data_6U17
# 
_entry.id   6U17 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6U17         
WWPDB D_1000243696 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6U17 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Pidugu, L.S.'  1 ? 
'Pozharski, E.' 2 ? 
'Drohat, A.C.'  3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_id_ASTM           JACSAT 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1520-5126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            141 
_citation.language                  ? 
_citation.page_first                18851 
_citation.page_last                 18861 
_citation.title                     'Excision of 5-Carboxylcytosine by Thymine DNA Glycosylase.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/jacs.9b10376 
_citation.pdbx_database_id_PubMed   31693361 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pidugu, L.S.'  1 ? 
primary 'Dai, Q.'       2 ? 
primary 'Malik, S.S.'   3 ? 
primary 'Pozharski, E.' 4 ? 
primary 'Drohat, A.C.'  5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.250 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6U17 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     96.870 
_cell.length_a_esd                 ? 
_cell.length_b                     52.760 
_cell.length_b_esd                 ? 
_cell.length_c                     81.620 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6U17 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'G/T mismatch-specific thymine DNA glycosylase' 25875.010 1   3.2.2.29 ? ? ? 
2 polymer     syn 'DNA (28-MER)'                                  8646.565  1   ?        ? ? ? 
3 polymer     syn 'DNA (30-MER)'                                  8628.518  1   ?        ? ? ? 
4 non-polymer syn 'ACETATE ION'                                   59.044    1   ?        ? ? ? 
5 water       nat water                                           18.015    308 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Thymine-DNA glycosylase,hTDG' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no yes 
;SKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWK
CLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKE
VFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSAR(CSO)AQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
;SKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWK
CLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKE
VFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
A ? 
2 polydeoxyribonucleotide no no  
;(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DA)(DG)(DC)(DG)(DA)(DT)
(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DT)
;
CAGCTCTGTACGTGAGCGATGGACAGCT C ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DA)(DT)(DC)(DG)(DC)(DT)(DC)(DA)(1FC)(DG)(DT)
(DA)(DC)(DA)(DG)(DA)(DG)(DC)(DT)(DG)
;
AGCTGTCCATCGCTCAXGTACAGAGCTG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   LYS n 
1 4   SER n 
1 5   GLY n 
1 6   LYS n 
1 7   SER n 
1 8   ALA n 
1 9   LYS n 
1 10  SER n 
1 11  LYS n 
1 12  GLU n 
1 13  LYS n 
1 14  GLN n 
1 15  GLU n 
1 16  LYS n 
1 17  ILE n 
1 18  THR n 
1 19  ASP n 
1 20  THR n 
1 21  PHE n 
1 22  LYS n 
1 23  VAL n 
1 24  LYS n 
1 25  ARG n 
1 26  LYS n 
1 27  VAL n 
1 28  ASP n 
1 29  ARG n 
1 30  PHE n 
1 31  ASN n 
1 32  GLY n 
1 33  VAL n 
1 34  SER n 
1 35  GLU n 
1 36  ALA n 
1 37  GLU n 
1 38  LEU n 
1 39  LEU n 
1 40  THR n 
1 41  LYS n 
1 42  THR n 
1 43  LEU n 
1 44  PRO n 
1 45  ASP n 
1 46  ILE n 
1 47  LEU n 
1 48  THR n 
1 49  PHE n 
1 50  ASN n 
1 51  LEU n 
1 52  ASP n 
1 53  ILE n 
1 54  VAL n 
1 55  ILE n 
1 56  ILE n 
1 57  GLY n 
1 58  ILE n 
1 59  ASN n 
1 60  PRO n 
1 61  GLY n 
1 62  LEU n 
1 63  MET n 
1 64  ALA n 
1 65  ALA n 
1 66  TYR n 
1 67  LYS n 
1 68  GLY n 
1 69  HIS n 
1 70  HIS n 
1 71  TYR n 
1 72  PRO n 
1 73  GLY n 
1 74  PRO n 
1 75  GLY n 
1 76  ASN n 
1 77  HIS n 
1 78  PHE n 
1 79  TRP n 
1 80  LYS n 
1 81  CYS n 
1 82  LEU n 
1 83  PHE n 
1 84  MET n 
1 85  SER n 
1 86  GLY n 
1 87  LEU n 
1 88  SER n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  ASN n 
1 94  HIS n 
1 95  MET n 
1 96  ASP n 
1 97  ASP n 
1 98  HIS n 
1 99  THR n 
1 100 LEU n 
1 101 PRO n 
1 102 GLY n 
1 103 LYS n 
1 104 TYR n 
1 105 GLY n 
1 106 ILE n 
1 107 GLY n 
1 108 PHE n 
1 109 THR n 
1 110 ASN n 
1 111 MET n 
1 112 VAL n 
1 113 GLU n 
1 114 ARG n 
1 115 THR n 
1 116 THR n 
1 117 PRO n 
1 118 GLY n 
1 119 SER n 
1 120 LYS n 
1 121 ASP n 
1 122 LEU n 
1 123 SER n 
1 124 SER n 
1 125 LYS n 
1 126 GLU n 
1 127 PHE n 
1 128 ARG n 
1 129 GLU n 
1 130 GLY n 
1 131 GLY n 
1 132 ARG n 
1 133 ILE n 
1 134 LEU n 
1 135 VAL n 
1 136 GLN n 
1 137 LYS n 
1 138 LEU n 
1 139 GLN n 
1 140 LYS n 
1 141 TYR n 
1 142 GLN n 
1 143 PRO n 
1 144 ARG n 
1 145 ILE n 
1 146 ALA n 
1 147 VAL n 
1 148 PHE n 
1 149 ASN n 
1 150 GLY n 
1 151 LYS n 
1 152 CYS n 
1 153 ILE n 
1 154 TYR n 
1 155 GLU n 
1 156 ILE n 
1 157 PHE n 
1 158 SER n 
1 159 LYS n 
1 160 GLU n 
1 161 VAL n 
1 162 PHE n 
1 163 GLY n 
1 164 VAL n 
1 165 LYS n 
1 166 VAL n 
1 167 LYS n 
1 168 ASN n 
1 169 LEU n 
1 170 GLU n 
1 171 PHE n 
1 172 GLY n 
1 173 LEU n 
1 174 GLN n 
1 175 PRO n 
1 176 HIS n 
1 177 LYS n 
1 178 ILE n 
1 179 PRO n 
1 180 ASP n 
1 181 THR n 
1 182 GLU n 
1 183 THR n 
1 184 LEU n 
1 185 CYS n 
1 186 TYR n 
1 187 VAL n 
1 188 MET n 
1 189 PRO n 
1 190 SER n 
1 191 SER n 
1 192 SER n 
1 193 ALA n 
1 194 ARG n 
1 195 CSO y 
1 195 CYS y 
1 196 ALA n 
1 197 GLN n 
1 198 PHE n 
1 199 PRO n 
1 200 ARG n 
1 201 ALA n 
1 202 GLN n 
1 203 ASP n 
1 204 LYS n 
1 205 VAL n 
1 206 HIS n 
1 207 TYR n 
1 208 TYR n 
1 209 ILE n 
1 210 LYS n 
1 211 LEU n 
1 212 LYS n 
1 213 ASP n 
1 214 LEU n 
1 215 ARG n 
1 216 ASP n 
1 217 GLN n 
1 218 LEU n 
1 219 LYS n 
1 220 GLY n 
1 221 ILE n 
1 222 GLU n 
1 223 ARG n 
1 224 ASN n 
1 225 MET n 
1 226 ASP n 
1 227 VAL n 
2 1   DC  n 
2 2   DA  n 
2 3   DG  n 
2 4   DC  n 
2 5   DT  n 
2 6   DC  n 
2 7   DT  n 
2 8   DG  n 
2 9   DT  n 
2 10  DA  n 
2 11  DC  n 
2 12  DG  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
2 19  DA  n 
2 20  DT  n 
2 21  DG  n 
2 22  DG  n 
2 23  DA  n 
2 24  DC  n 
2 25  DA  n 
2 26  DG  n 
2 27  DC  n 
2 28  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DT  n 
3 5   DG  n 
3 6   DT  n 
3 7   DC  n 
3 8   DC  n 
3 9   DA  n 
3 10  DT  n 
3 11  DC  n 
3 12  DG  n 
3 13  DC  n 
3 14  DT  n 
3 15  DC  n 
3 16  DA  n 
3 17  1FC n 
3 18  DG  n 
3 19  DT  n 
3 20  DA  n 
3 21  DC  n 
3 22  DA  n 
3 23  DG  n 
3 24  DA  n 
3 25  DG  n 
3 26  DC  n 
3 27  DT  n 
3 28  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   227 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TDG 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 28 'synthetic construct' ? 32630 ? 
3 1 sample 1 28 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TDG_HUMAN Q13569 ? 1 
;SKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWK
CLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKE
VFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
82 
2 PDB 6U17      6U17   ? 2 ? 1  
3 PDB 6U17      6U17   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6U17 A 1 ? 227 ? Q13569 82 ? 308 ? 82 308 
2 2 6U17 C 1 ? 28  ? 6U17   1  ? 28  ? 1  28  
3 3 6U17 D 1 ? 28  ? 6U17   1  ? 28  ? 1  28  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1FC 'DNA linking'       n 
'4-amino-1-(2-deoxy-2-fluoro-5-O-phosphono-beta-D-arabinofuranosyl)-2-oxo-1,2-dihydropyrimidine-5-carboxylic acid' ? 
'C10 H13 F N3 O9 P' 369.197 
ACT non-polymer         . 'ACETATE ION' ? 'C2 H3 O2 -1'       59.044  
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S'      137.158 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6U17 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.72 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG3350, sodium Acetate, Ammonium acetate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-11-26 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97946 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97946 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            25.290 
_reflns.entry_id                         6U17 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.550 
_reflns.d_resolution_low                 81.270 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       56857 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.500 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  21.700 
_reflns.pdbx_Rmerge_I_obs                0.145 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.400 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             4406 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.148 
_reflns.pdbx_Rpim_I_all                  0.030 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         1235432 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.550 1.580  ? ? 43681 ? ? ? 2528 86.700 ? ? ? ? 5.336 ? ? ? ? ? ? ? ? 17.300 ? ? ? 0.800  5.499 1.280 ? 1 1 0.343 ? 
8.490 81.270 ? ? 10475 ? ? ? 399  99.600 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 26.300 ? ? ? 37.100 0.069 0.013 ? 2 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            0.1010 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            5.5691 
_refine.aniso_B[2][2]                            0.1366 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -0.2376 
_refine.B_iso_max                                126.830 
_refine.B_iso_mean                               51.8400 
_refine.B_iso_min                                25.780 
_refine.correlation_coeff_Fo_to_Fc               0.9640 
_refine.correlation_coeff_Fo_to_Fc_free          0.9550 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6U17 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.5500 
_refine.ls_d_res_low                             43.2500 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     56810 
_refine.ls_number_reflns_R_free                  2789 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.1000 
_refine.ls_percent_reflns_R_free                 4.9100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1910 
_refine.ls_R_factor_R_free                       0.2240 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1890 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5T2W 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.0800 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.0840 
_refine.pdbx_overall_SU_R_Blow_DPI               0.0810 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.0760 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6U17 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.290 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.5500 
_refine_hist.d_res_low                        43.2500 
_refine_hist.number_atoms_solvent             309 
_refine_hist.number_atoms_total               2986 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       253 
_refine_hist.pdbx_B_iso_mean_ligand           57.47 
_refine_hist.pdbx_B_iso_mean_solvent          60.66 
_refine_hist.pdbx_number_atoms_protein        1527 
_refine_hist.pdbx_number_atoms_nucleic_acid   1146 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? ?      ? 823  ? t_dihedral_angle_d        2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_trig_c_planes           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 325  ? t_gen_planes              5.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 2870 ? t_it                      20.000 HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_nbd                     ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_improper_torsion        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_pseud_angle             ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 373  ? t_chiral_improper_torsion 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? 3    ? t_sum_occupancies         1.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_distance        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_angle           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_torsion         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 3196 ? t_ideal_dist_contact      4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 0.010  ? 2873 ? t_bond_d                  2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 0.980  ? 4132 ? t_angle_deg               2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 3.380  ? ?    ? t_omega_torsion           ?      ?            
'X-RAY DIFFRACTION' ? 20.740 ? ?    ? t_other_torsion           ?      ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.5500 
_refine_ls_shell.d_res_low                        1.5600 
_refine_ls_shell.number_reflns_all                1137 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.number_reflns_R_work             1076 
_refine_ls_shell.percent_reflns_obs               82.1700 
_refine_ls_shell.percent_reflns_R_free            5.3600 
_refine_ls_shell.R_factor_all                     0.2501 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2744 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2488 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6U17 
_struct.title                        
;Human thymine DNA glycosylase bound to DNA with 2'-F-5-carboxyl-dC substrate analog
;
_struct.pdbx_descriptor              'G/T mismatch-specific thymine DNA glycosylase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6U17 
_struct_keywords.text            'protein-DNA complex, HYDROLASE-DNA complex, DNA BINDING PROTEIN, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 34  ? THR A 40  ? SER A 115 THR A 121 1 ? 7  
HELX_P HELX_P2  AA2 GLY A 61  ? GLY A 68  ? GLY A 142 GLY A 149 1 ? 8  
HELX_P HELX_P3  AA3 HIS A 77  ? SER A 85  ? HIS A 158 SER A 166 1 ? 9  
HELX_P HELX_P4  AA4 ASN A 93  ? HIS A 98  ? ASN A 174 HIS A 179 5 ? 6  
HELX_P HELX_P5  AA5 THR A 99  ? GLY A 105 ? THR A 180 GLY A 186 1 ? 7  
HELX_P HELX_P6  AA6 GLY A 118 ? LEU A 122 ? GLY A 199 LEU A 203 5 ? 5  
HELX_P HELX_P7  AA7 SER A 123 ? GLN A 142 ? SER A 204 GLN A 223 1 ? 20 
HELX_P HELX_P8  AA8 GLY A 150 ? PHE A 162 ? GLY A 231 PHE A 243 1 ? 13 
HELX_P HELX_P9  AA9 ARG A 200 ? ASP A 203 ? ARG A 281 ASP A 284 5 ? 4  
HELX_P HELX_P10 AB1 LYS A 204 ? GLU A 222 ? LYS A 285 GLU A 303 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A ARG 194 C     ? ? ? 1_555 A CSO 195 N  A ? A ARG 275 A CSO 276 1_555 ? ? ? ? ? ? ?            1.362 ? 
covale2  covale both ? A CSO 195 C     A ? ? 1_555 A ALA 196 N  ? ? A CSO 276 A ALA 277 1_555 ? ? ? ? ? ? ?            1.319 ? 
covale3  covale both ? C DA  16  "O3'" ? ? ? 1_555 C 1FC 17  P  ? ? D DA  16  D 1FC 17  1_555 ? ? ? ? ? ? ?            1.578 ? 
covale4  covale one  ? C 1FC 17  "O3'" ? ? ? 1_555 C DG  18  P  ? ? D 1FC 17  D DG  18  1_555 ? ? ? ? ? ? ?            1.605 ? 
hydrog1  hydrog ?    ? B DC  1   N3    ? ? ? 1_555 C DG  28  N1 ? ? C DC  1   D DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DC  1   N4    ? ? ? 1_555 C DG  28  O6 ? ? C DC  1   D DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DC  1   O2    ? ? ? 1_555 C DG  28  N2 ? ? C DC  1   D DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DA  2   N1    ? ? ? 1_555 C DT  27  N3 ? ? C DA  2   D DT  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DA  2   N6    ? ? ? 1_555 C DT  27  O4 ? ? C DA  2   D DT  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  3   N1    ? ? ? 1_555 C DC  26  N3 ? ? C DG  3   D DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  3   N2    ? ? ? 1_555 C DC  26  O2 ? ? C DG  3   D DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DG  3   O6    ? ? ? 1_555 C DC  26  N4 ? ? C DG  3   D DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DC  4   N3    ? ? ? 1_555 C DG  25  N1 ? ? C DC  4   D DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DC  4   N4    ? ? ? 1_555 C DG  25  O6 ? ? C DC  4   D DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DC  4   O2    ? ? ? 1_555 C DG  25  N2 ? ? C DC  4   D DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DT  5   N3    ? ? ? 1_555 C DA  24  N1 ? ? C DT  5   D DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DT  5   O4    ? ? ? 1_555 C DA  24  N6 ? ? C DT  5   D DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DC  6   N3    ? ? ? 1_555 C DG  23  N1 ? ? C DC  6   D DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DC  6   N4    ? ? ? 1_555 C DG  23  O6 ? ? C DC  6   D DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DC  6   O2    ? ? ? 1_555 C DG  23  N2 ? ? C DC  6   D DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DT  7   N3    ? ? ? 1_555 C DA  22  N1 ? ? C DT  7   D DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DT  7   O4    ? ? ? 1_555 C DA  22  N6 ? ? C DT  7   D DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DG  8   N1    ? ? ? 1_555 C DC  21  N3 ? ? C DG  8   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DG  8   N2    ? ? ? 1_555 C DC  21  O2 ? ? C DG  8   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DG  8   O6    ? ? ? 1_555 C DC  21  N4 ? ? C DG  8   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DT  9   N3    ? ? ? 1_555 C DA  20  N1 ? ? C DT  9   D DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DT  9   O4    ? ? ? 1_555 C DA  20  N6 ? ? C DT  9   D DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DA  10  N1    ? ? ? 1_555 C DT  19  N3 ? ? C DA  10  D DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DA  10  N6    ? ? ? 1_555 C DT  19  O4 ? ? C DA  10  D DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DC  11  N3    ? ? ? 1_555 C DG  18  N1 ? ? C DC  11  D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DC  11  N4    ? ? ? 1_555 C DG  18  O6 ? ? C DC  11  D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DC  11  O2    ? ? ? 1_555 C DG  18  N2 ? ? C DC  11  D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DT  13  N3    ? ? ? 1_555 C DA  16  N1 ? ? C DT  13  D DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? B DT  13  O4    ? ? ? 1_555 C DA  16  N6 ? ? C DT  13  D DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? B DG  14  N1    ? ? ? 1_555 C DC  15  N3 ? ? C DG  14  D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? B DG  14  N2    ? ? ? 1_555 C DC  15  O2 ? ? C DG  14  D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? B DG  14  O6    ? ? ? 1_555 C DC  15  N4 ? ? C DG  14  D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? B DA  15  N1    ? ? ? 1_555 C DT  14  N3 ? ? C DA  15  D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? B DA  15  N6    ? ? ? 1_555 C DT  14  O4 ? ? C DA  15  D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? B DG  16  N1    ? ? ? 1_555 C DC  13  N3 ? ? C DG  16  D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? B DG  16  N2    ? ? ? 1_555 C DC  13  O2 ? ? C DG  16  D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? B DG  16  O6    ? ? ? 1_555 C DC  13  N4 ? ? C DG  16  D DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? B DC  17  N3    ? ? ? 1_555 C DG  12  N1 ? ? C DC  17  D DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? B DC  17  N4    ? ? ? 1_555 C DG  12  O6 ? ? C DC  17  D DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? B DC  17  O2    ? ? ? 1_555 C DG  12  N2 ? ? C DC  17  D DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? B DG  18  N1    ? ? ? 1_555 C DC  11  N3 ? ? C DG  18  D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? B DG  18  N2    ? ? ? 1_555 C DC  11  O2 ? ? C DG  18  D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? B DG  18  O6    ? ? ? 1_555 C DC  11  N4 ? ? C DG  18  D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? B DA  19  N1    ? ? ? 1_555 C DT  10  N3 ? ? C DA  19  D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? B DA  19  N6    ? ? ? 1_555 C DT  10  O4 ? ? C DA  19  D DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? B DT  20  N3    ? ? ? 1_555 C DA  9   N1 ? ? C DT  20  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? B DT  20  O4    ? ? ? 1_555 C DA  9   N6 ? ? C DT  20  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? B DG  21  N1    ? ? ? 1_555 C DC  8   N3 ? ? C DG  21  D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? B DG  21  N2    ? ? ? 1_555 C DC  8   O2 ? ? C DG  21  D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? B DG  21  O6    ? ? ? 1_555 C DC  8   N4 ? ? C DG  21  D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? B DG  22  N1    ? ? ? 1_555 C DC  7   N3 ? ? C DG  22  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? B DG  22  N2    ? ? ? 1_555 C DC  7   O2 ? ? C DG  22  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? B DG  22  O6    ? ? ? 1_555 C DC  7   N4 ? ? C DG  22  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? B DA  23  N1    ? ? ? 1_555 C DT  6   N3 ? ? C DA  23  D DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ?    ? B DA  23  N6    ? ? ? 1_555 C DT  6   O4 ? ? C DA  23  D DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ?    ? B DC  24  N3    ? ? ? 1_555 C DG  5   N1 ? ? C DC  24  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ?    ? B DC  24  N4    ? ? ? 1_555 C DG  5   O6 ? ? C DC  24  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ?    ? B DC  24  O2    ? ? ? 1_555 C DG  5   N2 ? ? C DC  24  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ?    ? B DA  25  N1    ? ? ? 1_555 C DT  4   N3 ? ? C DA  25  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ?    ? B DA  25  N6    ? ? ? 1_555 C DT  4   O4 ? ? C DA  25  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ?    ? B DG  26  N1    ? ? ? 1_555 C DC  3   N3 ? ? C DG  26  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ?    ? B DG  26  N2    ? ? ? 1_555 C DC  3   O2 ? ? C DG  26  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ?    ? B DG  26  O6    ? ? ? 1_555 C DC  3   N4 ? ? C DG  26  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ?    ? B DC  27  N3    ? ? ? 1_555 C DG  2   N1 ? ? C DC  27  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ?    ? B DC  27  N4    ? ? ? 1_555 C DG  2   O6 ? ? C DC  27  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ?    ? B DC  27  O2    ? ? ? 1_555 C DG  2   N2 ? ? C DC  27  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ?    ? B DT  28  N3    ? ? ? 1_555 C DA  1   N1 ? ? C DT  28  D DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ?    ? B DT  28  O4    ? ? ? 1_555 C DA  1   N6 ? ? C DT  28  D DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 106 ? ASN A 110 ? ILE A 187 ASN A 191 
AA1 2 ILE A 53  ? GLY A 57  ? ILE A 134 GLY A 138 
AA1 3 ILE A 145 ? ASN A 149 ? ILE A 226 ASN A 230 
AA1 4 LEU A 184 ? MET A 188 ? LEU A 265 MET A 269 
AA1 5 GLY A 172 ? LEU A 173 ? GLY A 253 LEU A 254 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 107 ? O GLY A 188 N ILE A 55  ? N ILE A 136 
AA1 2 3 N ILE A 56  ? N ILE A 137 O VAL A 147 ? O VAL A 228 
AA1 3 4 N ALA A 146 ? N ALA A 227 O LEU A 184 ? O LEU A 265 
AA1 4 5 O VAL A 187 ? O VAL A 268 N GLY A 172 ? N GLY A 253 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ACT 
_struct_site.pdbx_auth_seq_id     401 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue ACT A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 ARG A 29  ? ARG A 110 . ? 1_555 ? 
2 AC1 5 PHE A 30  ? PHE A 111 . ? 1_555 ? 
3 AC1 5 TYR A 66  ? TYR A 147 . ? 1_555 ? 
4 AC1 5 ARG A 200 ? ARG A 281 . ? 4_546 ? 
5 AC1 5 DG  B 14  ? DG  C 14  . ? 4_546 ? 
# 
_atom_sites.entry_id                    6U17 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010323 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000949 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018954 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012304 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 26  ? 39.495  -11.104 39.607 1.00 66.95  ? 107 LYS A N     1 
ATOM   2    C CA    . LYS A 1 26  ? 38.308  -11.146 38.751 1.00 66.19  ? 107 LYS A CA    1 
ATOM   3    C C     . LYS A 1 26  ? 37.032  -10.810 39.530 1.00 67.69  ? 107 LYS A C     1 
ATOM   4    O O     . LYS A 1 26  ? 36.879  -11.217 40.688 1.00 67.73  ? 107 LYS A O     1 
ATOM   5    C CB    . LYS A 1 26  ? 38.178  -12.518 38.072 1.00 68.79  ? 107 LYS A CB    1 
ATOM   6    N N     . VAL A 1 27  ? 36.126  -10.048 38.893 1.00 61.53  ? 108 VAL A N     1 
ATOM   7    C CA    . VAL A 1 27  ? 34.842  -9.658  39.479 1.00 59.61  ? 108 VAL A CA    1 
ATOM   8    C C     . VAL A 1 27  ? 33.745  -10.584 38.935 1.00 59.65  ? 108 VAL A C     1 
ATOM   9    O O     . VAL A 1 27  ? 33.523  -10.644 37.724 1.00 59.35  ? 108 VAL A O     1 
ATOM   10   C CB    . VAL A 1 27  ? 34.528  -8.146  39.295 1.00 63.19  ? 108 VAL A CB    1 
ATOM   11   C CG1   . VAL A 1 27  ? 33.094  -7.818  39.714 1.00 62.93  ? 108 VAL A CG1   1 
ATOM   12   C CG2   . VAL A 1 27  ? 35.524  -7.283  40.072 1.00 62.85  ? 108 VAL A CG2   1 
ATOM   13   N N     . ASP A 1 28  ? 33.094  -11.320 39.844 1.00 52.96  ? 109 ASP A N     1 
ATOM   14   C CA    . ASP A 1 28  ? 32.028  -12.272 39.556 1.00 50.40  ? 109 ASP A CA    1 
ATOM   15   C C     . ASP A 1 28  ? 30.679  -11.586 39.750 1.00 47.31  ? 109 ASP A C     1 
ATOM   16   O O     . ASP A 1 28  ? 30.277  -11.295 40.881 1.00 46.94  ? 109 ASP A O     1 
ATOM   17   C CB    . ASP A 1 28  ? 32.167  -13.493 40.487 1.00 53.03  ? 109 ASP A CB    1 
ATOM   18   C CG    . ASP A 1 28  ? 31.330  -14.684 40.069 1.00 69.46  ? 109 ASP A CG    1 
ATOM   19   O OD1   . ASP A 1 28  ? 31.725  -15.378 39.107 1.00 71.03  ? 109 ASP A OD1   1 
ATOM   20   O OD2   . ASP A 1 28  ? 30.293  -14.935 40.717 1.00 78.31  ? 109 ASP A OD2   1 
ATOM   21   N N     . ARG A 1 29  ? 30.006  -11.277 38.641 1.00 39.29  ? 110 ARG A N     1 
ATOM   22   C CA    . ARG A 1 29  ? 28.710  -10.603 38.655 1.00 37.28  ? 110 ARG A CA    1 
ATOM   23   C C     . ARG A 1 29  ? 27.581  -11.614 38.402 1.00 38.83  ? 110 ARG A C     1 
ATOM   24   O O     . ARG A 1 29  ? 26.413  -11.234 38.464 1.00 38.59  ? 110 ARG A O     1 
ATOM   25   C CB    . ARG A 1 29  ? 28.686  -9.510  37.541 1.00 39.13  ? 110 ARG A CB    1 
ATOM   26   C CG    . ARG A 1 29  ? 29.577  -8.294  37.827 1.00 45.37  ? 110 ARG A CG    1 
ATOM   27   C CD    . ARG A 1 29  ? 29.981  -7.552  36.537 1.00 58.09  ? 110 ARG A CD    1 
ATOM   28   N NE    . ARG A 1 29  ? 28.874  -7.384  35.584 1.00 65.44  ? 110 ARG A NE    1 
ATOM   29   C CZ    . ARG A 1 29  ? 28.971  -7.555  34.266 1.00 78.59  ? 110 ARG A CZ    1 
ATOM   30   N NH1   . ARG A 1 29  ? 30.128  -7.906  33.715 1.00 65.15  ? 110 ARG A NH1   1 
ATOM   31   N NH2   . ARG A 1 29  ? 27.910  -7.384  33.489 1.00 63.78  ? 110 ARG A NH2   1 
ATOM   32   N N     . PHE A 1 30  ? 27.917  -12.901 38.125 1.00 33.71  ? 111 PHE A N     1 
ATOM   33   C CA    . PHE A 1 30  ? 26.905  -13.892 37.757 1.00 32.52  ? 111 PHE A CA    1 
ATOM   34   C C     . PHE A 1 30  ? 26.938  -15.202 38.553 1.00 36.64  ? 111 PHE A C     1 
ATOM   35   O O     . PHE A 1 30  ? 26.705  -16.304 38.019 1.00 34.82  ? 111 PHE A O     1 
ATOM   36   C CB    . PHE A 1 30  ? 26.945  -14.174 36.266 1.00 33.30  ? 111 PHE A CB    1 
ATOM   37   C CG    . PHE A 1 30  ? 26.776  -12.906 35.448 1.00 33.75  ? 111 PHE A CG    1 
ATOM   38   C CD1   . PHE A 1 30  ? 25.534  -12.280 35.348 1.00 35.31  ? 111 PHE A CD1   1 
ATOM   39   C CD2   . PHE A 1 30  ? 27.876  -12.288 34.860 1.00 36.12  ? 111 PHE A CD2   1 
ATOM   40   C CE1   . PHE A 1 30  ? 25.375  -11.122 34.561 1.00 36.04  ? 111 PHE A CE1   1 
ATOM   41   C CE2   . PHE A 1 30  ? 27.721  -11.112 34.107 1.00 38.59  ? 111 PHE A CE2   1 
ATOM   42   C CZ    . PHE A 1 30  ? 26.479  -10.518 33.999 1.00 35.72  ? 111 PHE A CZ    1 
ATOM   43   N N     . ASN A 1 31  ? 27.194  -15.055 39.845 1.00 35.26  ? 112 ASN A N     1 
ATOM   44   C CA    . ASN A 1 31  ? 27.107  -16.179 40.772 1.00 36.23  ? 112 ASN A CA    1 
ATOM   45   C C     . ASN A 1 31  ? 27.824  -17.445 40.243 1.00 40.21  ? 112 ASN A C     1 
ATOM   46   O O     . ASN A 1 31  ? 27.247  -18.532 40.176 1.00 41.39  ? 112 ASN A O     1 
ATOM   47   C CB    . ASN A 1 31  ? 25.599  -16.413 41.041 1.00 35.25  ? 112 ASN A CB    1 
ATOM   48   C CG    . ASN A 1 31  ? 25.316  -17.334 42.196 1.00 42.89  ? 112 ASN A CG    1 
ATOM   49   O OD1   . ASN A 1 31  ? 26.140  -17.501 43.099 1.00 35.85  ? 112 ASN A OD1   1 
ATOM   50   N ND2   . ASN A 1 31  ? 24.156  -17.957 42.157 1.00 36.50  ? 112 ASN A ND2   1 
ATOM   51   N N     . GLY A 1 32  ? 29.053  -17.263 39.773 1.00 39.54  ? 113 GLY A N     1 
ATOM   52   C CA    . GLY A 1 32  ? 29.874  -18.348 39.236 1.00 40.69  ? 113 GLY A CA    1 
ATOM   53   C C     . GLY A 1 32  ? 29.562  -18.893 37.858 1.00 45.36  ? 113 GLY A C     1 
ATOM   54   O O     . GLY A 1 32  ? 30.173  -19.881 37.444 1.00 46.42  ? 113 GLY A O     1 
ATOM   55   N N     . VAL A 1 33  ? 28.613  -18.280 37.125 1.00 41.92  ? 114 VAL A N     1 
ATOM   56   C CA    . VAL A 1 33  ? 28.291  -18.687 35.761 1.00 41.25  ? 114 VAL A CA    1 
ATOM   57   C C     . VAL A 1 33  ? 29.206  -17.834 34.870 1.00 42.63  ? 114 VAL A C     1 
ATOM   58   O O     . VAL A 1 33  ? 29.260  -16.618 35.065 1.00 40.49  ? 114 VAL A O     1 
ATOM   59   C CB    . VAL A 1 33  ? 26.782  -18.489 35.434 1.00 44.65  ? 114 VAL A CB    1 
ATOM   60   C CG1   . VAL A 1 33  ? 26.466  -18.835 33.970 1.00 44.27  ? 114 VAL A CG1   1 
ATOM   61   C CG2   . VAL A 1 33  ? 25.913  -19.310 36.379 1.00 44.04  ? 114 VAL A CG2   1 
ATOM   62   N N     . SER A 1 34  ? 29.959  -18.460 33.942 1.00 41.57  ? 115 SER A N     1 
ATOM   63   C CA    . SER A 1 34  ? 30.866  -17.714 33.049 1.00 41.72  ? 115 SER A CA    1 
ATOM   64   C C     . SER A 1 34  ? 30.111  -16.843 32.037 1.00 45.97  ? 115 SER A C     1 
ATOM   65   O O     . SER A 1 34  ? 29.000  -17.192 31.630 1.00 45.87  ? 115 SER A O     1 
ATOM   66   C CB    . SER A 1 34  ? 31.810  -18.663 32.308 1.00 44.88  ? 115 SER A CB    1 
ATOM   67   O OG    . SER A 1 34  ? 31.163  -19.360 31.255 1.00 47.79  ? 115 SER A OG    1 
ATOM   68   N N     . GLU A 1 35  ? 30.742  -15.737 31.596 1.00 42.83  ? 116 GLU A N     1 
ATOM   69   C CA    . GLU A 1 35  ? 30.192  -14.849 30.562 1.00 43.36  ? 116 GLU A CA    1 
ATOM   70   C C     . GLU A 1 35  ? 30.017  -15.614 29.250 1.00 48.20  ? 116 GLU A C     1 
ATOM   71   O O     . GLU A 1 35  ? 28.999  -15.431 28.582 1.00 46.27  ? 116 GLU A O     1 
ATOM   72   C CB    . GLU A 1 35  ? 31.092  -13.621 30.358 1.00 45.23  ? 116 GLU A CB    1 
ATOM   73   N N     . ALA A 1 36  ? 30.970  -16.533 28.933 1.00 47.15  ? 117 ALA A N     1 
ATOM   74   C CA    . ALA A 1 36  ? 30.936  -17.395 27.742 1.00 47.60  ? 117 ALA A CA    1 
ATOM   75   C C     . ALA A 1 36  ? 29.654  -18.232 27.693 1.00 50.78  ? 117 ALA A C     1 
ATOM   76   O O     . ALA A 1 36  ? 29.039  -18.301 26.631 1.00 51.62  ? 117 ALA A O     1 
ATOM   77   C CB    . ALA A 1 36  ? 32.161  -18.305 27.695 1.00 48.67  ? 117 ALA A CB    1 
ATOM   78   N N     . GLU A 1 37  ? 29.225  -18.818 28.848 1.00 44.88  ? 118 GLU A N     1 
ATOM   79   C CA    . GLU A 1 37  ? 27.982  -19.596 28.936 1.00 44.04  ? 118 GLU A CA    1 
ATOM   80   C C     . GLU A 1 37  ? 26.757  -18.708 28.647 1.00 44.16  ? 118 GLU A C     1 
ATOM   81   O O     . GLU A 1 37  ? 25.897  -19.077 27.841 1.00 43.30  ? 118 GLU A O     1 
ATOM   82   C CB    . GLU A 1 37  ? 27.851  -20.284 30.305 1.00 45.92  ? 118 GLU A CB    1 
ATOM   83   C CG    . GLU A 1 37  ? 26.607  -21.157 30.414 1.00 61.26  ? 118 GLU A CG    1 
ATOM   84   C CD    . GLU A 1 37  ? 26.457  -22.029 31.645 1.00 85.37  ? 118 GLU A CD    1 
ATOM   85   O OE1   . GLU A 1 37  ? 27.482  -22.374 32.276 1.00 76.51  ? 118 GLU A OE1   1 
ATOM   86   O OE2   . GLU A 1 37  ? 25.301  -22.388 31.967 1.00 86.23  ? 118 GLU A OE2   1 
ATOM   87   N N     . LEU A 1 38  ? 26.708  -17.520 29.264 1.00 38.38  ? 119 LEU A N     1 
ATOM   88   C CA    . LEU A 1 38  ? 25.611  -16.572 29.055 1.00 37.04  ? 119 LEU A CA    1 
ATOM   89   C C     . LEU A 1 38  ? 25.468  -16.127 27.615 1.00 40.08  ? 119 LEU A C     1 
ATOM   90   O O     . LEU A 1 38  ? 24.344  -15.992 27.123 1.00 38.82  ? 119 LEU A O     1 
ATOM   91   C CB    . LEU A 1 38  ? 25.762  -15.350 29.984 1.00 36.09  ? 119 LEU A CB    1 
ATOM   92   C CG    . LEU A 1 38  ? 25.726  -15.645 31.464 1.00 38.63  ? 119 LEU A CG    1 
ATOM   93   C CD1   . LEU A 1 38  ? 25.882  -14.347 32.302 1.00 37.54  ? 119 LEU A CD1   1 
ATOM   94   C CD2   . LEU A 1 38  ? 24.459  -16.379 31.852 1.00 40.63  ? 119 LEU A CD2   1 
ATOM   95   N N     . LEU A 1 39  ? 26.600  -15.966 26.911 1.00 39.73  ? 120 LEU A N     1 
ATOM   96   C CA    . LEU A 1 39  ? 26.591  -15.552 25.500 1.00 41.01  ? 120 LEU A CA    1 
ATOM   97   C C     . LEU A 1 39  ? 25.872  -16.548 24.554 1.00 43.48  ? 120 LEU A C     1 
ATOM   98   O O     . LEU A 1 39  ? 25.410  -16.128 23.489 1.00 41.83  ? 120 LEU A O     1 
ATOM   99   C CB    . LEU A 1 39  ? 28.000  -15.210 24.966 1.00 41.88  ? 120 LEU A CB    1 
ATOM   100  C CG    . LEU A 1 39  ? 28.683  -13.996 25.617 1.00 47.03  ? 120 LEU A CG    1 
ATOM   101  C CD1   . LEU A 1 39  ? 30.158  -13.953 25.259 1.00 48.29  ? 120 LEU A CD1   1 
ATOM   102  C CD2   . LEU A 1 39  ? 27.995  -12.684 25.229 1.00 47.08  ? 120 LEU A CD2   1 
ATOM   103  N N     . THR A 1 40  ? 25.698  -17.825 24.986 1.00 41.28  ? 121 THR A N     1 
ATOM   104  C CA    . THR A 1 40  ? 24.993  -18.856 24.188 1.00 41.17  ? 121 THR A CA    1 
ATOM   105  C C     . THR A 1 40  ? 23.499  -18.966 24.584 1.00 44.18  ? 121 THR A C     1 
ATOM   106  O O     . THR A 1 40  ? 22.734  -19.663 23.904 1.00 44.23  ? 121 THR A O     1 
ATOM   107  C CB    . THR A 1 40  ? 25.688  -20.232 24.300 1.00 52.66  ? 121 THR A CB    1 
ATOM   108  O OG1   . THR A 1 40  ? 25.562  -20.733 25.632 1.00 50.27  ? 121 THR A OG1   1 
ATOM   109  C CG2   . THR A 1 40  ? 27.150  -20.202 23.873 1.00 56.42  ? 121 THR A CG2   1 
ATOM   110  N N     . LYS A 1 41  ? 23.091  -18.293 25.682 1.00 39.18  ? 122 LYS A N     1 
ATOM   111  C CA    . LYS A 1 41  ? 21.711  -18.332 26.160 1.00 38.03  ? 122 LYS A CA    1 
ATOM   112  C C     . LYS A 1 41  ? 20.837  -17.353 25.393 1.00 42.37  ? 122 LYS A C     1 
ATOM   113  O O     . LYS A 1 41  ? 21.350  -16.416 24.773 1.00 42.85  ? 122 LYS A O     1 
ATOM   114  C CB    . LYS A 1 41  ? 21.634  -18.068 27.669 1.00 39.76  ? 122 LYS A CB    1 
ATOM   115  C CG    . LYS A 1 41  ? 22.163  -19.235 28.545 1.00 45.19  ? 122 LYS A CG    1 
ATOM   116  C CD    . LYS A 1 41  ? 21.988  -18.951 30.046 1.00 44.39  ? 122 LYS A CD    1 
ATOM   117  C CE    . LYS A 1 41  ? 20.678  -19.492 30.579 1.00 46.87  ? 122 LYS A CE    1 
ATOM   118  N NZ    . LYS A 1 41  ? 20.281  -18.848 31.864 1.00 38.60  ? 122 LYS A NZ    1 
ATOM   119  N N     . THR A 1 42  ? 19.522  -17.620 25.347 1.00 38.42  ? 123 THR A N     1 
ATOM   120  C CA    . THR A 1 42  ? 18.569  -16.726 24.682 1.00 37.63  ? 123 THR A CA    1 
ATOM   121  C C     . THR A 1 42  ? 17.469  -16.368 25.682 1.00 39.86  ? 123 THR A C     1 
ATOM   122  O O     . THR A 1 42  ? 17.367  -16.994 26.736 1.00 39.27  ? 123 THR A O     1 
ATOM   123  C CB    . THR A 1 42  ? 18.009  -17.347 23.398 1.00 46.14  ? 123 THR A CB    1 
ATOM   124  O OG1   . THR A 1 42  ? 17.396  -18.592 23.733 1.00 45.52  ? 123 THR A OG1   1 
ATOM   125  C CG2   . THR A 1 42  ? 19.079  -17.540 22.313 1.00 49.44  ? 123 THR A CG2   1 
ATOM   126  N N     . LEU A 1 43  ? 16.631  -15.400 25.338 1.00 34.18  ? 124 LEU A N     1 
ATOM   127  C CA    . LEU A 1 43  ? 15.549  -14.930 26.192 1.00 31.09  ? 124 LEU A CA    1 
ATOM   128  C C     . LEU A 1 43  ? 14.208  -15.197 25.476 1.00 35.46  ? 124 LEU A C     1 
ATOM   129  O O     . LEU A 1 43  ? 13.970  -14.638 24.403 1.00 35.25  ? 124 LEU A O     1 
ATOM   130  C CB    . LEU A 1 43  ? 15.743  -13.411 26.495 1.00 30.17  ? 124 LEU A CB    1 
ATOM   131  C CG    . LEU A 1 43  ? 14.721  -12.694 27.348 1.00 33.84  ? 124 LEU A CG    1 
ATOM   132  C CD1   . LEU A 1 43  ? 14.735  -13.248 28.779 1.00 33.00  ? 124 LEU A CD1   1 
ATOM   133  C CD2   . LEU A 1 43  ? 15.007  -11.161 27.349 1.00 30.83  ? 124 LEU A CD2   1 
ATOM   134  N N     . PRO A 1 44  ? 13.319  -16.024 26.070 1.00 33.41  ? 125 PRO A N     1 
ATOM   135  C CA    . PRO A 1 44  ? 12.020  -16.283 25.435 1.00 33.71  ? 125 PRO A CA    1 
ATOM   136  C C     . PRO A 1 44  ? 11.120  -15.064 25.213 1.00 36.01  ? 125 PRO A C     1 
ATOM   137  O O     . PRO A 1 44  ? 11.071  -14.153 26.058 1.00 35.66  ? 125 PRO A O     1 
ATOM   138  C CB    . PRO A 1 44  ? 11.338  -17.264 26.401 1.00 36.83  ? 125 PRO A CB    1 
ATOM   139  C CG    . PRO A 1 44  ? 12.441  -17.847 27.218 1.00 40.44  ? 125 PRO A CG    1 
ATOM   140  C CD    . PRO A 1 44  ? 13.459  -16.770 27.346 1.00 35.87  ? 125 PRO A CD    1 
ATOM   141  N N     . ASP A 1 45  ? 10.372  -15.071 24.086 1.00 35.04  ? 126 ASP A N     1 
ATOM   142  C CA    . ASP A 1 45  ? 9.375   -14.036 23.831 1.00 34.89  ? 126 ASP A CA    1 
ATOM   143  C C     . ASP A 1 45  ? 8.214   -14.275 24.807 1.00 39.57  ? 126 ASP A C     1 
ATOM   144  O O     . ASP A 1 45  ? 8.021   -15.402 25.285 1.00 39.27  ? 126 ASP A O     1 
ATOM   145  C CB    . ASP A 1 45  ? 8.812   -14.124 22.405 1.00 36.66  ? 126 ASP A CB    1 
ATOM   146  C CG    . ASP A 1 45  ? 9.762   -13.761 21.282 1.00 40.58  ? 126 ASP A CG    1 
ATOM   147  O OD1   . ASP A 1 45  ? 10.748  -13.032 21.545 1.00 39.72  ? 126 ASP A OD1   1 
ATOM   148  O OD2   . ASP A 1 45  ? 9.539   -14.230 20.155 1.00 44.63  ? 126 ASP A OD2   1 
ATOM   149  N N     . ILE A 1 46  ? 7.444   -13.230 25.090 1.00 33.19  ? 127 ILE A N     1 
ATOM   150  C CA    . ILE A 1 46  ? 6.250   -13.333 25.929 1.00 34.08  ? 127 ILE A CA    1 
ATOM   151  C C     . ILE A 1 46  ? 5.198   -12.662 25.067 1.00 37.72  ? 127 ILE A C     1 
ATOM   152  O O     . ILE A 1 46  ? 4.974   -11.454 25.170 1.00 37.36  ? 127 ILE A O     1 
ATOM   153  C CB    . ILE A 1 46  ? 6.433   -12.676 27.328 1.00 37.59  ? 127 ILE A CB    1 
ATOM   154  C CG1   . ILE A 1 46  ? 7.552   -13.389 28.109 1.00 37.89  ? 127 ILE A CG1   1 
ATOM   155  C CG2   . ILE A 1 46  ? 5.111   -12.668 28.129 1.00 38.72  ? 127 ILE A CG2   1 
ATOM   156  C CD1   . ILE A 1 46  ? 8.023   -12.677 29.342 1.00 38.57  ? 127 ILE A CD1   1 
ATOM   157  N N     . LEU A 1 47  ? 4.624   -13.429 24.169 1.00 37.88  ? 128 LEU A N     1 
ATOM   158  C CA    . LEU A 1 47  ? 3.657   -12.909 23.211 1.00 38.04  ? 128 LEU A CA    1 
ATOM   159  C C     . LEU A 1 47  ? 2.359   -13.690 23.206 1.00 44.17  ? 128 LEU A C     1 
ATOM   160  O O     . LEU A 1 47  ? 2.373   -14.920 23.335 1.00 44.29  ? 128 LEU A O     1 
ATOM   161  C CB    . LEU A 1 47  ? 4.267   -12.904 21.796 1.00 38.23  ? 128 LEU A CB    1 
ATOM   162  C CG    . LEU A 1 47  ? 5.476   -11.970 21.558 1.00 41.48  ? 128 LEU A CG    1 
ATOM   163  C CD1   . LEU A 1 47  ? 6.137   -12.272 20.212 1.00 41.76  ? 128 LEU A CD1   1 
ATOM   164  C CD2   . LEU A 1 47  ? 5.067   -10.504 21.614 1.00 42.57  ? 128 LEU A CD2   1 
ATOM   165  N N     . THR A 1 48  ? 1.236   -12.959 23.087 1.00 41.96  ? 129 THR A N     1 
ATOM   166  C CA    . THR A 1 48  ? -0.131  -13.485 22.966 1.00 42.63  ? 129 THR A CA    1 
ATOM   167  C C     . THR A 1 48  ? -0.876  -12.592 21.967 1.00 46.37  ? 129 THR A C     1 
ATOM   168  O O     . THR A 1 48  ? -0.389  -11.507 21.620 1.00 44.61  ? 129 THR A O     1 
ATOM   169  C CB    . THR A 1 48  ? -0.906  -13.498 24.321 1.00 52.83  ? 129 THR A CB    1 
ATOM   170  O OG1   . THR A 1 48  ? -1.302  -12.174 24.686 1.00 54.39  ? 129 THR A OG1   1 
ATOM   171  C CG2   . THR A 1 48  ? -0.164  -14.197 25.462 1.00 50.41  ? 129 THR A CG2   1 
ATOM   172  N N     . PHE A 1 49  ? -2.064  -13.030 21.527 1.00 43.66  ? 130 PHE A N     1 
ATOM   173  C CA    . PHE A 1 49  ? -2.917  -12.227 20.662 1.00 44.84  ? 130 PHE A CA    1 
ATOM   174  C C     . PHE A 1 49  ? -3.674  -11.192 21.522 1.00 49.69  ? 130 PHE A C     1 
ATOM   175  O O     . PHE A 1 49  ? -3.726  -11.329 22.747 1.00 48.61  ? 130 PHE A O     1 
ATOM   176  C CB    . PHE A 1 49  ? -3.901  -13.144 19.904 1.00 47.41  ? 130 PHE A CB    1 
ATOM   177  C CG    . PHE A 1 49  ? -3.207  -14.132 19.002 1.00 49.41  ? 130 PHE A CG    1 
ATOM   178  C CD1   . PHE A 1 49  ? -2.746  -13.750 17.748 1.00 53.35  ? 130 PHE A CD1   1 
ATOM   179  C CD2   . PHE A 1 49  ? -2.993  -15.444 19.413 1.00 52.54  ? 130 PHE A CD2   1 
ATOM   180  C CE1   . PHE A 1 49  ? -2.088  -14.664 16.919 1.00 54.39  ? 130 PHE A CE1   1 
ATOM   181  C CE2   . PHE A 1 49  ? -2.323  -16.350 18.589 1.00 55.77  ? 130 PHE A CE2   1 
ATOM   182  C CZ    . PHE A 1 49  ? -1.883  -15.954 17.345 1.00 53.83  ? 130 PHE A CZ    1 
ATOM   183  N N     . ASN A 1 50  ? -4.228  -10.141 20.880 1.00 47.39  ? 131 ASN A N     1 
ATOM   184  C CA    . ASN A 1 50  ? -5.045  -9.091  21.508 1.00 47.18  ? 131 ASN A CA    1 
ATOM   185  C C     . ASN A 1 50  ? -4.318  -8.258  22.569 1.00 49.27  ? 131 ASN A C     1 
ATOM   186  O O     . ASN A 1 50  ? -4.969  -7.702  23.455 1.00 51.07  ? 131 ASN A O     1 
ATOM   187  C CB    . ASN A 1 50  ? -6.361  -9.668  22.084 1.00 51.64  ? 131 ASN A CB    1 
ATOM   188  C CG    . ASN A 1 50  ? -7.150  -10.491 21.095 1.00 74.05  ? 131 ASN A CG    1 
ATOM   189  O OD1   . ASN A 1 50  ? -7.647  -9.986  20.085 1.00 70.23  ? 131 ASN A OD1   1 
ATOM   190  N ND2   . ASN A 1 50  ? -7.272  -11.782 21.362 1.00 67.78  ? 131 ASN A ND2   1 
ATOM   191  N N     . LEU A 1 51  ? -2.986  -8.151  22.479 1.00 43.02  ? 132 LEU A N     1 
ATOM   192  C CA    . LEU A 1 51  ? -2.214  -7.313  23.409 1.00 41.65  ? 132 LEU A CA    1 
ATOM   193  C C     . LEU A 1 51  ? -2.379  -5.846  23.019 1.00 43.57  ? 132 LEU A C     1 
ATOM   194  O O     . LEU A 1 51  ? -2.519  -5.542  21.839 1.00 42.95  ? 132 LEU A O     1 
ATOM   195  C CB    . LEU A 1 51  ? -0.719  -7.651  23.327 1.00 41.55  ? 132 LEU A CB    1 
ATOM   196  C CG    . LEU A 1 51  ? -0.248  -8.965  23.925 1.00 45.50  ? 132 LEU A CG    1 
ATOM   197  C CD1   . LEU A 1 51  ? 1.170   -9.248  23.502 1.00 45.23  ? 132 LEU A CD1   1 
ATOM   198  C CD2   . LEU A 1 51  ? -0.325  -8.933  25.439 1.00 48.35  ? 132 LEU A CD2   1 
ATOM   199  N N     . ASP A 1 52  ? -2.336  -4.940  23.997 1.00 40.46  ? 133 ASP A N     1 
ATOM   200  C CA    . ASP A 1 52  ? -2.379  -3.510  23.723 1.00 39.53  ? 133 ASP A CA    1 
ATOM   201  C C     . ASP A 1 52  ? -0.975  -3.073  23.299 1.00 41.03  ? 133 ASP A C     1 
ATOM   202  O O     . ASP A 1 52  ? -0.831  -2.279  22.368 1.00 41.69  ? 133 ASP A O     1 
ATOM   203  C CB    . ASP A 1 52  ? -2.800  -2.709  24.976 1.00 42.39  ? 133 ASP A CB    1 
ATOM   204  C CG    . ASP A 1 52  ? -4.205  -2.950  25.521 1.00 59.66  ? 133 ASP A CG    1 
ATOM   205  O OD1   . ASP A 1 52  ? -5.137  -3.162  24.708 1.00 62.15  ? 133 ASP A OD1   1 
ATOM   206  O OD2   . ASP A 1 52  ? -4.378  -2.887  26.759 1.00 67.36  ? 133 ASP A OD2   1 
ATOM   207  N N     . ILE A 1 53  ? 0.060   -3.576  24.004 1.00 36.55  ? 134 ILE A N     1 
ATOM   208  C CA    . ILE A 1 53  ? 1.457   -3.182  23.808 1.00 34.97  ? 134 ILE A CA    1 
ATOM   209  C C     . ILE A 1 53  ? 2.423   -4.356  23.700 1.00 37.79  ? 134 ILE A C     1 
ATOM   210  O O     . ILE A 1 53  ? 2.331   -5.314  24.475 1.00 36.76  ? 134 ILE A O     1 
ATOM   211  C CB    . ILE A 1 53  ? 1.879   -2.244  24.995 1.00 36.75  ? 134 ILE A CB    1 
ATOM   212  C CG1   . ILE A 1 53  ? 1.162   -0.876  24.903 1.00 36.47  ? 134 ILE A CG1   1 
ATOM   213  C CG2   . ILE A 1 53  ? 3.403   -2.068  25.112 1.00 33.53  ? 134 ILE A CG2   1 
ATOM   214  C CD1   . ILE A 1 53  ? 1.086   -0.106  26.293 1.00 40.39  ? 134 ILE A CD1   1 
ATOM   215  N N     . VAL A 1 54  ? 3.404   -4.236  22.787 1.00 33.01  ? 135 VAL A N     1 
ATOM   216  C CA    . VAL A 1 54  ? 4.512   -5.185  22.747 1.00 32.28  ? 135 VAL A CA    1 
ATOM   217  C C     . VAL A 1 54  ? 5.795   -4.393  22.943 1.00 32.39  ? 135 VAL A C     1 
ATOM   218  O O     . VAL A 1 54  ? 6.082   -3.503  22.148 1.00 30.90  ? 135 VAL A O     1 
ATOM   219  C CB    . VAL A 1 54  ? 4.580   -6.104  21.488 1.00 36.24  ? 135 VAL A CB    1 
ATOM   220  C CG1   . VAL A 1 54  ? 5.902   -6.875  21.447 1.00 36.07  ? 135 VAL A CG1   1 
ATOM   221  C CG2   . VAL A 1 54  ? 3.413   -7.076  21.464 1.00 36.39  ? 135 VAL A CG2   1 
ATOM   222  N N     . ILE A 1 55  ? 6.559   -4.704  23.989 1.00 30.13  ? 136 ILE A N     1 
ATOM   223  C CA    . ILE A 1 55  ? 7.825   -4.017  24.227 1.00 27.98  ? 136 ILE A CA    1 
ATOM   224  C C     . ILE A 1 55  ? 8.883   -4.778  23.434 1.00 30.72  ? 136 ILE A C     1 
ATOM   225  O O     . ILE A 1 55  ? 9.182   -5.918  23.767 1.00 29.81  ? 136 ILE A O     1 
ATOM   226  C CB    . ILE A 1 55  ? 8.207   -3.984  25.731 1.00 29.58  ? 136 ILE A CB    1 
ATOM   227  C CG1   . ILE A 1 55  ? 7.106   -3.281  26.611 1.00 31.27  ? 136 ILE A CG1   1 
ATOM   228  C CG2   . ILE A 1 55  ? 9.616   -3.371  25.933 1.00 28.73  ? 136 ILE A CG2   1 
ATOM   229  C CD1   . ILE A 1 55  ? 6.890   -1.740  26.428 1.00 31.69  ? 136 ILE A CD1   1 
ATOM   230  N N     . ILE A 1 56  ? 9.544   -4.077  22.514 1.00 28.34  ? 137 ILE A N     1 
ATOM   231  C CA    . ILE A 1 56  ? 10.586  -4.664  21.677 1.00 28.04  ? 137 ILE A CA    1 
ATOM   232  C C     . ILE A 1 56  ? 11.936  -4.130  22.091 1.00 31.55  ? 137 ILE A C     1 
ATOM   233  O O     . ILE A 1 56  ? 12.235  -2.967  21.813 1.00 31.61  ? 137 ILE A O     1 
ATOM   234  C CB    . ILE A 1 56  ? 10.357  -4.320  20.170 1.00 30.64  ? 137 ILE A CB    1 
ATOM   235  C CG1   . ILE A 1 56  ? 8.939   -4.706  19.687 1.00 32.46  ? 137 ILE A CG1   1 
ATOM   236  C CG2   . ILE A 1 56  ? 11.477  -4.954  19.296 1.00 29.03  ? 137 ILE A CG2   1 
ATOM   237  C CD1   . ILE A 1 56  ? 8.468   -3.916  18.370 1.00 34.63  ? 137 ILE A CD1   1 
ATOM   238  N N     . GLY A 1 57  ? 12.745  -4.964  22.735 1.00 29.45  ? 138 GLY A N     1 
ATOM   239  C CA    . GLY A 1 57  ? 14.107  -4.571  23.060 1.00 28.06  ? 138 GLY A CA    1 
ATOM   240  C C     . GLY A 1 57  ? 15.043  -4.821  21.883 1.00 30.35  ? 138 GLY A C     1 
ATOM   241  O O     . GLY A 1 57  ? 14.629  -5.270  20.808 1.00 29.66  ? 138 GLY A O     1 
ATOM   242  N N     . ILE A 1 58  ? 16.315  -4.525  22.083 1.00 29.36  ? 139 ILE A N     1 
ATOM   243  C CA    . ILE A 1 58  ? 17.355  -4.686  21.080 1.00 28.56  ? 139 ILE A CA    1 
ATOM   244  C C     . ILE A 1 58  ? 17.735  -6.155  21.053 1.00 33.00  ? 139 ILE A C     1 
ATOM   245  O O     . ILE A 1 58  ? 17.476  -6.830  20.057 1.00 30.45  ? 139 ILE A O     1 
ATOM   246  C CB    . ILE A 1 58  ? 18.562  -3.740  21.356 1.00 31.66  ? 139 ILE A CB    1 
ATOM   247  C CG1   . ILE A 1 58  ? 18.097  -2.251  21.329 1.00 32.10  ? 139 ILE A CG1   1 
ATOM   248  C CG2   . ILE A 1 58  ? 19.696  -4.000  20.329 1.00 31.70  ? 139 ILE A CG2   1 
ATOM   249  C CD1   . ILE A 1 58  ? 18.992  -1.239  22.053 1.00 33.03  ? 139 ILE A CD1   1 
ATOM   250  N N     . ASN A 1 59  ? 18.317  -6.655  22.149 1.00 30.68  ? 140 ASN A N     1 
ATOM   251  C CA    . ASN A 1 59  ? 18.672  -8.058  22.273 1.00 29.40  ? 140 ASN A CA    1 
ATOM   252  C C     . ASN A 1 59  ? 18.875  -8.287  23.758 1.00 29.37  ? 140 ASN A C     1 
ATOM   253  O O     . ASN A 1 59  ? 18.947  -7.331  24.514 1.00 28.30  ? 140 ASN A O     1 
ATOM   254  C CB    . ASN A 1 59  ? 19.964  -8.397  21.521 1.00 32.41  ? 140 ASN A CB    1 
ATOM   255  C CG    . ASN A 1 59  ? 21.201  -7.749  22.069 1.00 40.75  ? 140 ASN A CG    1 
ATOM   256  O OD1   . ASN A 1 59  ? 21.205  -6.562  22.433 1.00 39.46  ? 140 ASN A OD1   1 
ATOM   257  N ND2   . ASN A 1 59  ? 22.267  -8.530  22.139 1.00 33.09  ? 140 ASN A ND2   1 
ATOM   258  N N     . PRO A 1 60  ? 18.988  -9.527  24.224 1.00 28.80  ? 141 PRO A N     1 
ATOM   259  C CA    . PRO A 1 60  ? 19.218  -9.705  25.676 1.00 28.11  ? 141 PRO A CA    1 
ATOM   260  C C     . PRO A 1 60  ? 20.632  -9.293  26.064 1.00 30.19  ? 141 PRO A C     1 
ATOM   261  O O     . PRO A 1 60  ? 21.583  -9.592  25.340 1.00 30.99  ? 141 PRO A O     1 
ATOM   262  C CB    . PRO A 1 60  ? 19.044  -11.235 25.893 1.00 31.07  ? 141 PRO A CB    1 
ATOM   263  C CG    . PRO A 1 60  ? 18.531  -11.780 24.598 1.00 34.93  ? 141 PRO A CG    1 
ATOM   264  C CD    . PRO A 1 60  ? 18.911  -10.811 23.509 1.00 31.77  ? 141 PRO A CD    1 
ATOM   265  N N     . GLY A 1 61  ? 20.772  -8.648  27.218 1.00 28.04  ? 142 GLY A N     1 
ATOM   266  C CA    . GLY A 1 61  ? 22.075  -8.397  27.809 1.00 29.18  ? 142 GLY A CA    1 
ATOM   267  C C     . GLY A 1 61  ? 22.455  -9.607  28.657 1.00 32.54  ? 142 GLY A C     1 
ATOM   268  O O     . GLY A 1 61  ? 21.654  -10.547 28.798 1.00 29.50  ? 142 GLY A O     1 
ATOM   269  N N     . LEU A 1 62  ? 23.634  -9.568  29.298 1.00 30.14  ? 143 LEU A N     1 
ATOM   270  C CA    . LEU A 1 62  ? 24.098  -10.703 30.120 1.00 31.41  ? 143 LEU A CA    1 
ATOM   271  C C     . LEU A 1 62  ? 23.160  -11.076 31.274 1.00 32.93  ? 143 LEU A C     1 
ATOM   272  O O     . LEU A 1 62  ? 22.926  -12.264 31.495 1.00 32.27  ? 143 LEU A O     1 
ATOM   273  C CB    . LEU A 1 62  ? 25.523  -10.502 30.639 1.00 32.63  ? 143 LEU A CB    1 
ATOM   274  C CG    . LEU A 1 62  ? 26.654  -10.471 29.604 1.00 38.72  ? 143 LEU A CG    1 
ATOM   275  C CD1   . LEU A 1 62  ? 27.958  -10.054 30.250 1.00 39.89  ? 143 LEU A CD1   1 
ATOM   276  C CD2   . LEU A 1 62  ? 26.850  -11.837 28.951 1.00 42.45  ? 143 LEU A CD2   1 
ATOM   277  N N     . MET A 1 63  ? 22.559  -10.073 31.933 1.00 28.42  ? 144 MET A N     1 
ATOM   278  C CA    . MET A 1 63  ? 21.643  -10.337 33.041 1.00 28.28  ? 144 MET A CA    1 
ATOM   279  C C     . MET A 1 63  ? 20.355  -11.008 32.592 1.00 30.12  ? 144 MET A C     1 
ATOM   280  O O     . MET A 1 63  ? 19.894  -11.942 33.267 1.00 29.66  ? 144 MET A O     1 
ATOM   281  C CB    . MET A 1 63  ? 21.354  -9.088  33.890 1.00 30.19  ? 144 MET A CB    1 
ATOM   282  C CG    . MET A 1 63  ? 20.746  -9.468  35.258 1.00 32.18  ? 144 MET A CG    1 
ATOM   283  S SD    . MET A 1 63  ? 21.829  -10.516 36.311 1.00 35.99  ? 144 MET A SD    1 
