652 40.170  -48.802  1.00 48.82  ?  414 ASP A CA    1 
ATOM   2376  C  C     . ASP A  1 308 ? 104.926 41.458  -48.036  1.00 50.21  ?  414 ASP A C     1 
ATOM   2377  O  O     . ASP A  1 308 ? 104.760 41.487  -46.813  1.00 52.41  ?  414 ASP A O     1 
ATOM   2378  C  CB    . ASP A  1 308 ? 105.899 39.303  -48.873  1.00 48.29  ?  414 ASP A CB    1 
ATOM   2379  C  CG    . ASP A  1 308 ? 105.615 37.942  -49.477  1.00 47.55  ?  414 ASP A CG    1 
ATOM   2380  O  OD1   . ASP A  1 308 ? 104.584 37.332  -49.136  1.00 46.62  ?  414 ASP A OD1   1 
ATOM   2381  O  OD2   . ASP A  1 308 ? 106.421 37.492  -50.309  1.00 47.62  ?  414 ASP A OD2   1 
ATOM   2382  N  N     . ASP A  1 309 ? 105.324 42.513  -48.743  1.00 50.11  ?  415 ASP A N     1 
ATOM   2383  C  CA    . ASP A  1 309 ? 105.542 43.828  -48.143  1.00 50.18  ?  415 ASP A CA    1 
ATOM   2384  C  C     . ASP A  1 309 ? 104.563 44.855  -48.721  1.00 51.70  ?  415 ASP A C     1 
ATOM   2385  O  O     . ASP A  1 309 ? 104.435 44.971  -49.931  1.00 52.21  ?  415 ASP A O     1 
ATOM   2386  C  CB    . ASP A  1 309 ? 106.979 44.266  -48.383  1.00 49.18  ?  415 ASP A CB    1 
ATOM   2387  C  CG    . ASP A  1 309 ? 107.251 45.680  -47.904  1.00 49.21  ?  415 ASP A CG    1 
ATOM   2388  O  OD1   . ASP A  1 309 ? 106.760 46.056  -46.818  1.00 49.72  ?  415 ASP A OD1   1 
ATOM   2389  O  OD2   . ASP A  1 309 ? 107.955 46.422  -48.611  1.00 49.30  ?  415 ASP A OD2   1 
ATOM   2390  N  N     . MET A  1 310 ? 103.894 45.607  -47.855  1.00 54.64  ?  416 MET A N     1 
ATOM   2391  C  CA    . MET A  1 310 ? 102.883 46.581  -48.285  1.00 55.45  ?  416 MET A CA    1 
ATOM   2392  C  C     . MET A  1 310 ? 103.444 47.898  -48.793  1.00 57.08  ?  416 MET A C     1 
ATOM   2393  O  O     . MET A  1 310 ? 102.800 48.560  -49.600  1.00 58.28  ?  416 MET A O     1 
ATOM   2394  C  CB    . MET A  1 310 ? 101.889 46.865  -47.150  1.00 54.99  ?  416 MET A CB    1 
ATOM   2395  C  CG    . MET A  1 310 ? 100.988 45.699  -46.816  1.00 54.42  ?  416 MET A CG    1 
ATOM   2396  S  SD    . MET A  1 310 ? 99.946  45.184  -48.207  1.00 52.53  ?  416 MET A SD    1 
ATOM   2397  C  CE    . MET A  1 310 ? 100.859 43.763  -48.818  1.00 53.18  ?  416 MET A CE    1 
ATOM   2398  N  N     . GLU A  1 311 ? 104.614 48.297  -48.313  1.00 59.09  ?  417 GLU A N     1 
ATOM   2399  C  CA    . GLU A  1 311 ? 105.233 49.520  -48.807  1.00 59.83  ?  417 GLU A CA    1 
ATOM   2400  C  C     . GLU A  1 311 ? 105.615 49.356  -50.277  1.00 57.05  ?  417 GLU A C     1 
ATOM   2401  O  O     . GLU A  1 311 ? 105.503 50.301  -51.056  1.00 58.07  ?  417 GLU A O     1 
ATOM   2402  C  CB    . GLU A  1 311 ? 106.447 49.895  -47.967  1.00 63.92  ?  417 GLU A CB    1 
ATOM   2403  C  CG    . GLU A  1 311 ? 106.914 51.325  -48.181  1.00 66.49  ?  417 GLU A CG    1 
ATOM   2404  C  CD    . GLU A  1 311 ? 108.074 51.705  -47.284  1.00 69.08  ?  417 GLU A CD    1 
ATOM   2405  O  OE1   . GLU A  1 311 ? 108.053 51.322  -46.089  1.00 71.73  ?  417 GLU A OE1   1 
ATOM   2406  O  OE2   . GLU A  1 311 ? 109.008 52.383  -47.774  1.00 69.83  ?  417 GLU A OE2   1 
ATOM   2407  N  N     . ALA A  1 312 ? 106.046 48.150  -50.646  1.00 53.59  ?  418 ALA A N     1 
ATOM   2408  C  CA    . ALA A  1 312 ? 106.337 47.815  -52.039  1.00 51.64  ?  418 ALA A CA    1 
ATOM   2409  C  C     . ALA A  1 312 ? 105.059 47.719  -52.862  1.00 50.33  ?  418 ALA A C     1 
ATOM   2410  O  O     . ALA A  1 312 ? 104.940 48.347  -53.912  1.00 49.83  ?  418 ALA A O     1 
ATOM   2411  C  CB    . ALA A  1 312 ? 107.098 46.502  -52.116  1.00 51.75  ?  418 ALA A CB    1 
ATOM   2412  N  N     . TYR A  1 313 ? 104.109 46.932  -52.361  1.00 49.40  ?  419 TYR A N     1 
ATOM   2413  C  CA    . TYR A  1 313 ? 102.809 46.688  -53.022  1.00 47.48  ?  419 TYR A CA    1 
ATOM   2414  C  C     . TYR A  1 313 ? 102.013 47.965  -53.305  1.00 47.10  ?  419 TYR A C     1 
ATOM   2415  O  O     . TYR A  1 313 ? 101.240 48.012  -54.265  1.00 45.31  ?  419 TYR A O     1 
ATOM   2416  C  CB    . TYR A  1 313 ? 101.974 45.743  -52.153  1.00 47.02  ?  419 TYR A CB    1 
ATOM   2417  C  CG    . TYR A  1 313 ? 100.799 45.077  -52.835  1.00 46.66  ?  419 TYR A CG    1 
ATOM   2418  C  CD1   . TYR A  1 313 ? 100.963 44.328  -53.997  1.00 46.04  ?  419 TYR A CD1   1 
ATOM   2419  C  CD2   . TYR A  1 313 ? 99.520  45.148  -52.278  1.00 46.94  ?  419 TYR A CD2   1 
ATOM   2420  C  CE1   . TYR A  1 313 ? 99.882  43.703  -54.601  1.00 46.07  ?  419 TYR A CE1   1 
ATOM   2421  C  CE2   . TYR A  1 313 ? 98.435  44.528  -52.873  1.00 46.30  ?  419 TYR A CE2   1 
ATOM   2422  C  CZ    . TYR A  1 313 ? 98.614  43.805  -54.031  1.00 46.09  ?  419 TYR A CZ    1 
ATOM   2423  O  OH    . TYR A  1 313 ? 97.520  43.196  -54.601  1.00 44.93  ?  419 TYR A OH    1 
ATOM   2424  N  N     . THR A  1 314 ? 102.209 48.985  -52.466  1.00 48.67  ?  420 THR A N     1 
ATOM   2425  C  CA    . THR A  1 314 ? 101.674 50.330  -52.689  1.00 50.42  ?  420 THR A CA    1 
ATOM   2426  C  C     . THR A  1 314 ? 102.038 50.882  -54.081  1.00 51.67  ?  420 THR A C     1 
ATOM   2427  O  O     . THR A  1 314 ? 101.219 51.542  -54.735  1.00 50.69  ?  420 THR A O     1 
ATOM   2428  C  CB    . THR A  1 314 ? 102.163 51.302  -51.589  1.00 52.22  ?  420 THR A CB    1 
ATOM   2429  O  OG1   . THR A  1 314 ? 101.708 50.846  -50.304  1.00 54.79  ?  420 THR A OG1   1 
ATOM   2430  C  CG2   . THR A  1 314 ? 101.629 52.719  -51.807  1.00 52.74  ?  420 THR A CG2   1 
ATOM   2431  N  N     . LYS A  1 315 ? 103.260 50.604  -54.532  1.00 54.19  ?  421 LYS A N     1 
ATOM   2432  C  CA    . LYS A  1 315 ? 103.731 51.063  -55.840  1.00 54.10  ?  421 LYS A CA    1 
ATOM   2433  C  C     . LYS A  1 315 ? 103.418 50.111  -57.008  1.00 50.83  ?  421 LYS A C     1 
ATOM   2434  O  O     . LYS A  1 315 ? 103.771 50.411  -58.154  1.00 49.82  ?  421 LYS A O     1 
ATOM   2435  C  CB    . LYS A  1 315 ? 105.235 51.352  -55.767  1.00 57.86  ?  421 LYS A CB    1 
ATOM   2436  C  CG    . LYS A  1 315 ? 105.602 52.352  -54.682  1.00 61.78  ?  421 LYS A CG    1 
ATOM   2437  C  CD    . LYS A  1 315 ? 107.010 52.947  -54.924  1.00 65.74  ?  421 LYS A CD    1 
ATOM   2438  C  CE    . LYS A  1 315 ? 108.194 52.106  -54.405  1.00 68.39  ?  421 LYS A CE    1 
ATOM   2439  N  NZ    . LYS A  1 315 ? 109.309 52.982  -53.964  1.00 69.52  ?  421 LYS A NZ    1 
ATOM   2440  N  N     . LEU A  1 316 ? 102.745 48.988  -56.731  1.00 48.61  ?  422 LEU A N     1 
ATOM   2441  C  CA    . LEU A  1 316 ? 102.442 47.969  -57.741  1.00 47.10  ?  422 LEU A CA    1 
ATOM   2442  C  C     . LEU A  1 316 ? 101.020 48.115  -58.251  1.00 46.58  ?  422 LEU A C     1 
ATOM   2443  O  O     . LEU A  1 316 ? 100.068 47.716  -57.578  1.00 48.17  ?  422 LEU A O     1 
ATOM   2444  C  CB    . LEU A  1 316 ? 102.635 46.564  -57.164  1.00 46.92  ?  422 LEU A CB    1 
ATOM   2445  C  CG    . LEU A  1 316 ? 102.340 45.396  -58.119  1.00 46.52  ?  422 LEU A CG    1 
ATOM   2446  C  CD1   . LEU A  1 316 ? 103.196 45.455  -59.382  1.00 46.83  ?  422 LEU A CD1   1 
ATOM   2447  C  CD2   . LEU A  1 316 ? 102.527 44.058  -57.418  1.00 46.78  ?  422 LEU A CD2   1 
ATOM   2448  N  N     . THR A  1 317 ? 100.889 48.669  -59.451  1.00 45.79  ?  423 THR A N     1 
ATOM   2449  C  CA    . THR A  1 317 ? 99.595  48.983  -60.050  1.00 45.44  ?  423 THR A CA    1 
ATOM   2450  C  C     . THR A  1 317 ? 99.605  48.558  -61.522  1.00 44.75  ?  423 THR A C     1 
ATOM   2451  O  O     . THR A  1 317 ? 100.572 47.936  -61.980  1.00 45.00  ?  423 THR A O     1 
ATOM   2452  C  CB    . THR A  1 317 ? 99.314  50.496  -59.933  1.00 46.01  ?  423 THR A CB    1 
ATOM   2453  O  OG1   . THR A  1 317 ? 100.380 51.237  -60.549  1.00 47.03  ?  423 THR A OG1   1 
ATOM   2454  C  CG2   . THR A  1 317 ? 99.170  50.909  -58.465  1.00 46.34  ?  423 THR A CG2   1 
ATOM   2455  N  N     . ASP A  1 318 ? 98.530  48.883  -62.253  1.00 43.04  ?  424 ASP A N     1 
ATOM   2456  C  CA    . ASP A  1 318 ? 98.454  48.687  -63.715  1.00 41.45  ?  424 ASP A CA    1 
ATOM   2457  C  C     . ASP A  1 318 ? 99.629  49.300  -64.485  1.00 42.05  ?  424 ASP A C     1 
ATOM   2458  O  O     . ASP A  1 318 ? 99.934  48.857  -65.588  1.00 42.89  ?  424 ASP A O     1 
ATOM   2459  C  CB    . ASP A  1 318 ? 97.147  49.264  -64.293  1.00 40.10  ?  424 ASP A CB    1 
ATOM   2460  C  CG    . ASP A  1 318 ? 95.906  48.466  -63.903  1.00 38.78  ?  424 ASP A CG    1 
ATOM   2461  O  OD1   . ASP A  1 318 ? 95.999  47.547  -63.063  1.00 38.41  ?  424 ASP A OD1   1 
ATOM   2462  O  OD2   . ASP A  1 318 ? 94.820  48.781  -64.439  1.00 37.82  ?  424 ASP A OD2   1 
ATOM   2463  N  N     . ASN A  1 319 ? 100.259 50.337  -63.913  1.00 42.57  ?  425 ASN A N     1 
ATOM   2464  C  CA    . ASN A  1 319 ? 101.527 50.894  -64.414  1.00 42.91  ?  425 ASN A CA    1 
ATOM   2465  C  C     . ASN A  1 319 ? 102.512 49.869  -64.928  1.00 41.84  ?  425 ASN A C     1 
ATOM   2466  O  O     . ASN A  1 319 ? 103.284 50.112  -65.852  1.00 41.43  ?  425 ASN A O     1 
ATOM   2467  C  CB    . ASN A  1 319 ? 102.275 51.619  -63.288  1.00 44.43  ?  425 ASN A CB    1 
ATOM   2468  C  CG    . ASN A  1 319 ? 103.372 52.507  -63.818  1.00 45.75  ?  425 ASN A CG    1 
ATOM   2469  O  OD1   . ASN A  1 319 ? 104.565 52.363  -63.474  1.00 47.29  ?  425 ASN A OD1   1 
ATOM   2470  N  ND2   . ASN A  1 319 ? 102.969 53.411  -64.706  1.00 45.65  ?  425 ASN A ND2   1 
ATOM   2471  N  N     . ILE A  1 320 ? 102.585 48.753  -64.205  1.00 40.94  ?  426 ILE A N     1 
ATOM   2472  C  CA    . ILE A  1 320 ? 103.548 47.707  -64.503  1.00 40.44  ?  426 ILE A CA    1 
ATOM   2473  C  C     . ILE A  1 320 ? 103.409 47.168  -65.941  1.00 38.66  ?  426 ILE A C     1 
ATOM   2474  O  O     . ILE A  1 320 ? 104.393 46.743  -66.535  1.00 39.14  ?  426 ILE A O     1 
ATOM   2475  C  CB    . ILE A  1 320 ? 103.497 46.589  -63.422  1.00 41.30  ?  426 ILE A CB    1 