ATOM   284  C CE    . MET A 1 63  ? 23.030  -9.294  36.760 1.00 34.55  ? 144 MET A CE    1 
ATOM   285  N N     . ALA A 1 64  ? 19.766  -10.550 31.454 1.00 28.01  ? 145 ALA A N     1 
ATOM   286  C CA    . ALA A 1 64  ? 18.556  -11.202 30.953 1.00 29.04  ? 145 ALA A CA    1 
ATOM   287  C C     . ALA A 1 64  ? 18.838  -12.651 30.551 1.00 33.28  ? 145 ALA A C     1 
ATOM   288  O O     . ALA A 1 64  ? 17.992  -13.516 30.796 1.00 32.90  ? 145 ALA A O     1 
ATOM   289  C CB    . ALA A 1 64  ? 17.972  -10.451 29.760 1.00 28.87  ? 145 ALA A CB    1 
ATOM   290  N N     . ALA A 1 65  ? 20.013  -12.914 29.929 1.00 30.65  ? 146 ALA A N     1 
ATOM   291  C CA    . ALA A 1 65  ? 20.419  -14.275 29.564 1.00 31.65  ? 146 ALA A CA    1 
ATOM   292  C C     . ALA A 1 65  ? 20.520  -15.119 30.844 1.00 34.28  ? 146 ALA A C     1 
ATOM   293  O O     . ALA A 1 65  ? 20.051  -16.257 30.860 1.00 34.76  ? 146 ALA A O     1 
ATOM   294  C CB    . ALA A 1 65  ? 21.760  -14.265 28.857 1.00 33.53  ? 146 ALA A CB    1 
ATOM   295  N N     . TYR A 1 66  ? 21.124  -14.561 31.880 1.00 30.71  ? 147 TYR A N     1 
ATOM   296  C CA    . TYR A 1 66  ? 21.278  -15.251 33.170 1.00 29.81  ? 147 TYR A CA    1 
ATOM   297  C C     . TYR A 1 66  ? 19.936  -15.615 33.836 1.00 35.03  ? 147 TYR A C     1 
ATOM   298  O O     . TYR A 1 66  ? 19.718  -16.773 34.216 1.00 34.36  ? 147 TYR A O     1 
ATOM   299  C CB    . TYR A 1 66  ? 22.176  -14.438 34.122 1.00 28.94  ? 147 TYR A CB    1 
ATOM   300  C CG    . TYR A 1 66  ? 22.403  -15.115 35.462 1.00 31.68  ? 147 TYR A CG    1 
ATOM   301  C CD1   . TYR A 1 66  ? 21.448  -15.045 36.475 1.00 32.36  ? 147 TYR A CD1   1 
ATOM   302  C CD2   . TYR A 1 66  ? 23.531  -15.894 35.684 1.00 32.40  ? 147 TYR A CD2   1 
ATOM   303  C CE1   . TYR A 1 66  ? 21.594  -15.782 37.664 1.00 33.80  ? 147 TYR A CE1   1 
ATOM   304  C CE2   . TYR A 1 66  ? 23.727  -16.553 36.902 1.00 33.59  ? 147 TYR A CE2   1 
ATOM   305  C CZ    . TYR A 1 66  ? 22.745  -16.519 37.870 1.00 37.82  ? 147 TYR A CZ    1 
ATOM   306  O OH    . TYR A 1 66  ? 22.956  -17.225 39.034 1.00 40.01  ? 147 TYR A OH    1 
ATOM   307  N N     . LYS A 1 67  ? 19.041  -14.634 33.941 1.00 32.01  ? 148 LYS A N     1 
ATOM   308  C CA    . LYS A 1 67  ? 17.779  -14.772 34.667 1.00 31.16  ? 148 LYS A CA    1 
ATOM   309  C C     . LYS A 1 67  ? 16.688  -15.449 33.861 1.00 35.52  ? 148 LYS A C     1 
ATOM   310  O O     . LYS A 1 67  ? 15.799  -16.066 34.446 1.00 36.49  ? 148 LYS A O     1 
ATOM   311  C CB    . LYS A 1 67  ? 17.289  -13.389 35.153 1.00 29.10  ? 148 LYS A CB    1 
ATOM   312  C CG    . LYS A 1 67  ? 18.213  -12.746 36.168 1.00 25.98  ? 148 LYS A CG    1 
ATOM   313  C CD    . LYS A 1 67  ? 18.017  -13.399 37.567 1.00 31.06  ? 148 LYS A CD    1 
ATOM   314  C CE    . LYS A 1 67  ? 18.743  -12.637 38.636 1.00 34.57  ? 148 LYS A CE    1 
ATOM   315  N NZ    . LYS A 1 67  ? 18.565  -13.304 39.957 1.00 38.91  ? 148 LYS A NZ    1 
ATOM   316  N N     . GLY A 1 68  ? 16.723  -15.284 32.559 1.00 31.87  ? 149 GLY A N     1 
ATOM   317  C CA    . GLY A 1 68  ? 15.677  -15.811 31.687 1.00 30.21  ? 149 GLY A CA    1 
ATOM   318  C C     . GLY A 1 68  ? 14.404  -14.994 31.807 1.00 33.84  ? 149 GLY A C     1 
ATOM   319  O O     . GLY A 1 68  ? 13.325  -15.464 31.460 1.00 35.22  ? 149 GLY A O     1 
ATOM   320  N N     . HIS A 1 69  ? 14.525  -13.748 32.289 1.00 30.35  ? 150 HIS A N     1 
ATOM   321  C CA    . HIS A 1 69  ? 13.386  -12.837 32.434 1.00 29.70  ? 150 HIS A CA    1 
ATOM   322  C C     . HIS A 1 69  ? 13.725  -11.481 31.836 1.00 31.76  ? 150 HIS A C     1 
ATOM   323  O O     . HIS A 1 69  ? 14.901  -11.161 31.689 1.00 29.63  ? 150 HIS A O     1 
ATOM   324  C CB    . HIS A 1 69  ? 12.959  -12.678 33.895 1.00 30.21  ? 150 HIS A CB    1 
ATOM   325  C CG    . HIS A 1 69  ? 12.339  -13.906 34.478 1.00 33.91  ? 150 HIS A CG    1 
ATOM   326  N ND1   . HIS A 1 69  ? 10.986  -14.173 34.330 1.00 36.38  ? 150 HIS A ND1   1 
ATOM   327  C CD2   . HIS A 1 69  ? 12.910  -14.904 35.192 1.00 37.13  ? 150 HIS A CD2   1 
ATOM   328  C CE1   . HIS A 1 69  ? 10.778  -15.321 34.966 1.00 37.17  ? 150 HIS A CE1   1 
ATOM   329  N NE2   . HIS A 1 69  ? 11.904  -15.790 35.512 1.00 37.13  ? 150 HIS A NE2   1 
ATOM   330  N N     . HIS A 1 70  ? 12.697  -10.687 31.518 1.00 28.38  ? 151 HIS A N     1 
ATOM   331  C CA    . HIS A 1 70  ? 12.893  -9.382  30.891 1.00 28.80  ? 151 HIS A CA    1 
ATOM   332  C C     . HIS A 1 70  ? 13.260  -8.257  31.850 1.00 29.48  ? 151 HIS A C     1 
ATOM   333  O O     . HIS A 1 70  ? 12.591  -8.042  32.862 1.00 29.56  ? 151 HIS A O     1 
ATOM   334  C CB    . HIS A 1 70  ? 11.669  -8.987  30.045 1.00 29.32  ? 151 HIS A CB    1 
ATOM   335  C CG    . HIS A 1 70  ? 11.531  -9.845  28.824 1.00 34.56  ? 151 HIS A CG    1 
ATOM   336  N ND1   . HIS A 1 70  ? 11.927  -9.390  27.575 1.00 37.37  ? 151 HIS A ND1   1 
ATOM   337  C CD2   . HIS A 1 70  ? 11.151  -11.137 28.719 1.00 38.10  ? 151 HIS A CD2   1 
ATOM   338  C CE1   . HIS A 1 70  ? 11.720  -10.404 26.742 1.00 36.73  ? 151 HIS A CE1   1 
ATOM   339  N NE2   . HIS A 1 70  ? 11.228  -11.461 27.374 1.00 36.69  ? 151 HIS A NE2   1 
ATOM   340  N N     . TYR A 1 71  ? 14.293  -7.497  31.452 1.00 26.77  ? 152 TYR A N     1 
ATOM   341  C CA    . TYR A 1 71  ? 14.854  -6.284  32.107 1.00 25.92  ? 152 TYR A CA    1 
ATOM   342  C C     . TYR A 1 71  ? 15.198  -6.522  33.601 1.00 26.95  ? 152 TYR A C     1 
ATOM   343  O O     . TYR A 1 71  ? 14.763  -5.751  34.456 1.00 28.14  ? 152 TYR A O     1 
ATOM   344  C CB    . TYR A 1 71  ? 13.955  -5.053  31.887 1.00 27.07  ? 152 TYR A CB    1 
ATOM   345  C CG    . TYR A 1 71  ? 13.701  -4.854  30.410 1.00 26.73  ? 152 TYR A CG    1 
ATOM   346  C CD1   . TYR A 1 71  ? 14.698  -4.361  29.569 1.00 28.50  ? 152 TYR A CD1   1 
ATOM   347  C CD2   . TYR A 1 71  ? 12.499  -5.255  29.830 1.00 28.48  ? 152 TYR A CD2   1 
ATOM   348  C CE1   . TYR A 1 71  ? 14.485  -4.224  28.186 1.00 27.80  ? 152 TYR A CE1   1 
ATOM   349  C CE2   . TYR A 1 71  ? 12.281  -5.141  28.455 1.00 29.20  ? 152 TYR A CE2   1 
ATOM   350  C CZ    . TYR A 1 71  ? 13.283  -4.641  27.632 1.00 28.09  ? 152 TYR A CZ    1 
ATOM   351  O OH    . TYR A 1 71  ? 13.060  -4.524  26.275 1.00 27.51  ? 152 TYR A OH    1 
ATOM   352  N N     . PRO A 1 72  ? 16.042  -7.539  33.893 1.00 26.23  ? 153 PRO A N     1 
ATOM   353  C CA    . PRO A 1 72  ? 16.427  -7.814  35.299 1.00 27.18  ? 153 PRO A CA    1 
ATOM   354  C C     . PRO A 1 72  ? 17.587  -6.950  35.774 1.00 32.42  ? 153 PRO A C     1 
ATOM   355  O O     . PRO A 1 72  ? 17.916  -7.010  36.948 1.00 32.16  ? 153 PRO A O     1 
ATOM   356  C CB    . PRO A 1 72  ? 16.857  -9.278  35.261 1.00 29.04  ? 153 PRO A CB    1 
ATOM   357  C CG    . PRO A 1 72  ? 17.388  -9.465  33.856 1.00 31.76  ? 153 PRO A CG    1 
ATOM   358  C CD    . PRO A 1 72  ? 16.633  -8.535  32.958 1.00 28.93  ? 153 PRO A CD    1 
ATOM   359  N N     . GLY A 1 73  ? 18.246  -6.242  34.847 1.00 31.53  ? 154 GLY A N     1 
ATOM   360  C CA    . GLY A 1 73  ? 19.401  -5.423  35.178 1.00 32.08  ? 154 GLY A CA    1 
ATOM   361  C C     . GLY A 1 73  ? 19.088  -4.489  36.326 1.00 33.65  ? 154 GLY A C     1 
ATOM   362  O O     . GLY A 1 73  ? 18.094  -3.763  36.272 1.00 32.92  ? 154 GLY A O     1 
ATOM   363  N N     . PRO A 1 74  ? 19.865  -4.536  37.427 1.00 31.42  ? 155 PRO A N     1 
ATOM   364  C CA    . PRO A 1 74  ? 19.531  -3.693  38.588 1.00 31.39  ? 155 PRO A CA    1 
ATOM   365  C C     . PRO A 1 74  ? 19.405  -2.206  38.299 1.00 35.17  ? 155 PRO A C     1 
ATOM   366  O O     . PRO A 1 74  ? 18.635  -1.517  38.971 1.00 36.93  ? 155 PRO A O     1 
ATOM   367  C CB    . PRO A 1 74  ? 20.667  -3.976  39.571 1.00 32.27  ? 155 PRO A CB    1 
ATOM   368  C CG    . PRO A 1 74  ? 21.195  -5.277  39.181 1.00 38.25  ? 155 PRO A CG    1 
ATOM   369  C CD    . PRO A 1 74  ? 21.044  -5.383  37.699 1.00 33.60  ? 155 PRO A CD    1 
ATOM   370  N N     . GLY A 1 75  ? 20.133  -1.731  37.292 1.00 32.42  ? 156 GLY A N     1 
ATOM   371  C CA    . GLY A 1 75  ? 20.094  -0.329  36.912 1.00 31.88  ? 156 GLY A CA    1 
ATOM   372  C C     . GLY A 1 75  ? 19.212  -0.034  35.712 1.00 30.78  ? 156 GLY A C     1 
ATOM   373  O O     . GLY A 1 75  ? 19.049  1.133   35.354 1.00 30.68  ? 156 GLY A O     1 
ATOM   374  N N     . ASN A 1 76  ? 18.624  -1.073  35.072 1.00 28.86  ? 157 ASN A N     1 
ATOM   375  C CA    . ASN A 1 76  ? 17.768  -0.848  33.893 1.00 28.35  ? 157 ASN A CA    1 
ATOM   376  C C     . ASN A 1 76  ? 16.525  -0.088  34.334 1.00 32.27  ? 157 ASN A C     1 
ATOM   377  O O     . ASN A 1 76  ? 16.002  -0.365  35.409 1.00 32.80  ? 157 ASN A O     1 
ATOM   378  C CB    . ASN A 1 76  ? 17.419  -2.178  33.188 1.00 26.77  ? 157 ASN A CB    1 
ATOM   379  C CG    . ASN A 1 76  ? 16.850  -1.935  31.813 1.00 30.60  ? 157 ASN A CG    1 
ATOM   380  O OD1   . ASN A 1 76  ? 15.690  -1.537  31.671 1.00 31.58  ? 157 ASN A OD1   1 
ATOM   381  N ND2   . ASN A 1 76  ? 17.647  -2.174  30.779 1.00 30.15  ? 157 ASN A ND2   1 
ATOM   382  N N     . HIS A 1 77  ? 16.087  0.899   33.537 1.00 28.25  ? 158 HIS A N     1 
ATOM   383  C CA    . HIS A 1 77  ? 14.980  1.788   33.903 1.00 28.04  ? 158 HIS A CA    1 
ATOM   384  C C     . HIS A 1 77  ? 13.584  1.271   33.586 1.00 30.98  ? 158 HIS A C     1 
ATOM   385  O O     . HIS A 1 77  ? 12.618  1.912   33.997 1.00 31.40  ? 158 HIS A O     1 
ATOM   386  C CB    . HIS A 1 77  ? 15.189  3.180   33.231 1.00 27.62  ? 158 HIS A CB    1 
ATOM   387  C CG    . HIS A 1 77  ? 16.478  3.830   33.612 1.00 30.41  ? 158 HIS A CG    1 
ATOM   388  N ND1   . HIS A 1 77  ? 17.209  4.556   32.713 1.00 31.54  ? 158 HIS A ND1   1 
ATOM   389  C CD2   . HIS A 1 77  ? 17.147  3.790   34.795 1.00 32.63  ? 158 HIS A CD2   1 
ATOM   390  C CE1   . HIS A 1 77  ? 18.267  4.997   33.383 1.00 32.07  ? 158 HIS A CE1   1 
ATOM   391  N NE2   . HIS A 1 77  ? 18.291  4.518   34.624 1.00 32.70  ? 158 HIS A NE2   1 
ATOM   392  N N     . PHE A 1 78  ? 13.459  0.126   32.883 1.00 28.06  ? 159 PHE A N     1 
ATOM   393  C CA    . PHE A 1 78  ? 12.165  -0.350  32.425 1.00 26.66  ? 159 PHE A CA    1 
ATOM   394  C C     . PHE A 1 78  ? 11.083  -0.470  33.517 1.00 29.60  ? 159 PHE A C     1 
ATOM   395  O O     . PHE A 1 78  ? 10.029  0.149   33.362 1.00 29.62  ? 159 PHE A O     1 
ATOM   396  C CB    . PHE A 1 78  ? 12.269  -1.678  31.614 1.00 27.94  ? 159 PHE A CB    1 
ATOM   397  C CG    . PHE A 1 78  ? 10.898  -2.156  31.198 1.00 28.33  ? 159 PHE A CG    1 
ATOM   398  C CD1   . PHE A 1 78  ? 10.230  -1.559  30.131 1.00 28.20  ? 159 PHE A CD1   1 
ATOM   399  C CD2   . PHE A 1 78  ? 10.262  -3.186  31.888 1.00 28.72  ? 159 PHE A CD2   1 
ATOM   400  C CE1   . PHE A 1 78  ? 8.943   -1.965  29.775 1.00 28.48  ? 159 PHE A CE1   1 
ATOM   401  C CE2   . PHE A 1 78  ? 8.969   -3.589  31.537 1.00 31.10  ? 159 PHE A CE2   1 
ATOM   402  C CZ    . PHE A 1 78  ? 8.327   -2.993  30.465 1.00 28.45  ? 159 PHE A CZ    1 
ATOM   403  N N     . TRP A 1 79  ? 11.317  -1.290  34.591 1.00 26.53  ? 160 TRP A N     1 
ATOM   404  C CA    . TRP A 1 79  ? 10.300  -1.516  35.608 1.00 28.22  ? 160 TRP A CA    1 
ATOM   405  C C     . TRP A 1 79  ? 9.956   -0.243  36.400 1.00 32.56  ? 160 TRP A C     1 
ATOM   406  O O     . TRP A 1 79  ? 8.786   -0.017  36.733 1.00 32.22  ? 160 TRP A O     1 
ATOM   407  C CB    . TRP A 1 79  ? 10.730  -2.700  36.520 1.00 27.57  ? 160 TRP A CB    1 
ATOM   408  C CG    . TRP A 1 79  ? 10.798  -3.996  35.743 1.00 28.83  ? 160 TRP A CG    1 
ATOM   409  C CD1   . TRP A 1 79  ? 11.919  -4.652  35.330 1.00 31.17  ? 160 TRP A CD1   1 
ATOM   410  C CD2   . TRP A 1 79  ? 9.683   -4.729  35.214 1.00 29.64  ? 160 TRP A CD2   1 
ATOM   411  N NE1   . TRP A 1 79  ? 11.574  -5.755  34.571 1.00 31.03  ? 160 TRP A NE1   1 
ATOM   412  C CE2   . TRP A 1 79  ? 10.204  -5.840  34.507 1.00 33.08  ? 160 TRP A CE2   1 
ATOM   413  C CE3   . TRP A 1 79  ? 8.283   -4.566  35.290 1.00 31.53  ? 160 TRP A CE3   1 
ATOM   414  C CZ2   . TRP A 1 79  ? 9.376   -6.767  33.850 1.00 32.47  ? 160 TRP A CZ2   1 
ATOM   415  C CZ3   . TRP A 1 79  ? 7.464   -5.519  34.702 1.00 32.79  ? 160 TRP A CZ3   1 
ATOM   416  C CH2   . TRP A 1 79  ? 8.007   -6.604  33.985 1.00 33.10  ? 160 TRP A CH2   1 
ATOM   417  N N     . LYS A 1 80  ? 10.968  0.590   36.676 1.00 30.40  ? 161 LYS A N     1 
ATOM   418  C CA    . LYS A 1 80  ? 10.822  1.877   37.375 1.00 31.73  ? 161 LYS A CA    1 
ATOM   419  C C     . LYS A 1 80  ? 9.942   2.839   36.529 1.00 34.23  ? 161 LYS A C     1 
ATOM   420  O O     . LYS A 1 80  ? 8.991   3.404   37.059 1.00 35.06  ? 161 LYS A O     1 
ATOM   421  C CB    . LYS A 1 80  ? 12.201  2.486   37.594 1.00 36.01  ? 161 LYS A CB    1 
ATOM   422  C CG    . LYS A 1 80  ? 12.158  3.587   38.620 1.00 51.38  ? 161 LYS A CG    1 
ATOM   423  C CD    . LYS A 1 80  ? 13.517  4.004   39.094 1.00 56.54  ? 161 LYS A CD    1 
ATOM   424  C CE    . LYS A 1 80  ? 13.346  4.901   40.284 1.00 55.09  ? 161 LYS A CE    1 
ATOM   425  N NZ    . LYS A 1 80  ? 14.655  5.222   40.895 1.00 60.76  ? 161 LYS A NZ    1 
ATOM   426  N N     . CYS A 1 81  ? 10.219  2.964   35.210 1.00 32.06  ? 162 CYS A N     1 
ATOM   427  C CA    . CYS A 1 81  ? 9.411   3.825   34.317 1.00 32.14  ? 162 CYS A CA    1 
ATOM   428  C C     . CYS A 1 81  ? 7.983   3.326   34.152 1.00 35.45  ? 162 CYS A C     1 
ATOM   429  O O     . CYS A 1 81  ? 7.063   4.128   34.154 1.00 35.46  ? 162 CYS A O     1 
ATOM   430  C CB    . CYS A 1 81  ? 10.092  4.006   32.972 1.00 31.73  ? 162 CYS A CB    1 
ATOM   431  S SG    . CYS A 1 81  ? 11.642  4.933   33.048 1.00 35.66  ? 162 CYS A SG    1 
ATOM   432  N N     . LEU A 1 82  ? 7.785   2.005   34.095 1.00 34.05  ? 163 LEU A N     1 
ATOM   433  C CA    . LEU A 1 82  ? 6.446   1.420   33.967 1.00 35.09  ? 163 LEU A CA    1 
ATOM   434  C C     . LEU A 1 82  ? 5.584   1.814   35.198 1.00 38.92  ? 163 LEU A C     1 
ATOM   435  O O     . LEU A 1 82  ? 4.400   2.124   35.058 1.00 39.28  ? 163 LEU A O     1 
ATOM   436  C CB    . LEU A 1 82  ? 6.572   -0.108  33.841 1.00 35.22  ? 163 LEU A CB    1 
ATOM   437  C CG    . LEU A 1 82  ? 5.367   -0.863  33.287 1.00 40.32  ? 163 LEU A CG    1 
ATOM   438  C CD1   . LEU A 1 82  ? 5.348   -0.843  31.771 1.00 40.27  ? 163 LEU A CD1   1 
ATOM   439  C CD2   . LEU A 1 82  ? 5.375   -2.304  33.766 1.00 41.87  ? 163 LEU A CD2   1 
ATOM   440  N N     . PHE A 1 83  ? 6.200   1.843   36.384 1.00 35.17  ? 164 PHE A N     1 
ATOM   441  C CA    . PHE A 1 83  ? 5.484   2.237   37.588 1.00 35.83  ? 164 PHE A CA    1 
ATOM   442  C C     . PHE A 1 83  ? 5.340   3.745   37.671 1.00 41.02  ? 164 PHE A C     1 
ATOM   443  O O     . PHE A 1 83  ? 4.225   4.214   37.888 1.00 43.12  ? 164 PHE A O     1 
ATOM   444  C CB    . PHE A 1 83  ? 6.106   1.625   38.854 1.00 37.25  ? 164 PHE A CB    1 
ATOM   445  C CG    . PHE A 1 83  ? 5.553   2.176   40.152 1.00 39.37  ? 164 PHE A CG    1 
ATOM   446  C CD1   . PHE A 1 83  ? 4.195   2.075   40.451 1.00 43.82  ? 164 PHE A CD1   1 
ATOM   447  C CD2   . PHE A 1 83  ? 6.385   2.812   41.063 1.00 42.13  ? 164 PHE A CD2   1 
ATOM   448  C CE1   . PHE A 1 83  ? 3.681   2.584   41.660 1.00 45.22  ? 164 PHE A CE1   1 
ATOM   449  C CE2   . PHE A 1 83  ? 5.872   3.317   42.273 1.00 45.73  ? 164 PHE A CE2   1 
ATOM   450  C CZ    . PHE A 1 83  ? 4.521   3.212   42.552 1.00 44.02  ? 164 PHE A CZ    1 
ATOM   451  N N     . MET A 1 84  ? 6.449   4.503   37.507 1.00 37.34  ? 165 MET A N     1 
ATOM   452  C CA    . MET A 1 84  ? 6.453   5.982   37.566 1.00 37.68  ? 165 MET A CA    1 
ATOM   453  C C     . MET A 1 84  ? 5.442   6.599   36.590 1.00 41.15  ? 165 MET A C     1 
ATOM   454  O O     . MET A 1 84  ? 4.820   7.604   36.932 1.00 42.39  ? 165 MET A O     1 
ATOM   455  C CB    . MET A 1 84  ? 7.863   6.584   37.360 1.00 39.40  ? 165 MET A CB    1 
ATOM   456  C CG    . MET A 1 84  ? 8.815   6.407   38.550 1.00 43.44  ? 165 MET A CG    1 
ATOM   457  S SD    . MET A 1 84  ? 10.574  6.662   38.105 1.00 47.85  ? 165 MET A SD    1 
ATOM   458  C CE    . MET A 1 84  ? 10.669  8.429   38.024 1.00 45.03  ? 165 MET A CE    1 
ATOM   459  N N     . SER A 1 85  ? 5.221   5.956   35.422 1.00 37.27  ? 166 SER A N     1 
ATOM   460  C CA    . SER A 1 85  ? 4.274   6.433   34.420 1.00 36.54  ? 166 SER A CA    1 
ATOM   461  C C     . SER A 1 85  ? 2.824   6.081   34.731 1.00 43.44  ? 166 SER A C     1 
ATOM   462  O O     . SER A 1 85  ? 1.914   6.619   34.092 1.00 43.13  ? 166 SER A O     1 
ATOM   463  C CB    . SER A 1 85  ? 4.625   5.855   33.051 1.00 37.59  ? 166 SER A CB    1 
ATOM   464  O OG    . SER A 1 85  ? 4.423   4.448   33.033 1.00 36.47  ? 166 SER A OG    1 
ATOM   465  N N     . GLY A 1 86  ? 2.630   5.097   35.595 1.00 42.85  ? 167 GLY A N     1 
ATOM   466  C CA    . GLY A 1 86  ? 1.301   4.611   35.937 1.00 43.81  ? 167 GLY A CA    1 
ATOM   467  C C     . GLY A 1 86  ? 0.838   3.430   35.107 1.00 48.44  ? 167 GLY A C     1 
ATOM   468  O O     . GLY A 1 86  ? -0.311  3.008   35.258 1.00 50.35  ? 167 GLY A O     1 
ATOM   469  N N     . LEU A 1 87  ? 1.719   2.865   34.233 1.00 42.86  ? 168 LEU A N     1 
ATOM   470  C CA    . LEU A 1 87  ? 1.374   1.690   33.417 1.00 42.44  ? 168 LEU A CA    1 
ATOM   471  C C     . LEU A 1 87  ? 1.166   0.454   34.318 1.00 47.43  ? 168 LEU A C     1 
ATOM   472  O O     . LEU A 1 87  ? 0.355   -0.408  33.998 1.00 48.12  ? 168 LEU A O     1 
ATOM   473  C CB    . LEU A 1 87  ? 2.375   1.432   32.271 1.00 41.81  ? 168 LEU A CB    1 
ATOM   474  C CG    . LEU A 1 87  ? 2.308   2.386   31.054 1.00 44.70  ? 168 LEU A CG    1 
ATOM   475  C CD1   . LEU A 1 87  ? 3.581   2.322   30.247 1.00 43.25  ? 168 LEU A CD1   1 
ATOM   476  C CD2   . LEU A 1 87  ? 1.138   2.047   30.140 1.00 46.52  ? 168 LEU A CD2   1 
ATOM   477  N N     . SER A 1 88  ? 1.847   0.416   35.480 1.00 44.71  ? 169 SER A N     1 
ATOM   478  C CA    . SER A 1 88  ? 1.630   -0.573  36.538 1.00 44.55  ? 169 SER A CA    1 
ATOM   479  C C     . SER A 1 88  ? 1.245   0.215   37.802 1.00 51.10  ? 169 SER A C     1 
ATOM   480  O O     . SER A 1 88  ? 1.784   1.303   38.011 1.00 49.88  ? 169 SER A O     1 
ATOM   481  C CB    . SER A 1 88  ? 2.861   -1.454  36.757 1.00 44.68  ? 169 SER A CB    1 
ATOM   482  O OG    . SER A 1 88  ? 3.994   -0.728  37.197 1.00 42.89  ? 169 SER A OG    1 
ATOM   483  N N     . GLU A 1 89  ? 0.285   -0.302  38.614 1.00 50.57  ? 170 GLU A N     1 
ATOM   484  C CA    . GLU A 1 89  ? -0.204  0.357   39.841 1.00 51.05  ? 170 GLU A CA    1 
ATOM   485  C C     . GLU A 1 89  ? 0.790   0.233   41.002 1.00 54.98  ? 170 GLU A C     1 
ATOM   486  O O     . GLU A 1 89  ? 0.774   1.047   41.935 1.00 55.34  ? 170 GLU A O     1 
ATOM   487  C CB    . GLU A 1 89  ? -1.583  -0.187  40.252 1.00 52.70  ? 170 GLU A CB    1 
ATOM   488  N N     . VAL A 1 90  ? 1.655   -0.788  40.937 1.00 49.56  ? 171 VAL A N     1 
ATOM   489  C CA    . VAL A 1 90  ? 2.705   -1.045  41.928 1.00 48.19  ? 171 VAL A CA    1 
ATOM   490  C C     . VAL A 1 90  ? 4.019   -1.218  41.172 1.00 47.89  ? 171 VAL A C     1 
ATOM   491  O O     . VAL A 1 90  ? 4.009   -1.487  39.972 1.00 44.29  ? 171 VAL A O     1 
ATOM   492  C CB    . VAL A 1 90  ? 2.414   -2.273  42.845 1.00 52.43  ? 171 VAL A CB    1 
ATOM   493  C CG1   . VAL A 1 90  ? 1.281   -1.992  43.828 1.00 52.67  ? 171 VAL A CG1   1 
ATOM   494  C CG2   . VAL A 1 90  ? 2.142   -3.545  42.037 1.00 52.05  ? 171 VAL A CG2   1 
ATOM   495  N N     . GLN A 1 91  ? 5.145   -1.070  41.878 1.00 43.87  ? 172 GLN A N     1 
ATOM   496  C CA    . GLN A 1 91  ? 6.465   -1.263  41.294 1.00 42.53  ? 172 GLN A CA    1 
ATOM   497  C C     . GLN A 1 91  ? 6.690   -2.779  41.100 1.00 42.30  ? 172 GLN A C     1 
ATOM   498  O O     . GLN A 1 91  ? 6.678   -3.545  42.066 1.00 41.47  ? 172 GLN A O     1 
ATOM   499  C CB    . GLN A 1 91  ? 7.522   -0.654  42.232 1.00 44.01  ? 172 GLN A CB    1 
ATOM   500  C CG    . GLN A 1 91  ? 8.951   -1.075  41.941 1.00 54.59  ? 172 GLN A CG    1 
ATOM   501  C CD    . GLN A 1 91  ? 9.484   -0.348  40.752 1.00 51.73  ? 172 GLN A CD    1 
ATOM   502  O OE1   . GLN A 1 91  ? 9.959   0.779   40.865 1.00 48.24  ? 172 GLN A OE1   1 
ATOM   503  N NE2   . GLN A 1 91  ? 9.411   -0.984  39.587 1.00 49.03  ? 172 GLN A NE2   1 
ATOM   504  N N     . LEU A 1 92  ? 6.852   -3.204  39.845 1.00 37.87  ? 173 LEU A N     1 
ATOM   505  C CA    . LEU A 1 92  ? 7.067   -4.613  39.525 1.00 35.85  ? 173 LEU A CA    1 
ATOM   506  C C     . LEU A 1 92  ? 8.541   -4.862  39.237 1.00 36.74  ? 173 LEU A C     1 
ATOM   507  O O     . LEU A 1 92  ? 9.342   -3.937  39.286 1.00 35.40  ? 173 LEU A O     1 
ATOM   508  C CB    . LEU A 1 92  ? 6.182   -5.036  38.333 1.00 36.49  ? 173 LEU A CB    1 
ATOM   509  C CG    . LEU A 1 92  ? 4.663   -4.859  38.500 1.00 41.24  ? 173 LEU A CG    1 
ATOM   510  C CD1   . LEU A 1 92  ? 3.960   -5.095  37.184 1.00 40.14  ? 173 LEU A CD1   1 
ATOM   511  C CD2   . LEU A 1 92  ? 4.089   -5.781  39.598 1.00 43.90  ? 173 LEU A CD2   1 
ATOM   512  N N     . ASN A 1 93  ? 8.913   -6.114  38.963 1.00 32.23  ? 174 ASN A N     1 
ATOM   513  C CA    . ASN A 1 93  ? 10.293  -6.442  38.641 1.00 31.27  ? 174 ASN A CA    1 
ATOM   514  C C     . ASN A 1 93  ? 10.294  -7.549  37.616 1.00 33.41  ? 174 ASN A C     1 
ATOM   515  O O     . ASN A 1 93  ? 9.217   -8.042  37.245 1.00 33.04  ? 174 ASN A O     1 
ATOM   516  C CB    . ASN A 1 93  ? 11.082  -6.815  39.903 1.00 32.98  ? 174 ASN A CB    1 
ATOM   517  C CG    . ASN A 1 93  ? 10.560  -8.061  40.575 1.00 38.31  ? 174 ASN A CG    1 
ATOM   518  O OD1   . ASN A 1 93  ? 10.734  -9.176  40.083 1.00 36.51  ? 174 ASN A OD1   1 
ATOM   519  N ND2   . ASN A 1 93  ? 9.899   -7.889  41.704 1.00 42.56  ? 174 ASN A ND2   1 
ATOM   520  N N     . HIS A 1 94  ? 11.486  -7.953  37.152 1.00 31.23  ? 175 HIS A N     1 
ATOM   521  C CA    . HIS A 1 94  ? 11.624  -8.972  36.094 1.00 31.35  ? 175 HIS A CA    1 
ATOM   522  C C     . HIS A 1 94  ? 10.847  -10.290 36.328 1.00 34.93  ? 175 HIS A C     1 
ATOM   523  O O     . HIS A 1 94  ? 10.439  -10.936 35.354 1.00 35.23  ? 175 HIS A O     1 
ATOM   524  C CB    . HIS A 1 94  ? 13.097  -9.270  35.802 1.00 31.92  ? 175 HIS A CB    1 
ATOM   525  C CG    . HIS A 1 94  ? 13.836  -9.876  36.960 1.00 35.27  ? 175 HIS A CG    1 
ATOM   526  N ND1   . HIS A 1 94  ? 14.007  -11.238 37.065 1.00 37.51  ? 175 HIS A ND1   1 
ATOM   527  C CD2   . HIS A 1 94  ? 14.496  -9.274  37.973 1.00 35.90  ? 175 HIS A CD2   1 
ATOM   528  C CE1   . HIS A 1 94  ? 14.710  -11.423 38.173 1.00 35.53  ? 175 HIS A CE1   1 
ATOM   529  N NE2   . HIS A 1 94  ? 15.049  -10.276 38.736 1.00 36.11  ? 175 HIS A NE2   1 
ATOM   530  N N     . MET A 1 95  ? 10.654  -10.704 37.610 1.00 33.86  ? 176 MET A N     1 
ATOM   531  C CA    . MET A 1 95  ? 9.934   -11.950 37.900 1.00 34.57  ? 176 MET A CA    1 
ATOM   532  C C     . MET A 1 95  ? 8.420   -11.860 37.597 1.00 39.15  ? 176 MET A C     1 
ATOM   533  O O     . MET A 1 95  ? 7.733   -12.876 37.633 1.00 39.22  ? 176 MET A O     1 
ATOM   534  C CB    . MET A 1 95  ? 10.212  -12.405 39.351 1.00 36.81  ? 176 MET A CB    1 
ATOM   535  C CG    . MET A 1 95  ? 11.679  -12.747 39.594 1.00 41.38  ? 176 MET A CG    1 
ATOM   536  S SD    . MET A 1 95  ? 12.382  -14.072 38.541 1.00 47.92  ? 176 MET A SD    1 
ATOM   537  C CE    . MET A 1 95  ? 11.319  -15.478 38.981 1.00 44.49  ? 176 MET A CE    1 
ATOM   538  N N     . ASP A 1 96  ? 7.907   -10.640 37.295 1.00 35.36  ? 177 ASP A N     1 
ATOM   539  C CA    . ASP A 1 96  ? 6.489   -10.418 36.987 1.00 35.30  ? 177 ASP A CA    1 
ATOM   540  C C     . ASP A 1 96  ? 6.216   -10.357 35.485 1.00 41.00  ? 177 ASP A C     1 
ATOM   541  O O     . ASP A 1 96  ? 5.060   -10.168 35.076 1.00 41.62  ? 177 ASP A O     1 
ATOM   542  C CB    . ASP A 1 96  ? 6.007   -9.114  37.653 1.00 37.69  ? 177 ASP A CB    1 
ATOM   543  C CG    . ASP A 1 96  ? 6.151   -9.096  39.155 1.00 42.15  ? 177 ASP A CG    1 
ATOM   544  O OD1   . ASP A 1 96  ? 5.714   -10.082 39.808 1.00 48.06  ? 177 ASP A OD1   1 
ATOM   545  O OD2   . ASP A 1 96  ? 6.729   -8.113  39.686 1.00 39.01  ? 177 ASP A OD2   1 
ATOM   546  N N     . ASP A 1 97  ? 7.269   -10.477 34.654 1.00 36.55  ? 178 ASP A N     1 
ATOM   547  C CA    . ASP A 1 97  ? 7.125   -10.342 33.207 1.00 35.84  ? 178 ASP A CA    1 
ATOM   548  C C     . ASP A 1 97  ? 6.037   -11.265 32.600 1.00 37.94  ? 178 ASP A C     1 
ATOM   549  O O     . ASP A 1 97  ? 5.312   -10.796 31.728 1.00 35.30  ? 178 ASP A O     1 
ATOM   550  C CB    . ASP A 1 97  ? 8.477   -10.473 32.469 1.00 37.27  ? 178 ASP A CB    1 
ATOM   551  C CG    . ASP A 1 97  ? 9.197   -11.804 32.582 1.00 39.05  ? 178 ASP A CG    1 
ATOM   552  O OD1   . ASP A 1 97  ? 8.753   -12.656 33.386 1.00 36.79  ? 178 ASP A OD1   1 
ATOM   553  O OD2   . ASP A 1 97  ? 10.214  -11.989 31.875 1.00 36.38  ? 178 ASP A OD2   1 
ATOM   554  N N     . HIS A 1 98  ? 5.846   -12.510 33.123 1.00 35.51  ? 179 HIS A N     1 
ATOM   555  C CA    . HIS A 1 98  ? 4.819   -13.420 32.578 1.00 37.32  ? 179 HIS A CA    1 
ATOM   556  C C     . HIS A 1 98  ? 3.369   -13.021 32.920 1.00 40.20  ? 179 HIS A C     1 
ATOM   557  O O     . HIS A 1 98  ? 2.442   -13.477 32.247 1.00 39.18  ? 179 HIS A O     1 
ATOM   558  C CB    . HIS A 1 98  ? 5.105   -14.884 32.982 1.00 39.52  ? 179 HIS A CB    1 
ATOM   559  C CG    . HIS A 1 98  ? 6.301   -15.410 32.266 1.00 44.01  ? 179 HIS A CG    1 
ATOM   560  N ND1   . HIS A 1 98  ? 6.183   -16.032 31.041 1.00 46.04  ? 179 HIS A ND1   1 
ATOM   561  C CD2   . HIS A 1 98  ? 7.615   -15.310 32.581 1.00 46.61  ? 179 HIS A CD2   1 
ATOM   562  C CE1   . HIS A 1 98  ? 7.417   -16.312 30.659 1.00 45.80  ? 179 HIS A CE1   1 
ATOM   563  N NE2   . HIS A 1 98  ? 8.315   -15.866 31.528 1.00 46.77  ? 179 HIS A NE2   1 
ATOM   564  N N     . THR A 1 99  ? 3.181   -12.157 33.936 1.00 37.89  ? 180 THR A N     1 
ATOM   565  C CA    . THR A 1 99  ? 1.854   -11.685 34.365 1.00 37.55  ? 180 THR A CA    1 
ATOM   566  C C     . THR A 1 99  ? 1.383   -10.492 33.532 1.00 40.96  ? 180 THR A C     1 
ATOM   567  O O     . THR A 1 99  ? 0.193   -10.159 33.558 1.00 40.94  ? 180 THR A O     1 
ATOM   568  C CB    . THR A 1 99  ? 1.856   -11.319 35.874 1.00 44.86  ? 180 THR A CB    1 
ATOM   569  O OG1   . THR A 1 99  ? 2.515   -10.062 36.068 1.00 44.66  ? 180 THR A OG1   1 
ATOM   570  C CG2   . THR A 1 99  ? 2.480   -12.403 36.757 1.00 43.31  ? 180 THR A CG2   1 
ATOM   571  N N     . LEU A 1 100 ? 2.315   -9.843  32.798 1.00 35.87  ? 181 LEU A N     1 
ATOM   572  C CA    . LEU A 1 100 ? 2.008   -8.621  32.046 1.00 35.17  ? 181 LEU A CA    1 
ATOM   573  C C     . LEU A 1 100 ? 1.003   -8.807  30.902 1.00 38.79  ? 181 LEU A C     1 
ATOM   574  O O     . LEU A 1 100 ? 0.105   -7.970  30.832 1.00 38.48  ? 181 LEU A O     1 
ATOM   575  C CB    . LEU A 1 100 ? 3.271   -7.902  31.579 1.00 34.66  ? 181 LEU A CB    1 
ATOM   576  C CG    . LEU A 1 100 ? 3.634   -6.687  32.457 1.00 38.88  ? 181 LEU A CG    1 
ATOM   577  C CD1   . LEU A 1 100 ? 3.960   -7.091  33.918 1.00 39.79  ? 181 LEU A CD1   1 
ATOM   578  C CD2   . LEU A 1 100 ? 4.765   -5.906  31.871 1.00 38.91  ? 181 LEU A CD2   1 
ATOM   579  N N     . PRO A 1 101 ? 1.003   -9.874  30.060 1.00 36.07  ? 182 PRO A N     1 
ATOM   580  C CA    . PRO A 1 101 ? -0.039  -9.954  29.030 1.00 37.18  ? 182 PRO A CA    1 
ATOM   581  C C     . PRO A 1 101 ? -1.454  -10.026 29.595 1.00 43.31  ? 182 PRO A C     1 
ATOM   582  O O     . PRO A 1 101 ? -2.343  -9.334  29.104 1.00 42.96  ? 182 PRO A O     1 
ATOM   583  C CB    . PRO A 1 101 ? 0.337   -11.216 28.238 1.00 39.10  ? 182 PRO A CB    1 
ATOM   584  C CG    . PRO A 1 101 ? 1.776   -11.386 28.479 1.00 42.33  ? 182 PRO A CG    1 
ATOM   585  C CD    . PRO A 1 101 ? 1.971   -10.975 29.905 1.00 37.65  ? 182 PRO A CD    1 
ATOM   586  N N     . GLY A 1 102 ? -1.639  -10.843 30.623 1.00 42.51  ? 183 GLY A N     1 
ATOM   587  C CA    . GLY A 1 102 ? -2.939  -11.059 31.249 1.00 43.79  ? 183 GLY A CA    1 
ATOM   588  C C     . GLY A 1 102 ? -3.434  -9.909  32.098 1.00 49.50  ? 183 GLY A C     1 
ATOM   589  O O     . GLY A 1 102 ? -4.593  -9.501  31.973 1.00 49.66  ? 183 GLY A O     1 
ATOM   590  N N     . LYS A 1 103 ? -2.561  -9.388  32.977 1.00 46.97  ? 184 LYS A N     1 
ATOM   591  C CA    . LYS A 1 103 ? -2.915  -8.297  33.877 1.00 47.01  ? 184 LYS A CA    1 
ATOM   592  C C     . LYS A 1 103 ? -2.900  -6.916  33.241 1.00 51.67  ? 184 LYS A C     1 
ATOM   593  O O     . LYS A 1 103 ? -3.804  -6.132  33.520 1.00 52.85  ? 184 LYS A O     1 
ATOM   594  C CB    . LYS A 1 103 ? -2.031  -8.312  35.124 1.00 49.75  ? 184 LYS A CB    1 
ATOM   595  N N     . TYR A 1 104 ? -1.888  -6.603  32.407 1.00 46.60  ? 185 TYR A N     1 
ATOM   596  C CA    . TYR A 1 104 ? -1.731  -5.262  31.851 1.00 46.19  ? 185 TYR A CA    1 
ATOM   597  C C     . TYR A 1 104 ? -1.859  -5.128  30.331 1.00 48.39  ? 185 TYR A C     1 
ATOM   598  O O     . TYR A 1 104 ? -1.878  -3.998  29.843 1.00 47.82  ? 185 TYR A O     1 
ATOM   599  C CB    . TYR A 1 104 ? -0.386  -4.657  32.307 1.00 47.51  ? 185 TYR A CB    1 
ATOM   600  C CG    . TYR A 1 104 ? -0.241  -4.577  33.811 1.00 49.20  ? 185 TYR A CG    1 
ATOM   601  C CD1   . TYR A 1 104 ? -0.769  -3.506  34.526 1.00 51.06  ? 185 TYR A CD1   1 
ATOM   602  C CD2   . TYR A 1 104 ? 0.412   -5.580  34.522 1.00 49.94  ? 185 TYR A CD2   1 
ATOM   603  C CE1   . TYR A 1 104 ? -0.647  -3.433  35.913 1.00 52.22  ? 185 TYR A CE1   1 
ATOM   604  C CE2   . TYR A 1 104 ? 0.528   -5.525  35.908 1.00 51.39  ? 185 TYR A CE2   1 
ATOM   605  C CZ    . TYR A 1 104 ? 0.008   -4.444  36.600 1.00 60.49  ? 185 TYR A CZ    1 
ATOM   606  O OH    . TYR A 1 104 ? 0.128   -4.388  37.968 1.00 63.06  ? 185 TYR A OH    1 
ATOM   607  N N     . GLY A 1 105 ? -1.939  -6.245  29.604 1.00 42.77  ? 186 GLY A N     1 
ATOM   608  C CA    . GLY A 1 105 ? -2.036  -6.221  28.144 1.00 41.16  ? 186 GLY A CA    1 
ATOM   609  C C     . GLY A 1 105 ? -0.723  -5.875  27.464 1.00 42.11  ? 186 GLY A C     1 
ATOM   610  O O     . GLY A 1 105 ? -0.724  -5.306  26.369 1.00 41.93  ? 186 GLY A O     1 
ATOM   611  N N     . ILE A 1 106 ? 0.406   -6.210  28.122 1.00 37.23  ? 187 ILE A N     1 
ATOM   612  C CA    . ILE A 1 106 ? 1.769   -5.936  27.654 1.00 35.66  ? 187 ILE A CA    1 
ATOM   613  C C     . ILE A 1 106 ? 2.547   -7.239  27.398 1.00 38.00  ? 187 ILE A C     1 
ATOM   614  O O     . ILE A 1 106 ? 2.644   -8.092  28.283 1.00 37.06  ? 187 ILE A O     1 
ATOM   615  C CB    . ILE A 1 106 ? 2.528   -5.005  28.658 1.00 36.80  ? 187 ILE A CB    1 
ATOM   616  C CG1   . ILE A 1 106 ? 1.827   -3.623  28.803 1.00 35.36  ? 187 ILE A CG1   1 
ATOM   617  C CG2   . ILE A 1 106 ? 4.027   -4.845  28.288 1.00 36.74  ? 187 ILE A CG2   1 
ATOM   618  C CD1   . ILE A 1 106 ? 2.455   -2.677  29.856 1.00 34.43  ? 187 ILE A CD1   1 
ATOM   619  N N     . GLY A 1 107 ? 3.167   -7.323  26.227 1.00 34.29  ? 188 GLY A N     1 
ATOM   620  C CA    . GLY A 1 107 ? 4.011   -8.448  25.855 1.00 34.05  ? 188 GLY A CA    1 
ATOM   621  C C     . GLY A 1 107 ? 5.429   -8.000  25.590 1.00 34.58  ? 188 GLY A C     1 
ATOM   622  O O     . GLY A 1 107 ? 5.707   -6.797  25.620 1.00 31.99  ? 188 GLY A O     1 
ATOM   623  N N     . PHE A 1 108 ? 6.319   -8.960  25.272 1.00 31.84  ? 189 PHE A N     1 
ATOM   624  C CA    . PHE A 1 108 ? 7.735   -8.683  25.054 1.00 30.40  ? 189 PHE A CA    1 
ATOM   625  C C     . PHE A 1 108 ? 8.348   -9.506  23.968 1.00 33.63  ? 189 PHE A C     1 
ATOM   626  O O     . PHE A 1 108 ? 8.073   -10.702 23.862 1.00 33.26  ? 189 PHE A O     1 
ATOM   627  C CB    . PHE A 1 108 ? 8.539   -9.038  26.316 1.00 31.13  ? 189 PHE A CB    1 
ATOM   628  C CG    . PHE A 1 108 ? 8.231   -8.240  27.550 1.00 31.42  ? 189 PHE A CG    1 
ATOM   629  C CD1   . PHE A 1 108 ? 8.904   -7.051  27.814 1.00 32.82  ? 189 PHE A CD1   1 
ATOM   630  C CD2   . PHE A 1 108 ? 7.347   -8.731  28.508 1.00 31.71  ? 189 PHE A CD2   1 
ATOM   631  C CE1   . PHE A 1 108 ? 8.658   -6.335  28.997 1.00 34.28  ? 189 PHE A CE1   1 
ATOM   632  C CE2   . PHE A 1 108 ? 7.088   -8.004  29.681 1.00 34.62  ? 189 PHE A CE2   1 
ATOM   633  C CZ    . PHE A 1 108 ? 7.773   -6.836  29.935 1.00 32.88  ? 189 PHE A CZ    1 
ATOM   634  N N     . THR A 1 109 ? 9.274   -8.884  23.228 1.00 30.68  ? 190 THR A N     1 
ATOM   635  C CA    . THR A 1 109 ? 10.159  -9.523  22.266 1.00 30.39  ? 190 THR A CA    1 
ATOM   636  C C     . THR A 1 109 ? 11.413  -8.675  22.119 1.00 33.24  ? 190 THR A C     1 
ATOM   637  O O     . THR A 1 109 ? 11.527  -7.655  22.789 1.00 33.07  ? 190 THR A O     1 
ATOM   638  C CB    . THR A 1 109 ? 9.444   -9.894  20.936 1.00 37.50  ? 190 THR A CB    1 
ATOM   639  O OG1   . THR A 1 109 ? 10.300  -10.784 20.197 1.00 37.28  ? 190 THR A OG1   1 
ATOM   640  C CG2   . THR A 1 109 ? 9.066   -8.661  20.085 1.00 37.80  ? 190 THR A CG2   1 
ATOM   641  N N     . ASN A 1 110 ? 12.361  -9.113  21.292 1.00 31.21  ? 191 ASN A N     1 
ATOM   642  C CA    . ASN A 1 110 ? 13.563  -8.339  20.973 1.00 31.12  ? 191 ASN A CA    1 
ATOM   643  C C     . ASN A 1 110 ? 13.821  -8.415  19.523 1.00 35.27  ? 191 ASN A C     1 
ATOM   644  O O     . ASN A 1 110 ? 13.465  -9.434  18.883 1.00 34.20  ? 191 ASN A O     1 
ATOM   645  C CB    . ASN A 1 110 ? 14.795  -8.873  21.653 1.00 29.60  ? 191 ASN A CB    1 
ATOM   646  C CG    . ASN A 1 110 ? 14.801  -8.582  23.114 1.00 42.11  ? 191 ASN A CG    1 
ATOM   647  O OD1   . ASN A 1 110 ? 14.508  -7.477  23.548 1.00 34.68  ? 191 ASN A OD1   1 
ATOM   648  N ND2   . ASN A 1 110 ? 15.126  -9.566  23.876 1.00 38.15  ? 191 ASN A ND2   1 
ATOM   649  N N     . MET A 1 111 ? 14.494  -7.368  18.982 1.00 30.52  ? 192 MET A N     1 
ATOM   650  C CA    . MET A 1 111 ? 14.833  -7.332  17.538 1.00 31.41  ? 192 MET A CA    1 
ATOM   651  C C     . MET A 1 111 ? 15.809  -8.488  17.195 1.00 35.70  ? 192 MET A C     1 
ATOM   652  O O     . MET A 1 111 ? 15.641  -9.146  16.169 1.00 35.34  ? 192 MET A O     1 
ATOM   653  C CB    . MET A 1 111 ? 15.476  -5.957  17.229 1.00 35.00  ? 192 MET A CB    1 
ATOM   654  C CG    . MET A 1 111 ? 15.953  -5.773  15.804 1.00 40.47  ? 192 MET A CG    1 
ATOM   655  S SD    . MET A 1 111 ? 14.564  -5.174  14.829 1.00 44.12  ? 192 MET A SD    1 
ATOM   656  C CE    . MET A 1 111 ? 15.438  -4.264  13.531 1.00 43.08  ? 192 MET A CE    1 
ATOM   657  N N     . VAL A 1 112 ? 16.842  -8.699  18.025 1.00 33.00  ? 193 VAL A N     1 
ATOM   658  C CA    . VAL A 1 112 ? 17.895  -9.701  17.818 1.00 33.00  ? 193 VAL A CA    1 
ATOM   659  C C     . VAL A 1 112 ? 17.861  -10.740 18.975 1.00 35.25  ? 193 VAL A C     1 
ATOM   660  O O     . VAL A 1 112 ? 17.737  -10.372 20.154 1.00 30.78  ? 193 VAL A O     1 
ATOM   661  C CB    . VAL A 1 112 ? 19.298  -9.022  17.647 1.00 38.34  ? 193 VAL A CB    1 
ATOM   662  C CG1   . VAL A 1 112 ? 20.429  -10.055 17.579 1.00 39.40  ? 193 VAL A CG1   1 
ATOM   663  C CG2   . VAL A 1 112 ? 19.326  -8.125  16.394 1.00 38.08  ? 193 VAL A CG2   1 
ATOM   664  N N     . GLU A 1 113 ? 17.989  -12.017 18.620 1.00 34.89  ? 194 GLU A N     1 
ATOM   665  C CA    . GLU A 1 113 ? 17.957  -13.116 19.594 1.00 35.18  ? 194 GLU A CA    1 
ATOM   666  C C     . GLU A 1 113 ? 19.279  -13.263 20.385 1.00 37.13  ? 194 GLU A C     1 
ATOM   667  O O     . GLU A 1 113 ? 19.242  -13.666 21.544 1.00 38.27  ? 194 GLU A O     1 
ATOM   668  C CB    . GLU A 1 113 ? 17.627  -14.410 18.812 1.00 37.09  ? 194 GLU A CB    1 
ATOM   669  C CG    . GLU A 1 113 ? 17.277  -15.624 19.641 1.00 52.73  ? 194 GLU A CG    1 
ATOM   670  C CD    . GLU A 1 113 ? 17.000  -16.833 18.768 1.00 77.87  ? 194 GLU A CD    1 
ATOM   671  O OE1   . GLU A 1 113 ? 15.846  -16.973 18.302 1.00 80.16  ? 194 GLU A OE1   1 
ATOM   672  O OE2   . GLU A 1 113 ? 17.942  -17.621 18.520 1.00 67.22  ? 194 GLU A OE2   1 
ATOM   673  N N     . ARG A 1 114 ? 20.443  -13.050 19.735 1.00 34.26  ? 195 ARG A N     1 
ATOM   674  C CA    . ARG A 1 114 ? 21.756  -13.293 20.340 1.00 34.19  ? 195 ARG A CA    1 
ATOM   675  C C     . ARG A 1 114 ? 22.010  -12.392 21.533 1.00 36.58  ? 195 ARG A C     1 
ATOM   676  O O     . ARG A 1 114 ? 21.785  -11.194 21.417 1.00 36.51  ? 195 ARG A O     1 
ATOM   677  C CB    . ARG A 1 114 ? 22.889  -13.110 19.323 1.00 36.15  ? 195 ARG A CB    1 
ATOM   678  C CG    . ARG A 1 114 ? 24.296  -13.442 19.872 1.00 41.42  ? 195 ARG A CG    1 
ATOM   679  C CD    . ARG A 1 114 ? 25.349  -13.545 18.759 1.00 48.97  ? 195 ARG A CD    1 
ATOM   680  N NE    . ARG A 1 114 ? 25.669  -12.241 18.161 1.00 51.19  ? 195 ARG A NE    1 
ATOM   681  C CZ    . ARG A 1 114 ? 26.735  -11.500 18.465 1.00 60.95  ? 195 ARG A CZ    1 
ATOM   682  N NH1   . ARG A 1 114 ? 27.611  -11.922 19.367 1.00 49.07  ? 195 ARG A NH1   1 
ATOM   683  N NH2   . ARG A 1 114 ? 26.940  -10.337 17.853 1.00 48.87  ? 195 ARG A NH2   1 
ATOM   684  N N     . THR A 1 115 ? 22.544  -12.957 22.616 1.00 31.81  ? 196 THR A N     1 
ATOM   685  C CA    . THR A 1 115 ? 22.886  -12.204 23.814 1.00 32.22  ? 196 THR A CA    1 
ATOM   686  C C     . THR A 1 115 ? 24.250  -11.556 23.618 1.00 35.83  ? 196 THR A C     1 
ATOM   687  O O     . THR A 1 115 ? 25.180  -12.210 23.138 1.00 36.00  ? 196 THR A O     1 
ATOM   688  C CB    . THR A 1 115 ? 22.950  -13.176 25.025 1.00 36.82  ? 196 THR A CB    1 
ATOM   689  O OG1   . THR A 1 115 ? 21.644  -13.672 25.295 1.00 34.88  ? 196 THR A OG1   1 
ATOM   690  C CG2   . THR A 1 115 ? 23.582  -12.555 26.269 1.00 35.60  ? 196 THR A CG2   1 
ATOM   691  N N     . THR A 1 116 ? 24.380  -10.293 24.043 1.00 34.18  ? 197 THR A N     1 
ATOM   692  C CA    . THR A 1 116 ? 25.671  -9.612  24.037 1.00 34.89  ? 197 THR A CA    1 
ATOM   693  C C     . THR A 1 116 ? 25.717  -8.671  25.242 1.00 36.97  ? 197 THR A C     1 
ATOM   694  O O     . THR A 1 116 ? 24.654  -8.272  25.732 1.00 35.91  ? 197 THR A O     1 
ATOM   695  C CB    . THR A 1 116 ? 25.907  -8.776  22.729 1.00 38.71  ? 197 THR A CB    1 
ATOM   696  O OG1   . THR A 1 116 ? 24.907  -7.760  22.631 1.00 39.77  ? 197 THR A OG1   1 
ATOM   697  C CG2   . THR A 1 116 ? 25.981  -9.613  21.460 1.00 38.73  ? 197 THR A CG2   1 
ATOM   698  N N     . PRO A 1 117 ? 26.904  -8.181  25.663 1.00 34.98  ? 198 PRO A N     1 
ATOM   699  C CA    . PRO A 1 117 ? 26.927  -7.190  26.772 1.00 35.13  ? 198 PRO A CA    1 
ATOM   700  C C     . PRO A 1 117 ? 26.182  -5.870  26.465 1.00 37.30  ? 198 PRO A C     1 
ATOM   701  O O     . PRO A 1 117 ? 25.505  -5.319  27.340 1.00 37.13  ? 198 PRO A O     1 
ATOM   702  C CB    . PRO A 1 117 ? 28.423  -6.966  27.026 1.00 37.78  ? 198 PRO A CB    1 
ATOM   703  C CG    . PRO A 1 117 ? 29.105  -8.194  26.431 1.00 41.83  ? 198 PRO A CG    1 
ATOM   704  C CD    . PRO A 1 117 ? 28.271  -8.526  25.215 1.00 36.40  ? 198 PRO A CD    1 
ATOM   705  N N     . GLY A 1 118 ? 26.275  -5.395  25.219 1.00 34.71  ? 199 GLY A N     1 
ATOM   706  C CA    . GLY A 1 118 ? 25.614  -4.169  24.791 1.00 33.98  ? 199 GLY A CA    1 
ATOM   707  C C     . GLY A 1 118 ? 25.247  -4.178  23.316 1.00 38.10  ? 199 GLY A C     1 
ATOM   708  O O     . GLY A 1 118 ? 25.668  -5.070  22.561 1.00 38.56  ? 199 GLY A O     1 
ATOM   709  N N     . SER A 1 119 ? 24.500  -3.135  22.879 1.00 34.99  ? 200 SER A N     1 
ATOM   710  C CA    . SER A 1 119 ? 24.046  -2.966  21.479 1.00 35.04  ? 200 SER A CA    1 
ATOM   711  C C     . SER A 1 119 ? 25.170  -2.836  20.448 1.00 40.04  ? 200 SER A C     1 
ATOM   712  O O     . SER A 1 119 ? 24.974  -3.196  19.268 1.00 40.38  ? 200 SER A O     1 
ATOM   713  C CB    . SER A 1 119 ? 23.111  -1.758  21.372 1.00 39.47  ? 200 SER A CB    1 
ATOM   714  O OG    . SER A 1 119 ? 23.790  -0.514  21.492 1.00 39.70  ? 200 SER A OG    1 
ATOM   715  N N     . LYS A 1 120 ? 26.335  -2.322  20.882 1.00 37.54  ? 201 LYS A N     1 
ATOM   716  C CA    . LYS A 1 120 ? 27.485  -2.056  20.013 1.00 40.43  ? 201 LYS A CA    1 
ATOM   717  C C     . LYS A 1 120 ? 28.163  -3.331  19.470 1.00 46.16  ? 201 LYS A C     1 
ATOM   718  O O     . LYS A 1 120 ? 28.929  -3.249  18.515 1.00 46.07  ? 201 LYS A O     1 
ATOM   719  C CB    . LYS A 1 120 ? 28.493  -1.125  20.711 1.00 43.74  ? 201 LYS A CB    1 
ATOM   720  C CG    . LYS A 1 120 ? 28.008  0.329   20.777 1.00 55.03  ? 201 LYS A CG    1 
ATOM   721  C CD    . LYS A 1 120 ? 28.962  1.219   21.543 1.00 65.27  ? 201 LYS A CD    1 
ATOM   722  N N     . ASP A 1 121 ? 27.857  -4.505  20.055 1.00 43.07  ? 202 ASP A N     1 
ATOM   723  C CA    . ASP A 1 121 ? 28.434  -5.782  19.610 1.00 42.52  ? 202 ASP A CA    1 
ATOM   724  C C     . ASP A 1 121 ? 27.656  -6.448  18.459 1.00 48.29  ? 202 ASP A C     1 
ATOM   725  O O     . ASP A 1 121 ? 28.149  -7.415  17.880 1.00 50.70  ? 202 ASP A O     1 
ATOM   726  C CB    . ASP A 1 121 ? 28.589  -6.743  20.817 1.00 44.65  ? 202 ASP A CB    1 
ATOM   727  C CG    . ASP A 1 121 ? 29.317  -6.120  22.004 1.00 60.51  ? 202 ASP A CG    1 
ATOM   728  O OD1   . ASP A 1 121 ? 30.493  -5.707  21.834 1.00 63.05  ? 202 ASP A OD1   1 
ATOM   729  O OD2   . ASP A 1 121 ? 28.706  -6.027  23.098 1.00 62.88  ? 202 ASP A OD2   1 
ATOM   730  N N     . LEU A 1 122 ? 26.475  -5.914  18.089 1.00 42.37  ? 203 LEU A N     1 
ATOM   731  C CA    . LEU A 1 122 ? 25.645  -6.478  17.024 1.00 40.19  ? 203 LEU A CA    1 
ATOM   732  C C     . LEU A 1 122 ? 26.009  -5.962  15.639 1.00 46.47  ? 203 LEU A C     1 
ATOM   733  O O     . LEU A 1 122 ? 26.260  -4.767  15.473 1.00 46.80  ? 203 LEU A O     1 
ATOM   734  C CB    . LEU A 1 122 ? 24.149  -6.247  17.286 1.00 39.17  ? 203 LEU A CB    1 
ATOM   735  C CG    . LEU A 1 122 ? 23.578  -6.862  18.599 1.00 43.32  ? 203 LEU A CG    1 
ATOM   736  C CD1   . LEU A 1 122 ? 22.135  -6.489  18.773 1.00 42.53  ? 203 LEU A CD1   1 
ATOM   737  C CD2   . LEU A 1 122 ? 23.678  -8.370  18.575 1.00 46.38  ? 203 LEU A CD2   1 
ATOM   738  N N     . SER A 1 123 ? 25.995  -6.857  14.641 1.00 44.79  ? 204 SER A N     1 
ATOM   739  C CA    . SER A 1 123 ? 26.289  -6.495  13.249 1.00 45.40  ? 204 SER A CA    1 
ATOM   740  C C     . SER A 1 123 ? 25.011  -6.027  12.511 1.00 50.06  ? 204 SER A C     1 
ATOM   741  O O     . SER A 1 123 ? 23.889  -6.294  12.958 1.00 50.03  ? 204 SER A O     1 
ATOM   742  C CB    . SER A 1 123 ? 26.920  -7.679  12.511 1.00 49.02  ? 204 SER A CB    1 
ATOM   743  O OG    . SER A 1 123 ? 25.959  -8.642  12.110 1.00 55.52  ? 204 SER A OG    1 
ATOM   744  N N     . SER A 1 124 ? 25.196  -5.345  11.377 1.00 47.27  ? 205 SER A N     1 
ATOM   745  C CA    . SER A 1 124 ? 24.121  -4.863  10.512 1.00 47.32  ? 205 SER A CA    1 
ATOM   746  C C     . SER A 1 124 ? 23.239  -6.020  10.002 1.00 51.08  ? 205 SER A C     1 
ATOM   747  O O     . SER A 1 124 ? 22.012  -5.899  10.009 1.00 49.19  ? 205 SER A O     1 
ATOM   748  C CB    . SER A 1 124 ? 24.711  -4.105  9.321  1.00 48.23  ? 205 SER A CB    1 
ATOM   749  O OG    . SER A 1 124 ? 23.688  -3.667  8.443  1.00 54.26  ? 205 SER A OG    1 
ATOM   750  N N     . LYS A 1 125 ? 23.868  -7.121  9.534  1.00 49.87  ? 206 LYS A N     1 
ATOM   751  C CA    . LYS A 1 125 ? 23.172  -8.308  9.027  1.00 48.48  ? 206 LYS A CA    1 
ATOM   752  C C     . LYS A 1 125 ? 22.270  -8.914  10.126 1.00 48.42  ? 206 LYS A C     1 
ATOM   753  O O     . LYS A 1 125 ? 21.122  -9.265  9.844  1.00 47.43  ? 206 LYS A O     1 
ATOM   754  C CB    . LYS A 1 125 ? 24.178  -9.356  8.524  1.00 51.54  ? 206 LYS A CB    1 
ATOM   755  C CG    . LYS A 1 125 ? 24.764  -9.048  7.151  1.00 66.30  ? 206 LYS A CG    1 
ATOM   756  N N     . GLU A 1 126 ? 22.765  -8.990  11.376 1.00 45.70  ? 207 GLU A N     1 
ATOM   757  C CA    . GLU A 1 126 ? 21.971  -9.520  12.491 1.00 44.40  ? 207 GLU A CA    1 
ATOM   758  C C     . GLU A 1 126 ? 20.713  -8.684  12.695 1.00 45.11  ? 207 GLU A C     1 
ATOM   759  O O     . GLU A 1 126 ? 19.638  -9.234  12.925 1.00 43.20  ? 207 GLU A O     1 
ATOM   760  C CB    . GLU A 1 126 ? 22.775  -9.502  13.794 1.00 46.62  ? 207 GLU A CB    1 
ATOM   761  C CG    . GLU A 1 126 ? 23.891  -10.515 13.832 1.00 59.76  ? 207 GLU A CG    1 
ATOM   762  C CD    . GLU A 1 126 ? 24.581  -10.485 15.177 1.00 67.86  ? 207 GLU A CD    1 
ATOM   763  O OE1   . GLU A 1 126 ? 25.561  -9.722  15.332 1.00 54.18  ? 207 GLU A OE1   1 
ATOM   764  O OE2   . GLU A 1 126 ? 24.115  -11.202 16.088 1.00 59.04  ? 207 GLU A OE2   1 
ATOM   765  N N     . PHE A 1 127 ? 20.854  -7.352  12.612 1.00 40.81  ? 208 PHE A N     1 
ATOM   766  C CA    . PHE A 1 127 ? 19.736  -6.439  12.807 1.00 40.05  ? 208 PHE A CA    1 
ATOM   767  C C     . PHE A 1 127 ? 18.688  -6.601  11.701 1.00 42.00  ? 208 PHE A C     1 
ATOM   768  O O     . PHE A 1 127 ? 17.499  -6.663  11.996 1.00 40.69  ? 208 PHE A O     1 
ATOM   769  C CB    . PHE A 1 127 ? 20.231  -4.994  12.881 1.00 41.31  ? 208 PHE A CB    1 
ATOM   770  C CG    . PHE A 1 127 ? 20.745  -4.550  14.236 1.00 42.92  ? 208 PHE A CG    1 
ATOM   771  C CD1   . PHE A 1 127 ? 19.910  -4.553  15.348 1.00 45.73  ? 208 PHE A CD1   1 
ATOM   772  C CD2   . PHE A 1 127 ? 22.024  -4.021  14.371 1.00 45.32  ? 208 PHE A CD2   1 
ATOM   773  C CE1   . PHE A 1 127 ? 20.364  -4.067  16.588 1.00 47.41  ? 208 PHE A CE1   1 
ATOM   774  C CE2   . PHE A 1 127 ? 22.476  -3.537  15.609 1.00 48.32  ? 208 PHE A CE2   1 
ATOM   775  C CZ    . PHE A 1 127 ? 21.640  -3.560  16.703 1.00 46.47  ? 208 PHE A CZ    1 
ATOM   776  N N     . ARG A 1 128 ? 19.125  -6.706  10.436 1.00 40.11  ? 209 ARG A N     1 
ATOM   777  C CA    . ARG A 1 128 ? 18.188  -6.844  9.318  1.00 40.56  ? 209 ARG A CA    1 
ATOM   778  C C     . ARG A 1 128 ? 17.506  -8.210  9.304  1.00 43.57  ? 209 ARG A C     1 
ATOM   779  O O     . ARG A 1 128 ? 16.318  -8.288  8.974  1.00 43.16  ? 209 ARG A O     1 
ATOM   780  C CB    . ARG A 1 128 ? 18.830  -6.471  7.975  1.00 40.66  ? 209 ARG A CB    1 
ATOM   781  C CG    . ARG A 1 128 ? 19.099  -4.954  7.946  1.00 49.73  ? 209 ARG A CG    1 
ATOM   782  C CD    . ARG A 1 128 ? 19.872  -4.476  6.738  1.00 59.51  ? 209 ARG A CD    1 
ATOM   783  N NE    . ARG A 1 128 ? 21.290  -4.822  6.831  1.00 66.08  ? 209 ARG A NE    1 
ATOM   784  C CZ    . ARG A 1 128 ? 21.971  -5.453  5.881  1.00 77.83  ? 209 ARG A CZ    1 
ATOM   785  N NH1   . ARG A 1 128 ? 21.380  -5.787  4.740  1.00 70.22  ? 209 ARG A NH1   1 
ATOM   786  N NH2   . ARG A 1 128 ? 23.253  -5.736  6.056  1.00 65.64  ? 209 ARG A NH2   1 
ATOM   787  N N     . GLU A 1 129 ? 18.214  -9.264  9.748  1.00 40.96  ? 210 GLU A N     1 
ATOM   788  C CA    . GLU A 1 129 ? 17.624  -10.602 9.900  1.00 41.63  ? 210 GLU A CA    1 
ATOM   789  C C     . GLU A 1 129 ? 16.535  -10.468 11.001 1.00 42.29  ? 210 GLU A C     1 
ATOM   790  O O     . GLU A 1 129 ? 15.378  -10.841 10.784 1.00 42.31  ? 210 GLU A O     1 
ATOM   791  C CB    . GLU A 1 129 ? 18.706  -11.617 10.302 1.00 43.65  ? 210 GLU A CB    1 
ATOM   792  C CG    . GLU A 1 129 ? 18.173  -12.980 10.726 1.00 51.68  ? 210 GLU A CG    1 
ATOM   793  C CD    . GLU A 1 129 ? 19.234  -13.930 11.240 1.00 63.54  ? 210 GLU A CD    1 
ATOM   794  O OE1   . GLU A 1 129 ? 20.101  -13.486 12.027 1.00 48.68  ? 210 GLU A OE1   1 
ATOM   795  O OE2   . GLU A 1 129 ? 19.195  -15.122 10.863 1.00 59.24  ? 210 GLU A OE2   1 
ATOM   796  N N     . GLY A 1 130 ? 16.902  -9.840  12.121 1.00 37.89  ? 211 GLY A N     1 
ATOM   797  C CA    . GLY A 1 130 ? 15.980  -9.562  13.217 1.00 36.81  ? 211 GLY A CA    1 
ATOM   798  C C     . GLY A 1 130 ? 14.747  -8.790  12.782 1.00 39.07  ? 211 GLY A C     1 
ATOM   799  O O     . GLY A 1 130 ? 13.632  -9.177  13.134 1.00 37.69  ? 211 GLY A O     1 
ATOM   800  N N     . GLY A 1 131 ? 14.947  -7.758  11.952 1.00 36.67  ? 212 GLY A N     1 
ATOM   801  C CA    . GLY A 1 131 ? 13.860  -6.959  11.408 1.00 36.87  ? 212 GLY A CA    1 
ATOM   802  C C     . GLY A 1 131 ? 12.839  -7.773  10.624 1.00 41.46  ? 212 GLY A C     1 
ATOM   803  O O     . GLY A 1 131 ? 11.637  -7.617  10.837 1.00 41.15  ? 212 GLY A O     1 
ATOM   804  N N     . ARG A 1 132 ? 13.298  -8.656  9.706  1.00 40.92  ? 213 ARG A N     1 
ATOM   805  C CA    . ARG A 1 132 ? 12.428  -9.536  8.907  1.00 39.77  ? 213 ARG A CA    1 
ATOM   806  C C     . ARG A 1 132 ? 11.605  -10.476 9.832  1.00 42.49  ? 213 ARG A C     1 
ATOM   807  O O     . ARG A 1 132 ? 10.386  -10.566 9.690  1.00 42.61  ? 213 ARG A O     1 
ATOM   808  C CB    . ARG A 1 132 ? 13.283  -10.311 7.907  1.00 41.07  ? 213 ARG A CB    1 
ATOM   809  C CG    . ARG A 1 132 ? 12.506  -11.397 7.144  1.00 44.75  ? 213 ARG A CG    1 
ATOM   810  C CD    . ARG A 1 132 ? 13.352  -12.214 6.161  1.00 46.46  ? 213 ARG A CD    1 
ATOM   811  N NE    . ARG A 1 132 ? 14.530  -12.830 6.788  1.00 44.69  ? 213 ARG A NE    1 
ATOM   812  C CZ    . ARG A 1 132 ? 14.518  -13.946 7.509  1.00 55.34  ? 213 ARG A CZ    1 
ATOM   813  N NH1   . ARG A 1 132 ? 13.383  -14.599 7.716  1.00 47.65  ? 213 ARG A NH1   1 
ATOM   814  N NH2   . ARG A 1 132 ? 15.642  -14.414 8.034  1.00 49.63  ? 213 ARG A NH2   1 
ATOM   815  N N     . ILE A 1 133 ? 12.265  -11.089 10.820 1.00 37.91  ? 214 ILE A N     1 
ATOM   816  C CA    . ILE A 1 133 ? 11.614  -11.971 11.803 1.00 38.24  ? 214 ILE A CA    1 
ATOM   817  C C     . ILE A 1 133 ? 10.575  -11.171 12.625 1.00 40.96  ? 214 ILE A C     1 
ATOM   818  O O     . ILE A 1 133 ? 9.473   -11.666 12.904 1.00 39.15  ? 214 ILE A O     1 
ATOM   819  C CB    . ILE A 1 133 ? 12.683  -12.675 12.698 1.00 41.46  ? 214 ILE A CB    1 
ATOM   820  C CG1   . ILE A 1 133 ? 13.532  -13.654 11.817 1.00 42.03  ? 214 ILE A CG1   1 
ATOM   821  C CG2   . ILE A 1 133 ? 12.035  -13.454 13.856 1.00 41.08  ? 214 ILE A CG2   1 
ATOM   822  C CD1   . ILE A 1 133 ? 14.929  -13.971 12.403 1.00 48.68  ? 214 ILE A CD1   1 
ATOM   823  N N     . LEU A 1 134 ? 10.953  -9.944  13.037 1.00 36.37  ? 215 LEU A N     1 
ATOM   824  C CA    . LEU A 1 134 ? 10.086  -9.109  13.858 1.00 35.81  ? 215 LEU A CA    1 
ATOM   825  C C     . LEU A 1 134 ? 8.827   -8.675  13.111 1.00 39.50  ? 215 LEU A C     1 
ATOM   826  O O     . LEU A 1 134 ? 7.734   -8.764  13.666 1.00 38.64  ? 215 LEU A O     1 
ATOM   827  C CB    . LEU A 1 134 ? 10.868  -7.876  14.370 1.00 35.81  ? 215 LEU A CB    1 
ATOM   828  C CG    . LEU A 1 134 ? 10.068  -6.890  15.210 1.00 40.15  ? 215 LEU A CG    1 
ATOM   829  C CD1   . LEU A 1 134 ? 9.573   -7.546  16.499 1.00 39.52  ? 215 LEU A CD1   1 
ATOM   830  C CD2   . LEU A 1 134 ? 10.877  -5.637  15.495 1.00 37.82  ? 215 LEU A CD2   1 
ATOM   831  N N     . VAL A 1 135 ? 8.957   -8.258  11.855 1.00 39.87  ? 216 VAL A N     1 
ATOM   832  C CA    . VAL A 1 135 ? 7.756   -7.792  11.158 1.00 42.19  ? 216 VAL A CA    1 
ATOM   833  C C     . VAL A 1 135 ? 6.748   -8.986  11.020 1.00 45.71  ? 216 VAL A C     1 
ATOM   834  O O     . VAL A 1 135 ? 5.558   -8.803  11.296 1.00 42.89  ? 216 VAL A O     1 
ATOM   835  C CB    . VAL A 1 135 ? 8.054   -6.998  9.860  1.00 48.94  ? 216 VAL A CB    1 
ATOM   836  C CG1   . VAL A 1 135 ? 8.450   -7.896  8.688  1.00 49.98  ? 216 VAL A CG1   1 
ATOM   837  C CG2   . VAL A 1 135 ? 6.873   -6.116  9.487  1.00 50.15  ? 216 VAL A CG2   1 
ATOM   838  N N     . GLN A 1 136 ? 7.260   -10.211 10.773 1.00 43.88  ? 217 GLN A N     1 
ATOM   839  C CA    . GLN A 1 136 ? 6.439   -11.432 10.703 1.00 44.57  ? 217 GLN A CA    1 
ATOM   840  C C     . GLN A 1 136 ? 5.703   -11.681 12.041 1.00 44.55  ? 217 GLN A C     1 
ATOM   841  O O     . GLN A 1 136 ? 4.510   -11.986 12.038 1.00 43.74  ? 217 GLN A O     1 
ATOM   842  C CB    . GLN A 1 136 ? 7.306   -12.646 10.326 1.00 47.60  ? 217 GLN A CB    1 
ATOM   843  C CG    . GLN A 1 136 ? 6.548   -13.969 10.213 1.00 65.60  ? 217 GLN A CG    1 
ATOM   844  N N     . LYS A 1 137 ? 6.405   -11.520 13.171 1.00 39.94  ? 218 LYS A N     1 
ATOM   845  C CA    . LYS A 1 137 ? 5.800   -11.705 14.489 1.00 39.41  ? 218 LYS A CA    1 
ATOM   846  C C     . LYS A 1 137 ? 4.684   -10.684 14.764 1.00 41.98  ? 218 LYS A C     1 
ATOM   847  O O     . LYS A 1 137 ? 3.632   -11.052 15.298 1.00 41.72  ? 218 LYS A O     1 
ATOM   848  C CB    . LYS A 1 137 ? 6.860   -11.655 15.595 1.00 42.00  ? 218 LYS A CB    1 
ATOM   849  C CG    . LYS A 1 137 ? 7.692   -12.918 15.682 1.00 52.36  ? 218 LYS A CG    1 
ATOM   850  C CD    . LYS A 1 137 ? 8.561   -12.903 16.905 1.00 55.36  ? 218 LYS A CD    1 
ATOM   851  C CE    . LYS A 1 137 ? 9.656   -13.921 16.766 1.00 56.76  ? 218 LYS A CE    1 
ATOM   852  N NZ    . LYS A 1 137 ? 10.744  -13.676 17.747 1.00 44.70  ? 218 LYS A NZ    1 
ATOM   853  N N     . LEU A 1 138 ? 4.901   -9.420  14.377 1.00 39.52  ? 219 LEU A N     1 
ATOM   854  C CA    . LEU A 1 138 ? 3.917   -8.352  14.603 1.00 39.71  ? 219 LEU A CA    1 
ATOM   855  C C     . LEU A 1 138 ? 2.689   -8.551  13.717 1.00 46.79  ? 219 LEU A C     1 
ATOM   856  O O     . LEU A 1 138 ? 1.579   -8.192  14.110 1.00 46.10  ? 219 LEU A O     1 
ATOM   857  C CB    . LEU A 1 138 ? 4.523   -6.956  14.420 1.00 39.17  ? 219 LEU A CB    1 
ATOM   858  C CG    . LEU A 1 138 ? 5.610   -6.554  15.439 1.00 41.90  ? 219 LEU A CG    1 
ATOM   859  C CD1   . LEU A 1 138 ? 6.307   -5.291  15.012 1.00 41.90  ? 219 LEU A CD1   1 
ATOM   860  C CD2   . LEU A 1 138 ? 5.030   -6.401  16.872 1.00 42.05  ? 219 LEU A CD2   1 
ATOM   861  N N     . GLN A 1 139 ? 2.893   -9.153  12.535 1.00 44.25  ? 220 GLN A N     1 
ATOM   862  C CA    . GLN A 1 139 ? 1.811   -9.477  11.608 1.00 44.74  ? 220 GLN A CA    1 
ATOM   863  C C     . GLN A 1 139 ? 0.983   -10.637 12.117 1.00 49.90  ? 220 GLN A C     1 
ATOM   864  O O     . GLN A 1 139 ? -0.205  -10.716 11.807 1.00 51.76  ? 220 GLN A O     1 
ATOM   865  C CB    . GLN A 1 139 ? 2.338   -9.725  10.183 1.00 45.65  ? 220 GLN A CB    1 
ATOM   866  C CG    . GLN A 1 139 ? 2.803   -8.426  9.522  1.00 47.27  ? 220 GLN A CG    1 
ATOM   867  C CD    . GLN A 1 139 ? 3.546   -8.620  8.211  1.00 56.51  ? 220 GLN A CD    1 
ATOM   868  O OE1   . GLN A 1 139 ? 4.336   -9.546  8.028  1.00 52.07  ? 220 GLN A OE1   1 
ATOM   869  N NE2   . GLN A 1 139 ? 3.339   -7.709  7.282  1.00 51.93  ? 220 GLN A NE2   1 
ATOM   870  N N     . LYS A 1 140 ? 1.592   -11.521 12.925 1.00 46.47  ? 221 LYS A N     1 
ATOM   871  C CA    . LYS A 1 140 ? 0.895   -12.659 13.514 1.00 45.43  ? 221 LYS A CA    1 
ATOM   872  C C     . LYS A 1 140 ? 0.067   -12.167 14.731 1.00 49.35  ? 221 LYS A C     1 
ATOM   873  O O     . LYS A 1 140 ? -1.157  -12.298 14.735 1.00 51.01  ? 221 LYS A O     1 
ATOM   874  C CB    . LYS A 1 140 ? 1.906   -13.765 13.925 1.00 45.16  ? 221 LYS A CB    1 
ATOM   875  C CG    . LYS A 1 140 ? 1.278   -14.951 14.640 1.00 47.73  ? 221 LYS A CG    1 
ATOM   876  C CD    . LYS A 1 140 ? 2.306   -16.025 14.955 1.00 52.48  ? 221 LYS A CD    1 
ATOM   877  C CE    . LYS A 1 140 ? 1.704   -17.127 15.789 1.00 57.86  ? 221 LYS A CE    1 
ATOM   878  N NZ    . LYS A 1 140 ? 2.696   -17.677 16.747 1.00 68.74  ? 221 LYS A NZ    1 
ATOM   879  N N     . TYR A 1 141 ? 0.730   -11.571 15.733 1.00 43.56  ? 222 TYR A N     1 
ATOM   880  C CA    . TYR A 1 141 ? 0.074   -11.184 16.985 1.00 43.03  ? 222 TYR A CA    1 
ATOM   881  C C     . TYR A 1 141 ? -0.719  -9.887  16.949 1.00 46.54  ? 222 TYR A C     1 
ATOM   882  O O     . TYR A 1 141 ? -1.652  -9.731  17.739 1.00 46.10  ? 222 TYR A O     1 
ATOM   883  C CB    . TYR A 1 141 ? 1.088   -11.154 18.129 1.00 43.29  ? 222 TYR A CB    1 
ATOM   884  C CG    . TYR A 1 141 ? 1.643   -12.531 18.433 1.00 44.14  ? 222 TYR A CG    1 
ATOM   885  C CD1   . TYR A 1 141 ? 0.876   -13.481 19.102 1.00 46.81  ? 222 TYR A CD1   1 
ATOM   886  C CD2   . TYR A 1 141 ? 2.896   -12.919 17.964 1.00 44.18  ? 222 TYR A CD2   1 
ATOM   887  C CE1   . TYR A 1 141 ? 1.366   -14.763 19.351 1.00 47.67  ? 222 TYR A CE1   1 
ATOM   888  C CE2   . TYR A 1 141 ? 3.400   -14.192 18.212 1.00 44.68  ? 222 TYR A CE2   1 
ATOM   889  C CZ    . TYR A 1 141 ? 2.628   -15.114 18.899 1.00 53.59  ? 222 TYR A CZ    1 
ATOM   890  O OH    . TYR A 1 141 ? 3.134   -16.361 19.154 1.00 53.05  ? 222 TYR A OH    1 
ATOM   891  N N     . GLN A 1 142 ? -0.342  -8.962  16.064 1.00 42.74  ? 223 GLN A N     1 
ATOM   892  C CA    . GLN A 1 142 ? -1.020  -7.686  15.824 1.00 42.67  ? 223 GLN A CA    1 
ATOM   893  C C     . GLN A 1 142 ? -1.394  -6.928  17.103 1.00 43.63  ? 223 GLN A C     1 
ATOM   894  O O     . GLN A 1 142 ? -2.577  -6.677  17.370 1.00 43.62  ? 223 GLN A O     1 
ATOM   895  C CB    . GLN A 1 142 ? -2.227  -7.888  14.909 1.00 44.19  ? 223 GLN A CB    1 
ATOM   896  C CG    . GLN A 1 142 ? -1.807  -8.258  13.508 1.00 52.56  ? 223 GLN A CG    1 
ATOM   897  C CD    . GLN A 1 142 ? -2.994  -8.579  12.645 1.00 71.29  ? 223 GLN A CD    1 
ATOM   898  O OE1   . GLN A 1 142 ? -3.880  -7.745  12.430 1.00 63.57  ? 223 GLN A OE1   1 
ATOM   899  N NE2   . GLN A 1 142 ? -3.034  -9.804  12.138 1.00 67.19  ? 223 GLN A NE2   1 
ATOM   900  N N     . PRO A 1 143 ? -0.385  -6.522  17.897 1.00 38.34  ? 224 PRO A N     1 
ATOM   901  C CA    . PRO A 1 143 ? -0.689  -5.729  19.099 1.00 37.69  ? 224 PRO A CA    1 
ATOM   902  C C     . PRO A 1 143 ? -1.199  -4.334  18.704 1.00 42.18  ? 224 PRO A C     1 
ATOM   903  O O     . PRO A 1 143 ? -0.909  -3.897  17.599 1.00 41.00  ? 224 PRO A O     1 
ATOM   904  C CB    . PRO A 1 143 ? 0.669   -5.633  19.798 1.00 39.23  ? 224 PRO A CB    1 
ATOM   905  C CG    . PRO A 1 143 ? 1.674   -5.721  18.679 1.00 43.07  ? 224 PRO A CG    1 
ATOM   906  C CD    . PRO A 1 143 ? 1.073   -6.691  17.702 1.00 38.83  ? 224 PRO A CD    1 
ATOM   907  N N     . ARG A 1 144 ? -1.917  -3.615  19.583 1.00 40.42  ? 225 ARG A N     1 
ATOM   908  C CA    . ARG A 1 144 ? -2.364  -2.263  19.190 1.00 40.02  ? 225 ARG A CA    1 
ATOM   909  C C     . ARG A 1 144 ? -1.134  -1.363  18.930 1.00 43.15  ? 225 ARG A C     1 
ATOM   910  O O     . ARG A 1 144 ? -1.154  -0.542  18.005 1.00 43.13  ? 225 ARG A O     1 
ATOM   911  C CB    . ARG A 1 144 ? -3.260  -1.607  20.265 1.00 41.76  ? 225 ARG A CB    1 
ATOM   912  C CG    . ARG A 1 144 ? -4.563  -2.336  20.580 1.00 55.21  ? 225 ARG A CG    1 
ATOM   913  C CD    . ARG A 1 144 ? -5.318  -1.570  21.656 1.00 66.82  ? 225 ARG A CD    1 
ATOM   914  N NE    . ARG A 1 144 ? -6.482  -2.295  22.170 1.00 79.51  ? 225 ARG A NE    1 
ATOM   915  C CZ    . ARG A 1 144 ? -7.714  -2.192  21.674 1.00 99.68  ? 225 ARG A CZ    1 
ATOM   916  N NH1   . ARG A 1 144 ? -7.955  -1.406  20.632 1.00 87.24  ? 225 ARG A NH1   1 
ATOM   917  N NH2   . ARG A 1 144 ? -8.711  -2.879  22.214 1.00 91.43  ? 225 ARG A NH2   1 
ATOM   918  N N     . ILE A 1 145 ? -0.062  -1.531  19.750 1.00 39.42  ? 226 ILE A N     1 
ATOM   919  C CA    . ILE A 1 145 ? 1.149   -0.700  19.661 1.00 37.95  ? 226 ILE A CA    1 
ATOM   920  C C     . ILE A 1 145 ? 2.433   -1.525  19.732 1.00 38.63  ? 226 ILE A C     1 
ATOM   921  O O     . ILE A 1 145 ? 2.642   -2.265  20.701 1.00 36.31  ? 226 ILE A O     1 
ATOM   922  C CB    . ILE A 1 145 ? 1.172   0.432   20.755 1.00 39.82  ? 226 ILE A CB    1 
ATOM   923  C CG1   . ILE A 1 145 ? -0.123  1.282   20.772 1.00 40.44  ? 226 ILE A CG1   1 
ATOM   924  C CG2   . ILE A 1 145 ? 2.413   1.327   20.594 1.00 36.92  ? 226 ILE A CG2   1 
ATOM   925  C CD1   . ILE A 1 145 ? -0.449  1.977   22.172 1.00 39.80  ? 226 ILE A CD1   1 
ATOM   926  N N     . ALA A 1 146 ? 3.311   -1.349  18.729 1.00 35.04  ? 227 ALA A N     1 
ATOM   927  C CA    . ALA A 1 146 ? 4.639   -1.975  18.729 1.00 34.39  ? 227 ALA A CA    1 
ATOM   928  C C     . ALA A 1 146 ? 5.600   -0.909  19.297 1.00 35.41  ? 227 ALA A C     1 
ATOM   929  O O     . ALA A 1 146 ? 5.794   0.153   18.672 1.00 34.54  ? 227 ALA A O     1 
ATOM   930  C CB    . ALA A 1 146 ? 5.054   -2.366  17.318 1.00 34.94  ? 227 ALA A CB    1 
ATOM   931  N N     . VAL A 1 147 ? 6.126   -1.164  20.498 1.00 30.82  ? 228 VAL A N     1 
ATOM   932  C CA    . VAL A 1 147 ? 7.006   -0.221  21.209 1.00 31.33  ? 228 VAL A CA    1 
ATOM   933  C C     . VAL A 1 147 ? 8.460   -0.578  21.046 1.00 34.22  ? 228 VAL A C     1 
ATOM   934  O O     . VAL A 1 147 ? 8.896   -1.593  21.568 1.00 34.22  ? 228 VAL A O     1 
ATOM   935  C CB    . VAL A 1 147 ? 6.614   -0.067  22.696 1.00 33.87  ? 228 VAL A CB    1 
ATOM   936  C CG1   . VAL A 1 147 ? 7.610   0.821   23.463 1.00 34.00  ? 228 VAL A CG1   1 
ATOM   937  C CG2   . VAL A 1 147 ? 5.210   0.482   22.823 1.00 34.01  ? 228 VAL A CG2   1 
ATOM   938  N N     . PHE A 1 148 ? 9.215   0.277   20.371 1.00 30.23  ? 229 PHE A N     1 
ATOM   939  C CA    . PHE A 1 148 ? 10.632  0.033   20.167 1.00 29.35  ? 229 PHE A CA    1 
ATOM   940  C C     . PHE A 1 148 ? 11.384  0.624   21.327 1.00 31.24  ? 229 PHE A C     1 
ATOM   941  O O     . PHE A 1 148 ? 11.457  1.844   21.479 1.00 29.45  ? 229 PHE A O     1 
ATOM   942  C CB    . PHE A 1 148 ? 11.101  0.630   18.839 1.00 29.97  ? 229 PHE A CB    1 
ATOM   943  C CG    . PHE A 1 148 ? 10.573  -0.127  17.638 1.00 30.32  ? 229 PHE A CG    1 
ATOM   944  C CD1   . PHE A 1 148 ? 9.258   0.040   17.212 1.00 32.76  ? 229 PHE A CD1   1 
ATOM   945  C CD2   . PHE A 1 148 ? 11.388  -1.004  16.940 1.00 31.11  ? 229 PHE A CD2   1 
ATOM   946  C CE1   . PHE A 1 148 ? 8.763   -0.681  16.126 1.00 34.70  ? 229 PHE A CE1   1 
ATOM   947  C CE2   . PHE A 1 148 ? 10.891  -1.735  15.859 1.00 35.14  ? 229 PHE A CE2   1 
ATOM   948  C CZ    . PHE A 1 148 ? 9.580   -1.570  15.460 1.00 35.14  ? 229 PHE A CZ    1 
ATOM   949  N N     . ASN A 1 149 ? 11.913  -0.247  22.176 1.00 27.86  ? 230 ASN A N     1 
ATOM   950  C CA    . ASN A 1 149 ? 12.690  0.145   23.330 1.00 28.72  ? 230 ASN A CA    1 
ATOM   951  C C     . ASN A 1 149 ? 14.139  0.311   22.876 1.00 30.68  ? 230 ASN A C     1 
ATOM   952  O O     . ASN A 1 149 ? 14.980  -0.565  23.113 1.00 29.98  ? 230 ASN A O     1 
ATOM   953  C CB    . ASN A 1 149 ? 12.544  -0.971  24.416 1.00 27.15  ? 230 ASN A CB    1 
ATOM   954  C CG    . ASN A 1 149 ? 13.201  -0.616  25.714 1.00 29.70  ? 230 ASN A CG    1 
ATOM   955  O OD1   . ASN A 1 149 ? 13.569  0.532   25.955 1.00 29.98  ? 230 ASN A OD1   1 
ATOM   956  N ND2   . ASN A 1 149 ? 13.358  -1.614  26.594 1.00 29.83  ? 230 ASN A ND2   1 
ATOM   957  N N     . GLY A 1 150 ? 14.397  1.413   22.177 1.00 30.25  ? 231 GLY A N     1 
ATOM   958  C CA    . GLY A 1 150 ? 15.700  1.683   21.602 1.00 30.12  ? 231 GLY A CA    1 
ATOM   959  C C     . GLY A 1 150 ? 15.515  2.341   20.244 1.00 33.86  ? 231 GLY A C     1 
ATOM   960  O O     . GLY A 1 150 ? 14.834  1.799   19.368 1.00 33.54  ? 231 GLY A O     1 
ATOM   961  N N     . LYS A 1 151 ? 16.098  3.513   20.085 1.00 31.80  ? 232 LYS A N     1 
ATOM   962  C CA    . LYS A 1 151 ? 16.014  4.305   18.840 1.00 32.75  ? 232 LYS A CA    1 
ATOM   963  C C     . LYS A 1 151 ? 16.700  3.567   17.672 1.00 35.74  ? 232 LYS A C     1 
ATOM   964  O O     . LYS A 1 151 ? 16.137  3.476   16.573 1.00 34.68  ? 232 LYS A O     1 
ATOM   965  C CB    . LYS A 1 151 ? 16.663  5.679   19.076 1.00 35.51  ? 232 LYS A CB    1 
ATOM   966  C CG    . LYS A 1 151 ? 16.386  6.674   17.962 1.00 41.88  ? 232 LYS A CG    1 
ATOM   967  C CD    . LYS A 1 151 ? 16.832  8.068   18.332 1.00 46.07  ? 232 LYS A CD    1 
ATOM   968  C CE    . LYS A 1 151 ? 15.850  9.126   17.885 1.00 58.40  ? 232 LYS A CE    1 
ATOM   969  N NZ    . LYS A 1 151 ? 16.339  10.505  18.190 1.00 61.50  ? 232 LYS A NZ    1 
ATOM   970  N N     . CYS A 1 152 ? 17.904  3.010   17.939 1.00 36.25  ? 233 CYS A N     1 
ATOM   971  C CA    . CYS A 1 152 ? 18.742  2.276   16.982 1.00 35.84  ? 233 CYS A CA    1 
ATOM   972  C C     . CYS A 1 152 ? 17.988  1.160   16.237 1.00 40.34  ? 233 CYS A C     1 
ATOM   973  O O     . CYS A 1 152 ? 18.141  1.054   15.032 1.00 41.70  ? 233 CYS A O     1 
ATOM   974  C CB    . CYS A 1 152 ? 20.006  1.742   17.659 1.00 36.53  ? 233 CYS A CB    1 
ATOM   975  S SG    . CYS A 1 152 ? 19.719  0.444   18.903 1.00 39.98  ? 233 CYS A SG    1 
ATOM   976  N N     . ILE A 1 153 ? 17.128  0.387   16.933 1.00 35.34  ? 234 ILE A N     1 
ATOM   977  C CA    . ILE A 1 153 ? 16.397  -0.688  16.261 1.00 35.19  ? 234 ILE A CA    1 
ATOM   978  C C     . ILE A 1 153 ? 15.282  -0.152  15.363 1.00 37.27  ? 234 ILE A C     1 
ATOM   979  O O     . ILE A 1 153 ? 14.986  -0.787  14.340 1.00 35.87  ? 234 ILE A O     1 
ATOM   980  C CB    . ILE A 1 153 ? 15.905  -1.819  17.188 1.00 38.68  ? 234 ILE A CB    1 
ATOM   981  C CG1   . ILE A 1 153 ? 15.109  -1.254  18.397 1.00 40.41  ? 234 ILE A CG1   1 
ATOM   982  C CG2   . ILE A 1 153 ? 17.123  -2.649  17.659 1.00 38.46  ? 234 ILE A CG2   1 
ATOM   983  C CD1   . ILE A 1 153 ? 14.394  -2.238  19.279 1.00 39.93  ? 234 ILE A CD1   1 
ATOM   984  N N     . TYR A 1 154 ? 14.668  0.998   15.716 1.00 34.56  ? 235 TYR A N     1 
ATOM   985  C CA    . TYR A 1 154 ? 13.656  1.557   14.808 1.00 34.90  ? 235 TYR A CA    1 
ATOM   986  C C     . TYR A 1 154 ? 14.321  2.177   13.586 1.00 39.88  ? 235 TYR A C     1 
ATOM   987  O O     . TYR A 1 154 ? 13.761  2.096   12.482 1.00 40.00  ? 235 TYR A O     1 
ATOM   988  C CB    . TYR A 1 154 ? 12.684  2.546   15.497 1.00 34.00  ? 235 TYR A CB    1 
ATOM   989  C CG    . TYR A 1 154 ? 11.578  2.919   14.522 1.00 37.09  ? 235 TYR A CG    1 
ATOM   990  C CD1   . TYR A 1 154 ? 10.513  2.059   14.288 1.00 37.96  ? 235 TYR A CD1   1 
ATOM   991  C CD2   . TYR A 1 154 ? 11.627  4.109   13.803 1.00 38.77  ? 235 TYR A CD2   1 
ATOM   992  C CE1   . TYR A 1 154 ? 9.534   2.353   13.349 1.00 39.18  ? 235 TYR A CE1   1 
ATOM   993  C CE2   . TYR A 1 154 ? 10.662  4.410   12.838 1.00 39.59  ? 235 TYR A CE2   1 
ATOM   994  C CZ    . TYR A 1 154 ? 9.616   3.523   12.611 1.00 43.53  ? 235 TYR A CZ    1 
ATOM   995  O OH    . TYR A 1 154 ? 8.645   3.779   11.670 1.00 47.56  ? 235 TYR A OH    1 
ATOM   996  N N     . GLU A 1 155 ? 15.544  2.720   13.731 1.00 37.16  ? 236 GLU A N     1 
ATOM   997  C CA    . GLU A 1 155 ? 16.236  3.285   12.540 1.00 39.94  ? 236 GLU A CA    1 
ATOM   998  C C     . GLU A 1 155 ? 16.444  2.188   11.464 1.00 43.59  ? 236 GLU A C     1 
ATOM   999  O O     . GLU A 1 155 ? 16.134  2.380   10.263 1.00 43.72  ? 236 GLU A O     1 
ATOM   1000 C CB    . GLU A 1 155 ? 17.582  3.891   12.979 1.00 42.76  ? 236 GLU A CB    1 
ATOM   1001 C CG    . GLU A 1 155 ? 18.136  4.878   11.963 1.00 55.54  ? 236 GLU A CG    1 
ATOM   1002 N N     . ILE A 1 156 ? 16.886  0.998   11.914 1.00 40.83  ? 237 ILE A N     1 
ATOM   1003 C CA    . ILE A 1 156 ? 17.078  -0.159  11.009 1.00 40.74  ? 237 ILE A CA    1 
ATOM   1004 C C     . ILE A 1 156 ? 15.717  -0.632  10.473 1.00 42.84  ? 237 ILE A C     1 
ATOM   1005 O O     . ILE A 1 156 ? 15.577  -0.875  9.280  1.00 43.04  ? 237 ILE A O     1 
ATOM   1006 C CB    . ILE A 1 156 ? 17.829  -1.295  11.766 1.00 43.81  ? 237 ILE A CB    1 
ATOM   1007 C CG1   . ILE A 1 156 ? 19.289  -0.894  12.027 1.00 44.67  ? 237 ILE A CG1   1 
ATOM   1008 C CG2   . ILE A 1 156 ? 17.752  -2.658  11.026 1.00 45.59  ? 237 ILE A CG2   1 
ATOM   1009 C CD1   . ILE A 1 156 ? 19.822  -1.328  13.273 1.00 48.89  ? 237 ILE A CD1   1 
ATOM   1010 N N     . PHE A 1 157 ? 14.742  -0.826  11.388 1.00 40.46  ? 238 PHE A N     1 
ATOM   1011 C CA    . PHE A 1 157 ? 13.398  -1.303  11.054 1.00 39.29  ? 238 PHE A CA    1 
ATOM   1012 C C     . PHE A 1 157 ? 12.729  -0.448  9.991  1.00 44.89  ? 238 PHE A C     1 
ATOM   1013 O O     . PHE A 1 157 ? 12.211  -0.993  9.010  1.00 43.96  ? 238 PHE A O     1 
ATOM   1014 C CB    . PHE A 1 157 ? 12.520  -1.369  12.320 1.00 39.16  ? 238 PHE A CB    1 
ATOM   1015 C CG    . PHE A 1 157 ? 11.222  -2.111  12.105 1.00 38.22  ? 238 PHE A CG    1 
ATOM   1016 C CD1   . PHE A 1 157 ? 11.150  -3.487  12.291 1.00 40.37  ? 238 PHE A CD1   1 
ATOM   1017 C CD2   . PHE A 1 157 ? 10.063  -1.428  11.751 1.00 38.32  ? 238 PHE A CD2   1 
ATOM   1018 C CE1   . PHE A 1 157 ? 9.947   -4.168  12.116 1.00 41.11  ? 238 PHE A CE1   1 
ATOM   1019 C CE2   . PHE A 1 157 ? 8.857   -2.108  11.590 1.00 40.98  ? 238 PHE A CE2   1 
ATOM   1020 C CZ    . PHE A 1 157 ? 8.806   -3.474  11.779 1.00 38.87  ? 238 PHE A CZ    1 
ATOM   1021 N N     . SER A 1 158 ? 12.735  0.875   10.186 1.00 40.80  ? 239 SER A N     1 
ATOM   1022 C CA    . SER A 1 158 ? 12.132  1.848   9.262  1.00 42.87  ? 239 SER A CA    1 
ATOM   1023 C C     . SER A 1 158 ? 12.685  1.745   7.820  1.00 48.69  ? 239 SER A C     1 
ATOM   1024 O O     . SER A 1 158 ? 11.907  1.794   6.844  1.00 47.90  ? 239 SER A O     1 
ATOM   1025 C CB    . SER A 1 158 ? 12.321  3.262   9.807  1.00 45.45  ? 239 SER A CB    1 
ATOM   1026 O OG    . SER A 1 158 ? 11.885  4.177   8.810  1.00 51.28  ? 239 SER A OG    1 
ATOM   1027 N N     . LYS A 1 159 ? 14.025  1.652   7.685  1.00 46.36  ? 240 LYS A N     1 
ATOM   1028 C CA    . LYS A 1 159 ? 14.703  1.604   6.375  1.00 47.85  ? 240 LYS A CA    1 
ATOM   1029 C C     . LYS A 1 159 ? 14.430  0.261   5.692  1.00 50.38  ? 240 LYS A C     1 
ATOM   1030 O O     . LYS A 1 159 ? 14.266  0.196   4.472  1.00 49.61  ? 240 LYS A O     1 
ATOM   1031 C CB    . LYS A 1 159 ? 16.217  1.847   6.583  1.00 52.33  ? 240 LYS A CB    1 
ATOM   1032 C CG    . LYS A 1 159 ? 17.079  1.866   5.328  1.00 72.87  ? 240 LYS A CG    1 
ATOM   1033 C CD    . LYS A 1 159 ? 18.548  2.045   5.688  1.00 84.38  ? 240 LYS A CD    1 
ATOM   1034 N N     . GLU A 1 160 ? 14.345  -0.806  6.505  1.00 47.42  ? 241 GLU A N     1 
ATOM   1035 C CA    . GLU A 1 160 ? 14.121  -2.161  6.029  1.00 47.16  ? 241 GLU A CA    1 
ATOM   1036 C C     . GLU A 1 160 ? 12.661  -2.485  5.662  1.00 51.68  ? 241 GLU A C     1 
ATOM   1037 O O     . GLU A 1 160 ? 12.412  -3.107  4.630  1.00 50.44  ? 241 GLU A O     1 
ATOM   1038 C CB    . GLU A 1 160 ? 14.652  -3.124  7.084  1.00 47.82  ? 241 GLU A CB    1 
ATOM   1039 C CG    . GLU A 1 160 ? 14.524  -4.574  6.699  1.00 51.52  ? 241 GLU A CG    1 
ATOM   1040 C CD    . GLU A 1 160 ? 15.057  -5.501  7.765  1.00 60.26  ? 241 GLU A CD    1 
ATOM   1041 O OE1   . GLU A 1 160 ? 15.077  -5.128  8.964  1.00 53.78  ? 241 GLU A OE1   1 
ATOM   1042 O OE2   . GLU A 1 160 ? 15.447  -6.623  7.385  1.00 52.14  ? 241 GLU A OE2   1 
ATOM   1043 N N     . VAL A 1 161 ? 11.709  -2.061  6.494  1.00 49.12  ? 242 VAL A N     1 
ATOM   1044 C CA    . VAL A 1 161 ? 10.279  -2.349  6.333  1.00 48.39  ? 242 VAL A CA    1 
ATOM   1045 C C     . VAL A 1 161 ? 9.520   -1.255  5.568  1.00 52.79  ? 242 VAL A C     1 
ATOM   1046 O O     . VAL A 1 161 ? 8.698   -1.577  4.703  1.00 54.18  ? 242 VAL A O     1 
ATOM   1047 C CB    . VAL A 1 161 ? 9.640   -2.648  7.721  1.00 49.58  ? 242 VAL A CB    1 
ATOM   1048 C CG1   . VAL A 1 161 ? 8.138   -2.895  7.616  1.00 48.71  ? 242 VAL A CG1   1 
ATOM   1049 C CG2   . VAL A 1 161 ? 10.340  -3.821  8.409  1.00 48.47  ? 242 VAL A CG2   1 
ATOM   1050 N N     . PHE A 1 162 ? 9.762   0.025   5.880  1.00 50.45  ? 243 PHE A N     1 
ATOM   1051 C CA    . PHE A 1 162 ? 9.040   1.108   5.192  1.00 51.53  ? 243 PHE A CA    1 
ATOM   1052 C C     . PHE A 1 162 ? 9.840   1.745   4.045  1.00 59.07  ? 243 PHE A C     1 
ATOM   1053 O O     . PHE A 1 162 ? 9.285   2.534   3.250  1.00 57.26  ? 243 PHE A O     1 
ATOM   1054 C CB    . PHE A 1 162 ? 8.554   2.161   6.203  1.00 52.42  ? 243 PHE A CB    1 
ATOM   1055 C CG    . PHE A 1 162 ? 7.769   1.578   7.353  1.00 51.66  ? 243 PHE A CG    1 
ATOM   1056 C CD1   . PHE A 1 162 ? 6.572   0.906   7.131  1.00 53.09  ? 243 PHE A CD1   1 
ATOM   1057 C CD2   . PHE A 1 162 ? 8.233   1.688   8.660  1.00 51.80  ? 243 PHE A CD2   1 
ATOM   1058 C CE1   . PHE A 1 162 ? 5.874   0.319   8.190  1.00 53.48  ? 243 PHE A CE1   1 
ATOM   1059 C CE2   . PHE A 1 162 ? 7.512   1.136   9.724  1.00 53.22  ? 243 PHE A CE2   1 
ATOM   1060 C CZ    . PHE A 1 162 ? 6.337   0.455   9.485  1.00 50.47  ? 243 PHE A CZ    1 
ATOM   1061 N N     . GLY A 1 163 ? 11.123  1.377   3.953  1.00 58.94  ? 244 GLY A N     1 
ATOM   1062 C CA    . GLY A 1 163 ? 12.044  1.914   2.954  1.00 60.60  ? 244 GLY A CA    1 
ATOM   1063 C C     . GLY A 1 163 ? 12.232  3.407   3.133  1.00 66.06  ? 244 GLY A C     1 
ATOM   1064 O O     . GLY A 1 163 ? 12.421  4.137   2.158  1.00 66.15  ? 244 GLY A O     1 
ATOM   1065 N N     . VAL A 1 164 ? 12.136  3.868   4.397  1.00 63.59  ? 245 VAL A N     1 
ATOM   1066 C CA    . VAL A 1 164 ? 12.218  5.272   4.776  1.00 64.13  ? 245 VAL A CA    1 
ATOM   1067 C C     . VAL A 1 164 ? 13.391  5.503   5.720  1.00 69.20  ? 245 VAL A C     1 
ATOM   1068 O O     . VAL A 1 164 ? 13.551  4.792   6.723  1.00 67.45  ? 245 VAL A O     1 
ATOM   1069 C CB    . VAL A 1 164 ? 10.864  5.778   5.371  1.00 68.66  ? 245 VAL A CB    1 
ATOM   1070 C CG1   . VAL A 1 164 ? 10.997  7.156   6.030  1.00 68.69  ? 245 VAL A CG1   1 
ATOM   1071 C CG2   . VAL A 1 164 ? 9.762   5.794   4.319  1.00 68.09  ? 245 VAL A CG2   1 
ATOM   1072 N N     . LYS A 1 165 ? 14.202  6.512   5.384  1.00 68.03  ? 246 LYS A N     1 
ATOM   1073 C CA    . LYS A 1 165 ? 15.342  6.972   6.158  1.00 69.08  ? 246 LYS A CA    1 
ATOM   1074 C C     . LYS A 1 165 ? 15.206  8.482   6.269  1.00 74.03  ? 246 LYS A C     1 
ATOM   1075 O O     . LYS A 1 165 ? 15.299  9.181   5.259  1.00 72.77  ? 246 LYS A O     1 
ATOM   1076 C CB    . LYS A 1 165 ? 16.677  6.566   5.490  1.00 72.30  ? 246 LYS A CB    1 
ATOM   1077 C CG    . LYS A 1 165 ? 17.941  7.027   6.238  1.00 87.52  ? 246 LYS A CG    1 
ATOM   1078 C CD    . LYS A 1 165 ? 18.313  6.129   7.410  1.00 95.30  ? 246 LYS A CD    1 
ATOM   1079 N N     . VAL A 1 166 ? 14.927  8.980   7.489  1.00 71.46  ? 247 VAL A N     1 
ATOM   1080 C CA    . VAL A 1 166 ? 14.805  10.425  7.725  1.00 71.70  ? 247 VAL A CA    1 
ATOM   1081 C C     . VAL A 1 166 ? 16.086  10.950  8.365  1.00 76.06  ? 247 VAL A C     1 
ATOM   1082 O O     . VAL A 1 166 ? 16.765  10.198  9.072  1.00 75.65  ? 247 VAL A O     1 
ATOM   1083 C CB    . VAL A 1 166 ? 13.515  10.876  8.471  1.00 76.12  ? 247 VAL A CB    1 
ATOM   1084 C CG1   . VAL A 1 166 ? 12.283  10.742  7.577  1.00 76.20  ? 247 VAL A CG1   1 
ATOM   1085 C CG2   . VAL A 1 166 ? 13.321  10.127  9.790  1.00 76.20  ? 247 VAL A CG2   1 
ATOM   1086 N N     . LYS A 1 167 ? 16.440  12.214  8.080  1.00 72.80  ? 248 LYS A N     1 
ATOM   1087 C CA    . LYS A 1 167 ? 17.643  12.851  8.618  1.00 72.19  ? 248 LYS A CA    1 
ATOM   1088 C C     . LYS A 1 167 ? 17.544  12.996  10.132 1.00 74.26  ? 248 LYS A C     1 
ATOM   1089 O O     . LYS A 1 167 ? 18.531  12.773  10.841 1.00 74.08  ? 248 LYS A O     1 
ATOM   1090 C CB    . LYS A 1 167 ? 17.871  14.220  7.956  1.00 74.94  ? 248 LYS A CB    1 
ATOM   1091 N N     . ASN A 1 168 ? 16.346  13.363  10.626 1.00 68.42  ? 249 ASN A N     1 
ATOM   1092 C CA    . ASN A 1 168 ? 16.101  13.530  12.049 1.00 66.74  ? 249 ASN A CA    1 
ATOM   1093 C C     . ASN A 1 168 ? 14.983  12.593  12.537 1.00 64.08  ? 249 ASN A C     1 
ATOM   1094 O O     . ASN A 1 168 ? 13.817  12.995  12.646 1.00 61.98  ? 249 ASN A O     1 
ATOM   1095 C CB    . ASN A 1 168 ? 15.854  15.013  12.410 1.00 67.15  ? 249 ASN A CB    1 
ATOM   1096 N N     . LEU A 1 169 ? 15.341  11.321  12.809 1.00 57.42  ? 250 LEU A N     1 
ATOM   1097 C CA    . LEU A 1 169 ? 14.367  10.375  13.355 1.00 54.08  ? 250 LEU A CA    1 
ATOM   1098 C C     . LEU A 1 169 ? 14.014  10.894  14.745 1.00 50.95  ? 250 LEU A C     1 
ATOM   1099 O O     . LEU A 1 169 ? 14.909  11.290  15.497 1.00 52.97  ? 250 LEU A O     1 
ATOM   1100 C CB    . LEU A 1 169 ? 14.928  8.933   13.412 1.00 53.74  ? 250 LEU A CB    1 
ATOM   1101 C CG    . LEU A 1 169 ? 14.150  7.892   14.263 1.00 58.33  ? 250 LEU A CG    1 
ATOM   1102 C CD1   . LEU A 1 169 ? 12.764  7.613   13.689 1.00 58.80  ? 250 LEU A CD1   1 
ATOM   1103 C CD2   . LEU A 1 169 ? 14.944  6.609   14.441 1.00 58.99  ? 250 LEU A CD2   1 
ATOM   1104 N N     . GLU A 1 170 ? 12.725  10.925  15.075 1.00 41.88  ? 251 GLU A N     1 
ATOM   1105 C CA    . GLU A 1 170 ? 12.273  11.393  16.396 1.00 39.91  ? 251 GLU A CA    1 
ATOM   1106 C C     . GLU A 1 170 ? 11.683  10.236  17.249 1.00 39.63  ? 251 GLU A C     1 
ATOM   1107 O O     . GLU A 1 170 ? 11.299  9.199   16.704 1.00 38.33  ? 251 GLU A O     1 
ATOM   1108 C CB    . GLU A 1 170 ? 11.240  12.505  16.226 1.00 40.83  ? 251 GLU A CB    1 
ATOM   1109 C CG    . GLU A 1 170 ? 11.823  13.752  15.558 1.00 45.66  ? 251 GLU A CG    1 
ATOM   1110 C CD    . GLU A 1 170 ? 10.941  14.982  15.571 1.00 61.11  ? 251 GLU A CD    1 
ATOM   1111 O OE1   . GLU A 1 170 ? 9.703   14.831  15.659 1.00 51.80  ? 251 GLU A OE1   1 
ATOM   1112 O OE2   . GLU A 1 170 ? 11.492  16.103  15.497 1.00 57.09  ? 251 GLU A OE2   1 
ATOM   1113 N N     . PHE A 1 171 ? 11.575  10.432  18.557 1.00 36.47  ? 252 PHE A N     1 
ATOM   1114 C CA    . PHE A 1 171 ? 10.953  9.434   19.434 1.00 34.46  ? 252 PHE A CA    1 
ATOM   1115 C C     . PHE A 1 171 ? 9.434   9.589   19.325 1.00 38.95  ? 252 PHE A C     1 
ATOM   1116 O O     . PHE A 1 171 ? 8.945   10.444  18.566 1.00 38.73  ? 252 PHE A O     1 
ATOM   1117 C CB    . PHE A 1 171 ? 11.406  9.627   20.901 1.00 35.64  ? 252 PHE A CB    1 
ATOM   1118 C CG    . PHE A 1 171 ? 12.867  9.335   21.151 1.00 37.49  ? 252 PHE A CG    1 
ATOM   1119 C CD1   . PHE A 1 171 ? 13.341  8.032   21.150 1.00 40.83  ? 252 PHE A CD1   1 
ATOM   1120 C CD2   . PHE A 1 171 ? 13.767  10.367  21.400 1.00 41.14  ? 252 PHE A CD2   1 
ATOM   1121 C CE1   . PHE A 1 171 ? 14.691  7.763   21.386 1.00 41.85  ? 252 PHE A CE1   1 
ATOM   1122 C CE2   . PHE A 1 171 ? 15.114  10.093  21.655 1.00 42.46  ? 252 PHE A CE2   1 
ATOM   1123 C CZ    . PHE A 1 171 ? 15.568  8.795   21.634 1.00 40.01  ? 252 PHE A CZ    1 
ATOM   1124 N N     . GLY A 1 172 ? 8.704   8.762   20.051 1.00 35.65  ? 253 GLY A N     1 
ATOM   1125 C CA    . GLY A 1 172 ? 7.256   8.847   20.056 1.00 36.76  ? 253 GLY A CA    1 
ATOM   1126 C C     . GLY A 1 172 ? 6.586   8.135   18.898 1.00 40.45  ? 253 GLY A C     1 
ATOM   1127 O O     . GLY A 1 172 ? 7.156   7.228   18.271 1.00 36.71  ? 253 GLY A O     1 
ATOM   1128 N N     . LEU A 1 173 ? 5.339   8.532   18.627 1.00 39.55  ? 254 LEU A N     1 
ATOM   1129 C CA    . LEU A 1 173 ? 4.538   7.898   17.597 1.00 38.95  ? 254 LEU A CA    1 
ATOM   1130 C C     . LEU A 1 173 ? 5.127   8.125   16.196 1.00 41.42  ? 254 LEU A C     1 
ATOM   1131 O O     . LEU A 1 173 ? 5.508   9.257   15.876 1.00 40.75  ? 254 LEU A O     1 
ATOM   1132 C CB    . LEU A 1 173 ? 3.079   8.394   17.681 1.00 39.81  ? 254 LEU A CB    1 
ATOM   1133 C CG    . LEU A 1 173 ? 2.081   7.674   16.746 1.00 42.69  ? 254 LEU A CG    1 
ATOM   1134 C CD1   . LEU A 1 173 ? 2.017   6.147   17.023 1.00 42.77  ? 254 LEU A CD1   1 
ATOM   1135 C CD2   . LEU A 1 173 ? 0.708   8.250   16.878 1.00 45.67  ? 254 LEU A CD2   1 
ATOM   1136 N N     . GLN A 1 174 ? 5.235   7.050   15.386 1.00 39.93  ? 255 GLN A N     1 
ATOM   1137 C CA    . GLN A 1 174 ? 5.801   7.119   14.052 1.00 40.54  ? 255 GLN A CA    1 
ATOM   1138 C C     . GLN A 1 174 ? 4.660   7.150   13.043 1.00 47.34  ? 255 GLN A C     1 
ATOM   1139 O O     . GLN A 1 174 ? 3.597   6.580   13.298 1.00 45.78  ? 255 GLN A O     1 
ATOM   1140 C CB    . GLN A 1 174 ? 6.760   5.942   13.776 1.00 41.33  ? 255 GLN A CB    1 
ATOM   1141 C CG    . GLN A 1 174 ? 7.923   5.812   14.785 1.00 40.32  ? 255 GLN A CG    1 
ATOM   1142 C CD    . GLN A 1 174 ? 8.820   7.046   14.809 1.00 41.73  ? 255 GLN A CD    1 
ATOM   1143 O OE1   . GLN A 1 174 ? 9.253   7.551   13.766 1.00 44.22  ? 255 GLN A OE1   1 
ATOM   1144 N NE2   . GLN A 1 174 ? 9.115   7.575   15.998 1.00 37.86  ? 255 GLN A NE2   1 
ATOM   1145 N N     . PRO A 1 175 ? 4.875   7.763   11.863 1.00 46.87  ? 256 PRO A N     1 
ATOM   1146 C CA    . PRO A 1 175 ? 3.765   7.887   10.904 1.00 48.20  ? 256 PRO A CA    1 
ATOM   1147 C C     . PRO A 1 175 ? 3.429   6.652   10.055 1.00 55.33  ? 256 PRO A C     1 
ATOM   1148 O O     . PRO A 1 175 ? 2.570   6.778   9.178  1.00 56.19  ? 256 PRO A O     1 
ATOM   1149 C CB    . PRO A 1 175 ? 4.178   9.074   10.042 1.00 50.35  ? 256 PRO A CB    1 
ATOM   1150 C CG    . PRO A 1 175 ? 5.644   9.178   10.161 1.00 53.79  ? 256 PRO A CG    1 
ATOM   1151 C CD    . PRO A 1 175 ? 6.069   8.526   11.441 1.00 48.55  ? 256 PRO A CD    1 
ATOM   1152 N N     . HIS A 1 176 ? 4.055   5.467   10.315 1.00 52.29  ? 257 HIS A N     1 
ATOM   1153 C CA    A HIS A 1 176 ? 3.815   4.244   9.554  0.52 52.83  ? 257 HIS A CA    1 
ATOM   1154 C CA    B HIS A 1 176 ? 3.750   4.262   9.549  0.48 52.84  ? 257 HIS A CA    1 
ATOM   1155 C C     . HIS A 1 176 ? 3.282   3.093   10.407 1.00 56.18  ? 257 HIS A C     1 
ATOM   1156 O O     . HIS A 1 176 ? 3.886   2.773   11.431 1.00 58.23  ? 257 HIS A O     1 
ATOM   1157 C CB    A HIS A 1 176 ? 5.109   3.787   8.865  0.52 53.86  ? 257 HIS A CB    1 
ATOM   1158 C CB    B HIS A 1 176 ? 4.913   3.836   8.633  0.48 53.89  ? 257 HIS A CB    1 
ATOM   1159 C CG    A HIS A 1 176 ? 5.812   4.849   8.085  0.52 56.89  ? 257 HIS A CG    1 
ATOM   1160 C CG    B HIS A 1 176 ? 5.279   4.842   7.583  0.48 56.99  ? 257 HIS A CG    1 
ATOM   1161 N ND1   A HIS A 1 176 ? 6.915   5.505   8.599  0.52 58.21  ? 257 HIS A ND1   1 
ATOM   1162 N ND1   B HIS A 1 176 ? 6.569   5.332   7.477  0.48 58.76  ? 257 HIS A ND1   1 
ATOM   1163 C CD2   A HIS A 1 176 ? 5.558   5.321   6.843  0.52 58.09  ? 257 HIS A CD2   1 
ATOM   1164 C CD2   B HIS A 1 176 ? 4.514   5.420   6.628  0.48 58.35  ? 257 HIS A CD2   1 
ATOM   1165 C CE1   A HIS A 1 176 ? 7.292   6.355   7.659  0.52 57.73  ? 257 HIS A CE1   1 
ATOM   1166 C CE1   B HIS A 1 176 ? 6.547   6.189   6.469  0.48 57.80  ? 257 HIS A CE1   1 
ATOM   1167 N NE2   A HIS A 1 176 ? 6.503   6.284   6.586  0.52 57.88  ? 257 HIS A NE2   1 
ATOM   1168 N NE2   B HIS A 1 176 ? 5.331   6.278   5.930  0.48 58.07  ? 257 HIS A NE2   1 
ATOM   1169 N N     . LYS A 1 177 ? 2.186   2.462   9.976  1.00 49.73  ? 258 LYS A N     1 
ATOM   1170 C CA    . LYS A 1 177 ? 1.598   1.288   10.635 1.00 48.64  ? 258 LYS A CA    1 
ATOM   1171 C C     . LYS A 1 177 ? 2.352   0.045   10.127 1.00 50.85  ? 258 LYS A C     1 
ATOM   1172 O O     . LYS A 1 177 ? 2.894   0.083   9.025  1.00 50.10  ? 258 LYS A O     1 
ATOM   1173 C CB    . LYS A 1 177 ? 0.107   1.145   10.272 1.00 50.04  ? 258 LYS A CB    1 
ATOM   1174 C CG    . LYS A 1 177 ? -0.800  2.156   10.959 1.00 57.00  ? 258 LYS A CG    1 
ATOM   1175 C CD    . LYS A 1 177 ? -2.245  1.959   10.544 1.00 68.29  ? 258 LYS A CD    1 
ATOM   1176 C CE    . LYS A 1 177 ? -3.120  3.098   11.009 1.00 78.94  ? 258 LYS A CE    1 
ATOM   1177 N NZ    . LYS A 1 177 ? -4.453  3.071   10.346 1.00 88.92  ? 258 LYS A NZ    1 
ATOM   1178 N N     . ILE A 1 178 ? 2.386   -1.056  10.913 1.00 45.96  ? 259 ILE A N     1 
ATOM   1179 C CA    . ILE A 1 178 ? 3.037   -2.296  10.471 1.00 44.68  ? 259 ILE A CA    1 
ATOM   1180 C C     . ILE A 1 178 ? 2.292   -2.772  9.207  1.00 50.42  ? 259 ILE A C     1 
ATOM   1181 O O     . ILE A 1 178 ? 1.059   -2.734  9.214  1.00 50.91  ? 259 ILE A O     1 
ATOM   1182 C CB    . ILE A 1 178 ? 3.069   -3.365  11.612 1.00 46.61  ? 259 ILE A CB    1 
ATOM   1183 C CG1   . ILE A 1 178 ? 3.938   -2.892  12.805 1.00 45.97  ? 259 ILE A CG1   1 
ATOM   1184 C CG2   . ILE A 1 178 ? 3.493   -4.753  11.116 1.00 45.90  ? 259 ILE A CG2   1 
ATOM   1185 C CD1   . ILE A 1 178 ? 5.403   -2.654  12.522 1.00 49.80  ? 259 ILE A CD1   1 
ATOM   1186 N N     . PRO A 1 179 ? 3.003   -3.101  8.098  1.00 48.06  ? 260 PRO A N     1 
ATOM   1187 C CA    . PRO A 1 179 ? 2.292   -3.476  6.842  1.00 49.16  ? 260 PRO A CA    1 
ATOM   1188 C C     . PRO A 1 179 ? 1.260   -4.576  7.025  1.00 53.40  ? 260 PRO A C     1 
ATOM   1189 O O     . PRO A 1 179 ? 1.520   -5.555  7.734  1.00 52.74  ? 260 PRO A O     1 
ATOM   1190 C CB    . PRO A 1 179 ? 3.423   -3.911  5.906  1.00 50.76  ? 260 PRO A CB    1 
ATOM   1191 C CG    . PRO A 1 179 ? 4.616   -3.140  6.401  1.00 54.61  ? 260 PRO A CG    1 
ATOM   1192 C CD    . PRO A 1 179 ? 4.467   -3.135  7.905  1.00 49.22  ? 260 PRO A CD    1 
ATOM   1193 N N     . ASP A 1 180 ? 0.068   -4.382  6.409  1.00 53.15  ? 261 ASP A N     1 
ATOM   1194 C CA    . ASP A 1 180 ? -1.073  -5.315  6.437  1.00 54.54  ? 261 ASP A CA    1 
ATOM   1195 C C     . ASP A 1 180 ? -1.718  -5.470  7.823  1.00 58.71  ? 261 ASP A C     1 
ATOM   1196 O O     . ASP A 1 180 ? -2.352  -6.496  8.094  1.00 58.93  ? 261 ASP A O     1 
ATOM   1197 C CB    . ASP A 1 180 ? -0.697  -6.692  5.840  1.00 56.96  ? 261 ASP A CB    1 
ATOM   1198 N N     . THR A 1 181 ? -1.522  -4.463  8.721  1.00 53.99  ? 262 THR A N     1 
ATOM   1199 C CA    . THR A 1 181 ? -2.074  -4.459  10.078 1.00 52.81  ? 262 THR A CA    1 
ATOM   1200 C C     . THR A 1 181 ? -2.430  -3.011  10.489 1.00 53.54  ? 262 THR A C     1 
ATOM   1201 O O     . THR A 1 181 ? -2.075  -2.052  9.784  1.00 52.68  ? 262 THR A O     1 
ATOM   1202 C CB    . THR A 1 181 ? -1.026  -4.964  11.122 1.00 59.09  ? 262 THR A CB    1 
ATOM   1203 O OG1   . THR A 1 181 ? -0.092  -3.914  11.387 1.00 55.12  ? 262 THR A OG1   1 
ATOM   1204 C CG2   . THR A 1 181 ? -0.298  -6.245  10.714 1.00 56.54  ? 262 THR A CG2   1 
ATOM   1205 N N     . GLU A 1 182 ? -3.067  -2.861  11.663 1.00 48.50  ? 263 GLU A N     1 
ATOM   1206 C CA    . GLU A 1 182 ? -3.392  -1.553  12.247 1.00 48.14  ? 263 GLU A CA    1 
ATOM   1207 C C     . GLU A 1 182 ? -2.420  -1.199  13.384 1.00 48.92  ? 263 GLU A C     1 
ATOM   1208 O O     . GLU A 1 182 ? -2.598  -0.168  14.035 1.00 50.74  ? 263 GLU A O     1 
ATOM   1209 C CB    . GLU A 1 182 ? -4.858  -1.501  12.732 1.00 50.01  ? 263 GLU A CB    1 
ATOM   1210 C CG    . GLU A 1 182 ? -5.894  -1.673  11.619 1.00 59.79  ? 263 GLU A CG    1 
ATOM   1211 C CD    . GLU A 1 182 ? -5.994  -0.575  10.573 1.00 84.09  ? 263 GLU A CD    1 
ATOM   1212 O OE1   . GLU A 1 182 ? -5.650  0.589   10.883 1.00 81.95  ? 263 GLU A OE1   1 
ATOM   1213 O OE2   . GLU A 1 182 ? -6.436  -0.880  9.442  1.00 84.82  ? 263 GLU A OE2   1 
ATOM   1214 N N     . THR A 1 183 ? -1.378  -2.032  13.594 1.00 42.28  ? 264 THR A N     1 
ATOM   1215 C CA    . THR A 1 183 ? -0.375  -1.835  14.652 1.00 40.72  ? 264 THR A CA    1 
ATOM   1216 C C     . THR A 1 183 ? 0.452   -0.562  14.423 1.00 42.37  ? 264 THR A C     1 
ATOM   1217 O O     . THR A 1 183 ? 1.109   -0.445  13.385 1.00 41.87  ? 264 THR A O     1 
ATOM   1218 C CB    . THR A 1 183 ? 0.566   -3.036  14.733 1.00 42.78  ? 264 THR A CB    1 
ATOM   1219 O OG1   . THR A 1 183 ? -0.183  -4.236  14.956 1.00 43.03  ? 264 THR A OG1   1 
ATOM   1220 C CG2   . THR A 1 183 ? 1.638   -2.862  15.801 1.00 39.47  ? 264 THR A CG2   1 
ATOM   1221 N N     . LEU A 1 184 ? 0.478   0.334   15.428 1.00 39.97  ? 265 LEU A N     1 
ATOM   1222 C CA    . LEU A 1 184 ? 1.260   1.568   15.396 1.00 40.68  ? 265 LEU A CA    1 
ATOM   1223 C C     . LEU A 1 184 ? 2.708   1.309   15.830 1.00 40.50  ? 265 LEU A C     1 
ATOM   1224 O O     . LEU A 1 184 ? 2.958   0.333   16.528 1.00 40.48  ? 265 LEU A O     1 
ATOM   1225 C CB    . LEU A 1 184 ? 0.628   2.626   16.330 1.00 41.51  ? 265 LEU A CB    1 
ATOM   1226 C CG    . LEU A 1 184 ? -0.850  3.007   16.092 1.00 48.33  ? 265 LEU A CG    1 
ATOM   1227 C CD1   . LEU A 1 184 ? -1.333  3.985   17.152 1.00 49.74  ? 265 LEU A CD1   1 
ATOM   1228 C CD2   . LEU A 1 184 ? -1.078  3.570   14.695 1.00 51.83  ? 265 LEU A CD2   1 
ATOM   1229 N N     . CYS A 1 185 ? 3.657   2.193   15.444 1.00 35.80  ? 266 CYS A N     1 
ATOM   1230 C CA    . CYS A 1 185 ? 5.061   2.100   15.881 1.00 35.06  ? 266 CYS A CA    1 
ATOM   1231 C C     . CYS A 1 185 ? 5.344   3.278   16.813 1.00 35.19  ? 266 CYS A C     1 
ATOM   1232 O O     . CYS A 1 185 ? 5.165   4.431   16.414 1.00 35.84  ? 266 CYS A O     1 
ATOM   1233 C CB    . CYS A 1 185 ? 6.025   2.082   14.705 1.00 36.19  ? 266 CYS A CB    1 
ATOM   1234 S SG    . CYS A 1 185 ? 5.831   0.634   13.631 1.00 40.93  ? 266 CYS A SG    1 
ATOM   1235 N N     . TYR A 1 186 ? 5.808   2.979   18.029 1.00 32.62  ? 267 TYR A N     1 
ATOM   1236 C CA    . TYR A 1 186 ? 6.106   3.998   19.029 1.00 31.98  ? 267 TYR A CA    1 
ATOM   1237 C C     . TYR A 1 186 ? 7.538   3.783   19.515 1.00 36.06  ? 267 TYR A C     1 
ATOM   1238 O O     . TYR A 1 186 ? 7.869   2.664   19.888 1.00 35.39  ? 267 TYR A O     1 
ATOM   1239 C CB    . TYR A 1 186 ? 5.115   3.887   20.193 1.00 33.30  ? 267 TYR A CB    1 
ATOM   1240 C CG    . TYR A 1 186 ? 5.223   5.029   21.175 1.00 33.59  ? 267 TYR A CG    1 
ATOM   1241 C CD1   . TYR A 1 186 ? 4.528   6.222   20.971 1.00 35.60  ? 267 TYR A CD1   1 
ATOM   1242 C CD2   . TYR A 1 186 ? 6.064   4.944   22.279 1.00 33.36  ? 267 TYR A CD2   1 
ATOM   1243 C CE1   . TYR A 1 186 ? 4.637   7.285   21.872 1.00 34.85  ? 267 TYR A CE1   1 
ATOM   1244 C CE2   . TYR A 1 186 ? 6.218   6.012   23.152 1.00 33.34  ? 267 TYR A CE2   1 
ATOM   1245 C CZ    . TYR A 1 186 ? 5.504   7.183   22.948 1.00 36.30  ? 267 TYR A CZ    1 
ATOM   1246 O OH    . TYR A 1 186 ? 5.648   8.226   23.846 1.00 39.24  ? 267 TYR A OH    1 
ATOM   1247 N N     . VAL A 1 187 ? 8.398   4.828   19.453 1.00 32.72  ? 268 VAL A N     1 
ATOM   1248 C CA    . VAL A 1 187 ? 9.824   4.690   19.760 1.00 31.71  ? 268 VAL A CA    1 
ATOM   1249 C C     . VAL A 1 187 ? 10.215  5.372   21.047 1.00 34.27  ? 268 VAL A C     1 
ATOM   1250 O O     . VAL A 1 187 ? 9.784   6.498   21.279 1.00 33.87  ? 268 VAL A O     1 
ATOM   1251 C CB    . VAL A 1 187 ? 10.683  5.190   18.560 1.00 33.71  ? 268 VAL A CB    1 
ATOM   1252 C CG1   . VAL A 1 187 ? 12.174  5.009   18.815 1.00 34.42  ? 268 VAL A CG1   1 
ATOM   1253 C CG2   . VAL A 1 187 ? 10.279  4.490   17.270 1.00 33.12  ? 268 VAL A CG2   1 
ATOM   1254 N N     . MET A 1 188 ? 11.034  4.707   21.887 1.00 31.72  ? 269 MET A N     1 
ATOM   1255 C CA    . MET A 1 188 ? 11.472  5.365   23.122 1.00 32.19  ? 269 MET A CA    1 
ATOM   1256 C C     . MET A 1 188 ? 12.968  5.181   23.229 1.00 33.61  ? 269 MET A C     1 
ATOM   1257 O O     . MET A 1 188 ? 13.502  4.216   22.684 1.00 31.53  ? 269 MET A O     1 
ATOM   1258 C CB    . MET A 1 188 ? 10.810  4.723   24.371 1.00 35.31  ? 269 MET A CB    1 
ATOM   1259 C CG    . MET A 1 188 ? 9.291   4.711   24.307 1.00 39.45  ? 269 MET A CG    1 
ATOM   1260 S SD    . MET A 1 188 ? 8.454   4.374   25.873 1.00 42.01  ? 269 MET A SD    1 
ATOM   1261 C CE    . MET A 1 188 ? 9.214   2.794   26.352 1.00 36.86  ? 269 MET A CE    1 
ATOM   1262 N N     . PRO A 1 189 ? 13.668  6.026   24.002 1.00 31.90  ? 270 PRO A N     1 
ATOM   1263 C CA    . PRO A 1 189 ? 15.093  5.767   24.223 1.00 31.83  ? 270 PRO A CA    1 
ATOM   1264 C C     . PRO A 1 189 ? 15.207  4.469   25.034 1.00 32.90  ? 270 PRO A C     1 
ATOM   1265 O O     . PRO A 1 189 ? 14.343  4.168   25.881 1.00 31.63  ? 270 PRO A O     1 
ATOM   1266 C CB    . PRO A 1 189 ? 15.541  6.973   25.080 1.00 33.55  ? 270 PRO A CB    1 
ATOM   1267 C CG    . PRO A 1 189 ? 14.280  7.465   25.723 1.00 37.26  ? 270 PRO A CG    1 
ATOM   1268 C CD    . PRO A 1 189 ? 13.214  7.244   24.705 1.00 32.88  ? 270 PRO A CD    1 
ATOM   1269 N N     . SER A 1 190 ? 16.233  3.674   24.740 1.00 29.18  ? 271 SER A N     1 
ATOM   1270 C CA    . SER A 1 190 ? 16.440  2.403   25.451 1.00 28.93  ? 271 SER A CA    1 
ATOM   1271 C C     . SER A 1 190 ? 16.402  2.577   26.979 1.00 32.25  ? 271 SER A C     1 
ATOM   1272 O O     . SER A 1 190 ? 16.935  3.551   27.511 1.00 31.65  ? 271 SER A O     1 
ATOM   1273 C CB    . SER A 1 190 ? 17.755  1.769   25.036 1.00 30.83  ? 271 SER A CB    1 
ATOM   1274 O OG    . SER A 1 190 ? 18.103  0.686   25.890 1.00 29.21  ? 271 SER A OG    1 
ATOM   1275 N N     . SER A 1 191 ? 15.729  1.649   27.657 1.00 28.88  ? 272 SER A N     1 
ATOM   1276 C CA    . SER A 1 191 ? 15.600  1.648   29.126 1.00 27.49  ? 272 SER A CA    1 
ATOM   1277 C C     . SER A 1 191 ? 16.961  1.317   29.796 1.00 31.79  ? 272 SER A C     1 
ATOM   1278 O O     . SER A 1 191 ? 17.087  1.463   31.010 1.00 29.31  ? 272 SER A O     1 
ATOM   1279 C CB    . SER A 1 191 ? 14.519  0.652   29.553 1.00 29.48  ? 272 SER A CB    1 
ATOM   1280 O OG    . SER A 1 191 ? 14.856  -0.673  29.183 1.00 30.73  ? 272 SER A OG    1 
ATOM   1281 N N     . SER A 1 192 ? 17.981  0.888   29.005 1.00 29.43  ? 273 SER A N     1 
ATOM   1282 C CA    . SER A 1 192 ? 19.327  0.650   29.545 1.00 28.03  ? 273 SER A CA    1 
ATOM   1283 C C     . SER A 1 192 ? 19.885  1.960   30.147 1.00 29.42  ? 273 SER A C     1 
ATOM   1284 O O     . SER A 1 192 ? 19.838  3.040   29.514 1.00 28.62  ? 273 SER A O     1 
ATOM   1285 C CB    . SER A 1 192 ? 20.273  0.202   28.434 1.00 29.87  ? 273 SER A CB    1 
ATOM   1286 O OG    . SER A 1 192 ? 21.593  0.124   28.959 1.00 29.17  ? 273 SER A OG    1 
ATOM   1287 N N     . ALA A 1 193 ? 20.553  1.822   31.291 1.00 25.78  ? 274 ALA A N     1 
ATOM   1288 C CA    . ALA A 1 193 ? 21.140  3.027   31.905 1.00 26.03  ? 274 ALA A CA    1 
ATOM   1289 C C     . ALA A 1 193 ? 22.479  3.359   31.222 1.00 31.18  ? 274 ALA A C     1 
ATOM   1290 O O     . ALA A 1 193 ? 23.137  4.297   31.626 1.00 32.21  ? 274 ALA A O     1 
ATOM   1291 C CB    . ALA A 1 193 ? 21.321  2.810   33.402 1.00 25.97  ? 274 ALA A CB    1 
ATOM   1292 N N     . ARG A 1 194 ? 22.880  2.610   30.158 1.00 29.24  ? 275 ARG A N     1 
ATOM   1293 C CA    . ARG A 1 194 ? 24.110  2.925   29.430 1.00 30.18  ? 275 ARG A CA    1 
ATOM   1294 C C     . ARG A 1 194 ? 24.053  4.286   28.728 1.00 34.88  ? 275 ARG A C     1 
ATOM   1295 O O     . ARG A 1 194 ? 25.088  4.932   28.568 1.00 35.23  ? 275 ARG A O     1 
ATOM   1296 C CB    . ARG A 1 194 ? 24.430  1.839   28.356 1.00 33.55  ? 275 ARG A CB    1 
ATOM   1297 C CG    . ARG A 1 194 ? 25.847  1.982   27.783 1.00 37.58  ? 275 ARG A CG    1 
ATOM   1298 C CD    . ARG A 1 194 ? 26.236  0.884   26.821 1.00 41.76  ? 275 ARG A CD    1 
ATOM   1299 N NE    . ARG A 1 194 ? 26.044  -0.471  27.362 1.00 39.63  ? 275 ARG A NE    1 
ATOM   1300 C CZ    . ARG A 1 194 ? 27.004  -1.237  27.850 1.00 43.20  ? 275 ARG A CZ    1 
ATOM   1301 N NH1   . ARG A 1 194 ? 28.224  -0.744  28.038 1.00 38.19  ? 275 ARG A NH1   1 
ATOM   1302 N NH2   . ARG A 1 194 ? 26.743  -2.485  28.209 1.00 39.35  ? 275 ARG A NH2   1 
HETATM 1303 N N     A CSO A 1 195 ? 22.861  4.729   28.239 0.52 34.10  ? 276 CSO A N     1 
HETATM 1304 C CA    A CSO A 1 195 ? 22.799  5.994   27.472 0.52 35.41  ? 276 CSO A CA    1 
HETATM 1305 C CB    A CSO A 1 195 ? 21.757  6.151   26.361 0.52 38.01  ? 276 CSO A CB    1 
HETATM 1306 S SG    A CSO A 1 195 ? 20.040  6.180   26.917 0.52 40.67  ? 276 CSO A SG    1 
HETATM 1307 C C     A CSO A 1 195 ? 22.780  7.229   28.374 0.52 37.75  ? 276 CSO A C     1 
HETATM 1308 O O     A CSO A 1 195 ? 21.832  7.489   29.111 0.52 37.41  ? 276 CSO A O     1 
HETATM 1309 O OD    A CSO A 1 195 ? 19.627  4.671   26.500 0.52 42.44  ? 276 CSO A OD    1 
ATOM   1310 N N     B CYS A 1 195 ? 22.857  4.717   28.393 0.48 32.95  ? 276 CYS A N     1 
ATOM   1311 C CA    B CYS A 1 195 ? 22.597  5.943   27.675 0.48 34.14  ? 276 CYS A CA    1 
ATOM   1312 C C     B CYS A 1 195 ? 22.804  7.194   28.545 0.48 38.04  ? 276 CYS A C     1 
ATOM   1313 O O     B CYS A 1 195 ? 22.038  7.407   29.486 0.48 38.66  ? 276 CYS A O     1 
ATOM   1314 C CB    B CYS A 1 195 ? 21.189  5.883   27.110 0.48 34.61  ? 276 CYS A CB    1 
ATOM   1315 S SG    B CYS A 1 195 ? 20.806  7.233   25.992 0.48 38.86  ? 276 CYS A SG    1 
ATOM   1316 N N     . ALA A 1 196 ? 23.828  8.017   28.230 1.00 36.19  ? 277 ALA A N     1 
ATOM   1317 C CA    . ALA A 1 196 ? 24.094  9.244   28.996 1.00 37.83  ? 277 ALA A CA    1 
ATOM   1318 C C     . ALA A 1 196 ? 23.160  10.421  28.687 1.00 43.81  ? 277 ALA A C     1 
ATOM   1319 O O     . ALA A 1 196 ? 23.038  11.323  29.522 1.00 43.86  ? 277 ALA A O     1 
ATOM   1320 C CB    . ALA A 1 196 ? 25.543  9.662   28.823 1.00 39.65  ? 277 ALA A CB    1 
ATOM   1321 N N     . GLN A 1 197 ? 22.493  10.404  27.509 1.00 40.02  ? 278 GLN A N     1 
ATOM   1322 C CA    . GLN A 1 197 ? 21.583  11.465  27.031 1.00 38.90  ? 278 GLN A CA    1 
ATOM   1323 C C     . GLN A 1 197 ? 20.307  11.582  27.853 1.00 41.89  ? 278 GLN A C     1 
ATOM   1324 O O     . GLN A 1 197 ? 19.720  12.661  27.913 1.00 42.02  ? 278 GLN A O     1 
ATOM   1325 C CB    . GLN A 1 197 ? 21.227  11.262  25.553 1.00 41.02  ? 278 GLN A CB    1 
ATOM   1326 C CG    . GLN A 1 197 ? 22.367  11.606  24.608 1.00 50.31  ? 278 GLN A CG    1 
ATOM   1327 C CD    . GLN A 1 197 ? 23.323  10.467  24.330 1.00 52.09  ? 278 GLN A CD    1 
ATOM   1328 O OE1   . GLN A 1 197 ? 23.192  9.332   24.837 1.00 43.67  ? 278 GLN A OE1   1 
ATOM   1329 N NE2   . GLN A 1 197 ? 24.309  10.755  23.492 1.00 48.19  ? 278 GLN A NE2   1 
ATOM   1330 N N     . PHE A 1 198 ? 19.865  10.462  28.448 1.00 37.12  ? 279 PHE A N     1 
ATOM   1331 C CA    . PHE A 1 198 ? 18.691  10.368  29.323 1.00 37.22  ? 279 PHE A CA    1 
ATOM   1332 C C     . PHE A 1 198 ? 19.257  9.656   30.520 1.00 39.71  ? 279 PHE A C     1 
ATOM   1333 O O     . PHE A 1 198 ? 19.110  8.442   30.634 1.00 38.15  ? 279 PHE A O     1 
ATOM   1334 C CB    . PHE A 1 198 ? 17.578  9.547   28.645 1.00 37.80  ? 279 PHE A CB    1 
ATOM   1335 C CG    . PHE A 1 198 ? 17.100  10.113  27.340 1.00 39.94  ? 279 PHE A CG    1 
ATOM   1336 C CD1   . PHE A 1 198 ? 17.714  9.755   26.141 1.00 42.40  ? 279 PHE A CD1   1 
ATOM   1337 C CD2   . PHE A 1 198 ? 16.068  11.045  27.304 1.00 41.83  ? 279 PHE A CD2   1 
ATOM   1338 C CE1   . PHE A 1 198 ? 17.288  10.304  24.924 1.00 41.64  ? 279 PHE A CE1   1 
ATOM   1339 C CE2   . PHE A 1 198 ? 15.614  11.560  26.081 1.00 44.05  ? 279 PHE A CE2   1 
ATOM   1340 C CZ    . PHE A 1 198 ? 16.261  11.222  24.908 1.00 41.12  ? 279 PHE A CZ    1 
ATOM   1341 N N     . PRO A 1 199 ? 20.017  10.384  31.375 1.00 36.34  ? 280 PRO A N     1 
ATOM   1342 C CA    . PRO A 1 199 ? 20.786  9.706   32.440 1.00 36.63  ? 280 PRO A CA    1 
ATOM   1343 C C     . PRO A 1 199 ? 20.001  8.956   33.517 1.00 36.97  ? 280 PRO A C     1 
ATOM   1344 O O     . PRO A 1 199 ? 20.553  8.066   34.160 1.00 35.37  ? 280 PRO A O     1 
ATOM   1345 C CB    . PRO A 1 199 ? 21.617  10.842  33.056 1.00 39.34  ? 280 PRO A CB    1 
ATOM   1346 C CG    . PRO A 1 199 ? 21.012  12.092  32.599 1.00 42.46  ? 280 PRO A CG    1 
ATOM   1347 C CD    . PRO A 1 199 ? 20.331  11.827  31.314 1.00 37.86  ? 280 PRO A CD    1 
ATOM   1348 N N     . ARG A 1 200 ? 18.748  9.330   33.746 1.00 34.48  ? 281 ARG A N     1 
ATOM   1349 C CA    . ARG A 1 200 ? 17.956  8.729   34.819 1.00 35.23  ? 281 ARG A CA    1 
ATOM   1350 C C     . ARG A 1 200 ? 16.655  8.185   34.281 1.00 33.68  ? 281 ARG A C     1 
ATOM   1351 O O     . ARG A 1 200 ? 16.198  8.669   33.261 1.00 34.79  ? 281 ARG A O     1 
ATOM   1352 C CB    . ARG A 1 200 ? 17.576  9.837   35.851 1.00 37.14  ? 281 ARG A CB    1 
ATOM   1353 C CG    . ARG A 1 200 ? 18.721  10.722  36.388 1.00 41.40  ? 281 ARG A CG    1 
ATOM   1354 C CD    . ARG A 1 200 ? 18.179  11.915  37.185 1.00 42.47  ? 281 ARG A CD    1 
ATOM   1355 N NE    . ARG A 1 200 ? 17.448  12.843  36.306 1.00 43.48  ? 281 ARG A NE    1 
ATOM   1356 C CZ    . ARG A 1 200 ? 16.767  13.911  36.717 1.00 58.74  ? 281 ARG A CZ    1 
ATOM   1357 N NH1   . ARG A 1 200 ? 16.725  14.226  38.010 1.00 50.75  ? 281 ARG A NH1   1 
ATOM   1358 N NH2   . ARG A 1 200 ? 16.125  14.672  35.841 1.00 47.33  ? 281 ARG A NH2   1 
ATOM   1359 N N     . ALA A 1 201 ? 15.964  7.349   35.069 1.00 32.35  ? 282 ALA A N     1 
ATOM   1360 C CA    . ALA A 1 201 ? 14.621  6.860   34.750 1.00 33.45  ? 282 ALA A CA    1 
ATOM   1361 C C     . ALA A 1 201 ? 13.671  8.042   34.565 1.00 35.27  ? 282 ALA A C     1 
ATOM   1362 O O     . ALA A 1 201 ? 12.901  8.049   33.612 1.00 33.51  ? 282 ALA A O     1 
ATOM   1363 C CB    . ALA A 1 201 ? 14.104  5.943   35.861 1.00 33.08  ? 282 ALA A CB    1 
ATOM   1364 N N     . GLN A 1 202 ? 13.787  9.093   35.435 1.00 33.54  ? 283 GLN A N     1 