ATOM   2476  C  CG1   . ILE A  1 320 ? 104.887 46.027  -63.168  1.00 42.35  ?  426 ILE A CG1   1 
ATOM   2477  C  CG2   . ILE A  1 320 ? 102.521 45.487  -63.772  1.00 41.23  ?  426 ILE A CG2   1 
ATOM   2478  C  CD1   . ILE A  1 320 ? 105.753 46.948  -62.335  1.00 43.32  ?  426 ILE A CD1   1 
ATOM   2479  N  N     . PHE A  1 321 ? 102.190 47.208  -66.477  1.00 36.96  ?  427 PHE A N     1 
ATOM   2480  C  CA    . PHE A  1 321 ? 101.906 46.945  -67.900  1.00 36.24  ?  427 PHE A CA    1 
ATOM   2481  C  C     . PHE A  1 321 ? 102.708 47.867  -68.822  1.00 36.37  ?  427 PHE A C     1 
ATOM   2482  O  O     . PHE A  1 321 ? 103.484 47.399  -69.661  1.00 35.31  ?  427 PHE A O     1 
ATOM   2483  C  CB    . PHE A  1 321 ? 100.402 47.132  -68.166  1.00 35.73  ?  427 PHE A CB    1 
ATOM   2484  C  CG    . PHE A  1 321 ? 99.968  46.862  -69.585  1.00 35.20  ?  427 PHE A CG    1 
ATOM   2485  C  CD1   . PHE A  1 321 ? 99.926  47.897  -70.520  1.00 34.85  ?  427 PHE A CD1   1 
ATOM   2486  C  CD2   . PHE A  1 321 ? 99.541  45.598  -69.971  1.00 34.69  ?  427 PHE A CD2   1 
ATOM   2487  C  CE1   . PHE A  1 321 ? 99.518  47.650  -71.829  1.00 34.41  ?  427 PHE A CE1   1 
ATOM   2488  C  CE2   . PHE A  1 321 ? 99.127  45.374  -71.292  1.00 34.14  ?  427 PHE A CE2   1 
ATOM   2489  C  CZ    . PHE A  1 321 ? 99.106  46.391  -72.204  1.00 34.08  ?  427 PHE A CZ    1 
ATOM   2490  N  N     . LEU A  1 322 ? 102.509 49.175  -68.653  1.00 37.52  ?  428 LEU A N     1 
ATOM   2491  C  CA    . LEU A  1 322 ? 103.177 50.169  -69.492  1.00 38.72  ?  428 LEU A CA    1 
ATOM   2492  C  C     . LEU A  1 322 ? 104.674 50.252  -69.247  1.00 40.48  ?  428 LEU A C     1 
ATOM   2493  O  O     . LEU A  1 322 ? 105.436 50.587  -70.161  1.00 40.89  ?  428 LEU A O     1 
ATOM   2494  C  CB    . LEU A  1 322 ? 102.562 51.550  -69.276  1.00 38.45  ?  428 LEU A CB    1 
ATOM   2495  C  CG    . LEU A  1 322 ? 101.127 51.709  -69.779  1.00 37.74  ?  428 LEU A CG    1 
ATOM   2496  C  CD1   . LEU A  1 322 ? 100.624 53.099  -69.452  1.00 37.98  ?  428 LEU A CD1   1 
ATOM   2497  C  CD2   . LEU A  1 322 ? 101.001 51.499  -71.282  1.00 37.44  ?  428 LEU A CD2   1 
ATOM   2498  N  N     . GLU A  1 323 ? 105.082 49.964  -68.012  1.00 42.36  ?  429 GLU A N     1 
ATOM   2499  C  CA    . GLU A  1 323 ? 106.496 49.891  -67.679  1.00 43.38  ?  429 GLU A CA    1 
ATOM   2500  C  C     . GLU A  1 323 ? 107.138 48.830  -68.570  1.00 42.44  ?  429 GLU A C     1 
ATOM   2501  O  O     . GLU A  1 323 ? 108.133 49.112  -69.231  1.00 43.40  ?  429 GLU A O     1 
ATOM   2502  C  CB    . GLU A  1 323 ? 106.702 49.594  -66.179  1.00 45.27  ?  429 GLU A CB    1 
ATOM   2503  C  CG    . GLU A  1 323 ? 108.046 50.075  -65.620  1.00 46.70  ?  429 GLU A CG    1 
ATOM   2504  C  CD    . GLU A  1 323 ? 108.279 49.694  -64.170  1.00 47.75  ?  429 GLU A CD    1 
ATOM   2505  O  OE1   . GLU A  1 323 ? 107.434 50.109  -63.339  1.00 47.76  ?  429 GLU A OE1   1 
ATOM   2506  O  OE2   . GLU A  1 323 ? 109.303 49.004  -63.861  1.00 48.99  ?  429 GLU A OE2   1 
ATOM   2507  N  N     . ILE A  1 324 ? 106.530 47.642  -68.628  1.00 41.12  ?  430 ILE A N     1 
ATOM   2508  C  CA    . ILE A  1 324 ? 107.008 46.542  -69.490  1.00 40.94  ?  430 ILE A CA    1 
ATOM   2509  C  C     . ILE A  1 324 ? 106.961 46.924  -70.967  1.00 41.16  ?  430 ILE A C     1 
ATOM   2510  O  O     . ILE A  1 324 ? 107.911 46.670  -71.708  1.00 40.16  ?  430 ILE A O     1 
ATOM   2511  C  CB    . ILE A  1 324 ? 106.217 45.230  -69.266  1.00 40.21  ?  430 ILE A CB    1 
ATOM   2512  C  CG1   . ILE A  1 324 ? 106.497 44.664  -67.869  1.00 40.82  ?  430 ILE A CG1   1 
ATOM   2513  C  CG2   . ILE A  1 324 ? 106.599 44.163  -70.284  1.00 40.11  ?  430 ILE A CG2   1 
ATOM   2514  C  CD1   . ILE A  1 324 ? 105.457 43.656  -67.396  1.00 41.20  ?  430 ILE A CD1   1 
ATOM   2515  N  N     . LEU A  1 325 ? 105.853 47.526  -71.389  1.00 42.05  ?  431 LEU A N     1 
ATOM   2516  C  CA    . LEU A  1 325 ? 105.656 47.883  -72.799  1.00 43.15  ?  431 LEU A CA    1 
ATOM   2517  C  C     . LEU A  1 325 ? 106.711 48.869  -73.284  1.00 44.89  ?  431 LEU A C     1 
ATOM   2518  O  O     . LEU A  1 325 ? 107.334 48.669  -74.321  1.00 44.94  ?  431 LEU A O     1 
ATOM   2519  C  CB    . LEU A  1 325 ? 104.265 48.468  -73.016  1.00 42.78  ?  431 LEU A CB    1 
ATOM   2520  C  CG    . LEU A  1 325 ? 103.850 48.712  -74.476  1.00 42.46  ?  431 LEU A CG    1 
ATOM   2521  C  CD1   . LEU A  1 325 ? 103.630 47.433  -75.224  1.00 42.24  ?  431 LEU A CD1   1 
ATOM   2522  C  CD2   . LEU A  1 325 ? 102.606 49.537  -74.606  1.00 42.10  ?  431 LEU A CD2   1 
ATOM   2523  N  N     . TYR A  1 326 ? 106.895 49.935  -72.517  1.00 47.31  ?  432 TYR A N     1 
ATOM   2524  C  CA    . TYR A  1 326 ? 107.823 51.002  -72.888  1.00 50.04  ?  432 TYR A CA    1 
ATOM   2525  C  C     . TYR A  1 326 ? 109.311 50.686  -72.682  1.00 51.89  ?  432 TYR A C     1 
ATOM   2526  O  O     . TYR A  1 326 ? 110.154 51.416  -73.206  1.00 52.24  ?  432 TYR A O     1 
ATOM   2527  C  CB    . TYR A  1 326 ? 107.456 52.302  -72.151  1.00 51.57  ?  432 TYR A CB    1 
ATOM   2528  C  CG    . TYR A  1 326 ? 106.069 52.874  -72.450  1.00 52.83  ?  432 TYR A CG    1 
ATOM   2529  C  CD1   . TYR A  1 326 ? 105.433 52.642  -73.671  1.00 53.46  ?  432 TYR A CD1   1 
ATOM   2530  C  CD2   . TYR A  1 326 ? 105.411 53.692  -71.525  1.00 54.47  ?  432 TYR A CD2   1 
ATOM   2531  C  CE1   . TYR A  1 326 ? 104.188 53.181  -73.957  1.00 54.48  ?  432 TYR A CE1   1 
ATOM   2532  C  CE2   . TYR A  1 326 ? 104.162 54.227  -71.792  1.00 55.62  ?  432 TYR A CE2   1 
ATOM   2533  C  CZ    . TYR A  1 326 ? 103.563 53.979  -73.032  1.00 55.63  ?  432 TYR A CZ    1 
ATOM   2534  O  OH    . TYR A  1 326 ? 102.319 54.486  -73.334  1.00 57.13  ?  432 TYR A OH    1 
ATOM   2535  N  N     . SER A  1 327 ? 109.642 49.616  -71.950  1.00 54.45  ?  433 SER A N     1 
ATOM   2536  C  CA    . SER A  1 327 ? 111.043 49.330  -71.602  1.00 56.87  ?  433 SER A CA    1 
ATOM   2537  C  C     . SER A  1 327 ? 111.910 48.990  -72.812  1.00 58.12  ?  433 SER A C     1 
ATOM   2538  O  O     . SER A  1 327 ? 111.413 48.592  -73.866  1.00 57.10  ?  433 SER A O     1 
ATOM   2539  C  CB    . SER A  1 327 ? 111.154 48.200  -70.565  1.00 57.35  ?  433 SER A CB    1 
ATOM   2540  O  OG    . SER A  1 327 ? 110.843 46.934  -71.130  1.00 57.19  ?  433 SER A OG    1 
ATOM   2541  N  N     . THR A  1 328 ? 113.213 49.183  -72.627  1.00 58.96  ?  434 THR A N     1 
ATOM   2542  C  CA    . THR A  1 328 ? 114.239 48.780  -73.586  1.00 58.68  ?  434 THR A CA    1 
ATOM   2543  C  C     . THR A  1 328 ? 115.230 47.752  -73.024  1.00 58.58  ?  434 THR A C     1 
ATOM   2544  O  O     . THR A  1 328 ? 116.127 47.322  -73.742  1.00 57.84  ?  434 THR A O     1 
ATOM   2545  C  CB    . THR A  1 328 ? 115.024 50.016  -74.061  1.00 59.64  ?  434 THR A CB    1 
ATOM   2546  O  OG1   . THR A  1 328 ? 115.523 50.729  -72.917  1.00 61.16  ?  434 THR A OG1   1 
ATOM   2547  C  CG2   . THR A  1 328 ? 114.133 50.930  -74.903  1.00 59.58  ?  434 THR A CG2   1 
ATOM   2548  N  N     . ASP A  1 329 ? 115.075 47.353  -71.758  1.00 60.09  ?  435 ASP A N     1 
ATOM   2549  C  CA    . ASP A  1 329 ? 115.890 46.282  -71.176  1.00 62.05  ?  435 ASP A CA    1 
ATOM   2550  C  C     . ASP A  1 329 ? 115.684 45.008  -72.018  1.00 62.25  ?  435 ASP A C     1 
ATOM   2551  O  O     . ASP A  1 329 ? 114.552 44.550  -72.170  1.00 59.39  ?  435 ASP A O     1 
ATOM   2552  C  CB    . ASP A  1 329 ? 115.509 46.040  -69.712  1.00 61.80  ?  435 ASP A CB    1 
ATOM   2553  C  CG    . ASP A  1 329 ? 116.489 45.129  -68.971  1.00 61.65  ?  435 ASP A CG    1 
ATOM   2554  O  OD1   . ASP A  1 329 ? 117.100 44.223  -69.588  1.00 64.65  ?  435 ASP A OD1   1 
ATOM   2555  O  OD2   . ASP A  1 329 ? 116.520 45.244  -67.742  1.00 58.63  ?  435 ASP A OD2   1 
ATOM   2556  N  N     . PRO A  1 330 ? 116.765 44.454  -72.585  1.00 65.02  ?  436 PRO A N     1 
ATOM   2557  C  CA    . PRO A  1 330 ? 116.609 43.211  -73.351  1.00 65.94  ?  436 PRO A CA    1 
ATOM   2558  C  C     . PRO A  1 330 ? 116.206 41.975  -72.538  1.00 65.31  ?  436 PRO A C     1 
ATOM   2559  O  O     . PRO A  1 330 ? 115.707 41.010  -73.117  1.00 63.99  ?  436 PRO A O     1 
ATOM   2560  C  CB    . PRO A  1 330 ? 117.983 43.013  -73.995  1.00 67.99  ?  436 PRO A CB    1 
ATOM   2561  C  CG    . PRO A  1 330 ? 118.575 44.375  -74.041  1.00 68.63  ?  436 PRO A CG    1 
ATOM   2562  C  CD    . PRO A  1 330 ? 118.124 45.009  -72.739  1.00 67.40  ?  436 PRO A CD    1 
ATOM   2563  N  N     . LYS A  1 331 ? 116.418 41.994  -71.219  1.00 67.67  ?  437 LYS A N     1 
ATOM   2564  C  CA    . LYS A  1 331 ? 115.921 40.925  -70.335  1.00 71.10  ?  437 LYS A CA    1 
ATOM   2565  C  C     . LYS A  1 331 ? 114.401 40.832  -70.376  1.00 70.87  ?  437 LYS A C     1 
ATOM   2566  O  O     . LYS A  1 331 ? 113.847 39.745  -70.203  1.00 72.14  ?  437 LYS A O     1 
ATOM   2567  C  CB    . LYS A  1 331 ? 116.407 41.127  -68.902  1.00 74.44  ?  437 LYS A CB    1 
ATOM   2568  C  CG    . LYS A  1 331 ? 117.893 40.908  -68.734  1.00 78.48  ?  437 LYS A CG    1 
ATOM   2569  C  CD    . LYS A  1 331 ? 118.408 41.284  -67.364  1.00 81.89  ?  437 LYS A CD    1 
ATOM   2570  C  CE    . LYS A  1 331 ? 119.547 40.322  -66.961  1.00 84.72  ?  437 LYS A CE    1 
ATOM   2571  N  NZ    . LYS A  1 331 ? 120.036 40.563  -65.593  1.00 86.40  ?  437 LYS A NZ    1 
ATOM   2572  N  N     . LEU A  1 332 ? 113.740 41.963  -70.620  1.00 69.64  ?  438 LEU A N     1 
ATOM   2573  C  CA    . LEU A  1 332 ? 112.277 42.046  -70.736  1.00 68.07  ?  438 LEU A CA    1 
ATOM   2574  C  C     . LEU A  1 332 ? 111.722 41.859  -72.158  1.00 67.53  ?  438 LEU A C     1 
ATOM   2575  O  O     . LEU A  1 332 ? 110.523 42.044  -72.365  1.00 64.78  ?  438 LEU A O     1 
ATOM   2576  C  CB    . LEU A  1 332 ? 111.798 43.401  -70.196  1.00 67.78  ?  438 LEU A CB    1 