ATOM   1365 C CA    . GLN A 1 202 ? 12.989  10.311  35.357 1.00 34.46  ? 283 GLN A CA    1 
ATOM   1366 C C     . GLN A 1 202 ? 13.073  10.963  33.973 1.00 38.55  ? 283 GLN A C     1 
ATOM   1367 O O     . GLN A 1 202 ? 12.101  11.567  33.512 1.00 41.47  ? 283 GLN A O     1 
ATOM   1368 C CB    . GLN A 1 202 ? 13.464  11.314  36.468 1.00 35.72  ? 283 GLN A CB    1 
ATOM   1369 C CG    . GLN A 1 202 ? 12.999  12.769  36.354 1.00 51.02  ? 283 GLN A CG    1 
ATOM   1370 C CD    . GLN A 1 202 ? 11.498  12.948  36.371 1.00 70.58  ? 283 GLN A CD    1 
ATOM   1371 O OE1   . GLN A 1 202 ? 10.735  12.135  36.921 1.00 65.29  ? 283 GLN A OE1   1 
ATOM   1372 N NE2   . GLN A 1 202 ? 11.049  14.025  35.751 1.00 56.51  ? 283 GLN A NE2   1 
ATOM   1373 N N     . ASP A 1 203 ? 14.240  10.901  33.334 1.00 34.98  ? 284 ASP A N     1 
ATOM   1374 C CA    . ASP A 1 203 ? 14.438  11.512  32.022 1.00 34.54  ? 284 ASP A CA    1 
ATOM   1375 C C     . ASP A 1 203 ? 13.729  10.775  30.852 1.00 37.69  ? 284 ASP A C     1 
ATOM   1376 O O     . ASP A 1 203 ? 13.569  11.357  29.782 1.00 39.46  ? 284 ASP A O     1 
ATOM   1377 C CB    . ASP A 1 203 ? 15.934  11.671  31.726 1.00 36.98  ? 284 ASP A CB    1 
ATOM   1378 C CG    . ASP A 1 203 ? 16.633  12.496  32.795 1.00 42.11  ? 284 ASP A CG    1 
ATOM   1379 O OD1   . ASP A 1 203 ? 16.195  13.645  33.038 1.00 41.91  ? 284 ASP A OD1   1 
ATOM   1380 O OD2   . ASP A 1 203 ? 17.609  11.995  33.388 1.00 41.61  ? 284 ASP A OD2   1 
ATOM   1381 N N     . LYS A 1 204 ? 13.260  9.547   31.110 1.00 32.80  ? 285 LYS A N     1 
ATOM   1382 C CA    . LYS A 1 204 ? 12.607  8.694   30.076 1.00 32.38  ? 285 LYS A CA    1 
ATOM   1383 C C     . LYS A 1 204 ? 11.114  8.500   30.327 1.00 36.81  ? 285 LYS A C     1 
ATOM   1384 O O     . LYS A 1 204 ? 10.394  8.115   29.418 1.00 35.67  ? 285 LYS A O     1 
ATOM   1385 C CB    . LYS A 1 204 ? 13.284  7.306   30.074 1.00 32.75  ? 285 LYS A CB    1 
ATOM   1386 C CG    . LYS A 1 204 ? 14.746  7.319   29.651 1.00 37.83  ? 285 LYS A CG    1 
ATOM   1387 C CD    . LYS A 1 204 ? 15.432  5.969   29.803 1.00 35.72  ? 285 LYS A CD    1 
ATOM   1388 C CE    . LYS A 1 204 ? 16.919  6.052   29.545 1.00 33.07  ? 285 LYS A CE    1 
ATOM   1389 N NZ    . LYS A 1 204 ? 17.639  4.800   29.936 1.00 32.68  ? 285 LYS A NZ    1 
ATOM   1390 N N     . VAL A 1 205 ? 10.654  8.777   31.561 1.00 34.93  ? 286 VAL A N     1 
ATOM   1391 C CA    A VAL A 1 205 ? 9.271   8.530   31.956 0.64 34.29  ? 286 VAL A CA    1 
ATOM   1392 C CA    B VAL A 1 205 ? 9.273   8.604   32.018 0.36 34.54  ? 286 VAL A CA    1 
ATOM   1393 C C     . VAL A 1 205 ? 8.266   9.320   31.092 1.00 36.62  ? 286 VAL A C     1 
ATOM   1394 O O     . VAL A 1 205 ? 7.179   8.792   30.831 1.00 36.22  ? 286 VAL A O     1 
ATOM   1395 C CB    A VAL A 1 205 ? 9.026   8.691   33.479 0.64 37.42  ? 286 VAL A CB    1 
ATOM   1396 C CB    B VAL A 1 205 ? 9.162   9.020   33.514 0.36 38.36  ? 286 VAL A CB    1 
ATOM   1397 C CG1   A VAL A 1 205 ? 9.053   10.153  33.922 0.64 37.46  ? 286 VAL A CG1   1 
ATOM   1398 C CG1   B VAL A 1 205 ? 7.733   9.329   33.934 0.36 38.49  ? 286 VAL A CG1   1 
ATOM   1399 C CG2   A VAL A 1 205 ? 7.731   8.003   33.899 0.64 36.96  ? 286 VAL A CG2   1 
ATOM   1400 C CG2   B VAL A 1 205 ? 9.755   7.947   34.417 0.36 38.02  ? 286 VAL A CG2   1 
ATOM   1401 N N     . HIS A 1 206 ? 8.644   10.496  30.572 1.00 33.82  ? 287 HIS A N     1 
ATOM   1402 C CA    . HIS A 1 206 ? 7.759   11.255  29.677 1.00 35.69  ? 287 HIS A CA    1 
ATOM   1403 C C     . HIS A 1 206 ? 7.254   10.356  28.516 1.00 37.87  ? 287 HIS A C     1 
ATOM   1404 O O     . HIS A 1 206 ? 6.067   10.398  28.149 1.00 37.76  ? 287 HIS A O     1 
ATOM   1405 C CB    . HIS A 1 206 ? 8.486   12.491  29.111 1.00 38.38  ? 287 HIS A CB    1 
ATOM   1406 C CG    . HIS A 1 206 ? 7.815   13.081  27.913 1.00 43.85  ? 287 HIS A CG    1 
ATOM   1407 N ND1   . HIS A 1 206 ? 8.334   12.906  26.646 1.00 46.97  ? 287 HIS A ND1   1 
ATOM   1408 C CD2   . HIS A 1 206 ? 6.667   13.799  27.822 1.00 47.15  ? 287 HIS A CD2   1 
ATOM   1409 C CE1   . HIS A 1 206 ? 7.490   13.512  25.822 1.00 46.71  ? 287 HIS A CE1   1 
ATOM   1410 N NE2   . HIS A 1 206 ? 6.478   14.076  26.481 1.00 47.18  ? 287 HIS A NE2   1 
ATOM   1411 N N     . TYR A 1 207 ? 8.157   9.544   27.937 1.00 34.16  ? 288 TYR A N     1 
ATOM   1412 C CA    . TYR A 1 207 ? 7.761   8.672   26.820 1.00 33.39  ? 288 TYR A CA    1 
ATOM   1413 C C     . TYR A 1 207 ? 6.776   7.557   27.237 1.00 36.19  ? 288 TYR A C     1 
ATOM   1414 O O     . TYR A 1 207 ? 5.886   7.194   26.457 1.00 35.25  ? 288 TYR A O     1 
ATOM   1415 C CB    . TYR A 1 207 ? 9.001   8.121   26.076 1.00 35.00  ? 288 TYR A CB    1 
ATOM   1416 C CG    . TYR A 1 207 ? 9.715   9.236   25.332 1.00 37.69  ? 288 TYR A CG    1 
ATOM   1417 C CD1   . TYR A 1 207 ? 9.112   9.879   24.250 1.00 40.32  ? 288 TYR A CD1   1 
ATOM   1418 C CD2   . TYR A 1 207 ? 10.964  9.688   25.745 1.00 39.32  ? 288 TYR A CD2   1 
ATOM   1419 C CE1   . TYR A 1 207 ? 9.725   10.964  23.614 1.00 40.17  ? 288 TYR A CE1   1 
ATOM   1420 C CE2   . TYR A 1 207 ? 11.606  10.744  25.091 1.00 40.35  ? 288 TYR A CE2   1 
ATOM   1421 C CZ    . TYR A 1 207 ? 10.988  11.372  24.020 1.00 44.40  ? 288 TYR A CZ    1 
ATOM   1422 O OH    . TYR A 1 207 ? 11.609  12.438  23.400 1.00 45.48  ? 288 TYR A OH    1 
ATOM   1423 N N     . TYR A 1 208 ? 6.912   7.046   28.471 1.00 32.62  ? 289 TYR A N     1 
ATOM   1424 C CA    . TYR A 1 208 ? 6.022   6.020   29.013 1.00 31.31  ? 289 TYR A CA    1 
ATOM   1425 C C     . TYR A 1 208 ? 4.636   6.618   29.309 1.00 37.16  ? 289 TYR A C     1 
ATOM   1426 O O     . TYR A 1 208 ? 3.625   5.953   29.087 1.00 36.17  ? 289 TYR A O     1 
ATOM   1427 C CB    . TYR A 1 208 ? 6.633   5.421   30.278 1.00 30.24  ? 289 TYR A CB    1 
ATOM   1428 C CG    . TYR A 1 208 ? 7.795   4.484   30.031 1.00 30.68  ? 289 TYR A CG    1 
ATOM   1429 C CD1   . TYR A 1 208 ? 9.044   4.971   29.647 1.00 31.31  ? 289 TYR A CD1   1 
ATOM   1430 C CD2   . TYR A 1 208 ? 7.667   3.111   30.247 1.00 32.26  ? 289 TYR A CD2   1 
ATOM   1431 C CE1   . TYR A 1 208 ? 10.133  4.109   29.465 1.00 30.42  ? 289 TYR A CE1   1 
ATOM   1432 C CE2   . TYR A 1 208 ? 8.753   2.245   30.094 1.00 33.19  ? 289 TYR A CE2   1 
ATOM   1433 C CZ    . TYR A 1 208 ? 9.983   2.748   29.698 1.00 36.26  ? 289 TYR A CZ    1 
ATOM   1434 O OH    . TYR A 1 208 ? 11.019  1.869   29.456 1.00 32.80  ? 289 TYR A OH    1 
ATOM   1435 N N     . ILE A 1 209 ? 4.594   7.863   29.842 1.00 36.71  ? 290 ILE A N     1 
ATOM   1436 C CA    . ILE A 1 209 ? 3.328   8.540   30.100 1.00 36.39  ? 290 ILE A CA    1 
ATOM   1437 C C     . ILE A 1 209 ? 2.583   8.785   28.780 1.00 41.33  ? 290 ILE A C     1 
ATOM   1438 O O     . ILE A 1 209 ? 1.376   8.557   28.712 1.00 42.30  ? 290 ILE A O     1 
ATOM   1439 C CB    . ILE A 1 209 ? 3.544   9.856   30.905 1.00 38.34  ? 290 ILE A CB    1 
ATOM   1440 C CG1   . ILE A 1 209 ? 4.122   9.549   32.295 1.00 37.73  ? 290 ILE A CG1   1 
ATOM   1441 C CG2   . ILE A 1 209 ? 2.238   10.674  31.005 1.00 39.76  ? 290 ILE A CG2   1 
ATOM   1442 C CD1   . ILE A 1 209 ? 4.697   10.767  33.002 1.00 41.87  ? 290 ILE A CD1   1 
ATOM   1443 N N     . LYS A 1 210 ? 3.304   9.227   27.727 1.00 37.84  ? 291 LYS A N     1 
ATOM   1444 C CA    . LYS A 1 210 ? 2.714   9.465   26.403 1.00 37.49  ? 291 LYS A CA    1 
ATOM   1445 C C     . LYS A 1 210 ? 2.259   8.124   25.767 1.00 39.42  ? 291 LYS A C     1 
ATOM   1446 O O     . LYS A 1 210 ? 1.228   8.083   25.084 1.00 41.06  ? 291 LYS A O     1 
ATOM   1447 C CB    . LYS A 1 210 ? 3.689   10.223  25.484 1.00 39.26  ? 291 LYS A CB    1 
ATOM   1448 C CG    . LYS A 1 210 ? 3.801   11.707  25.812 1.00 46.83  ? 291 LYS A CG    1 
ATOM   1449 C CD    . LYS A 1 210 ? 2.948   12.563  24.881 1.00 61.07  ? 291 LYS A CD    1 
ATOM   1450 N N     . LEU A 1 211 ? 2.992   7.028   26.048 1.00 35.62  ? 292 LEU A N     1 
ATOM   1451 C CA    . LEU A 1 211 ? 2.620   5.682   25.592 1.00 34.74  ? 292 LEU A CA    1 
ATOM   1452 C C     . LEU A 1 211 ? 1.277   5.312   26.249 1.00 39.88  ? 292 LEU A C     1 
ATOM   1453 O O     . LEU A 1 211 ? 0.370   4.871   25.541 1.00 39.96  ? 292 LEU A O     1 
ATOM   1454 C CB    . LEU A 1 211 ? 3.712   4.658   25.966 1.00 33.94  ? 292 LEU A CB    1 
ATOM   1455 C CG    . LEU A 1 211 ? 3.424   3.175   25.667 1.00 36.69  ? 292 LEU A CG    1 
ATOM   1456 C CD1   . LEU A 1 211 ? 3.036   2.968   24.202 1.00 35.81  ? 292 LEU A CD1   1 
ATOM   1457 C CD2   . LEU A 1 211 ? 4.611   2.302   26.066 1.00 37.86  ? 292 LEU A CD2   1 
ATOM   1458 N N     . LYS A 1 212 ? 1.142   5.560   27.575 1.00 38.73  ? 293 LYS A N     1 
ATOM   1459 C CA    . LYS A 1 212 ? -0.073  5.302   28.364 1.00 38.81  ? 293 LYS A CA    1 
ATOM   1460 C C     . LYS A 1 212 ? -1.257  6.073   27.782 1.00 44.75  ? 293 LYS A C     1 
ATOM   1461 O O     . LYS A 1 212 ? -2.302  5.470   27.535 1.00 43.61  ? 293 LYS A O     1 
ATOM   1462 C CB    . LYS A 1 212 ? 0.133   5.656   29.850 1.00 39.38  ? 293 LYS A CB    1 
ATOM   1463 C CG    . LYS A 1 212 ? -1.000  5.147   30.738 1.00 50.57  ? 293 LYS A CG    1 
ATOM   1464 C CD    . LYS A 1 212 ? -0.916  5.606   32.184 1.00 58.92  ? 293 LYS A CD    1 
ATOM   1465 C CE    . LYS A 1 212 ? -1.971  4.930   33.038 1.00 75.65  ? 293 LYS A CE    1 
ATOM   1466 N NZ    . LYS A 1 212 ? -3.365  5.140   32.535 1.00 82.96  ? 293 LYS A NZ    1 
ATOM   1467 N N     . ASP A 1 213 ? -1.071  7.392   27.521 1.00 44.39  ? 294 ASP A N     1 
ATOM   1468 C CA    . ASP A 1 213 ? -2.084  8.271   26.917 1.00 44.59  ? 294 ASP A CA    1 
ATOM   1469 C C     . ASP A 1 213 ? -2.516  7.738   25.537 1.00 46.99  ? 294 ASP A C     1 
ATOM   1470 O O     . ASP A 1 213 ? -3.713  7.744   25.227 1.00 47.28  ? 294 ASP A O     1 
ATOM   1471 C CB    . ASP A 1 213 ? -1.562  9.711   26.783 1.00 46.99  ? 294 ASP A CB    1 
ATOM   1472 C CG    . ASP A 1 213 ? -1.238  10.427  28.087 1.00 58.96  ? 294 ASP A CG    1 
ATOM   1473 O OD1   . ASP A 1 213 ? -1.716  9.972   29.157 1.00 59.33  ? 294 ASP A OD1   1 
ATOM   1474 O OD2   . ASP A 1 213 ? -0.517  11.451  28.036 1.00 64.33  ? 294 ASP A OD2   1 
ATOM   1475 N N     . LEU A 1 214 ? -1.542  7.286   24.712 1.00 42.51  ? 295 LEU A N     1 
ATOM   1476 C CA    . LEU A 1 214 ? -1.814  6.707   23.392 1.00 41.97  ? 295 LEU A CA    1 
ATOM   1477 C C     . LEU A 1 214 ? -2.672  5.435   23.541 1.00 47.13  ? 295 LEU A C     1 
ATOM   1478 O O     . LEU A 1 214 ? -3.636  5.277   22.789 1.00 48.84  ? 295 LEU A O     1 
ATOM   1479 C CB    . LEU A 1 214 ? -0.514  6.403   22.612 1.00 41.38  ? 295 LEU A CB    1 
ATOM   1480 C CG    . LEU A 1 214 ? -0.690  5.797   21.207 1.00 44.92  ? 295 LEU A CG    1 
ATOM   1481 C CD1   . LEU A 1 214 ? -1.386  6.800   20.227 1.00 45.37  ? 295 LEU A CD1   1 
ATOM   1482 C CD2   . LEU A 1 214 ? 0.626   5.319   20.644 1.00 45.20  ? 295 LEU A CD2   1 
ATOM   1483 N N     . ARG A 1 215 ? -2.339  4.551   24.520 1.00 43.16  ? 296 ARG A N     1 
ATOM   1484 C CA    . ARG A 1 215 ? -3.097  3.321   24.770 1.00 43.09  ? 296 ARG A CA    1 
ATOM   1485 C C     . ARG A 1 215 ? -4.548  3.633   25.175 1.00 49.68  ? 296 ARG A C     1 
ATOM   1486 O O     . ARG A 1 215 ? -5.482  3.044   24.619 1.00 48.85  ? 296 ARG A O     1 
ATOM   1487 C CB    . ARG A 1 215 ? -2.423  2.470   25.854 1.00 42.90  ? 296 ARG A CB    1 
ATOM   1488 C CG    . ARG A 1 215 ? -3.122  1.116   26.026 1.00 46.58  ? 296 ARG A CG    1 
ATOM   1489 C CD    . ARG A 1 215 ? -3.051  0.560   27.419 1.00 53.42  ? 296 ARG A CD    1 
ATOM   1490 N NE    . ARG A 1 215 ? -3.372  1.522   28.478 1.00 56.52  ? 296 ARG A NE    1 
ATOM   1491 C CZ    . ARG A 1 215 ? -2.922  1.414   29.724 1.00 67.34  ? 296 ARG A CZ    1 
ATOM   1492 N NH1   . ARG A 1 215 ? -2.141  0.399   30.068 1.00 52.64  ? 296 ARG A NH1   1 
ATOM   1493 N NH2   . ARG A 1 215 ? -3.244  2.325   30.633 1.00 55.21  ? 296 ARG A NH2   1 
ATOM   1494 N N     . ASP A 1 216 ? -4.722  4.571   26.135 1.00 48.56  ? 297 ASP A N     1 
ATOM   1495 C CA    . ASP A 1 216 ? -6.023  4.990   26.656 1.00 49.74  ? 297 ASP A CA    1 
ATOM   1496 C C     . ASP A 1 216 ? -6.893  5.617   25.577 1.00 56.31  ? 297 ASP A C     1 
ATOM   1497 O O     . ASP A 1 216 ? -8.107  5.396   25.581 1.00 57.56  ? 297 ASP A O     1 
ATOM   1498 C CB    . ASP A 1 216 ? -5.856  5.918   27.879 1.00 51.80  ? 297 ASP A CB    1 
ATOM   1499 C CG    . ASP A 1 216 ? -5.107  5.309   29.064 1.00 65.85  ? 297 ASP A CG    1 
ATOM   1500 O OD1   . ASP A 1 216 ? -4.845  4.079   29.043 1.00 66.76  ? 297 ASP A OD1   1 
ATOM   1501 O OD2   . ASP A 1 216 ? -4.780  6.062   30.011 1.00 71.46  ? 297 ASP A OD2   1 
ATOM   1502 N N     . GLN A 1 217 ? -6.271  6.352   24.623 1.00 53.29  ? 298 GLN A N     1 
ATOM   1503 C CA    . GLN A 1 217 ? -6.960  6.987   23.490 1.00 53.77  ? 298 GLN A CA    1 
ATOM   1504 C C     . GLN A 1 217 ? -7.474  5.910   22.523 1.00 59.45  ? 298 GLN A C     1 
ATOM   1505 O O     . GLN A 1 217 ? -8.595  6.029   22.017 1.00 58.67  ? 298 GLN A O     1 
ATOM   1506 C CB    . GLN A 1 217 ? -6.012  7.957   22.750 1.00 55.09  ? 298 GLN A CB    1 
ATOM   1507 C CG    . GLN A 1 217 ? -6.668  8.807   21.668 1.00 73.81  ? 298 GLN A CG    1 
ATOM   1508 C CD    . GLN A 1 217 ? -5.641  9.401   20.739 1.00 93.37  ? 298 GLN A CD    1 
ATOM   1509 N N     . LEU A 1 218 ? -6.645  4.874   22.260 1.00 57.15  ? 299 LEU A N     1 
ATOM   1510 C CA    . LEU A 1 218 ? -6.988  3.769   21.359 1.00 57.71  ? 299 LEU A CA    1 
ATOM   1511 C C     . LEU A 1 218 ? -8.133  2.920   21.901 1.00 64.18  ? 299 LEU A C     1 
ATOM   1512 O O     . LEU A 1 218 ? -9.059  2.597   21.151 1.00 64.27  ? 299 LEU A O     1 
ATOM   1513 C CB    . LEU A 1 218 ? -5.763  2.894   21.035 1.00 57.81  ? 299 LEU A CB    1 
ATOM   1514 C CG    . LEU A 1 218 ? -4.638  3.532   20.204 1.00 62.59  ? 299 LEU A CG    1 
ATOM   1515 C CD1   . LEU A 1 218 ? -3.544  2.521   19.929 1.00 62.43  ? 299 LEU A CD1   1 
ATOM   1516 C CD2   . LEU A 1 218 ? -5.151  4.106   18.875 1.00 64.67  ? 299 LEU A CD2   1 
ATOM   1517 N N     . LYS A 1 219 ? -8.087  2.589   23.207 1.00 62.62  ? 300 LYS A N     1 
ATOM   1518 C CA    . LYS A 1 219 ? -9.127  1.826   23.898 1.00 63.66  ? 300 LYS A CA    1 
ATOM   1519 C C     . LYS A 1 219 ? -10.442 2.626   23.964 1.00 72.22  ? 300 LYS A C     1 
ATOM   1520 O O     . LYS A 1 219 ? -11.520 2.026   23.942 1.00 72.37  ? 300 LYS A O     1 
ATOM   1521 C CB    . LYS A 1 219 ? -8.668  1.408   25.306 1.00 65.31  ? 300 LYS A CB    1 
ATOM   1522 C CG    . LYS A 1 219 ? -7.647  0.273   25.315 1.00 68.34  ? 300 LYS A CG    1 
ATOM   1523 C CD    . LYS A 1 219 ? -7.250  -0.114  26.726 1.00 73.87  ? 300 LYS A CD    1 
ATOM   1524 N N     . GLY A 1 220 ? -10.327 3.960   24.008 1.00 71.10  ? 301 GLY A N     1 
ATOM   1525 C CA    . GLY A 1 220 ? -11.447 4.896   24.037 1.00 72.04  ? 301 GLY A CA    1 
ATOM   1526 C C     . GLY A 1 220 ? -12.293 4.855   22.780 1.00 78.66  ? 301 GLY A C     1 
ATOM   1527 O O     . GLY A 1 220 ? -13.522 4.934   22.861 1.00 78.50  ? 301 GLY A O     1 
ATOM   1528 N N     . ILE A 1 221 ? -11.635 4.706   21.606 1.00 77.14  ? 302 ILE A N     1 
ATOM   1529 C CA    . ILE A 1 221 ? -12.291 4.594   20.297 1.00 77.29  ? 302 ILE A CA    1 
ATOM   1530 C C     . ILE A 1 221 ? -13.042 3.255   20.181 1.00 81.48  ? 302 ILE A C     1 
ATOM   1531 O O     . ILE A 1 221 ? -14.048 3.180   19.474 1.00 80.90  ? 302 ILE A O     1 
ATOM   1532 C CB    . ILE A 1 221 ? -11.279 4.791   19.146 1.00 80.61  ? 302 ILE A CB    1 
ATOM   1533 N N     . GLU A 1 222 ? -12.556 2.211   20.890 1.00 78.19  ? 303 GLU A N     1 
ATOM   1534 C CA    . GLU A 1 222 ? -13.171 0.884   20.940 1.00 103.14 ? 303 GLU A CA    1 
ATOM   1535 C C     . GLU A 1 222 ? -14.358 0.917   21.901 1.00 126.83 ? 303 GLU A C     1 
ATOM   1536 O O     . GLU A 1 222 ? -15.267 0.096   21.800 1.00 87.48  ? 303 GLU A O     1 
ATOM   1537 C CB    . GLU A 1 222 ? -12.151 -0.174  21.395 1.00 104.45 ? 303 GLU A CB    1 
ATOM   1538 C CG    . GLU A 1 222 ? -11.309 -0.735  20.265 1.00 114.29 ? 303 GLU A CG    1 
ATOM   1539 O "O5'" . DC  B 2 1   ? 34.097  23.321  -1.154 1.00 97.64  ? 1   DC  C "O5'" 1 
ATOM   1540 C "C5'" . DC  B 2 1   ? 33.558  24.405  -1.921 1.00 97.59  ? 1   DC  C "C5'" 1 
ATOM   1541 C "C4'" . DC  B 2 1   ? 32.132  24.112  -2.405 1.00 97.14  ? 1   DC  C "C4'" 1 
ATOM   1542 O "O4'" . DC  B 2 1   ? 32.140  23.076  -3.429 1.00 95.48  ? 1   DC  C "O4'" 1 
ATOM   1543 C "C3'" . DC  B 2 1   ? 31.135  23.654  -1.332 1.00 97.09  ? 1   DC  C "C3'" 1 
ATOM   1544 O "O3'" . DC  B 2 1   ? 29.859  24.289  -1.544 1.00 98.33  ? 1   DC  C "O3'" 1 
ATOM   1545 C "C2'" . DC  B 2 1   ? 31.057  22.143  -1.551 1.00 96.07  ? 1   DC  C "C2'" 1 
ATOM   1546 C "C1'" . DC  B 2 1   ? 31.251  22.031  -3.063 1.00 95.70  ? 1   DC  C "C1'" 1 
ATOM   1547 N N1    . DC  B 2 1   ? 31.835  20.707  -3.510 1.00 95.24  ? 1   DC  C N1    1 
ATOM   1548 C C2    . DC  B 2 1   ? 31.000  19.718  -4.092 1.00 94.94  ? 1   DC  C C2    1 
ATOM   1549 O O2    . DC  B 2 1   ? 29.786  19.932  -4.219 1.00 94.27  ? 1   DC  C O2    1 
ATOM   1550 N N3    . DC  B 2 1   ? 31.562  18.545  -4.499 1.00 95.47  ? 1   DC  C N3    1 
ATOM   1551 C C4    . DC  B 2 1   ? 32.882  18.346  -4.362 1.00 96.23  ? 1   DC  C C4    1 
ATOM   1552 N N4    . DC  B 2 1   ? 33.384  17.184  -4.781 1.00 97.05  ? 1   DC  C N4    1 
ATOM   1553 C C5    . DC  B 2 1   ? 33.738  19.319  -3.752 1.00 95.82  ? 1   DC  C C5    1 
ATOM   1554 C C6    . DC  B 2 1   ? 33.182  20.470  -3.349 1.00 95.30  ? 1   DC  C C6    1 
ATOM   1555 P P     . DA  B 2 2   ? 28.791  24.445  -0.346 1.00 99.45  ? 2   DA  C P     1 
ATOM   1556 O OP1   . DA  B 2 2   ? 27.916  25.597  -0.688 1.00 100.43 ? 2   DA  C OP1   1 
ATOM   1557 O OP2   . DA  B 2 2   ? 29.519  24.429  0.947  1.00 99.23  ? 2   DA  C OP2   1 
ATOM   1558 O "O5'" . DA  B 2 2   ? 27.942  23.090  -0.428 1.00 98.23  ? 2   DA  C "O5'" 1 
ATOM   1559 C "C5'" . DA  B 2 2   ? 26.942  22.906  -1.442 1.00 96.95  ? 2   DA  C "C5'" 1 
ATOM   1560 C "C4'" . DA  B 2 2   ? 26.274  21.540  -1.308 1.00 95.70  ? 2   DA  C "C4'" 1 
ATOM   1561 O "O4'" . DA  B 2 2   ? 27.191  20.497  -1.735 1.00 94.47  ? 2   DA  C "O4'" 1 
ATOM   1562 C "C3'" . DA  B 2 2   ? 25.813  21.156  0.106  1.00 95.53  ? 2   DA  C "C3'" 1 
ATOM   1563 O "O3'" . DA  B 2 2   ? 24.492  20.595  0.038  1.00 96.02  ? 2   DA  C "O3'" 1 
ATOM   1564 C "C2'" . DA  B 2 2   ? 26.856  20.119  0.554  1.00 94.46  ? 2   DA  C "C2'" 1 
ATOM   1565 C "C1'" . DA  B 2 2   ? 27.222  19.467  -0.776 1.00 93.58  ? 2   DA  C "C1'" 1 
ATOM   1566 N N9    . DA  B 2 2   ? 28.547  18.833  -0.815 1.00 91.20  ? 2   DA  C N9    1 
ATOM   1567 C C8    . DA  B 2 2   ? 29.719  19.307  -0.279 1.00 89.94  ? 2   DA  C C8    1 
ATOM   1568 N N7    . DA  B 2 2   ? 30.765  18.552  -0.527 1.00 89.13  ? 2   DA  C N7    1 
ATOM   1569 C C5    . DA  B 2 2   ? 30.250  17.509  -1.285 1.00 88.63  ? 2   DA  C C5    1 
ATOM   1570 C C6    . DA  B 2 2   ? 30.843  16.359  -1.863 1.00 86.71  ? 2   DA  C C6    1 
ATOM   1571 N N6    . DA  B 2 2   ? 32.142  16.064  -1.755 1.00 86.17  ? 2   DA  C N6    1 
ATOM   1572 N N1    . DA  B 2 2   ? 30.030  15.498  -2.521 1.00 85.60  ? 2   DA  C N1    1 
ATOM   1573 C C2    . DA  B 2 2   ? 28.723  15.781  -2.628 1.00 85.85  ? 2   DA  C C2    1 
ATOM   1574 N N3    . DA  B 2 2   ? 28.059  16.843  -2.170 1.00 87.17  ? 2   DA  C N3    1 
ATOM   1575 C C4    . DA  B 2 2   ? 28.885  17.672  -1.483 1.00 89.30  ? 2   DA  C C4    1 
ATOM   1576 P P     . DG  B 2 3   ? 23.527  20.532  1.331  1.00 95.50  ? 3   DG  C P     1 
ATOM   1577 O OP1   . DG  B 2 3   ? 22.311  21.323  1.019  1.00 96.39  ? 3   DG  C OP1   1 
ATOM   1578 O OP2   . DG  B 2 3   ? 24.319  20.845  2.545  1.00 95.27  ? 3   DG  C OP2   1 
ATOM   1579 O "O5'" . DG  B 2 3   ? 23.130  18.993  1.390  1.00 93.92  ? 3   DG  C "O5'" 1 
ATOM   1580 C "C5'" . DG  B 2 3   ? 22.727  18.307  0.206  1.00 92.66  ? 3   DG  C "C5'" 1 
ATOM   1581 C "C4'" . DG  B 2 3   ? 23.068  16.830  0.299  1.00 91.22  ? 3   DG  C "C4'" 1 
ATOM   1582 O "O4'" . DG  B 2 3   ? 24.501  16.641  0.127  1.00 89.44  ? 3   DG  C "O4'" 1 
ATOM   1583 C "C3'" . DG  B 2 3   ? 22.707  16.163  1.632  1.00 91.52  ? 3   DG  C "C3'" 1 
ATOM   1584 O "O3'" . DG  B 2 3   ? 21.969  14.961  1.388  1.00 93.16  ? 3   DG  C "O3'" 1 
ATOM   1585 C "C2'" . DG  B 2 3   ? 24.074  15.874  2.269  1.00 89.83  ? 3   DG  C "C2'" 1 
ATOM   1586 C "C1'" . DG  B 2 3   ? 24.928  15.657  1.030  1.00 87.89  ? 3   DG  C "C1'" 1 
ATOM   1587 N N9    . DG  B 2 3   ? 26.382  15.775  1.235  1.00 84.12  ? 3   DG  C N9    1 
ATOM   1588 C C8    . DG  B 2 3   ? 27.069  16.810  1.843  1.00 82.91  ? 3   DG  C C8    1 
ATOM   1589 N N7    . DG  B 2 3   ? 28.366  16.641  1.855  1.00 81.48  ? 3   DG  C N7    1 
ATOM   1590 C C5    . DG  B 2 3   ? 28.559  15.433  1.190  1.00 79.94  ? 3   DG  C C5    1 
ATOM   1591 C C6    . DG  B 2 3   ? 29.759  14.728  0.890  1.00 77.62  ? 3   DG  C C6    1 
ATOM   1592 O O6    . DG  B 2 3   ? 30.925  15.071  1.117  1.00 76.55  ? 3   DG  C O6    1 
ATOM   1593 N N1    . DG  B 2 3   ? 29.507  13.518  0.239  1.00 77.54  ? 3   DG  C N1    1 
ATOM   1594 C C2    . DG  B 2 3   ? 28.253  13.055  -0.106 1.00 78.46  ? 3   DG  C C2    1 
ATOM   1595 N N2    . DG  B 2 3   ? 28.203  11.866  -0.720 1.00 77.92  ? 3   DG  C N2    1 
ATOM   1596 N N3    . DG  B 2 3   ? 27.122  13.696  0.179  1.00 79.81  ? 3   DG  C N3    1 
ATOM   1597 C C4    . DG  B 2 3   ? 27.348  14.881  0.813  1.00 81.17  ? 3   DG  C C4    1 
ATOM   1598 P P     . DC  B 2 4   ? 20.919  14.393  2.472  1.00 94.22  ? 4   DC  C P     1 
ATOM   1599 O OP1   . DC  B 2 4   ? 19.582  14.383  1.819  1.00 94.71  ? 4   DC  C OP1   1 
ATOM   1600 O OP2   . DC  B 2 4   ? 21.112  15.115  3.758  1.00 94.02  ? 4   DC  C OP2   1 
ATOM   1601 O "O5'" . DC  B 2 4   ? 21.414  12.878  2.688  1.00 92.83  ? 4   DC  C "O5'" 1 
ATOM   1602 C "C5'" . DC  B 2 4   ? 21.580  12.002  1.554  1.00 91.18  ? 4   DC  C "C5'" 1 
ATOM   1603 C "C4'" . DC  B 2 4   ? 22.806  11.110  1.709  1.00 89.16  ? 4   DC  C "C4'" 1 
ATOM   1604 O "O4'" . DC  B 2 4   ? 24.007  11.907  1.685  1.00 87.58  ? 4   DC  C "O4'" 1 
ATOM   1605 C "C3'" . DC  B 2 4   ? 22.904  10.341  3.018  1.00 88.31  ? 4   DC  C "C3'" 1 
ATOM   1606 O "O3'" . DC  B 2 4   ? 22.188  9.092   2.924  1.00 88.79  ? 4   DC  C "O3'" 1 
ATOM   1607 C "C2'" . DC  B 2 4   ? 24.417  10.113  3.174  1.00 86.91  ? 4   DC  C "C2'" 1 
ATOM   1608 C "C1'" . DC  B 2 4   ? 25.053  11.117  2.214  1.00 85.17  ? 4   DC  C "C1'" 1 
ATOM   1609 N N1    . DC  B 2 4   ? 26.121  11.998  2.851  1.00 80.90  ? 4   DC  C N1    1 
ATOM   1610 C C2    . DC  B 2 4   ? 27.472  11.579  2.847  1.00 78.43  ? 4   DC  C C2    1 
ATOM   1611 O O2    . DC  B 2 4   ? 27.772  10.497  2.333  1.00 77.93  ? 4   DC  C O2    1 
ATOM   1612 N N3    . DC  B 2 4   ? 28.416  12.389  3.403  1.00 77.31  ? 4   DC  C N3    1 
ATOM   1613 C C4    . DC  B 2 4   ? 28.057  13.544  3.976  1.00 77.50  ? 4   DC  C C4    1 
ATOM   1614 N N4    . DC  B 2 4   ? 29.020  14.313  4.494  1.00 77.21  ? 4   DC  C N4    1 
ATOM   1615 C C5    . DC  B 2 4   ? 26.690  13.967  4.032  1.00 78.50  ? 4   DC  C C5    1 
ATOM   1616 C C6    . DC  B 2 4   ? 25.767  13.170  3.468  1.00 79.64  ? 4   DC  C C6    1 
ATOM   1617 P P     . DT  B 2 5   ? 21.919  8.178   4.232  1.00 89.14  ? 5   DT  C P     1 
ATOM   1618 O OP1   . DT  B 2 5   ? 20.763  7.297   3.932  1.00 89.58  ? 5   DT  C OP1   1 
ATOM   1619 O OP2   . DT  B 2 5   ? 21.885  9.056   5.438  1.00 89.21  ? 5   DT  C OP2   1 
ATOM   1620 O "O5'" . DT  B 2 5   ? 23.241  7.271   4.334  1.00 87.46  ? 5   DT  C "O5'" 1 
ATOM   1621 C "C5'" . DT  B 2 5   ? 23.699  6.509   3.201  1.00 85.51  ? 5   DT  C "C5'" 1 
ATOM   1622 C "C4'" . DT  B 2 5   ? 25.114  5.987   3.434  1.00 83.17  ? 5   DT  C "C4'" 1 
ATOM   1623 O "O4'" . DT  B 2 5   ? 26.030  7.099   3.645  1.00 81.35  ? 5   DT  C "O4'" 1 
ATOM   1624 C "C3'" . DT  B 2 5   ? 25.282  5.056   4.637  1.00 82.41  ? 5   DT  C "C3'" 1 
ATOM   1625 O "O3'" . DT  B 2 5   ? 26.050  3.908   4.253  1.00 83.24  ? 5   DT  C "O3'" 1 
ATOM   1626 C "C2'" . DT  B 2 5   ? 26.011  5.928   5.671  1.00 80.62  ? 5   DT  C "C2'" 1 
ATOM   1627 C "C1'" . DT  B 2 5   ? 26.839  6.840   4.778  1.00 78.84  ? 5   DT  C "C1'" 1 
ATOM   1628 N N1    . DT  B 2 5   ? 27.251  8.175   5.407  1.00 74.64  ? 5   DT  C N1    1 
ATOM   1629 C C2    . DT  B 2 5   ? 28.604  8.479   5.547  1.00 72.01  ? 5   DT  C C2    1 
ATOM   1630 O O2    . DT  B 2 5   ? 29.507  7.707   5.262  1.00 71.65  ? 5   DT  C O2    1 
ATOM   1631 N N3    . DT  B 2 5   ? 28.860  9.728   6.059  1.00 69.85  ? 5   DT  C N3    1 
ATOM   1632 C C4    . DT  B 2 5   ? 27.934  10.706  6.397  1.00 69.50  ? 5   DT  C C4    1 
ATOM   1633 O O4    . DT  B 2 5   ? 28.331  11.796  6.804  1.00 68.37  ? 5   DT  C O4    1 
ATOM   1634 C C5    . DT  B 2 5   ? 26.541  10.331  6.227  1.00 70.94  ? 5   DT  C C5    1 
ATOM   1635 C C7    . DT  B 2 5   ? 25.444  11.293  6.594  1.00 71.08  ? 5   DT  C C7    1 
ATOM   1636 C C6    . DT  B 2 5   ? 26.272  9.100   5.755  1.00 72.69  ? 5   DT  C C6    1 
ATOM   1637 P P     . DC  B 2 6   ? 26.182  2.630   5.218  1.00 84.22  ? 6   DC  C P     1 
ATOM   1638 O OP1   . DC  B 2 6   ? 26.340  1.429   4.360  1.00 84.88  ? 6   DC  C OP1   1 
ATOM   1639 O OP2   . DC  B 2 6   ? 25.093  2.674   6.227  1.00 84.26  ? 6   DC  C OP2   1 
ATOM   1640 O "O5'" . DC  B 2 6   ? 27.564  2.912   5.976  1.00 83.02  ? 6   DC  C "O5'" 1 
ATOM   1641 C "C5'" . DC  B 2 6   ? 28.793  2.983   5.236  1.00 81.46  ? 6   DC  C "C5'" 1 
ATOM   1642 C "C4'" . DC  B 2 6   ? 29.955  3.357   6.144  1.00 79.88  ? 6   DC  C "C4'" 1 
ATOM   1643 O "O4'" . DC  B 2 6   ? 29.870  4.761   6.490  1.00 78.12  ? 6   DC  C "O4'" 1 
ATOM   1644 C "C3'" . DC  B 2 6   ? 30.038  2.584   7.465  1.00 79.61  ? 6   DC  C "C3'" 1 
ATOM   1645 O "O3'" . DC  B 2 6   ? 31.346  2.037   7.619  1.00 81.07  ? 6   DC  C "O3'" 1 
ATOM   1646 C "C2'" . DC  B 2 6   ? 29.726  3.641   8.535  1.00 77.89  ? 6   DC  C "C2'" 1 
ATOM   1647 C "C1'" . DC  B 2 6   ? 30.174  4.926   7.854  1.00 75.89  ? 6   DC  C "C1'" 1 
ATOM   1648 N N1    . DC  B 2 6   ? 29.481  6.187   8.350  1.00 71.56  ? 6   DC  C N1    1 
ATOM   1649 C C2    . DC  B 2 6   ? 30.251  7.291   8.770  1.00 68.92  ? 6   DC  C C2    1 
ATOM   1650 O O2    . DC  B 2 6   ? 31.486  7.201   8.780  1.00 68.80  ? 6   DC  C O2    1 
ATOM   1651 N N3    . DC  B 2 6   ? 29.607  8.422   9.186  1.00 66.82  ? 6   DC  C N3    1 
ATOM   1652 C C4    . DC  B 2 6   ? 28.270  8.490   9.151  1.00 66.34  ? 6   DC  C C4    1 
ATOM   1653 N N4    . DC  B 2 6   ? 27.691  9.623   9.546  1.00 65.58  ? 6   DC  C N4    1 
ATOM   1654 C C5    . DC  B 2 6   ? 27.471  7.390   8.720  1.00 67.95  ? 6   DC  C C5    1 
ATOM   1655 C C6    . DC  B 2 6   ? 28.108  6.270   8.334  1.00 69.76  ? 6   DC  C C6    1 
ATOM   1656 P P     . DT  B 2 7   ? 31.643  0.824   8.639  1.00 82.58  ? 7   DT  C P     1 
ATOM   1657 O OP1   . DT  B 2 7   ? 32.463  -0.176  7.908  1.00 83.61  ? 7   DT  C OP1   1 
ATOM   1658 O OP2   . DT  B 2 7   ? 30.373  0.403   9.293  1.00 82.59  ? 7   DT  C OP2   1 
ATOM   1659 O "O5'" . DT  B 2 7   ? 32.555  1.524   9.757  1.00 81.17  ? 7   DT  C "O5'" 1 
ATOM   1660 C "C5'" . DT  B 2 7   ? 33.693  2.306   9.362  1.00 79.36  ? 7   DT  C "C5'" 1 
ATOM   1661 C "C4'" . DT  B 2 7   ? 34.144  3.240   10.477 1.00 77.39  ? 7   DT  C "C4'" 1 
ATOM   1662 O "O4'" . DT  B 2 7   ? 33.252  4.381   10.574 1.00 75.59  ? 7   DT  C "O4'" 1 
ATOM   1663 C "C3'" . DT  B 2 7   ? 34.220  2.627   11.882 1.00 76.66  ? 7   DT  C "C3'" 1 
ATOM   1664 O "O3'" . DT  B 2 7   ? 35.492  2.921   12.444 1.00 77.90  ? 7   DT  C "O3'" 1 
ATOM   1665 C "C2'" . DT  B 2 7   ? 33.094  3.343   12.642 1.00 74.54  ? 7   DT  C "C2'" 1 
ATOM   1666 C "C1'" . DT  B 2 7   ? 33.079  4.691   11.935 1.00 72.52  ? 7   DT  C "C1'" 1 
ATOM   1667 N N1    . DT  B 2 7   ? 31.806  5.501   12.103 1.00 67.52  ? 7   DT  C N1    1 
ATOM   1668 C C2    . DT  B 2 7   ? 31.894  6.844   12.462 1.00 64.36  ? 7   DT  C C2    1 
ATOM   1669 O O2    . DT  B 2 7   ? 32.951  7.421   12.686 1.00 62.81  ? 7   DT  C O2    1 
ATOM   1670 N N3    . DT  B 2 7   ? 30.683  7.491   12.553 1.00 63.26  ? 7   DT  C N3    1 
ATOM   1671 C C4    . DT  B 2 7   ? 29.422  6.962   12.317 1.00 63.02  ? 7   DT  C C4    1 
ATOM   1672 O O4    . DT  B 2 7   ? 28.436  7.688   12.417 1.00 61.39  ? 7   DT  C O4    1 
ATOM   1673 C C5    . DT  B 2 7   ? 29.395  5.552   11.962 1.00 65.17  ? 7   DT  C C5    1 
ATOM   1674 C C7    . DT  B 2 7   ? 28.088  4.855   11.715 1.00 66.04  ? 7   DT  C C7    1 
ATOM   1675 C C6    . DT  B 2 7   ? 30.572  4.899   11.869 1.00 66.25  ? 7   DT  C C6    1 
ATOM   1676 P P     . DG  B 2 8   ? 36.176  1.956   13.536 1.00 78.63  ? 8   DG  C P     1 
ATOM   1677 O OP1   . DG  B 2 8   ? 37.297  1.252   12.861 1.00 79.19  ? 8   DG  C OP1   1 
ATOM   1678 O OP2   . DG  B 2 8   ? 35.118  1.180   14.237 1.00 78.67  ? 8   DG  C OP2   1 
ATOM   1679 O "O5'" . DG  B 2 8   ? 36.783  3.001   14.589 1.00 76.56  ? 8   DG  C "O5'" 1 
ATOM   1680 C "C5'" . DG  B 2 8   ? 37.422  4.208   14.120 1.00 73.96  ? 8   DG  C "C5'" 1 
ATOM   1681 C "C4'" . DG  B 2 8   ? 37.202  5.361   15.091 1.00 71.37  ? 8   DG  C "C4'" 1 
ATOM   1682 O "O4'" . DG  B 2 8   ? 35.863  5.896   14.941 1.00 68.97  ? 8   DG  C "O4'" 1 
ATOM   1683 C "C3'" . DG  B 2 8   ? 37.375  5.017   16.571 1.00 70.91  ? 8   DG  C "C3'" 1 
ATOM   1684 O "O3'" . DG  B 2 8   ? 38.320  5.925   17.145 1.00 72.69  ? 8   DG  C "O3'" 1 
ATOM   1685 C "C2'" . DG  B 2 8   ? 35.959  5.165   17.163 1.00 68.63  ? 8   DG  C "C2'" 1 
ATOM   1686 C "C1'" . DG  B 2 8   ? 35.299  6.147   16.205 1.00 66.61  ? 8   DG  C "C1'" 1 
ATOM   1687 N N9    . DG  B 2 8   ? 33.838  6.002   16.087 1.00 62.10  ? 8   DG  C N9    1 
ATOM   1688 C C8    . DG  B 2 8   ? 33.144  4.869   15.709 1.00 59.96  ? 8   DG  C C8    1 
ATOM   1689 N N7    . DG  B 2 8   ? 31.858  5.061   15.570 1.00 57.88  ? 8   DG  C N7    1 
ATOM   1690 C C5    . DG  B 2 8   ? 31.682  6.415   15.846 1.00 56.05  ? 8   DG  C C5    1 
ATOM   1691 C C6    . DG  B 2 8   ? 30.495  7.202   15.878 1.00 52.14  ? 8   DG  C C6    1 
ATOM   1692 O O6    . DG  B 2 8   ? 29.342  6.856   15.603 1.00 49.27  ? 8   DG  C O6    1 
ATOM   1693 N N1    . DG  B 2 8   ? 30.755  8.528   16.235 1.00 53.24  ? 8   DG  C N1    1 
ATOM   1694 C C2    . DG  B 2 8   ? 32.007  9.035   16.525 1.00 55.19  ? 8   DG  C C2    1 
ATOM   1695 N N2    . DG  B 2 8   ? 32.067  10.336  16.839 1.00 55.49  ? 8   DG  C N2    1 
ATOM   1696 N N3    . DG  B 2 8   ? 33.130  8.323   16.459 1.00 57.08  ? 8   DG  C N3    1 
ATOM   1697 C C4    . DG  B 2 8   ? 32.894  7.016   16.144 1.00 58.57  ? 8   DG  C C4    1 
ATOM   1698 P P     . DT  B 2 9   ? 38.866  5.744   18.644 1.00 74.22  ? 9   DT  C P     1 
ATOM   1699 O OP1   . DT  B 2 9   ? 40.263  6.244   18.680 1.00 74.80  ? 9   DT  C OP1   1 
ATOM   1700 O OP2   . DT  B 2 9   ? 38.561  4.364   19.110 1.00 74.83  ? 9   DT  C OP2   1 
ATOM   1701 O "O5'" . DT  B 2 9   ? 37.936  6.752   19.460 1.00 72.92  ? 9   DT  C "O5'" 1 
ATOM   1702 C "C5'" . DT  B 2 9   ? 37.798  8.108   19.016 1.00 71.21  ? 9   DT  C "C5'" 1 
ATOM   1703 C "C4'" . DT  B 2 9   ? 36.730  8.828   19.815 1.00 69.55  ? 9   DT  C "C4'" 1 
ATOM   1704 O "O4'" . DT  B 2 9   ? 35.422  8.457   19.328 1.00 67.61  ? 9   DT  C "O4'" 1 
ATOM   1705 C "C3'" . DT  B 2 9   ? 36.725  8.533   21.324 1.00 69.11  ? 9   DT  C "C3'" 1 
ATOM   1706 O "O3'" . DT  B 2 9   ? 36.839  9.752   22.032 1.00 70.82  ? 9   DT  C "O3'" 1 
ATOM   1707 C "C2'" . DT  B 2 9   ? 35.362  7.866   21.563 1.00 66.88  ? 9   DT  C "C2'" 1 
ATOM   1708 C "C1'" . DT  B 2 9   ? 34.544  8.435   20.413 1.00 64.78  ? 9   DT  C "C1'" 1 
ATOM   1709 N N1    . DT  B 2 9   ? 33.319  7.646   20.034 1.00 60.16  ? 9   DT  C N1    1 
ATOM   1710 C C2    . DT  B 2 9   ? 32.110  8.308   19.904 1.00 57.75  ? 9   DT  C C2    1 
ATOM   1711 O O2    . DT  B 2 9   ? 31.970  9.502   20.114 1.00 57.02  ? 9   DT  C O2    1 
ATOM   1712 N N3    . DT  B 2 9   ? 31.058  7.514   19.519 1.00 56.87  ? 9   DT  C N3    1 
ATOM   1713 C C4    . DT  B 2 9   ? 31.084  6.160   19.228 1.00 56.28  ? 9   DT  C C4    1 
ATOM   1714 O O4    . DT  B 2 9   ? 30.045  5.602   18.869 1.00 54.60  ? 9   DT  C O4    1 
ATOM   1715 C C5    . DT  B 2 9   ? 32.380  5.515   19.397 1.00 57.77  ? 9   DT  C C5    1 
ATOM   1716 C C7    . DT  B 2 9   ? 32.533  4.039   19.159 1.00 57.87  ? 9   DT  C C7    1 
ATOM   1717 C C6    . DT  B 2 9   ? 33.424  6.281   19.775 1.00 58.82  ? 9   DT  C C6    1 
ATOM   1718 P P     . DA  B 2 10  ? 37.555  9.826   23.467 1.00 71.85  ? 10  DA  C P     1 
ATOM   1719 O OP1   . DA  B 2 10  ? 38.898  10.432  23.268 1.00 72.39  ? 10  DA  C OP1   1 
ATOM   1720 O OP2   . DA  B 2 10  ? 37.422  8.505   24.144 1.00 72.43  ? 10  DA  C OP2   1 
ATOM   1721 O "O5'" . DA  B 2 10  ? 36.626  10.871  24.255 1.00 70.09  ? 10  DA  C "O5'" 1 
ATOM   1722 C "C5'" . DA  B 2 10  ? 35.931  11.913  23.534 1.00 67.87  ? 10  DA  C "C5'" 1 
ATOM   1723 C "C4'" . DA  B 2 10  ? 34.500  12.069  24.029 1.00 65.60  ? 10  DA  C "C4'" 1 
ATOM   1724 O "O4'" . DA  B 2 10  ? 33.656  11.051  23.448 1.00 63.67  ? 10  DA  C "O4'" 1 
ATOM   1725 C "C3'" . DA  B 2 10  ? 34.318  11.968  25.542 1.00 65.09  ? 10  DA  C "C3'" 1 
ATOM   1726 O "O3'" . DA  B 2 10  ? 33.808  13.201  26.027 1.00 66.66  ? 10  DA  C "O3'" 1 
ATOM   1727 C "C2'" . DA  B 2 10  ? 33.336  10.798  25.748 1.00 62.62  ? 10  DA  C "C2'" 1 
ATOM   1728 C "C1'" . DA  B 2 10  ? 32.680  10.663  24.378 1.00 60.81  ? 10  DA  C "C1'" 1 
ATOM   1729 N N9    . DA  B 2 10  ? 32.266  9.302   24.037 1.00 56.73  ? 10  DA  C N9    1 
ATOM   1730 C C8    . DA  B 2 10  ? 33.052  8.182   24.020 1.00 55.35  ? 10  DA  C C8    1 
ATOM   1731 N N7    . DA  B 2 10  ? 32.448  7.113   23.557 1.00 53.99  ? 10  DA  C N7    1 
ATOM   1732 C C5    . DA  B 2 10  ? 31.178  7.556   23.246 1.00 52.13  ? 10  DA  C C5    1 
ATOM   1733 C C6    . DA  B 2 10  ? 30.043  6.902   22.713 1.00 49.16  ? 10  DA  C C6    1 
ATOM   1734 N N6    . DA  B 2 10  ? 30.018  5.603   22.405 1.00 46.57  ? 10  DA  C N6    1 
ATOM   1735 N N1    . DA  B 2 10  ? 28.926  7.638   22.528 1.00 49.24  ? 10  DA  C N1    1 
ATOM   1736 C C2    . DA  B 2 10  ? 28.933  8.936   22.877 1.00 50.29  ? 10  DA  C C2    1 
ATOM   1737 N N3    . DA  B 2 10  ? 29.947  9.671   23.340 1.00 51.84  ? 10  DA  C N3    1 
ATOM   1738 C C4    . DA  B 2 10  ? 31.051  8.910   23.518 1.00 53.56  ? 10  DA  C C4    1 
ATOM   1739 P P     . DC  B 2 11  ? 33.883  13.570  27.586 1.00 67.13  ? 11  DC  C P     1 
ATOM   1740 O OP1   . DC  B 2 11  ? 34.159  15.017  27.688 1.00 67.86  ? 11  DC  C OP1   1 
ATOM   1741 O OP2   . DC  B 2 11  ? 34.760  12.593  28.282 1.00 67.43  ? 11  DC  C OP2   1 
ATOM   1742 O "O5'" . DC  B 2 11  ? 32.386  13.293  28.069 1.00 65.52  ? 11  DC  C "O5'" 1 
ATOM   1743 C "C5'" . DC  B 2 11  ? 31.283  13.887  27.369 1.00 63.10  ? 11  DC  C "C5'" 1 
ATOM   1744 C "C4'" . DC  B 2 11  ? 30.009  13.113  27.637 1.00 60.99  ? 11  DC  C "C4'" 1 
ATOM   1745 O "O4'" . DC  B 2 11  ? 30.039  11.872  26.915 1.00 58.72  ? 11  DC  C "O4'" 1 
ATOM   1746 C "C3'" . DC  B 2 11  ? 29.813  12.697  29.087 1.00 60.31  ? 11  DC  C "C3'" 1 
ATOM   1747 O "O3'" . DC  B 2 11  ? 29.109  13.711  29.779 1.00 61.12  ? 11  DC  C "O3'" 1 
ATOM   1748 C "C2'" . DC  B 2 11  ? 29.008  11.389  28.996 1.00 58.91  ? 11  DC  C "C2'" 1 
ATOM   1749 C "C1'" . DC  B 2 11  ? 29.105  11.013  27.509 1.00 57.04  ? 11  DC  C "C1'" 1 
ATOM   1750 N N1    . DC  B 2 11  ? 29.502  9.580   27.229 1.00 53.55  ? 11  DC  C N1    1 
ATOM   1751 C C2    . DC  B 2 11  ? 28.650  8.783   26.445 1.00 51.47  ? 11  DC  C C2    1 
ATOM   1752 O O2    . DC  B 2 11  ? 27.586  9.271   26.031 1.00 51.05  ? 11  DC  C O2    1 
ATOM   1753 N N3    . DC  B 2 11  ? 29.028  7.505   26.150 1.00 49.76  ? 11  DC  C N3    1 
ATOM   1754 C C4    . DC  B 2 11  ? 30.212  7.033   26.573 1.00 49.28  ? 11  DC  C C4    1 
ATOM   1755 N N4    . DC  B 2 11  ? 30.534  5.772   26.255 1.00 48.55  ? 11  DC  C N4    1 
ATOM   1756 C C5    . DC  B 2 11  ? 31.113  7.839   27.344 1.00 49.99  ? 11  DC  C C5    1 
ATOM   1757 C C6    . DC  B 2 11  ? 30.718  9.087   27.658 1.00 51.61  ? 11  DC  C C6    1 
ATOM   1758 P P     . DG  B 2 12  ? 29.319  13.932  31.342 1.00 62.43  ? 12  DG  C P     1 
ATOM   1759 O OP1   . DG  B 2 12  ? 29.482  15.391  31.584 1.00 63.56  ? 12  DG  C OP1   1 
ATOM   1760 O OP2   . DG  B 2 12  ? 30.354  12.988  31.844 1.00 62.98  ? 12  DG  C OP2   1 
ATOM   1761 O "O5'" . DG  B 2 12  ? 27.916  13.455  31.945 1.00 59.39  ? 12  DG  C "O5'" 1 
ATOM   1762 C "C5'" . DG  B 2 12  ? 26.682  14.019  31.481 1.00 55.50  ? 12  DG  C "C5'" 1 
ATOM   1763 C "C4'" . DG  B 2 12  ? 25.516  13.500  32.319 1.00 52.52  ? 12  DG  C "C4'" 1 
ATOM   1764 O "O4'" . DG  B 2 12  ? 25.278  12.096  32.032 1.00 49.47  ? 12  DG  C "O4'" 1 
ATOM   1765 C "C3'" . DG  B 2 12  ? 25.682  13.575  33.839 1.00 51.77  ? 12  DG  C "C3'" 1 
ATOM   1766 O "O3'" . DG  B 2 12  ? 24.388  13.794  34.421 1.00 53.27  ? 12  DG  C "O3'" 1 
ATOM   1767 C "C2'" . DG  B 2 12  ? 26.228  12.173  34.187 1.00 50.48  ? 12  DG  C "C2'" 1 
ATOM   1768 C "C1'" . DG  B 2 12  ? 25.458  11.308  33.192 1.00 47.66  ? 12  DG  C "C1'" 1 
ATOM   1769 N N9    . DG  B 2 12  ? 26.143  10.087  32.774 1.00 44.70  ? 12  DG  C N9    1 
ATOM   1770 C C8    . DG  B 2 12  ? 27.399  9.998   32.210 1.00 44.53  ? 12  DG  C C8    1 
ATOM   1771 N N7    . DG  B 2 12  ? 27.676  8.811   31.727 1.00 42.53  ? 12  DG  C N7    1 
ATOM   1772 C C5    . DG  B 2 12  ? 26.519  8.078   31.948 1.00 40.22  ? 12  DG  C C5    1 
ATOM   1773 C C6    . DG  B 2 12  ? 26.196  6.744   31.554 1.00 37.61  ? 12  DG  C C6    1 
ATOM   1774 O O6    . DG  B 2 12  ? 26.939  5.917   31.029 1.00 37.99  ? 12  DG  C O6    1 
ATOM   1775 N N1    . DG  B 2 12  ? 24.882  6.394   31.907 1.00 35.10  ? 12  DG  C N1    1 
ATOM   1776 C C2    . DG  B 2 12  ? 23.982  7.253   32.534 1.00 35.72  ? 12  DG  C C2    1 
ATOM   1777 N N2    . DG  B 2 12  ? 22.764  6.764   32.800 1.00 34.01  ? 12  DG  C N2    1 
ATOM   1778 N N3    . DG  B 2 12  ? 24.263  8.521   32.843 1.00 36.90  ? 12  DG  C N3    1 
ATOM   1779 C C4    . DG  B 2 12  ? 25.541  8.863   32.523 1.00 39.96  ? 12  DG  C C4    1 
ATOM   1780 P P     . DT  B 2 13  ? 24.196  14.211  35.955 1.00 55.12  ? 13  DT  C P     1 
ATOM   1781 O OP1   . DT  B 2 13  ? 23.382  15.450  35.974 1.00 58.41  ? 13  DT  C OP1   1 
ATOM   1782 O OP2   . DT  B 2 13  ? 25.514  14.184  36.645 1.00 54.43  ? 13  DT  C OP2   1 
ATOM   1783 O "O5'" . DT  B 2 13  ? 23.301  13.036  36.529 1.00 54.13  ? 13  DT  C "O5'" 1 
ATOM   1784 C "C5'" . DT  B 2 13  ? 23.869  11.863  36.912 1.00 49.69  ? 13  DT  C "C5'" 1 
ATOM   1785 C "C4'" . DT  B 2 13  ? 22.826  10.784  36.933 1.00 44.69  ? 13  DT  C "C4'" 1 
ATOM   1786 O "O4'" . DT  B 2 13  ? 23.225  9.741   36.034 1.00 40.05  ? 13  DT  C "O4'" 1 
ATOM   1787 C "C3'" . DT  B 2 13  ? 22.656  10.141  38.302 1.00 40.97  ? 13  DT  C "C3'" 1 
ATOM   1788 O "O3'" . DT  B 2 13  ? 21.278  9.955   38.608 1.00 40.61  ? 13  DT  C "O3'" 1 
ATOM   1789 C "C2'" . DT  B 2 13  ? 23.422  8.827   38.206 1.00 39.05  ? 13  DT  C "C2'" 1 
ATOM   1790 C "C1'" . DT  B 2 13  ? 23.363  8.507   36.705 1.00 39.09  ? 13  DT  C "C1'" 1 
ATOM   1791 N N1    . DT  B 2 13  ? 24.620  7.840   36.186 1.00 39.15  ? 13  DT  C N1    1 
ATOM   1792 C C2    . DT  B 2 13  ? 24.562  6.533   35.692 1.00 37.95  ? 13  DT  C C2    1 
ATOM   1793 O O2    . DT  B 2 13  ? 23.582  5.829   35.787 1.00 39.02  ? 13  DT  C O2    1 
ATOM   1794 N N3    . DT  B 2 13  ? 25.757  6.047   35.216 1.00 35.87  ? 13  DT  C N3    1 
ATOM   1795 C C4    . DT  B 2 13  ? 26.949  6.748   35.087 1.00 38.02  ? 13  DT  C C4    1 
ATOM   1796 O O4    . DT  B 2 13  ? 27.920  6.188   34.608 1.00 39.04  ? 13  DT  C O4    1 
ATOM   1797 C C5    . DT  B 2 13  ? 26.959  8.079   35.679 1.00 40.17  ? 13  DT  C C5    1 
ATOM   1798 C C7    . DT  B 2 13  ? 28.216  8.902   35.686 1.00 41.30  ? 13  DT  C C7    1 
ATOM   1799 C C6    . DT  B 2 13  ? 25.792  8.581   36.109 1.00 40.07  ? 13  DT  C C6    1 
ATOM   1800 P P     . DG  B 2 14  ? 20.804  9.716   40.150 1.00 40.92  ? 14  DG  C P     1 
ATOM   1801 O OP1   . DG  B 2 14  ? 19.371  10.063  40.213 1.00 42.40  ? 14  DG  C OP1   1 
ATOM   1802 O OP2   . DG  B 2 14  ? 21.772  10.400  41.089 1.00 43.23  ? 14  DG  C OP2   1 
ATOM   1803 O "O5'" . DG  B 2 14  ? 20.962  8.177   40.370 1.00 38.19  ? 14  DG  C "O5'" 1 
ATOM   1804 C "C5'" . DG  B 2 14  ? 20.271  7.252   39.489 1.00 40.13  ? 14  DG  C "C5'" 1 
ATOM   1805 C "C4'" . DG  B 2 14  ? 20.796  5.851   39.675 1.00 40.90  ? 14  DG  C "C4'" 1 
ATOM   1806 O "O4'" . DG  B 2 14  ? 22.115  5.726   39.102 1.00 40.47  ? 14  DG  C "O4'" 1 
ATOM   1807 C "C3'" . DG  B 2 14  ? 20.899  5.329   41.121 1.00 43.47  ? 14  DG  C "C3'" 1 
ATOM   1808 O "O3'" . DG  B 2 14  ? 20.264  4.070   41.130 1.00 45.96  ? 14  DG  C "O3'" 1 
ATOM   1809 C "C2'" . DG  B 2 14  ? 22.424  5.205   41.358 1.00 42.15  ? 14  DG  C "C2'" 1 
ATOM   1810 C "C1'" . DG  B 2 14  ? 22.891  4.890   39.940 1.00 40.34  ? 14  DG  C "C1'" 1 
ATOM   1811 N N9    . DG  B 2 14  ? 24.303  5.143   39.656 1.00 38.21  ? 14  DG  C N9    1 
ATOM   1812 C C8    . DG  B 2 14  ? 24.991  6.332   39.830 1.00 39.22  ? 14  DG  C C8    1 
ATOM   1813 N N7    . DG  B 2 14  ? 26.161  6.346   39.240 1.00 40.31  ? 14  DG  C N7    1 
ATOM   1814 C C5    . DG  B 2 14  ? 26.237  5.104   38.605 1.00 38.53  ? 14  DG  C C5    1 
ATOM   1815 C C6    . DG  B 2 14  ? 27.264  4.536   37.799 1.00 36.84  ? 14  DG  C C6    1 
ATOM   1816 O O6    . DG  B 2 14  ? 28.360  5.019   37.509 1.00 39.27  ? 14  DG  C O6    1 
ATOM   1817 N N1    . DG  B 2 14  ? 26.931  3.275   37.341 1.00 34.70  ? 14  DG  C N1    1 
ATOM   1818 C C2    . DG  B 2 14  ? 25.748  2.620   37.632 1.00 35.28  ? 14  DG  C C2    1 
ATOM   1819 N N2    . DG  B 2 14  ? 25.603  1.385   37.141 1.00 35.08  ? 14  DG  C N2    1 
ATOM   1820 N N3    . DG  B 2 14  ? 24.771  3.147   38.356 1.00 36.88  ? 14  DG  C N3    1 
ATOM   1821 C C4    . DG  B 2 14  ? 25.077  4.388   38.800 1.00 37.87  ? 14  DG  C C4    1 
ATOM   1822 P P     . DA  B 2 15  ? 20.018  3.215   42.443 1.00 47.94  ? 15  DA  C P     1 
ATOM   1823 O OP1   . DA  B 2 15  ? 18.600  2.793   42.433 1.00 50.93  ? 15  DA  C OP1   1 
ATOM   1824 O OP2   . DA  B 2 15  ? 20.565  3.916   43.644 1.00 48.06  ? 15  DA  C OP2   1 
ATOM   1825 O "O5'" . DA  B 2 15  ? 20.921  1.940   42.165 1.00 47.06  ? 15  DA  C "O5'" 1 
ATOM   1826 C "C5'" . DA  B 2 15  ? 20.513  1.001   41.145 1.00 43.62  ? 15  DA  C "C5'" 1 
ATOM   1827 C "C4'" . DA  B 2 15  ? 21.435  -0.195  41.117 1.00 42.03  ? 15  DA  C "C4'" 1 
ATOM   1828 O "O4'" . DA  B 2 15  ? 22.722  0.196   40.584 1.00 41.04  ? 15  DA  C "O4'" 1 
ATOM   1829 C "C3'" . DA  B 2 15  ? 21.710  -0.853  42.466 1.00 44.17  ? 15  DA  C "C3'" 1 
ATOM   1830 O "O3'" . DA  B 2 15  ? 21.665  -2.238  42.277 1.00 47.04  ? 15  DA  C "O3'" 1 
ATOM   1831 C "C2'" . DA  B 2 15  ? 23.123  -0.375  42.818 1.00 42.92  ? 15  DA  C "C2'" 1 
ATOM   1832 C "C1'" . DA  B 2 15  ? 23.760  -0.227  41.446 1.00 40.91  ? 15  DA  C "C1'" 1 
ATOM   1833 N N9    . DA  B 2 15  ? 24.809  0.792   41.402 1.00 39.95  ? 15  DA  C N9    1 
ATOM   1834 C C8    . DA  B 2 15  ? 24.762  2.055   41.944 1.00 40.35  ? 15  DA  C C8    1 
ATOM   1835 N N7    . DA  B 2 15  ? 25.811  2.795   41.659 1.00 39.79  ? 15  DA  C N7    1 
ATOM   1836 C C5    . DA  B 2 15  ? 26.637  1.927   40.958 1.00 37.61  ? 15  DA  C C5    1 
ATOM   1837 C C6    . DA  B 2 15  ? 27.928  2.074   40.431 1.00 36.31  ? 15  DA  C C6    1 
ATOM   1838 N N6    . DA  B 2 15  ? 28.622  3.207   40.514 1.00 37.97  ? 15  DA  C N6    1 
ATOM   1839 N N1    . DA  B 2 15  ? 28.451  1.027   39.757 1.00 35.71  ? 15  DA  C N1    1 
ATOM   1840 C C2    . DA  B 2 15  ? 27.734  -0.092  39.614 1.00 35.48  ? 15  DA  C C2    1 
ATOM   1841 N N3    . DA  B 2 15  ? 26.526  -0.368  40.103 1.00 36.78  ? 15  DA  C N3    1 
ATOM   1842 C C4    . DA  B 2 15  ? 26.024  0.699   40.766 1.00 37.30  ? 15  DA  C C4    1 
ATOM   1843 P P     . DG  B 2 16  ? 21.731  -3.280  43.475 1.00 47.65  ? 16  DG  C P     1 
ATOM   1844 O OP1   . DG  B 2 16  ? 20.640  -4.266  43.268 1.00 47.72  ? 16  DG  C OP1   1 
ATOM   1845 O OP2   . DG  B 2 16  ? 21.832  -2.568  44.770 1.00 48.75  ? 16  DG  C OP2   1 
ATOM   1846 O "O5'" . DG  B 2 16  ? 23.127  -4.011  43.214 1.00 48.62  ? 16  DG  C "O5'" 1 
ATOM   1847 C "C5'" . DG  B 2 16  ? 23.221  -4.993  42.182 1.00 48.25  ? 16  DG  C "C5'" 1 
ATOM   1848 C "C4'" . DG  B 2 16  ? 24.651  -5.446  41.976 1.00 47.62  ? 16  DG  C "C4'" 1 
ATOM   1849 O "O4'" . DG  B 2 16  ? 25.527  -4.299  41.811 1.00 46.90  ? 16  DG  C "O4'" 1 
ATOM   1850 C "C3'" . DG  B 2 16  ? 25.235  -6.290  43.104 1.00 48.71  ? 16  DG  C "C3'" 1 
ATOM   1851 O "O3'" . DG  B 2 16  ? 25.910  -7.415  42.520 1.00 50.63  ? 16  DG  C "O3'" 1 
ATOM   1852 C "C2'" . DG  B 2 16  ? 26.179  -5.317  43.834 1.00 46.73  ? 16  DG  C "C2'" 1 
ATOM   1853 C "C1'" . DG  B 2 16  ? 26.629  -4.404  42.699 1.00 45.66  ? 16  DG  C "C1'" 1 
ATOM   1854 N N9    . DG  B 2 16  ? 27.020  -3.053  43.100 1.00 42.10  ? 16  DG  C N9    1 
ATOM   1855 C C8    . DG  B 2 16  ? 26.257  -2.129  43.784 1.00 40.19  ? 16  DG  C C8    1 
ATOM   1856 N N7    . DG  B 2 16  ? 26.815  -0.953  43.867 1.00 39.37  ? 16  DG  C N7    1 
ATOM   1857 C C5    . DG  B 2 16  ? 27.993  -1.078  43.131 1.00 38.58  ? 16  DG  C C5    1 
ATOM   1858 C C6    . DG  B 2 16  ? 29.069  -0.155  42.962 1.00 36.96  ? 16  DG  C C6    1 
ATOM   1859 O O6    . DG  B 2 16  ? 29.110  1.036   43.295 1.00 38.33  ? 16  DG  C O6    1 
ATOM   1860 N N1    . DG  B 2 16  ? 30.117  -0.712  42.202 1.00 36.04  ? 16  DG  C N1    1 
ATOM   1861 C C2    . DG  B 2 16  ? 30.173  -2.020  41.794 1.00 37.22  ? 16  DG  C C2    1 
ATOM   1862 N N2    . DG  B 2 16  ? 31.272  -2.403  41.117 1.00 37.93  ? 16  DG  C N2    1 
ATOM   1863 N N3    . DG  B 2 16  ? 29.185  -2.894  41.967 1.00 38.59  ? 16  DG  C N3    1 
ATOM   1864 C C4    . DG  B 2 16  ? 28.133  -2.354  42.652 1.00 39.62  ? 16  DG  C C4    1 
ATOM   1865 P P     . DC  B 2 17  ? 26.409  -8.659  43.396 1.00 51.77  ? 17  DC  C P     1 
ATOM   1866 O OP1   . DC  B 2 17  ? 26.172  -9.898  42.601 1.00 53.06  ? 17  DC  C OP1   1 
ATOM   1867 O OP2   . DC  B 2 17  ? 25.848  -8.538  44.754 1.00 52.76  ? 17  DC  C OP2   1 
ATOM   1868 O "O5'" . DC  B 2 17  ? 27.990  -8.382  43.466 1.00 50.24  ? 17  DC  C "O5'" 1 
ATOM   1869 C "C5'" . DC  B 2 17  ? 28.770  -8.439  42.239 1.00 47.52  ? 17  DC  C "C5'" 1 
ATOM   1870 C "C4'" . DC  B 2 17  ? 30.212  -8.024  42.471 1.00 45.12  ? 17  DC  C "C4'" 1 
ATOM   1871 O "O4'" . DC  B 2 17  ? 30.284  -6.618  42.800 1.00 42.77  ? 17  DC  C "O4'" 1 
ATOM   1872 C "C3'" . DC  B 2 17  ? 30.952  -8.770  43.582 1.00 44.77  ? 17  DC  C "C3'" 1 
ATOM   1873 O "O3'" . DC  B 2 17  ? 32.176  -9.240  43.051 1.00 45.99  ? 17  DC  C "O3'" 1 
ATOM   1874 C "C2'" . DC  B 2 17  ? 31.160  -7.698  44.673 1.00 43.38  ? 17  DC  C "C2'" 1 
ATOM   1875 C "C1'" . DC  B 2 17  ? 31.191  -6.409  43.858 1.00 42.03  ? 17  DC  C "C1'" 1 
ATOM   1876 N N1    . DC  B 2 17  ? 30.745  -5.148  44.586 1.00 39.64  ? 17  DC  C N1    1 
ATOM   1877 C C2    . DC  B 2 17  ? 31.523  -3.961  44.496 1.00 38.12  ? 17  DC  C C2    1 
ATOM   1878 O O2    . DC  B 2 17  ? 32.638  -3.996  43.964 1.00 39.68  ? 17  DC  C O2    1 
ATOM   1879 N N3    . DC  B 2 17  ? 31.044  -2.818  45.041 1.00 36.40  ? 17  DC  C N3    1 
ATOM   1880 C C4    . DC  B 2 17  ? 29.876  -2.814  45.705 1.00 35.05  ? 17  DC  C C4    1 
ATOM   1881 N N4    . DC  B 2 17  ? 29.460  -1.657  46.207 1.00 34.27  ? 17  DC  C N4    1 
ATOM   1882 C C5    . DC  B 2 17  ? 29.052  -3.982  45.794 1.00 36.17  ? 17  DC  C C5    1 
ATOM   1883 C C6    . DC  B 2 17  ? 29.504  -5.108  45.201 1.00 38.86  ? 17  DC  C C6    1 
ATOM   1884 P P     . DG  B 2 18  ? 33.055  -10.345 43.793 1.00 48.15  ? 18  DG  C P     1 
ATOM   1885 O OP1   . DG  B 2 18  ? 33.682  -11.202 42.749 1.00 49.38  ? 18  DG  C OP1   1 
ATOM   1886 O OP2   . DG  B 2 18  ? 32.254  -10.974 44.887 1.00 49.15  ? 18  DG  C OP2   1 
ATOM   1887 O "O5'" . DG  B 2 18  ? 34.173  -9.430  44.517 1.00 47.73  ? 18  DG  C "O5'" 1 
ATOM   1888 C "C5'" . DG  B 2 18  ? 35.168  -8.767  43.768 1.00 46.44  ? 18  DG  C "C5'" 1 
ATOM   1889 C "C4'" . DG  B 2 18  ? 35.965  -7.825  44.650 1.00 45.47  ? 18  DG  C "C4'" 1 
ATOM   1890 O "O4'" . DG  B 2 18  ? 35.125  -6.738  45.095 1.00 43.62  ? 18  DG  C "O4'" 1 
ATOM   1891 C "C3'" . DG  B 2 18  ? 36.600  -8.433  45.909 1.00 47.21  ? 18  DG  C "C3'" 1 
ATOM   1892 O "O3'" . DG  B 2 18  ? 37.981  -8.069  45.899 1.00 49.76  ? 18  DG  C "O3'" 1 
ATOM   1893 C "C2'" . DG  B 2 18  ? 35.825  -7.762  47.064 1.00 45.73  ? 18  DG  C "C2'" 1 
ATOM   1894 C "C1'" . DG  B 2 18  ? 35.429  -6.437  46.428 1.00 43.56  ? 18  DG  C "C1'" 1 
ATOM   1895 N N9    . DG  B 2 18  ? 34.258  -5.797  47.018 1.00 41.16  ? 18  DG  C N9    1 
ATOM   1896 C C8    . DG  B 2 18  ? 33.061  -6.389  47.353 1.00 40.28  ? 18  DG  C C8    1 
ATOM   1897 N N7    . DG  B 2 18  ? 32.186  -5.551  47.839 1.00 38.89  ? 18  DG  C N7    1 
ATOM   1898 C C5    . DG  B 2 18  ? 32.817  -4.319  47.756 1.00 38.92  ? 18  DG  C C5    1 
ATOM   1899 C C6    . DG  B 2 18  ? 32.367  -3.030  48.150 1.00 36.58  ? 18  DG  C C6    1 
ATOM   1900 O O6    . DG  B 2 18  ? 31.276  -2.719  48.629 1.00 37.26  ? 18  DG  C O6    1 
ATOM   1901 N N1    . DG  B 2 18  ? 33.349  -2.064  47.988 1.00 35.57  ? 18  DG  C N1    1 
ATOM   1902 C C2    . DG  B 2 18  ? 34.598  -2.295  47.452 1.00 37.38  ? 18  DG  C C2    1 
ATOM   1903 N N2    . DG  B 2 18  ? 35.429  -1.248  47.408 1.00 36.30  ? 18  DG  C N2    1 
ATOM   1904 N N3    . DG  B 2 18  ? 35.023  -3.488  47.042 1.00 38.25  ? 18  DG  C N3    1 
ATOM   1905 C C4    . DG  B 2 18  ? 34.095  -4.457  47.253 1.00 39.40  ? 18  DG  C C4    1 