ATOM   2577  C  CG    . LEU A  1 332 ? 112.066 43.696  -68.719  1.00 68.73  ?  438 LEU A CG    1 
ATOM   2578  C  CD1   . LEU A  1 332 ? 111.810 45.161  -68.419  1.00 69.36  ?  438 LEU A CD1   1 
ATOM   2579  C  CD2   . LEU A  1 332 ? 111.193 42.837  -67.821  1.00 69.04  ?  438 LEU A CD2   1 
ATOM   2580  N  N     . LYS A  1 333 ? 112.559 41.485  -73.139  1.00 70.00  ?  439 LYS A N     1 
ATOM   2581  C  CA    . LYS A  1 333 ? 112.104 41.418  -74.528  1.00 70.99  ?  439 LYS A CA    1 
ATOM   2582  C  C     . LYS A  1 333 ? 110.982 40.412  -74.738  1.00 67.82  ?  439 LYS A C     1 
ATOM   2583  O  O     . LYS A  1 333 ? 110.038 40.692  -75.460  1.00 68.49  ?  439 LYS A O     1 
ATOM   2584  C  CB    . LYS A  1 333 ? 113.256 41.122  -75.480  1.00 75.03  ?  439 LYS A CB    1 
ATOM   2585  C  CG    . LYS A  1 333 ? 112.871 41.109  -76.965  1.00 76.79  ?  439 LYS A CG    1 
ATOM   2586  C  CD    . LYS A  1 333 ? 113.870 40.235  -77.778  1.00 78.43  ?  439 LYS A CD    1 
ATOM   2587  C  CE    . LYS A  1 333 ? 113.298 39.076  -78.645  1.00 79.03  ?  439 LYS A CE    1 
ATOM   2588  N  NZ    . LYS A  1 333 ? 113.592 39.275  -80.074  1.00 80.83  ?  439 LYS A NZ    1 
ATOM   2589  N  N     . ASP A  1 334 ? 111.093 39.222  -74.098  1.00 64.34  ?  440 ASP A N     1 
ATOM   2590  C  CA    . ASP A  1 334 ? 110.003 38.239  -74.167  1.00 60.72  ?  440 ASP A CA    1 
ATOM   2591  C  C     . ASP A  1 334 ? 108.669 38.769  -73.664  1.00 58.66  ?  440 ASP A C     1 
ATOM   2592  O  O     . ASP A  1 334 ? 107.644 38.576  -74.312  1.00 57.46  ?  440 ASP A O     1 
ATOM   2593  C  CB    . ASP A  1 334 ? 110.398 36.968  -73.421  1.00 59.66  ?  440 ASP A CB    1 
ATOM   2594  C  CG    . ASP A  1 334 ? 111.232 36.014  -74.313  1.00 57.69  ?  440 ASP A CG    1 
ATOM   2595  O  OD1   . ASP A  1 334 ? 111.858 36.479  -75.284  1.00 55.42  ?  440 ASP A OD1   1 
ATOM   2596  O  OD2   . ASP A  1 334 ? 111.231 34.792  -74.060  1.00 56.65  ?  440 ASP A OD2   1 
ATOM   2597  N  N     . ALA A  1 335 ? 108.691 39.427  -72.517  1.00 56.31  ?  441 ALA A N     1 
ATOM   2598  C  CA    . ALA A  1 335 ? 107.470 40.002  -71.919  1.00 54.76  ?  441 ALA A CA    1 
ATOM   2599  C  C     . ALA A  1 335 ? 106.915 41.136  -72.773  1.00 53.59  ?  441 ALA A C     1 
ATOM   2600  O  O     . ALA A  1 335 ? 105.729 41.158  -73.070  1.00 51.76  ?  441 ALA A O     1 
ATOM   2601  C  CB    . ALA A  1 335 ? 107.758 40.486  -70.503  1.00 55.77  ?  441 ALA A CB    1 
ATOM   2602  N  N     . ARG A  1 336 ? 107.781 42.062  -73.169  1.00 54.51  ?  442 ARG A N     1 
ATOM   2603  C  CA    . ARG A  1 336 ? 107.399 43.199  -74.022  1.00 55.30  ?  442 ARG A CA    1 
ATOM   2604  C  C     . ARG A  1 336 ? 106.786 42.775  -75.357  1.00 51.98  ?  442 ARG A C     1 
ATOM   2605  O  O     . ARG A  1 336 ? 105.913 43.463  -75.881  1.00 49.80  ?  442 ARG A O     1 
ATOM   2606  C  CB    . ARG A  1 336 ? 108.615 44.109  -74.272  1.00 59.21  ?  442 ARG A CB    1 
ATOM   2607  C  CG    . ARG A  1 336 ? 108.402 45.265  -75.258  1.00 60.87  ?  442 ARG A CG    1 
ATOM   2608  C  CD    . ARG A  1 336 ? 109.501 46.322  -75.200  1.00 62.33  ?  442 ARG A CD    1 
ATOM   2609  N  NE    . ARG A  1 336 ? 110.847 45.813  -75.536  1.00 63.84  ?  442 ARG A NE    1 
ATOM   2610  C  CZ    . ARG A  1 336 ? 111.765 45.364  -74.662  1.00 66.19  ?  442 ARG A CZ    1 
ATOM   2611  N  NH1   . ARG A  1 336 ? 112.944 44.934  -75.092  1.00 67.69  ?  442 ARG A NH1   1 
ATOM   2612  N  NH2   . ARG A  1 336 ? 111.520 45.318  -73.350  1.00 67.82  ?  442 ARG A NH2   1 
ATOM   2613  N  N     . GLU A  1 337 ? 107.242 41.656  -75.913  1.00 49.59  ?  443 GLU A N     1 
ATOM   2614  C  CA    . GLU A  1 337 ? 106.700 41.174  -77.182  1.00 47.59  ?  443 GLU A CA    1 
ATOM   2615  C  C     . GLU A  1 337 ? 105.272 40.677  -77.039  1.00 45.77  ?  443 GLU A C     1 
ATOM   2616  O  O     . GLU A  1 337 ? 104.472 40.892  -77.939  1.00 45.59  ?  443 GLU A O     1 
ATOM   2617  C  CB    . GLU A  1 337 ? 107.595 40.094  -77.819  1.00 47.76  ?  443 GLU A CB    1 
ATOM   2618  C  CG    . GLU A  1 337 ? 108.885 40.623  -78.464  1.00 47.27  ?  443 GLU A CG    1 
ATOM   2619  C  CD    . GLU A  1 337 ? 108.669 41.703  -79.511  1.00 46.19  ?  443 GLU A CD    1 
ATOM   2620  O  OE1   . GLU A  1 337 ? 107.639 41.664  -80.203  1.00 45.94  ?  443 GLU A OE1   1 
ATOM   2621  O  OE2   . GLU A  1 337 ? 109.535 42.596  -79.635  1.00 45.67  ?  443 GLU A OE2   1 
ATOM   2622  N  N     . ILE A  1 338 ? 104.944 40.030  -75.924  1.00 44.89  ?  444 ILE A N     1 
ATOM   2623  C  CA    . ILE A  1 338 ? 103.556 39.611  -75.675  1.00 44.65  ?  444 ILE A CA    1 
ATOM   2624  C  C     . ILE A  1 338 ? 102.642 40.833  -75.614  1.00 42.77  ?  444 ILE A C     1 
ATOM   2625  O  O     . ILE A  1 338 ? 101.582 40.847  -76.238  1.00 40.86  ?  444 ILE A O     1 
ATOM   2626  C  CB    . ILE A  1 338 ? 103.406 38.754  -74.388  1.00 46.22  ?  444 ILE A CB    1 
ATOM   2627  C  CG1   . ILE A  1 338 ? 104.120 37.402  -74.563  1.00 47.54  ?  444 ILE A CG1   1 
ATOM   2628  C  CG2   . ILE A  1 338 ? 101.939 38.518  -74.062  1.00 45.92  ?  444 ILE A CG2   1 
ATOM   2629  C  CD1   . ILE A  1 338 ? 104.190 36.535  -73.316  1.00 47.69  ?  444 ILE A CD1   1 
ATOM   2630  N  N     . LEU A  1 339 ? 103.060 41.856  -74.877  1.00 42.61  ?  445 LEU A N     1 
ATOM   2631  C  CA    . LEU A  1 339 ? 102.255 43.071  -74.725  1.00 42.68  ?  445 LEU A CA    1 
ATOM   2632  C  C     . LEU A  1 339 ? 102.118 43.844  -76.028  1.00 43.89  ?  445 LEU A C     1 
ATOM   2633  O  O     . LEU A  1 339 ? 101.061 44.409  -76.298  1.00 44.57  ?  445 LEU A O     1 
ATOM   2634  C  CB    . LEU A  1 339 ? 102.823 43.980  -73.636  1.00 42.13  ?  445 LEU A CB    1 
ATOM   2635  C  CG    . LEU A  1 339 ? 102.941 43.388  -72.220  1.00 42.06  ?  445 LEU A CG    1 
ATOM   2636  C  CD1   . LEU A  1 339 ? 103.229 44.502  -71.237  1.00 42.36  ?  445 LEU A CD1   1 
ATOM   2637  C  CD2   . LEU A  1 339 ? 101.723 42.614  -71.772  1.00 41.72  ?  445 LEU A CD2   1 
ATOM   2638  N  N     . LYS A  1 340 ? 103.173 43.867  -76.844  1.00 46.04  ?  446 LYS A N     1 
ATOM   2639  C  CA    . LYS A  1 340 ? 103.080 44.479  -78.175  1.00 46.45  ?  446 LYS A CA    1 
ATOM   2640  C  C     . LYS A  1 340 ? 102.084 43.729  -79.062  1.00 44.58  ?  446 LYS A C     1 
ATOM   2641  O  O     . LYS A  1 340 ? 101.361 44.355  -79.830  1.00 43.64  ?  446 LYS A O     1 
ATOM   2642  C  CB    . LYS A  1 340 ? 104.447 44.591  -78.850  1.00 48.38  ?  446 LYS A CB    1 
ATOM   2643  C  CG    . LYS A  1 340 ? 105.040 45.993  -78.829  1.00 50.55  ?  446 LYS A CG    1 
ATOM   2644  C  CD    . LYS A  1 340 ? 106.569 45.942  -79.045  1.00 53.61  ?  446 LYS A CD    1 
ATOM   2645  C  CE    . LYS A  1 340 ? 107.243 46.765  -80.204  1.00 55.35  ?  446 LYS A CE    1 
ATOM   2646  N  NZ    . LYS A  1 340 ? 106.503 47.958  -80.714  1.00 56.25  ?  446 LYS A NZ    1 
ATOM   2647  N  N     . GLN A  1 341 ? 102.031 42.397  -78.933  1.00 42.99  ?  447 GLN A N     1 
ATOM   2648  C  CA    . GLN A  1 341 ? 101.040 41.584  -79.650  1.00 41.79  ?  447 GLN A CA    1 
ATOM   2649  C  C     . GLN A  1 341 ? 99.588  41.904  -79.265  1.00 40.19  ?  447 GLN A C     1 
ATOM   2650  O  O     . GLN A  1 341 ? 98.689  41.661  -80.058  1.00 39.58  ?  447 GLN A O     1 
ATOM   2651  C  CB    . GLN A  1 341 ? 101.324 40.074  -79.502  1.00 42.75  ?  447 GLN A CB    1 
ATOM   2652  C  CG    . GLN A  1 341 ? 102.563 39.545  -80.215  1.00 45.14  ?  447 GLN A CG    1 
ATOM   2653  C  CD    . GLN A  1 341 ? 102.726 40.070  -81.650  1.00 47.40  ?  447 GLN A CD    1 
ATOM   2654  O  OE1   . GLN A  1 341 ? 102.128 39.532  -82.583  1.00 49.15  ?  447 GLN A OE1   1 
ATOM   2655  N  NE2   . GLN A  1 341 ? 103.534 41.120  -81.821  1.00 47.71  ?  447 GLN A NE2   1 
ATOM   2656  N  N     . ILE A  1 342 ? 99.360  42.438  -78.068  1.00 39.46  ?  448 ILE A N     1 
ATOM   2657  C  CA    . ILE A  1 342 ? 98.025  42.906  -77.640  1.00 38.81  ?  448 ILE A CA    1 
ATOM   2658  C  C     . ILE A  1 342 ? 97.617  44.240  -78.298  1.00 40.04  ?  448 ILE A C     1 
ATOM   2659  O  O     . ILE A  1 342 ? 96.435  44.459  -78.617  1.00 39.11  ?  448 ILE A O     1 
ATOM   2660  C  CB    . ILE A  1 342 ? 97.945  43.030  -76.103  1.00 37.50  ?  448 ILE A CB    1 
ATOM   2661  C  CG1   . ILE A  1 342 ? 97.987  41.635  -75.470  1.00 36.58  ?  448 ILE A CG1   1 
ATOM   2662  C  CG2   . ILE A  1 342 ? 96.693  43.780  -75.668  1.00 37.51  ?  448 ILE A CG2   1 
ATOM   2663  C  CD1   . ILE A  1 342 ? 98.191  41.610  -73.960  1.00 36.45  ?  448 ILE A CD1   1 
ATOM   2664  N  N     . GLU A  1 343 ? 98.582  45.136  -78.462  1.00 42.26  ?  449 GLU A N     1 
ATOM   2665  C  CA    . GLU A  1 343 ? 98.338  46.394  -79.154  1.00 43.08  ?  449 GLU A CA    1 
ATOM   2666  C  C     . GLU A  1 343 ? 97.912  46.100  -80.587  1.00 42.31  ?  449 GLU A C     1 
ATOM   2667  O  O     . GLU A  1 343 ? 96.823  46.508  -81.008  1.00 41.59  ?  449 GLU A O     1 
ATOM   2668  C  CB    . GLU A  1 343 ? 99.582  47.286  -79.161  1.00 44.86  ?  449 GLU A CB    1 
ATOM   2669  C  CG    . GLU A  1 343 ? 99.899  47.945  -77.847  1.00 46.80  ?  449 GLU A CG    1 
ATOM   2670  C  CD    . GLU A  1 343 ? 100.949 49.046  -78.015  1.00 48.13  ?  449 GLU A CD    1 
ATOM   2671  O  OE1   . GLU A  1 343 ? 101.979 48.782  -78.674  1.00 48.86  ?  449 GLU A OE1   1 
ATOM   2672  O  OE2   . GLU A  1 343 ? 100.793 50.182  -77.464  1.00 50.20  ?  449 GLU A OE2   1 
ATOM   2673  N  N     . TYR A  1 344 ? 98.766  45.354  -81.294  1.00 42.68  ?  450 TYR A N     1 
ATOM   2674  C  CA    . TYR A  1 344 ? 98.530  44.929  -82.678  1.00 42.85  ?  450 TYR A CA    1 
ATOM   2675  C  C     . TYR A  1 344 ? 97.344  43.978  -82.869  1.00 41.53  ?  450 TYR A C     1 
ATOM   2676  O  O     . TYR A  1 344 ? 96.872  43.802  -83.988  1.00 41.18  ?  450 TYR A O     1 
ATOM   2677  C  CB    . TYR A  1 344 ? 99.789  44.249  -83.270  1.00 43.92  ?  450 TYR A CB    1 
ATOM   2678  C  CG    . TYR A  1 344 ? 100.932 45.195  -83.562  1.00 44.90  ?  450 TYR A CG    1 
ATOM   2679  C  CD1   . TYR A  1 344 ? 100.829 46.094  -84.608  1.00 45.43  ?  450 TYR A CD1   1 
ATOM   2680  C  CD2   . TYR A  1 344 ? 102.116 45.182  -82.814  1.00 45.90  ?  450 TYR A CD2   1 
ATOM   2681  C  CE1   . TYR A  1 344 ? 101.881 46.956  -84.936  1.00 46.01  ?  450 TYR A CE1   1 
ATOM   2682  C  CE2   . TYR A  1 344 ? 103.148 46.048  -83.086  1.00 46.96  ?  450 TYR A CE2   1 
ATOM   2683  C  CZ    . TYR A  1 344 ? 103.031 46.930  -84.170  1.00 47.00  ?  450 TYR A CZ    1 
ATOM   2684  O  OH    . TYR A  1 344 ? 104.047 47.796  -84.482  1.00 47.37  ?  450 TYR A OH    1 
ATOM   2685  N  N     . ARG A  1 345 ? 96.916  43.334  -81.783  1.00 40.67  ?  451 ARG A N     1 
ATOM   2686  C  CA    . ARG A  1 345 ? 95.730  42.482  -81.763  1.00 40.44  ?  451 ARG A CA    1 
ATOM   2687  C  C     . ARG A  1 345 ? 95.986  41.092  -82.377  1.00 40.81  ?  451 ARG A C     1 
ATOM   2688  O  O     . ARG A  1 345 ? 95.067  40.489  -82.934  1.00 41.27  ?  451 ARG A O     1 
ATOM   2689  C  CB    . ARG A  1 345 ? 94.526  43.179  -82.425  1.00 39.88  ?  451 ARG A CB    1 
ATOM   2690  C  CG    . ARG A  1 345 ? 93.177  42.839  -81.805  1.00 39.50  ?  451 ARG A CG    1 
ATOM   2691  C  CD    . ARG A  1 345 ? 92.947  43.628  -80.526  1.00 39.64  ?  451 ARG A CD    1 
ATOM   2692  N  NE    . ARG A  1 345 ? 91.636  43.360  -79.938  1.00 39.43  ?  451 ARG A NE    1 
ATOM   2693  C  CZ    . ARG A  1 345 ? 91.194  43.884  -78.794  1.00 38.30  ?  451 ARG A CZ    1 
ATOM   2694  N  NH1   . ARG A  1 345 ? 91.968  44.718  -78.085  1.00 38.45  ?  451 ARG A NH1   1 
ATOM   2695  N  NH2   . ARG A  1 345 ? 89.976  43.573  -78.360  1.00 36.98  ?  451 ARG A NH2   1 
ATOM   2696  N  N     . ASN A  1 346 ? 97.223  40.587  -82.253  1.00 41.15  ?  452 ASN A N     1 
ATOM   2697  C  CA    . ASN A  1 346 ? 97.551  39.190  -82.576  1.00 41.52  ?  452 ASN A CA    1 
ATOM   2698  C  C     . ASN A  1 346 ? 97.410  38.367  -81.325  1.00 41.14  ?  452 ASN A C     1 
ATOM   2699  O  O     . ASN A  1 346 ? 98.393  37.927  -80.713  1.00 41.58  ?  452 ASN A O     1 
ATOM   2700  C  CB    . ASN A  1 346 ? 98.966  39.062  -83.112  1.00 42.80  ?  452 ASN A CB    1 
ATOM   2701  C  CG    . ASN A  1 346 ? 99.120  39.686  -84.467  1.00 44.58  ?  452 ASN A CG    1 
ATOM   2702  O  OD1   . ASN A  1 346 ? 98.319  39.436  -85.372  1.00 47.01  ?  452 ASN A OD1   1 
ATOM   2703  N  ND2   . ASN A  1 346 ? 100.146 40.508  -84.627  1.00 45.70  ?  452 ASN A ND2   1 
ATOM   2704  N  N     . LEU A  1 347 ? 96.155  38.166  -80.952  1.00 40.60  ?  453 LEU A N     1 
ATOM   2705  C  CA    . LEU A  1 347 ? 95.824  37.463  -79.744  1.00 40.71  ?  453 LEU A CA    1 
ATOM   2706  C  C     . LEU A  1 347 ? 95.788  36.002  -80.068  1.00 40.72  ?  453 LEU A C     1 
ATOM   2707  O  O     . LEU A  1 347 ? 95.639  35.614  -81.244  1.00 41.00  ?  453 LEU A O     1 
ATOM   2708  C  CB    . LEU A  1 347 ? 94.476  37.921  -79.201  1.00 41.06  ?  453 LEU A CB    1 
ATOM   2709  C  CG    . LEU A  1 347 ? 94.238  39.434  -79.114  1.00 41.85  ?  453 LEU A CG    1 
ATOM   2710  C  CD1   . LEU A  1 347 ? 92.911  39.747  -78.438  1.00 41.87  ?  453 LEU A CD1   1 
ATOM   2711  C  CD2   . LEU A  1 347 ? 95.383  40.137  -78.393  1.00 42.67  ?  453 LEU A CD2   1 
ATOM   2712  N  N     . PHE A  1 348 ? 95.917  35.196  -79.024  1.00 40.82  ?  454 PHE A N     1 
ATOM   2713  C  CA    . PHE A  1 348 ? 95.793  33.762  -79.152  1.00 41.39  ?  454 PHE A CA    1 
ATOM   2714  C  C     . PHE A  1 348 ? 94.346  33.489  -79.556  1.00 42.95  ?  454 PHE A C     1 
ATOM   2715  O  O     . PHE A  1 348 ? 93.428  34.092  -78.996  1.00 43.94  ?  454 PHE A O     1 
ATOM   2716  C  CB    . PHE A  1 348 ? 96.121  33.058  -77.827  1.00 40.60  ?  454 PHE A CB    1 
ATOM   2717  C  CG    . PHE A  1 348 ? 97.485  33.389  -77.233  1.00 39.69  ?  454 PHE A CG    1 
ATOM   2718  C  CD1   . PHE A  1 348 ? 98.596  33.650  -78.033  1.00 39.24  ?  454 PHE A CD1   1 
ATOM   2719  C  CD2   . PHE A  1 348 ? 97.658  33.395  -75.855  1.00 38.99  ?  454 PHE A CD2   1 
ATOM   2720  C  CE1   . PHE A  1 348 ? 99.845  33.919  -77.470  1.00 39.27  ?  454 PHE A CE1   1 
ATOM   2721  C  CE2   . PHE A  1 348 ? 98.902  33.670  -75.280  1.00 38.98  ?  454 PHE A CE2   1 
ATOM   2722  C  CZ    . PHE A  1 348 ? 99.993  33.921  -76.086  1.00 38.89  ?  454 PHE A CZ    1 
ATOM   2723  N  N     . LYS A  1 349 ? 94.137  32.608  -80.536  1.00 44.53  ?  455 LYS A N     1 
ATOM   2724  C  CA    . LYS A  1 349 ? 92.814  32.460  -81.145  1.00 46.08  ?  455 LYS A CA    1 
ATOM   2725  C  C     . LYS A  1 349 ? 91.893  31.501  -80.392  1.00 46.36  ?  455 LYS A C     1 
ATOM   2726  O  O     . LYS A  1 349 ? 92.308  30.415  -79.987  1.00 47.14  ?  455 LYS A O     1 
ATOM   2727  C  CB    . LYS A  1 349 ? 92.941  32.042  -82.602  1.00 47.55  ?  455 LYS A CB    1 
ATOM   2728  C  CG    . LYS A  1 349 ? 93.558  33.087  -83.501  1.00 49.64  ?  455 LYS A CG    1 
ATOM   2729  C  CD    . LYS A  1 349 ? 92.578  34.200  -83.849  1.00 51.21  ?  455 LYS A CD    1 
ATOM   2730  C  CE    . LYS A  1 349 ? 93.299  35.413  -84.428  1.00 53.35  ?  455 LYS A CE    1 
ATOM   2731  N  NZ    . LYS A  1 349 ? 92.347  36.289  -85.139  1.00 54.66  ?  455 LYS A NZ    1 
ATOM   2732  N  N     . TYR A  1 350 ? 90.643  31.932  -80.226  1.00 45.45  ?  456 TYR A N     1 
ATOM   2733  C  CA    . TYR A  1 350 ? 89.602  31.145  -79.578  1.00 44.71  ?  456 TYR A CA    1 
ATOM   2734  C  C     . TYR A  1 350 ? 89.197  30.016  -80.502  1.00 43.79  ?  456 TYR A C     1 
ATOM   2735  O  O     . TYR A  1 350 ? 88.922  30.244  -81.683  1.00 44.95  ?  456 TYR A O     1 
ATOM   2736  C  CB    . TYR A  1 350 ? 88.403  32.063  -79.284  1.00 45.44  ?  456 TYR A CB    1 
ATOM   2737  C  CG    . TYR A  1 350 ? 87.139  31.386  -78.791  1.00 46.20  ?  456 TYR A CG    1 
ATOM   2738  C  CD1   . TYR A  1 350 ? 87.032  30.907  -77.486  1.00 46.22  ?  456 TYR A CD1   1 
ATOM   2739  C  CD2   . TYR A  1 350 ? 86.025  31.269  -79.618  1.00 46.98  ?  456 TYR A CD2   1 
ATOM   2740  C  CE1   . TYR A  1 350 ? 85.866  30.310  -77.032  1.00 46.24  ?  456 TYR A CE1   1 
ATOM   2741  C  CE2   . TYR A  1 350 ? 84.849  30.676  -79.174  1.00 46.80  ?  456 TYR A CE2   1 
ATOM   2742  C  CZ    . TYR A  1 350 ? 84.778  30.198  -77.885  1.00 46.20  ?  456 TYR A CZ    1 
ATOM   2743  O  OH    . TYR A  1 350 ? 83.614  29.614  -77.460  1.00 46.78  ?  456 TYR A OH    1 
ATOM   2744  N  N     . VAL A  1 351 ? 89.177  28.799  -79.974  1.00 41.61  ?  457 VAL A N     1 
ATOM   2745  C  CA    . VAL A  1 351 ? 88.791  27.619  -80.758  1.00 40.22  ?  457 VAL A CA    1 
ATOM   2746  C  C     . VAL A  1 351 ? 87.326  27.249  -80.515  1.00 39.45  ?  457 VAL A C     1 
ATOM   2747  O  O     . VAL A  1 351 ? 86.575  26.988  -81.451  1.00 39.12  ?  457 VAL A O     1 
ATOM   2748  C  CB    . VAL A  1 351 ? 89.734  26.445  -80.433  1.00 39.49  ?  457 VAL A CB    1 
ATOM   2749  C  CG1   . VAL A  1 351 ? 89.352  25.206  -81.211  1.00 39.62  ?  457 VAL A CG1   1 
ATOM   2750  C  CG2   . VAL A  1 351 ? 91.178  26.831  -80.745  1.00 39.04  ?  457 VAL A CG2   1 
ATOM   2751  N  N     . GLY A  1 352 ? 86.928  27.235  -79.249  1.00 39.31  ?  458 GLY A N     1 
ATOM   2752  C  CA    . GLY A  1 352 ? 85.551  26.917  -78.866  1.00 39.73  ?  458 GLY A CA    1 
ATOM   2753  C  C     . GLY A  1 352 ? 85.411  26.738  -77.368  1.00 40.60  ?  458 GLY A C     1 
ATOM   2754  O  O     . GLY A  1 352 ? 86.387  26.817  -76.609  1.00 40.56  ?  458 GLY A O     1 
ATOM   2755  N  N     . GLU A  1 353 ? 84.179  26.482  -76.955  1.00 41.44  ?  459 GLU A N     1 
ATOM   2756  C  CA    . GLU A  1 353 ? 83.812  26.342  -75.540  1.00 41.58  ?  459 GLU A CA    1 
ATOM   2757  C  C     . GLU A  1 353 ? 83.087  25.007  -75.368  1.00 41.73  ?  459 GLU A C     1 
ATOM   2758  O  O     . GLU A  1 353 ? 82.452  24.516  -76.305  1.00 42.32  ?  459 GLU A O     1 
ATOM   2759  C  CB    . GLU A  1 353 ? 82.920  27.522  -75.143  1.00 41.50  ?  459 GLU A CB    1 
ATOM   2760  C  CG    . GLU A  1 353 ? 82.346  27.518  -73.745  1.00 41.74  ?  459 GLU A CG    1 
ATOM   2761  C  CD    . GLU A  1 353 ? 81.671  28.843  -73.393  1.00 41.64  ?  459 GLU A CD    1 
ATOM   2762  O  OE1   . GLU A  1 353 ? 81.176  29.539  -74.312  1.00 41.81  ?  459 GLU A OE1   1 
ATOM   2763  O  OE2   . GLU A  1 353 ? 81.653  29.199  -72.188  1.00 41.27  ?  459 GLU A OE2   1 
ATOM   2764  N  N     . THR A  1 354 ? 83.196  24.419  -74.182  1.00 41.16  ?  460 THR A N     1 
ATOM   2765  C  CA    . THR A  1 354 ? 82.467  23.186  -73.867  1.00 40.75  ?  460 THR A CA    1 
ATOM   2766  C  C     . THR A  1 354 ? 82.259  23.039  -72.356  1.00 40.89  ?  460 THR A C     1 
ATOM   2767  O  O     . THR A  1 354 ? 82.894  23.737  -71.567  1.00 40.68  ?  460 THR A O     1 
ATOM   2768  C  CB    . THR A  1 354 ? 83.162  21.948  -74.475  1.00 40.39  ?  460 THR A CB    1 
ATOM   2769  O  OG1   . THR A  1 354 ? 82.308  20.804  -74.367  1.00 40.23  ?  460 THR A OG1   1 
ATOM   2770  C  CG2   . THR A  1 354 ? 84.498  21.665  -73.811  1.00 40.55  ?  460 THR A CG2   1 
ATOM   2771  N  N     . GLN A  1 355 ? 81.356  22.138  -71.983  1.00 41.68  ?  461 GLN A N     1 
ATOM   2772  C  CA    . GLN A  1 355 ? 81.082  21.803  -70.580  1.00 43.08  ?  461 GLN A CA    1 
ATOM   2773  C  C     . GLN A  1 355 ? 81.204  20.296  -70.350  1.00 45.36  ?  461 GLN A C     1 
ATOM   2774  O  O     . GLN A  1 355 ? 80.960  19.522  -71.273  1.00 46.08  ?  461 GLN A O     1 
ATOM   2775  C  CB    . GLN A  1 355 ? 79.663  22.194  -70.204  1.00 42.55  ?  461 GLN A CB    1 
ATOM   2776  C  CG    . GLN A  1 355 ? 79.305  23.637  -70.406  1.00 42.22  ?  461 GLN A CG    1 
ATOM   2777  C  CD    . GLN A  1 355 ? 77.906  23.913  -69.888  1.00 43.24  ?  461 GLN A CD    1 