ATOM   1906 P P     . DA  B 2 19  ? 38.999  -8.431  47.070 1.00 51.59  ? 19  DA  C P     1 
ATOM   1907 O OP1   . DA  B 2 19  ? 40.254  -8.887  46.431 1.00 53.28  ? 19  DA  C OP1   1 
ATOM   1908 O OP2   . DA  B 2 19  ? 38.335  -9.286  48.092 1.00 52.35  ? 19  DA  C OP2   1 
ATOM   1909 O "O5'" . DA  B 2 19  ? 39.261  -7.001  47.747 1.00 50.70  ? 19  DA  C "O5'" 1 
ATOM   1910 C "C5'" . DA  B 2 19  ? 39.659  -5.893  46.932 1.00 50.68  ? 19  DA  C "C5'" 1 
ATOM   1911 C "C4'" . DA  B 2 19  ? 39.885  -4.659  47.789 1.00 51.23  ? 19  DA  C "C4'" 1 
ATOM   1912 O "O4'" . DA  B 2 19  ? 38.607  -4.091  48.176 1.00 49.34  ? 19  DA  C "O4'" 1 
ATOM   1913 C "C3'" . DA  B 2 19  ? 40.677  -4.893  49.082 1.00 52.63  ? 19  DA  C "C3'" 1 
ATOM   1914 O "O3'" . DA  B 2 19  ? 41.641  -3.855  49.222 1.00 57.38  ? 19  DA  C "O3'" 1 
ATOM   1915 C "C2'" . DA  B 2 19  ? 39.605  -4.861  50.183 1.00 49.98  ? 19  DA  C "C2'" 1 
ATOM   1916 C "C1'" . DA  B 2 19  ? 38.544  -3.933  49.584 1.00 47.31  ? 19  DA  C "C1'" 1 
ATOM   1917 N N9    . DA  B 2 19  ? 37.175  -4.249  50.002 1.00 43.58  ? 19  DA  C N9    1 
ATOM   1918 C C8    . DA  B 2 19  ? 36.548  -5.464  49.914 1.00 42.31  ? 19  DA  C C8    1 
ATOM   1919 N N7    . DA  B 2 19  ? 35.289  -5.443  50.268 1.00 41.17  ? 19  DA  C N7    1 
ATOM   1920 C C5    . DA  B 2 19  ? 35.054  -4.111  50.588 1.00 40.41  ? 19  DA  C C5    1 
ATOM   1921 C C6    . DA  B 2 19  ? 33.910  -3.429  51.060 1.00 38.69  ? 19  DA  C C6    1 
ATOM   1922 N N6    . DA  B 2 19  ? 32.743  -4.033  51.294 1.00 38.78  ? 19  DA  C N6    1 
ATOM   1923 N N1    . DA  B 2 19  ? 34.015  -2.089  51.278 1.00 38.55  ? 19  DA  C N1    1 
ATOM   1924 C C2    . DA  B 2 19  ? 35.187  -1.490  51.059 1.00 39.68  ? 19  DA  C C2    1 
ATOM   1925 N N3    . DA  B 2 19  ? 36.335  -2.030  50.640 1.00 40.82  ? 19  DA  C N3    1 
ATOM   1926 C C4    . DA  B 2 19  ? 36.201  -3.356  50.414 1.00 41.63  ? 19  DA  C C4    1 
ATOM   1927 P P     . DT  B 2 20  ? 42.782  -3.881  50.361 1.00 61.36  ? 20  DT  C P     1 
ATOM   1928 O OP1   . DT  B 2 20  ? 44.007  -3.278  49.775 1.00 62.48  ? 20  DT  C OP1   1 
ATOM   1929 O OP2   . DT  B 2 20  ? 42.844  -5.229  50.975 1.00 62.03  ? 20  DT  C OP2   1 
ATOM   1930 O "O5'" . DT  B 2 20  ? 42.187  -2.873  51.463 1.00 61.18  ? 20  DT  C "O5'" 1 
ATOM   1931 C "C5'" . DT  B 2 20  ? 41.671  -1.601  51.053 1.00 59.17  ? 20  DT  C "C5'" 1 
ATOM   1932 C "C4'" . DT  B 2 20  ? 40.946  -0.899  52.188 1.00 56.86  ? 20  DT  C "C4'" 1 
ATOM   1933 O "O4'" . DT  B 2 20  ? 39.594  -1.395  52.305 1.00 53.98  ? 20  DT  C "O4'" 1 
ATOM   1934 C "C3'" . DT  B 2 20  ? 41.583  -1.042  53.570 1.00 57.68  ? 20  DT  C "C3'" 1 
ATOM   1935 O "O3'" . DT  B 2 20  ? 41.953  0.255   54.048 1.00 61.15  ? 20  DT  C "O3'" 1 
ATOM   1936 C "C2'" . DT  B 2 20  ? 40.486  -1.690  54.434 1.00 54.83  ? 20  DT  C "C2'" 1 
ATOM   1937 C "C1'" . DT  B 2 20  ? 39.218  -1.355  53.659 1.00 52.59  ? 20  DT  C "C1'" 1 
ATOM   1938 N N1    . DT  B 2 20  ? 38.067  -2.320  53.862 1.00 48.36  ? 20  DT  C N1    1 
ATOM   1939 C C2    . DT  B 2 20  ? 36.810  -1.824  54.187 1.00 46.53  ? 20  DT  C C2    1 
ATOM   1940 O O2    . DT  B 2 20  ? 36.582  -0.646  54.399 1.00 47.78  ? 20  DT  C O2    1 
ATOM   1941 N N3    . DT  B 2 20  ? 35.823  -2.770  54.267 1.00 43.88  ? 20  DT  C N3    1 
ATOM   1942 C C4    . DT  B 2 20  ? 35.945  -4.134  54.029 1.00 42.86  ? 20  DT  C C4    1 
ATOM   1943 O O4    . DT  B 2 20  ? 34.944  -4.842  54.081 1.00 41.07  ? 20  DT  C O4    1 
ATOM   1944 C C5    . DT  B 2 20  ? 37.279  -4.586  53.670 1.00 44.55  ? 20  DT  C C5    1 
ATOM   1945 C C7    . DT  B 2 20  ? 37.546  -6.041  53.372 1.00 44.30  ? 20  DT  C C7    1 
ATOM   1946 C C6    . DT  B 2 20  ? 38.253  -3.665  53.579 1.00 45.89  ? 20  DT  C C6    1 
ATOM   1947 P P     . DG  B 2 21  ? 43.040  0.433   55.216 1.00 64.55  ? 21  DG  C P     1 
ATOM   1948 O OP1   . DG  B 2 21  ? 43.840  1.641   54.894 1.00 66.88  ? 21  DG  C OP1   1 
ATOM   1949 O OP2   . DG  B 2 21  ? 43.720  -0.864  55.454 1.00 64.42  ? 21  DG  C OP2   1 
ATOM   1950 O "O5'" . DG  B 2 21  ? 42.128  0.744   56.491 1.00 63.54  ? 21  DG  C "O5'" 1 
ATOM   1951 C "C5'" . DG  B 2 21  ? 41.078  1.740   56.412 1.00 61.59  ? 21  DG  C "C5'" 1 
ATOM   1952 C "C4'" . DG  B 2 21  ? 40.096  1.587   57.571 1.00 59.82  ? 21  DG  C "C4'" 1 
ATOM   1953 O "O4'" . DG  B 2 21  ? 39.149  0.521   57.278 1.00 57.09  ? 21  DG  C "O4'" 1 
ATOM   1954 C "C3'" . DG  B 2 21  ? 40.719  1.225   58.943 1.00 59.69  ? 21  DG  C "C3'" 1 
ATOM   1955 O "O3'" . DG  B 2 21  ? 40.009  1.889   59.971 1.00 62.18  ? 21  DG  C "O3'" 1 
ATOM   1956 C "C2'" . DG  B 2 21  ? 40.458  -0.274  59.030 1.00 58.05  ? 21  DG  C "C2'" 1 
ATOM   1957 C "C1'" . DG  B 2 21  ? 39.073  -0.320  58.406 1.00 55.87  ? 21  DG  C "C1'" 1 
ATOM   1958 N N9    . DG  B 2 21  ? 38.625  -1.644  57.990 1.00 52.76  ? 21  DG  C N9    1 
ATOM   1959 C C8    . DG  B 2 21  ? 39.401  -2.703  57.587 1.00 51.65  ? 21  DG  C C8    1 
ATOM   1960 N N7    . DG  B 2 21  ? 38.710  -3.760  57.282 1.00 50.12  ? 21  DG  C N7    1 
ATOM   1961 C C5    . DG  B 2 21  ? 37.396  -3.383  57.517 1.00 48.13  ? 21  DG  C C5    1 
ATOM   1962 C C6    . DG  B 2 21  ? 36.211  -4.134  57.421 1.00 46.17  ? 21  DG  C C6    1 
ATOM   1963 O O6    . DG  B 2 21  ? 36.084  -5.302  57.028 1.00 46.61  ? 21  DG  C O6    1 
ATOM   1964 N N1    . DG  B 2 21  ? 35.089  -3.382  57.775 1.00 44.53  ? 21  DG  C N1    1 
ATOM   1965 C C2    . DG  B 2 21  ? 35.120  -2.080  58.201 1.00 45.05  ? 21  DG  C C2    1 
ATOM   1966 N N2    . DG  B 2 21  ? 33.955  -1.539  58.550 1.00 44.82  ? 21  DG  C N2    1 
ATOM   1967 N N3    . DG  B 2 21  ? 36.228  -1.359  58.303 1.00 47.07  ? 21  DG  C N3    1 
ATOM   1968 C C4    . DG  B 2 21  ? 37.327  -2.074  57.925 1.00 49.12  ? 21  DG  C C4    1 
ATOM   1969 P P     . DG  B 2 22  ? 40.752  2.805   61.070 1.00 62.99  ? 22  DG  C P     1 
ATOM   1970 O OP1   . DG  B 2 22  ? 41.416  3.916   60.359 1.00 63.73  ? 22  DG  C OP1   1 
ATOM   1971 O OP2   . DG  B 2 22  ? 41.530  1.939   61.978 1.00 63.85  ? 22  DG  C OP2   1 
ATOM   1972 O "O5'" . DG  B 2 22  ? 39.517  3.388   61.891 1.00 62.78  ? 22  DG  C "O5'" 1 
ATOM   1973 C "C5'" . DG  B 2 22  ? 38.355  3.880   61.214 1.00 61.99  ? 22  DG  C "C5'" 1 
ATOM   1974 C "C4'" . DG  B 2 22  ? 37.085  3.521   61.981 1.00 62.62  ? 22  DG  C "C4'" 1 
ATOM   1975 O "O4'" . DG  B 2 22  ? 36.609  2.201   61.578 1.00 61.66  ? 22  DG  C "O4'" 1 
ATOM   1976 C "C3'" . DG  B 2 22  ? 37.211  3.491   63.508 1.00 64.75  ? 22  DG  C "C3'" 1 
ATOM   1977 O "O3'" . DG  B 2 22  ? 36.076  4.160   64.089 1.00 68.46  ? 22  DG  C "O3'" 1 
ATOM   1978 C "C2'" . DG  B 2 22  ? 37.262  1.990   63.844 1.00 61.84  ? 22  DG  C "C2'" 1 
ATOM   1979 C "C1'" . DG  B 2 22  ? 36.447  1.368   62.715 1.00 59.89  ? 22  DG  C "C1'" 1 
ATOM   1980 N N9    . DG  B 2 22  ? 36.869  0.013   62.341 1.00 56.64  ? 22  DG  C N9    1 
ATOM   1981 C C8    . DG  B 2 22  ? 38.154  -0.412  62.058 1.00 55.99  ? 22  DG  C C8    1 
ATOM   1982 N N7    . DG  B 2 22  ? 38.214  -1.644  61.622 1.00 54.41  ? 22  DG  C N7    1 
ATOM   1983 C C5    . DG  B 2 22  ? 36.885  -2.049  61.566 1.00 51.77  ? 22  DG  C C5    1 
ATOM   1984 C C6    . DG  B 2 22  ? 36.331  -3.322  61.269 1.00 49.39  ? 22  DG  C C6    1 
ATOM   1985 O O6    . DG  B 2 22  ? 36.908  -4.326  60.828 1.00 49.15  ? 22  DG  C O6    1 
ATOM   1986 N N1    . DG  B 2 22  ? 34.940  -3.318  61.378 1.00 48.06  ? 22  DG  C N1    1 
ATOM   1987 C C2    . DG  B 2 22  ? 34.193  -2.266  61.845 1.00 49.21  ? 22  DG  C C2    1 
ATOM   1988 N N2    . DG  B 2 22  ? 32.875  -2.463  61.908 1.00 50.25  ? 22  DG  C N2    1 
ATOM   1989 N N3    . DG  B 2 22  ? 34.696  -1.072  62.145 1.00 50.72  ? 22  DG  C N3    1 
ATOM   1990 C C4    . DG  B 2 22  ? 36.045  -1.037  61.996 1.00 52.92  ? 22  DG  C C4    1 
ATOM   1991 P P     . DA  B 2 23  ? 35.878  4.280   65.677 1.00 70.56  ? 23  DA  C P     1 
ATOM   1992 O OP1   . DA  B 2 23  ? 35.154  5.550   65.930 1.00 72.47  ? 23  DA  C OP1   1 
ATOM   1993 O OP2   . DA  B 2 23  ? 37.178  4.028   66.354 1.00 70.33  ? 23  DA  C OP2   1 
ATOM   1994 O "O5'" . DA  B 2 23  ? 34.895  3.053   66.007 1.00 68.87  ? 23  DA  C "O5'" 1 
ATOM   1995 C "C5'" . DA  B 2 23  ? 33.563  3.075   65.480 1.00 67.53  ? 23  DA  C "C5'" 1 
ATOM   1996 C "C4'" . DA  B 2 23  ? 32.750  1.865   65.911 1.00 65.89  ? 23  DA  C "C4'" 1 
ATOM   1997 O "O4'" . DA  B 2 23  ? 33.262  0.643   65.307 1.00 63.81  ? 23  DA  C "O4'" 1 
ATOM   1998 C "C3'" . DA  B 2 23  ? 32.628  1.615   67.403 1.00 65.97  ? 23  DA  C "C3'" 1 
ATOM   1999 O "O3'" . DA  B 2 23  ? 31.262  1.340   67.687 1.00 68.34  ? 23  DA  C "O3'" 1 
ATOM   2000 C "C2'" . DA  B 2 23  ? 33.532  0.391   67.632 1.00 63.91  ? 23  DA  C "C2'" 1 
ATOM   2001 C "C1'" . DA  B 2 23  ? 33.402  -0.352  66.290 1.00 61.70  ? 23  DA  C "C1'" 1 
ATOM   2002 N N9    . DA  B 2 23  ? 34.562  -1.157  65.919 1.00 58.52  ? 23  DA  C N9    1 
ATOM   2003 C C8    . DA  B 2 23  ? 35.867  -0.745  65.843 1.00 58.01  ? 23  DA  C C8    1 
ATOM   2004 N N7    . DA  B 2 23  ? 36.692  -1.659  65.387 1.00 55.94  ? 23  DA  C N7    1 
ATOM   2005 C C5    . DA  B 2 23  ? 35.873  -2.741  65.125 1.00 54.21  ? 23  DA  C C5    1 
ATOM   2006 C C6    . DA  B 2 23  ? 36.135  -4.029  64.603 1.00 51.55  ? 23  DA  C C6    1 
ATOM   2007 N N6    . DA  B 2 23  ? 37.354  -4.440  64.239 1.00 49.76  ? 23  DA  C N6    1 
ATOM   2008 N N1    . DA  B 2 23  ? 35.087  -4.874  64.472 1.00 50.19  ? 23  DA  C N1    1 
ATOM   2009 C C2    . DA  B 2 23  ? 33.855  -4.450  64.799 1.00 51.19  ? 23  DA  C C2    1 
ATOM   2010 N N3    . DA  B 2 23  ? 33.488  -3.274  65.316 1.00 53.77  ? 23  DA  C N3    1 
ATOM   2011 C C4    . DA  B 2 23  ? 34.550  -2.444  65.424 1.00 55.18  ? 23  DA  C C4    1 
ATOM   2012 P P     . DC  B 2 24  ? 30.680  1.350   69.184 1.00 72.29  ? 24  DC  C P     1 
ATOM   2013 O OP1   . DC  B 2 24  ? 29.266  1.796   69.074 1.00 73.84  ? 24  DC  C OP1   1 
ATOM   2014 O OP2   . DC  B 2 24  ? 31.631  2.056   70.080 1.00 71.36  ? 24  DC  C OP2   1 
ATOM   2015 O "O5'" . DC  B 2 24  ? 30.713  -0.192  69.596 1.00 71.81  ? 24  DC  C "O5'" 1 
ATOM   2016 C "C5'" . DC  B 2 24  ? 30.183  -1.183  68.739 1.00 71.81  ? 24  DC  C "C5'" 1 
ATOM   2017 C "C4'" . DC  B 2 24  ? 30.767  -2.542  69.073 1.00 71.33  ? 24  DC  C "C4'" 1 
ATOM   2018 O "O4'" . DC  B 2 24  ? 32.061  -2.683  68.461 1.00 69.74  ? 24  DC  C "O4'" 1 
ATOM   2019 C "C3'" . DC  B 2 24  ? 30.982  -2.828  70.567 1.00 72.37  ? 24  DC  C "C3'" 1 
ATOM   2020 O "O3'" . DC  B 2 24  ? 30.109  -3.857  70.957 1.00 74.54  ? 24  DC  C "O3'" 1 
ATOM   2021 C "C2'" . DC  B 2 24  ? 32.459  -3.279  70.654 1.00 70.46  ? 24  DC  C "C2'" 1 
ATOM   2022 C "C1'" . DC  B 2 24  ? 32.752  -3.628  69.196 1.00 67.72  ? 24  DC  C "C1'" 1 
ATOM   2023 N N1    . DC  B 2 24  ? 34.217  -3.637  68.793 1.00 63.54  ? 24  DC  C N1    1 
ATOM   2024 C C2    . DC  B 2 24  ? 34.751  -4.791  68.179 1.00 60.34  ? 24  DC  C C2    1 
ATOM   2025 O O2    . DC  B 2 24  ? 34.011  -5.747  67.946 1.00 59.62  ? 24  DC  C O2    1 
ATOM   2026 N N3    . DC  B 2 24  ? 36.075  -4.821  67.870 1.00 58.71  ? 24  DC  C N3    1 
ATOM   2027 C C4    . DC  B 2 24  ? 36.862  -3.778  68.159 1.00 58.93  ? 24  DC  C C4    1 
ATOM   2028 N N4    . DC  B 2 24  ? 38.142  -3.846  67.791 1.00 57.05  ? 24  DC  C N4    1 
ATOM   2029 C C5    . DC  B 2 24  ? 36.352  -2.603  68.802 1.00 60.94  ? 24  DC  C C5    1 
ATOM   2030 C C6    . DC  B 2 24  ? 35.032  -2.564  69.074 1.00 62.65  ? 24  DC  C C6    1 
ATOM   2031 P P     . DA  B 2 25  ? 29.513  -3.951  72.444 1.00 76.88  ? 25  DA  C P     1 
ATOM   2032 O OP1   . DA  B 2 25  ? 28.135  -3.411  72.400 1.00 78.48  ? 25  DA  C OP1   1 
ATOM   2033 O OP2   . DA  B 2 25  ? 30.498  -3.411  73.410 1.00 76.50  ? 25  DA  C OP2   1 
ATOM   2034 O "O5'" . DA  B 2 25  ? 29.436  -5.526  72.654 1.00 75.51  ? 25  DA  C "O5'" 1 
ATOM   2035 C "C5'" . DA  B 2 25  ? 29.132  -6.369  71.541 1.00 73.44  ? 25  DA  C "C5'" 1 
ATOM   2036 C "C4'" . DA  B 2 25  ? 29.932  -7.652  71.592 1.00 71.30  ? 25  DA  C "C4'" 1 
ATOM   2037 O "O4'" . DA  B 2 25  ? 31.278  -7.443  71.102 1.00 69.40  ? 25  DA  C "O4'" 1 
ATOM   2038 C "C3'" . DA  B 2 25  ? 30.052  -8.291  72.971 1.00 71.79  ? 25  DA  C "C3'" 1 
ATOM   2039 O "O3'" . DA  B 2 25  ? 29.616  -9.620  72.848 1.00 73.71  ? 25  DA  C "O3'" 1 
ATOM   2040 C "C2'" . DA  B 2 25  ? 31.548  -8.182  73.308 1.00 70.30  ? 25  DA  C "C2'" 1 
ATOM   2041 C "C1'" . DA  B 2 25  ? 32.206  -8.105  71.934 1.00 69.45  ? 25  DA  C "C1'" 1 
ATOM   2042 N N9    . DA  B 2 25  ? 33.446  -7.324  71.909 1.00 68.03  ? 25  DA  C N9    1 
ATOM   2043 C C8    . DA  B 2 25  ? 33.614  -6.056  72.404 1.00 68.74  ? 25  DA  C C8    1 
ATOM   2044 N N7    . DA  B 2 25  ? 34.768  -5.514  72.108 1.00 68.01  ? 25  DA  C N7    1 
ATOM   2045 C C5    . DA  B 2 25  ? 35.429  -6.503  71.404 1.00 65.48  ? 25  DA  C C5    1 
ATOM   2046 C C6    . DA  B 2 25  ? 36.722  -6.560  70.842 1.00 62.40  ? 25  DA  C C6    1 
ATOM   2047 N N6    . DA  B 2 25  ? 37.602  -5.555  70.932 1.00 62.40  ? 25  DA  C N6    1 
ATOM   2048 N N1    . DA  B 2 25  ? 37.081  -7.691  70.205 1.00 60.62  ? 25  DA  C N1    1 
ATOM   2049 C C2    . DA  B 2 25  ? 36.199  -8.699  70.122 1.00 61.66  ? 25  DA  C C2    1 
ATOM   2050 N N3    . DA  B 2 25  ? 34.937  -8.744  70.562 1.00 63.58  ? 25  DA  C N3    1 
ATOM   2051 C C4    . DA  B 2 25  ? 34.615  -7.611  71.223 1.00 65.44  ? 25  DA  C C4    1 
ATOM   2052 P P     . DG  B 2 26  ? 29.414  -10.582 74.098 1.00 74.73  ? 26  DG  C P     1 
ATOM   2053 O OP1   . DG  B 2 26  ? 28.235  -11.428 73.795 1.00 76.48  ? 26  DG  C OP1   1 
ATOM   2054 O OP2   . DG  B 2 26  ? 29.461  -9.801  75.352 1.00 75.29  ? 26  DG  C OP2   1 
ATOM   2055 O "O5'" . DG  B 2 26  ? 30.735  -11.474 74.014 1.00 72.50  ? 26  DG  C "O5'" 1 
ATOM   2056 C "C5'" . DG  B 2 26  ? 31.071  -12.133 72.774 1.00 69.55  ? 26  DG  C "C5'" 1 
ATOM   2057 C "C4'" . DG  B 2 26  ? 32.366  -12.921 72.892 1.00 68.49  ? 26  DG  C "C4'" 1 
ATOM   2058 O "O4'" . DG  B 2 26  ? 33.506  -12.053 72.714 1.00 66.87  ? 26  DG  C "O4'" 1 
ATOM   2059 C "C3'" . DG  B 2 26  ? 32.589  -13.673 74.209 1.00 69.18  ? 26  DG  C "C3'" 1 
ATOM   2060 O "O3'" . DG  B 2 26  ? 33.064  -14.954 73.913 1.00 70.15  ? 26  DG  C "O3'" 1 
ATOM   2061 C "C2'" . DG  B 2 26  ? 33.646  -12.832 74.938 1.00 67.82  ? 26  DG  C "C2'" 1 
ATOM   2062 C "C1'" . DG  B 2 26  ? 34.432  -12.238 73.766 1.00 67.32  ? 26  DG  C "C1'" 1 
ATOM   2063 N N9    . DG  B 2 26  ? 35.054  -10.942 74.037 1.00 66.61  ? 26  DG  C N9    1 
ATOM   2064 C C8    . DG  B 2 26  ? 34.436  -9.830  74.561 1.00 67.46  ? 26  DG  C C8    1 
ATOM   2065 N N7    . DG  B 2 26  ? 35.188  -8.770  74.568 1.00 67.10  ? 26  DG  C N7    1 
ATOM   2066 C C5    . DG  B 2 26  ? 36.352  -9.172  73.932 1.00 65.49  ? 26  DG  C C5    1 
ATOM   2067 C C6    . DG  B 2 26  ? 37.558  -8.456  73.695 1.00 64.43  ? 26  DG  C C6    1 
ATOM   2068 O O6    . DG  B 2 26  ? 37.797  -7.259  73.913 1.00 64.07  ? 26  DG  C O6    1 
ATOM   2069 N N1    . DG  B 2 26  ? 38.529  -9.260  73.097 1.00 63.05  ? 26  DG  C N1    1 
ATOM   2070 C C2    . DG  B 2 26  ? 38.359  -10.581 72.770 1.00 64.28  ? 26  DG  C C2    1 
ATOM   2071 N N2    . DG  B 2 26  ? 39.416  -11.195 72.226 1.00 65.81  ? 26  DG  C N2    1 
ATOM   2072 N N3    . DG  B 2 26  ? 37.257  -11.277 73.034 1.00 64.59  ? 26  DG  C N3    1 
ATOM   2073 C C4    . DG  B 2 26  ? 36.280  -10.503 73.578 1.00 65.31  ? 26  DG  C C4    1 
ATOM   2074 P P     . DC  B 2 27  ? 33.009  -16.134 74.988 1.00 72.54  ? 27  DC  C P     1 
ATOM   2075 O OP1   . DC  B 2 27  ? 32.640  -17.367 74.242 1.00 74.37  ? 27  DC  C OP1   1 
ATOM   2076 O OP2   . DC  B 2 27  ? 32.197  -15.712 76.152 1.00 72.47  ? 27  DC  C OP2   1 
ATOM   2077 O "O5'" . DC  B 2 27  ? 34.534  -16.248 75.458 1.00 74.22  ? 27  DC  C "O5'" 1 
ATOM   2078 C "C5'" . DC  B 2 27  ? 35.557  -16.218 74.464 1.00 75.40  ? 27  DC  C "C5'" 1 
ATOM   2079 C "C4'" . DC  B 2 27  ? 36.896  -15.736 74.996 1.00 76.14  ? 27  DC  C "C4'" 1 
ATOM   2080 O "O4'" . DC  B 2 27  ? 36.940  -14.305 75.089 1.00 73.62  ? 27  DC  C "O4'" 1 
ATOM   2081 C "C3'" . DC  B 2 27  ? 37.310  -16.262 76.356 1.00 78.82  ? 27  DC  C "C3'" 1 
ATOM   2082 O "O3'" . DC  B 2 27  ? 38.404  -17.133 76.191 1.00 83.92  ? 27  DC  C "O3'" 1 
ATOM   2083 C "C2'" . DC  B 2 27  ? 37.720  -14.998 77.134 1.00 76.05  ? 27  DC  C "C2'" 1 
ATOM   2084 C "C1'" . DC  B 2 27  ? 37.934  -13.994 76.012 1.00 74.67  ? 27  DC  C "C1'" 1 
ATOM   2085 N N1    . DC  B 2 27  ? 37.796  -12.547 76.418 1.00 72.54  ? 27  DC  C N1    1 
ATOM   2086 C C2    . DC  B 2 27  ? 38.853  -11.637 76.164 1.00 71.63  ? 27  DC  C C2    1 
ATOM   2087 O O2    . DC  B 2 27  ? 39.912  -12.048 75.667 1.00 73.11  ? 27  DC  C O2    1 
ATOM   2088 N N3    . DC  B 2 27  ? 38.678  -10.327 76.480 1.00 69.12  ? 27  DC  C N3    1 
ATOM   2089 C C4    . DC  B 2 27  ? 37.524  -9.912  77.025 1.00 69.39  ? 27  DC  C C4    1 
ATOM   2090 N N4    . DC  B 2 27  ? 37.416  -8.628  77.348 1.00 70.40  ? 27  DC  C N4    1 
ATOM   2091 C C5    . DC  B 2 27  ? 36.440  -10.808 77.279 1.00 70.23  ? 27  DC  C C5    1 
ATOM   2092 C C6    . DC  B 2 27  ? 36.610  -12.098 76.949 1.00 71.80  ? 27  DC  C C6    1 
ATOM   2093 P P     . DT  B 2 28  ? 38.623  -18.372 77.178 1.00 87.48  ? 28  DT  C P     1 
ATOM   2094 O OP1   . DT  B 2 28  ? 38.709  -19.588 76.335 1.00 89.20  ? 28  DT  C OP1   1 
ATOM   2095 O OP2   . DT  B 2 28  ? 37.618  -18.306 78.271 1.00 87.97  ? 28  DT  C OP2   1 
ATOM   2096 O "O5'" . DT  B 2 28  ? 40.065  -18.093 77.813 1.00 88.17  ? 28  DT  C "O5'" 1 
ATOM   2097 C "C5'" . DT  B 2 28  ? 40.293  -16.937 78.522 1.00 86.84  ? 28  DT  C "C5'" 1 
ATOM   2098 C "C4'" . DT  B 2 28  ? 41.677  -16.388 78.235 1.00 86.73  ? 28  DT  C "C4'" 1 
ATOM   2099 O "O4'" . DT  B 2 28  ? 41.556  -14.984 77.859 1.00 84.73  ? 28  DT  C "O4'" 1 
ATOM   2100 C "C3'" . DT  B 2 28  ? 42.611  -16.423 79.451 1.00 88.50  ? 28  DT  C "C3'" 1 
ATOM   2101 O "O3'" . DT  B 2 28  ? 43.966  -16.660 79.084 1.00 90.91  ? 28  DT  C "O3'" 1 
ATOM   2102 C "C2'" . DT  B 2 28  ? 42.435  -15.059 80.074 1.00 86.94  ? 28  DT  C "C2'" 1 
ATOM   2103 C "C1'" . DT  B 2 28  ? 42.063  -14.156 78.905 1.00 84.63  ? 28  DT  C "C1'" 1 
ATOM   2104 N N1    . DT  B 2 28  ? 41.028  -13.088 79.266 1.00 81.58  ? 28  DT  C N1    1 
ATOM   2105 C C2    . DT  B 2 28  ? 41.415  -11.757 79.298 1.00 78.02  ? 28  DT  C C2    1 
ATOM   2106 O O2    . DT  B 2 28  ? 42.529  -11.371 78.974 1.00 76.99  ? 28  DT  C O2    1 
ATOM   2107 N N3    . DT  B 2 28  ? 40.411  -10.875 79.622 1.00 76.36  ? 28  DT  C N3    1 
ATOM   2108 C C4    . DT  B 2 28  ? 39.118  -11.168 80.035 1.00 76.27  ? 28  DT  C C4    1 
ATOM   2109 O O4    . DT  B 2 28  ? 38.335  -10.234 80.270 1.00 75.05  ? 28  DT  C O4    1 
ATOM   2110 C C5    . DT  B 2 28  ? 38.781  -12.589 80.041 1.00 77.87  ? 28  DT  C C5    1 
ATOM   2111 C C7    . DT  B 2 28  ? 37.400  -13.051 80.441 1.00 76.21  ? 28  DT  C C7    1 
ATOM   2112 C C6    . DT  B 2 28  ? 39.749  -13.469 79.681 1.00 80.02  ? 28  DT  C C6    1 
ATOM   2113 O "O5'" . DA  C 3 1   ? 43.433  -2.336  82.830 1.00 95.29  ? 1   DA  D "O5'" 1 
ATOM   2114 C "C5'" . DA  C 3 1   ? 43.920  -1.614  81.693 1.00 94.44  ? 1   DA  D "C5'" 1 
ATOM   2115 C "C4'" . DA  C 3 1   ? 45.052  -2.387  81.022 1.00 93.38  ? 1   DA  D "C4'" 1 
ATOM   2116 O "O4'" . DA  C 3 1   ? 44.674  -3.771  80.848 1.00 91.91  ? 1   DA  D "O4'" 1 
ATOM   2117 C "C3'" . DA  C 3 1   ? 45.467  -1.920  79.635 1.00 94.30  ? 1   DA  D "C3'" 1 
ATOM   2118 O "O3'" . DA  C 3 1   ? 46.858  -2.301  79.427 1.00 96.23  ? 1   DA  D "O3'" 1 
ATOM   2119 C "C2'" . DA  C 3 1   ? 44.502  -2.703  78.716 1.00 92.20  ? 1   DA  D "C2'" 1 
ATOM   2120 C "C1'" . DA  C 3 1   ? 44.311  -4.018  79.495 1.00 89.67  ? 1   DA  D "C1'" 1 
ATOM   2121 N N9    . DA  C 3 1   ? 42.943  -4.543  79.494 1.00 85.58  ? 1   DA  D N9    1 
ATOM   2122 C C8    . DA  C 3 1   ? 41.771  -3.831  79.585 1.00 83.99  ? 1   DA  D C8    1 
ATOM   2123 N N7    . DA  C 3 1   ? 40.694  -4.581  79.630 1.00 82.39  ? 1   DA  D N7    1 
ATOM   2124 C C5    . DA  C 3 1   ? 41.190  -5.876  79.600 1.00 81.10  ? 1   DA  D C5    1 
ATOM   2125 C C6    . DA  C 3 1   ? 40.560  -7.144  79.646 1.00 78.41  ? 1   DA  D C6    1 
ATOM   2126 N N6    . DA  C 3 1   ? 39.247  -7.306  79.788 1.00 77.55  ? 1   DA  D N6    1 
ATOM   2127 N N1    . DA  C 3 1   ? 41.348  -8.241  79.588 1.00 77.86  ? 1   DA  D N1    1 
ATOM   2128 C C2    . DA  C 3 1   ? 42.679  -8.085  79.520 1.00 78.81  ? 1   DA  D C2    1 
ATOM   2129 N N3    . DA  C 3 1   ? 43.388  -6.950  79.494 1.00 80.16  ? 1   DA  D N3    1 
ATOM   2130 C C4    . DA  C 3 1   ? 42.576  -5.872  79.547 1.00 82.39  ? 1   DA  D C4    1 
ATOM   2131 P P     . DG  C 3 2   ? 47.658  -1.907  78.084 1.00 96.95  ? 2   DG  D P     1 
ATOM   2132 O OP1   . DG  C 3 2   ? 49.102  -1.851  78.436 1.00 98.30  ? 2   DG  D OP1   1 
ATOM   2133 O OP2   . DG  C 3 2   ? 46.998  -0.738  77.460 1.00 97.99  ? 2   DG  D OP2   1 
ATOM   2134 O "O5'" . DG  C 3 2   ? 47.407  -3.177  77.138 1.00 94.28  ? 2   DG  D "O5'" 1 
ATOM   2135 C "C5'" . DG  C 3 2   ? 48.023  -4.426  77.458 1.00 91.43  ? 2   DG  D "C5'" 1 
ATOM   2136 C "C4'" . DG  C 3 2   ? 47.514  -5.538  76.557 1.00 88.30  ? 2   DG  D "C4'" 1 
ATOM   2137 O "O4'" . DG  C 3 2   ? 46.128  -5.819  76.848 1.00 85.73  ? 2   DG  D "O4'" 1 
ATOM   2138 C "C3'" . DG  C 3 2   ? 47.593  -5.274  75.047 1.00 87.27  ? 2   DG  D "C3'" 1 
ATOM   2139 O "O3'" . DG  C 3 2   ? 48.410  -6.295  74.455 1.00 88.30  ? 2   DG  D "O3'" 1 
ATOM   2140 C "C2'" . DG  C 3 2   ? 46.121  -5.353  74.583 1.00 84.72  ? 2   DG  D "C2'" 1 
ATOM   2141 C "C1'" . DG  C 3 2   ? 45.514  -6.234  75.665 1.00 83.01  ? 2   DG  D "C1'" 1 
ATOM   2142 N N9    . DG  C 3 2   ? 44.061  -6.130  75.833 1.00 78.88  ? 2   DG  D N9    1 
ATOM   2143 C C8    . DG  C 3 2   ? 43.310  -4.984  76.020 1.00 77.79  ? 2   DG  D C8    1 
ATOM   2144 N N7    . DG  C 3 2   ? 42.034  -5.219  76.190 1.00 76.34  ? 2   DG  D N7    1 
ATOM   2145 C C5    . DG  C 3 2   ? 41.935  -6.613  76.143 1.00 74.92  ? 2   DG  D C5    1 
ATOM   2146 C C6    . DG  C 3 2   ? 40.802  -7.467  76.280 1.00 71.12  ? 2   DG  D C6    1 
ATOM   2147 O O6    . DG  C 3 2   ? 39.621  -7.153  76.445 1.00 70.05  ? 2   DG  D O6    1 
ATOM   2148 N N1    . DG  C 3 2   ? 41.130  -8.798  76.091 1.00 70.84  ? 2   DG  D N1    1 
ATOM   2149 C C2    . DG  C 3 2   ? 42.400  -9.270  75.840 1.00 74.07  ? 2   DG  D C2    1 
ATOM   2150 N N2    . DG  C 3 2   ? 42.536  -10.601 75.753 1.00 76.06  ? 2   DG  D N2    1 
ATOM   2151 N N3    . DG  C 3 2   ? 43.473  -8.494  75.747 1.00 75.12  ? 2   DG  D N3    1 
ATOM   2152 C C4    . DG  C 3 2   ? 43.174  -7.182  75.930 1.00 76.15  ? 2   DG  D C4    1 
ATOM   2153 P P     . DC  C 3 3   ? 48.960  -6.184  72.941 1.00 88.61  ? 3   DC  D P     1 
ATOM   2154 O OP1   . DC  C 3 3   ? 50.397  -6.572  72.970 1.00 89.47  ? 3   DC  D OP1   1 
ATOM   2155 O OP2   . DC  C 3 3   ? 48.545  -4.879  72.359 1.00 88.57  ? 3   DC  D OP2   1 
ATOM   2156 O "O5'" . DC  C 3 3   ? 48.137  -7.334  72.203 1.00 85.85  ? 3   DC  D "O5'" 1 
ATOM   2157 C "C5'" . DC  C 3 3   ? 48.047  -8.630  72.807 1.00 83.41  ? 3   DC  D "C5'" 1 
ATOM   2158 C "C4'" . DC  C 3 3   ? 46.824  -9.378  72.319 1.00 80.89  ? 3   DC  D "C4'" 1 
ATOM   2159 O "O4'" . DC  C 3 3   ? 45.627  -8.787  72.855 1.00 78.84  ? 3   DC  D "O4'" 1 
ATOM   2160 C "C3'" . DC  C 3 3   ? 46.635  -9.406  70.799 1.00 79.93  ? 3   DC  D "C3'" 1 
ATOM   2161 O "O3'" . DC  C 3 3   ? 46.918  -10.713 70.335 1.00 80.96  ? 3   DC  D "O3'" 1 
ATOM   2162 C "C2'" . DC  C 3 3   ? 45.157  -9.014  70.588 1.00 77.73  ? 3   DC  D "C2'" 1 
ATOM   2163 C "C1'" . DC  C 3 3   ? 44.577  -9.127  71.995 1.00 76.23  ? 3   DC  D "C1'" 1 
ATOM   2164 N N1    . DC  C 3 3   ? 43.387  -8.230  72.274 1.00 72.04  ? 3   DC  D N1    1 
ATOM   2165 C C2    . DC  C 3 3   ? 42.103  -8.799  72.419 1.00 69.79  ? 3   DC  D C2    1 
ATOM   2166 O O2    . DC  C 3 3   ? 41.962  -10.028 72.307 1.00 70.78  ? 3   DC  D O2    1 
ATOM   2167 N N3    . DC  C 3 3   ? 41.049  -7.983  72.697 1.00 67.34  ? 3   DC  D N3    1 
ATOM   2168 C C4    . DC  C 3 3   ? 41.227  -6.664  72.796 1.00 67.70  ? 3   DC  D C4    1 
ATOM   2169 N N4    . DC  C 3 3   ? 40.159  -5.907  73.070 1.00 67.42  ? 3   DC  D N4    1 
ATOM   2170 C C5    . DC  C 3 3   ? 42.518  -6.061  72.643 1.00 69.55  ? 3   DC  D C5    1 
ATOM   2171 C C6    . DC  C 3 3   ? 43.558  -6.872  72.384 1.00 70.63  ? 3   DC  D C6    1 
ATOM   2172 P P     . DT  C 3 4   ? 47.193  -11.021 68.778 1.00 81.85  ? 4   DT  D P     1 
ATOM   2173 O OP1   . DT  C 3 4   ? 48.074  -12.220 68.737 1.00 82.20  ? 4   DT  D OP1   1 
ATOM   2174 O OP2   . DT  C 3 4   ? 47.598  -9.772  68.088 1.00 81.28  ? 4   DT  D OP2   1 
ATOM   2175 O "O5'" . DT  C 3 4   ? 45.742  -11.417 68.235 1.00 79.51  ? 4   DT  D "O5'" 1 
ATOM   2176 C "C5'" . DT  C 3 4   ? 44.966  -12.414 68.918 1.00 76.83  ? 4   DT  D "C5'" 1 
ATOM   2177 C "C4'" . DT  C 3 4   ? 43.531  -12.400 68.432 1.00 74.21  ? 4   DT  D "C4'" 1 
ATOM   2178 O "O4'" . DT  C 3 4   ? 42.786  -11.370 69.134 1.00 72.26  ? 4   DT  D "O4'" 1 
ATOM   2179 C "C3'" . DT  C 3 4   ? 43.364  -12.102 66.932 1.00 73.68  ? 4   DT  D "C3'" 1 
ATOM   2180 O "O3'" . DT  C 3 4   ? 42.640  -13.120 66.320 1.00 75.02  ? 4   DT  D "O3'" 1 
ATOM   2181 C "C2'" . DT  C 3 4   ? 42.586  -10.796 66.898 1.00 72.08  ? 4   DT  D "C2'" 1 
ATOM   2182 C "C1'" . DT  C 3 4   ? 41.858  -10.835 68.233 1.00 70.19  ? 4   DT  D "C1'" 1 
ATOM   2183 N N1    . DT  C 3 4   ? 41.391  -9.487  68.700 1.00 65.53  ? 4   DT  D N1    1 
ATOM   2184 C C2    . DT  C 3 4   ? 40.057  -9.318  69.030 1.00 63.56  ? 4   DT  D C2    1 
ATOM   2185 O O2    . DT  C 3 4   ? 39.261  -10.232 69.103 1.00 64.10  ? 4   DT  D O2    1 
ATOM   2186 N N3    . DT  C 3 4   ? 39.700  -8.037  69.328 1.00 62.74  ? 4   DT  D N3    1 
ATOM   2187 C C4    . DT  C 3 4   ? 40.499  -6.914  69.284 1.00 62.35  ? 4   DT  D C4    1 
ATOM   2188 O O4    . DT  C 3 4   ? 40.027  -5.847  69.620 1.00 62.33  ? 4   DT  D O4    1 
ATOM   2189 C C5    . DT  C 3 4   ? 41.876  -7.142  68.887 1.00 63.52  ? 4   DT  D C5    1 
ATOM   2190 C C7    . DT  C 3 4   ? 42.855  -6.008  68.834 1.00 64.10  ? 4   DT  D C7    1 
ATOM   2191 C C6    . DT  C 3 4   ? 42.241  -8.399  68.588 1.00 64.50  ? 4   DT  D C6    1 
ATOM   2192 P P     . DG  C 3 5   ? 42.939  -13.560 64.807 1.00 74.39  ? 5   DG  D P     1 
ATOM   2193 O OP1   . DG  C 3 5   ? 43.667  -14.844 64.879 1.00 73.21  ? 5   DG  D OP1   1 
ATOM   2194 O OP2   . DG  C 3 5   ? 43.513  -12.412 64.066 1.00 73.93  ? 5   DG  D OP2   1 
ATOM   2195 O "O5'" . DG  C 3 5   ? 41.474  -13.814 64.233 1.00 70.78  ? 5   DG  D "O5'" 1 
ATOM   2196 C "C5'" . DG  C 3 5   ? 40.526  -14.535 65.026 1.00 66.62  ? 5   DG  D "C5'" 1 
ATOM   2197 C "C4'" . DG  C 3 5   ? 39.139  -13.952 64.851 1.00 62.01  ? 5   DG  D "C4'" 1 
ATOM   2198 O "O4'" . DG  C 3 5   ? 39.026  -12.722 65.597 1.00 60.99  ? 5   DG  D "O4'" 1 
ATOM   2199 C "C3'" . DG  C 3 5   ? 38.748  -13.640 63.422 1.00 58.30  ? 5   DG  D "C3'" 1 
ATOM   2200 O "O3'" . DG  C 3 5   ? 37.571  -14.352 63.097 1.00 53.76  ? 5   DG  D "O3'" 1 
ATOM   2201 C "C2'" . DG  C 3 5   ? 38.540  -12.123 63.412 1.00 59.60  ? 5   DG  D "C2'" 1 
ATOM   2202 C "C1'" . DG  C 3 5   ? 38.280  -11.799 64.872 1.00 60.83  ? 5   DG  D "C1'" 1 
ATOM   2203 N N9    . DG  C 3 5   ? 38.749  -10.465 65.244 1.00 60.27  ? 5   DG  D N9    1 
ATOM   2204 C C8    . DG  C 3 5   ? 40.004  -9.951  65.024 1.00 60.18  ? 5   DG  D C8    1 
ATOM   2205 N N7    . DG  C 3 5   ? 40.132  -8.713  65.385 1.00 58.60  ? 5   DG  D N7    1 
ATOM   2206 C C5    . DG  C 3 5   ? 38.876  -8.371  65.856 1.00 57.42  ? 5   DG  D C5    1 
ATOM   2207 C C6    . DG  C 3 5   ? 38.427  -7.163  66.427 1.00 55.23  ? 5   DG  D C6    1 
ATOM   2208 O O6    . DG  C 3 5   ? 39.062  -6.127  66.569 1.00 56.63  ? 5   DG  D O6    1 
ATOM   2209 N N1    . DG  C 3 5   ? 37.074  -7.215  66.772 1.00 52.83  ? 5   DG  D N1    1 
ATOM   2210 C C2    . DG  C 3 5   ? 36.270  -8.325  66.623 1.00 53.15  ? 5   DG  D C2    1 
ATOM   2211 N N2    . DG  C 3 5   ? 34.995  -8.197  67.001 1.00 52.05  ? 5   DG  D N2    1 
ATOM   2212 N N3    . DG  C 3 5   ? 36.698  -9.485  66.144 1.00 55.65  ? 5   DG  D N3    1 
ATOM   2213 C C4    . DG  C 3 5   ? 38.001  -9.428  65.751 1.00 58.02  ? 5   DG  D C4    1 
ATOM   2214 P P     . DT  C 3 6   ? 36.844  -14.214 61.679 1.00 49.47  ? 6   DT  D P     1 
ATOM   2215 O OP1   . DT  C 3 6   ? 36.466  -15.587 61.227 1.00 49.87  ? 6   DT  D OP1   1 
ATOM   2216 O OP2   . DT  C 3 6   ? 37.633  -13.369 60.746 1.00 49.49  ? 6   DT  D OP2   1 
ATOM   2217 O "O5'" . DT  C 3 6   ? 35.535  -13.410 62.050 1.00 45.94  ? 6   DT  D "O5'" 1 
ATOM   2218 C "C5'" . DT  C 3 6   ? 34.643  -13.896 62.999 1.00 45.80  ? 6   DT  D "C5'" 1 
ATOM   2219 C "C4'" . DT  C 3 6   ? 33.493  -12.926 63.182 1.00 46.13  ? 6   DT  D "C4'" 1 
ATOM   2220 O "O4'" . DT  C 3 6   ? 33.989  -11.669 63.710 1.00 47.59  ? 6   DT  D "O4'" 1 
ATOM   2221 C "C3'" . DT  C 3 6   ? 32.678  -12.605 61.937 1.00 44.93  ? 6   DT  D "C3'" 1 
ATOM   2222 O "O3'" . DT  C 3 6   ? 31.308  -12.662 62.269 1.00 43.89  ? 6   DT  D "O3'" 1 
ATOM   2223 C "C2'" . DT  C 3 6   ? 33.126  -11.187 61.563 1.00 45.70  ? 6   DT  D "C2'" 1 
ATOM   2224 C "C1'" . DT  C 3 6   ? 33.514  -10.600 62.940 1.00 46.21  ? 6   DT  D "C1'" 1 
ATOM   2225 N N1    . DT  C 3 6   ? 34.598  -9.582  62.888 1.00 47.85  ? 6   DT  D N1    1 
ATOM   2226 C C2    . DT  C 3 6   ? 34.395  -8.323  63.475 1.00 47.73  ? 6   DT  D C2    1 
ATOM   2227 O O2    . DT  C 3 6   ? 33.333  -7.967  63.953 1.00 45.96  ? 6   DT  D O2    1 
ATOM   2228 N N3    . DT  C 3 6   ? 35.490  -7.491  63.438 1.00 48.60  ? 6   DT  D N3    1 
ATOM   2229 C C4    . DT  C 3 6   ? 36.736  -7.774  62.907 1.00 51.05  ? 6   DT  D C4    1 
ATOM   2230 O O4    . DT  C 3 6   ? 37.617  -6.938  62.963 1.00 51.75  ? 6   DT  D O4    1 
ATOM   2231 C C5    . DT  C 3 6   ? 36.882  -9.098  62.316 1.00 52.85  ? 6   DT  D C5    1 
ATOM   2232 C C7    . DT  C 3 6   ? 38.173  -9.491  61.661 1.00 55.35  ? 6   DT  D C7    1 
ATOM   2233 C C6    . DT  C 3 6   ? 35.836  -9.938  62.377 1.00 50.10  ? 6   DT  D C6    1 
ATOM   2234 P P     . DC  C 3 7   ? 30.162  -12.568 61.157 1.00 44.39  ? 7   DC  D P     1 
ATOM   2235 O OP1   . DC  C 3 7   ? 28.992  -13.322 61.651 1.00 43.95  ? 7   DC  D OP1   1 
ATOM   2236 O OP2   . DC  C 3 7   ? 30.753  -12.806 59.845 1.00 44.48  ? 7   DC  D OP2   1 
ATOM   2237 O "O5'" . DC  C 3 7   ? 29.778  -10.989 61.198 1.00 44.87  ? 7   DC  D "O5'" 1 
ATOM   2238 C "C5'" . DC  C 3 7   ? 29.191  -10.497 62.388 1.00 47.44  ? 7   DC  D "C5'" 1 
ATOM   2239 C "C4'" . DC  C 3 7   ? 29.085  -8.990  62.341 1.00 50.13  ? 7   DC  D "C4'" 1 
ATOM   2240 O "O4'" . DC  C 3 7   ? 30.406  -8.422  62.231 1.00 49.87  ? 7   DC  D "O4'" 1 
ATOM   2241 C "C3'" . DC  C 3 7   ? 28.272  -8.448  61.168 1.00 51.42  ? 7   DC  D "C3'" 1 
ATOM   2242 O "O3'" . DC  C 3 7   ? 27.204  -7.671  61.671 1.00 54.66  ? 7   DC  D "O3'" 1 
ATOM   2243 C "C2'" . DC  C 3 7   ? 29.281  -7.634  60.340 1.00 49.77  ? 7   DC  D "C2'" 1 
ATOM   2244 C "C1'" . DC  C 3 7   ? 30.363  -7.324  61.358 1.00 48.91  ? 7   DC  D "C1'" 1 
ATOM   2245 N N1    . DC  C 3 7   ? 31.758  -7.110  60.815 1.00 48.08  ? 7   DC  D N1    1 
ATOM   2246 C C2    . DC  C 3 7   ? 32.476  -5.958  61.212 1.00 46.82  ? 7   DC  D C2    1 
ATOM   2247 O O2    . DC  C 3 7   ? 31.903  -5.087  61.873 1.00 48.12  ? 7   DC  D O2    1 
ATOM   2248 N N3    . DC  C 3 7   ? 33.786  -5.840  60.859 1.00 45.18  ? 7   DC  D N3    1 
ATOM   2249 C C4    . DC  C 3 7   ? 34.388  -6.803  60.157 1.00 45.76  ? 7   DC  D C4    1 
ATOM   2250 N N4    . DC  C 3 7   ? 35.684  -6.643  59.879 1.00 45.73  ? 7   DC  D N4    1 
ATOM   2251 C C5    . DC  C 3 7   ? 33.694  -8.002  59.763 1.00 46.79  ? 7   DC  D C5    1 
ATOM   2252 C C6    . DC  C 3 7   ? 32.394  -8.110  60.106 1.00 47.32  ? 7   DC  D C6    1 
ATOM   2253 P P     . DC  C 3 8   ? 25.907  -7.338  60.778 1.00 56.81  ? 8   DC  D P     1 
ATOM   2254 O OP1   . DC  C 3 8   ? 24.796  -7.046  61.722 1.00 58.28  ? 8   DC  D OP1   1 
ATOM   2255 O OP2   . DC  C 3 8   ? 25.746  -8.365  59.737 1.00 56.41  ? 8   DC  D OP2   1 
ATOM   2256 O "O5'" . DC  C 3 8   ? 26.328  -5.966  60.052 1.00 56.90  ? 8   DC  D "O5'" 1 
ATOM   2257 C "C5'" . DC  C 3 8   ? 26.739  -4.820  60.835 1.00 56.68  ? 8   DC  D "C5'" 1 
ATOM   2258 C "C4'" . DC  C 3 8   ? 27.380  -3.763  59.951 1.00 56.92  ? 8   DC  D "C4'" 1 
ATOM   2259 O "O4'" . DC  C 3 8   ? 28.793  -4.060  59.761 1.00 55.02  ? 8   DC  D "O4'" 1 
ATOM   2260 C "C3'" . DC  C 3 8   ? 26.777  -3.643  58.536 1.00 57.58  ? 8   DC  D "C3'" 1 
ATOM   2261 O "O3'" . DC  C 3 8   ? 26.690  -2.284  58.166 1.00 60.72  ? 8   DC  D "O3'" 1 
ATOM   2262 C "C2'" . DC  C 3 8   ? 27.821  -4.339  57.675 1.00 55.83  ? 8   DC  D "C2'" 1 
ATOM   2263 C "C1'" . DC  C 3 8   ? 29.088  -3.900  58.403 1.00 53.54  ? 8   DC  D "C1'" 1 
ATOM   2264 N N1    . DC  C 3 8   ? 30.323  -4.680  58.039 1.00 49.68  ? 8   DC  D N1    1 
ATOM   2265 C C2    . DC  C 3 8   ? 31.575  -4.048  58.110 1.00 47.10  ? 8   DC  D C2    1 
ATOM   2266 O O2    . DC  C 3 8   ? 31.657  -2.915  58.596 1.00 45.99  ? 8   DC  D O2    1 
ATOM   2267 N N3    . DC  C 3 8   ? 32.672  -4.721  57.669 1.00 45.56  ? 8   DC  D N3    1 
ATOM   2268 C C4    . DC  C 3 8   ? 32.557  -5.938  57.162 1.00 45.76  ? 8   DC  D C4    1 
ATOM   2269 N N4    . DC  C 3 8   ? 33.675  -6.563  56.787 1.00 45.48  ? 8   DC  D N4    1 
ATOM   2270 C C5    . DC  C 3 8   ? 31.286  -6.586  57.029 1.00 47.77  ? 8   DC  D C5    1 
ATOM   2271 C C6    . DC  C 3 8   ? 30.205  -5.908  57.442 1.00 48.51  ? 8   DC  D C6    1 
ATOM   2272 P P     . DA  C 3 9   ? 25.319  -1.467  58.279 1.00 60.18  ? 9   DA  D P     1 
ATOM   2273 O OP1   . DA  C 3 9   ? 24.796  -1.638  59.658 1.00 61.68  ? 9   DA  D OP1   1 
ATOM   2274 O OP2   . DA  C 3 9   ? 24.482  -1.816  57.126 1.00 59.55  ? 9   DA  D OP2   1 
ATOM   2275 O "O5'" . DA  C 3 9   ? 25.848  0.032   58.114 1.00 57.23  ? 9   DA  D "O5'" 1 
ATOM   2276 C "C5'" . DA  C 3 9   ? 26.679  0.625   59.138 1.00 52.93  ? 9   DA  D "C5'" 1 
ATOM   2277 C "C4'" . DA  C 3 9   ? 27.779  1.499   58.534 1.00 49.71  ? 9   DA  D "C4'" 1 
ATOM   2278 O "O4'" . DA  C 3 9   ? 28.912  0.700   58.100 1.00 48.16  ? 9   DA  D "O4'" 1 
ATOM   2279 C "C3'" . DA  C 3 9   ? 27.385  2.378   57.339 1.00 48.15  ? 9   DA  D "C3'" 1 
ATOM   2280 O "O3'" . DA  C 3 9   ? 27.912  3.674   57.560 1.00 49.16  ? 9   DA  D "O3'" 1 
ATOM   2281 C "C2'" . DA  C 3 9   ? 28.045  1.682   56.136 1.00 45.23  ? 9   DA  D "C2'" 1 
ATOM   2282 C "C1'" . DA  C 3 9   ? 29.284  1.041   56.773 1.00 45.34  ? 9   DA  D "C1'" 1 
ATOM   2283 N N9    . DA  C 3 9   ? 29.738  -0.187  56.106 1.00 42.98  ? 9   DA  D N9    1 
ATOM   2284 C C8    . DA  C 3 9   ? 28.972  -1.271  55.795 1.00 43.09  ? 9   DA  D C8    1 
ATOM   2285 N N7    . DA  C 3 9   ? 29.633  -2.241  55.213 1.00 43.86  ? 9   DA  D N7    1 
ATOM   2286 C C5    . DA  C 3 9   ? 30.955  -1.864  55.348 1.00 42.66  ? 9   DA  D C5    1 
ATOM   2287 C C6    . DA  C 3 9   ? 32.168  -2.483  54.948 1.00 41.35  ? 9   DA  D C6    1 
ATOM   2288 N N6    . DA  C 3 9   ? 32.229  -3.714  54.430 1.00 40.77  ? 9   DA  D N6    1 
ATOM   2289 N N1    . DA  C 3 9   ? 33.315  -1.786  55.114 1.00 40.09  ? 9   DA  D N1    1 
ATOM   2290 C C2    . DA  C 3 9   ? 33.242  -0.531  55.597 1.00 40.44  ? 9   DA  D C2    1 
ATOM   2291 N N3    . DA  C 3 9   ? 32.164  0.155   55.996 1.00 40.65  ? 9   DA  D N3    1 
ATOM   2292 C C4    . DA  C 3 9   ? 31.039  -0.565  55.826 1.00 41.67  ? 9   DA  D C4    1 
ATOM   2293 P P     . DT  C 3 10  ? 27.551  4.921   56.603 1.00 48.61  ? 10  DT  D P     1 
ATOM   2294 O OP1   . DT  C 3 10  ? 27.687  6.103   57.438 1.00 48.66  ? 10  DT  D OP1   1 
ATOM   2295 O OP2   . DT  C 3 10  ? 26.287  4.643   55.857 1.00 48.46  ? 10  DT  D OP2   1 
ATOM   2296 O "O5'" . DT  C 3 10  ? 28.718  4.907   55.504 1.00 47.10  ? 10  DT  D "O5'" 1 
ATOM   2297 C "C5'" . DT  C 3 10  ? 30.080  5.046   55.922 1.00 45.32  ? 10  DT  D "C5'" 1 
ATOM   2298 C "C4'" . DT  C 3 10  ? 31.000  4.635   54.793 1.00 44.45  ? 10  DT  D "C4'" 1 
ATOM   2299 O "O4'" . DT  C 3 10  ? 30.964  3.205   54.586 1.00 43.58  ? 10  DT  D "O4'" 1 
ATOM   2300 C "C3'" . DT  C 3 10  ? 30.663  5.249   53.431 1.00 44.58  ? 10  DT  D "C3'" 1 
ATOM   2301 O "O3'" . DT  C 3 10  ? 31.534  6.322   53.213 1.00 46.70  ? 10  DT  D "O3'" 1 
ATOM   2302 C "C2'" . DT  C 3 10  ? 30.885  4.094   52.429 1.00 42.26  ? 10  DT  D "C2'" 1 
ATOM   2303 C "C1'" . DT  C 3 10  ? 31.489  2.994   53.315 1.00 41.98  ? 10  DT  D "C1'" 1 
ATOM   2304 N N1    . DT  C 3 10  ? 31.193  1.606   52.883 1.00 40.45  ? 10  DT  D N1    1 
ATOM   2305 C C2    . DT  C 3 10  ? 32.252  0.786   52.565 1.00 39.90  ? 10  DT  D C2    1 
ATOM   2306 O O2    . DT  C 3 10  ? 33.417  1.141   52.657 1.00 40.71  ? 10  DT  D O2    1 
ATOM   2307 N N3    . DT  C 3 10  ? 31.905  -0.503  52.233 1.00 38.72  ? 10  DT  D N3    1 
ATOM   2308 C C4    . DT  C 3 10  ? 30.627  -1.020  52.117 1.00 39.91  ? 10  DT  D C4    1 
ATOM   2309 O O4    . DT  C 3 10  ? 30.481  -2.189  51.790 1.00 40.18  ? 10  DT  D O4    1 
ATOM   2310 C C5    . DT  C 3 10  ? 29.545  -0.087  52.404 1.00 41.01  ? 10  DT  D C5    1 
ATOM   2311 C C7    . DT  C 3 10  ? 28.114  -0.542  52.326 1.00 41.67  ? 10  DT  D C7    1 
ATOM   2312 C C6    . DT  C 3 10  ? 29.876  1.178   52.746 1.00 41.01  ? 10  DT  D C6    1 
ATOM   2313 P P     . DC  C 3 11  ? 31.458  7.249   51.897 1.00 48.23  ? 11  DC  D P     1 
ATOM   2314 O OP1   . DC  C 3 11  ? 31.835  8.601   52.347 1.00 50.09  ? 11  DC  D OP1   1 
ATOM   2315 O OP2   . DC  C 3 11  ? 30.182  7.043   51.175 1.00 45.49  ? 11  DC  D OP2   1 
ATOM   2316 O "O5'" . DC  C 3 11  ? 32.639  6.667   51.003 1.00 50.26  ? 11  DC  D "O5'" 1 
ATOM   2317 C "C5'" . DC  C 3 11  ? 33.958  6.516   51.576 1.00 51.67  ? 11  DC  D "C5'" 1 
ATOM   2318 C "C4'" . DC  C 3 11  ? 34.846  5.702   50.654 1.00 53.08  ? 11  DC  D "C4'" 1 
ATOM   2319 O "O4'" . DC  C 3 11  ? 34.408  4.324   50.658 1.00 52.38  ? 11  DC  D "O4'" 1 
ATOM   2320 C "C3'" . DC  C 3 11  ? 34.836  6.173   49.202 1.00 55.44  ? 11  DC  D "C3'" 1 
ATOM   2321 O "O3'" . DC  C 3 11  ? 36.138  6.609   48.833 1.00 58.40  ? 11  DC  D "O3'" 1 
ATOM   2322 C "C2'" . DC  C 3 11  ? 34.354  4.972   48.380 1.00 53.79  ? 11  DC  D "C2'" 1 
ATOM   2323 C "C1'" . DC  C 3 11  ? 34.461  3.792   49.352 1.00 50.50  ? 11  DC  D "C1'" 1 
ATOM   2324 N N1    . DC  C 3 11  ? 33.331  2.782   49.220 1.00 45.59  ? 11  DC  D N1    1 
ATOM   2325 C C2    . DC  C 3 11  ? 33.613  1.435   48.898 1.00 42.12  ? 11  DC  D C2    1 
ATOM   2326 O O2    . DC  C 3 11  ? 34.789  1.066   48.792 1.00 42.57  ? 11  DC  D O2    1 
ATOM   2327 N N3    . DC  C 3 11  ? 32.584  0.548   48.857 1.00 39.33  ? 11  DC  D N3    1 
ATOM   2328 C C4    . DC  C 3 11  ? 31.325  0.964   49.014 1.00 39.91  ? 11  DC  D C4    1 
ATOM   2329 N N4    . DC  C 3 11  ? 30.359  0.051   48.979 1.00 40.12  ? 11  DC  D N4    1 
ATOM   2330 C C5    . DC  C 3 11  ? 31.010  2.333   49.300 1.00 42.31  ? 11  DC  D C5    1 
ATOM   2331 C C6    . DC  C 3 11  ? 32.027  3.200   49.357 1.00 43.66  ? 11  DC  D C6    1 
ATOM   2332 P P     . DG  C 3 12  ? 36.381  7.488   47.504 1.00 59.36  ? 12  DG  D P     1 
ATOM   2333 O OP1   . DG  C 3 12  ? 37.593  8.300   47.758 1.00 61.22  ? 12  DG  D OP1   1 
ATOM   2334 O OP2   . DG  C 3 12  ? 35.108  8.148   47.119 1.00 58.67  ? 12  DG  D OP2   1 
ATOM   2335 O "O5'" . DG  C 3 12  ? 36.715  6.364   46.401 1.00 57.40  ? 12  DG  D "O5'" 1 
ATOM   2336 C "C5'" . DG  C 3 12  ? 37.840  5.486   46.593 1.00 55.65  ? 12  DG  D "C5'" 1 
ATOM   2337 C "C4'" . DG  C 3 12  ? 37.935  4.428   45.495 1.00 54.78  ? 12  DG  D "C4'" 1 
ATOM   2338 O "O4'" . DG  C 3 12  ? 36.935  3.391   45.682 1.00 52.47  ? 12  DG  D "O4'" 1 
ATOM   2339 C "C3'" . DG  C 3 12  ? 37.800  4.920   44.063 1.00 56.07  ? 12  DG  D "C3'" 1 
ATOM   2340 O "O3'" . DG  C 3 12  ? 38.838  4.315   43.288 1.00 59.24  ? 12  DG  D "O3'" 1 
ATOM   2341 C "C2'" . DG  C 3 12  ? 36.396  4.441   43.653 1.00 53.54  ? 12  DG  D "C2'" 1 
ATOM   2342 C "C1'" . DG  C 3 12  ? 36.239  3.167   44.484 1.00 51.69  ? 12  DG  D "C1'" 1 
ATOM   2343 N N9    . DG  C 3 12  ? 34.857  2.840   44.835 1.00 47.73  ? 12  DG  D N9    1 
ATOM   2344 C C8    . DG  C 3 12  ? 33.899  3.705   45.317 1.00 46.97  ? 12  DG  D C8    1 
ATOM   2345 N N7    . DG  C 3 12  ? 32.764  3.127   45.579 1.00 45.36  ? 12  DG  D N7    1 
ATOM   2346 C C5    . DG  C 3 12  ? 32.986  1.790   45.286 1.00 42.11  ? 12  DG  D C5    1 
ATOM   2347 C C6    . DG  C 3 12  ? 32.107  0.692   45.361 1.00 39.78  ? 12  DG  D C6    1 
ATOM   2348 O O6    . DG  C 3 12  ? 30.942  0.685   45.755 1.00 40.23  ? 12  DG  D O6    1 
ATOM   2349 N N1    . DG  C 3 12  ? 32.697  -0.490  44.902 1.00 39.06  ? 12  DG  D N1    1 
ATOM   2350 C C2    . DG  C 3 12  ? 33.991  -0.585  44.432 1.00 40.24  ? 12  DG  D C2    1 
ATOM   2351 N N2    . DG  C 3 12  ? 34.394  -1.798  44.038 1.00 41.15  ? 12  DG  D N2    1 
ATOM   2352 N N3    . DG  C 3 12  ? 34.844  0.441   44.400 1.00 41.56  ? 12  DG  D N3    1 
ATOM   2353 C C4    . DG  C 3 12  ? 34.268  1.595   44.819 1.00 43.30  ? 12  DG  D C4    1 
ATOM   2354 P P     . DC  C 3 13  ? 39.108  4.704   41.755 1.00 62.16  ? 13  DC  D P     1 
ATOM   2355 O OP1   . DC  C 3 13  ? 40.581  4.756   41.579 1.00 63.83  ? 13  DC  D OP1   1 
ATOM   2356 O OP2   . DC  C 3 13  ? 38.271  5.878   41.371 1.00 62.25  ? 13  DC  D OP2   1 
ATOM   2357 O "O5'" . DC  C 3 13  ? 38.528  3.428   40.978 1.00 60.11  ? 13  DC  D "O5'" 1 
ATOM   2358 C "C5'" . DC  C 3 13  ? 38.960  2.119   41.335 1.00 57.79  ? 13  DC  D "C5'" 1 
ATOM   2359 C "C4'" . DC  C 3 13  ? 38.096  1.067   40.667 1.00 55.66  ? 13  DC  D "C4'" 1 
ATOM   2360 O "O4'" . DC  C 3 13  ? 36.801  1.012   41.305 1.00 53.45  ? 13  DC  D "O4'" 1 
ATOM   2361 C "C3'" . DC  C 3 13  ? 37.841  1.277   39.177 1.00 55.72  ? 13  DC  D "C3'" 1 
ATOM   2362 O "O3'" . DC  C 3 13  ? 38.229  0.102   38.488 1.00 57.70  ? 13  DC  D "O3'" 1 
ATOM   2363 C "C2'" . DC  C 3 13  ? 36.327  1.534   39.084 1.00 53.51  ? 13  DC  D "C2'" 1 
ATOM   2364 C "C1'" . DC  C 3 13  ? 35.799  0.847   40.340 1.00 51.02  ? 13  DC  D "C1'" 1 
ATOM   2365 N N1    . DC  C 3 13  ? 34.502  1.431   40.904 1.00 46.00  ? 13  DC  D N1    1 
ATOM   2366 C C2    . DC  C 3 13  ? 33.411  0.576   41.189 1.00 43.11  ? 13  DC  D C2    1 
ATOM   2367 O O2    . DC  C 3 13  ? 33.472  -0.616  40.867 1.00 43.97  ? 13  DC  D O2    1 
ATOM   2368 N N3    . DC  C 3 13  ? 32.279  1.108   41.724 1.00 41.29  ? 13  DC  D N3    1 
ATOM   2369 C C4    . DC  C 3 13  ? 32.221  2.413   42.014 1.00 41.64  ? 13  DC  D C4    1 
ATOM   2370 N N4    . DC  C 3 13  ? 31.112  2.877   42.608 1.00 41.05  ? 13  DC  D N4    1 
ATOM   2371 C C5    . DC  C 3 13  ? 33.321  3.296   41.754 1.00 44.33  ? 13  DC  D C5    1 
ATOM   2372 C C6    . DC  C 3 13  ? 34.426  2.767   41.203 1.00 45.13  ? 13  DC  D C6    1 
ATOM   2373 P P     . DT  C 3 14  ? 38.394  0.077   36.894 1.00 58.69  ? 14  DT  D P     1 
ATOM   2374 O OP1   . DT  C 3 14  ? 39.563  -0.797  36.601 1.00 59.99  ? 14  DT  D OP1   1 
ATOM   2375 O OP2   . DT  C 3 14  ? 38.352  1.468   36.372 1.00 58.66  ? 14  DT  D OP2   1 
ATOM   2376 O "O5'" . DT  C 3 14  ? 37.049  -0.657  36.429 1.00 54.99  ? 14  DT  D "O5'" 1 
ATOM   2377 C "C5'" . DT  C 3 14  ? 36.783  -1.962  36.878 1.00 51.41  ? 14  DT  D "C5'" 1 
ATOM   2378 C "C4'" . DT  C 3 14  ? 35.343  -2.345  36.631 1.00 48.42  ? 14  DT  D "C4'" 1 
ATOM   2379 O "O4'" . DT  C 3 14  ? 34.458  -1.546  37.442 1.00 45.94  ? 14  DT  D "O4'" 1 
ATOM   2380 C "C3'" . DT  C 3 14  ? 34.858  -2.215  35.189 1.00 48.04  ? 14  DT  D "C3'" 1 
ATOM   2381 O "O3'" . DT  C 3 14  ? 34.484  -3.491  34.741 1.00 49.74  ? 14  DT  D "O3'" 1 
ATOM   2382 C "C2'" . DT  C 3 14  ? 33.659  -1.252  35.271 1.00 46.16  ? 14  DT  D "C2'" 1 
ATOM   2383 C "C1'" . DT  C 3 14  ? 33.249  -1.359  36.737 1.00 44.25  ? 14  DT  D "C1'" 1 
ATOM   2384 N N1    . DT  C 3 14  ? 32.577  -0.113  37.292 1.00 40.35  ? 14  DT  D N1    1 
ATOM   2385 C C2    . DT  C 3 14  ? 31.336  -0.212  37.916 1.00 37.23  ? 14  DT  D C2    1 
ATOM   2386 O O2    . DT  C 3 14  ? 30.695  -1.247  37.997 1.00 37.45  ? 14  DT  D O2    1 
ATOM   2387 N N3    . DT  C 3 14  ? 30.877  0.958   38.451 1.00 36.14  ? 14  DT  D N3    1 
ATOM   2388 C C4    . DT  C 3 14  ? 31.511  2.184   38.468 1.00 38.12  ? 14  DT  D C4    1 
ATOM   2389 O O4    . DT  C 3 14  ? 30.960  3.144   39.003 1.00 39.47  ? 14  DT  D O4    1 
ATOM   2390 C C5    . DT  C 3 14  ? 32.798  2.228   37.804 1.00 40.15  ? 14  DT  D C5    1 
ATOM   2391 C C7    . DT  C 3 14  ? 33.550  3.525   37.687 1.00 41.31  ? 14  DT  D C7    1 
ATOM   2392 C C6    . DT  C 3 14  ? 33.272  1.088   37.275 1.00 40.57  ? 14  DT  D C6    1 
ATOM   2393 P P     . DC  C 3 15  ? 34.190  -3.785  33.198 1.00 51.26  ? 15  DC  D P     1 
ATOM   2394 O OP1   . DC  C 3 15  ? 34.487  -5.215  32.958 1.00 53.03  ? 15  DC  D OP1   1 
ATOM   2395 O OP2   . DC  C 3 15  ? 34.849  -2.743  32.372 1.00 52.16  ? 15  DC  D OP2   1 
ATOM   2396 O "O5'" . DC  C 3 15  ? 32.612  -3.555  33.106 1.00 48.57  ? 15  DC  D "O5'" 1 
ATOM   2397 C "C5'" . DC  C 3 15  ? 31.749  -4.283  33.957 1.00 46.04  ? 15  DC  D "C5'" 1 
ATOM   2398 C "C4'" . DC  C 3 15  ? 30.380  -3.652  34.020 1.00 43.61  ? 15  DC  D "C4'" 1 
ATOM   2399 O "O4'" . DC  C 3 15  ? 30.431  -2.372  34.656 1.00 43.75  ? 15  DC  D "O4'" 1 
ATOM   2400 C "C3'" . DC  C 3 15  ? 29.711  -3.423  32.682 1.00 43.25  ? 15  DC  D "C3'" 1 
ATOM   2401 O "O3'" . DC  C 3 15  ? 28.870  -4.551  32.441 1.00 41.42  ? 15  DC  D "O3'" 1 
ATOM   2402 C "C2'" . DC  C 3 15  ? 28.931  -2.095  32.867 1.00 43.38  ? 15  DC  D "C2'" 1 
ATOM   2403 C "C1'" . DC  C 3 15  ? 29.250  -1.685  34.308 1.00 43.16  ? 15  DC  D "C1'" 1 
ATOM   2404 N N1    . DC  C 3 15  ? 29.464  -0.187  34.558 1.00 41.53  ? 15  DC  D N1    1 
ATOM   2405 C C2    . DC  C 3 15  ? 28.587  0.518   35.437 1.00 39.96  ? 15  DC  D C2    1 
ATOM   2406 O O2    . DC  C 3 15  ? 27.566  -0.038  35.863 1.00 40.36  ? 15  DC  D O2    1 
ATOM   2407 N N3    . DC  C 3 15  ? 28.856  1.813   35.731 1.00 38.53  ? 15  DC  D N3    1 
ATOM   2408 C C4    . DC  C 3 15  ? 29.972  2.398   35.262 1.00 38.56  ? 15  DC  D C4    1 
ATOM   2409 N N4    . DC  C 3 15  ? 30.221  3.646   35.641 1.00 37.96  ? 15  DC  D N4    1 
ATOM   2410 C C5    . DC  C 3 15  ? 30.892  1.704   34.404 1.00 39.56  ? 15  DC  D C5    1 
ATOM   2411 C C6    . DC  C 3 15  ? 30.604  0.433   34.080 1.00 40.44  ? 15  DC  D C6    1 
ATOM   2412 P P     . DA  C 3 16  ? 28.024  -4.712  31.099 1.00 39.88  ? 16  DA  D P     1 
ATOM   2413 O OP1   . DA  C 3 16  ? 27.716  -6.155  30.931 1.00 41.89  ? 16  DA  D OP1   1 
ATOM   2414 O OP2   . DA  C 3 16  ? 28.704  -3.968  29.999 1.00 40.09  ? 16  DA  D OP2   1 
ATOM   2415 O "O5'" . DA  C 3 16  ? 26.684  -3.927  31.456 1.00 35.95  ? 16  DA  D "O5'" 1 
ATOM   2416 C "C5'" . DA  C 3 16  ? 25.873  -4.333  32.553 1.00 34.93  ? 16  DA  D "C5'" 1 
ATOM   2417 C "C4'" . DA  C 3 16  ? 24.650  -3.443  32.653 1.00 32.61  ? 16  DA  D "C4'" 1 
ATOM   2418 O "O4'" . DA  C 3 16  ? 25.031  -2.090  33.036 1.00 32.50  ? 16  DA  D "O4'" 1 
ATOM   2419 C "C3'" . DA  C 3 16  ? 23.833  -3.308  31.357 1.00 30.68  ? 16  DA  D "C3'" 1 
ATOM   2420 O "O3'" . DA  C 3 16  ? 22.479  -3.222  31.715 1.00 31.27  ? 16  DA  D "O3'" 1 
ATOM   2421 C "C2'" . DA  C 3 16  ? 24.325  -1.977  30.774 1.00 30.23  ? 16  DA  D "C2'" 1 
ATOM   2422 C "C1'" . DA  C 3 16  ? 24.521  -1.167  32.067 1.00 31.41  ? 16  DA  D "C1'" 1 
ATOM   2423 N N9    . DA  C 3 16  ? 25.460  -0.058  31.975 1.00 32.36  ? 16  DA  D N9    1 
ATOM   2424 C C8    . DA  C 3 16  ? 26.647  -0.034  31.296 1.00 33.05  ? 16  DA  D C8    1 
ATOM   2425 N N7    . DA  C 3 16  ? 27.367  1.039   31.528 1.00 34.01  ? 16  DA  D N7    1 
ATOM   2426 C C5    . DA  C 3 16  ? 26.628  1.751   32.463 1.00 33.93  ? 16  DA  D C5    1 
ATOM   2427 C C6    . DA  C 3 16  ? 26.855  2.986   33.139 1.00 34.39  ? 16  DA  D C6    1 
ATOM   2428 N N6    . DA  C 3 16  ? 27.936  3.745   32.948 1.00 35.91  ? 16  DA  D N6    1 
ATOM   2429 N N1    . DA  C 3 16  ? 25.878  3.448   33.955 1.00 33.21  ? 16  DA  D N1    1 
ATOM   2430 C C2    . DA  C 3 16  ? 24.824  2.651   34.209 1.00 33.01  ? 16  DA  D C2    1 
ATOM   2431 N N3    . DA  C 3 16  ? 24.508  1.466   33.633 1.00 34.13  ? 16  DA  D N3    1 
ATOM   2432 C C4    . DA  C 3 16  ? 25.470  1.066   32.783 1.00 32.87  ? 16  DA  D C4    1 
HETATM 2433 F F24   . 1FC C 3 17  ? 18.957  -2.636  27.060 1.00 37.47  ? 17  1FC D F24   1 
HETATM 2434 C "C2'" . 1FC C 3 17  ? 19.882  -3.152  26.150 1.00 30.69  ? 17  1FC D "C2'" 1 
HETATM 2435 C "C3'" . 1FC C 3 17  ? 21.316  -2.918  26.640 1.00 31.39  ? 17  1FC D "C3'" 1 
HETATM 2436 O "O3'" . 1FC C 3 17  ? 22.159  -2.470  25.584 1.00 32.26  ? 17  1FC D "O3'" 1 
HETATM 2437 C "C4'" . 1FC C 3 17  ? 21.805  -4.282  27.162 1.00 30.23  ? 17  1FC D "C4'" 1 
HETATM 2438 C "C5'" . 1FC C 3 17  ? 22.396  -4.259  28.556 1.00 30.77  ? 17  1FC D "C5'" 1 
HETATM 2439 O "O5'" . 1FC C 3 17  ? 21.508  -3.554  29.461 1.00 30.68  ? 17  1FC D "O5'" 1 
HETATM 2440 P P     . 1FC C 3 17  ? 21.343  -4.035  30.982 1.00 31.39  ? 17  1FC D P     1 
HETATM 2441 O OP2   . 1FC C 3 17  ? 21.650  -5.474  31.070 1.00 34.46  ? 17  1FC D OP2   1 
HETATM 2442 O OP1   . 1FC C 3 17  ? 20.064  -3.516  31.519 1.00 28.35  ? 17  1FC D OP1   1 
HETATM 2443 C "C1'" . 1FC C 3 17  ? 19.773  -4.667  26.196 1.00 28.81  ? 17  1FC D "C1'" 1 
HETATM 2444 O "O4'" . 1FC C 3 17  ? 20.651  -5.111  27.206 1.00 29.18  ? 17  1FC D "O4'" 1 
HETATM 2445 N N1    . 1FC C 3 17  ? 18.441  -5.217  26.466 1.00 27.79  ? 17  1FC D N1    1 
HETATM 2446 C C6    . 1FC C 3 17  ? 18.150  -5.907  27.629 1.00 26.14  ? 17  1FC D C6    1 