ATOM   2778  O  OE1   . GLN A  1 355 ? 76.996  24.184  -70.667  1.00 44.43  ?  461 GLN A OE1   1 
ATOM   2779  N  NE2   . GLN A  1 355 ? 77.724  23.796  -68.548  1.00 43.09  ?  461 GLN A NE2   1 
ATOM   2780  N  N     . PRO A  1 356 ? 81.543  19.874  -69.119  1.00 47.90  ?  462 PRO A N     1 
ATOM   2781  C  CA    . PRO A  1 356 ? 81.387  18.459  -68.784  1.00 49.79  ?  462 PRO A CA    1 
ATOM   2782  C  C     . PRO A  1 356 ? 79.931  18.024  -68.683  1.00 51.35  ?  462 PRO A C     1 
ATOM   2783  O  O     . PRO A  1 356 ? 79.033  18.868  -68.644  1.00 51.44  ?  462 PRO A O     1 
ATOM   2784  C  CB    . PRO A  1 356 ? 82.092  18.328  -67.426  1.00 50.45  ?  462 PRO A CB    1 
ATOM   2785  C  CG    . PRO A  1 356 ? 83.011  19.480  -67.351  1.00 49.50  ?  462 PRO A CG    1 
ATOM   2786  C  CD    . PRO A  1 356 ? 82.293  20.588  -68.077  1.00 48.64  ?  462 PRO A CD    1 
ATOM   2787  N  N     . THR A  1 357 ? 79.721  16.714  -68.644  1.00 53.75  ?  463 THR A N     1 
ATOM   2788  C  CA    . THR A  1 357 ? 78.386  16.130  -68.515  1.00 56.53  ?  463 THR A CA    1 
ATOM   2789  C  C     . THR A  1 357 ? 78.323  15.213  -67.304  1.00 58.98  ?  463 THR A C     1 
ATOM   2790  O  O     . THR A  1 357 ? 79.355  14.850  -66.733  1.00 58.12  ?  463 THR A O     1 
ATOM   2791  C  CB    . THR A  1 357 ? 78.014  15.315  -69.755  1.00 56.30  ?  463 THR A CB    1 
ATOM   2792  O  OG1   . THR A  1 357 ? 79.095  14.451  -70.085  1.00 55.01  ?  463 THR A OG1   1 
ATOM   2793  C  CG2   . THR A  1 357 ? 77.715  16.231  -70.922  1.00 55.87  ?  463 THR A CG2   1 
ATOM   2794  N  N     . GLY A  1 358 ? 77.100  14.816  -66.950  1.00 61.51  ?  464 GLY A N     1 
ATOM   2795  C  CA    . GLY A  1 358 ? 76.862  14.007  -65.766  1.00 63.80  ?  464 GLY A CA    1 
ATOM   2796  C  C     . GLY A  1 358 ? 77.120  14.850  -64.531  1.00 65.39  ?  464 GLY A C     1 
ATOM   2797  O  O     . GLY A  1 358 ? 76.649  15.976  -64.438  1.00 67.43  ?  464 GLY A O     1 
ATOM   2798  N  N     . GLN A  1 359 ? 77.867  14.290  -63.582  1.00 65.39  ?  465 GLN A N     1 
ATOM   2799  C  CA    . GLN A  1 359 ? 78.405  15.036  -62.461  1.00 63.94  ?  465 GLN A CA    1 
ATOM   2800  C  C     . GLN A  1 359 ? 79.929  14.843  -62.457  1.00 63.71  ?  465 GLN A C     1 
ATOM   2801  O  O     . GLN A  1 359 ? 80.493  14.468  -61.448  1.00 62.84  ?  465 GLN A O     1 
ATOM   2802  C  CB    . GLN A  1 359 ? 77.750  14.568  -61.152  1.00 63.79  ?  465 GLN A CB    1 
ATOM   2803  N  N     . ILE A  1 360 ? 80.579  15.142  -63.591  1.00 65.63  ?  466 ILE A N     1 
ATOM   2804  C  CA    . ILE A  1 360 ? 82.061  15.133  -63.747  1.00 67.99  ?  466 ILE A CA    1 
ATOM   2805  C  C     . ILE A  1 360 ? 82.656  16.521  -63.440  1.00 66.63  ?  466 ILE A C     1 
ATOM   2806  O  O     . ILE A  1 360 ? 82.811  17.346  -64.337  1.00 66.47  ?  466 ILE A O     1 
ATOM   2807  C  CB    . ILE A  1 360 ? 82.523  14.736  -65.206  1.00 69.74  ?  466 ILE A CB    1 
ATOM   2808  C  CG1   . ILE A  1 360 ? 81.898  13.429  -65.728  1.00 70.70  ?  466 ILE A CG1   1 
ATOM   2809  C  CG2   . ILE A  1 360 ? 84.053  14.618  -65.280  1.00 69.93  ?  466 ILE A CG2   1 
ATOM   2810  C  CD1   . ILE A  1 360 ? 81.998  13.281  -67.248  1.00 70.19  ?  466 ILE A CD1   1 
ATOM   2811  N  N     . LYS A  1 361 ? 83.031  16.782  -62.182  1.00 64.18  ?  467 LYS A N     1 
ATOM   2812  C  CA    . LYS A  1 361 ? 83.708  18.065  -61.834  1.00 61.52  ?  467 LYS A CA    1 
ATOM   2813  C  C     . LYS A  1 361 ? 85.191  17.949  -62.168  1.00 59.55  ?  467 LYS A C     1 
ATOM   2814  O  O     . LYS A  1 361 ? 85.831  16.938  -61.831  1.00 58.83  ?  467 LYS A O     1 
ATOM   2815  C  CB    . LYS A  1 361 ? 83.544  18.347  -60.336  1.00 61.27  ?  467 LYS A CB    1 
ATOM   2816  N  N     . ILE A  1 362 ? 85.748  18.939  -62.867  1.00 59.15  ?  468 ILE A N     1 
ATOM   2817  C  CA    . ILE A  1 362 ? 87.210  19.004  -63.147  1.00 61.15  ?  468 ILE A CA    1 
ATOM   2818  C  C     . ILE A  1 362 ? 87.930  19.680  -61.999  1.00 63.35  ?  468 ILE A C     1 
ATOM   2819  O  O     . ILE A  1 362 ? 87.788  20.888  -61.820  1.00 63.49  ?  468 ILE A O     1 
ATOM   2820  C  CB    . ILE A  1 362 ? 87.525  19.754  -64.466  1.00 60.87  ?  468 ILE A CB    1 
ATOM   2821  C  CG1   . ILE A  1 362 ? 86.905  19.006  -65.649  1.00 60.87  ?  468 ILE A CG1   1 
ATOM   2822  C  CG2   . ILE A  1 362 ? 89.034  19.901  -64.658  1.00 60.66  ?  468 ILE A CG2   1 
ATOM   2823  C  CD1   . ILE A  1 362 ? 87.113  19.639  -67.001  1.00 60.16  ?  468 ILE A CD1   1 
ATOM   2824  N  N     . LYS A  1 363 ? 88.732  18.924  -61.254  1.00 67.91  ?  469 LYS A N     1 
ATOM   2825  C  CA    . LYS A  1 363 ? 89.469  19.462  -60.098  1.00 71.78  ?  469 LYS A CA    1 
ATOM   2826  C  C     . LYS A  1 363 ? 90.574  20.425  -60.541  1.00 75.13  ?  469 LYS A C     1 
ATOM   2827  O  O     . LYS A  1 363 ? 91.085  20.315  -61.651  1.00 74.12  ?  469 LYS A O     1 
ATOM   2828  C  CB    . LYS A  1 363 ? 90.032  18.323  -59.242  1.00 71.28  ?  469 LYS A CB    1 
ATOM   2829  N  N     . ARG A  1 364 ? 90.913  21.373  -59.666  1.00 80.36  ?  470 ARG A N     1 
ATOM   2830  C  CA    . ARG A  1 364 ? 91.898  22.439  -59.960  1.00 83.84  ?  470 ARG A CA    1 
ATOM   2831  C  C     . ARG A  1 364 ? 93.303  21.905  -60.235  1.00 81.98  ?  470 ARG A C     1 
ATOM   2832  O  O     . ARG A  1 364 ? 93.999  22.387  -61.123  1.00 79.46  ?  470 ARG A O     1 
ATOM   2833  C  CB    . ARG A  1 364 ? 91.966  23.425  -58.803  1.00 89.09  ?  470 ARG A CB    1 
ATOM   2834  C  CG    . ARG A  1 364 ? 92.922  24.581  -59.087  1.00 93.15  ?  470 ARG A CG    1 
ATOM   2835  C  CD    . ARG A  1 364 ? 92.938  25.616  -57.975  1.00 97.53  ?  470 ARG A CD    1 
ATOM   2836  N  NE    . ARG A  1 364 ? 91.601  26.169  -57.733  1.00 101.70 ?  470 ARG A NE    1 
ATOM   2837  C  CZ    . ARG A  1 364 ? 90.973  27.056  -58.503  1.00 100.89 ?  470 ARG A CZ    1 
ATOM   2838  N  NH1   . ARG A  1 364 ? 91.534  27.528  -59.611  1.00 104.11 ?  470 ARG A NH1   1 
ATOM   2839  N  NH2   . ARG A  1 364 ? 89.743  27.445  -58.162  1.00 96.18  ?  470 ARG A NH2   1 
ATOM   2840  N  N     . GLU A  1 365 ? 93.725  20.962  -59.409  1.00 81.13  ?  471 GLU A N     1 
ATOM   2841  C  CA    . GLU A  1 365 ? 94.886  20.085  -59.665  1.00 80.87  ?  471 GLU A CA    1 
ATOM   2842  C  C     . GLU A  1 365 ? 95.135  19.722  -61.147  1.00 76.60  ?  471 GLU A C     1 
ATOM   2843  O  O     . GLU A  1 365 ? 96.251  19.844  -61.643  1.00 76.88  ?  471 GLU A O     1 
ATOM   2844  C  CB    . GLU A  1 365 ? 94.756  18.804  -58.818  1.00 84.64  ?  471 GLU A CB    1 
ATOM   2845  C  CG    . GLU A  1 365 ? 93.405  18.105  -58.926  1.00 88.76  ?  471 GLU A CG    1 
ATOM   2846  C  CD    . GLU A  1 365 ? 93.220  16.907  -58.027  1.00 93.48  ?  471 GLU A CD    1 
ATOM   2847  O  OE1   . GLU A  1 365 ? 94.080  16.611  -57.161  1.00 97.02  ?  471 GLU A OE1   1 
ATOM   2848  O  OE2   . GLU A  1 365 ? 92.148  16.286  -58.180  1.00 97.00  ?  471 GLU A OE2   1 
ATOM   2849  N  N     . ASP A  1 366 ? 94.084  19.305  -61.848  1.00 73.43  ?  472 ASP A N     1 
ATOM   2850  C  CA    . ASP A  1 366 ? 94.194  18.791  -63.226  1.00 74.08  ?  472 ASP A CA    1 
ATOM   2851  C  C     . ASP A  1 366 ? 94.320  19.859  -64.313  1.00 72.06  ?  472 ASP A C     1 
ATOM   2852  O  O     . ASP A  1 366 ? 94.562  19.520  -65.476  1.00 68.63  ?  472 ASP A O     1 
ATOM   2853  C  CB    . ASP A  1 366 ? 92.984  17.905  -63.552  1.00 74.92  ?  472 ASP A CB    1 
ATOM   2854  C  CG    . ASP A  1 366 ? 92.842  16.723  -62.615  1.00 76.22  ?  472 ASP A CG    1 
ATOM   2855  O  OD1   . ASP A  1 366 ? 93.850  16.277  -62.026  1.00 76.52  ?  472 ASP A OD1   1 
ATOM   2856  O  OD2   . ASP A  1 366 ? 91.710  16.234  -62.485  1.00 78.09  ?  472 ASP A OD2   1 
ATOM   2857  N  N     . TYR A  1 367 ? 94.159  21.128  -63.960  1.00 70.04  ?  473 TYR A N     1 
ATOM   2858  C  CA    . TYR A  1 367 ? 94.226  22.249  -64.917  1.00 67.75  ?  473 TYR A CA    1 
ATOM   2859  C  C     . TYR A  1 367 ? 95.533  22.231  -65.706  1.00 64.95  ?  473 TYR A C     1 
ATOM   2860  O  O     . TYR A  1 367 ? 95.514  22.347  -66.931  1.00 61.01  ?  473 TYR A O     1 
ATOM   2861  C  CB    . TYR A  1 367 ? 94.052  23.605  -64.191  1.00 68.31  ?  473 TYR A CB    1 
ATOM   2862  C  CG    . TYR A  1 367 ? 92.642  23.943  -63.675  1.00 68.10  ?  473 TYR A CG    1 
ATOM   2863  C  CD1   . TYR A  1 367 ? 91.607  22.983  -63.623  1.00 68.16  ?  473 TYR A CD1   1 
ATOM   2864  C  CD2   . TYR A  1 367 ? 92.353  25.232  -63.203  1.00 68.19  ?  473 TYR A CD2   1 
ATOM   2865  C  CE1   . TYR A  1 367 ? 90.342  23.310  -63.142  1.00 67.99  ?  473 TYR A CE1   1 
ATOM   2866  C  CE2   . TYR A  1 367 ? 91.087  25.562  -62.720  1.00 67.32  ?  473 TYR A CE2   1 
ATOM   2867  C  CZ    . TYR A  1 367 ? 90.092  24.600  -62.686  1.00 66.79  ?  473 TYR A CZ    1 
ATOM   2868  O  OH    . TYR A  1 367 ? 88.851  24.917  -62.208  1.00 64.37  ?  473 TYR A OH    1 
ATOM   2869  N  N     . GLU A  1 368 ? 96.648  22.050  -64.998  1.00 64.94  ?  474 GLU A N     1 
ATOM   2870  C  CA    . GLU A  1 368 ? 97.975  21.926  -65.616  1.00 65.25  ?  474 GLU A CA    1 
ATOM   2871  C  C     . GLU A  1 368 ? 97.982  20.951  -66.793  1.00 67.06  ?  474 GLU A C     1 
ATOM   2872  O  O     . GLU A  1 368 ? 98.544  21.266  -67.845  1.00 67.87  ?  474 GLU A O     1 
ATOM   2873  C  CB    . GLU A  1 368 ? 99.025  21.492  -64.586  1.00 62.80  ?  474 GLU A CB    1 
ATOM   2874  N  N     . SER A  1 369 ? 97.328  19.806  -66.631  1.00 68.33  ?  475 SER A N     1 
ATOM   2875  C  CA    . SER A  1 369 ? 97.412  18.694  -67.604  1.00 69.56  ?  475 SER A CA    1 
ATOM   2876  C  C     . SER A  1 369 ? 96.543  18.774  -68.871  1.00 68.57  ?  475 SER A C     1 
ATOM   2877  O  O     . SER A  1 369 ? 96.757  17.998  -69.790  1.00 68.59  ?  475 SER A O     1 
ATOM   2878  C  CB    . SER A  1 369 ? 97.084  17.365  -66.898  1.00 69.67  ?  475 SER A CB    1 