HETATM 2447 C C5    . 1FC C 3 17  ? 16.972  -6.584  27.773 1.00 28.90  ? 17  1FC D C5    1 
HETATM 2448 C C21   . 1FC C 3 17  ? 16.741  -7.319  29.060 1.00 30.00  ? 17  1FC D C21   1 
HETATM 2449 O O23   . 1FC C 3 17  ? 17.560  -7.149  29.994 1.00 27.72  ? 17  1FC D O23   1 
HETATM 2450 O O22   . 1FC C 3 17  ? 15.706  -8.009  29.136 1.00 28.71  ? 17  1FC D O22   1 
HETATM 2451 C C4    . 1FC C 3 17  ? 16.084  -6.585  26.630 1.00 29.19  ? 17  1FC D C4    1 
HETATM 2452 N N4    . 1FC C 3 17  ? 14.924  -7.255  26.650 1.00 32.20  ? 17  1FC D N4    1 
HETATM 2453 N N3    . 1FC C 3 17  ? 16.322  -5.790  25.579 1.00 29.59  ? 17  1FC D N3    1 
HETATM 2454 C C2    . 1FC C 3 17  ? 17.483  -5.096  25.465 1.00 29.00  ? 17  1FC D C2    1 
HETATM 2455 O O2    . 1FC C 3 17  ? 17.738  -4.404  24.495 1.00 29.19  ? 17  1FC D O2    1 
ATOM   2456 P P     . DG  C 3 18  ? 23.089  -1.195  25.876 1.00 31.54  ? 18  DG  D P     1 
ATOM   2457 O OP1   . DG  C 3 18  ? 24.115  -1.178  24.821 1.00 32.43  ? 18  DG  D OP1   1 
ATOM   2458 O OP2   . DG  C 3 18  ? 23.474  -1.178  27.299 1.00 30.07  ? 18  DG  D OP2   1 
ATOM   2459 O "O5'" . DG  C 3 18  ? 22.065  0.013   25.660 1.00 30.61  ? 18  DG  D "O5'" 1 
ATOM   2460 C "C5'" . DG  C 3 18  ? 21.607  0.330   24.367 1.00 31.31  ? 18  DG  D "C5'" 1 
ATOM   2461 C "C4'" . DG  C 3 18  ? 21.172  1.784   24.337 1.00 31.61  ? 18  DG  D "C4'" 1 
ATOM   2462 O "O4'" . DG  C 3 18  ? 22.252  2.642   24.794 1.00 32.17  ? 18  DG  D "O4'" 1 
ATOM   2463 C "C3'" . DG  C 3 18  ? 20.777  2.315   22.949 1.00 31.17  ? 18  DG  D "C3'" 1 
ATOM   2464 O "O3'" . DG  C 3 18  ? 19.811  3.353   23.125 1.00 31.83  ? 18  DG  D "O3'" 1 
ATOM   2465 C "C2'" . DG  C 3 18  ? 22.102  2.855   22.407 1.00 32.25  ? 18  DG  D "C2'" 1 
ATOM   2466 C "C1'" . DG  C 3 18  ? 22.740  3.429   23.684 1.00 33.05  ? 18  DG  D "C1'" 1 
ATOM   2467 N N9    . DG  C 3 18  ? 24.206  3.377   23.695 1.00 36.18  ? 18  DG  D N9    1 
ATOM   2468 C C8    . DG  C 3 18  ? 25.003  2.266   23.478 1.00 37.69  ? 18  DG  D C8    1 
ATOM   2469 N N7    . DG  C 3 18  ? 26.267  2.473   23.731 1.00 38.77  ? 18  DG  D N7    1 
ATOM   2470 C C5    . DG  C 3 18  ? 26.313  3.789   24.182 1.00 38.95  ? 18  DG  D C5    1 
ATOM   2471 C C6    . DG  C 3 18  ? 27.408  4.554   24.671 1.00 39.79  ? 18  DG  D C6    1 
ATOM   2472 O O6    . DG  C 3 18  ? 28.600  4.227   24.744 1.00 41.05  ? 18  DG  D O6    1 
ATOM   2473 N N1    . DG  C 3 18  ? 27.007  5.820   25.105 1.00 39.04  ? 18  DG  D N1    1 
ATOM   2474 C C2    . DG  C 3 18  ? 25.716  6.304   25.024 1.00 38.68  ? 18  DG  D C2    1 
ATOM   2475 N N2    . DG  C 3 18  ? 25.516  7.558   25.470 1.00 37.20  ? 18  DG  D N2    1 
ATOM   2476 N N3    . DG  C 3 18  ? 24.681  5.592   24.571 1.00 36.22  ? 18  DG  D N3    1 
ATOM   2477 C C4    . DG  C 3 18  ? 25.043  4.335   24.224 1.00 37.16  ? 18  DG  D C4    1 
ATOM   2478 P P     . DT  C 3 19  ? 19.013  4.032   21.893 1.00 32.07  ? 19  DT  D P     1 
ATOM   2479 O OP1   . DT  C 3 19  ? 17.650  4.337   22.362 1.00 32.84  ? 19  DT  D OP1   1 
ATOM   2480 O OP2   . DT  C 3 19  ? 19.215  3.245   20.644 1.00 32.90  ? 19  DT  D OP2   1 
ATOM   2481 O "O5'" . DT  C 3 19  ? 19.800  5.382   21.690 1.00 32.35  ? 19  DT  D "O5'" 1 
ATOM   2482 C "C5'" . DT  C 3 19  ? 19.781  6.371   22.687 1.00 33.06  ? 19  DT  D "C5'" 1 
ATOM   2483 C "C4'" . DT  C 3 19  ? 20.811  7.427   22.390 1.00 36.96  ? 19  DT  D "C4'" 1 
ATOM   2484 O "O4'" . DT  C 3 19  ? 22.120  6.863   22.477 1.00 37.26  ? 19  DT  D "O4'" 1 
ATOM   2485 C "C3'" . DT  C 3 19  ? 20.729  8.036   20.990 1.00 40.67  ? 19  DT  D "C3'" 1 
ATOM   2486 O "O3'" . DT  C 3 19  ? 20.045  9.240   21.081 1.00 43.34  ? 19  DT  D "O3'" 1 
ATOM   2487 C "C2'" . DT  C 3 19  ? 22.204  8.217   20.559 1.00 40.28  ? 19  DT  D "C2'" 1 
ATOM   2488 C "C1'" . DT  C 3 19  ? 22.986  7.703   21.761 1.00 38.75  ? 19  DT  D "C1'" 1 
ATOM   2489 N N1    . DT  C 3 19  ? 24.225  6.939   21.437 1.00 39.37  ? 19  DT  D N1    1 
ATOM   2490 C C2    . DT  C 3 19  ? 25.445  7.434   21.871 1.00 40.39  ? 19  DT  D C2    1 
ATOM   2491 O O2    . DT  C 3 19  ? 25.594  8.556   22.333 1.00 41.77  ? 19  DT  D O2    1 
ATOM   2492 N N3    . DT  C 3 19  ? 26.505  6.594   21.668 1.00 40.18  ? 19  DT  D N3    1 
ATOM   2493 C C4    . DT  C 3 19  ? 26.488  5.343   21.075 1.00 39.54  ? 19  DT  D C4    1 
ATOM   2494 O O4    . DT  C 3 19  ? 27.536  4.716   20.982 1.00 40.28  ? 19  DT  D O4    1 
ATOM   2495 C C5    . DT  C 3 19  ? 25.177  4.853   20.693 1.00 38.86  ? 19  DT  D C5    1 
ATOM   2496 C C7    . DT  C 3 19  ? 25.028  3.506   20.055 1.00 39.54  ? 19  DT  D C7    1 
ATOM   2497 C C6    . DT  C 3 19  ? 24.121  5.661   20.882 1.00 38.45  ? 19  DT  D C6    1 
ATOM   2498 P P     . DA  C 3 20  ? 19.782  10.178  19.769 1.00 46.80  ? 20  DA  D P     1 
ATOM   2499 O OP1   . DA  C 3 20  ? 18.568  10.964  20.064 1.00 49.70  ? 20  DA  D OP1   1 
ATOM   2500 O OP2   . DA  C 3 20  ? 19.861  9.371   18.530 1.00 45.77  ? 20  DA  D OP2   1 
ATOM   2501 O "O5'" . DA  C 3 20  ? 21.065  11.131  19.792 1.00 48.14  ? 20  DA  D "O5'" 1 
ATOM   2502 C "C5'" . DA  C 3 20  ? 21.338  11.947  20.891 1.00 50.63  ? 20  DA  D "C5'" 1 
ATOM   2503 C "C4'" . DA  C 3 20  ? 22.615  12.732  20.652 1.00 52.89  ? 20  DA  D "C4'" 1 
ATOM   2504 O "O4'" . DA  C 3 20  ? 23.766  11.852  20.660 1.00 52.71  ? 20  DA  D "O4'" 1 
ATOM   2505 C "C3'" . DA  C 3 20  ? 22.685  13.532  19.350 1.00 55.18  ? 20  DA  D "C3'" 1 
ATOM   2506 O "O3'" . DA  C 3 20  ? 23.250  14.773  19.661 1.00 59.39  ? 20  DA  D "O3'" 1 
ATOM   2507 C "C2'" . DA  C 3 20  ? 23.598  12.684  18.445 1.00 53.30  ? 20  DA  D "C2'" 1 
ATOM   2508 C "C1'" . DA  C 3 20  ? 24.515  12.003  19.470 1.00 52.37  ? 20  DA  D "C1'" 1 
ATOM   2509 N N9    . DA  C 3 20  ? 25.012  10.680  19.073 1.00 49.17  ? 20  DA  D N9    1 
ATOM   2510 C C8    . DA  C 3 20  ? 24.320  9.685   18.433 1.00 48.13  ? 20  DA  D C8    1 
ATOM   2511 N N7    . DA  C 3 20  ? 25.028  8.610   18.209 1.00 47.77  ? 20  DA  D N7    1 
ATOM   2512 C C5    . DA  C 3 20  ? 26.275  8.913   18.730 1.00 47.13  ? 20  DA  D C5    1 
ATOM   2513 C C6    . DA  C 3 20  ? 27.474  8.161   18.852 1.00 46.59  ? 20  DA  D C6    1 
ATOM   2514 N N6    . DA  C 3 20  ? 27.607  6.910   18.390 1.00 47.15  ? 20  DA  D N6    1 
ATOM   2515 N N1    . DA  C 3 20  ? 28.569  8.800   19.326 1.00 46.27  ? 20  DA  D N1    1 
ATOM   2516 C C2    . DA  C 3 20  ? 28.446  10.073  19.760 1.00 46.87  ? 20  DA  D C2    1 
ATOM   2517 N N3    . DA  C 3 20  ? 27.347  10.838  19.805 1.00 47.24  ? 20  DA  D N3    1 
ATOM   2518 C C4    . DA  C 3 20  ? 26.291  10.200  19.240 1.00 47.64  ? 20  DA  D C4    1 
ATOM   2519 P P     . DC  C 3 21  ? 23.268  15.990  18.614 1.00 62.33  ? 21  DC  D P     1 
ATOM   2520 O OP1   . DC  C 3 21  ? 23.154  17.225  19.422 1.00 64.71  ? 21  DC  D OP1   1 
ATOM   2521 O OP2   . DC  C 3 21  ? 22.301  15.711  17.523 1.00 60.90  ? 21  DC  D OP2   1 
ATOM   2522 O "O5'" . DC  C 3 21  ? 24.742  15.882  18.018 1.00 62.92  ? 21  DC  D "O5'" 1 
ATOM   2523 C "C5'" . DC  C 3 21  ? 25.872  15.940  18.895 1.00 63.77  ? 21  DC  D "C5'" 1 
ATOM   2524 C "C4'" . DC  C 3 21  ? 27.144  15.554  18.163 1.00 65.36  ? 21  DC  D "C4'" 1 
ATOM   2525 O "O4'" . DC  C 3 21  ? 27.222  14.113  18.036 1.00 63.91  ? 21  DC  D "O4'" 1 
ATOM   2526 C "C3'" . DC  C 3 21  ? 27.287  16.119  16.737 1.00 68.23  ? 21  DC  D "C3'" 1 
ATOM   2527 O "O3'" . DC  C 3 21  ? 28.531  16.758  16.617 1.00 72.89  ? 21  DC  D "O3'" 1 
ATOM   2528 C "C2'" . DC  C 3 21  ? 27.236  14.872  15.854 1.00 66.08  ? 21  DC  D "C2'" 1 
ATOM   2529 C "C1'" . DC  C 3 21  ? 27.817  13.835  16.807 1.00 63.24  ? 21  DC  D "C1'" 1 
ATOM   2530 N N1    . DC  C 3 21  ? 27.563  12.406  16.427 1.00 59.37  ? 21  DC  D N1    1 
ATOM   2531 C C2    . DC  C 3 21  ? 28.616  11.472  16.523 1.00 57.53  ? 21  DC  D C2    1 
ATOM   2532 O O2    . DC  C 3 21  ? 29.711  11.836  16.991 1.00 57.17  ? 21  DC  D O2    1 
ATOM   2533 N N3    . DC  C 3 21  ? 28.385  10.179  16.140 1.00 55.06  ? 21  DC  D N3    1 
ATOM   2534 C C4    . DC  C 3 21  ? 27.182  9.826   15.653 1.00 53.45  ? 21  DC  D C4    1 
ATOM   2535 N N4    . DC  C 3 21  ? 26.999  8.557   15.302 1.00 51.28  ? 21  DC  D N4    1 
ATOM   2536 C C5    . DC  C 3 21  ? 26.104  10.763  15.542 1.00 55.26  ? 21  DC  D C5    1 
ATOM   2537 C C6    . DC  C 3 21  ? 26.341  12.032  15.917 1.00 57.41  ? 21  DC  D C6    1 
ATOM   2538 P P     . DA  C 3 22  ? 28.724  18.036  15.675 1.00 75.98  ? 22  DA  D P     1 
ATOM   2539 O OP1   . DA  C 3 22  ? 28.512  19.239  16.520 1.00 77.43  ? 22  DA  D OP1   1 
ATOM   2540 O OP2   . DA  C 3 22  ? 27.932  17.848  14.432 1.00 75.38  ? 22  DA  D OP2   1 
ATOM   2541 O "O5'" . DA  C 3 22  ? 30.273  17.928  15.294 1.00 76.45  ? 22  DA  D "O5'" 1 
ATOM   2542 C "C5'" . DA  C 3 22  ? 31.259  17.790  16.332 1.00 76.07  ? 22  DA  D "C5'" 1 
ATOM   2543 C "C4'" . DA  C 3 22  ? 32.375  16.843  15.913 1.00 75.81  ? 22  DA  D "C4'" 1 
ATOM   2544 O "O4'" . DA  C 3 22  ? 31.842  15.515  15.684 1.00 74.48  ? 22  DA  D "O4'" 1 
ATOM   2545 C "C3'" . DA  C 3 22  ? 33.142  17.224  14.643 1.00 76.95  ? 22  DA  D "C3'" 1 
ATOM   2546 O "O3'" . DA  C 3 22  ? 34.529  16.997  14.859 1.00 80.18  ? 22  DA  D "O3'" 1 
ATOM   2547 C "C2'" . DA  C 3 22  ? 32.573  16.265  13.591 1.00 74.70  ? 22  DA  D "C2'" 1 
ATOM   2548 C "C1'" . DA  C 3 22  ? 32.286  15.029  14.438 1.00 72.43  ? 22  DA  D "C1'" 1 
ATOM   2549 N N9    . DA  C 3 22  ? 31.250  14.138  13.911 1.00 68.51  ? 22  DA  D N9    1 
ATOM   2550 C C8    . DA  C 3 22  ? 29.936  14.452  13.660 1.00 67.28  ? 22  DA  D C8    1 
ATOM   2551 N N7    . DA  C 3 22  ? 29.191  13.420  13.332 1.00 65.17  ? 22  DA  D N7    1 
ATOM   2552 C C5    . DA  C 3 22  ? 30.070  12.355  13.364 1.00 63.19  ? 22  DA  D C5    1 
ATOM   2553 C C6    . DA  C 3 22  ? 29.907  10.977  13.091 1.00 60.47  ? 22  DA  D C6    1 
ATOM   2554 N N6    . DA  C 3 22  ? 28.750  10.437  12.698 1.00 59.53  ? 22  DA  D N6    1 
ATOM   2555 N N1    . DA  C 3 22  ? 31.007  10.191  13.161 1.00 59.72  ? 22  DA  D N1    1 
ATOM   2556 C C2    . DA  C 3 22  ? 32.176  10.731  13.542 1.00 60.63  ? 22  DA  D C2    1 
ATOM   2557 N N3    . DA  C 3 22  ? 32.443  11.999  13.876 1.00 62.72  ? 22  DA  D N3    1 
ATOM   2558 C C4    . DA  C 3 22  ? 31.340  12.773  13.746 1.00 64.85  ? 22  DA  D C4    1 
ATOM   2559 P P     . DG  C 3 23  ? 35.649  17.857  14.101 1.00 83.71  ? 23  DG  D P     1 
ATOM   2560 O OP1   . DG  C 3 23  ? 36.763  18.060  15.070 1.00 84.19  ? 23  DG  D OP1   1 
ATOM   2561 O OP2   . DG  C 3 23  ? 35.009  19.032  13.444 1.00 83.58  ? 23  DG  D OP2   1 
ATOM   2562 O "O5'" . DG  C 3 23  ? 36.131  16.863  12.934 1.00 83.49  ? 23  DG  D "O5'" 1 
ATOM   2563 C "C5'" . DG  C 3 23  ? 36.787  15.626  13.261 1.00 82.78  ? 23  DG  D "C5'" 1 
ATOM   2564 C "C4'" . DG  C 3 23  ? 36.679  14.617  12.122 1.00 81.97  ? 23  DG  D "C4'" 1 
ATOM   2565 O "O4'" . DG  C 3 23  ? 35.347  14.037  12.089 1.00 80.12  ? 23  DG  D "O4'" 1 
ATOM   2566 C "C3'" . DG  C 3 23  ? 36.938  15.156  10.691 1.00 82.83  ? 23  DG  D "C3'" 1 
ATOM   2567 O "O3'" . DG  C 3 23  ? 37.710  14.196  9.974  1.00 85.36  ? 23  DG  D "O3'" 1 
ATOM   2568 C "C2'" . DG  C 3 23  ? 35.522  15.204  10.111 1.00 80.83  ? 23  DG  D "C2'" 1 
ATOM   2569 C "C1'" . DG  C 3 23  ? 34.979  13.937  10.745 1.00 78.19  ? 23  DG  D "C1'" 1 
ATOM   2570 N N9    . DG  C 3 23  ? 33.544  13.708  10.620 1.00 73.84  ? 23  DG  D N9    1 
ATOM   2571 C C8    . DG  C 3 23  ? 32.536  14.647  10.593 1.00 72.99  ? 23  DG  D C8    1 
ATOM   2572 N N7    . DG  C 3 23  ? 31.353  14.133  10.399 1.00 71.67  ? 23  DG  D N7    1 
ATOM   2573 C C5    . DG  C 3 23  ? 31.597  12.774  10.244 1.00 69.55  ? 23  DG  D C5    1 
ATOM   2574 C C6    . DG  C 3 23  ? 30.701  11.705  9.988  1.00 66.64  ? 23  DG  D C6    1 
ATOM   2575 O O6    . DG  C 3 23  ? 29.471  11.750  9.875  1.00 66.04  ? 23  DG  D O6    1 
ATOM   2576 N N1    . DG  C 3 23  ? 31.372  10.481  9.859  1.00 65.30  ? 23  DG  D N1    1 
ATOM   2577 C C2    . DG  C 3 23  ? 32.738  10.315  9.977  1.00 65.68  ? 23  DG  D C2    1 
ATOM   2578 N N2    . DG  C 3 23  ? 33.205  9.068   9.835  1.00 65.05  ? 23  DG  D N2    1 
ATOM   2579 N N3    . DG  C 3 23  ? 33.584  11.307  10.231 1.00 67.47  ? 23  DG  D N3    1 
ATOM   2580 C C4    . DG  C 3 23  ? 32.946  12.505  10.351 1.00 70.16  ? 23  DG  D C4    1 
ATOM   2581 P P     . DA  C 3 24  ? 39.094  14.568  9.270  1.00 87.57  ? 24  DA  D P     1 
ATOM   2582 O OP1   . DA  C 3 24  ? 40.116  14.689  10.346 1.00 88.58  ? 24  DA  D OP1   1 
ATOM   2583 O OP2   . DA  C 3 24  ? 38.866  15.687  8.322  1.00 87.90  ? 24  DA  D OP2   1 
ATOM   2584 O "O5'" . DA  C 3 24  ? 39.386  13.241  8.419  1.00 86.84  ? 24  DA  D "O5'" 1 
ATOM   2585 C "C5'" . DA  C 3 24  ? 39.359  11.955  9.079  1.00 85.76  ? 24  DA  D "C5'" 1 
ATOM   2586 C "C4'" . DA  C 3 24  ? 38.663  10.891  8.236  1.00 84.60  ? 24  DA  D "C4'" 1 
ATOM   2587 O "O4'" . DA  C 3 24  ? 37.219  11.045  8.290  1.00 82.44  ? 24  DA  D "O4'" 1 
ATOM   2588 C "C3'" . DA  C 3 24  ? 39.041  10.850  6.756  1.00 85.75  ? 24  DA  D "C3'" 1 
ATOM   2589 O "O3'" . DA  C 3 24  ? 39.329  9.504   6.398  1.00 88.74  ? 24  DA  D "O3'" 1 
ATOM   2590 C "C2'" . DA  C 3 24  ? 37.781  11.374  6.048  1.00 83.56  ? 24  DA  D "C2'" 1 
ATOM   2591 C "C1'" . DA  C 3 24  ? 36.688  10.885  6.989  1.00 80.91  ? 24  DA  D "C1'" 1 
ATOM   2592 N N9    . DA  C 3 24  ? 35.422  11.625  6.912  1.00 76.52  ? 24  DA  D N9    1 
ATOM   2593 C C8    . DA  C 3 24  ? 35.224  12.950  7.213  1.00 75.27  ? 24  DA  D C8    1 
ATOM   2594 N N7    . DA  C 3 24  ? 33.965  13.321  7.192  1.00 73.87  ? 24  DA  D N7    1 
ATOM   2595 C C5    . DA  C 3 24  ? 33.278  12.153  6.909  1.00 72.41  ? 24  DA  D C5    1 
ATOM   2596 C C6    . DA  C 3 24  ? 31.899  11.869  6.759  1.00 70.10  ? 24  DA  D C6    1 
ATOM   2597 N N6    . DA  C 3 24  ? 30.944  12.798  6.862  1.00 69.50  ? 24  DA  D N6    1 
ATOM   2598 N N1    . DA  C 3 24  ? 31.546  10.600  6.440  1.00 69.26  ? 24  DA  D N1    1 
ATOM   2599 C C2    . DA  C 3 24  ? 32.506  9.668   6.330  1.00 70.00  ? 24  DA  D C2    1 
ATOM   2600 N N3    . DA  C 3 24  ? 33.832  9.810   6.460  1.00 71.51  ? 24  DA  D N3    1 
ATOM   2601 C C4    . DA  C 3 24  ? 34.157  11.090  6.754  1.00 73.42  ? 24  DA  D C4    1 
ATOM   2602 P P     . DG  C 3 25  ? 40.281  9.150   5.157  1.00 91.81  ? 25  DG  D P     1 
ATOM   2603 O OP1   . DG  C 3 25  ? 41.279  8.163   5.635  1.00 92.50  ? 25  DG  D OP1   1 
ATOM   2604 O OP2   . DG  C 3 25  ? 40.736  10.410  4.522  1.00 91.85  ? 25  DG  D OP2   1 
ATOM   2605 O "O5'" . DG  C 3 25  ? 39.264  8.423   4.147  1.00 91.80  ? 25  DG  D "O5'" 1 
ATOM   2606 C "C5'" . DG  C 3 25  ? 38.262  7.519   4.671  1.00 90.50  ? 25  DG  D "C5'" 1 
ATOM   2607 C "C4'" . DG  C 3 25  ? 37.058  7.394   3.742  1.00 89.44  ? 25  DG  D "C4'" 1 
ATOM   2608 O "O4'" . DG  C 3 25  ? 36.066  8.414   4.041  1.00 87.40  ? 25  DG  D "O4'" 1 
ATOM   2609 C "C3'" . DG  C 3 25  ? 37.343  7.500   2.237  1.00 90.09  ? 25  DG  D "C3'" 1 
ATOM   2610 O "O3'" . DG  C 3 25  ? 36.697  6.414   1.569  1.00 92.78  ? 25  DG  D "O3'" 1 
ATOM   2611 C "C2'" . DG  C 3 25  ? 36.709  8.850   1.854  1.00 87.71  ? 25  DG  D "C2'" 1 
ATOM   2612 C "C1'" . DG  C 3 25  ? 35.535  8.875   2.816  1.00 84.65  ? 25  DG  D "C1'" 1 
ATOM   2613 N N9    . DG  C 3 25  ? 34.893  10.182  3.021  1.00 79.11  ? 25  DG  D N9    1 
ATOM   2614 C C8    . DG  C 3 25  ? 35.503  11.385  3.320  1.00 77.66  ? 25  DG  D C8    1 
ATOM   2615 N N7    . DG  C 3 25  ? 34.658  12.363  3.526  1.00 76.12  ? 25  DG  D N7    1 
ATOM   2616 C C5    . DG  C 3 25  ? 33.404  11.765  3.400  1.00 74.55  ? 25  DG  D C5    1 
ATOM   2617 C C6    . DG  C 3 25  ? 32.095  12.331  3.489  1.00 72.24  ? 25  DG  D C6    1 
ATOM   2618 O O6    . DG  C 3 25  ? 31.781  13.492  3.778  1.00 72.47  ? 25  DG  D O6    1 
ATOM   2619 N N1    . DG  C 3 25  ? 31.095  11.388  3.224  1.00 69.96  ? 25  DG  D N1    1 
ATOM   2620 C C2    . DG  C 3 25  ? 31.326  10.073  2.887  1.00 69.65  ? 25  DG  D C2    1 
ATOM   2621 N N2    . DG  C 3 25  ? 30.246  9.328   2.626  1.00 68.93  ? 25  DG  D N2    1 
ATOM   2622 N N3    . DG  C 3 25  ? 32.540  9.529   2.798  1.00 71.52  ? 25  DG  D N3    1 
ATOM   2623 C C4    . DG  C 3 25  ? 33.531  10.427  3.074  1.00 74.94  ? 25  DG  D C4    1 
ATOM   2624 P P     . DC  C 3 26  ? 37.354  5.700   0.291  1.00 94.74  ? 26  DC  D P     1 
ATOM   2625 O OP1   . DC  C 3 26  ? 37.757  4.334   0.704  1.00 95.72  ? 26  DC  D OP1   1 
ATOM   2626 O OP2   . DC  C 3 26  ? 38.353  6.615   -0.325 1.00 94.99  ? 26  DC  D OP2   1 
ATOM   2627 O "O5'" . DC  C 3 26  ? 36.112  5.588   -0.710 1.00 94.28  ? 26  DC  D "O5'" 1 
ATOM   2628 C "C5'" . DC  C 3 26  ? 35.389  6.760   -1.065 1.00 92.99  ? 26  DC  D "C5'" 1 
ATOM   2629 C "C4'" . DC  C 3 26  ? 33.889  6.494   -1.100 1.00 90.99  ? 26  DC  D "C4'" 1 
ATOM   2630 O "O4'" . DC  C 3 26  ? 33.192  7.484   -0.285 1.00 88.25  ? 26  DC  D "O4'" 1 
ATOM   2631 C "C3'" . DC  C 3 26  ? 33.271  6.594   -2.491 1.00 91.02  ? 26  DC  D "C3'" 1 
ATOM   2632 O "O3'" . DC  C 3 26  ? 32.176  5.687   -2.629 1.00 92.88  ? 26  DC  D "O3'" 1 
ATOM   2633 C "C2'" . DC  C 3 26  ? 32.821  8.048   -2.568 1.00 88.88  ? 26  DC  D "C2'" 1 
ATOM   2634 C "C1'" . DC  C 3 26  ? 32.437  8.361   -1.125 1.00 85.91  ? 26  DC  D "C1'" 1 
ATOM   2635 N N1    . DC  C 3 26  ? 32.709  9.802   -0.721 1.00 80.55  ? 26  DC  D N1    1 
ATOM   2636 C C2    . DC  C 3 26  ? 31.630  10.679  -0.463 1.00 77.63  ? 26  DC  D C2    1 
ATOM   2637 O O2    . DC  C 3 26  ? 30.469  10.270  -0.577 1.00 76.82  ? 26  DC  D O2    1 
ATOM   2638 N N3    . DC  C 3 26  ? 31.900  11.956  -0.066 1.00 76.56  ? 26  DC  D N3    1 
ATOM   2639 C C4    . DC  C 3 26  ? 33.170  12.383  0.023  1.00 76.57  ? 26  DC  D C4    1 
ATOM   2640 N N4    . DC  C 3 26  ? 33.380  13.656  0.377  1.00 75.97  ? 26  DC  D N4    1 
ATOM   2641 C C5    . DC  C 3 26  ? 34.281  11.520  -0.258 1.00 77.70  ? 26  DC  D C5    1 
ATOM   2642 C C6    . DC  C 3 26  ? 34.009  10.251  -0.615 1.00 79.08  ? 26  DC  D C6    1 
ATOM   2643 P P     . DT  C 3 27  ? 31.688  5.204   -4.090 1.00 94.10  ? 27  DT  D P     1 
ATOM   2644 O OP1   . DT  C 3 27  ? 30.878  3.973   -3.902 1.00 94.68  ? 27  DT  D OP1   1 
ATOM   2645 O OP2   . DT  C 3 27  ? 32.857  5.181   -5.008 1.00 95.14  ? 27  DT  D OP2   1 
ATOM   2646 O "O5'" . DT  C 3 27  ? 30.724  6.396   -4.573 1.00 93.55  ? 27  DT  D "O5'" 1 
ATOM   2647 C "C5'" . DT  C 3 27  ? 29.491  6.643   -3.881 1.00 92.24  ? 27  DT  D "C5'" 1 
ATOM   2648 C "C4'" . DT  C 3 27  ? 28.812  7.915   -4.371 1.00 90.61  ? 27  DT  D "C4'" 1 
ATOM   2649 O "O4'" . DT  C 3 27  ? 29.446  9.080   -3.797 1.00 88.50  ? 27  DT  D "O4'" 1 
ATOM   2650 C "C3'" . DT  C 3 27  ? 28.791  8.138   -5.886 1.00 91.06  ? 27  DT  D "C3'" 1 
ATOM   2651 O "O3'" . DT  C 3 27  ? 27.457  8.400   -6.284 1.00 93.33  ? 27  DT  D "O3'" 1 
ATOM   2652 C "C2'" . DT  C 3 27  ? 29.682  9.378   -6.084 1.00 88.76  ? 27  DT  D "C2'" 1 
ATOM   2653 C "C1'" . DT  C 3 27  ? 29.458  10.096  -4.762 1.00 86.89  ? 27  DT  D "C1'" 1 
ATOM   2654 N N1    . DT  C 3 27  ? 30.504  11.097  -4.380 1.00 82.88  ? 27  DT  D N1    1 
ATOM   2655 C C2    . DT  C 3 27  ? 30.105  12.315  -3.867 1.00 80.31  ? 27  DT  D C2    1 
ATOM   2656 O O2    . DT  C 3 27  ? 28.937  12.646  -3.753 1.00 79.42  ? 27  DT  D O2    1 
ATOM   2657 N N3    . DT  C 3 27  ? 31.131  13.135  -3.478 1.00 79.85  ? 27  DT  D N3    1 
ATOM   2658 C C4    . DT  C 3 27  ? 32.490  12.876  -3.549 1.00 80.41  ? 27  DT  D C4    1 
ATOM   2659 O O4    . DT  C 3 27  ? 33.282  13.722  -3.142 1.00 80.15  ? 27  DT  D O4    1 
ATOM   2660 C C5    . DT  C 3 27  ? 32.847  11.576  -4.104 1.00 81.41  ? 27  DT  D C5    1 
ATOM   2661 C C7    . DT  C 3 27  ? 34.287  11.169  -4.250 1.00 81.58  ? 27  DT  D C7    1 
ATOM   2662 C C6    . DT  C 3 27  ? 31.848  10.763  -4.484 1.00 82.14  ? 27  DT  D C6    1 
ATOM   2663 P P     . DG  C 3 28  ? 26.922  8.007   -7.745 1.00 93.98  ? 28  DG  D P     1 
ATOM   2664 O OP1   . DG  C 3 28  ? 26.077  6.799   -7.600 1.00 94.60  ? 28  DG  D OP1   1 
ATOM   2665 O OP2   . DG  C 3 28  ? 28.061  8.001   -8.694 1.00 94.01  ? 28  DG  D OP2   1 
ATOM   2666 O "O5'" . DG  C 3 28  ? 25.980  9.253   -8.101 1.00 94.76  ? 28  DG  D "O5'" 1 
ATOM   2667 C "C5'" . DG  C 3 28  ? 25.084  9.781   -7.090 1.00 94.63  ? 28  DG  D "C5'" 1 
ATOM   2668 C "C4'" . DG  C 3 28  ? 24.959  11.298  -7.181 1.00 94.01  ? 28  DG  D "C4'" 1 
ATOM   2669 O "O4'" . DG  C 3 28  ? 26.151  11.930  -6.643 1.00 92.86  ? 28  DG  D "O4'" 1 
ATOM   2670 C "C3'" . DG  C 3 28  ? 24.771  11.861  -8.596 1.00 94.01  ? 28  DG  D "C3'" 1 
ATOM   2671 O "O3'" . DG  C 3 28  ? 23.616  12.691  -8.642 1.00 95.32  ? 28  DG  D "O3'" 1 
ATOM   2672 C "C2'" . DG  C 3 28  ? 26.052  12.664  -8.851 1.00 92.78  ? 28  DG  D "C2'" 1 
ATOM   2673 C "C1'" . DG  C 3 28  ? 26.459  13.049  -7.438 1.00 91.66  ? 28  DG  D "C1'" 1 
ATOM   2674 N N9    . DG  C 3 28  ? 27.880  13.364  -7.287 1.00 89.18  ? 28  DG  D N9    1 
ATOM   2675 C C8    . DG  C 3 28  ? 28.949  12.558  -7.596 1.00 88.33  ? 28  DG  D C8    1 
ATOM   2676 N N7    . DG  C 3 28  ? 30.103  13.095  -7.325 1.00 87.82  ? 28  DG  D N7    1 
ATOM   2677 C C5    . DG  C 3 28  ? 29.781  14.309  -6.740 1.00 87.56  ? 28  DG  D C5    1 
ATOM   2678 C C6    . DG  C 3 28  ? 30.623  15.352  -6.272 1.00 86.92  ? 28  DG  D C6    1 
ATOM   2679 O O6    . DG  C 3 28  ? 31.859  15.400  -6.284 1.00 86.64  ? 28  DG  D O6    1 
ATOM   2680 N N1    . DG  C 3 28  ? 29.888  16.449  -5.818 1.00 86.55  ? 28  DG  D N1    1 
ATOM   2681 C C2    . DG  C 3 28  ? 28.515  16.544  -5.853 1.00 86.44  ? 28  DG  D C2    1 
ATOM   2682 N N2    . DG  C 3 28  ? 27.985  17.677  -5.386 1.00 86.63  ? 28  DG  D N2    1 
ATOM   2683 N N3    . DG  C 3 28  ? 27.715  15.567  -6.263 1.00 86.83  ? 28  DG  D N3    1 
ATOM   2684 C C4    . DG  C 3 28  ? 28.414  14.494  -6.720 1.00 87.75  ? 28  DG  D C4    1 
HETATM 2685 C C     . ACT D 4 .   ? 22.866  -12.630 40.045 1.00 58.27  ? 401 ACT A C     1 
HETATM 2686 O O     . ACT D 4 .   ? 22.414  -11.448 40.074 1.00 57.68  ? 401 ACT A O     1 
HETATM 2687 O OXT   . ACT D 4 .   ? 22.784  -13.501 40.979 1.00 54.66  ? 401 ACT A OXT   1 
HETATM 2688 C CH3   . ACT D 4 .   ? 23.581  -13.046 38.773 1.00 59.28  ? 401 ACT A CH3   1 
HETATM 2689 O O     . HOH E 5 .   ? 7.936   16.229  14.377 1.00 61.42  ? 501 HOH A O     1 
HETATM 2690 O O     . HOH E 5 .   ? 9.126   7.088   11.188 1.00 50.16  ? 502 HOH A O     1 
HETATM 2691 O O     . HOH E 5 .   ? 9.561   5.207   9.513  1.00 50.65  ? 503 HOH A O     1 
HETATM 2692 O O     . HOH E 5 .   ? 10.575  12.465  31.542 1.00 42.59  ? 504 HOH A O     1 
HETATM 2693 O O     . HOH E 5 .   ? 13.623  -0.601  36.567 1.00 44.13  ? 505 HOH A O     1 
HETATM 2694 O O     . HOH E 5 .   ? 16.954  -14.177 22.794 1.00 36.30  ? 506 HOH A O     1 
HETATM 2695 O O     . HOH E 5 .   ? 8.071   -3.968  3.722  1.00 60.70  ? 507 HOH A O     1 
HETATM 2696 O O     . HOH E 5 .   ? 25.917  -2.490  16.807 1.00 51.65  ? 508 HOH A O     1 
HETATM 2697 O O     . HOH E 5 .   ? 2.586   4.164   13.790 1.00 45.10  ? 509 HOH A O     1 
HETATM 2698 O O     . HOH E 5 .   ? 10.052  10.093  13.711 1.00 44.42  ? 510 HOH A O     1 
HETATM 2699 O O     . HOH E 5 .   ? -1.778  -2.068  27.995 1.00 56.13  ? 511 HOH A O     1 
HETATM 2700 O O     . HOH E 5 .   ? 13.419  -10.506 15.565 1.00 38.72  ? 512 HOH A O     1 
HETATM 2701 O O     . HOH E 5 .   ? 19.706  3.099   37.051 1.00 35.36  ? 513 HOH A O     1 
HETATM 2702 O O     . HOH E 5 .   ? 14.788  -18.146 24.167 1.00 48.75  ? 514 HOH A O     1 
HETATM 2703 O O     . HOH E 5 .   ? 20.093  5.948   30.691 1.00 32.88  ? 515 HOH A O     1 
HETATM 2704 O O     . HOH E 5 .   ? 22.869  -16.021 22.598 1.00 41.05  ? 516 HOH A O     1 
HETATM 2705 O O     . HOH E 5 .   ? 22.680  -13.951 12.655 1.00 57.75  ? 517 HOH A O     1 
HETATM 2706 O O     . HOH E 5 .   ? -3.413  -0.004  16.637 1.00 49.12  ? 518 HOH A O     1 
HETATM 2707 O O     . HOH E 5 .   ? 11.513  -6.574  25.456 1.00 34.13  ? 519 HOH A O     1 
HETATM 2708 O O     . HOH E 5 .   ? 6.706   -1.603  37.391 1.00 38.43  ? 520 HOH A O     1 
HETATM 2709 O O     . HOH E 5 .   ? 18.117  -2.203  41.528 1.00 55.16  ? 521 HOH A O     1 
HETATM 2710 O O     . HOH E 5 .   ? 11.857  -3.188  39.915 1.00 38.69  ? 522 HOH A O     1 
HETATM 2711 O O     . HOH E 5 .   ? 19.457  -11.683 14.044 1.00 41.92  ? 523 HOH A O     1 
HETATM 2712 O O     . HOH E 5 .   ? 12.470  2.732   27.340 1.00 41.52  ? 524 HOH A O     1 
HETATM 2713 O O     . HOH E 5 .   ? 30.212  -14.873 36.919 1.00 66.54  ? 525 HOH A O     1 
HETATM 2714 O O     . HOH E 5 .   ? 15.493  -4.439  36.710 1.00 35.57  ? 526 HOH A O     1 
HETATM 2715 O O     . HOH E 5 .   ? 18.793  -20.888 23.387 1.00 62.51  ? 527 HOH A O     1 
HETATM 2716 O O     . HOH E 5 .   ? 22.969  -13.527 15.298 1.00 64.05  ? 528 HOH A O     1 
HETATM 2717 O O     . HOH E 5 .   ? 0.922   6.513   12.860 1.00 60.53  ? 529 HOH A O     1 
HETATM 2718 O O     . HOH E 5 .   ? -2.076  -0.137  32.826 1.00 61.66  ? 530 HOH A O     1 
HETATM 2719 O O     . HOH E 5 .   ? 13.816  13.982  23.747 1.00 58.54  ? 531 HOH A O     1 
HETATM 2720 O O     . HOH E 5 .   ? 25.182  -9.447  40.098 1.00 55.24  ? 532 HOH A O     1 
HETATM 2721 O O     . HOH E 5 .   ? 5.917   -13.772 35.821 1.00 53.49  ? 533 HOH A O     1 
HETATM 2722 O O     . HOH E 5 .   ? 20.471  1.864   13.892 1.00 52.43  ? 534 HOH A O     1 
HETATM 2723 O O     . HOH E 5 .   ? 29.719  -21.372 33.450 1.00 63.66  ? 535 HOH A O     1 
HETATM 2724 O O     . HOH E 5 .   ? 3.159   -13.460 10.197 1.00 54.19  ? 536 HOH A O     1 
HETATM 2725 O O     . HOH E 5 .   ? 12.830  -12.418 23.322 1.00 40.43  ? 537 HOH A O     1 
HETATM 2726 O O     . HOH E 5 .   ? 15.585  4.702   8.956  1.00 58.34  ? 538 HOH A O     1 
HETATM 2727 O O     . HOH E 5 .   ? 1.734   0.049   6.563  1.00 58.14  ? 539 HOH A O     1 
HETATM 2728 O O     . HOH E 5 .   ? 0.696   9.973   23.198 1.00 51.50  ? 540 HOH A O     1 
HETATM 2729 O O     . HOH E 5 .   ? 1.238   3.642   39.296 1.00 57.80  ? 541 HOH A O     1 
HETATM 2730 O O     . HOH E 5 .   ? 30.329  -18.304 24.229 1.00 51.49  ? 542 HOH A O     1 
HETATM 2731 O O     . HOH E 5 .   ? -4.343  -10.084 18.019 1.00 54.98  ? 543 HOH A O     1 
HETATM 2732 O O     . HOH E 5 .   ? 23.360  -20.356 21.339 1.00 64.36  ? 544 HOH A O     1 
HETATM 2733 O O     . HOH E 5 .   ? 7.232   -17.367 27.008 1.00 48.09  ? 545 HOH A O     1 
HETATM 2734 O O     . HOH E 5 .   ? 21.472  -3.934  23.123 1.00 40.64  ? 546 HOH A O     1 
HETATM 2735 O O     . HOH E 5 .   ? 8.127   12.926  14.500 1.00 52.08  ? 547 HOH A O     1 
HETATM 2736 O O     . HOH E 5 .   ? -1.706  -0.743  7.416  1.00 66.11  ? 548 HOH A O     1 
HETATM 2737 O O     . HOH E 5 .   ? 7.833   10.689  15.928 1.00 43.94  ? 549 HOH A O     1 
HETATM 2738 O O     . HOH E 5 .   ? 16.785  -1.511  24.932 1.00 31.26  ? 550 HOH A O     1 
HETATM 2739 O O     . HOH E 5 .   ? 15.383  -16.741 37.061 1.00 52.61  ? 551 HOH A O     1 
HETATM 2740 O O     . HOH E 5 .   ? 23.824  -19.804 39.287 1.00 46.12  ? 552 HOH A O     1 
HETATM 2741 O O     . HOH E 5 .   ? 27.808  4.634   28.573 1.00 50.00  ? 553 HOH A O     1 
HETATM 2742 O O     . HOH E 5 .   ? -4.219  -6.405  19.543 1.00 57.06  ? 554 HOH A O     1 
HETATM 2743 O O     . HOH E 5 .   ? 20.299  6.162   36.113 1.00 33.89  ? 555 HOH A O     1 
HETATM 2744 O O     . HOH E 5 .   ? 1.956   -8.919  38.508 1.00 52.55  ? 556 HOH A O     1 
HETATM 2745 O O     . HOH E 5 .   ? 17.760  13.896  29.422 1.00 53.16  ? 557 HOH A O     1 
HETATM 2746 O O     . HOH E 5 .   ? 12.744  -13.817 19.794 1.00 57.64  ? 558 HOH A O     1 
HETATM 2747 O O     . HOH E 5 .   ? 17.739  -16.968 29.480 1.00 41.49  ? 559 HOH A O     1 
HETATM 2748 O O     . HOH E 5 .   ? -0.283  -13.156 31.842 1.00 42.45  ? 560 HOH A O     1 
HETATM 2749 O O     . HOH E 5 .   ? 8.988   -14.395 12.705 1.00 46.93  ? 561 HOH A O     1 
HETATM 2750 O O     . HOH E 5 .   ? 17.149  5.226   39.666 1.00 56.23  ? 562 HOH A O     1 
HETATM 2751 O O     . HOH E 5 .   ? 28.096  -12.898 41.518 1.00 51.01  ? 563 HOH A O     1 
HETATM 2752 O O     . HOH E 5 .   ? 15.805  -13.175 40.306 1.00 41.00  ? 564 HOH A O     1 
HETATM 2753 O O     . HOH E 5 .   ? 14.158  -18.284 34.064 1.00 61.63  ? 565 HOH A O     1 
HETATM 2754 O O     . HOH E 5 .   ? -1.147  -9.009  20.387 1.00 42.37  ? 566 HOH A O     1 
HETATM 2755 O O     . HOH E 5 .   ? -6.373  -0.240  18.649 1.00 56.77  ? 567 HOH A O     1 
HETATM 2756 O O     . HOH E 5 .   ? 6.664   -7.515  42.414 1.00 54.16  ? 568 HOH A O     1 
HETATM 2757 O O     . HOH E 5 .   ? 23.315  14.103  29.566 1.00 66.46  ? 569 HOH A O     1 
HETATM 2758 O O     . HOH E 5 .   ? 14.597  -11.988 18.976 1.00 48.35  ? 570 HOH A O     1 
HETATM 2759 O O     . HOH E 5 .   ? -4.148  -9.550  26.972 1.00 77.60  ? 571 HOH A O     1 
HETATM 2760 O O     . HOH E 5 .   ? 19.547  14.001  34.846 1.00 78.46  ? 572 HOH A O     1 
HETATM 2761 O O     . HOH E 5 .   ? 27.194  -13.550 21.714 1.00 44.39  ? 573 HOH A O     1 
HETATM 2762 O O     . HOH E 5 .   ? 10.653  -14.256 7.109  1.00 67.33  ? 574 HOH A O     1 
HETATM 2763 O O     . HOH E 5 .   ? 8.834   -5.291  42.603 1.00 48.90  ? 575 HOH A O     1 
HETATM 2764 O O     . HOH E 5 .   ? 33.534  -16.456 30.121 1.00 55.90  ? 576 HOH A O     1 
HETATM 2765 O O     . HOH E 5 .   ? 17.810  -1.200  7.574  1.00 54.29  ? 577 HOH A O     1 
HETATM 2766 O O     . HOH E 5 .   ? 3.302   -12.174 7.806  1.00 62.86  ? 578 HOH A O     1 
HETATM 2767 O O     . HOH E 5 .   ? 22.885  -6.111  24.672 1.00 34.90  ? 579 HOH A O     1 
HETATM 2768 O O     . HOH E 5 .   ? 10.647  -17.422 22.522 1.00 54.81  ? 580 HOH A O     1 
HETATM 2769 O O     . HOH E 5 .   ? 11.294  -10.934 17.206 1.00 39.31  ? 581 HOH A O     1 
HETATM 2770 O O     . HOH E 5 .   ? 12.181  -10.562 42.111 1.00 52.71  ? 582 HOH A O     1 
HETATM 2771 O O     . HOH E 5 .   ? 18.666  -20.091 26.521 1.00 41.86  ? 583 HOH A O     1 
HETATM 2772 O O     . HOH E 5 .   ? 16.582  0.637   38.032 1.00 50.62  ? 584 HOH A O     1 
HETATM 2773 O O     . HOH E 5 .   ? 24.311  0.453   18.842 1.00 47.56  ? 585 HOH A O     1 
HETATM 2774 O O     . HOH E 5 .   ? 2.675   -15.147 29.918 1.00 58.64  ? 586 HOH A O     1 
HETATM 2775 O O     . HOH E 5 .   ? 15.311  -12.033 22.386 1.00 45.97  ? 587 HOH A O     1 
HETATM 2776 O O     . HOH E 5 .   ? 20.793  -0.722  32.637 1.00 31.81  ? 588 HOH A O     1 
HETATM 2777 O O     . HOH E 5 .   ? 31.338  -11.563 36.065 1.00 55.45  ? 589 HOH A O     1 
HETATM 2778 O O     . HOH E 5 .   ? 5.505   -16.174 23.790 1.00 48.95  ? 590 HOH A O     1 
HETATM 2779 O O     . HOH E 5 .   ? 17.671  -18.802 33.150 1.00 65.60  ? 591 HOH A O     1 
HETATM 2780 O O     . HOH E 5 .   ? 22.254  -19.227 34.020 1.00 62.57  ? 592 HOH A O     1 
HETATM 2781 O O     . HOH E 5 .   ? 14.259  -2.625  34.640 1.00 50.88  ? 593 HOH A O     1 
HETATM 2782 O O     . HOH E 5 .   ? 14.406  -16.328 22.009 1.00 45.35  ? 594 HOH A O     1 
HETATM 2783 O O     . HOH E 5 .   ? 17.683  6.359   37.280 1.00 33.48  ? 595 HOH A O     1 
HETATM 2784 O O     . HOH E 5 .   ? 2.964   6.091   39.831 1.00 61.06  ? 596 HOH A O     1 
HETATM 2785 O O     . HOH E 5 .   ? 3.888   10.667  13.792 1.00 53.98  ? 597 HOH A O     1 
HETATM 2786 O O     . HOH E 5 .   ? 17.570  -12.709 15.737 1.00 42.01  ? 598 HOH A O     1 
HETATM 2787 O O     . HOH E 5 .   ? 0.740   3.219   7.455  1.00 54.78  ? 599 HOH A O     1 
HETATM 2788 O O     . HOH E 5 .   ? 13.884  -6.442  38.169 1.00 42.55  ? 600 HOH A O     1 
HETATM 2789 O O     . HOH E 5 .   ? 7.186   -16.009 19.545 1.00 49.27  ? 601 HOH A O     1 
HETATM 2790 O O     . HOH E 5 .   ? 22.068  -3.063  35.375 1.00 46.01  ? 602 HOH A O     1 
HETATM 2791 O O     . HOH E 5 .   ? 7.751   -10.556 42.012 1.00 64.40  ? 603 HOH A O     1 
HETATM 2792 O O     . HOH E 5 .   ? -5.382  -4.759  31.312 1.00 72.65  ? 604 HOH A O     1 
HETATM 2793 O O     . HOH E 5 .   ? 38.619  -10.966 43.187 1.00 83.94  ? 605 HOH A O     1 
HETATM 2794 O O     . HOH E 5 .   ? 9.291   2.262   43.462 1.00 58.89  ? 606 HOH A O     1 
HETATM 2795 O O     . HOH E 5 .   ? 7.909   10.966  37.129 1.00 63.14  ? 607 HOH A O     1 
HETATM 2796 O O     . HOH E 5 .   ? 26.266  12.140  25.407 1.00 68.14  ? 608 HOH A O     1 
HETATM 2797 O O     . HOH E 5 .   ? -3.887  -4.435  15.684 1.00 63.38  ? 609 HOH A O     1 
HETATM 2798 O O     . HOH E 5 .   ? 28.921  -3.305  24.595 1.00 70.07  ? 610 HOH A O     1 
HETATM 2799 O O     . HOH E 5 .   ? 18.126  14.093  25.633 1.00 60.31  ? 611 HOH A O     1 
HETATM 2800 O O     . HOH E 5 .   ? 19.093  -18.443 36.789 1.00 58.08  ? 612 HOH A O     1 
HETATM 2801 O O     . HOH E 5 .   ? 13.908  -15.411 16.403 1.00 53.20  ? 613 HOH A O     1 
HETATM 2802 O O     . HOH E 5 .   ? -9.744  -13.673 20.935 1.00 70.95  ? 614 HOH A O     1 
HETATM 2803 O O     . HOH E 5 .   ? 13.552  14.790  10.080 1.00 74.75  ? 615 HOH A O     1 
HETATM 2804 O O     . HOH E 5 .   ? 24.899  13.805  23.005 1.00 65.23  ? 616 HOH A O     1 
HETATM 2805 O O     . HOH E 5 .   ? 15.466  4.942   2.561  1.00 79.70  ? 617 HOH A O     1 
HETATM 2806 O O     . HOH E 5 .   ? 15.794  -19.791 26.984 1.00 44.29  ? 618 HOH A O     1 
HETATM 2807 O O     . HOH E 5 .   ? 20.486  -13.395 16.518 1.00 48.87  ? 619 HOH A O     1 
HETATM 2808 O O     . HOH E 5 .   ? 27.041  -6.760  8.947  1.00 56.47  ? 620 HOH A O     1 
HETATM 2809 O O     . HOH E 5 .   ? -7.646  -3.616  18.236 1.00 74.29  ? 621 HOH A O     1 
HETATM 2810 O O     . HOH E 5 .   ? 28.666  -0.516  16.643 1.00 62.02  ? 622 HOH A O     1 
HETATM 2811 O O     . HOH E 5 .   ? -4.736  -2.929  33.484 1.00 62.69  ? 623 HOH A O     1 
HETATM 2812 O O     . HOH E 5 .   ? 29.206  2.455   27.746 1.00 50.06  ? 624 HOH A O     1 
HETATM 2813 O O     . HOH E 5 .   ? 15.645  -2.050  40.441 1.00 53.76  ? 625 HOH A O     1 
HETATM 2814 O O     . HOH E 5 .   ? -6.388  -5.413  20.876 1.00 84.04  ? 626 HOH A O     1 
HETATM 2815 O O     . HOH E 5 .   ? -2.730  -13.443 28.627 1.00 73.20  ? 627 HOH A O     1 
HETATM 2816 O O     . HOH E 5 .   ? 22.861  -7.998  40.135 1.00 66.96  ? 628 HOH A O     1 
HETATM 2817 O O     . HOH E 5 .   ? 27.218  -4.356  36.039 1.00 51.16  ? 629 HOH A O     1 
HETATM 2818 O O     . HOH E 5 .   ? 5.772   -0.417  3.205  1.00 76.62  ? 630 HOH A O     1 
HETATM 2819 O O     . HOH E 5 .   ? 17.865  -9.778  40.744 1.00 50.24  ? 631 HOH A O     1 
HETATM 2820 O O     . HOH E 5 .   ? 14.937  -11.183 42.144 1.00 53.83  ? 632 HOH A O     1 
HETATM 2821 O O     . HOH E 5 .   ? 6.149   -16.482 16.898 1.00 65.37  ? 633 HOH A O     1 
HETATM 2822 O O     . HOH E 5 .   ? 11.278  -17.039 5.987  1.00 84.93  ? 634 HOH A O     1 
HETATM 2823 O O     . HOH E 5 .   ? 8.129   13.573  32.528 1.00 61.62  ? 635 HOH A O     1 
HETATM 2824 O O     . HOH E 5 .   ? -5.987  -8.157  16.971 1.00 68.01  ? 636 HOH A O     1 
HETATM 2825 O O     . HOH E 5 .   ? 14.869  -12.835 16.139 1.00 51.22  ? 637 HOH A O     1 
HETATM 2826 O O     . HOH E 5 .   ? 0.003   -14.241 10.448 1.00 71.14  ? 638 HOH A O     1 
HETATM 2827 O O     . HOH E 5 .   ? 8.629   -18.414 34.313 1.00 60.30  ? 639 HOH A O     1 
HETATM 2828 O O     . HOH E 5 .   ? 28.506  -15.387 17.980 1.00 72.22  ? 640 HOH A O     1 
HETATM 2829 O O     . HOH E 5 .   ? 11.928  14.787  30.658 1.00 60.46  ? 641 HOH A O     1 
HETATM 2830 O O     . HOH E 5 .   ? -5.899  -6.698  29.468 1.00 66.59  ? 642 HOH A O     1 
HETATM 2831 O O     . HOH E 5 .   ? 24.665  -12.669 11.319 1.00 71.74  ? 643 HOH A O     1 
HETATM 2832 O O     . HOH E 5 .   ? 16.831  -22.697 23.967 1.00 59.53  ? 644 HOH A O     1 
HETATM 2833 O O     . HOH E 5 .   ? 20.409  -1.028  8.331  1.00 64.27  ? 645 HOH A O     1 
HETATM 2834 O O     . HOH E 5 .   ? 1.304   10.078  13.195 1.00 68.98  ? 646 HOH A O     1 
HETATM 2835 O O     . HOH E 5 .   ? 20.994  -20.266 36.141 1.00 63.52  ? 647 HOH A O     1 
HETATM 2836 O O     . HOH E 5 .   ? 12.075  -4.120  42.467 1.00 55.73  ? 648 HOH A O     1 
HETATM 2837 O O     . HOH E 5 .   ? 14.112  -2.773  38.308 1.00 41.55  ? 649 HOH A O     1 
HETATM 2838 O O     . HOH E 5 .   ? -1.028  5.817   11.156 1.00 70.23  ? 650 HOH A O     1 
HETATM 2839 O O     . HOH E 5 .   ? 15.388  -19.391 29.648 1.00 61.28  ? 651 HOH A O     1 
HETATM 2840 O O     . HOH E 5 .   ? 5.699   14.726  14.044 1.00 70.06  ? 652 HOH A O     1 
HETATM 2841 O O     . HOH E 5 .   ? 20.834  2.616   11.139 1.00 69.87  ? 653 HOH A O     1 
HETATM 2842 O O     . HOH E 5 .   ? 20.978  4.335   14.929 1.00 59.91  ? 654 HOH A O     1 
HETATM 2843 O O     . HOH E 5 .   ? -7.191  -11.139 28.755 1.00 75.62  ? 655 HOH A O     1 
HETATM 2844 O O     . HOH E 5 .   ? 15.351  -19.921 32.264 1.00 67.58  ? 656 HOH A O     1 
HETATM 2845 O O     . HOH E 5 .   ? 8.444   -5.970  5.422  1.00 58.71  ? 657 HOH A O     1 
HETATM 2846 O O     . HOH E 5 .   ? 22.536  -17.187 20.175 1.00 47.21  ? 658 HOH A O     1 
HETATM 2847 O O     . HOH E 5 .   ? 9.260   11.361  11.329 1.00 51.80  ? 659 HOH A O     1 
HETATM 2848 O O     . HOH E 5 .   ? 15.397  14.137  21.544 1.00 74.17  ? 660 HOH A O     1 
HETATM 2849 O O     . HOH E 5 .   ? -0.434  -14.908 28.787 1.00 71.96  ? 661 HOH A O     1 
HETATM 2850 O O     . HOH E 5 .   ? 10.282  -16.408 13.920 1.00 59.80  ? 662 HOH A O     1 
HETATM 2851 O O     . HOH E 5 .   ? 13.298  -18.727 5.192  1.00 82.91  ? 663 HOH A O     1 
HETATM 2852 O O     . HOH E 5 .   ? 26.608  1.239   17.597 1.00 57.40  ? 664 HOH A O     1 
HETATM 2853 O O     . HOH E 5 .   ? 24.985  -17.038 18.521 1.00 66.55  ? 665 HOH A O     1 
HETATM 2854 O O     . HOH E 5 .   ? -8.863  -4.037  28.258 1.00 69.66  ? 666 HOH A O     1 
HETATM 2855 O O     . HOH E 5 .   ? 6.721   12.398  11.693 1.00 60.74  ? 667 HOH A O     1 
HETATM 2856 O O     . HOH E 5 .   ? 24.134  -21.926 37.664 1.00 54.13  ? 668 HOH A O     1 
HETATM 2857 O O     . HOH E 5 .   ? 14.261  -22.077 33.508 1.00 63.44  ? 669 HOH A O     1 
HETATM 2858 O O     . HOH E 5 .   ? -6.289  0.917   37.010 1.00 75.44  ? 670 HOH A O     1 
HETATM 2859 O O     . HOH E 5 .   ? 3.793   14.473  12.132 1.00 80.20  ? 671 HOH A O     1 
HETATM 2860 O O     . HOH E 5 .   ? -1.684  10.612  13.551 1.00 66.44  ? 672 HOH A O     1 
HETATM 2861 O O     . HOH E 5 .   ? -9.610  -14.103 30.813 1.00 71.76  ? 673 HOH A O     1 
HETATM 2862 O O     . HOH F 5 .   ? 37.329  -16.424 80.153 1.00 86.86  ? 101 HOH C O     1 
HETATM 2863 O O     . HOH F 5 .   ? 34.052  -7.357  53.749 1.00 55.86  ? 102 HOH C O     1 
HETATM 2864 O O     . HOH F 5 .   ? 29.343  7.122   38.897 1.00 67.50  ? 103 HOH C O     1 
HETATM 2865 O O     . HOH F 5 .   ? 31.445  -17.273 71.814 1.00 72.77  ? 104 HOH C O     1 
HETATM 2866 O O     . HOH F 5 .   ? 23.089  3.341   44.444 1.00 55.03  ? 105 HOH C O     1 
HETATM 2867 O O     . HOH F 5 .   ? 30.417  6.990   33.890 1.00 54.56  ? 106 HOH C O     1 
HETATM 2868 O O     . HOH F 5 .   ? 37.340  1.571   67.508 1.00 86.51  ? 107 HOH C O     1 
HETATM 2869 O O     . HOH F 5 .   ? 23.228  -0.283  37.955 1.00 45.51  ? 108 HOH C O     1 
HETATM 2870 O O     . HOH F 5 .   ? 28.133  4.434   15.327 1.00 67.30  ? 109 HOH C O     1 
HETATM 2871 O O     . HOH F 5 .   ? 23.561  8.849   42.435 1.00 56.16  ? 110 HOH C O     1 
HETATM 2872 O O     . HOH F 5 .   ? 39.374  -5.408  60.413 1.00 100.43 ? 111 HOH C O     1 
HETATM 2873 O O     . HOH F 5 .   ? 41.421  -7.463  44.416 1.00 70.55  ? 112 HOH C O     1 
HETATM 2874 O O     . HOH F 5 .   ? 37.126  1.778   55.555 1.00 70.76  ? 113 HOH C O     1 
HETATM 2875 O O     . HOH F 5 .   ? 36.390  -5.186  75.036 1.00 80.55  ? 114 HOH C O     1 
HETATM 2876 O O     . HOH F 5 .   ? 32.952  0.789   59.663 1.00 67.25  ? 115 HOH C O     1 
HETATM 2877 O O     . HOH F 5 .   ? 33.806  -7.719  50.840 1.00 62.45  ? 116 HOH C O     1 
HETATM 2878 O O     . HOH F 5 .   ? 38.315  -0.154  50.112 1.00 58.29  ? 117 HOH C O     1 
HETATM 2879 O O     . HOH F 5 .   ? 34.795  -4.963  42.482 1.00 57.96  ? 118 HOH C O     1 
HETATM 2880 O O     . HOH F 5 .   ? 39.424  -1.110  65.231 1.00 73.43  ? 119 HOH C O     1 
HETATM 2881 O O     . HOH F 5 .   ? 32.868  4.355   23.681 1.00 68.58  ? 120 HOH C O     1 
HETATM 2882 O O     . HOH F 5 .   ? 34.348  -6.610  76.132 1.00 84.40  ? 121 HOH C O     1 
HETATM 2883 O O     . HOH F 5 .   ? 25.202  -2.683  39.261 1.00 53.33  ? 122 HOH C O     1 
HETATM 2884 O O     . HOH F 5 .   ? 30.710  -3.263  65.640 1.00 65.95  ? 123 HOH C O     1 
HETATM 2885 O O     . HOH F 5 .   ? 26.117  1.342   45.313 1.00 61.56  ? 124 HOH C O     1 
HETATM 2886 O O     . HOH F 5 .   ? 29.719  -5.777  49.161 1.00 60.57  ? 125 HOH C O     1 
HETATM 2887 O O     . HOH F 5 .   ? 37.907  -8.458  50.745 1.00 49.82  ? 126 HOH C O     1 
HETATM 2888 O O     . HOH F 5 .   ? 29.031  12.278  23.881 1.00 70.45  ? 127 HOH C O     1 
HETATM 2889 O O     . HOH F 5 .   ? 32.916  -17.276 78.396 1.00 82.65  ? 128 HOH C O     1 
HETATM 2890 O O     . HOH F 5 .   ? 22.376  3.084   36.850 1.00 51.47  ? 129 HOH C O     1 
HETATM 2891 O O     . HOH F 5 .   ? 27.437  8.800   39.980 1.00 64.14  ? 130 HOH C O     1 
HETATM 2892 O O     . HOH F 5 .   ? 30.474  8.194   31.443 1.00 54.86  ? 131 HOH C O     1 
HETATM 2893 O O     . HOH F 5 .   ? 28.824  2.991   18.699 1.00 62.20  ? 132 HOH C O     1 
HETATM 2894 O O     . HOH F 5 .   ? 31.909  -9.662  47.448 1.00 46.56  ? 133 HOH C O     1 
HETATM 2895 O O     . HOH F 5 .   ? 39.811  -1.564  68.459 1.00 79.09  ? 134 HOH C O     1 
HETATM 2896 O O     . HOH F 5 .   ? 27.077  12.078  37.901 1.00 69.89  ? 135 HOH C O     1 
HETATM 2897 O O     . HOH F 5 .   ? 26.292  5.255   43.139 1.00 62.86  ? 136 HOH C O     1 
HETATM 2898 O O     . HOH F 5 .   ? 31.560  -7.382  68.195 1.00 70.51  ? 137 HOH C O     1 
HETATM 2899 O O     . HOH F 5 .   ? 38.978  -1.433  47.002 1.00 76.93  ? 138 HOH C O     1 
HETATM 2900 O O     . HOH F 5 .   ? 27.207  -2.099  48.065 1.00 78.62  ? 139 HOH C O     1 
HETATM 2901 O O     . HOH F 5 .   ? 36.378  -13.428 71.206 1.00 76.79  ? 140 HOH C O     1 
HETATM 2902 O O     . HOH F 5 .   ? 33.067  4.644   27.354 1.00 67.30  ? 141 HOH C O     1 
HETATM 2903 O O     . HOH F 5 .   ? 36.628  5.301   69.002 1.00 86.11  ? 142 HOH C O     1 
HETATM 2904 O O     . HOH F 5 .   ? 37.237  -3.855  45.054 1.00 51.55  ? 143 HOH C O     1 
HETATM 2905 O O     . HOH F 5 .   ? 35.466  1.514   58.851 1.00 62.02  ? 144 HOH C O     1 
HETATM 2906 O O     . HOH F 5 .   ? 31.294  -6.775  51.271 1.00 54.05  ? 145 HOH C O     1 
HETATM 2907 O O     . HOH F 5 .   ? 33.106  10.246  29.568 1.00 66.23  ? 146 HOH C O     1 
HETATM 2908 O O     . HOH F 5 .   ? 38.874  -14.273 71.830 1.00 74.50  ? 147 HOH C O     1 
HETATM 2909 O O     . HOH F 5 .   ? 33.992  18.089  -0.153 1.00 106.49 ? 148 HOH C O     1 
HETATM 2910 O O     . HOH F 5 .   ? 29.984  5.999   29.938 1.00 56.71  ? 149 HOH C O     1 
HETATM 2911 O O     . HOH F 5 .   ? 34.178  -13.986 78.225 1.00 93.67  ? 150 HOH C O     1 
HETATM 2912 O O     . HOH F 5 .   ? 17.900  2.724   39.045 1.00 50.42  ? 151 HOH C O     1 
HETATM 2913 O O     . HOH F 5 .   ? 31.933  -5.343  75.951 1.00 90.13  ? 152 HOH C O     1 
HETATM 2914 O O     . HOH F 5 .   ? 30.919  -10.411 69.229 1.00 78.85  ? 153 HOH C O     1 
HETATM 2915 O O     . HOH F 5 .   ? 41.193  -3.387  60.546 1.00 68.25  ? 154 HOH C O     1 
HETATM 2916 O O     . HOH F 5 .   ? 40.755  -3.177  64.035 1.00 76.43  ? 155 HOH C O     1 
HETATM 2917 O O     . HOH F 5 .   ? 32.083  2.396   22.017 1.00 62.39  ? 156 HOH C O     1 
HETATM 2918 O O     . HOH F 5 .   ? 22.720  1.167   46.069 1.00 68.65  ? 157 HOH C O     1 
HETATM 2919 O O     . HOH F 5 .   ? 25.636  -6.423  38.335 1.00 54.28  ? 158 HOH C O     1 
HETATM 2920 O O     . HOH F 5 .   ? 23.959  5.675   45.465 1.00 68.38  ? 159 HOH C O     1 
HETATM 2921 O O     . HOH F 5 .   ? 34.665  -15.884 80.131 1.00 86.49  ? 160 HOH C O     1 
HETATM 2922 O O     . HOH F 5 .   ? 35.698  0.244   70.733 1.00 88.39  ? 161 HOH C O     1 
HETATM 2923 O O     . HOH F 5 .   ? 29.687  -12.831 69.470 1.00 76.07  ? 162 HOH C O     1 
HETATM 2924 O O     . HOH G 5 .   ? 23.515  -7.252  31.732 1.00 33.46  ? 101 HOH D O     1 
HETATM 2925 O O     . HOH G 5 .   ? 17.770  12.452  22.122 1.00 72.73  ? 102 HOH D O     1 
HETATM 2926 O O     . HOH G 5 .   ? 29.275  5.083   49.613 1.00 61.29  ? 103 HOH D O     1 
HETATM 2927 O O     . HOH G 5 .   ? 20.116  -7.878  30.271 1.00 30.40  ? 104 HOH D O     1 
HETATM 2928 O O     . HOH G 5 .   ? 25.938  -1.017  55.000 1.00 69.49  ? 105 HOH D O     1 
HETATM 2929 O O     . HOH G 5 .   ? 35.901  14.102  -2.616 1.00 90.91  ? 106 HOH D O     1 
HETATM 2930 O O     . HOH G 5 .   ? 30.473  -0.832  59.841 1.00 58.42  ? 107 HOH D O     1 
HETATM 2931 O O     . HOH G 5 .   ? 28.827  2.169   46.574 1.00 53.10  ? 108 HOH D O     1 
HETATM 2932 O O     . HOH G 5 .   ? 26.643  -1.010  23.856 1.00 40.02  ? 109 HOH D O     1 
HETATM 2933 O O     . HOH G 5 .   ? 25.759  -2.065  35.897 1.00 52.54  ? 110 HOH D O     1 
HETATM 2934 O O     . HOH G 5 .   ? 28.813  -3.335  49.978 1.00 54.52  ? 111 HOH D O     1 
HETATM 2935 O O     . HOH G 5 .   ? 35.828  2.263   53.215 1.00 66.64  ? 112 HOH D O     1 
HETATM 2936 O O     . HOH G 5 .   ? 41.374  -5.516  65.277 1.00 74.56  ? 113 HOH D O     1 
HETATM 2937 O O     . HOH G 5 .   ? 50.549  -13.328 68.502 1.00 87.95  ? 114 HOH D O     1 
HETATM 2938 O O     . HOH G 5 .   ? 32.853  2.439   57.309 1.00 52.70  ? 115 HOH D O     1 
HETATM 2939 O O     . HOH G 5 .   ? 40.308  -6.883  62.514 1.00 68.20  ? 116 HOH D O     1 
HETATM 2940 O O     . HOH G 5 .   ? 33.312  18.731  11.328 1.00 105.48 ? 117 HOH D O     1 
HETATM 2941 O O     . HOH G 5 .   ? 30.006  -3.839  37.492 1.00 56.04  ? 118 HOH D O     1 
HETATM 2942 O O     . HOH G 5 .   ? 38.398  -4.734  76.765 1.00 87.12  ? 119 HOH D O     1 
HETATM 2943 O O     . HOH G 5 .   ? 39.857  9.119   49.044 1.00 88.00  ? 120 HOH D O     1 
HETATM 2944 O O     . HOH G 5 .   ? 43.155  -11.224 61.633 1.00 81.62  ? 121 HOH D O     1 
HETATM 2945 O O     . HOH G 5 .   ? 29.789  -3.851  63.089 1.00 60.30  ? 122 HOH D O     1 
HETATM 2946 O O     . HOH G 5 .   ? 25.378  -6.819  29.665 1.00 33.99  ? 123 HOH D O     1 
HETATM 2947 O O     . HOH G 5 .   ? 20.554  6.858   17.597 1.00 49.39  ? 124 HOH D O     1 
HETATM 2948 O O     . HOH G 5 .   ? 28.313  -4.492  54.285 1.00 59.25  ? 125 HOH D O     1 
HETATM 2949 O O     . HOH G 5 .   ? 29.849  1.750   30.523 1.00 55.70  ? 126 HOH D O     1 
HETATM 2950 O O     . HOH G 5 .   ? 18.054  -5.344  32.104 1.00 28.64  ? 127 HOH D O     1 
HETATM 2951 O O     . HOH G 5 .   ? 26.357  -13.737 62.462 1.00 59.52  ? 128 HOH D O     1 
HETATM 2952 O O     . HOH G 5 .   ? 30.683  4.749   46.492 1.00 57.13  ? 129 HOH D O     1 
HETATM 2953 O O     . HOH G 5 .   ? 36.152  -11.621 59.129 1.00 46.62  ? 130 HOH D O     1 
HETATM 2954 O O     . HOH G 5 .   ? 40.383  -2.954  76.304 1.00 86.11  ? 131 HOH D O     1 
HETATM 2955 O O     . HOH G 5 .   ? 27.663  13.255  21.196 1.00 60.61  ? 132 HOH D O     1 
HETATM 2956 O O     . HOH G 5 .   ? 37.162  -5.453  79.462 1.00 91.38  ? 133 HOH D O     1 
HETATM 2957 O O     . HOH G 5 .   ? 36.957  -1.810  42.855 1.00 70.31  ? 134 HOH D O     1 
HETATM 2958 O O     . HOH G 5 .   ? 31.497  -10.588 58.265 1.00 58.34  ? 135 HOH D O     1 
HETATM 2959 O O     . HOH G 5 .   ? 30.886  -7.969  65.389 1.00 62.38  ? 136 HOH D O     1 
HETATM 2960 O O     . HOH G 5 .   ? 22.580  -0.274  34.798 1.00 37.40  ? 137 HOH D O     1 
HETATM 2961 O O     . HOH G 5 .   ? 34.107  15.174  3.987  1.00 89.64  ? 138 HOH D O     1 
HETATM 2962 O O     . HOH G 5 .   ? 32.541  4.939   34.414 1.00 75.97  ? 139 HOH D O     1 
HETATM 2963 O O     . HOH G 5 .   ? 25.156  5.881   17.143 1.00 60.40  ? 140 HOH D O     1 
HETATM 2964 O O     . HOH G 5 .   ? 34.963  -15.663 58.705 1.00 46.52  ? 141 HOH D O     1 
HETATM 2965 O O     . HOH G 5 .   ? 21.267  4.649   18.985 1.00 41.86  ? 142 HOH D O     1 
HETATM 2966 O O     . HOH G 5 .   ? 37.844  0.187   44.485 1.00 74.13  ? 143 HOH D O     1 
HETATM 2967 O O     A HOH G 5 .   ? 27.670  1.284   49.566 0.61 38.30  ? 144 HOH D O     1 
HETATM 2968 O O     B HOH G 5 .   ? 27.619  0.552   48.588 0.39 33.12  ? 144 HOH D O     1 
HETATM 2969 O O     . HOH G 5 .   ? 39.057  -16.932 60.450 1.00 61.59  ? 145 HOH D O     1 
HETATM 2970 O O     . HOH G 5 .   ? 27.468  -7.835  57.300 1.00 52.15  ? 146 HOH D O     1 
HETATM 2971 O O     . HOH G 5 .   ? 34.937  -6.189  36.059 1.00 63.48  ? 147 HOH D O     1 
HETATM 2972 O O     . HOH G 5 .   ? 33.364  -9.608  56.525 1.00 53.56  ? 148 HOH D O     1 
HETATM 2973 O O     . HOH G 5 .   ? 34.107  0.252   32.222 1.00 61.35  ? 149 HOH D O     1 
HETATM 2974 O O     . HOH G 5 .   ? 36.500  11.111  12.177 1.00 70.60  ? 150 HOH D O     1 
HETATM 2975 O O     . HOH G 5 .   ? 30.549  -7.178  29.977 1.00 60.52  ? 151 HOH D O     1 
HETATM 2976 O O     . HOH G 5 .   ? 18.965  13.831  18.765 1.00 72.08  ? 152 HOH D O     1 
HETATM 2977 O O     . HOH G 5 .   ? 30.870  4.017   31.609 1.00 53.64  ? 153 HOH D O     1 
HETATM 2978 O O     . HOH G 5 .   ? 30.311  -6.252  53.724 1.00 54.87  ? 154 HOH D O     1 
HETATM 2979 O O     . HOH G 5 .   ? 30.681  3.173   59.299 1.00 61.51  ? 155 HOH D O     1 
HETATM 2980 O O     . HOH G 5 .   ? 36.450  5.342   -4.008 1.00 123.56 ? 156 HOH D O     1 
HETATM 2981 O O     . HOH G 5 .   ? 41.731  3.190   38.828 1.00 71.05  ? 157 HOH D O     1 
HETATM 2982 O O     . HOH G 5 .   ? 45.652  -5.004  70.605 1.00 84.27  ? 158 HOH D O     1 
HETATM 2983 O O     . HOH G 5 .   ? 41.268  -15.618 61.364 1.00 68.62  ? 159 HOH D O     1 
HETATM 2984 O O     . HOH G 5 .   ? 29.003  -1.441  62.049 1.00 60.56  ? 160 HOH D O     1 
HETATM 2985 O O     . HOH G 5 .   ? 32.091  -1.028  30.719 1.00 81.89  ? 161 HOH D O     1 
HETATM 2986 O O     . HOH G 5 .   ? 22.613  -5.583  34.483 1.00 55.26  ? 162 HOH D O     1 
HETATM 2987 O O     . HOH G 5 .   ? 29.124  -6.031  64.598 1.00 67.90  ? 163 HOH D O     1 