ATOM   2879  O  OG    . SER A  1 369 ? 98.021  16.927  -65.889  1.00 70.25  ?  475 SER A OG    1 
ATOM   2880  N  N     . LEU A  1 370 ? 95.572  19.676  -68.906  1.00 67.64  ?  476 LEU A N     1 
ATOM   2881  C  CA    . LEU A  1 370 ? 94.551  19.667  -69.968  1.00 67.35  ?  476 LEU A CA    1 
ATOM   2882  C  C     . LEU A  1 370 ? 95.049  20.019  -71.377  1.00 67.25  ?  476 LEU A C     1 
ATOM   2883  O  O     . LEU A  1 370 ? 94.545  19.452  -72.351  1.00 69.44  ?  476 LEU A O     1 
ATOM   2884  C  CB    . LEU A  1 370 ? 93.347  20.533  -69.580  1.00 67.67  ?  476 LEU A CB    1 
ATOM   2885  C  CG    . LEU A  1 370 ? 92.540  20.081  -68.360  1.00 70.88  ?  476 LEU A CG    1 
ATOM   2886  C  CD1   . LEU A  1 370 ? 91.404  21.042  -68.103  1.00 71.44  ?  476 LEU A CD1   1 
ATOM   2887  C  CD2   . LEU A  1 370 ? 91.888  18.705  -68.555  1.00 73.26  ?  476 LEU A CD2   1 
ATOM   2888  N  N     . PRO A  1 371 ? 96.029  20.940  -71.500  1.00 66.23  ?  477 PRO A N     1 
ATOM   2889  C  CA    . PRO A  1 371 ? 96.646  21.175  -72.821  1.00 66.90  ?  477 PRO A CA    1 
ATOM   2890  C  C     . PRO A  1 371 ? 97.278  19.914  -73.429  1.00 69.14  ?  477 PRO A C     1 
ATOM   2891  O  O     . PRO A  1 371 ? 97.115  19.658  -74.621  1.00 68.55  ?  477 PRO A O     1 
ATOM   2892  C  CB    . PRO A  1 371 ? 97.715  22.224  -72.514  1.00 66.83  ?  477 PRO A CB    1 
ATOM   2893  C  CG    . PRO A  1 371 ? 97.156  22.986  -71.371  1.00 66.47  ?  477 PRO A CG    1 
ATOM   2894  C  CD    . PRO A  1 371 ? 96.450  21.959  -70.525  1.00 66.09  ?  477 PRO A CD    1 
ATOM   2895  N  N     . LYS A  1 372 ? 97.981  19.145  -72.598  1.00 74.19  ?  478 LYS A N     1 
ATOM   2896  C  CA    . LYS A  1 372 ? 98.514  17.830  -72.960  1.00 77.87  ?  478 LYS A CA    1 
ATOM   2897  C  C     . LYS A  1 372 ? 97.438  16.940  -73.560  1.00 75.93  ?  478 LYS A C     1 
ATOM   2898  O  O     . LYS A  1 372 ? 97.625  16.370  -74.622  1.00 77.77  ?  478 LYS A O     1 
ATOM   2899  C  CB    . LYS A  1 372 ? 99.171  17.167  -71.745  1.00 82.75  ?  478 LYS A CB    1 
ATOM   2900  C  CG    . LYS A  1 372 ? 100.305 18.057  -71.104  1.00 84.91  ?  478 LYS A CG    1 
ATOM   2901  C  CD    . LYS A  1 372 ? 99.954  19.180  -70.086  1.00 83.15  ?  478 LYS A CD    1 
ATOM   2902  C  CE    . LYS A  1 372 ? 100.609 20.535  -70.406  1.00 80.96  ?  478 LYS A CE    1 
ATOM   2903  N  NZ    . LYS A  1 372 ? 100.653 21.463  -69.246  1.00 79.68  ?  478 LYS A NZ    1 
ATOM   2904  N  N     . GLU A  1 373 ? 96.291  16.864  -72.895  1.00 74.78  ?  479 GLU A N     1 
ATOM   2905  C  CA    . GLU A  1 373 ? 95.178  16.013  -73.344  1.00 75.90  ?  479 GLU A CA    1 
ATOM   2906  C  C     . GLU A  1 373 ? 94.615  16.393  -74.714  1.00 72.94  ?  479 GLU A C     1 
ATOM   2907  O  O     . GLU A  1 373 ? 94.226  15.510  -75.484  1.00 73.81  ?  479 GLU A O     1 
ATOM   2908  C  CB    . GLU A  1 373 ? 94.044  16.029  -72.326  1.00 79.48  ?  479 GLU A CB    1 
ATOM   2909  C  CG    . GLU A  1 373 ? 94.392  15.423  -70.974  1.00 80.67  ?  479 GLU A CG    1 
ATOM   2910  C  CD    . GLU A  1 373 ? 93.222  15.464  -70.005  1.00 80.80  ?  479 GLU A CD    1 
ATOM   2911  O  OE1   . GLU A  1 373 ? 92.058  15.609  -70.457  1.00 80.72  ?  479 GLU A OE1   1 
ATOM   2912  O  OE2   . GLU A  1 373 ? 93.471  15.339  -68.793  1.00 84.43  ?  479 GLU A OE2   1 
ATOM   2913  N  N     . VAL A  1 374 ? 94.560  17.693  -75.005  1.00 69.05  ?  480 VAL A N     1 
ATOM   2914  C  CA    . VAL A  1 374 ? 93.998  18.187  -76.273  1.00 67.02  ?  480 VAL A CA    1 
ATOM   2915  C  C     . VAL A  1 374 ? 94.906  17.814  -77.442  1.00 64.21  ?  480 VAL A C     1 
ATOM   2916  O  O     . VAL A  1 374 ? 94.430  17.303  -78.458  1.00 62.54  ?  480 VAL A O     1 
ATOM   2917  C  CB    . VAL A  1 374 ? 93.741  19.710  -76.246  1.00 67.05  ?  480 VAL A CB    1 
ATOM   2918  C  CG1   . VAL A  1 374 ? 93.317  20.231  -77.612  1.00 66.73  ?  480 VAL A CG1   1 
ATOM   2919  C  CG2   . VAL A  1 374 ? 92.656  20.035  -75.243  1.00 66.58  ?  480 VAL A CG2   1 
ATOM   2920  N  N     . ALA A  1 375 ? 96.201  18.072  -77.295  1.00 62.84  ?  481 ALA A N     1 
ATOM   2921  C  CA    . ALA A  1 375 ? 97.192  17.654  -78.285  1.00 63.18  ?  481 ALA A CA    1 
ATOM   2922  C  C     . ALA A  1 375 ? 97.212  16.131  -78.459  1.00 64.93  ?  481 ALA A C     1 
ATOM   2923  O  O     . ALA A  1 375 ? 97.377  15.626  -79.582  1.00 64.17  ?  481 ALA A O     1 
ATOM   2924  C  CB    . ALA A  1 375 ? 98.570  18.156  -77.897  1.00 62.16  ?  481 ALA A CB    1 
ATOM   2925  N  N     . SER A  1 376 ? 97.006  15.408  -77.358  1.00 68.10  ?  482 SER A N     1 
ATOM   2926  C  CA    . SER A  1 376 ? 97.004  13.949  -77.359  1.00 73.29  ?  482 SER A CA    1 
ATOM   2927  C  C     . SER A  1 376 ? 95.869  13.293  -78.129  1.00 76.12  ?  482 SER A C     1 
ATOM   2928  O  O     . SER A  1 376 ? 95.995  12.123  -78.499  1.00 79.42  ?  482 SER A O     1 
ATOM   2929  C  CB    . SER A  1 376 ? 96.963  13.425  -75.923  1.00 76.73  ?  482 SER A CB    1 
ATOM   2930  O  OG    . SER A  1 376 ? 98.095  13.868  -75.202  1.00 80.29  ?  482 SER A OG    1 
ATOM   2931  N  N     . ALA A  1 377 ? 94.769  14.006  -78.350  1.00 77.48  ?  483 ALA A N     1 
ATOM   2932  C  CA    . ALA A  1 377 ? 93.655  13.462  -79.125  1.00 77.86  ?  483 ALA A CA    1 
ATOM   2933  C  C     . ALA A  1 377 ? 94.115  13.109  -80.539  1.00 78.59  ?  483 ALA A C     1 
ATOM   2934  O  O     . ALA A  1 377 ? 94.923  13.803  -81.135  1.00 74.87  ?  483 ALA A O     1 
ATOM   2935  C  CB    . ALA A  1 377 ? 92.488  14.449  -79.181  1.00 77.32  ?  483 ALA A CB    1 
ATOM   2936  N  N     . LYS A  1 378 ? 93.600  11.990  -81.038  1.00 84.16  ?  484 LYS A N     1 
ATOM   2937  C  CA    . LYS A  1 378 ? 93.943  11.481  -82.350  1.00 89.56  ?  484 LYS A CA    1 
ATOM   2938  C  C     . LYS A  1 378 ? 92.651  11.584  -83.175  1.00 92.95  ?  484 LYS A C     1 
ATOM   2939  O  O     . LYS A  1 378 ? 91.877  10.621  -83.207  1.00 98.84  ?  484 LYS A O     1 
ATOM   2940  C  CB    . LYS A  1 378 ? 94.408  10.038  -82.262  1.00 92.73  ?  484 LYS A CB    1 
ATOM   2941  C  CG    . LYS A  1 378 ? 95.432  9.744   -81.192  1.00 94.98  ?  484 LYS A CG    1 
ATOM   2942  C  CD    . LYS A  1 378 ? 96.754  10.452  -81.427  1.00 97.55  ?  484 LYS A CD    1 
ATOM   2943  C  CE    . LYS A  1 378 ? 97.786  9.926   -80.456  1.00 101.45 ?  484 LYS A CE    1 
ATOM   2944  N  NZ    . LYS A  1 378 ? 98.743  10.982  -80.018  1.00 104.32 ?  484 LYS A NZ    1 
ATOM   2945  N  N     . PRO A  1 379 ? 92.416  12.742  -83.817  1.00 92.19  ?  485 PRO A N     1 
ATOM   2946  C  CA    . PRO A  1 379 ? 91.247  12.898  -84.648  1.00 90.52  ?  485 PRO A CA    1 
ATOM   2947  C  C     . PRO A  1 379 ? 91.311  12.138  -85.941  1.00 88.38  ?  485 PRO A C     1 
ATOM   2948  O  O     . PRO A  1 379 ? 92.321  12.249  -86.628  1.00 89.82  ?  485 PRO A O     1 
ATOM   2949  C  CB    . PRO A  1 379 ? 91.165  14.416  -84.910  1.00 91.09  ?  485 PRO A CB    1 
ATOM   2950  C  CG    . PRO A  1 379 ? 92.588  14.830  -84.846  1.00 91.30  ?  485 PRO A CG    1 
ATOM   2951  C  CD    . PRO A  1 379 ? 93.232  13.966  -83.789  1.00 91.76  ?  485 PRO A CD    1 
ATOM   2952  N  N     . LYS A  1 380 ? 90.250  11.374  -86.267  1.00 87.30  ?  486 LYS A N     1 
ATOM   2953  C  CA    . LYS A  1 380 ? 90.320  10.441  -87.408  1.00 90.43  ?  486 LYS A CA    1 
ATOM   2954  C  C     . LYS A  1 380 ? 90.126  11.189  -88.739  1.00 95.51  ?  486 LYS A C     1 
ATOM   2955  O  O     . LYS A  1 380 ? 89.397  10.740  -89.529  1.00 101.11 ?  486 LYS A O     1 
ATOM   2956  C  CB    . LYS A  1 380 ? 89.325  9.283   -87.211  1.00 87.61  ?  486 LYS A CB    1 
ATOM   2957  N  N     . VAL A  1 381 ? 91.010  12.123  -89.010  1.00 100.22 ?  487 VAL A N     1 
ATOM   2958  C  CA    . VAL A  1 381 ? 91.258  12.765  -90.331  1.00 103.72 ?  487 VAL A CA    1 
ATOM   2959  C  C     . VAL A  1 381 ? 92.751  13.265  -90.171  1.00 106.78 ?  487 VAL A C     1 
ATOM   2960  O  O     . VAL A  1 381 ? 93.160  13.861  -89.164  1.00 113.41 ?  487 VAL A O     1 
ATOM   2961  C  CB    . VAL A  1 381 ? 90.469  14.059  -90.542  1.00 103.95 ?  487 VAL A CB    1 
ATOM   2962  C  CG1   . VAL A  1 381 ? 90.964  14.727  -91.857  1.00 100.20 ?  487 VAL A CG1   1 
ATOM   2963  C  CG2   . VAL A  1 381 ? 88.973  13.856  -90.377  1.00 105.89 ?  487 VAL A CG2   1 
ATOM   2964  N  N     . LEU A  1 382 ? 93.504  12.966  -91.209  1.00 108.35 ?  488 LEU A N     1 
ATOM   2965  C  CA    . LEU A  1 382 ? 94.981  13.118  -91.130  1.00 109.32 ?  488 LEU A CA    1 
ATOM   2966  C  C     . LEU A  1 382 ? 95.320  14.624  -91.259  1.00 111.60 ?  488 LEU A C     1 
ATOM   2967  O  O     . LEU A  1 382 ? 95.000  15.182  -92.317  1.00 115.63 ?  488 LEU A O     1 
ATOM   2968  C  CB    . LEU A  1 382 ? 95.745  12.262  -92.147  1.00 107.32 ?  488 LEU A CB    1 
ATOM   2969  C  CG    . LEU A  1 382 ? 95.812  10.752  -91.626  1.00 103.62 ?  488 LEU A CG    1 
ATOM   2970  C  CD1   . LEU A  1 382 ? 96.506  9.824   -92.601  1.00 101.12 ?  488 LEU A CD1   1 
ATOM   2971  C  CD2   . LEU A  1 382 ? 96.354  10.472  -90.202  1.00 101.74 ?  488 LEU A CD2   1 
ATOM   2972  N  N     . LEU A  1 383 ? 96.001  15.149  -90.264  1.00 110.71 ?  489 LEU A N     1 
ATOM   2973  C  CA    . LEU A  1 383 ? 96.332  16.554  -90.195  1.00 112.29 ?  489 LEU A CA    1 
ATOM   2974  C  C     . LEU A  1 383 ? 97.780  16.903  -90.648  1.00 112.10 ?  489 LEU A C     1 
ATOM   2975  O  O     . LEU A  1 383 ? 98.656  16.135  -90.530  1.00 109.60 ?  489 LEU A O     1 
ATOM   2976  C  CB    . LEU A  1 383 ? 96.240  17.059  -88.748  1.00 115.99 ?  489 LEU A CB    1 
ATOM   2977  C  CG    . LEU A  1 383 ? 94.868  16.774  -88.030  1.00 122.68 ?  489 LEU A CG    1 
ATOM   2978  C  CD1   . LEU A  1 383 ? 94.888  16.619  -86.534  1.00 126.99 ?  489 LEU A CD1   1 