HETATM 2988 O O     . HOH G 5 .   ? 34.426  4.426   55.279 1.00 66.89  ? 164 HOH D O     1 
HETATM 2989 O O     . HOH G 5 .   ? 34.158  -13.161 58.188 1.00 50.35  ? 165 HOH D O     1 
HETATM 2990 O O     . HOH G 5 .   ? 25.432  6.603   60.486 1.00 69.00  ? 166 HOH D O     1 
HETATM 2991 O O     . HOH G 5 .   ? 38.085  -4.836  35.223 1.00 70.45  ? 167 HOH D O     1 
HETATM 2992 O O     . HOH G 5 .   ? 44.971  -18.660 64.616 1.00 85.79  ? 168 HOH D O     1 
HETATM 2993 O O     . HOH G 5 .   ? 27.612  3.431   51.516 1.00 64.17  ? 169 HOH D O     1 
HETATM 2994 O O     . HOH G 5 .   ? 19.815  13.836  23.287 1.00 54.48  ? 170 HOH D O     1 
HETATM 2995 O O     . HOH G 5 .   ? 29.201  -9.855  56.756 1.00 54.62  ? 171 HOH D O     1 
HETATM 2996 O O     . HOH G 5 .   ? 26.809  -9.809  65.683 1.00 72.53  ? 172 HOH D O     1 
HETATM 2997 O O     . HOH G 5 .   ? 22.948  4.199   16.879 1.00 51.95  ? 173 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 26  ? 1.0712 0.7875 0.6850 0.0699  -0.1156 -0.0126 107 LYS A N     
2    C CA    . LYS A 26  ? 1.0720 0.7764 0.6666 0.0685  -0.1021 -0.0135 107 LYS A CA    
3    C C     . LYS A 26  ? 1.1148 0.7787 0.6785 0.0592  -0.1040 -0.0088 107 LYS A C     
4    O O     . LYS A 26  ? 1.1291 0.7656 0.6787 0.0606  -0.1157 -0.0083 107 LYS A O     
5    C CB    . LYS A 26  ? 1.1060 0.8094 0.6983 0.0857  -0.0999 -0.0230 107 LYS A CB    
6    N N     . VAL A 27  ? 1.0413 0.7022 0.5944 0.0499  -0.0926 -0.0054 108 VAL A N     
7    C CA    . VAL A 27  ? 1.0367 0.6650 0.5633 0.0421  -0.0919 -0.0018 108 VAL A CA    
8    C C     . VAL A 27  ? 1.0471 0.6603 0.5589 0.0482  -0.0855 -0.0058 108 VAL A C     
9    O O     . VAL A 27  ? 1.0370 0.6644 0.5535 0.0503  -0.0757 -0.0083 108 VAL A O     
10   C CB    . VAL A 27  ? 1.0821 0.7131 0.6058 0.0283  -0.0870 0.0045  108 VAL A CB    
11   C CG1   . VAL A 27  ? 1.0973 0.6986 0.5953 0.0236  -0.0842 0.0062  108 VAL A CG1   
12   C CG2   . VAL A 27  ? 1.0721 0.7096 0.6062 0.0211  -0.0973 0.0092  108 VAL A CG2   
13   N N     . ASP A 28  ? 0.9784 0.5622 0.4716 0.0502  -0.0919 -0.0060 109 ASP A N     
14   C CA    . ASP A 28  ? 0.9571 0.5224 0.4353 0.0538  -0.0890 -0.0084 109 ASP A CA    
15   C C     . ASP A 28  ? 0.9284 0.4787 0.3903 0.0437  -0.0819 -0.0039 109 ASP A C     
16   O O     . ASP A 28  ? 0.9346 0.4666 0.3823 0.0382  -0.0854 0.0000  109 ASP A O     
17   C CB    . ASP A 28  ? 1.0017 0.5439 0.4692 0.0603  -0.1012 -0.0099 109 ASP A CB    
18   C CG    . ASP A 28  ? 1.2196 0.7445 0.6751 0.0651  -0.1013 -0.0127 109 ASP A CG    
19   O OD1   . ASP A 28  ? 1.2327 0.7686 0.6975 0.0754  -0.1010 -0.0191 109 ASP A OD1   
20   O OD2   . ASP A 28  ? 1.3463 0.8466 0.7825 0.0585  -0.1020 -0.0085 109 ASP A OD2   
21   N N     . ARG A 29  ? 0.8233 0.3823 0.2871 0.0419  -0.0720 -0.0049 110 ARG A N     
22   C CA    . ARG A 29  ? 0.8052 0.3539 0.2572 0.0340  -0.0654 -0.0017 110 ARG A CA    
23   C C     . ARG A 29  ? 0.8332 0.3671 0.2752 0.0356  -0.0636 -0.0030 110 ARG A C     
24   O O     . ARG A 29  ? 0.8352 0.3616 0.2692 0.0298  -0.0585 -0.0007 110 ARG A O     
25   C CB    . ARG A 29  ? 0.8199 0.3866 0.2803 0.0299  -0.0574 -0.0013 110 ARG A CB    
26   C CG    . ARG A 29  ? 0.8925 0.4707 0.3605 0.0241  -0.0596 0.0022  110 ARG A CG    
27   C CD    . ARG A 29  ? 1.0428 0.6427 0.5218 0.0210  -0.0531 0.0028  110 ARG A CD    
28   N NE    . ARG A 29  ? 1.1397 0.7356 0.6112 0.0197  -0.0459 0.0019  110 ARG A NE    
29   C CZ    . ARG A 29  ? 1.3002 0.9097 0.7762 0.0221  -0.0397 -0.0002 110 ARG A CZ    
30   N NH1   . ARG A 29  ? 1.1184 0.7495 0.6075 0.0266  -0.0381 -0.0021 110 ARG A NH1   
31   N NH2   . ARG A 29  ? 1.1180 0.7201 0.5854 0.0208  -0.0353 -0.0009 110 ARG A NH2   
32   N N     . PHE A 30  ? 0.7695 0.2989 0.2123 0.0436  -0.0689 -0.0069 111 PHE A N     
33   C CA    . PHE A 30  ? 0.7625 0.2768 0.1962 0.0443  -0.0693 -0.0079 111 PHE A CA    
34   C C     . PHE A 30  ? 0.8257 0.3177 0.2486 0.0473  -0.0798 -0.0075 111 PHE A C     
35   O O     . PHE A 30  ? 0.8077 0.2889 0.2266 0.0522  -0.0847 -0.0106 111 PHE A O     
36   C CB    . PHE A 30  ? 0.7665 0.2919 0.2070 0.0507  -0.0658 -0.0133 111 PHE A CB    
37   C CG    . PHE A 30  ? 0.7639 0.3072 0.2112 0.0460  -0.0561 -0.0125 111 PHE A CG    
38   C CD1   . PHE A 30  ? 0.7872 0.3251 0.2291 0.0380  -0.0510 -0.0092 111 PHE A CD1   
39   C CD2   . PHE A 30  ? 0.7825 0.3483 0.2416 0.0490  -0.0527 -0.0142 111 PHE A CD2   
40   C CE1   . PHE A 30  ? 0.7910 0.3416 0.2369 0.0343  -0.0443 -0.0086 111 PHE A CE1   
41   C CE2   . PHE A 30  ? 0.8083 0.3873 0.2707 0.0431  -0.0450 -0.0122 111 PHE A CE2   
42   C CZ    . PHE A 30  ? 0.7778 0.3470 0.2324 0.0360  -0.0418 -0.0094 111 PHE A CZ    
43   N N     . ASN A 31  ? 0.8141 0.2960 0.2295 0.0437  -0.0845 -0.0034 112 ASN A N     
44   C CA    . ASN A 31  ? 0.8399 0.2965 0.2403 0.0436  -0.0948 -0.0011 112 ASN A CA    
45   C C     . ASN A 31  ? 0.8916 0.3415 0.2945 0.0555  -0.1057 -0.0072 112 ASN A C     
46   O O     . ASN A 31  ? 0.9174 0.3464 0.3088 0.0553  -0.1120 -0.0067 112 ASN A O     
47   C CB    . ASN A 31  ? 0.8367 0.2789 0.2239 0.0330  -0.0900 0.0047  112 ASN A CB    
48   C CG    . ASN A 31  ? 0.9487 0.3642 0.3165 0.0279  -0.0983 0.0103  112 ASN A CG    
49   O OD1   . ASN A 31  ? 0.8655 0.2707 0.2260 0.0306  -0.1069 0.0111  112 ASN A OD1   
50   N ND2   . ASN A 31  ? 0.8747 0.2783 0.2339 0.0198  -0.0966 0.0148  112 ASN A ND2   
51   N N     . GLY A 32  ? 0.8715 0.3407 0.2902 0.0660  -0.1076 -0.0132 113 GLY A N     
52   C CA    . GLY A 32  ? 0.8849 0.3527 0.3084 0.0806  -0.1172 -0.0210 113 GLY A CA    
53   C C     . GLY A 32  ? 0.9420 0.4138 0.3676 0.0880  -0.1140 -0.0274 113 GLY A C     
54   O O     . GLY A 32  ? 0.9569 0.4238 0.3829 0.1018  -0.1231 -0.0349 113 GLY A O     
55   N N     . VAL A 33  ? 0.8960 0.3752 0.3216 0.0801  -0.1025 -0.0253 114 VAL A N     
56   C CA    . VAL A 33  ? 0.8865 0.3688 0.3122 0.0865  -0.0995 -0.0313 114 VAL A CA    
57   C C     . VAL A 33  ? 0.8867 0.4032 0.3297 0.0929  -0.0895 -0.0360 114 VAL A C     
58   O O     . VAL A 33  ? 0.8513 0.3847 0.3024 0.0840  -0.0808 -0.0310 114 VAL A O     
59   C CB    . VAL A 33  ? 0.9359 0.4077 0.3530 0.0744  -0.0940 -0.0263 114 VAL A CB    
60   C CG1   . VAL A 33  ? 0.9309 0.4045 0.3465 0.0811  -0.0922 -0.0327 114 VAL A CG1   
61   C CG2   . VAL A 33  ? 0.9431 0.3852 0.3450 0.0659  -0.1027 -0.0201 114 VAL A CG2   
62   N N     . SER A 34  ? 0.8686 0.3949 0.3161 0.1081  -0.0910 -0.0452 115 SER A N     
63   C CA    . SER A 34  ? 0.8532 0.4151 0.3169 0.1137  -0.0800 -0.0491 115 SER A CA    
64   C C     . SER A 34  ? 0.9048 0.4760 0.3658 0.1052  -0.0675 -0.0466 115 SER A C     
65   O O     . SER A 34  ? 0.9150 0.4658 0.3621 0.1018  -0.0689 -0.0462 115 SER A O     
66   C CB    . SER A 34  ? 0.8888 0.4599 0.3565 0.1338  -0.0837 -0.0606 115 SER A CB    
67   O OG    . SER A 34  ? 0.9358 0.4916 0.3883 0.1405  -0.0844 -0.0665 115 SER A OG    
68   N N     . GLU A 35  ? 0.8506 0.4520 0.3248 0.1016  -0.0566 -0.0446 116 GLU A N     
69   C CA    . GLU A 35  ? 0.8553 0.4660 0.3260 0.0941  -0.0456 -0.0422 116 GLU A CA    
70   C C     . GLU A 35  ? 0.9212 0.5289 0.3815 0.1056  -0.0439 -0.0505 116 GLU A C     
71   O O     . GLU A 35  ? 0.9049 0.5001 0.3529 0.1003  -0.0416 -0.0493 116 GLU A O     
72   C CB    . GLU A 35  ? 0.8632 0.5061 0.3492 0.0881  -0.0361 -0.0381 116 GLU A CB    
73   N N     . ALA A 36  ? 0.9037 0.5203 0.3677 0.1225  -0.0466 -0.0596 117 ALA A N     
74   C CA    . ALA A 36  ? 0.9152 0.5268 0.3667 0.1371  -0.0466 -0.0696 117 ALA A CA    
75   C C     . ALA A 36  ? 0.9754 0.5475 0.4066 0.1359  -0.0574 -0.0705 117 ALA A C     
76   O O     . ALA A 36  ? 0.9932 0.5574 0.4108 0.1371  -0.0549 -0.0734 117 ALA A O     
77   C CB    . ALA A 36  ? 0.9216 0.5464 0.3813 0.1572  -0.0504 -0.0800 117 ALA A CB    
78   N N     . GLU A 37  ? 0.9096 0.4570 0.3384 0.1317  -0.0695 -0.0671 118 GLU A N     
79   C CA    . GLU A 37  ? 0.9167 0.4280 0.3286 0.1271  -0.0803 -0.0657 118 GLU A CA    
80   C C     . GLU A 37  ? 0.9201 0.4288 0.3289 0.1108  -0.0738 -0.0580 118 GLU A C     
81   O O     . GLU A 37  ? 0.9189 0.4112 0.3153 0.1106  -0.0771 -0.0601 118 GLU A O     
82   C CB    . GLU A 37  ? 0.9485 0.4375 0.3587 0.1234  -0.0929 -0.0615 118 GLU A CB    
83   C CG    . GLU A 37  ? 1.1603 0.6134 0.5540 0.1170  -0.1046 -0.0589 118 GLU A CG    
84   C CD    . GLU A 37  ? 1.4767 0.9034 0.8637 0.1130  -0.1182 -0.0544 118 GLU A CD    
85   O OE1   . GLU A 37  ? 1.3625 0.7911 0.7533 0.1221  -0.1239 -0.0574 118 GLU A OE1   
86   O OE2   . GLU A 37  ? 1.4982 0.9022 0.8759 0.1003  -0.1239 -0.0477 118 GLU A OE2   
87   N N     . LEU A 38  ? 0.8379 0.3625 0.2580 0.0983  -0.0655 -0.0499 119 LEU A N     
88   C CA    . LEU A 38  ? 0.8215 0.3454 0.2403 0.0846  -0.0597 -0.0433 119 LEU A CA    
89   C C     . LEU A 38  ? 0.8591 0.3914 0.2722 0.0870  -0.0530 -0.0467 119 LEU A C     
90   O O     . LEU A 38  ? 0.8500 0.3695 0.2556 0.0807  -0.0546 -0.0449 119 LEU A O     
91   C CB    . LEU A 38  ? 0.8008 0.3395 0.2310 0.0736  -0.0532 -0.0355 119 LEU A CB    
92   C CG    . LEU A 38  ? 0.8359 0.3638 0.2681 0.0691  -0.0593 -0.0310 119 LEU A CG    
93   C CD1   . LEU A 38  ? 0.8151 0.3558 0.2553 0.0593  -0.0532 -0.0243 119 LEU A CD1   
94   C CD2   . LEU A 38  ? 0.8728 0.3755 0.2954 0.0630  -0.0663 -0.0280 119 LEU A CD2   
95   N N     . LEU A 39  ? 0.8467 0.4003 0.2626 0.0965  -0.0461 -0.0518 120 LEU A N     
96   C CA    . LEU A 39  ? 0.8630 0.4253 0.2699 0.0992  -0.0386 -0.0549 120 LEU A CA    
97   C C     . LEU A 39  ? 0.9087 0.4465 0.2967 0.1074  -0.0464 -0.0619 120 LEU A C     
98   O O     . LEU A 39  ? 0.8922 0.4283 0.2690 0.1056  -0.0428 -0.0625 120 LEU A O     
99   C CB    . LEU A 39  ? 0.8610 0.4550 0.2753 0.1072  -0.0279 -0.0583 120 LEU A CB    
100  C CG    . LEU A 39  ? 0.9119 0.5313 0.3437 0.0963  -0.0201 -0.0502 120 LEU A CG    
101  C CD1   . LEU A 39  ? 0.9128 0.5655 0.3563 0.1050  -0.0115 -0.0539 120 LEU A CD1   
102  C CD2   . LEU A 39  ? 0.9139 0.5337 0.3412 0.0814  -0.0146 -0.0423 120 LEU A CD2   
103  N N     . THR A 40  ? 0.8902 0.4055 0.2729 0.1147  -0.0589 -0.0664 121 THR A N     
104  C CA    . THR A 40  ? 0.9045 0.3916 0.2682 0.1217  -0.0697 -0.0728 121 THR A CA    
105  C C     . THR A 40  ? 0.9514 0.4143 0.3131 0.1073  -0.0791 -0.0657 121 THR A C     
106  O O     . THR A 40  ? 0.9648 0.4037 0.3121 0.1093  -0.0892 -0.0691 121 THR A O     
107  C CB    . THR A 40  ? 1.0568 0.5306 0.4134 0.1389  -0.0801 -0.0823 121 THR A CB    
108  O OG1   . THR A 40  ? 1.0282 0.4893 0.3924 0.1336  -0.0894 -0.0776 121 THR A OG1   
109  C CG2   . THR A 40  ? 1.0938 0.5951 0.4547 0.1552  -0.0708 -0.0907 121 THR A CG2   
110  N N     . LYS A 41  ? 0.8810 0.3507 0.2569 0.0933  -0.0760 -0.0562 122 LYS A N     
111  C CA    . LYS A 41  ? 0.8712 0.3249 0.2490 0.0796  -0.0824 -0.0491 122 LYS A CA    
112  C C     . LYS A 41  ? 0.9243 0.3833 0.3024 0.0717  -0.0777 -0.0462 122 LYS A C     
113  O O     . LYS A 41  ? 0.9245 0.4009 0.3025 0.0736  -0.0679 -0.0472 122 LYS A O     
114  C CB    . LYS A 41  ? 0.8873 0.3460 0.2777 0.0697  -0.0806 -0.0411 122 LYS A CB    
115  C CG    . LYS A 41  ? 0.9620 0.4059 0.3490 0.0749  -0.0902 -0.0423 122 LYS A CG    
116  C CD    . LYS A 41  ? 0.9484 0.3945 0.3439 0.0638  -0.0886 -0.0335 122 LYS A CD    
117  C CE    . LYS A 41  ? 0.9869 0.4142 0.3797 0.0511  -0.0957 -0.0266 122 LYS A CE    
118  N NZ    . LYS A 41  ? 0.8768 0.3124 0.2775 0.0391  -0.0893 -0.0177 122 LYS A NZ    
119  N N     . THR A 42  ? 0.8797 0.3227 0.2574 0.0630  -0.0859 -0.0428 123 THR A N     
120  C CA    . THR A 42  ? 0.8680 0.3144 0.2476 0.0558  -0.0839 -0.0402 123 THR A CA    
121  C C     . THR A 42  ? 0.8900 0.3395 0.2852 0.0422  -0.0841 -0.0319 123 THR A C     
122  O O     . THR A 42  ? 0.8823 0.3272 0.2827 0.0379  -0.0870 -0.0281 123 THR A O     
123  C CB    . THR A 42  ? 0.9874 0.4138 0.3518 0.0602  -0.0942 -0.0456 123 THR A CB    
124  O OG1   . THR A 42  ? 0.9877 0.3919 0.3501 0.0577  -0.1080 -0.0450 123 THR A OG1   
125  C CG2   . THR A 42  ? 1.0353 0.4615 0.3818 0.0749  -0.0913 -0.0546 123 THR A CG2   
126  N N     . LEU A 43  ? 0.8135 0.2703 0.2149 0.0360  -0.0816 -0.0292 124 LEU A N     
127  C CA    . LEU A 43  ? 0.7665 0.2307 0.1840 0.0251  -0.0804 -0.0225 124 LEU A CA    
128  C C     . LEU A 43  ? 0.8242 0.2785 0.2446 0.0201  -0.0905 -0.0221 124 LEU A C     
129  O O     . LEU A 43  ? 0.8240 0.2764 0.2388 0.0227  -0.0926 -0.0251 124 LEU A O     
130  C CB    . LEU A 43  ? 0.7464 0.2293 0.1707 0.0235  -0.0696 -0.0204 124 LEU A CB    
131  C CG    . LEU A 43  ? 0.7842 0.2776 0.2239 0.0155  -0.0666 -0.0154 124 LEU A CG    
132  C CD1   . LEU A 43  ? 0.7706 0.2666 0.2167 0.0108  -0.0638 -0.0109 124 LEU A CD1   
133  C CD2   . LEU A 43  ? 0.7416 0.2472 0.1825 0.0164  -0.0592 -0.0152 124 LEU A CD2   
134  N N     . PRO A 44  ? 0.7973 0.2455 0.2267 0.0118  -0.0974 -0.0176 125 PRO A N     
135  C CA    . PRO A 44  ? 0.8011 0.2424 0.2372 0.0056  -0.1082 -0.0164 125 PRO A CA    
136  C C     . PRO A 44  ? 0.8201 0.2775 0.2705 0.0024  -0.1048 -0.0151 125 PRO A C     
137  O O     . PRO A 44  ? 0.8056 0.2817 0.2674 0.0004  -0.0941 -0.0123 125 PRO A O     
138  C CB    . PRO A 44  ? 0.8384 0.2762 0.2848 -0.0053 -0.1132 -0.0096 125 PRO A CB    
139  C CG    . PRO A 44  ? 0.8895 0.3215 0.3257 -0.0018 -0.1096 -0.0094 125 PRO A CG    
140  C CD    . PRO A 44  ? 0.8276 0.2744 0.2609 0.0065  -0.0966 -0.0126 125 PRO A CD    
141  N N     . ASP A 45  ? 0.8116 0.2595 0.2603 0.0025  -0.1156 -0.0176 126 ASP A N     
142  C CA    . ASP A 45  ? 0.8005 0.2611 0.2640 -0.0002 -0.1160 -0.0167 126 ASP A CA    
143  C C     . ASP A 45  ? 0.8457 0.3222 0.3356 -0.0109 -0.1161 -0.0103 126 ASP A C     
144  O O     . ASP A 45  ? 0.8429 0.3133 0.3357 -0.0179 -0.1205 -0.0062 126 ASP A O     
145  C CB    . ASP A 45  ? 0.8313 0.2754 0.2862 0.0020  -0.1302 -0.0207 126 ASP A CB    
146  C CG    . ASP A 45  ? 0.8946 0.3247 0.3225 0.0119  -0.1298 -0.0267 126 ASP A CG    
147  O OD1   . ASP A 45  ? 0.8830 0.3222 0.3038 0.0164  -0.1174 -0.0274 126 ASP A OD1   
148  O OD2   . ASP A 45  ? 0.9576 0.3676 0.3706 0.0147  -0.1421 -0.0305 126 ASP A OD2   
149  N N     . ILE A 46  ? 0.7521 0.2486 0.2603 -0.0120 -0.1116 -0.0092 127 ILE A N     
150  C CA    . ILE A 46  ? 0.7473 0.2645 0.2830 -0.0212 -0.1101 -0.0038 127 ILE A CA    
151  C C     . ILE A 46  ? 0.7870 0.3099 0.3364 -0.0197 -0.1192 -0.0064 127 ILE A C     
152  O O     . ILE A 46  ? 0.7753 0.3119 0.3321 -0.0141 -0.1139 -0.0089 127 ILE A O     
153  C CB    . ILE A 46  ? 0.7816 0.3206 0.3260 -0.0213 -0.0936 -0.0011 127 ILE A CB    
154  C CG1   . ILE A 46  ? 0.7940 0.3234 0.3223 -0.0223 -0.0872 0.0013  127 ILE A CG1   
155  C CG2   . ILE A 46  ? 0.7775 0.3427 0.3511 -0.0295 -0.0902 0.0040  127 ILE A CG2   
156  C CD1   . ILE A 46  ? 0.7975 0.3415 0.3263 -0.0203 -0.0725 0.0027  127 ILE A CD1   
157  N N     . LEU A 47  ? 0.7936 0.3021 0.3434 -0.0237 -0.1348 -0.0065 128 LEU A N     
158  C CA    . LEU A 47  ? 0.7918 0.3011 0.3523 -0.0221 -0.1471 -0.0093 128 LEU A CA    
159  C C     . LEU A 47  ? 0.8578 0.3757 0.4446 -0.0333 -0.1588 -0.0045 128 LEU A C     
160  O O     . LEU A 47  ? 0.8642 0.3706 0.4481 -0.0421 -0.1649 -0.0002 128 LEU A O     
161  C CB    . LEU A 47  ? 0.8143 0.2932 0.3449 -0.0145 -0.1579 -0.0153 128 LEU A CB    
162  C CG    . LEU A 47  ? 0.8661 0.3382 0.3718 -0.0043 -0.1477 -0.0196 128 LEU A CG    
163  C CD1   . LEU A 47  ? 0.8901 0.3328 0.3639 0.0016  -0.1568 -0.0244 128 LEU A CD1   
164  C CD2   . LEU A 47  ? 0.8716 0.3584 0.3876 0.0002  -0.1442 -0.0212 128 LEU A CD2   
165  N N     . THR A 48  ? 0.8141 0.3529 0.4275 -0.0333 -0.1627 -0.0052 129 THR A N     
166  C CA    . THR A 48  ? 0.8075 0.3604 0.4520 -0.0436 -0.1751 -0.0009 129 THR A CA    
167  C C     . THR A 48  ? 0.8517 0.4051 0.5051 -0.0362 -0.1880 -0.0067 129 THR A C     
168  O O     . THR A 48  ? 0.8368 0.3836 0.4744 -0.0243 -0.1844 -0.0127 129 THR A O     
169  C CB    . THR A 48  ? 0.9115 0.5045 0.5911 -0.0523 -0.1618 0.0058  129 THR A CB    
170  O OG1   . THR A 48  ? 0.9169 0.5365 0.6131 -0.0426 -0.1520 0.0015  129 THR A OG1   
171  C CG2   . THR A 48  ? 0.8842 0.4776 0.5534 -0.0591 -0.1475 0.0118  129 THR A CG2   
172  N N     . PHE A 49  ? 0.8064 0.3672 0.4854 -0.0440 -0.2040 -0.0043 130 PHE A N     
173  C CA    . PHE A 49  ? 0.8158 0.3797 0.5083 -0.0376 -0.2183 -0.0093 130 PHE A CA    
174  C C     . PHE A 49  ? 0.8512 0.4577 0.5791 -0.0330 -0.2065 -0.0102 130 PHE A C     
175  O O     . PHE A 49  ? 0.8224 0.4571 0.5674 -0.0379 -0.1891 -0.0056 130 PHE A O     
176  C CB    . PHE A 49  ? 0.8454 0.4019 0.5540 -0.0483 -0.2415 -0.0062 130 PHE A CB    
177  C CG    . PHE A 49  ? 0.8984 0.4097 0.5692 -0.0505 -0.2551 -0.0070 130 PHE A CG    
178  C CD1   . PHE A 49  ? 0.9711 0.4479 0.6083 -0.0399 -0.2672 -0.0143 130 PHE A CD1   
179  C CD2   . PHE A 49  ? 0.9427 0.4445 0.6090 -0.0624 -0.2560 -0.0006 130 PHE A CD2   
180  C CE1   . PHE A 49  ? 1.0102 0.4460 0.6103 -0.0399 -0.2786 -0.0162 130 PHE A CE1   
181  C CE2   . PHE A 49  ? 1.0103 0.4688 0.6397 -0.0618 -0.2691 -0.0029 130 PHE A CE2   
182  C CZ    . PHE A 49  ? 1.0071 0.4340 0.6040 -0.0499 -0.2797 -0.0112 130 PHE A CZ    
183  N N     . ASN A 50  ? 0.8184 0.4277 0.5545 -0.0224 -0.2163 -0.0166 131 ASN A N     
184  C CA    . ASN A 50  ? 0.7921 0.4391 0.5616 -0.0146 -0.2093 -0.0198 131 ASN A CA    
185  C C     . ASN A 50  ? 0.8177 0.4768 0.5774 -0.0060 -0.1866 -0.0220 131 ASN A C     
186  O O     . ASN A 50  ? 0.8185 0.5143 0.6076 -0.0019 -0.1759 -0.0231 131 ASN A O     
187  C CB    . ASN A 50  ? 0.8178 0.5069 0.6375 -0.0254 -0.2102 -0.0142 131 ASN A CB    
188  C CG    . ASN A 50  ? 1.1005 0.7794 0.9338 -0.0354 -0.2346 -0.0114 131 ASN A CG    
189  O OD1   . ASN A 50  ? 1.0550 0.7226 0.8908 -0.0282 -0.2537 -0.0170 131 ASN A OD1   
190  N ND2   . ASN A 50  ? 1.0185 0.6983 0.8588 -0.0525 -0.2360 -0.0025 131 ASN A ND2   
191  N N     . LEU A 51  ? 0.7621 0.3914 0.4811 -0.0027 -0.1796 -0.0229 132 LEU A N     
192  C CA    . LEU A 51  ? 0.7466 0.3827 0.4533 0.0053  -0.1609 -0.0251 132 LEU A CA    
193  C C     . LEU A 51  ? 0.7733 0.4056 0.4764 0.0200  -0.1666 -0.0329 132 LEU A C     
194  O O     . LEU A 51  ? 0.7770 0.3863 0.4685 0.0237  -0.1841 -0.0362 132 LEU A O     
195  C CB    . LEU A 51  ? 0.7690 0.3747 0.4352 0.0037  -0.1539 -0.0234 132 LEU A CB    
196  C CG    . LEU A 51  ? 0.8204 0.4256 0.4828 -0.0080 -0.1458 -0.0165 132 LEU A CG    
197  C CD1   . LEU A 51  ? 0.8408 0.4138 0.4639 -0.0067 -0.1439 -0.0170 132 LEU A CD1   
198  C CD2   . LEU A 51  ? 0.8409 0.4762 0.5200 -0.0105 -0.1268 -0.0131 132 LEU A CD2   
199  N N     . ASP A 52  ? 0.7255 0.3767 0.4350 0.0286  -0.1532 -0.0360 133 ASP A N     
200  C CA    . ASP A 52  ? 0.7191 0.3621 0.4206 0.0432  -0.1592 -0.0436 133 ASP A CA    
201  C C     . ASP A 52  ? 0.7654 0.3714 0.4222 0.0446  -0.1581 -0.0436 133 ASP A C     
202  O O     . ASP A 52  ? 0.7883 0.3694 0.4261 0.0507  -0.1714 -0.0471 133 ASP A O     
203  C CB    . ASP A 52  ? 0.7382 0.4128 0.4598 0.0529  -0.1454 -0.0478 133 ASP A CB    
204  C CG    . ASP A 52  ? 0.9263 0.6453 0.6950 0.0537  -0.1432 -0.0487 133 ASP A CG    
205  O OD1   . ASP A 52  ? 0.9486 0.6734 0.7394 0.0527  -0.1594 -0.0497 133 ASP A OD1   
206  O OD2   . ASP A 52  ? 1.0091 0.7580 0.7924 0.0555  -0.1254 -0.0485 133 ASP A OD2   
207  N N     . ILE A 53  ? 0.7150 0.3182 0.3555 0.0386  -0.1425 -0.0391 134 ILE A N     
208  C CA    . ILE A 53  ? 0.7167 0.2924 0.3197 0.0392  -0.1383 -0.0384 134 ILE A CA    
209  C C     . ILE A 53  ? 0.7624 0.3258 0.3477 0.0292  -0.1323 -0.0329 134 ILE A C     
210  O O     . ILE A 53  ? 0.7395 0.3189 0.3384 0.0224  -0.1232 -0.0290 134 ILE A O     
211  C CB    . ILE A 53  ? 0.7368 0.3226 0.3370 0.0461  -0.1250 -0.0405 134 ILE A CB    
212  C CG1   . ILE A 53  ? 0.7302 0.3178 0.3377 0.0590  -0.1340 -0.0476 134 ILE A CG1   
213  C CG2   . ILE A 53  ? 0.7141 0.2788 0.2813 0.0436  -0.1173 -0.0378 134 ILE A CG2   
214  C CD1   . ILE A 53  ? 0.7707 0.3776 0.3864 0.0679  -0.1213 -0.0514 134 ILE A CD1   
215  N N     . VAL A 54  ? 0.7218 0.2569 0.2753 0.0289  -0.1366 -0.0327 135 VAL A N     
216  C CA    . VAL A 54  ? 0.7228 0.2467 0.2569 0.0228  -0.1295 -0.0290 135 VAL A CA    
217  C C     . VAL A 54  ? 0.7359 0.2495 0.2453 0.0254  -0.1208 -0.0287 135 VAL A C     
218  O O     . VAL A 54  ? 0.7288 0.2255 0.2198 0.0286  -0.1276 -0.0302 135 VAL A O     
219  C CB    . VAL A 54  ? 0.7850 0.2877 0.3044 0.0191  -0.1411 -0.0287 135 VAL A CB    
220  C CG1   . VAL A 54  ? 0.7947 0.2853 0.2906 0.0165  -0.1328 -0.0268 135 VAL A CG1   
221  C CG2   . VAL A 54  ? 0.7749 0.2880 0.3199 0.0139  -0.1496 -0.0276 135 VAL A CG2   
222  N N     . ILE A 55  ? 0.7044 0.2273 0.2131 0.0232  -0.1071 -0.0262 136 ILE A N     
223  C CA    . ILE A 55  ? 0.6867 0.2016 0.1746 0.0243  -0.0996 -0.0253 136 ILE A CA    
224  C C     . ILE A 55  ? 0.7335 0.2338 0.2000 0.0211  -0.0988 -0.0236 136 ILE A C     
225  O O     . ILE A 55  ? 0.7198 0.2237 0.1891 0.0180  -0.0942 -0.0221 136 ILE A O     
226  C CB    . ILE A 55  ? 0.6992 0.2296 0.1950 0.0241  -0.0863 -0.0237 136 ILE A CB    
227  C CG1   . ILE A 55  ? 0.7078 0.2557 0.2246 0.0291  -0.0851 -0.0264 136 ILE A CG1   
228  C CG2   . ILE A 55  ? 0.6984 0.2198 0.1732 0.0239  -0.0803 -0.0221 136 ILE A CG2   
229  C CD1   . ILE A 55  ? 0.7176 0.2580 0.2285 0.0370  -0.0918 -0.0305 136 ILE A CD1   
230  N N     . ILE A 56  ? 0.7161 0.2006 0.1601 0.0219  -0.1023 -0.0236 137 ILE A N     
231  C CA    . ILE A 56  ? 0.7233 0.1965 0.1455 0.0203  -0.1003 -0.0227 137 ILE A CA    
232  C C     . ILE A 56  ? 0.7708 0.2470 0.1810 0.0189  -0.0899 -0.0200 137 ILE A C     
233  O O     . ILE A 56  ? 0.7777 0.2470 0.1762 0.0180  -0.0917 -0.0185 137 ILE A O     
234  C CB    . ILE A 56  ? 0.7695 0.2228 0.1720 0.0212  -0.1117 -0.0240 137 ILE A CB    
235  C CG1   . ILE A 56  ? 0.7896 0.2386 0.2051 0.0225  -0.1253 -0.0268 137 ILE A CG1   
236  C CG2   . ILE A 56  ? 0.7606 0.2042 0.1384 0.0208  -0.1075 -0.0238 137 ILE A CG2   
237  C CD1   . ILE A 56  ? 0.8301 0.2580 0.2279 0.0242  -0.1398 -0.0281 137 ILE A CD1   
238  N N     . GLY A 57  ? 0.7404 0.2254 0.1531 0.0182  -0.0806 -0.0191 138 GLY A N     
239  C CA    . GLY A 57  ? 0.7243 0.2140 0.1277 0.0166  -0.0716 -0.0165 138 GLY A CA    
240  C C     . GLY A 57  ? 0.7625 0.2456 0.1452 0.0166  -0.0700 -0.0164 138 GLY A C     
241  O O     . GLY A 57  ? 0.7610 0.2327 0.1333 0.0185  -0.0763 -0.0188 138 GLY A O     
242  N N     . ILE A 58  ? 0.7493 0.2403 0.1259 0.0146  -0.0615 -0.0137 139 ILE A N     
243  C CA    . ILE A 58  ? 0.7450 0.2362 0.1038 0.0146  -0.0568 -0.0132 139 ILE A CA    
244  C C     . ILE A 58  ? 0.7993 0.2947 0.1599 0.0208  -0.0534 -0.0175 139 ILE A C     
245  O O     . ILE A 58  ? 0.7747 0.2596 0.1229 0.0248  -0.0574 -0.0213 139 ILE A O     
246  C CB    . ILE A 58  ? 0.7819 0.2837 0.1373 0.0088  -0.0494 -0.0078 139 ILE A CB    
247  C CG1   . ILE A 58  ? 0.7928 0.2841 0.1428 0.0027  -0.0561 -0.0036 139 ILE A CG1   
248  C CG2   . ILE A 58  ? 0.7856 0.2939 0.1251 0.0088  -0.0419 -0.0071 139 ILE A CG2   
249  C CD1   . ILE A 58  ? 0.8015 0.3000 0.1535 -0.0041 -0.0527 0.0021  139 ILE A CD1   
250  N N     . ASN A 59  ? 0.7613 0.2689 0.1354 0.0220  -0.0477 -0.0174 140 ASN A N     
251  C CA    . ASN A 59  ? 0.7439 0.2530 0.1200 0.0284  -0.0465 -0.0217 140 ASN A CA    
252  C C     . ASN A 59  ? 0.7349 0.2530 0.1279 0.0273  -0.0438 -0.0199 140 ASN A C     
253  O O     . ASN A 59  ? 0.7169 0.2413 0.1168 0.0224  -0.0414 -0.0160 140 ASN A O     
254  C CB    . ASN A 59  ? 0.7835 0.3006 0.1474 0.0334  -0.0394 -0.0239 140 ASN A CB    
255  C CG    . ASN A 59  ? 0.8805 0.4170 0.2509 0.0303  -0.0302 -0.0200 140 ASN A CG    
256  O OD1   . ASN A 59  ? 0.8619 0.4018 0.2356 0.0223  -0.0294 -0.0144 140 ASN A OD1   
257  N ND2   . ASN A 59  ? 0.7786 0.3274 0.1512 0.0369  -0.0246 -0.0232 140 ASN A ND2   
258  N N     . PRO A 60  ? 0.7268 0.2432 0.1242 0.0317  -0.0451 -0.0227 141 PRO A N     
259  C CA    . PRO A 60  ? 0.7116 0.2346 0.1220 0.0299  -0.0428 -0.0202 141 PRO A CA    
260  C C     . PRO A 60  ? 0.7326 0.2701 0.1446 0.0307  -0.0358 -0.0188 141 PRO A C     
261  O O     . PRO A 60  ? 0.7425 0.2866 0.1484 0.0358  -0.0324 -0.0216 141 PRO A O     
262  C CB    . PRO A 60  ? 0.7522 0.2656 0.1628 0.0343  -0.0481 -0.0234 141 PRO A CB    
263  C CG    . PRO A 60  ? 0.8091 0.3096 0.2084 0.0380  -0.0543 -0.0276 141 PRO A CG    
264  C CD    . PRO A 60  ? 0.7711 0.2762 0.1597 0.0385  -0.0502 -0.0281 141 PRO A CD    
265  N N     . GLY A 61  ? 0.7005 0.2437 0.1211 0.0261  -0.0338 -0.0149 142 GLY A N     
266  C CA    . GLY A 61  ? 0.7092 0.2652 0.1342 0.0262  -0.0295 -0.0133 142 GLY A CA    
267  C C     . GLY A 61  ? 0.7507 0.3052 0.1805 0.0313  -0.0315 -0.0153 142 GLY A C     
268  O O     . GLY A 61  ? 0.7167 0.2590 0.1451 0.0330  -0.0361 -0.0170 142 GLY A O     
269  N N     . LEU A 62  ? 0.7147 0.2802 0.1504 0.0326  -0.0296 -0.0144 143 LEU A N     
270  C CA    . LEU A 62  ? 0.7308 0.2929 0.1697 0.0381  -0.0333 -0.0165 143 LEU A CA    
271  C C     . LEU A 62  ? 0.7552 0.3026 0.1933 0.0342  -0.0375 -0.0139 143 LEU A C     
272  O O     . LEU A 62  ? 0.7517 0.2876 0.1868 0.0376  -0.0425 -0.0157 143 LEU A O     
273  C CB    . LEU A 62  ? 0.7383 0.3159 0.1856 0.0402  -0.0319 -0.0159 143 LEU A CB    
274  C CG    . LEU A 62  ? 0.8076 0.4050 0.2586 0.0455  -0.0268 -0.0188 143 LEU A CG    
275  C CD1   . LEU A 62  ? 0.8121 0.4279 0.2758 0.0447  -0.0260 -0.0166 143 LEU A CD1   
276  C CD2   . LEU A 62  ? 0.8574 0.4515 0.3042 0.0579  -0.0289 -0.0264 143 LEU A CD2   
277  N N     . MET A 63  ? 0.6979 0.2448 0.1370 0.0271  -0.0356 -0.0097 144 MET A N     
278  C CA    . MET A 63  ? 0.7000 0.2366 0.1379 0.0232  -0.0372 -0.0070 144 MET A CA    
279  C C     . MET A 63  ? 0.7265 0.2544 0.1635 0.0216  -0.0392 -0.0075 144 MET A C     
280  O O     . MET A 63  ? 0.7242 0.2429 0.1597 0.0198  -0.0422 -0.0059 144 MET A O     
281  C CB    . MET A 63  ? 0.7234 0.2622 0.1613 0.0182  -0.0344 -0.0038 144 MET A CB    
282  C CG    . MET A 63  ? 0.7525 0.2832 0.1870 0.0154  -0.0345 -0.0011 144 MET A CG    
283  S SD    . MET A 63  ? 0.8046 0.3280 0.2347 0.0177  -0.0394 0.0000  144 MET A SD    
284  C CE    . MET A 63  ? 0.7834 0.3147 0.2147 0.0179  -0.0396 0.0007  144 MET A CE    
285  N N     . ALA A 64  ? 0.6990 0.2289 0.1365 0.0214  -0.0386 -0.0093 145 ALA A N     
286  C CA    . ALA A 64  ? 0.7144 0.2363 0.1526 0.0197  -0.0425 -0.0098 145 ALA A CA    
287  C C     . ALA A 64  ? 0.7735 0.2844 0.2066 0.0239  -0.0487 -0.0125 145 ALA A C     
288  O O     . ALA A 64  ? 0.7717 0.2727 0.2055 0.0203  -0.0536 -0.0108 145 ALA A O     
289  C CB    . ALA A 64  ? 0.7119 0.2355 0.1497 0.0196  -0.0428 -0.0116 145 ALA A CB    
290  N N     . ALA A 65  ? 0.7411 0.2543 0.1692 0.0317  -0.0488 -0.0167 146 ALA A N     
291  C CA    . ALA A 65  ? 0.7599 0.2615 0.1813 0.0388  -0.0556 -0.0210 146 ALA A CA    
292  C C     . ALA A 65  ? 0.7963 0.2885 0.2179 0.0369  -0.0601 -0.0181 146 ALA A C     
293  O O     . ALA A 65  ? 0.8098 0.2850 0.2260 0.0366  -0.0686 -0.0183 146 ALA A O     
294  C CB    . ALA A 65  ? 0.7814 0.2928 0.1997 0.0487  -0.0527 -0.0264 146 ALA A CB    
295  N N     . TYR A 66  ? 0.7469 0.2475 0.1725 0.0351  -0.0559 -0.0151 147 TYR A N     
296  C CA    . TYR A 66  ? 0.7398 0.2303 0.1626 0.0328  -0.0602 -0.0117 147 TYR A CA    
297  C C     . TYR A 66  ? 0.8098 0.2898 0.2312 0.0225  -0.0618 -0.0057 147 TYR A C     
298  O O     . TYR A 66  ? 0.8092 0.2723 0.2241 0.0205  -0.0697 -0.0038 147 TYR A O     
299  C CB    . TYR A 66  ? 0.7241 0.2252 0.1502 0.0327  -0.0559 -0.0097 147 TYR A CB    
300  C CG    . TYR A 66  ? 0.7651 0.2535 0.1852 0.0308  -0.0612 -0.0062 147 TYR A CG    
301  C CD1   . TYR A 66  ? 0.7775 0.2588 0.1931 0.0212  -0.0594 0.0001  147 TYR A CD1   
302  C CD2   . TYR A 66  ? 0.7768 0.2598 0.1945 0.0389  -0.0686 -0.0093 147 TYR A CD2   
303  C CE1   . TYR A 66  ? 0.8040 0.2703 0.2099 0.0184  -0.0649 0.0042  147 TYR A CE1   
304  C CE2   . TYR A 66  ? 0.7998 0.2673 0.2093 0.0370  -0.0755 -0.0058 147 TYR A CE2   
305  C CZ    . TYR A 66  ? 0.8591 0.3168 0.2610 0.0261  -0.0737 0.0013  147 TYR A CZ    
306  O OH    . TYR A 66  ? 0.8967 0.3367 0.2869 0.0237  -0.0809 0.0054  147 TYR A OH    
307  N N     . LYS A 67  ? 0.7661 0.2564 0.1938 0.0159  -0.0548 -0.0027 148 LYS A N     
308  C CA    . LYS A 67  ? 0.7553 0.2434 0.1852 0.0060  -0.0533 0.0032  148 LYS A CA    
309  C C     . LYS A 67  ? 0.8113 0.2935 0.2448 0.0018  -0.0585 0.0037  148 LYS A C     
310  O O     . LYS A 67  ? 0.8247 0.3020 0.2595 -0.0072 -0.0603 0.0094  148 LYS A O     
311  C CB    . LYS A 67  ? 0.7221 0.2255 0.1581 0.0031  -0.0438 0.0048  148 LYS A CB    
312  C CG    . LYS A 67  ? 0.6835 0.1894 0.1142 0.0052  -0.0402 0.0055  148 LYS A CG    
313  C CD    . LYS A 67  ? 0.7536 0.2504 0.1761 -0.0005 -0.0404 0.0111  148 LYS A CD    
314  C CE    . LYS A 67  ? 0.8000 0.2980 0.2155 0.0011  -0.0373 0.0119  148 LYS A CE    
315  N NZ    . LYS A 67  ? 0.8627 0.3494 0.2663 -0.0044 -0.0378 0.0175  148 LYS A NZ    
316  N N     . GLY A 68  ? 0.7644 0.2474 0.1991 0.0072  -0.0610 -0.0015 149 GLY A N     
317  C CA    . GLY A 68  ? 0.7445 0.2210 0.1824 0.0036  -0.0676 -0.0017 149 GLY A CA    
318  C C     . GLY A 68  ? 0.7813 0.2719 0.2325 -0.0037 -0.0625 0.0017  149 GLY A C     
319  O O     . GLY A 68  ? 0.7973 0.2855 0.2555 -0.0100 -0.0678 0.0039  149 GLY A O     
320  N N     . HIS A 69  ? 0.7308 0.2363 0.1863 -0.0023 -0.0530 0.0017  150 HIS A N     
321  C CA    . HIS A 69  ? 0.7133 0.2336 0.1815 -0.0061 -0.0480 0.0031  150 HIS A CA    
322  C C     . HIS A 69  ? 0.7373 0.2646 0.2049 0.0004  -0.0448 -0.0013 150 HIS A C     
323  O O     . HIS A 69  ? 0.7143 0.2388 0.1727 0.0055  -0.0435 -0.0035 150 HIS A O     
324  C CB    . HIS A 69  ? 0.7155 0.2450 0.1874 -0.0116 -0.0402 0.0082  150 HIS A CB    
325  C CG    . HIS A 69  ? 0.7635 0.2880 0.2371 -0.0212 -0.0429 0.0146  150 HIS A CG    
326  N ND1   . HIS A 69  ? 0.7868 0.3205 0.2751 -0.0292 -0.0439 0.0181  150 HIS A ND1   
327  C CD2   . HIS A 69  ? 0.8127 0.3233 0.2748 -0.0246 -0.0459 0.0184  150 HIS A CD2   
328  C CE1   . HIS A 69  ? 0.8006 0.3261 0.2855 -0.0387 -0.0469 0.0249  150 HIS A CE1   
329  N NE2   . HIS A 69  ? 0.8112 0.3208 0.2789 -0.0360 -0.0485 0.0252  150 HIS A NE2   
330  N N     . HIS A 70  ? 0.6879 0.2245 0.1659 -0.0002 -0.0442 -0.0021 151 HIS A N     
331  C CA    . HIS A 70  ? 0.6931 0.2325 0.1688 0.0050  -0.0435 -0.0058 151 HIS A CA    
332  C C     . HIS A 70  ? 0.7002 0.2462 0.1736 0.0073  -0.0367 -0.0057 151 HIS A C     
333  O O     . HIS A 70  ? 0.6961 0.2509 0.1761 0.0059  -0.0317 -0.0042 151 HIS A O     
334  C CB    . HIS A 70  ? 0.6949 0.2380 0.1811 0.0050  -0.0488 -0.0076 151 HIS A CB    
335  C CG    . HIS A 70  ? 0.7662 0.2978 0.2490 0.0044  -0.0579 -0.0089 151 HIS A CG    
336  N ND1   . HIS A 70  ? 0.8086 0.3311 0.2803 0.0087  -0.0626 -0.0125 151 HIS A ND1   
337  C CD2   . HIS A 70  ? 0.8123 0.3375 0.2979 -0.0001 -0.0635 -0.0071 151 HIS A CD2   
338  C CE1   . HIS A 70  ? 0.8055 0.3167 0.2734 0.0080  -0.0706 -0.0136 151 HIS A CE1   
339  N NE2   . HIS A 70  ? 0.8019 0.3136 0.2785 0.0027  -0.0724 -0.0105 151 HIS A NE2   
340  N N     . TYR A 71  ? 0.6708 0.2124 0.1340 0.0106  -0.0369 -0.0073 152 TYR A N     
341  C CA    . TYR A 71  ? 0.6614 0.2044 0.1190 0.0126  -0.0338 -0.0075 152 TYR A CA    
342  C C     . TYR A 71  ? 0.6745 0.2194 0.1299 0.0115  -0.0286 -0.0052 152 TYR A C     
343  O O     . TYR A 71  ? 0.6886 0.2368 0.1439 0.0130  -0.0254 -0.0057 152 TYR A O     
344  C CB    . TYR A 71  ? 0.6740 0.2191 0.1352 0.0153  -0.0357 -0.0099 152 TYR A CB    
345  C CG    . TYR A 71  ? 0.6719 0.2117 0.1319 0.0159  -0.0424 -0.0116 152 TYR A CG    
346  C CD1   . TYR A 71  ? 0.7010 0.2333 0.1487 0.0155  -0.0447 -0.0112 152 TYR A CD1   
347  C CD2   . TYR A 71  ? 0.6898 0.2321 0.1603 0.0159  -0.0465 -0.0130 152 TYR A CD2   
348  C CE1   . TYR A 71  ? 0.6960 0.2215 0.1386 0.0157  -0.0506 -0.0124 152 TYR A CE1   
349  C CE2   . TYR A 71  ? 0.7028 0.2372 0.1694 0.0166  -0.0540 -0.0146 152 TYR A CE2   
350  C CZ    . TYR A 71  ? 0.6972 0.2222 0.1480 0.0167  -0.0557 -0.0144 152 TYR A CZ    
351  O OH    . TYR A 71  ? 0.6956 0.2110 0.1387 0.0171  -0.0628 -0.0157 152 TYR A OH    
352  N N     . PRO A 72  ? 0.6681 0.2091 0.1194 0.0100  -0.0285 -0.0032 153 PRO A N     
353  C CA    . PRO A 72  ? 0.6823 0.2217 0.1285 0.0087  -0.0253 -0.0007 153 PRO A CA    
354  C C     . PRO A 72  ? 0.7523 0.2892 0.1904 0.0107  -0.0257 -0.0009 153 PRO A C     
355  O O     . PRO A 72  ? 0.7521 0.2858 0.1839 0.0101  -0.0242 0.0008  153 PRO A O     
356  C CB    . PRO A 72  ? 0.7085 0.2418 0.1532 0.0070  -0.0282 0.0011  153 PRO A CB    
357  C CG    . PRO A 72  ? 0.7432 0.2750 0.1885 0.0101  -0.0324 -0.0019 153 PRO A CG    
358  C CD    . PRO A 72  ? 0.7045 0.2407 0.1541 0.0106  -0.0325 -0.0040 153 PRO A CD    
359  N N     . GLY A 73  ? 0.7410 0.2786 0.1785 0.0119  -0.0283 -0.0023 154 GLY A N     
360  C CA    . GLY A 73  ? 0.7502 0.2866 0.1821 0.0117  -0.0301 -0.0014 154 GLY A CA    
361  C C     . GLY A 73  ? 0.7738 0.3056 0.1993 0.0122  -0.0296 -0.0014 154 GLY A C     
362  O O     . GLY A 73  ? 0.7646 0.2960 0.1902 0.0141  -0.0289 -0.0034 154 GLY A O     
363  N N     . PRO A 74  ? 0.7493 0.2765 0.1681 0.0118  -0.0307 0.0002  155 PRO A N     
364  C CA    . PRO A 74  ? 0.7546 0.2748 0.1633 0.0136  -0.0306 -0.0006 155 PRO A CA    
365  C C     . PRO A 74  ? 0.8056 0.3209 0.2098 0.0150  -0.0346 -0.0026 155 PRO A C     
366  O O     . PRO A 74  ? 0.8319 0.3423 0.2291 0.0191  -0.0337 -0.0054 155 PRO A O     
367  C CB    . PRO A 74  ? 0.7703 0.2842 0.1716 0.0123  -0.0340 0.0017  155 PRO A CB    
368  C CG    . PRO A 74  ? 0.8420 0.3607 0.2507 0.0111  -0.0339 0.0033  155 PRO A CG    
369  C CD    . PRO A 74  ? 0.7767 0.3041 0.1959 0.0110  -0.0330 0.0021  155 PRO A CD    
370  N N     . GLY A 75  ? 0.7693 0.2857 0.1766 0.0118  -0.0391 -0.0012 156 GLY A N     
371  C CA    . GLY A 75  ? 0.7673 0.2756 0.1684 0.0113  -0.0451 -0.0019 156 GLY A CA    
372  C C     . GLY A 75  ? 0.7513 0.2615 0.1569 0.0124  -0.0452 -0.0037 156 GLY A C     
373  O O     . GLY A 75  ? 0.7554 0.2561 0.1542 0.0125  -0.0516 -0.0044 156 GLY A O     
374  N N     . ASN A 76  ? 0.7205 0.2402 0.1358 0.0133  -0.0401 -0.0044 157 ASN A N     
375  C CA    . ASN A 76  ? 0.7126 0.2329 0.1318 0.0144  -0.0418 -0.0062 157 ASN A CA    
376  C C     . ASN A 76  ? 0.7637 0.2803 0.1823 0.0206  -0.0433 -0.0105 157 ASN A C     
377  O O     . ASN A 76  ? 0.7685 0.2891 0.1888 0.0243  -0.0385 -0.0124 157 ASN A O     
378  C CB    . ASN A 76  ? 0.6866 0.2155 0.1152 0.0140  -0.0378 -0.0062 157 ASN A CB    
379  C CG    . ASN A 76  ? 0.7354 0.2623 0.1650 0.0140  -0.0416 -0.0074 157 ASN A CG    
380  O OD1   . ASN A 76  ? 0.7469 0.2726 0.1802 0.0175  -0.0440 -0.0103 157 ASN A OD1   
381  N ND2   . ASN A 76  ? 0.7309 0.2580 0.1567 0.0108  -0.0423 -0.0055 157 ASN A ND2   
382  N N     . HIS A 77  ? 0.7165 0.2253 0.1317 0.0222  -0.0502 -0.0122 158 HIS A N     
383  C CA    . HIS A 77  ? 0.7155 0.2199 0.1298 0.0303  -0.0536 -0.0176 158 HIS A CA    
384  C C     . HIS A 77  ? 0.7436 0.2602 0.1731 0.0352  -0.0507 -0.0213 158 HIS A C     
385  O O     . HIS A 77  ? 0.7477 0.2656 0.1799 0.0435  -0.0521 -0.0265 158 HIS A O     
386  C CB    . HIS A 77  ? 0.7204 0.2069 0.1222 0.0300  -0.0654 -0.0178 158 HIS A CB    
387  C CG    . HIS A 77  ? 0.7643 0.2388 0.1525 0.0239  -0.0699 -0.0136 158 HIS A CG    
388  N ND1   . HIS A 77  ? 0.7856 0.2485 0.1641 0.0162  -0.0780 -0.0089 158 HIS A ND1   
389  C CD2   . HIS A 77  ? 0.7945 0.2677 0.1777 0.0235  -0.0678 -0.0128 158 HIS A CD2   
390  C CE1   . HIS A 77  ? 0.7974 0.2535 0.1676 0.0110  -0.0810 -0.0054 158 HIS A CE1   
391  N NE2   . HIS A 77  ? 0.8026 0.2643 0.1755 0.0155  -0.0754 -0.0078 158 HIS A NE2   
392  N N     . PHE A 78  ? 0.7004 0.2261 0.1399 0.0308  -0.0474 -0.0189 159 PHE A N     
393  C CA    . PHE A 78  ? 0.6739 0.2102 0.1288 0.0336  -0.0472 -0.0214 159 PHE A CA    
394  C C     . PHE A 78  ? 0.7022 0.2534 0.1691 0.0392  -0.0405 -0.0247 159 PHE A C     
395  O O     . PHE A 78  ? 0.6979 0.2540 0.1734 0.0463  -0.0439 -0.0295 159 PHE A O     
396  C CB    . PHE A 78  ? 0.6865 0.2273 0.1480 0.0274  -0.0457 -0.0182 159 PHE A CB    
397  C CG    . PHE A 78  ? 0.6823 0.2333 0.1608 0.0291  -0.0474 -0.0203 159 PHE A CG    
398  C CD1   . PHE A 78  ? 0.6817 0.2275 0.1624 0.0321  -0.0567 -0.0231 159 PHE A CD1   
399  C CD2   . PHE A 78  ? 0.6777 0.2434 0.1700 0.0267  -0.0407 -0.0188 159 PHE A CD2   
400  C CE1   . PHE A 78  ? 0.6755 0.2321 0.1745 0.0337  -0.0597 -0.0251 159 PHE A CE1   
401  C CE2   . PHE A 78  ? 0.6976 0.2753 0.2086 0.0268  -0.0429 -0.0200 159 PHE A CE2   
402  C CZ    . PHE A 78  ? 0.6640 0.2378 0.1794 0.0305  -0.0527 -0.0234 159 PHE A CZ    
403  N N     . TRP A 79  ? 0.6603 0.2197 0.1280 0.0362  -0.0311 -0.0220 160 TRP A N     
404  C CA    . TRP A 79  ? 0.6727 0.2487 0.1507 0.0398  -0.0227 -0.0237 160 TRP A CA    
405  C C     . TRP A 79  ? 0.7305 0.3050 0.2014 0.0505  -0.0225 -0.0299 160 TRP A C     
406  O O     . TRP A 79  ? 0.7168 0.3073 0.2002 0.0575  -0.0186 -0.0343 160 TRP A O     
407  C CB    . TRP A 79  ? 0.6639 0.2443 0.1393 0.0326  -0.0140 -0.0182 160 TRP A CB    
408  C CG    . TRP A 79  ? 0.6766 0.2584 0.1604 0.0241  -0.0157 -0.0135 160 TRP A CG    
409  C CD1   . TRP A 79  ? 0.7131 0.2832 0.1881 0.0190  -0.0188 -0.0102 160 TRP A CD1   
410  C CD2   . TRP A 79  ? 0.6762 0.2712 0.1788 0.0207  -0.0159 -0.0125 160 TRP A CD2   
411  N NE1   . TRP A 79  ? 0.7075 0.2798 0.1919 0.0138  -0.0214 -0.0079 160 TRP A NE1   
412  C CE2   . TRP A 79  ? 0.7232 0.3096 0.2242 0.0137  -0.0202 -0.0086 160 TRP A CE2   
413  C CE3   . TRP A 79  ? 0.6875 0.3016 0.2090 0.0233  -0.0134 -0.0146 160 TRP A CE3   
414  C CZ2   . TRP A 79  ? 0.7085 0.3010 0.2240 0.0084  -0.0236 -0.0066 160 TRP A CZ2   
415  C CZ3   . TRP A 79  ? 0.6942 0.3182 0.2334 0.0166  -0.0158 -0.0116 160 TRP A CZ3   
416  C CH2   . TRP A 79  ? 0.7038 0.3151 0.2388 0.0088  -0.0216 -0.0075 160 TRP A CH2   
417  N N     . LYS A 80  ? 0.7162 0.2717 0.1674 0.0521  -0.0275 -0.0305 161 LYS A N     
418  C CA    . LYS A 80  ? 0.7401 0.2865 0.1790 0.0626  -0.0307 -0.0368 161 LYS A CA    
419  C C     . LYS A 80  ? 0.7702 0.3145 0.2157 0.0713  -0.0400 -0.0430 161 LYS A C     
420  O O     . LYS A 80  ? 0.7765 0.3292 0.2265 0.0830  -0.0382 -0.0501 161 LYS A O     
421  C CB    . LYS A 80  ? 0.8091 0.3327 0.2265 0.0592  -0.0376 -0.0345 161 LYS A CB    
422  C CG    . LYS A 80  ? 1.0133 0.5248 0.4141 0.0692  -0.0405 -0.0405 161 LYS A CG    
423  C CD    . LYS A 80  ? 1.0923 0.5831 0.4730 0.0642  -0.0466 -0.0371 161 LYS A CD    
424  C CE    . LYS A 80  ? 1.0839 0.5627 0.4466 0.0752  -0.0486 -0.0437 161 LYS A CE    
425  N NZ    . LYS A 80  ? 1.1690 0.6275 0.5122 0.0696  -0.0554 -0.0402 161 LYS A NZ    
426  N N     . CYS A 81  ? 0.7460 0.2800 0.1921 0.0662  -0.0497 -0.0405 162 CYS A N     
427  C CA    . CYS A 81  ? 0.7474 0.2759 0.1979 0.0736  -0.0608 -0.0457 162 CYS A CA    
428  C C     . CYS A 81  ? 0.7727 0.3256 0.2485 0.0790  -0.0567 -0.0494 162 CYS A C     
429  O O     . CYS A 81  ? 0.7697 0.3257 0.2519 0.0910  -0.0620 -0.0569 162 CYS A O     
430  C CB    . CYS A 81  ? 0.7510 0.2618 0.1927 0.0653  -0.0713 -0.0410 162 CYS A CB    
431  S SG    . CYS A 81  ? 0.8191 0.3025 0.2334 0.0589  -0.0789 -0.0366 162 CYS A SG    
432  N N     . LEU A 82  ? 0.7439 0.3149 0.2350 0.0706  -0.0478 -0.0445 163 LEU A N     
433  C CA    . LEU A 82  ? 0.7396 0.3362 0.2574 0.0728  -0.0440 -0.0463 163 LEU A CA    
434  C C     . LEU A 82  ? 0.7784 0.3954 0.3050 0.0840  -0.0347 -0.0525 163 LEU A C     
435  O O     . LEU A 82  ? 0.7705 0.4053 0.3169 0.0930  -0.0362 -0.0583 163 LEU A O     
436  C CB    . LEU A 82  ? 0.7344 0.3419 0.2621 0.0598  -0.0369 -0.0386 163 LEU A CB    
437  C CG    . LEU A 82  ? 0.7829 0.4113 0.3377 0.0571  -0.0377 -0.0380 163 LEU A CG    
438  C CD1   . LEU A 82  ? 0.7870 0.4011 0.3420 0.0549  -0.0517 -0.0379 163 LEU A CD1   
439  C CD2   . LEU A 82  ? 0.7956 0.4368 0.3584 0.0453  -0.0280 -0.0307 163 LEU A CD2   
440  N N     . PHE A 83  ? 0.7371 0.3511 0.2480 0.0844  -0.0256 -0.0518 164 PHE A N     
441  C CA    . PHE A 83  ? 0.7389 0.3701 0.2526 0.0957  -0.0157 -0.0579 164 PHE A CA    
442  C C     . PHE A 83  ? 0.8137 0.4298 0.3150 0.1121  -0.0254 -0.0680 164 PHE A C     
443  O O     . PHE A 83  ? 0.8292 0.4641 0.3452 0.1255  -0.0236 -0.0761 164 PHE A O     
444  C CB    . PHE A 83  ? 0.7611 0.3937 0.2606 0.0899  -0.0026 -0.0532 164 PHE A CB    
445  C CG    . PHE A 83  ? 0.7859 0.4306 0.2793 0.1027  0.0075  -0.0601 164 PHE A CG    
446  C CD1   . PHE A 83  ? 0.8231 0.5017 0.3402 0.1101  0.0173  -0.0644 164 PHE A CD1   
447  C CD2   . PHE A 83  ? 0.8378 0.4608 0.3021 0.1079  0.0069  -0.0627 164 PHE A CD2   
448  C CE1   . PHE A 83  ? 0.8386 0.5306 0.3488 0.1235  0.0284  -0.0716 164 PHE A CE1   
449  C CE2   . PHE A 83  ? 0.8836 0.5156 0.3384 0.1211  0.0163  -0.0700 164 PHE A CE2   
450  C CZ    . PHE A 83  ? 0.8427 0.5097 0.3200 0.1295  0.0277  -0.0748 164 PHE A CZ    
451  N N     . MET A 84  ? 0.7870 0.3699 0.2620 0.1112  -0.0364 -0.0675 165 MET A N     
452  C CA    . MET A 84  ? 0.8044 0.3649 0.2624 0.1253  -0.0491 -0.0763 165 MET A CA    
453  C C     . MET A 84  ? 0.8423 0.4056 0.3157 0.1352  -0.0607 -0.0828 165 MET A C     
454  O O     . MET A 84  ? 0.8601 0.4203 0.3304 0.1524  -0.0664 -0.0932 165 MET A O     
455  C CB    . MET A 84  ? 0.8477 0.3720 0.2774 0.1179  -0.0608 -0.0719 165 MET A CB    
456  C CG    . MET A 84  ? 0.9080 0.4242 0.3184 0.1140  -0.0536 -0.0690 165 MET A CG    
457  S SD    . MET A 84  ? 0.9819 0.4662 0.3698 0.0988  -0.0651 -0.0599 165 MET A SD    
458  C CE    . MET A 84  ? 0.9652 0.4155 0.3301 0.1095  -0.0848 -0.0669 165 MET A CE    
459  N N     . SER A 85  ? 0.7854 0.3551 0.2755 0.1256  -0.0646 -0.0775 166 SER A N     
460  C CA    . SER A 85  ? 0.7707 0.3420 0.2757 0.1335  -0.0772 -0.0828 166 SER A CA    
461  C C     . SER A 85  ? 0.8344 0.4442 0.3721 0.1434  -0.0688 -0.0888 166 SER A C     
462  O O     . SER A 85  ? 0.8241 0.4381 0.3764 0.1540  -0.0799 -0.0955 166 SER A O     
463  C CB    . SER A 85  ? 0.7866 0.3479 0.2937 0.1193  -0.0851 -0.0747 166 SER A CB    
464  O OG    . SER A 85  ? 0.7578 0.3437 0.2844 0.1081  -0.0729 -0.0683 166 SER A OG    
465  N N     . GLY A 86  ? 0.8131 0.4512 0.3636 0.1378  -0.0504 -0.0851 167 GLY A N     
466  C CA    . GLY A 86  ? 0.8002 0.4802 0.3843 0.1432  -0.0399 -0.0883 167 GLY A CA    
467  C C     . GLY A 86  ? 0.8439 0.5422 0.4542 0.1289  -0.0394 -0.0804 167 GLY A C     
468  O O     . GLY A 86  ? 0.8456 0.5800 0.4875 0.1313  -0.0327 -0.0820 167 GLY A O     
469  N N     . LEU A 87  ? 0.7854 0.4600 0.3831 0.1139  -0.0465 -0.0719 168 LEU A N     
470  C CA    . LEU A 87  ? 0.7696 0.4557 0.3872 0.1002  -0.0478 -0.0646 168 LEU A CA    
471  C C     . LEU A 87  ? 0.8190 0.5326 0.4504 0.0892  -0.0302 -0.0576 168 LEU A C     
472  O O     . LEU A 87  ? 0.8114 0.5477 0.4693 0.0817  -0.0290 -0.0537 168 LEU A O     
473  C CB    . LEU A 87  ? 0.7791 0.4327 0.3768 0.0892  -0.0593 -0.0587 168 LEU A CB    
474  C CG    . LEU A 87  ? 0.8265 0.4561 0.4159 0.0957  -0.0785 -0.0631 168 LEU A CG    
475  C CD1   . LEU A 87  ? 0.8283 0.4253 0.3896 0.0857  -0.0851 -0.0571 168 LEU A CD1   
476  C CD2   . LEU A 87  ? 0.8355 0.4799 0.4523 0.0964  -0.0881 -0.0646 168 LEU A CD2   
477  N N     . SER A 88  ? 0.7918 0.5024 0.4045 0.0884  -0.0177 -0.0559 169 SER A N     
478  C CA    . SER A 88  ? 0.7790 0.5138 0.3997 0.0797  -0.0004 -0.0498 169 SER A CA    
479  C C     . SER A 88  ? 0.8581 0.6086 0.4749 0.0940  0.0114  -0.0572 169 SER A C     
480  O O     . SER A 88  ? 0.8575 0.5860 0.4518 0.1060  0.0060  -0.0642 169 SER A O     
481  C CB    . SER A 88  ? 0.7951 0.5088 0.3935 0.0655  0.0027  -0.0406 169 SER A CB    
482  O OG    . SER A 88  ? 0.7916 0.4788 0.3594 0.0705  0.0014  -0.0430 169 SER A OG    
483  N N     . GLU A 89  ? 0.8317 0.6201 0.4698 0.0929  0.0269  -0.0557 170 GLU A N     
484  C CA    . GLU A 89  ? 0.8320 0.6406 0.4673 0.1073  0.0407  -0.0632 170 GLU A CA    
485  C C     . GLU A 89  ? 0.8990 0.6898 0.5001 0.1041  0.0509  -0.0599 170 GLU A C     
486  O O     . GLU A 89  ? 0.9088 0.7000 0.4939 0.1186  0.0577  -0.0678 170 GLU A O     
487  C CB    . GLU A 89  ? 0.8238 0.6832 0.4954 0.1060  0.0548  -0.0620 170 GLU A CB    
488  N N     . VAL A 90  ? 0.8401 0.6138 0.4293 0.0860  0.0506  -0.0487 171 VAL A N     
489  C CA    . VAL A 90  ? 0.8402 0.5935 0.3973 0.0809  0.0572  -0.0443 171 VAL A CA    
490  C C     . VAL A 90  ? 0.8548 0.5709 0.3940 0.0726  0.0430  -0.0399 171 VAL A C     
491  O O     . VAL A 90  ? 0.8062 0.5176 0.3589 0.0670  0.0321  -0.0378 171 VAL A O     
492  C CB    . VAL A 90  ? 0.8858 0.6600 0.4462 0.0666  0.0736  -0.0340 171 VAL A CB    
493  C CG1   . VAL A 90  ? 0.8727 0.6842 0.4444 0.0756  0.0910  -0.0383 171 VAL A CG1   
494  C CG2   . VAL A 90  ? 0.8707 0.6535 0.4536 0.0481  0.0700  -0.0235 171 VAL A CG2   
495  N N     . GLN A 91  ? 0.8223 0.5134 0.3312 0.0720  0.0431  -0.0387 172 GLN A N     
496  C CA    . GLN A 91  ? 0.8209 0.4812 0.3139 0.0641  0.0316  -0.0343 172 GLN A CA    
497  C C     . GLN A 91  ? 0.8145 0.4780 0.3146 0.0470  0.0342  -0.0234 172 GLN A C     
498  O O     . GLN A 91  ? 0.8039 0.4739 0.2978 0.0400  0.0445  -0.0177 172 GLN A O     
499  C CB    . GLN A 91  ? 0.8582 0.4944 0.3195 0.0687  0.0309  -0.0362 172 GLN A CB    
500  C CG    . GLN A 91  ? 1.0059 0.6163 0.4521 0.0588  0.0223  -0.0301 172 GLN A CG    
501  C CD    . GLN A 91  ? 0.9751 0.5690 0.4216 0.0610  0.0081  -0.0328 172 GLN A CD    
502  O OE1   . GLN A 91  ? 0.9418 0.5184 0.3728 0.0689  0.0007  -0.0379 172 GLN A OE1   
503  N NE2   . GLN A 91  ? 0.9344 0.5319 0.3966 0.0535  0.0034  -0.0291 172 GLN A NE2   
504  N N     . LEU A 92  ? 0.7569 0.4140 0.2682 0.0407  0.0241  -0.0209 173 LEU A N     
505  C CA    . LEU A 92  ? 0.7299 0.3857 0.2465 0.0262  0.0235  -0.0120 173 LEU A CA    
506  C C     . LEU A 92  ? 0.7569 0.3851 0.2538 0.0224  0.0156  -0.0094 173 LEU A C     
507  O O     . LEU A 92  ? 0.7503 0.3630 0.2318 0.0292  0.0112  -0.0135 173 LEU A O     
508  C CB    . LEU A 92  ? 0.7253 0.3935 0.2676 0.0223  0.0172  -0.0113 173 LEU A CB    
509  C CG    . LEU A 92  ? 0.7659 0.4664 0.3344 0.0255  0.0238  -0.0136 173 LEU A CG    
510  C CD1   . LEU A 92  ? 0.7423 0.4491 0.3338 0.0229  0.0133  -0.0139 173 LEU A CD1   
511  C CD2   . LEU A 92  ? 0.7906 0.5124 0.3652 0.0158  0.0378  -0.0062 173 LEU A CD2   
512  N N     . ASN A 93  ? 0.7016 0.3239 0.1991 0.0116  0.0133  -0.0027 174 ASN A N     
513  C CA    . ASN A 93  ? 0.7019 0.3020 0.1840 0.0091  0.0062  -0.0009 174 ASN A CA    
514  C C     . ASN A 93  ? 0.7275 0.3236 0.2185 0.0018  -0.0007 0.0026  174 ASN A C     
515  O O     . ASN A 93  ? 0.7126 0.3218 0.2208 -0.0026 -0.0005 0.0044  174 ASN A O     
516  C CB    . ASN A 93  ? 0.7331 0.3236 0.1964 0.0064  0.0108  0.0029  174 ASN A CB    
517  C CG    . ASN A 93  ? 0.7978 0.3945 0.2633 -0.0037 0.0165  0.0102  174 ASN A CG    
518  O OD1   . ASN A 93  ? 0.7762 0.3661 0.2449 -0.0114 0.0110  0.0148  174 ASN A OD1   
519  N ND2   . ASN A 93  ? 0.8485 0.4576 0.3111 -0.0038 0.0273  0.0116  174 ASN A ND2   
520  N N     . HIS A 94  ? 0.7093 0.2883 0.1891 0.0008  -0.0071 0.0033  175 HIS A N     
521  C CA    . HIS A 94  ? 0.7119 0.2835 0.1959 -0.0036 -0.0149 0.0050  175 HIS A CA    
522  C C     . HIS A 94  ? 0.7534 0.3283 0.2453 -0.0132 -0.0149 0.0109  175 HIS A C     
523  O O     . HIS A 94  ? 0.7555 0.3277 0.2556 -0.0164 -0.0222 0.0113  175 HIS A O     
524  C CB    . HIS A 94  ? 0.7291 0.2846 0.1990 -0.0017 -0.0198 0.0044  175 HIS A CB    
525  C CG    . HIS A 94  ? 0.7780 0.3259 0.2361 -0.0042 -0.0176 0.0081  175 HIS A CG    
526  N ND1   . HIS A 94  ? 0.8106 0.3491 0.2654 -0.0096 -0.0216 0.0121  175 HIS A ND1   
527  C CD2   . HIS A 94  ? 0.7906 0.3359 0.2376 -0.0017 -0.0140 0.0081  175 HIS A CD2   
528  C CE1   . HIS A 94  ? 0.7922 0.3234 0.2345 -0.0103 -0.0199 0.0146  175 HIS A CE1   
529  N NE2   . HIS A 94  ? 0.7999 0.3350 0.2372 -0.0056 -0.0154 0.0123  175 HIS A NE2   
530  N N     . MET A 95  ? 0.7402 0.3189 0.2276 -0.0187 -0.0077 0.0161  176 MET A N     
531  C CA    . MET A 95  ? 0.7465 0.3272 0.2397 -0.0303 -0.0081 0.0235  176 MET A CA    
532  C C     . MET A 95  ? 0.7890 0.3924 0.3059 -0.0348 -0.0053 0.0248  176 MET A C     
533  O O     . MET A 95  ? 0.7860 0.3926 0.3114 -0.0462 -0.0074 0.0315  176 MET A O     
534  C CB    . MET A 95  ? 0.7812 0.3578 0.2596 -0.0359 -0.0013 0.0296  176 MET A CB    
535  C CG    . MET A 95  ? 0.8538 0.4069 0.3115 -0.0326 -0.0073 0.0291  176 MET A CG    
536  S SD    . MET A 95  ? 0.9452 0.4760 0.3995 -0.0346 -0.0225 0.0295  176 MET A SD    
537  C CE    . MET A 95  ? 0.9014 0.4299 0.3590 -0.0509 -0.0247 0.0400  176 MET A CE    
538  N N     . ASP A 96  ? 0.7322 0.3510 0.2602 -0.0260 -0.0019 0.0184  177 ASP A N     
539  C CA    . ASP A 96  ? 0.7149 0.3580 0.2682 -0.0277 -0.0001 0.0181  177 ASP A CA    
540  C C     . ASP A 96  ? 0.7850 0.4232 0.3495 -0.0253 -0.0125 0.0141  177 ASP A C     
541  O O     . ASP A 96  ? 0.7790 0.4361 0.3662 -0.0260 -0.0140 0.0132  177 ASP A O     
542  C CB    . ASP A 96  ? 0.7371 0.3998 0.2953 -0.0175 0.0103  0.0125  177 ASP A CB    
543  C CG    . ASP A 96  ? 0.7959 0.4643 0.3412 -0.0187 0.0233  0.0156  177 ASP A CG    
544  O OD1   . ASP A 96  ? 0.8670 0.5436 0.4153 -0.0308 0.0289  0.0241  177 ASP A OD1   
545  O OD2   . ASP A 96  ? 0.7633 0.4256 0.2933 -0.0083 0.0270  0.0101  177 ASP A OD2   
546  N N     . ASP A 97  ? 0.7419 0.3561 0.2906 -0.0217 -0.0215 0.0113  178 ASP A N     
547  C CA    . ASP A 97  ? 0.7340 0.3403 0.2873 -0.0184 -0.0330 0.0071  178 ASP A CA    
548  C C     . ASP A 97  ? 0.7527 0.3644 0.3243 -0.0275 -0.0412 0.0108  178 ASP A C     