ATOM   2979  C  CD2   . LEU A  1 383 ? 93.858  17.721  -88.545  1.00 124.47 ?  489 LEU A CD2   1 
ATOM   2980  N  N     . ASP A  1 384 ? 97.819  17.969  -91.476  1.00 115.60 ?  490 ASP A N     1 
ATOM   2981  C  CA    . ASP A  1 384 ? 99.023  18.397  -92.200  1.00 119.85 ?  490 ASP A CA    1 
ATOM   2982  C  C     . ASP A  1 384 ? 100.033 19.047  -91.319  1.00 113.09 ?  490 ASP A C     1 
ATOM   2983  O  O     . ASP A  1 384 ? 101.267 18.760  -91.521  1.00 116.73 ?  490 ASP A O     1 
ATOM   2984  C  CB    . ASP A  1 384 ? 98.664  19.436  -93.244  1.00 129.58 ?  490 ASP A CB    1 
ATOM   2985  C  CG    . ASP A  1 384 ? 97.843  18.780  -94.402  1.00 142.00 ?  490 ASP A CG    1 
ATOM   2986  O  OD1   . ASP A  1 384 ? 97.932  17.545  -94.632  1.00 154.76 ?  490 ASP A OD1   1 
ATOM   2987  O  OD2   . ASP A  1 384 ? 97.101  19.470  -95.089  1.00 154.10 ?  490 ASP A OD2   1 
ATOM   2988  N  N     . VAL A  1 385 ? 99.544  19.786  -90.260  1.00 103.65 ?  491 VAL A N     1 
ATOM   2989  C  CA    . VAL A  1 385 ? 100.455 20.166  -89.161  1.00 97.60  ?  491 VAL A CA    1 
ATOM   2990  C  C     . VAL A  1 385 ? 99.918  19.483  -87.833  1.00 89.69  ?  491 VAL A C     1 
ATOM   2991  O  O     . VAL A  1 385 ? 98.755  19.381  -87.580  1.00 91.09  ?  491 VAL A O     1 
ATOM   2992  C  CB    . VAL A  1 385 ? 100.494 21.620  -88.994  1.00 98.79  ?  491 VAL A CB    1 
ATOM   2993  C  CG1   . VAL A  1 385 ? 101.451 22.040  -87.806  1.00 98.07  ?  491 VAL A CG1   1 
ATOM   2994  C  CG2   . VAL A  1 385 ? 100.999 22.260  -90.313  1.00 99.18  ?  491 VAL A CG2   1 
ATOM   2995  N  N     . LYS A  1 386 ? 100.915 18.914  -87.097  1.00 79.58  ?  492 LYS A N     1 
ATOM   2996  C  CA    . LYS A  1 386 ? 100.716 18.442  -85.781  1.00 72.60  ?  492 LYS A CA    1 
ATOM   2997  C  C     . LYS A  1 386 ? 101.017 19.579  -84.815  1.00 68.94  ?  492 LYS A C     1 
ATOM   2998  O  O     . LYS A  1 386 ? 101.922 20.368  -85.057  1.00 66.64  ?  492 LYS A O     1 
ATOM   2999  C  CB    . LYS A  1 386 ? 101.625 17.245  -85.519  1.00 70.62  ?  492 LYS A CB    1 
ATOM   3000  N  N     . LEU A  1 387 ? 100.245 19.633  -83.711  1.00 68.32  ?  493 LEU A N     1 
ATOM   3001  C  CA    . LEU A  1 387 ? 100.413 20.689  -82.689  1.00 67.68  ?  493 LEU A CA    1 
ATOM   3002  C  C     . LEU A  1 387 ? 100.835 20.095  -81.342  1.00 65.81  ?  493 LEU A C     1 
ATOM   3003  O  O     . LEU A  1 387 ? 100.266 19.098  -80.904  1.00 66.24  ?  493 LEU A O     1 
ATOM   3004  C  CB    . LEU A  1 387 ? 99.112  21.464  -82.521  1.00 68.98  ?  493 LEU A CB    1 
ATOM   3005  C  CG    . LEU A  1 387 ? 98.609  22.314  -83.694  1.00 70.60  ?  493 LEU A CG    1 
ATOM   3006  C  CD1   . LEU A  1 387 ? 97.202  22.860  -83.433  1.00 70.05  ?  493 LEU A CD1   1 
ATOM   3007  C  CD2   . LEU A  1 387 ? 99.571  23.448  -84.013  1.00 72.17  ?  493 LEU A CD2   1 
ATOM   3008  N  N     . LYS A  1 388 ? 101.821 20.722  -80.693  1.00 63.75  ?  494 LYS A N     1 
ATOM   3009  C  CA    . LYS A  1 388 ? 102.309 20.298  -79.367  1.00 62.19  ?  494 LYS A CA    1 
ATOM   3010  C  C     . LYS A  1 388 ? 101.408 20.878  -78.270  1.00 61.27  ?  494 LYS A C     1 
ATOM   3011  O  O     . LYS A  1 388 ? 100.598 21.772  -78.529  1.00 63.02  ?  494 LYS A O     1 
ATOM   3012  C  CB    . LYS A  1 388 ? 103.774 20.701  -79.137  1.00 60.35  ?  494 LYS A CB    1 
ATOM   3013  N  N     . ALA A  1 389 ? 101.532 20.360  -77.052  1.00 58.92  ?  495 ALA A N     1 
ATOM   3014  C  CA    . ALA A  1 389 ? 100.653 20.756  -75.938  1.00 58.62  ?  495 ALA A CA    1 
ATOM   3015  C  C     . ALA A  1 389 ? 100.842 22.200  -75.460  1.00 58.11  ?  495 ALA A C     1 
ATOM   3016  O  O     . ALA A  1 389 ? 99.911  22.843  -74.987  1.00 58.90  ?  495 ALA A O     1 
ATOM   3017  C  CB    . ALA A  1 389 ? 100.831 19.796  -74.778  1.00 59.53  ?  495 ALA A CB    1 
ATOM   3018  N  N     . GLU A  1 390 ? 102.066 22.686  -75.561  1.00 57.07  ?  496 GLU A N     1 
ATOM   3019  C  CA    . GLU A  1 390 ? 102.406 24.096  -75.297  1.00 56.36  ?  496 GLU A CA    1 
ATOM   3020  C  C     . GLU A  1 390 ? 101.687 25.091  -76.210  1.00 52.91  ?  496 GLU A C     1 
ATOM   3021  O  O     . GLU A  1 390 ? 101.535 26.252  -75.858  1.00 51.18  ?  496 GLU A O     1 
ATOM   3022  C  CB    . GLU A  1 390 ? 103.916 24.283  -75.420  1.00 59.78  ?  496 GLU A CB    1 
ATOM   3023  C  CG    . GLU A  1 390 ? 104.435 24.095  -76.844  1.00 63.22  ?  496 GLU A CG    1 
ATOM   3024  C  CD    . GLU A  1 390 ? 105.870 23.508  -76.876  1.00 65.29  ?  496 GLU A CD    1 
ATOM   3025  O  OE1   . GLU A  1 390 ? 106.654 23.674  -75.889  1.00 64.56  ?  496 GLU A OE1   1 
ATOM   3026  O  OE2   . GLU A  1 390 ? 106.166 22.842  -77.888  1.00 67.59  ?  496 GLU A OE2   1 
ATOM   3027  N  N     . ASP A  1 391 ? 101.277 24.643  -77.398  1.00 50.99  ?  497 ASP A N     1 
ATOM   3028  C  CA    . ASP A  1 391 ? 100.505 25.476  -78.346  1.00 49.43  ?  497 ASP A CA    1 
ATOM   3029  C  C     . ASP A  1 391 ? 99.078  25.765  -77.872  1.00 48.15  ?  497 ASP A C     1 
ATOM   3030  O  O     . ASP A  1 391 ? 98.476  26.740  -78.318  1.00 47.67  ?  497 ASP A O     1 
ATOM   3031  C  CB    . ASP A  1 391 ? 100.435 24.828  -79.741  1.00 49.07  ?  497 ASP A CB    1 
ATOM   3032  C  CG    . ASP A  1 391 ? 101.809 24.580  -80.371  1.00 48.37  ?  497 ASP A CG    1 
ATOM   3033  O  OD1   . ASP A  1 391 ? 102.738 25.393  -80.169  1.00 47.35  ?  497 ASP A OD1   1 
ATOM   3034  O  OD2   . ASP A  1 391 ? 101.935 23.572  -81.099  1.00 48.00  ?  497 ASP A OD2   1 
ATOM   3035  N  N     . PHE A  1 392 ? 98.534  24.924  -76.993  1.00 47.78  ?  498 PHE A N     1 
ATOM   3036  C  CA    . PHE A  1 392 ? 97.161  25.074  -76.495  1.00 47.15  ?  498 PHE A CA    1 
ATOM   3037  C  C     . PHE A  1 392 ? 97.098  25.784  -75.140  1.00 46.99  ?  498 PHE A C     1 
ATOM   3038  O  O     . PHE A  1 392 ? 97.998  25.638  -74.304  1.00 46.79  ?  498 PHE A O     1 
ATOM   3039  C  CB    . PHE A  1 392 ? 96.486  23.698  -76.382  1.00 46.86  ?  498 PHE A CB    1 
ATOM   3040  C  CG    . PHE A  1 392 ? 96.193  23.054  -77.715  1.00 46.32  ?  498 PHE A CG    1 
ATOM   3041  C  CD1   . PHE A  1 392 ? 95.113  23.482  -78.479  1.00 46.05  ?  498 PHE A CD1   1 
ATOM   3042  C  CD2   . PHE A  1 392 ? 96.986  22.021  -78.207  1.00 46.27  ?  498 PHE A CD2   1 
ATOM   3043  C  CE1   . PHE A  1 392 ? 94.830  22.901  -79.707  1.00 46.59  ?  498 PHE A CE1   1 
ATOM   3044  C  CE2   . PHE A  1 392 ? 96.709  21.437  -79.425  1.00 46.62  ?  498 PHE A CE2   1 
ATOM   3045  C  CZ    . PHE A  1 392 ? 95.627  21.870  -80.181  1.00 46.93  ?  498 PHE A CZ    1 
ATOM   3046  N  N     . ILE A  1 393 ? 96.025  26.559  -74.951  1.00 47.09  ?  499 ILE A N     1 
ATOM   3047  C  CA    . ILE A  1 393 ? 95.620  27.086  -73.640  1.00 47.46  ?  499 ILE A CA    1 
ATOM   3048  C  C     . ILE A  1 393 ? 94.222  26.595  -73.364  1.00 46.14  ?  499 ILE A C     1 
ATOM   3049  O  O     . ILE A  1 393 ? 93.338  26.747  -74.196  1.00 44.74  ?  499 ILE A O     1 
ATOM   3050  C  CB    . ILE A  1 393 ? 95.587  28.622  -73.605  1.00 47.94  ?  499 ILE A CB    1 
ATOM   3051  C  CG1   . ILE A  1 393 ? 97.002  29.168  -73.802  1.00 48.34  ?  499 ILE A CG1   1 
ATOM   3052  C  CG2   . ILE A  1 393 ? 95.000  29.128  -72.277  1.00 47.64  ?  499 ILE A CG2   1 
ATOM   3053  C  CD1   . ILE A  1 393 ? 97.054  30.622  -74.161  1.00 47.82  ?  499 ILE A CD1   1 
ATOM   3054  N  N     . VAL A  1 394 ? 94.038  26.019  -72.184  1.00 46.47  ?  500 VAL A N     1 
ATOM   3055  C  CA    . VAL A  1 394 ? 92.722  25.587  -71.734  1.00 47.51  ?  500 VAL A CA    1 
ATOM   3056  C  C     . VAL A  1 394 ? 92.420  26.407  -70.482  1.00 46.88  ?  500 VAL A C     1 
ATOM   3057  O  O     . VAL A  1 394 ? 93.205  26.436  -69.537  1.00 47.41  ?  500 VAL A O     1 
ATOM   3058  C  CB    . VAL A  1 394 ? 92.677  24.079  -71.461  1.00 48.94  ?  500 VAL A CB    1 
ATOM   3059  C  CG1   . VAL A  1 394 ? 91.277  23.659  -71.016  1.00 49.54  ?  500 VAL A CG1   1 
ATOM   3060  C  CG2   . VAL A  1 394 ? 93.044  23.329  -72.724  1.00 49.06  ?  500 VAL A CG2   1 
ATOM   3061  N  N     . ASP A  1 395 ? 91.268  27.070  -70.508  1.00 45.30  ?  501 ASP A N     1 
ATOM   3062  C  CA    . ASP A  1 395 ? 90.862  28.002  -69.481  1.00 44.31  ?  501 ASP A CA    1 
ATOM   3063  C  C     . ASP A  1 395 ? 89.598  27.421  -68.873  1.00 44.63  ?  501 ASP A C     1 
ATOM   3064  O  O     . ASP A  1 395 ? 88.585  27.315  -69.551  1.00 44.10  ?  501 ASP A O     1 
ATOM   3065  C  CB    . ASP A  1 395 ? 90.598  29.357  -70.171  1.00 43.52  ?  501 ASP A CB    1 
ATOM   3066  C  CG    . ASP A  1 395 ? 90.445  30.500  -69.207  1.00 42.79  ?  501 ASP A CG    1 
ATOM   3067  O  OD1   . ASP A  1 395 ? 90.998  30.428  -68.087  1.00 43.39  ?  501 ASP A OD1   1 
ATOM   3068  O  OD2   . ASP A  1 395 ? 89.817  31.489  -69.617  1.00 41.32  ?  501 ASP A OD2   1 
ATOM   3069  N  N     . VAL A  1 396 ? 89.667  26.993  -67.616  1.00 45.90  ?  502 VAL A N     1 
ATOM   3070  C  CA    . VAL A  1 396 ? 88.509  26.394  -66.946  1.00 46.12  ?  502 VAL A CA    1 
ATOM   3071  C  C     . VAL A  1 396 ? 87.918  27.457  -66.027  1.00 46.48  ?  502 VAL A C     1 
ATOM   3072  O  O     . VAL A  1 396 ? 88.642  28.115  -65.271  1.00 48.88  ?  502 VAL A O     1 
ATOM   3073  C  CB    . VAL A  1 396 ? 88.858  25.134  -66.146  1.00 45.96  ?  502 VAL A CB    1 
ATOM   3074  C  CG1   . VAL A  1 396 ? 87.617  24.568  -65.448  1.00 44.99  ?  502 VAL A CG1   1 
ATOM   3075  C  CG2   . VAL A  1 396 ? 89.437  24.089  -67.070  1.00 46.55  ?  502 VAL A CG2   1 
ATOM   3076  N  N     . ILE A  1 397 ? 86.590  27.586  -66.094  1.00 45.59  ?  503 ILE A N     1 
ATOM   3077  C  CA    . ILE A  1 397 ? 85.872  28.666  -65.428  1.00 45.73  ?  503 ILE A CA    1 
ATOM   3078  C  C     . ILE A  1 397 ? 84.693  28.069  -64.649  1.00 46.15  ?  503 ILE A C     1 
ATOM   3079  O  O     . ILE A  1 397 ? 83.853  27.385  -65.235  1.00 46.13  ?  503 ILE A O     1 
ATOM   3080  C  CB    . ILE A  1 397 ? 85.375  29.699  -66.445  1.00 44.68  ?  503 ILE A CB    1 
ATOM   3081  C  CG1   . ILE A  1 397 ? 86.567  30.424  -67.070  1.00 43.85  ?  503 ILE A CG1   1 
ATOM   3082  C  CG2   . ILE A  1 397 ? 84.442  30.709  -65.799  1.00 45.15  ?  503 ILE A CG2   1 
ATOM   3083  C  CD1   . ILE A  1 397 ? 86.248  31.132  -68.379  1.00 44.05  ?  503 ILE A CD1   1 
ATOM   3084  N  N     . ASN A  1 398 ? 84.637  28.376  -63.345  1.00 45.49  ?  504 ASN A N     1 
ATOM   3085  C  CA    . ASN A  1 398 ? 83.536  27.963  -62.507  1.00 45.79  ?  504 ASN A CA    1 
ATOM   3086  C  C     . ASN A  1 398 ? 82.510  29.065  -62.389  1.00 45.97  ?  504 ASN A C     1 
ATOM   3087  O  O     . ASN A  1 398 ? 82.769  30.107  -61.786  1.00 47.86  ?  504 ASN A O     1 
ATOM   3088  C  CB    . ASN A  1 398 ? 84.040  27.577  -61.115  1.00 46.50  ?  504 ASN A CB    1 
ATOM   3089  C  CG    . ASN A  1 398 ? 85.012  26.424  -61.144  1.00 46.93  ?  504 ASN A CG    1 
ATOM   3090  O  OD1   . ASN A  1 398 ? 84.780  25.419  -61.800  1.00 46.34  ?  504 ASN A OD1   1 
ATOM   3091  N  ND2   . ASN A  1 398 ? 86.072  26.571  -60.386  1.00 48.25  ?  504 ASN A ND2   1 
ATOM   3092  N  N     . MET A  1 399 ? 81.331  28.824  -62.977  1.00 45.70  ?  505 MET A N     1 
ATOM   3093  C  CA    . MET A  1 399 ? 80.189  29.726  -62.868  1.00 45.72  ?  505 MET A CA    1 
ATOM   3094  C  C     . MET A  1 399 ? 79.291  29.161  -61.772  1.00 46.00  ?  505 MET A C     1 
ATOM   3095  O  O     . MET A  1 399 ? 78.875  27.997  -61.847  1.00 48.26  ?  505 MET A O     1 
ATOM   3096  C  CB    . MET A  1 399 ? 79.425  29.751  -64.177  1.00 45.57  ?  505 MET A CB    1 
ATOM   3097  C  CG    . MET A  1 399 ? 80.281  30.043  -65.402  1.00 45.80  ?  505 MET A CG    1 
ATOM   3098  S  SD    . MET A  1 399 ? 80.874  31.743  -65.505  1.00 45.57  ?  505 MET A SD    1 
ATOM   3099  C  CE    . MET A  1 399 ? 79.395  32.460  -66.156  1.00 46.00  ?  505 MET A CE    1 
ATOM   3100  N  N     . ASP A  1 400 ? 79.005  29.962  -60.744  1.00 44.06  ?  506 ASP A N     1 
ATOM   3101  C  CA    . ASP A  1 400 ? 78.190  29.517  -59.627  1.00 42.67  ?  506 ASP A CA    1 
ATOM   3102  C  C     . ASP A  1 400 ? 77.343  30.659  -59.097  1.00 41.50  ?  506 ASP A C     1 
ATOM   3103  O  O     . ASP A  1 400 ? 77.381  31.785  -59.627  1.00 40.36  ?  506 ASP A O     1 
ATOM   3104  C  CB    . ASP A  1 400 ? 79.063  28.880  -58.514  1.00 42.92  ?  506 ASP A CB    1 
ATOM   3105  C  CG    . ASP A  1 400 ? 80.124  29.814  -57.951  1.00 43.12  ?  506 ASP A CG    1 
ATOM   3106  O  OD1   . ASP A  1 400 ? 80.050  31.038  -58.141  1.00 43.51  ?  506 ASP A OD1   1 
ATOM   3107  O  OD2   . ASP A  1 400 ? 81.038  29.314  -57.281  1.00 42.84  ?  506 ASP A OD2   1 
ATOM   3108  N  N     . TYR A  1 401 ? 76.565  30.345  -58.053  1.00 41.37  ?  507 TYR A N     1 
ATOM   3109  C  CA    . TYR A  1 401 ? 75.776  31.340  -57.340  1.00 41.73  ?  507 TYR A CA    1 
ATOM   3110  C  C     . TYR A  1 401 ? 76.490  31.776  -56.053  1.00 43.04  ?  507 TYR A C     1 
ATOM   3111  O  O     . TYR A  1 401 ? 75.866  32.140  -55.075  1.00 43.93  ?  507 TYR A O     1 
ATOM   3112  C  CB    . TYR A  1 401 ? 74.369  30.783  -57.097  1.00 41.08  ?  507 TYR A CB    1 
ATOM   3113  C  CG    . TYR A  1 401 ? 73.336  31.097  -58.177  1.00 40.12  ?  507 TYR A CG    1 
ATOM   3114  C  CD1   . TYR A  1 401 ? 73.685  31.188  -59.529  1.00 39.75  ?  507 TYR A CD1   1 
ATOM   3115  C  CD2   . TYR A  1 401 ? 71.998  31.307  -57.850  1.00 39.92  ?  507 TYR A CD2   1 
ATOM   3116  C  CE1   . TYR A  1 401 ? 72.730  31.477  -60.512  1.00 39.37  ?  507 TYR A CE1   1 
ATOM   3117  C  CE2   . TYR A  1 401 ? 71.044  31.594  -58.810  1.00 39.52  ?  507 TYR A CE2   1 
ATOM   3118  C  CZ    . TYR A  1 401 ? 71.422  31.683  -60.145  1.00 38.93  ?  507 TYR A CZ    1 
ATOM   3119  O  OH    . TYR A  1 401 ? 70.455  31.970  -61.073  1.00 38.30  ?  507 TYR A OH    1 
ATOM   3120  N  N     . GLY A  1 402 ? 77.820  31.812  -56.094  1.00 43.89  ?  508 GLY A N     1 
ATOM   3121  C  CA    . GLY A  1 402 ? 78.620  32.372  -55.019  1.00 44.88  ?  508 GLY A CA    1 
ATOM   3122  C  C     . GLY A  1 402 ? 78.895  31.475  -53.832  1.00 46.25  ?  508 GLY A C     1 
ATOM   3123  O  O     . GLY A  1 402 ? 79.582  31.878  -52.915  1.00 45.86  ?  508 GLY A O     1 
ATOM   3124  N  N     . MET A  1 403 ? 78.355  30.261  -53.847  1.00 48.83  ?  509 MET A N     1 
ATOM   3125  C  CA    . MET A  1 403 ? 78.576  29.285  -52.777  1.00 51.57  ?  509 MET A CA    1 
ATOM   3126  C  C     . MET A  1 403 ? 78.743  27.929  -53.415  1.00 54.61  ?  509 MET A C     1 
ATOM   3127  O  O     . MET A  1 403 ? 78.092  26.947  -53.033  1.00 56.90  ?  509 MET A O     1 
ATOM   3128  C  CB    . MET A  1 403 ? 77.393  29.268  -51.813  1.00 50.98  ?  509 MET A CB    1 
ATOM   3129  C  CG    . MET A  1 403 ? 77.211  30.561  -51.036  1.00 50.26  ?  509 MET A CG    1 
ATOM   3130  S  SD    . MET A  1 403 ? 75.880  30.455  -49.845  1.00 49.00  ?  509 MET A SD    1 
ATOM   3131  C  CE    . MET A  1 403 ? 76.530  29.323  -48.612  1.00 49.64  ?  509 MET A CE    1 
ATOM   3132  N  N     . GLN A  1 404 ? 79.668  27.876  -54.386  1.00 55.79  ?  510 GLN A N     1 
ATOM   3133  C  CA    . GLN A  1 404 ? 79.952  26.661  -55.113  1.00 56.12  ?  510 GLN A CA    1 
ATOM   3134  C  C     . GLN A  1 404 ? 78.622  25.996  -55.500  1.00 55.71  ?  510 GLN A C     1 
ATOM   3135  O  O     . GLN A  1 404 ? 77.769  26.656  -56.093  1.00 54.69  ?  510 GLN A O     1 
ATOM   3136  C  CB    . GLN A  1 404 ? 80.863  25.776  -54.276  1.00 58.21  ?  510 GLN A CB    1 
ATOM   3137  C  CG    . GLN A  1 404 ? 82.142  26.394  -53.816  1.00 60.08  ?  510 GLN A CG    1 
ATOM   3138  C  CD    . GLN A  1 404 ? 82.600  25.764  -52.490  1.00 63.21  ?  510 GLN A CD    1 
ATOM   3139  O  OE1   . GLN A  1 404 ? 81.860  25.766  -51.473  1.00 63.15  ?  510 GLN A OE1   1 
ATOM   3140  N  NE2   . GLN A  1 404 ? 83.838  25.239  -52.480  1.00 67.52  ?  510 GLN A NE2   1 
ATOM   3141  N  N     . GLU A  1 405 ? 78.395  24.761  -55.089  1.00 55.62  ?  511 GLU A N     1 
ATOM   3142  C  CA    . GLU A  1 405 ? 77.248  23.990  -55.535  1.00 55.70  ?  511 GLU A CA    1 
ATOM   3143  C  C     . GLU A  1 405 ? 75.957  24.322  -54.819  1.00 54.30  ?  511 GLU A C     1 
ATOM   3144  O  O     . GLU A  1 405 ? 74.899  23.846  -55.229  1.00 53.05  ?  511 GLU A O     1 
ATOM   3145  C  CB    . GLU A  1 405 ? 77.561  22.508  -55.387  1.00 58.03  ?  511 GLU A CB    1 
ATOM   3146  C  CG    . GLU A  1 405 ? 78.701  22.073  -56.276  1.00 60.95  ?  511 GLU A CG    1 
ATOM   3147  C  CD    . GLU A  1 405 ? 79.547  20.914  -55.714  1.00 64.32  ?  511 GLU A CD    1 
ATOM   3148  O  OE1   . GLU A  1 405 ? 79.518  20.667  -54.478  1.00 64.53  ?  511 GLU A OE1   1 
ATOM   3149  O  OE2   . GLU A  1 405 ? 80.278  20.369  -56.534  1.00 68.50  ?  511 GLU A OE2   1 
ATOM   3150  N  N     . LYS A  1 406 ? 76.029  25.146  -53.773  1.00 55.33  ?  512 LYS A N     1 
ATOM   3151  C  CA    . LYS A  1 406 ? 74.862  25.474  -52.947  1.00 57.58  ?  512 LYS A CA    1 
ATOM   3152  C  C     . LYS A  1 406 ? 74.000  26.595  -53.518  1.00 56.30  ?  512 LYS A C     1 
ATOM   3153  O  O     . LYS A  1 406 ? 74.484  27.462  -54.263  1.00 58.16  ?  512 LYS A O     1 
ATOM   3154  C  CB    . LYS A  1 406 ? 75.299  25.859  -51.531  1.00 59.97  ?  512 LYS A CB    1 
ATOM   3155  C  CG    . LYS A  1 406 ? 76.030  24.750  -50.788  1.00 62.44  ?  512 LYS A CG    1 
ATOM   3156  C  CD    . LYS A  1 406 ? 76.428  25.177  -49.384  1.00 64.43  ?  512 LYS A CD    1 
ATOM   3157  C  CE    . LYS A  1 406 ? 77.597  24.337  -48.895  1.00 66.29  ?  512 LYS A CE    1 
ATOM   3158  N  NZ    . LYS A  1 406 ? 77.876  24.596  -47.460  1.00 68.03  ?  512 LYS A NZ    1 
ATOM   3159  N  N     . ASN A  1 407 ? 72.719  26.546  -53.153  1.00 52.80  ?  513 ASN A N     1 
ATOM   3160  C  CA    . ASN A  1 407 ? 71.724  27.580  -53.443  1.00 49.21  ?  513 ASN A CA    1 
ATOM   3161  C  C     . ASN A  1 407 ? 71.852  28.589  -52.301  1.00 48.09  ?  513 ASN A C     1 
ATOM   3162  O  O     . ASN A  1 407 ? 71.545  28.248  -51.154  1.00 48.19  ?  513 ASN A O     1 
ATOM   3163  C  CB    . ASN A  1 407 ? 70.313  26.943  -53.456  1.00 47.90  ?  513 ASN A CB    1 
ATOM   3164  C  CG    . ASN A  1 407 ? 69.216  27.953  -53.643  1.00 47.02  ?  513 ASN A CG    1 
ATOM   3165  O  OD1   . ASN A  1 407 ? 69.423  29.126  -53.354  1.00 46.68  ?  513 ASN A OD1   1 
ATOM   3166  N  ND2   . ASN A  1 407 ? 68.080  27.570  -54.193  1.00 45.81  ?  513 ASN A ND2   1 
ATOM   3167  N  N     . PRO A  1 408 ? 72.288  29.823  -52.599  1.00 46.98  ?  514 PRO A N     1 
ATOM   3168  C  CA    . PRO A  1 408 ? 72.457  30.798  -51.526  1.00 47.47  ?  514 PRO A CA    1 
ATOM   3169  C  C     . PRO A  1 408 ? 71.150  31.256  -50.871  1.00 48.87  ?  514 PRO A C     1 
ATOM   3170  O  O     . PRO A  1 408 ? 71.167  31.683  -49.723  1.00 50.35  ?  514 PRO A O     1 
ATOM   3171  C  CB    . PRO A  1 408 ? 73.189  31.971  -52.202  1.00 46.64  ?  514 PRO A CB    1 
ATOM   3172  C  CG    . PRO A  1 408 ? 72.841  31.861  -53.635  1.00 46.01  ?  514 PRO A CG    1 
ATOM   3173  C  CD    . PRO A  1 408 ? 72.600  30.397  -53.915  1.00 46.50  ?  514 PRO A CD    1 
ATOM   3174  N  N     . ILE A  1 409 ? 70.033  31.125  -51.581  1.00 49.65  ?  515 ILE A N     1 
ATOM   3175  C  CA    . ILE A  1 409 ? 68.716  31.486  -51.038  1.00 49.80  ?  515 ILE A CA    1 
ATOM   3176  C  C     . ILE A  1 409 ? 68.293  30.561  -49.898  1.00 50.10  ?  515 ILE A C     1 
ATOM   3177  O  O     . ILE A  1 409 ? 67.572  30.990  -48.997  1.00 52.60  ?  515 ILE A O     1 
ATOM   3178  C  CB    . ILE A  1 409 ? 67.630  31.503  -52.146  1.00 49.65  ?  515 ILE A CB    1 
ATOM   3179  C  CG1   . ILE A  1 409 ? 68.037  32.468  -53.288  1.00 49.40  ?  515 ILE A CG1   1 
ATOM   3180  C  CG2   . ILE A  1 409 ? 66.272  31.889  -51.584  1.00 49