549  O O     . ASP A 97  ? 0.7128 0.3306 0.2977 -0.0243 -0.0479 0.0071  178 ASP A O     
550  C CB    . ASP A 97  ? 0.7674 0.3492 0.2993 -0.0139 -0.0394 0.0043  178 ASP A CB    
551  C CG    . ASP A 97  ? 0.7995 0.3647 0.3194 -0.0196 -0.0432 0.0082  178 ASP A CG    
552  O OD1   . ASP A 97  ? 0.7682 0.3371 0.2926 -0.0286 -0.0410 0.0145  178 ASP A OD1   
553  O OD2   . ASP A 97  ? 0.7762 0.3246 0.2814 -0.0148 -0.0484 0.0050  178 ASP A OD2   
554  N N     . HIS A 98  ? 0.7220 0.3319 0.2951 -0.0394 -0.0416 0.0185  179 HIS A N     
555  C CA    . HIS A 98  ? 0.7381 0.3515 0.3285 -0.0502 -0.0512 0.0232  179 HIS A CA    
556  C C     . HIS A 98  ? 0.7530 0.4004 0.3741 -0.0545 -0.0457 0.0254  179 HIS A C     
557  O O     . HIS A 98  ? 0.7316 0.3852 0.3718 -0.0615 -0.0555 0.0276  179 HIS A O     
558  C CB    . HIS A 98  ? 0.7750 0.3716 0.3551 -0.0626 -0.0558 0.0313  179 HIS A CB    
559  C CG    . HIS A 98  ? 0.8508 0.4151 0.4064 -0.0569 -0.0659 0.0274  179 HIS A CG    
560  N ND1   . HIS A 98  ? 0.8833 0.4295 0.4367 -0.0573 -0.0814 0.0252  179 HIS A ND1   
561  C CD2   . HIS A 98  ? 0.8959 0.4454 0.4295 -0.0491 -0.0623 0.0243  179 HIS A CD2   
562  C CE1   . HIS A 98  ? 0.8961 0.4184 0.4258 -0.0492 -0.0854 0.0206  179 HIS A CE1   
563  N NE2   . HIS A 98  ? 0.9109 0.4360 0.4301 -0.0440 -0.0742 0.0199  179 HIS A NE2   
564  N N     . THR A 99  ? 0.7146 0.3843 0.3407 -0.0495 -0.0306 0.0242  180 THR A N     
565  C CA    . THR A 99  ? 0.6882 0.3948 0.3438 -0.0506 -0.0228 0.0249  180 THR A CA    
566  C C     . THR A 99  ? 0.7240 0.4394 0.3927 -0.0370 -0.0279 0.0152  180 THR A C     
567  O O     . THR A 99  ? 0.7042 0.4496 0.4018 -0.0364 -0.0260 0.0143  180 THR A O     
568  C CB    . THR A 99  ? 0.7758 0.5013 0.4274 -0.0497 -0.0040 0.0270  180 THR A CB    
569  O OG1   . THR A 99  ? 0.7802 0.4999 0.4167 -0.0334 0.0010  0.0179  180 THR A OG1   
570  C CG2   . THR A 99  ? 0.7673 0.4786 0.3996 -0.0621 0.0004  0.0364  180 THR A CG2   
571  N N     . LEU A 100 ? 0.6751 0.3650 0.3228 -0.0261 -0.0348 0.0082  181 LEU A N     
572  C CA    . LEU A 100 ? 0.6635 0.3557 0.3172 -0.0130 -0.0407 -0.0007 181 LEU A CA    
573  C C     . LEU A 100 ? 0.7003 0.3976 0.3760 -0.0152 -0.0552 -0.0017 181 LEU A C     
574  O O     . LEU A 100 ? 0.6825 0.4007 0.3789 -0.0074 -0.0558 -0.0066 181 LEU A O     
575  C CB    . LEU A 100 ? 0.6761 0.3401 0.3007 -0.0036 -0.0442 -0.0060 181 LEU A CB    
576  C CG    . LEU A 100 ? 0.7309 0.4001 0.3462 0.0073  -0.0340 -0.0109 181 LEU A CG    
577  C CD1   . LEU A 100 ? 0.7419 0.4197 0.3504 0.0028  -0.0192 -0.0061 181 LEU A CD1   
578  C CD2   . LEU A 100 ? 0.7484 0.3914 0.3386 0.0147  -0.0395 -0.0152 181 LEU A CD2   
579  N N     . PRO A 101 ? 0.6719 0.3526 0.3459 -0.0249 -0.0677 0.0025  182 PRO A N     
580  C CA    . PRO A 101 ? 0.6769 0.3630 0.3726 -0.0265 -0.0826 0.0011  182 PRO A CA    
581  C C     . PRO A 101 ? 0.7281 0.4545 0.4631 -0.0321 -0.0784 0.0044  182 PRO A C     
582  O O     . PRO A 101 ? 0.7109 0.4533 0.4681 -0.0252 -0.0852 -0.0007 182 PRO A O     
583  C CB    . PRO A 101 ? 0.7152 0.3733 0.3971 -0.0367 -0.0958 0.0055  182 PRO A CB    
584  C CG    . PRO A 101 ? 0.7756 0.4088 0.4240 -0.0338 -0.0897 0.0051  182 PRO A CG    
585  C CD    . PRO A 101 ? 0.7090 0.3620 0.3594 -0.0326 -0.0713 0.0070  182 PRO A CD    
586  N N     . GLY A 102 ? 0.7096 0.4526 0.4529 -0.0445 -0.0673 0.0129  183 GLY A N     
587  C CA    . GLY A 102 ? 0.6992 0.4843 0.4802 -0.0528 -0.0607 0.0181  183 GLY A CA    
588  C C     . GLY A 102 ? 0.7548 0.5744 0.5515 -0.0403 -0.0450 0.0123  183 GLY A C     
589  O O     . GLY A 102 ? 0.7344 0.5870 0.5655 -0.0371 -0.0463 0.0097  183 GLY A O     
590  N N     . LYS A 103 ? 0.7338 0.5457 0.5051 -0.0324 -0.0310 0.0097  184 LYS A N     
591  C CA    . LYS A 103 ? 0.7223 0.5620 0.5017 -0.0189 -0.0159 0.0033  184 LYS A CA    
592  C C     . LYS A 103 ? 0.7848 0.6170 0.5615 0.0012  -0.0238 -0.0093 184 LYS A C     
593  O O     . LYS A 103 ? 0.7815 0.6445 0.5820 0.0122  -0.0192 -0.0156 184 LYS A O     
594  C CB    . LYS A 103 ? 0.7687 0.6011 0.5205 -0.0191 0.0006  0.0058  184 LYS A CB    
595  N N     . TYR A 104 ? 0.7435 0.5358 0.4913 0.0063  -0.0354 -0.0130 185 TYR A N     
596  C CA    . TYR A 104 ? 0.7456 0.5250 0.4844 0.0237  -0.0433 -0.0236 185 TYR A CA    
597  C C     . TYR A 104 ? 0.7805 0.5386 0.5193 0.0254  -0.0642 -0.0266 185 TYR A C     
598  O O     . TYR A 104 ? 0.7786 0.5268 0.5116 0.0391  -0.0723 -0.0348 185 TYR A O     
599  C CB    . TYR A 104 ? 0.7839 0.5359 0.4853 0.0302  -0.0374 -0.0262 185 TYR A CB    
600  C CG    . TYR A 104 ? 0.8012 0.5701 0.4980 0.0315  -0.0185 -0.0250 185 TYR A CG    
601  C CD1   . TYR A 104 ? 0.8156 0.6046 0.5199 0.0463  -0.0107 -0.0329 185 TYR A CD1   
602  C CD2   . TYR A 104 ? 0.8172 0.5802 0.5001 0.0188  -0.0092 -0.0163 185 TYR A CD2   
603  C CE1   . TYR A 104 ? 0.8281 0.6312 0.5246 0.0482  0.0068  -0.0323 185 TYR A CE1   
604  C CE2   . TYR A 104 ? 0.8335 0.6100 0.5093 0.0194  0.0075  -0.0148 185 TYR A CE2   
605  C CZ    . TYR A 104 ? 0.9401 0.7365 0.6218 0.0341  0.0160  -0.0228 185 TYR A CZ    
606  O OH    . TYR A 104 ? 0.9724 0.7803 0.6433 0.0356  0.0327  -0.0217 185 TYR A OH    
607  N N     . GLY A 105 ? 0.7113 0.4599 0.4538 0.0120  -0.0738 -0.0202 186 GLY A N     
608  C CA    . GLY A 105 ? 0.7000 0.4254 0.4384 0.0130  -0.0940 -0.0227 186 GLY A CA    
609  C C     . GLY A 105 ? 0.7390 0.4237 0.4374 0.0172  -0.0993 -0.0250 186 GLY A C     
610  O O     . GLY A 105 ? 0.7464 0.4114 0.4353 0.0234  -0.1138 -0.0296 186 GLY A O     
611  N N     . ILE A 106 ? 0.6890 0.3617 0.3637 0.0134  -0.0877 -0.0215 187 ILE A N     
612  C CA    . ILE A 106 ? 0.6921 0.3320 0.3309 0.0162  -0.0894 -0.0228 187 ILE A CA    
613  C C     . ILE A 106 ? 0.7329 0.3548 0.3559 0.0056  -0.0902 -0.0170 187 ILE A C     
614  O O     . ILE A 106 ? 0.7164 0.3478 0.3439 -0.0023 -0.0811 -0.0116 187 ILE A O     
615  C CB    . ILE A 106 ? 0.7111 0.3519 0.3353 0.0238  -0.0766 -0.0252 187 ILE A CB    
616  C CG1   . ILE A 106 ? 0.6856 0.3377 0.3204 0.0370  -0.0786 -0.0326 187 ILE A CG1   
617  C CG2   . ILE A 106 ? 0.7315 0.3427 0.3216 0.0240  -0.0768 -0.0247 187 ILE A CG2   
618  C CD1   . ILE A 106 ? 0.6790 0.3303 0.2989 0.0451  -0.0679 -0.0357 187 ILE A CD1   
619  N N     . GLY A 107 ? 0.7023 0.2968 0.3037 0.0067  -0.1008 -0.0186 188 GLY A N     
620  C CA    . GLY A 107 ? 0.7123 0.2868 0.2948 0.0004  -0.1027 -0.0154 188 GLY A CA    
621  C C     . GLY A 107 ? 0.7356 0.2904 0.2878 0.0056  -0.0986 -0.0174 188 GLY A C     
622  O O     . GLY A 107 ? 0.7053 0.2596 0.2505 0.0124  -0.0961 -0.0204 188 GLY A O     
623  N N     . PHE A 108 ? 0.7126 0.2506 0.2466 0.0025  -0.0992 -0.0159 189 PHE A N     
624  C CA    . PHE A 108 ? 0.7076 0.2316 0.2158 0.0068  -0.0941 -0.0173 189 PHE A CA    
625  C C     . PHE A 108 ? 0.7623 0.2651 0.2505 0.0073  -0.1013 -0.0188 189 PHE A C     
626  O O     . PHE A 108 ? 0.7588 0.2553 0.2495 0.0031  -0.1072 -0.0175 189 PHE A O     
627  C CB    . PHE A 108 ? 0.7149 0.2463 0.2215 0.0048  -0.0817 -0.0142 189 PHE A CB    
628  C CG    . PHE A 108 ? 0.7082 0.2582 0.2276 0.0056  -0.0720 -0.0132 189 PHE A CG    
629  C CD1   . PHE A 108 ? 0.7294 0.2789 0.2387 0.0110  -0.0668 -0.0151 189 PHE A CD1   
630  C CD2   . PHE A 108 ? 0.6995 0.2667 0.2386 0.0003  -0.0677 -0.0098 189 PHE A CD2   
631  C CE1   . PHE A 108 ? 0.7405 0.3041 0.2580 0.0132  -0.0587 -0.0151 189 PHE A CE1   
632  C CE2   . PHE A 108 ? 0.7277 0.3123 0.2754 0.0025  -0.0575 -0.0096 189 PHE A CE2   
633  C CZ    . PHE A 108 ? 0.7107 0.2920 0.2465 0.0097  -0.0533 -0.0128 189 PHE A CZ    
634  N N     . THR A 109 ? 0.7359 0.2274 0.2023 0.0122  -0.1002 -0.0212 190 THR A N     
635  C CA    . THR A 109 ? 0.7459 0.2199 0.1889 0.0150  -0.1029 -0.0235 190 THR A CA    
636  C C     . THR A 109 ? 0.7877 0.2618 0.2134 0.0185  -0.0940 -0.0238 190 THR A C     
637  O O     . THR A 109 ? 0.7800 0.2645 0.2119 0.0179  -0.0879 -0.0220 190 THR A O     
638  C CB    . THR A 109 ? 0.8446 0.3010 0.2792 0.0158  -0.1176 -0.0263 190 THR A CB    
639  O OG1   . THR A 109 ? 0.8549 0.2950 0.2666 0.0196  -0.1191 -0.0293 190 THR A OG1   
640  C CG2   . THR A 109 ? 0.8527 0.3034 0.2802 0.0181  -0.1235 -0.0277 190 THR A CG2   
641  N N     . ASN A 110 ? 0.7726 0.2361 0.1771 0.0221  -0.0931 -0.0260 191 ASN A N     
642  C CA    . ASN A 110 ? 0.7761 0.2418 0.1645 0.0240  -0.0847 -0.0255 191 ASN A CA    
643  C C     . ASN A 110 ? 0.8416 0.2923 0.2060 0.0272  -0.0892 -0.0284 191 ASN A C     
644  O O     . ASN A 110 ? 0.8348 0.2725 0.1920 0.0303  -0.0972 -0.0320 191 ASN A O     
645  C CB    . ASN A 110 ? 0.7539 0.2291 0.1417 0.0259  -0.0745 -0.0253 191 ASN A CB    
646  C CG    . ASN A 110 ? 0.9016 0.3907 0.3075 0.0226  -0.0685 -0.0219 191 ASN A CG    
647  O OD1   . ASN A 110 ? 0.8035 0.2983 0.2157 0.0199  -0.0670 -0.0196 191 ASN A OD1   
648  N ND2   . ASN A 110 ? 0.8486 0.3408 0.2604 0.0234  -0.0661 -0.0220 191 ASN A ND2   
649  N N     . MET A 111 ? 0.7864 0.2375 0.1358 0.0262  -0.0845 -0.0264 192 MET A N     
650  C CA    . MET A 111 ? 0.8115 0.2486 0.1332 0.0286  -0.0869 -0.0283 192 MET A CA    
651  C C     . MET A 111 ? 0.8695 0.3079 0.1791 0.0354  -0.0807 -0.0326 192 MET A C     
652  O O     . MET A 111 ? 0.8764 0.2989 0.1673 0.0404  -0.0870 -0.0371 192 MET A O     
653  C CB    . MET A 111 ? 0.8601 0.3002 0.1695 0.0237  -0.0814 -0.0233 192 MET A CB    
654  C CG    . MET A 111 ? 0.9437 0.3719 0.2221 0.0244  -0.0812 -0.0235 192 MET A CG    
655  S SD    . MET A 111 ? 1.0029 0.4048 0.2687 0.0228  -0.0991 -0.0239 192 MET A SD    
656  C CE    . MET A 111 ? 1.0056 0.3975 0.2337 0.0184  -0.0948 -0.0194 192 MET A CE    
657  N N     . VAL A 112 ? 0.8262 0.2824 0.1452 0.0365  -0.0695 -0.0317 193 VAL A N     
658  C CA    . VAL A 112 ? 0.8275 0.2886 0.1379 0.0447  -0.0630 -0.0364 193 VAL A CA    
659  C C     . VAL A 112 ? 0.8483 0.3134 0.1777 0.0472  -0.0644 -0.0381 193 VAL A C     
660  O O     . VAL A 112 ? 0.7816 0.2573 0.1306 0.0418  -0.0618 -0.0338 193 VAL A O     
661  C CB    . VAL A 112 ? 0.8909 0.3712 0.1946 0.0440  -0.0488 -0.0338 193 VAL A CB    
662  C CG1   . VAL A 112 ? 0.9019 0.3929 0.2022 0.0543  -0.0413 -0.0395 193 VAL A CG1   
663  C CG2   . VAL A 112 ? 0.8979 0.3711 0.1779 0.0405  -0.0480 -0.0314 193 VAL A CG2   
664  N N     . GLU A 113 ? 0.8504 0.3046 0.1708 0.0557  -0.0690 -0.0444 194 GLU A N     
665  C CA    . GLU A 113 ? 0.8504 0.3026 0.1838 0.0579  -0.0729 -0.0459 194 GLU A CA    
666  C C     . GLU A 113 ? 0.8662 0.3371 0.2072 0.0622  -0.0623 -0.0461 194 GLU A C     
667  O O     . GLU A 113 ? 0.8747 0.3485 0.2308 0.0599  -0.0635 -0.0439 194 GLU A O     
668  C CB    . GLU A 113 ? 0.8879 0.3165 0.2049 0.0660  -0.0846 -0.0530 194 GLU A CB    
669  C CG    . GLU A 113 ? 1.0865 0.5042 0.4129 0.0662  -0.0937 -0.0537 194 GLU A CG    
670  C CD    . GLU A 113 ? 1.4205 0.8111 0.7273 0.0743  -0.1074 -0.0609 194 GLU A CD    
671  O OE1   . GLU A 113 ? 1.4559 0.8294 0.7602 0.0690  -0.1197 -0.0600 194 GLU A OE1   
672  O OE2   . GLU A 113 ? 1.2914 0.6774 0.5851 0.0867  -0.1068 -0.0680 194 GLU A OE2   
673  N N     . ARG A 114 ? 0.8294 0.3128 0.1595 0.0689  -0.0528 -0.0490 195 ARG A N     
674  C CA    . ARG A 114 ? 0.8192 0.3220 0.1577 0.0747  -0.0440 -0.0505 195 ARG A CA    
675  C C     . ARG A 114 ? 0.8370 0.3570 0.1956 0.0651  -0.0382 -0.0428 195 ARG A C     
676  O O     . ARG A 114 ? 0.8339 0.3596 0.1937 0.0561  -0.0346 -0.0371 195 ARG A O     
677  C CB    . ARG A 114 ? 0.8436 0.3615 0.1685 0.0826  -0.0335 -0.0544 195 ARG A CB    
678  C CG    . ARG A 114 ? 0.8985 0.4403 0.2351 0.0903  -0.0249 -0.0569 195 ARG A CG    
679  C CD    . ARG A 114 ? 0.9932 0.5513 0.3161 0.1010  -0.0145 -0.0628 195 ARG A CD    
680  N NE    . ARG A 114 ? 1.0169 0.5922 0.3358 0.0908  -0.0035 -0.0558 195 ARG A NE    
681  C CZ    . ARG A 114 ? 1.1257 0.7314 0.4586 0.0858  0.0080  -0.0506 195 ARG A CZ    
682  N NH1   . ARG A 114 ? 0.9624 0.5864 0.3156 0.0911  0.0102  -0.0523 195 ARG A NH1   
683  N NH2   . ARG A 114 ? 0.9712 0.5882 0.2973 0.0748  0.0162  -0.0432 195 ARG A NH2   
684  N N     . THR A 115 ? 0.7704 0.2965 0.1419 0.0678  -0.0383 -0.0431 196 THR A N     
685  C CA    . THR A 115 ? 0.7652 0.3054 0.1534 0.0601  -0.0339 -0.0367 196 THR A CA    
686  C C     . THR A 115 ? 0.8015 0.3665 0.1933 0.0613  -0.0235 -0.0358 196 THR A C     
687  O O     . THR A 115 ? 0.8014 0.3763 0.1902 0.0718  -0.0200 -0.0415 196 THR A O     
688  C CB    . THR A 115 ? 0.8225 0.3566 0.2200 0.0628  -0.0396 -0.0375 196 THR A CB    
689  O OG1   . THR A 115 ? 0.8050 0.3190 0.2012 0.0583  -0.0485 -0.0362 196 THR A OG1   
690  C CG2   . THR A 115 ? 0.7975 0.3458 0.2093 0.0575  -0.0355 -0.0323 196 THR A CG2   
691  N N     . THR A 116 ? 0.7745 0.3502 0.1738 0.0507  -0.0192 -0.0285 197 THR A N     
692  C CA    . THR A 116 ? 0.7730 0.3734 0.1793 0.0486  -0.0106 -0.0256 197 THR A CA    
693  C C     . THR A 116 ? 0.7938 0.3979 0.2128 0.0384  -0.0118 -0.0184 197 THR A C     
694  O O     . THR A 116 ? 0.7861 0.3745 0.2039 0.0327  -0.0171 -0.0158 197 THR A O     
695  C CB    . THR A 116 ? 0.8230 0.4313 0.2166 0.0443  -0.0037 -0.0231 197 THR A CB    
696  O OG1   . THR A 116 ? 0.8436 0.4370 0.2307 0.0338  -0.0080 -0.0177 197 THR A OG1   
697  C CG2   . THR A 116 ? 0.8297 0.4352 0.2069 0.0551  -0.0012 -0.0305 197 THR A CG2   
698  N N     . PRO A 117 ? 0.7578 0.3830 0.1882 0.0354  -0.0073 -0.0151 198 PRO A N     
699  C CA    . PRO A 117 ? 0.7572 0.3818 0.1960 0.0253  -0.0103 -0.0084 198 PRO A CA    
700  C C     . PRO A 117 ? 0.7912 0.4052 0.2209 0.0145  -0.0118 -0.0026 198 PRO A C     
701  O O     . PRO A 117 ? 0.7929 0.3941 0.2235 0.0100  -0.0172 -0.0003 198 PRO A O     
702  C CB    . PRO A 117 ? 0.7774 0.4280 0.2301 0.0240  -0.0060 -0.0059 198 PRO A CB    
703  C CG    . PRO A 117 ? 0.8233 0.4873 0.2786 0.0374  -0.0017 -0.0135 198 PRO A CG    
704  C CD    . PRO A 117 ? 0.7649 0.4159 0.2024 0.0415  0.0000  -0.0175 198 PRO A CD    
705  N N     . GLY A 118 ? 0.7606 0.3785 0.1798 0.0112  -0.0076 -0.0010 199 GLY A N     
706  C CA    . GLY A 118 ? 0.7593 0.3646 0.1672 0.0016  -0.0108 0.0043  199 GLY A CA    
707  C C     . GLY A 118 ? 0.8192 0.4188 0.2098 0.0023  -0.0085 0.0032  199 GLY A C     
708  O O     . GLY A 118 ? 0.8233 0.4318 0.2099 0.0102  -0.0028 -0.0016 199 GLY A O     
709  N N     . SER A 119 ? 0.7893 0.3728 0.1675 -0.0053 -0.0138 0.0073  200 SER A N     
710  C CA    . SER A 119 ? 0.8002 0.3731 0.1581 -0.0061 -0.0140 0.0072  200 SER A CA    
711  C C     . SER A 119 ? 0.8608 0.4514 0.2091 -0.0098 -0.0040 0.0107  200 SER A C     
712  O O     . SER A 119 ? 0.8728 0.4581 0.2033 -0.0060 -0.0015 0.0079  200 SER A O     
713  C CB    . SER A 119 ? 0.8668 0.4182 0.2147 -0.0138 -0.0237 0.0115  200 SER A CB    
714  O OG    . SER A 119 ? 0.8696 0.4242 0.2147 -0.0260 -0.0241 0.0201  200 SER A OG    
715  N N     . LYS A 120 ? 0.8182 0.4303 0.1777 -0.0175 0.0016  0.0168  201 LYS A N     
716  C CA    . LYS A 120 ? 0.8490 0.4840 0.2032 -0.0237 0.0125  0.0220  201 LYS A CA    
717  C C     . LYS A 120 ? 0.9135 0.5699 0.2703 -0.0104 0.0235  0.0141  201 LYS A C     
718  O O     . LYS A 120 ? 0.9091 0.5841 0.2573 -0.0127 0.0342  0.0166  201 LYS A O     
719  C CB    . LYS A 120 ? 0.8801 0.5329 0.2491 -0.0370 0.0136  0.0314  201 LYS A CB    
720  C CG    . LYS A 120 ? 1.0343 0.6650 0.3915 -0.0520 0.0035  0.0405  201 LYS A CG    
721  C CD    . LYS A 120 ? 1.1550 0.7988 0.5263 -0.0653 0.0015  0.0496  201 LYS A CD    
722  N N     . ASP A 121 ? 0.8725 0.5249 0.2392 0.0038  0.0206  0.0046  202 ASP A N     
723  C CA    . ASP A 121 ? 0.8601 0.5276 0.2279 0.0189  0.0280  -0.0045 202 ASP A CA    
724  C C     . ASP A 121 ? 0.9480 0.5958 0.2911 0.0283  0.0267  -0.0116 202 ASP A C     
725  O O     . ASP A 121 ? 0.9768 0.6348 0.3147 0.0414  0.0329  -0.0195 202 ASP A O     
726  C CB    . ASP A 121 ? 0.8792 0.5496 0.2678 0.0291  0.0236  -0.0106 202 ASP A CB    
727  C CG    . ASP A 121 ? 1.0673 0.7534 0.4782 0.0205  0.0227  -0.0042 202 ASP A CG    
728  O OD1   . ASP A 121 ? 1.0864 0.8018 0.5075 0.0156  0.0311  0.0003  202 ASP A OD1   
729  O OD2   . ASP A 121 ? 1.1005 0.7702 0.5185 0.0183  0.0136  -0.0033 202 ASP A OD2   
730  N N     . LEU A 122 ? 0.8878 0.5072 0.2148 0.0223  0.0179  -0.0092 203 LEU A N     
731  C CA    . LEU A 122 ? 0.8755 0.4727 0.1788 0.0299  0.0137  -0.0153 203 LEU A CA    
732  C C     . LEU A 122 ? 0.9627 0.5630 0.2401 0.0257  0.0215  -0.0121 203 LEU A C     
733  O O     . LEU A 122 ? 0.9666 0.5715 0.2399 0.0113  0.0240  -0.0020 203 LEU A O     
734  C CB    . LEU A 122 ? 0.8738 0.4402 0.1743 0.0267  -0.0009 -0.0151 203 LEU A CB    
735  C CG    . LEU A 122 ? 0.9209 0.4817 0.2434 0.0306  -0.0086 -0.0183 203 LEU A CG    
736  C CD1   . LEU A 122 ? 0.9192 0.4559 0.2407 0.0264  -0.0208 -0.0172 203 LEU A CD1   
737  C CD2   . LEU A 122 ? 0.9599 0.5191 0.2832 0.0448  -0.0094 -0.0278 203 LEU A CD2   
738  N N     . SER A 123 ? 0.9499 0.5446 0.2073 0.0380  0.0241  -0.0204 204 SER A N     
739  C CA    . SER A 123 ? 0.9674 0.5627 0.1949 0.0357  0.0321  -0.0183 204 SER A CA    
740  C C     . SER A 123 ? 1.0474 0.6055 0.2492 0.0305  0.0191  -0.0165 204 SER A C     
741  O O     . SER A 123 ? 1.0529 0.5871 0.2610 0.0329  0.0046  -0.0198 204 SER A O     
742  C CB    . SER A 123 ? 1.0137 0.6200 0.2288 0.0535  0.0412  -0.0294 204 SER A CB    
743  O OG    . SER A 123 ? 1.1119 0.6868 0.3109 0.0660  0.0290  -0.0395 204 SER A OG    
744  N N     . SER A 124 ? 1.0229 0.5773 0.1961 0.0233  0.0242  -0.0111 205 SER A N     
745  C CA    . SER A 124 ? 1.0448 0.5639 0.1892 0.0187  0.0119  -0.0092 205 SER A CA    
746  C C     . SER A 124 ? 1.1059 0.5989 0.2359 0.0341  0.0013  -0.0212 205 SER A C     
747  O O     . SER A 124 ? 1.0926 0.5565 0.2199 0.0326  -0.0155 -0.0219 205 SER A O     
748  C CB    . SER A 124 ? 1.0659 0.5884 0.1782 0.0094  0.0219  -0.0015 205 SER A CB    
749  O OG    . SER A 124 ? 1.1648 0.6502 0.2465 0.0055  0.0084  0.0001  205 SER A OG    
750  N N     . LYS A 125 ? 1.0903 0.5936 0.2108 0.0491  0.0101  -0.0308 206 LYS A N     
751  C CA    . LYS A 125 ? 1.0867 0.5641 0.1911 0.0645  -0.0007 -0.0428 206 LYS A CA    
752  C C     . LYS A 125 ? 1.0806 0.5455 0.2135 0.0673  -0.0157 -0.0465 206 LYS A C     
753  O O     . LYS A 125 ? 1.0812 0.5157 0.2052 0.0696  -0.0321 -0.0501 206 LYS A O     
754  C CB    . LYS A 125 ? 1.1238 0.6180 0.2164 0.0815  0.0122  -0.0530 206 LYS A CB    
755  C CG    . LYS A 125 ? 1.3226 0.8201 0.3765 0.0825  0.0246  -0.0524 206 LYS A CG    
756  N N     . GLU A 126 ? 1.0270 0.5156 0.1938 0.0660  -0.0104 -0.0447 207 GLU A N     
757  C CA    . GLU A 126 ? 1.0049 0.4841 0.1979 0.0671  -0.0226 -0.0469 207 GLU A CA    
758  C C     . GLU A 126 ? 1.0189 0.4784 0.2167 0.0554  -0.0359 -0.0406 207 GLU A C     
759  O O     . GLU A 126 ? 0.9992 0.4391 0.2032 0.0577  -0.0499 -0.0440 207 GLU A O     
760  C CB    . GLU A 126 ? 1.0129 0.5204 0.2380 0.0653  -0.0142 -0.0442 207 GLU A CB    
761  C CG    . GLU A 126 ? 1.1722 0.6986 0.4000 0.0794  -0.0047 -0.0521 207 GLU A CG    
762  C CD    . GLU A 126 ? 1.2559 0.8067 0.5159 0.0772  0.0003  -0.0492 207 GLU A CD    
763  O OE1   . GLU A 126 ? 1.0703 0.6489 0.3394 0.0707  0.0126  -0.0432 207 GLU A OE1   
764  O OE2   . GLU A 126 ? 1.1423 0.6833 0.4178 0.0806  -0.0089 -0.0521 207 GLU A OE2   
765  N N     . PHE A 127 ? 0.9634 0.4285 0.1588 0.0430  -0.0321 -0.0313 208 PHE A N     
766  C CA    . PHE A 127 ? 0.9581 0.4057 0.1578 0.0334  -0.0448 -0.0259 208 PHE A CA    
767  C C     . PHE A 127 ? 1.0015 0.4179 0.1764 0.0361  -0.0588 -0.0293 208 PHE A C     
768  O O     . PHE A 127 ? 0.9863 0.3870 0.1726 0.0356  -0.0733 -0.0306 208 PHE A O     
769  C CB    . PHE A 127 ? 0.9716 0.4286 0.1696 0.0202  -0.0390 -0.0155 208 PHE A CB    
770  C CG    . PHE A 127 ? 0.9747 0.4535 0.2025 0.0146  -0.0332 -0.0109 208 PHE A CG    
771  C CD1   . PHE A 127 ? 1.0036 0.4782 0.2557 0.0146  -0.0420 -0.0117 208 PHE A CD1   
772  C CD2   . PHE A 127 ? 0.9962 0.4993 0.2264 0.0082  -0.0198 -0.0048 208 PHE A CD2   
773  C CE1   . PHE A 127 ? 1.0116 0.5030 0.2868 0.0095  -0.0376 -0.0075 208 PHE A CE1   
774  C CE2   . PHE A 127 ? 1.0202 0.5399 0.2759 0.0023  -0.0169 -0.0002 208 PHE A CE2   
775  C CZ    . PHE A 127 ? 0.9925 0.5045 0.2686 0.0035  -0.0261 -0.0019 208 PHE A CZ    
776  N N     . ARG A 128 ? 0.9915 0.3998 0.1325 0.0394  -0.0547 -0.0311 209 ARG A N     
777  C CA    . ARG A 128 ? 1.0174 0.3932 0.1305 0.0421  -0.0692 -0.0344 209 ARG A CA    
778  C C     . ARG A 128 ? 1.0596 0.4201 0.1758 0.0536  -0.0806 -0.0444 209 ARG A C     
779  O O     . ARG A 128 ? 1.0640 0.3993 0.1766 0.0532  -0.0984 -0.0461 209 ARG A O     
780  C CB    . ARG A 128 ? 1.0345 0.4039 0.1063 0.0413  -0.0616 -0.0326 209 ARG A CB    
781  C CG    . ARG A 128 ? 1.1493 0.5237 0.2166 0.0258  -0.0575 -0.0205 209 ARG A CG    
782  C CD    . ARG A 128 ? 1.2866 0.6598 0.3146 0.0215  -0.0470 -0.0159 209 ARG A CD    
783  N NE    . ARG A 128 ? 1.3569 0.7652 0.3885 0.0244  -0.0246 -0.0162 209 ARG A NE    
784  C CZ    . ARG A 128 ? 1.5134 0.9268 0.5169 0.0333  -0.0131 -0.0214 209 ARG A CZ    
785  N NH1   . ARG A 128 ? 1.4399 0.8223 0.4058 0.0395  -0.0222 -0.0264 209 ARG A NH1   
786  N NH2   . ARG A 128 ? 1.3438 0.7938 0.3563 0.0367  0.0073  -0.0220 209 ARG A NH2   
787  N N     . GLU A 129 ? 1.0185 0.3937 0.1442 0.0632  -0.0723 -0.0506 210 GLU A N     
788  C CA    . GLU A 129 ? 1.0304 0.3902 0.1611 0.0729  -0.0843 -0.0593 210 GLU A CA    
789  C C     . GLU A 129 ? 1.0275 0.3864 0.1931 0.0649  -0.0958 -0.0553 210 GLU A C     
790  O O     . GLU A 129 ? 1.0348 0.3717 0.2011 0.0646  -0.1130 -0.0574 210 GLU A O     
791  C CB    . GLU A 129 ? 1.0484 0.4256 0.1844 0.0843  -0.0729 -0.0658 210 GLU A CB    
792  C CG    . GLU A 129 ? 1.1523 0.5139 0.2974 0.0925  -0.0861 -0.0733 210 GLU A CG    
793  C CD    . GLU A 129 ? 1.2950 0.6724 0.4469 0.1041  -0.0769 -0.0796 210 GLU A CD    
794  O OE1   . GLU A 129 ? 1.0900 0.4973 0.2624 0.1011  -0.0626 -0.0753 210 GLU A OE1   
795  O OE2   . GLU A 129 ? 1.2520 0.6103 0.3886 0.1167  -0.0855 -0.0891 210 GLU A OE2   
796  N N     . GLY A 130 ? 0.9545 0.3379 0.1474 0.0581  -0.0862 -0.0492 211 GLY A N     
797  C CA    . GLY A 130 ? 0.9291 0.3161 0.1536 0.0509  -0.0936 -0.0452 211 GLY A CA    
798  C C     . GLY A 130 ? 0.9639 0.3337 0.1867 0.0447  -0.1077 -0.0423 211 GLY A C     
799  O O     . GLY A 130 ? 0.9432 0.3053 0.1834 0.0435  -0.1205 -0.0434 211 GLY A O     
800  N N     . GLY A 131 ? 0.9431 0.3064 0.1439 0.0409  -0.1064 -0.0387 212 GLY A N     
801  C CA    . GLY A 131 ? 0.9541 0.2980 0.1487 0.0363  -0.1213 -0.0364 212 GLY A CA    
802  C C     . GLY A 131 ? 1.0242 0.3427 0.2084 0.0411  -0.1392 -0.0422 212 GLY A C     
803  O O     . GLY A 131 ? 1.0167 0.3281 0.2188 0.0384  -0.1537 -0.0418 212 GLY A O     
804  N N     . ARG A 132 ? 1.0316 0.3362 0.1869 0.0486  -0.1389 -0.0479 213 ARG A N     
805  C CA    . ARG A 132 ? 1.0311 0.3078 0.1722 0.0538  -0.1572 -0.0541 213 ARG A CA    
806  C C     . ARG A 132 ? 1.0528 0.3334 0.2281 0.0534  -0.1669 -0.0561 213 ARG A C     
807  O O     . ARG A 132 ? 1.0553 0.3224 0.2412 0.0505  -0.1849 -0.0563 213 ARG A O     
808  C CB    . ARG A 132 ? 1.0645 0.3285 0.1674 0.0637  -0.1521 -0.0607 213 ARG A CB    
809  C CG    . ARG A 132 ? 1.1275 0.3597 0.2131 0.0706  -0.1718 -0.0683 213 ARG A CG    
810  C CD    . ARG A 132 ? 1.1676 0.3853 0.2123 0.0831  -0.1671 -0.0767 213 ARG A CD    
811  N NE    . ARG A 132 ? 1.1347 0.3760 0.1873 0.0904  -0.1490 -0.0800 213 ARG A NE    
812  C CZ    . ARG A 132 ? 1.2629 0.5059 0.3341 0.0956  -0.1529 -0.0846 213 ARG A CZ    
813  N NH1   . ARG A 132 ? 1.1673 0.3910 0.2520 0.0927  -0.1735 -0.0856 213 ARG A NH1   
814  N NH2   . ARG A 132 ? 1.1817 0.4457 0.2585 0.1030  -0.1372 -0.0877 213 ARG A NH2   
815  N N     . ILE A 133 ? 0.9820 0.2825 0.1759 0.0552  -0.1549 -0.0566 214 ILE A N     
816  C CA    . ILE A 133 ? 0.9741 0.2799 0.1988 0.0531  -0.1617 -0.0568 214 ILE A CA    
817  C C     . ILE A 133 ? 0.9926 0.3122 0.2516 0.0436  -0.1662 -0.0507 214 ILE A C     
818  O O     . ILE A 133 ? 0.9642 0.2799 0.2436 0.0398  -0.1797 -0.0504 214 ILE A O     
819  C CB    . ILE A 133 ? 1.0061 0.3295 0.2397 0.0572  -0.1472 -0.0581 214 ILE A CB    
820  C CG1   . ILE A 133 ? 1.0296 0.3371 0.2301 0.0694  -0.1464 -0.0664 214 ILE A CG1   
821  C CG2   . ILE A 133 ? 0.9887 0.3183 0.2538 0.0524  -0.1530 -0.0562 214 ILE A CG2   
822  C CD1   . ILE A 133 ? 1.1063 0.4346 0.3087 0.0760  -0.1286 -0.0683 214 ILE A CD1   
823  N N     . LEU A 134 ? 0.9266 0.2631 0.1921 0.0401  -0.1548 -0.0460 215 LEU A N     
824  C CA    . LEU A 134 ? 0.9048 0.2554 0.2005 0.0338  -0.1574 -0.0415 215 LEU A CA    
825  C C     . LEU A 134 ? 0.9568 0.2913 0.2525 0.0323  -0.1761 -0.0420 215 LEU A C     
826  O O     . LEU A 134 ? 0.9334 0.2760 0.2587 0.0291  -0.1847 -0.0411 215 LEU A O     
827  C CB    . LEU A 134 ? 0.8989 0.2659 0.1958 0.0314  -0.1429 -0.0371 215 LEU A CB    
828  C CG    . LEU A 134 ? 0.9407 0.3204 0.2643 0.0273  -0.1452 -0.0337 215 LEU A CG    
829  C CD1   . LEU A 134 ? 0.9151 0.3139 0.2724 0.0255  -0.1422 -0.0332 215 LEU A CD1   
830  C CD2   . LEU A 134 ? 0.9109 0.2986 0.2277 0.0250  -0.1346 -0.0296 215 LEU A CD2   
831  N N     . VAL A 135 ? 0.9799 0.2921 0.2430 0.0346  -0.1828 -0.0434 216 VAL A N     
832  C CA    . VAL A 135 ? 1.0149 0.3103 0.2780 0.0335  -0.2026 -0.0440 216 VAL A CA    
833  C C     . VAL A 135 ? 1.0579 0.3441 0.3349 0.0335  -0.2192 -0.0473 216 VAL A C     
834  O O     . VAL A 135 ? 1.0107 0.3028 0.3160 0.0304  -0.2317 -0.0464 216 VAL A O     
835  C CB    . VAL A 135 ? 1.1221 0.3926 0.3449 0.0349  -0.2079 -0.0438 216 VAL A CB    
836  C CG1   . VAL A 135 ? 1.1562 0.4017 0.3410 0.0399  -0.2121 -0.0484 216 VAL A CG1   
837  C CG2   . VAL A 135 ? 1.1390 0.3977 0.3688 0.0334  -0.2269 -0.0430 216 VAL A CG2   
838  N N     . GLN A 136 ? 1.0433 0.3191 0.3049 0.0367  -0.2182 -0.0509 217 GLN A N     
839  C CA    . GLN A 136 ? 1.0523 0.3168 0.3246 0.0355  -0.2343 -0.0533 217 GLN A CA    
840  C C     . GLN A 136 ? 1.0271 0.3188 0.3467 0.0281  -0.2328 -0.0491 217 GLN A C     
841  O O     . GLN A 136 ? 1.0097 0.3006 0.3516 0.0232  -0.2491 -0.0482 217 GLN A O     
842  C CB    . GLN A 136 ? 1.1052 0.3533 0.3500 0.0418  -0.2317 -0.0584 217 GLN A CB    
843  C CG    . GLN A 136 ? 1.3373 0.5676 0.5877 0.0402  -0.2506 -0.0609 217 GLN A CG    
844  N N     . LYS A 137 ? 0.9554 0.2721 0.2899 0.0271  -0.2134 -0.0462 218 LYS A N     
845  C CA    . LYS A 137 ? 0.9264 0.2695 0.3015 0.0202  -0.2092 -0.0418 218 LYS A CA    
846  C C     . LYS A 137 ? 0.9440 0.3035 0.3476 0.0170  -0.2146 -0.0394 218 LYS A C     
847  O O     . LYS A 137 ? 0.9252 0.2988 0.3612 0.0110  -0.2218 -0.0370 218 LYS A O     
848  C CB    . LYS A 137 ? 0.9509 0.3141 0.3308 0.0207  -0.1879 -0.0396 218 LYS A CB    
849  C CG    . LYS A 137 ? 1.0902 0.4435 0.4559 0.0232  -0.1848 -0.0417 218 LYS A CG    
850  C CD    . LYS A 137 ? 1.1177 0.4920 0.4937 0.0228  -0.1665 -0.0390 218 LYS A CD    
851  C CE    . LYS A 137 ? 1.1467 0.5089 0.5009 0.0291  -0.1628 -0.0428 218 LYS A CE    
852  N NZ    . LYS A 137 ? 0.9860 0.3675 0.3449 0.0307  -0.1447 -0.0410 218 LYS A NZ    
853  N N     . LEU A 138 ? 0.9176 0.2752 0.3090 0.0210  -0.2120 -0.0400 219 LEU A N     
854  C CA    . LEU A 138 ? 0.9077 0.2783 0.3230 0.0207  -0.2180 -0.0391 219 LEU A CA    
855  C C     . LEU A 138 ? 0.9997 0.3564 0.4215 0.0199  -0.2415 -0.0411 219 LEU A C     
856  O O     . LEU A 138 ? 0.9738 0.3484 0.4293 0.0185  -0.2489 -0.0405 219 LEU A O     
857  C CB    . LEU A 138 ? 0.9080 0.2752 0.3051 0.0248  -0.2113 -0.0389 219 LEU A CB    
858  C CG    . LEU A 138 ? 0.9367 0.3214 0.3340 0.0247  -0.1897 -0.0364 219 LEU A CG    
859  C CD1   . LEU A 138 ? 0.9484 0.3228 0.3210 0.0267  -0.1862 -0.0354 219 LEU A CD1   
860  C CD2   . LEU A 138 ? 0.9154 0.3307 0.3516 0.0229  -0.1820 -0.0347 219 LEU A CD2   
861  N N     . GLN A 139 ? 0.9887 0.3142 0.3784 0.0215  -0.2534 -0.0438 220 GLN A N     
862  C CA    . GLN A 139 ? 1.0007 0.3076 0.3917 0.0205  -0.2781 -0.0459 220 GLN A CA    
863  C C     . GLN A 139 ? 1.0515 0.3699 0.4745 0.0132  -0.2863 -0.0441 220 GLN A C     
864  O O     . GLN A 139 ? 1.0676 0.3867 0.5125 0.0100  -0.3052 -0.0441 220 GLN A O     
865  C CB    . GLN A 139 ? 1.0419 0.3091 0.3835 0.0251  -0.2881 -0.0498 220 GLN A CB    
866  C CG    . GLN A 139 ? 1.0763 0.3308 0.3891 0.0298  -0.2857 -0.0500 220 GLN A CG    
867  C CD    . GLN A 139 ? 1.2229 0.4419 0.4824 0.0341  -0.2895 -0.0530 220 GLN A CD    
868  O OE1   . GLN A 139 ? 1.1767 0.3871 0.4147 0.0363  -0.2820 -0.0553 220 GLN A OE1   
869  N NE2   . GLN A 139 ? 1.1802 0.3778 0.4152 0.0360  -0.3006 -0.0532 220 GLN A NE2   
870  N N     . LYS A 140 ? 1.0034 0.3316 0.4306 0.0098  -0.2729 -0.0420 221 LYS A N     
871  C CA    . LYS A 140 ? 0.9773 0.3157 0.4330 0.0006  -0.2795 -0.0386 221 LYS A CA    
872  C C     . LYS A 140 ? 0.9968 0.3770 0.5013 -0.0051 -0.2712 -0.0338 221 LYS A C     
873  O O     . LYS A 140 ? 1.0031 0.3957 0.5393 -0.0111 -0.2850 -0.0318 221 LYS A O     
874  C CB    . LYS A 140 ? 0.9826 0.3125 0.4209 -0.0003 -0.2692 -0.0381 221 LYS A CB    
875  C CG    . LYS A 140 ? 1.0034 0.3418 0.4684 -0.0115 -0.2754 -0.0331 221 LYS A CG    
876  C CD    . LYS A 140 ? 1.0757 0.3995 0.5189 -0.0106 -0.2686 -0.0336 221 LYS A CD    
877  C CE    . LYS A 140 ? 1.1324 0.4643 0.6016 -0.0236 -0.2742 -0.0269 221 LYS A CE    
878  N NZ    . LYS A 140 ? 1.2714 0.6072 0.7333 -0.0234 -0.2582 -0.0251 221 LYS A NZ    
879  N N     . TYR A 141 ? 0.9143 0.3166 0.4243 -0.0028 -0.2490 -0.0323 222 TYR A N     
880  C CA    . TYR A 141 ? 0.8806 0.3221 0.4321 -0.0069 -0.2383 -0.0284 222 TYR A CA    
881  C C     . TYR A 141 ? 0.9128 0.3711 0.4845 -0.0013 -0.2417 -0.0307 222 TYR A C     
882  O O     . TYR A 141 ? 0.8832 0.3741 0.4945 -0.0046 -0.2393 -0.0285 222 TYR A O     
883  C CB    . TYR A 141 ? 0.8805 0.3361 0.4280 -0.0066 -0.2149 -0.0261 222 TYR A CB    
884  C CG    . TYR A 141 ? 0.8981 0.3432 0.4357 -0.0130 -0.2127 -0.0231 222 TYR A CG    
885  C CD1   . TYR A 141 ? 0.9182 0.3772 0.4831 -0.0245 -0.2163 -0.0173 222 TYR A CD1   
886  C CD2   . TYR A 141 ? 0.9197 0.3393 0.4198 -0.0075 -0.2089 -0.0261 222 TYR A CD2   
887  C CE1   . TYR A 141 ? 0.9380 0.3823 0.4910 -0.0306 -0.2173 -0.0144 222 TYR A CE1   
888  C CE2   . TYR A 141 ? 0.9335 0.3408 0.4234 -0.0113 -0.2091 -0.0245 222 TYR A CE2   
889  C CZ    . TYR A 141 ? 1.0346 0.4518 0.5497 -0.0229 -0.2144 -0.0187 222 TYR A CZ    
890  O OH    . TYR A 141 ? 1.0374 0.4385 0.5399 -0.0268 -0.2166 -0.0169 222 TYR A OH    
891  N N     . GLN A 142 ? 0.8808 0.3177 0.4253 0.0073  -0.2470 -0.0351 223 GLN A N     
892  C CA    . GLN A 142 ? 0.8740 0.3174 0.4298 0.0144  -0.2545 -0.0383 223 GLN A CA    
893  C C     . GLN A 142 ? 0.8625 0.3433 0.4518 0.0171  -0.2404 -0.0379 223 GLN A C     
894  O O     . GLN A 142 ? 0.8420 0.3471 0.4681 0.0179  -0.2476 -0.0388 223 GLN A O     
895  C CB    . GLN A 142 ? 0.8915 0.3266 0.4611 0.0132  -0.2799 -0.0400 223 GLN A CB    
896  C CG    . GLN A 142 ? 1.0259 0.4177 0.5533 0.0142  -0.2952 -0.0422 223 GLN A CG    
897  C CD    . GLN A 142 ? 1.2621 0.6437 0.8028 0.0120  -0.3220 -0.0436 223 GLN A CD    
898  O OE1   . GLN A 142 ? 1.1552 0.5447 0.7154 0.0165  -0.3344 -0.0460 223 GLN A OE1   
899  N NE2   . GLN A 142 ? 1.2199 0.5825 0.7504 0.0054  -0.3329 -0.0425 223 GLN A NE2   
900  N N     . PRO A 143 ? 0.7980 0.2844 0.3745 0.0193  -0.2205 -0.0370 224 PRO A N     
901  C CA    . PRO A 143 ? 0.7704 0.2884 0.3731 0.0236  -0.2075 -0.0376 224 PRO A CA    
902  C C     . PRO A 143 ? 0.8278 0.3427 0.4322 0.0343  -0.2178 -0.0430 224 PRO A C     
903  O O     . PRO A 143 ? 0.8326 0.3167 0.4083 0.0373  -0.2303 -0.0448 224 PRO A O     
904  C CB    . PRO A 143 ? 0.7988 0.3134 0.3784 0.0234  -0.1879 -0.0356 224 PRO A CB    
905  C CG    . PRO A 143 ? 0.8732 0.3523 0.4112 0.0236  -0.1930 -0.0359 224 PRO A CG    
906  C CD    . PRO A 143 ? 0.8246 0.2889 0.3620 0.0192  -0.2099 -0.0360 224 PRO A CD    
907  N N     . ARG A 144 ? 0.7856 0.3300 0.4203 0.0408  -0.2129 -0.0457 225 ARG A N     
908  C CA    . ARG A 144 ? 0.7833 0.3205 0.4169 0.0528  -0.2249 -0.0518 225 ARG A CA    
909  C C     . ARG A 144 ? 0.8474 0.3541 0.4381 0.0563  -0.2211 -0.0520 225 ARG A C     
910  O O     . ARG A 144 ? 0.8629 0.3430 0.4329 0.0615  -0.2365 -0.0545 225 ARG A O     
911  C CB    . ARG A 144 ? 0.7801 0.3550 0.4517 0.0618  -0.2186 -0.0561 225 ARG A CB    
912  C CG    . ARG A 144 ? 0.9221 0.5343 0.6414 0.0584  -0.2213 -0.0556 225 ARG A CG    
913  C CD    . ARG A 144 ? 1.0455 0.6955 0.7979 0.0698  -0.2127 -0.0611 225 ARG A CD    
914  N NE    . ARG A 144 ? 1.1751 0.8697 0.9762 0.0651  -0.2096 -0.0594 225 ARG A NE    
915  C CZ    . ARG A 144 ? 1.4135 1.1255 1.2485 0.0689  -0.2263 -0.0627 225 ARG A CZ    
916  N NH1   . ARG A 144 ? 1.2690 0.9538 1.0920 0.0779  -0.2487 -0.0683 225 ARG A NH1   
917  N NH2   . ARG A 144 ? 1.2788 1.0353 1.1598 0.0627  -0.2213 -0.0599 225 ARG A NH2   
918  N N     . ILE A 145 ? 0.8034 0.3135 0.3807 0.0525  -0.2015 -0.0486 226 ILE A N     
919  C CA    . ILE A 145 ? 0.8046 0.2915 0.3459 0.0540  -0.1962 -0.0476 226 ILE A CA    
920  C C     . ILE A 145 ? 0.8235 0.3022 0.3420 0.0451  -0.1824 -0.0423 226 ILE A C     
921  O O     . ILE A 145 ? 0.7826 0.2817 0.3153 0.0411  -0.1680 -0.0400 226 ILE A O     
922  C CB    . ILE A 145 ? 0.8215 0.3212 0.3704 0.0626  -0.1883 -0.0509 226 ILE A CB    
923  C CG1   . ILE A 145 ? 0.8175 0.3280 0.3910 0.0746  -0.2017 -0.0579 226 ILE A CG1   
924  C CG2   . ILE A 145 ? 0.8061 0.2792 0.3175 0.0621  -0.1858 -0.0488 226 ILE A CG2   
925  C CD1   . ILE A 145 ? 0.7937 0.3307 0.3878 0.0847  -0.1904 -0.0627 226 ILE A CD1   
926  N N     . ALA A 146 ? 0.7998 0.2492 0.2823 0.0425  -0.1867 -0.0403 227 ALA A N     
927  C CA    . ALA A 146 ? 0.8016 0.2441 0.2611 0.0362  -0.1735 -0.0362 227 ALA A CA    
928  C C     . ALA A 146 ? 0.8203 0.2603 0.2648 0.0372  -0.1640 -0.0346 227 ALA A C     
929  O O     . ALA A 146 ? 0.8231 0.2429 0.2465 0.0388  -0.1725 -0.0344 227 ALA A O     
930  C CB    . ALA A 146 ? 0.8276 0.2431 0.2566 0.0333  -0.1822 -0.0353 227 ALA A CB    
931  N N     . VAL A 147 ? 0.7523 0.2110 0.2075 0.0358  -0.1484 -0.0331 228 VAL A N     
932  C CA    . VAL A 147 ? 0.7628 0.2207 0.2070 0.0363  -0.1399 -0.0315 228 VAL A CA    
933  C C     . VAL A 147 ? 0.8089 0.2604 0.2308 0.0298  -0.1296 -0.0269 228 VAL A C     
934  O O     . VAL A 147 ? 0.8025 0.2663 0.2314 0.0271  -0.1191 -0.0257 228 VAL A O     
935  C CB    . VAL A 147 ? 0.7788 0.2603 0.2476 0.0404  -0.1308 -0.0335 228 VAL A CB    
936  C CG1   . VAL A 147 ? 0.7864 0.2641 0.2413 0.0405  -0.1232 -0.0319 228 VAL A CG1   
937  C CG2   . VAL A 147 ? 0.7702 0.2608 0.2612 0.0488  -0.1406 -0.0390 228 VAL A CG2   
938  N N     . PHE A 148 ? 0.7733 0.2063 0.1689 0.0272  -0.1328 -0.0241 229 PHE A N     
939  C CA    . PHE A 148 ? 0.7694 0.2002 0.1456 0.0209  -0.1224 -0.0195 229 PHE A CA    
940  C C     . PHE A 148 ? 0.7889 0.2291 0.1688 0.0195  -0.1133 -0.0172 229 PHE A C     
941  O O     . PHE A 148 ? 0.7724 0.2026 0.1440 0.0193  -0.1187 -0.0161 229 PHE A O     
942  C CB    . PHE A 148 ? 0.7950 0.2034 0.1405 0.0168  -0.1294 -0.0163 229 PHE A CB    
943  C CG    . PHE A 148 ? 0.8063 0.2031 0.1425 0.0180  -0.1374 -0.0184 229 PHE A CG    
944  C CD1   . PHE A 148 ? 0.8376 0.2252 0.1818 0.0227  -0.1529 -0.0223 229 PHE A CD1   
945  C CD2   . PHE A 148 ? 0.8225 0.2176 0.1420 0.0155  -0.1304 -0.0173 229 PHE A CD2   
946  C CE1   . PHE A 148 ? 0.8695 0.2444 0.2045 0.0235  -0.1622 -0.0243 229 PHE A CE1   
947  C CE2   . PHE A 148 ? 0.8818 0.2634 0.1901 0.0177  -0.1389 -0.0202 229 PHE A CE2   
948  C CZ    . PHE A 148 ? 0.8830 0.2535 0.1986 0.0210  -0.1553 -0.0233 229 PHE A CZ    
949  N N     . ASN A 149 ? 0.7367 0.1939 0.1280 0.0186  -0.1011 -0.0168 230 ASN A N     
950  C CA    . ASN A 149 ? 0.7435 0.2096 0.1381 0.0171  -0.0926 -0.0147 230 ASN A CA    
951  C C     . ASN A 149 ? 0.7757 0.2384 0.1515 0.0102  -0.0871 -0.0095 230 ASN A C     
952  O O     . ASN A 149 ? 0.7622 0.2364 0.1405 0.0085  -0.0773 -0.0083 230 ASN A O     
953  C CB    . ASN A 149 ? 0.7107 0.1954 0.1254 0.0190  -0.0832 -0.0164 230 ASN A CB    
954  C CG    . ASN A 149 ? 0.7392 0.2319 0.1574 0.0185  -0.0757 -0.0149 230 ASN A CG    
955  O OD1   . ASN A 149 ? 0.7484 0.2334 0.1575 0.0177  -0.0786 -0.0136 230 ASN A OD1   
956  N ND2   . ASN A 149 ? 0.7326 0.2384 0.1623 0.0185  -0.0673 -0.0149 230 ASN A ND2   
957  N N     . GLY A 150 ? 0.7817 0.2288 0.1390 0.0061  -0.0940 -0.0061 231 GLY A N     
958  C CA    . GLY A 150 ? 0.7866 0.2319 0.1258 -0.0023 -0.0891 0.0001  231 GLY A CA    
959  C C     . GLY A 150 ? 0.8485 0.2736 0.1644 -0.0062 -0.0984 0.0028  231 GLY A C     
960  O O     . GLY A 150 ? 0.8483 0.2663 0.1595 -0.0026 -0.1031 -0.0003 231 GLY A O     
961  N N     . LYS A 151 ? 0.8316 0.2452 0.1315 -0.0141 -0.1025 0.0091  232 LYS A N     
962  C CA    . LYS A 151 ? 0.8601 0.2509 0.1333 -0.0201 -0.1123 0.0136  232 LYS A CA    
963  C C     . LYS A 151 ? 0.9019 0.2973 0.1586 -0.0245 -0.1037 0.0164  232 LYS A C     
964  O O     . LYS A 151 ? 0.8996 0.2788 0.1393 -0.0232 -0.1109 0.0154  232 LYS A O     
965  C CB    . LYS A 151 ? 0.9037 0.2821 0.1636 -0.0300 -0.1180 0.0212  232 LYS A CB    
966  C CG    . LYS A 151 ? 1.0037 0.3526 0.2349 -0.0362 -0.1321 0.0261  232 LYS A CG    
967  C CD    . LYS A 151 ? 1.0666 0.3983 0.2855 -0.0454 -0.1416 0.0330  232 LYS A CD    
968  C CE    . LYS A 151 ? 1.2397 0.5373 0.4418 -0.0426 -0.1628 0.0319  232 LYS A CE    
969  N NZ    . LYS A 151 ? 1.2917 0.5675 0.4775 -0.0524 -0.1744 0.0393  232 LYS A NZ    
970  N N     . CYS A 152 ? 0.8992 0.3169 0.1612 -0.0283 -0.0886 0.0191  233 CYS A N     
971  C CA    . CYS A 152 ? 0.8950 0.3231 0.1436 -0.0306 -0.0774 0.0209  233 CYS A CA    
972  C C     . CYS A 152 ? 0.9551 0.3777 0.1999 -0.0208 -0.0791 0.0133  233 CYS A C     
973  O O     . CYS A 152 ? 0.9834 0.3969 0.2040 -0.0226 -0.0787 0.0147  233 CYS A O     
974  C CB    . CYS A 152 ? 0.8892 0.3460 0.1527 -0.0324 -0.0621 0.0225  233 CYS A CB    
975  S SG    . CYS A 152 ? 0.9168 0.3910 0.2114 -0.0201 -0.0571 0.0135  233 CYS A SG    
976  N N     . ILE A 153 ? 0.8832 0.3095 0.1499 -0.0113 -0.0822 0.0059  234 ILE A N     
977  C CA    . ILE A 153 ? 0.8845 0.3041 0.1485 -0.0033 -0.0860 -0.0008 234 ILE A CA    
978  C C     . ILE A 153 ? 0.9246 0.3181 0.1735 -0.0028 -0.1021 -0.0016 234 ILE A C     
979  O O     . ILE A 153 ? 0.9159 0.2980 0.1489 0.0006  -0.1060 -0.0047 234 ILE A O     
980  C CB    . ILE A 153 ? 0.9156 0.3476 0.2063 0.0045  -0.0842 -0.0071 234 ILE A CB    
981  C CG1   . ILE A 153 ? 0.9287 0.3639 0.2429 0.0053  -0.0895 -0.0076 234 ILE A CG1   
982  C CG2   . ILE A 153 ? 0.9035 0.3567 0.2009 0.0058  -0.0695 -0.0073 234 ILE A CG2   
983  C CD1   . ILE A 153 ? 0.9108 0.3565 0.2498 0.0110  -0.0890 -0.0125 234 ILE A CD1   
984  N N     . TYR A 154 ? 0.8928 0.2753 0.1451 -0.0051 -0.1127 0.0005  235 TYR A N     
985  C CA    . TYR A 154 ? 0.9109 0.2673 0.1478 -0.0039 -0.1298 -0.0004 235 TYR A CA    
986  C C     . TYR A 154 ? 0.9923 0.3309 0.1919 -0.0123 -0.1309 0.0063  235 TYR A C     
987  O O     . TYR A 154 ? 1.0079 0.3254 0.1866 -0.0108 -0.1413 0.0050  235 TYR A O     
988  C CB    . TYR A 154 ? 0.8972 0.2458 0.1490 -0.0010 -0.1429 -0.0019 235 TYR A CB    
989  C CG    . TYR A 154 ? 0.9490 0.2721 0.1881 0.0023  -0.1619 -0.0043 235 TYR A CG    
990  C CD1   . TYR A 154 ? 0.9550 0.2789 0.2084 0.0100  -0.1695 -0.0110 235 TYR A CD1   
991  C CD2   . TYR A 154 ? 0.9883 0.2851 0.1998 -0.0032 -0.1737 0.0008  235 TYR A CD2   
992  C CE1   . TYR A 154 ? 0.9820 0.2825 0.2240 0.0130  -0.1882 -0.0132 235 TYR A CE1   
993  C CE2   . TYR A 154 ? 1.0122 0.2831 0.2091 0.0001  -0.1925 -0.0013 235 TYR A CE2   
994  C CZ    . TYR A 154 ? 1.0558 0.3293 0.2689 0.0086  -0.1998 -0.0086 235 TYR A CZ    
995  O OH    . TYR A 154 ? 1.1193 0.3676 0.3200 0.0122  -0.2200 -0.0111 235 TYR A OH    
996  N N     . GLU A 155 ? 0.9580 0.3055 0.1483 -0.0218 -0.1199 0.0139  236 GLU A N     
997  C CA    . GLU A 155 ? 1.0101 0.3436 0.1638 -0.0319 -0.1188 0.0219  236 GLU A CA    
998  C C     . GLU A 155 ? 1.0622 0.3965 0.1975 -0.0276 -0.1118 0.0184  236 GLU A C     
999  O O     . GLU A 155 ? 1.0823 0.3926 0.1863 -0.0293 -0.1201 0.0198  236 GLU A O     
1000 C CB    . GLU A 155 ? 1.0404 0.3907 0.1935 -0.0437 -0.1061 0.0309  236 GLU A CB    
1001 C CG    . GLU A 155 ? 1.2199 0.5529 0.3373 -0.0578 -0.1085 0.0418  236 GLU A CG    
1002 N N     . ILE A 156 ? 1.0129 0.3718 0.1667 -0.0206 -0.0985 0.0129  237 ILE A N     
1003 C CA    . ILE A 156 ? 1.0170 0.3762 0.1547 -0.0136 -0.0926 0.0075  237 ILE A CA    
1004 C C     . ILE A 156 ? 1.0532 0.3880 0.1866 -0.0054 -0.1100 0.0004  237 ILE A C     
1005 O O     . ILE A 156 ? 1.0722 0.3880 0.1752 -0.0038 -0.1145 -0.0009 237 ILE A O     
1006 C CB    . ILE A 156 ? 1.0382 0.4272 0.1990 -0.0068 -0.0772 0.0025  237 ILE A CB    
1007 C CG1   . ILE A 156 ? 1.0405 0.4547 0.2020 -0.0147 -0.0601 0.0095  237 ILE A CG1   
1008 C CG2   . ILE A 156 ? 1.0660 0.4512 0.2148 0.0044  -0.0755 -0.0061 237 ILE A CG2   
1009 C CD1   . ILE A 156 ? 1.0748 0.5148 0.2679 -0.0119 -0.0513 0.0077  237 ILE A CD1   
1010 N N     . PHE A 157 ? 1.0118 0.3491 0.1765 -0.0002 -0.1189 -0.0043 238 PHE A N     
1011 C CA    . PHE A 157 ? 1.0013 0.3210 0.1707 0.0067  -0.1359 -0.0107 238 PHE A CA    
1012 C C     . PHE A 157 ? 1.0916 0.3804 0.2337 0.0039  -0.1527 -0.0083 238 PHE A C     
1013 O O     . PHE A 157 ? 1.0926 0.3619 0.2158 0.0080  -0.1627 -0.0122 238 PHE A O     
1014 C CB    . PHE A 157 ? 0.9819 0.3146 0.1916 0.0102  -0.1409 -0.0139 238 PHE A CB    
1015 C CG    . PHE A 157 ? 0.9689 0.2922 0.1911 0.0166  -0.1557 -0.0203 238 PHE A CG    
1016 C CD1   . PHE A 157 ? 0.9893 0.3212 0.2233 0.0214  -0.1524 -0.0253 238 PHE A CD1   
1017 C CD2   . PHE A 157 ? 0.9754 0.2814 0.1991 0.0176  -0.1743 -0.0212 238 PHE A CD2   
1018 C CE1   . PHE A 157 ? 0.9971 0.3207 0.2443 0.0251  -0.1672 -0.0300 238 PHE A CE1   
1019 C CE2   . PHE A 157 ? 1.0056 0.3064 0.2452 0.0225  -0.1885 -0.0266 238 PHE A CE2   
1020 C CZ    . PHE A 157 ? 0.9718 0.2819 0.2234 0.0253  -0.1847 -0.0304 238 PHE A CZ    
1021 N N     . SER A 158 ? 1.0434 0.3249 0.1818 -0.0029 -0.1577 -0.0022 239 SER A N     
1022 C CA    . SER A 158 ? 1.0894 0.3385 0.2008 -0.0061 -0.1757 0.0010  239 SER A CA    
1023 C C     . SER A 158 ? 1.1852 0.4145 0.2503 -0.0105 -0.1741 0.0044  239 SER A C     
1024 O O     . SER A 158 ? 1.1923 0.3928 0.2350 -0.0081 -0.1910 0.0025  239 SER A O     
1025 C CB    . SER A 158 ? 1.1231 0.3681 0.2356 -0.0134 -0.1792 0.0077  239 SER A CB    
1026 O OG    . SER A 158 ? 1.2192 0.4296 0.2996 -0.0174 -0.1969 0.0116  239 SER A OG    
1027 N N     . LYS A 159 ? 1.1554 0.4006 0.2057 -0.0168 -0.1542 0.0097  240 LYS A N     
1028 C CA    . LYS A 159 ? 1.1936 0.4255 0.1989 -0.0216 -0.1483 0.0138  240 LYS A CA    
1029 C C     . LYS A 159 ? 1.2307 0.4577 0.2258 -0.0103 -0.1485 0.0044  240 LYS A C     
1030 O O     . LYS A 159 ? 1.2425 0.4436 0.1990 -0.0098 -0.1556 0.0043  240 LYS A O     
1031 C CB    . LYS A 159 ? 1.2429 0.5016 0.2438 -0.0310 -0.1252 0.0217  240 LYS A CB    
1032 C CG    . LYS A 159 ? 1.5198 0.7726 0.4762 -0.0374 -0.1146 0.0273  240 LYS A CG    
1033 C CD    . LYS A 159 ? 1.6522 0.9396 0.6142 -0.0465 -0.0911 0.0348  240 LYS A CD    
1034 N N     . GLU A 160 ? 1.1748 0.4237 0.2032 -0.0012 -0.1425 -0.0034 241 GLU A N     
1035 C CA    . GLU A 160 ? 1.1750 0.4194 0.1974 0.0098  -0.1437 -0.0127 241 GLU A CA    
1036 C C     . GLU A 160 ? 1.2404 0.4580 0.2653 0.0157  -0.1681 -0.0187 241 GLU A C     
1037 O O     . GLU A 160 ? 1.2418 0.4370 0.2378 0.0210  -0.1759 -0.0234 241 GLU A O     
1038 C CB    . GLU A 160 ? 1.1617 0.4379 0.2174 0.0157  -0.1292 -0.0174 241 GLU A CB    
1039 C CG    . GLU A 160 ? 1.2122 0.4833 0.2622 0.0272  -0.1307 -0.0271 241 GLU A CG    
1040 C CD    . GLU A 160 ? 1.3029 0.6023 0.3843 0.0327  -0.1182 -0.0312 241 GLU A CD    
1041 O OE1   . GLU A 160 ? 1.2028 0.5226 0.3180 0.0283  -0.1138 -0.0278 241 GLU A OE1   
1042 O OE2   . GLU A 160 ? 1.2043 0.5029 0.2739 0.0422  -0.1140 -0.0383 241 GLU A OE2   
1043 N N     . VAL A 161 ? 1.1956 0.4160 0.2546 0.0151  -0.1801 -0.0188 242 VAL A N     
1044 C CA    . VAL A 161 ? 1.1879 0.3908 0.2599 0.0201  -0.2029 -0.0243 242 VAL A CA    
1045 C C     . VAL A 161 ? 1.2606 0.4331 0.3119 0.0169  -0.2231 -0.0211 242 VAL A C     
1046 O O     . VAL A 161 ? 1.2919 0.4385 0.3281 0.0208  -0.2418 -0.0250 242 VAL A O     
1047 C CB    . VAL A 161 ? 1.1770 0.4055 0.3015 0.0226  -0.2031 -0.0271 242 VAL A CB    
1048 C CG1   . VAL A 161 ? 1.1635 0.3800 0.3073 0.0266  -0.2259 -0.0318 242 VAL A CG1   
1049 C CG2   . VAL A 161 ? 1.1493 0.4022 0.2903 0.0258  -0.1861 -0.0302 242 VAL A CG2   
1050 N N     . PHE A 162 ? 1.2313 0.4042 0.2813 0.0101  -0.2219 -0.0141 243 PHE A N     
1051 C CA    . PHE A 162 ? 1.2624 0.4035 0.2920 0.0075  -0.2432 -0.0111 243 PHE A CA    
1052 C C     . PHE A 162 ? 1.3842 0.5005 0.3596 -0.0009 -0.2407 -0.0034 243 PHE A C     
1053 O O     . PHE A 162 ? 1.3814 0.4642 0.3299 -0.0034 -0.2601 -0.0005 243 PHE A O     
1054 C CB    . PHE A 162 ? 1.2603 0.4103 0.3211 0.0068  -0.2497 -0.0093 243 PHE A CB    
1055 C CG    . PHE A 162 ? 1.2242 0.4014 0.3372 0.0144  -0.2501 -0.0163 243 PHE A CG    
1056 C CD1   . PHE A 162 ? 1.2382 0.4103 0.3687 0.0216  -0.2667 -0.0232 243 PHE A CD1   
1057 C CD2   . PHE A 162 ? 1.2054 0.4135 0.3493 0.0136  -0.2340 -0.0153 243 PHE A CD2   
1058 C CE1   . PHE A 162 ? 1.2178 0.4179 0.3964 0.0267  -0.2654 -0.0283 243 PHE A CE1   
1059 C CE2   . PHE A 162 ? 1.1999 0.4332 0.3891 0.0198  -0.2331 -0.0210 243 PHE A CE2   
1060 C CZ    . PHE A 162 ? 1.1602 0.3906 0.3669 0.0258  -0.2481 -0.0270 243 PHE A CZ    
1061 N N     . GLY A 163 ? 1.3823 0.5154 0.3419 -0.0052 -0.2172 0.0000  244 GLY A N     
1062 C CA    . GLY A 163 ? 1.4246 0.5428 0.3352 -0.0147 -0.2093 0.0085  244 GLY A CA    
1063 C C     . GLY A 163 ? 1.4999 0.6079 0.4022 -0.0266 -0.2143 0.0190  244 GLY A C     
1064 O O     . GLY A 163 ? 1.5250 0.6047 0.3835 -0.0353 -0.2207 0.0267  244 GLY A O     
1065 N N     . VAL A 164 ? 1.4484 0.5767 0.3912 -0.0269 -0.2129 0.0193  245 VAL A N     
1066 C CA    . VAL A 164 ? 1.4592 0.5772 0.4001 -0.0363 -0.2204 0.0277  245 VAL A CA    
1067 C C     . VAL A 164 ? 1.5067 0.6571 0.4656 -0.0443 -0.1987 0.0336  245 VAL A C     
1068 O O     . VAL A 164 ? 1.4612 0.6437 0.4579 -0.0378 -0.1863 0.0279  245 VAL A O     
1069 C CB    . VAL A 164 ? 1.5111 0.6170 0.4806 -0.0276 -0.2439 0.0215  245 VAL A CB    
1070 C CG1   . VAL A 164 ? 1.5122 0.6115 0.4862 -0.0343 -0.2504 0.0280  245 VAL A CG1   
1071 C CG2   . VAL A 164 ? 1.5236 0.5930 0.4706 -0.0221 -0.2688 0.0178  245 VAL A CG2   
1072 N N     . LYS A 165 ? 1.5046 0.6450 0.4351 -0.0594 -0.1956 0.0458  246 LYS A N     
1073 C CA    . LYS A 165 ? 1.5056 0.6713 0.4480 -0.0704 -0.1789 0.0539  246 LYS A CA    
1074 C C     . LYS A 165 ? 1.5823 0.7202 0.5105 -0.0815 -0.1959 0.0631  246 LYS A C     
1075 O O     . LYS A 165 ? 1.5904 0.6979 0.4765 -0.0924 -0.2049 0.0720  246 LYS A O     
1076 C CB    . LYS A 165 ? 1.5479 0.7327 0.4665 -0.0801 -0.1554 0.0610  246 LYS A CB    
1077 C CG    . LYS A 165 ? 1.7266 0.9404 0.6585 -0.0933 -0.1382 0.0707  246 LYS A CG    
1078 C CD    . LYS A 165 ? 1.7964 1.0505 0.7741 -0.0841 -0.1229 0.0630  246 LYS A CD    
1079 N N     . VAL A 166 ? 1.5363 0.6814 0.4974 -0.0778 -0.2020 0.0603  247 VAL A N     
1080 C CA    . VAL A 166 ? 1.5527 0.6699 0.5019 -0.0865 -0.2198 0.0677  247 VAL A CA    
1081 C C     . VAL A 166 ? 1.6003 0.7363 0.5535 -0.1018 -0.2057 0.0783  247 VAL A C     
1082 O O     . VAL A 166 ? 1.5729 0.7476 0.5539 -0.0998 -0.1851 0.0759  247 VAL A O     
1083 C CB    . VAL A 166 ? 1.6051 0.7079 0.5793 -0.0717 -0.2415 0.0576  247 VAL A CB    
1084 C CG1   . VAL A 166 ? 1.6206 0.6941 0.5807 -0.0615 -0.2622 0.0511  247 VAL A CG1   
1085 C CG2   . VAL A 166 ? 1.5771 0.7173 0.6007 -0.0587 -0.2296 0.0471  247 VAL A CG2   
1086 N N     . LYS A 167 ? 1.5781 0.6857 0.5023 -0.1178 -0.2179 0.0907  248 LYS A N     
1087 C CA    . LYS A 167 ? 1.5654 0.6865 0.4908 -0.1353 -0.2083 0.1028  248 LYS A CA    
1088 C C     . LYS A 167 ? 1.5729 0.7103 0.5385 -0.1268 -0.2093 0.0959  248 LYS A C     
1089 O O     . LYS A 167 ? 1.5532 0.7228 0.5388 -0.1332 -0.1921 0.0994  248 LYS A O     
1090 C CB    . LYS A 167 ? 1.6283 0.7078 0.5113 -0.1547 -0.2260 0.1177  248 LYS A CB    
1091 N N     . ASN A 168 ? 1.5021 0.6181 0.4793 -0.1116 -0.2296 0.0857  249 ASN A N     
1092 C CA    . ASN A 168 ? 1.4652 0.5937 0.4771 -0.1012 -0.2317 0.0778  249 ASN A CA    
1093 C C     . ASN A 168 ? 1.4150 0.5599 0.4599 -0.0782 -0.2307 0.0613  249 ASN A C     
1094 O O     . ASN A 168 ? 1.3940 0.5178 0.4429 -0.0651 -0.2500 0.0530  249 ASN A O     
1095 C CB    . ASN A 168 ? 1.4882 0.5785 0.4849 -0.1054 -0.2561 0.0818  249 ASN A CB    
1096 N N     . LEU A 169 ? 1.3098 0.4932 0.3787 -0.0734 -0.2086 0.0567  250 LEU A N     
1097 C CA    . LEU A 169 ? 1.2506 0.4520 0.3523 -0.0545 -0.2065 0.0427  250 LEU A CA    
1098 C C     . LEU A 169 ? 1.2008 0.4068 0.3283 -0.0460 -0.2118 0.0369  250 LEU A C     
1099 O O     . LEU A 169 ? 1.2221 0.4370 0.3533 -0.0541 -0.2050 0.0423  250 LEU A O     
1100 C CB    . LEU A 169 ? 1.2281 0.4664 0.3474 -0.0524 -0.1830 0.0400  250 LEU A CB    
1101 C CG    . LEU A 169 ? 1.2657 0.5279 0.4228 -0.0361 -0.1777 0.0276  250 LEU A CG    
1102 C CD1   . LEU A 169 ? 1.2760 0.5232 0.4349 -0.0245 -0.1926 0.0195  250 LEU A CD1   
1103 C CD2   . LEU A 169 ? 1.2584 0.5535 0.4295 -0.0363 -0.1556 0.0267  250 LEU A CD2   
1104 N N     . GLU A 170 ? 1.0822 0.2823 0.2267 -0.0299 -0.2245 0.0261  251 GLU A N     
1105 C CA    . GLU A 170 ? 1.0476 0.2531 0.2158 -0.0190 -0.2291 0.0188  251 GLU A CA    
1106 C C     . GLU A 170 ? 1.0193 0.2602 0.2264 -0.0054 -0.2158 0.0083  251 GLU A C     
1107 O O     . GLU A 170 ? 0.9957 0.2493 0.2112 -0.0022 -0.2099 0.0052  251 GLU A O     
1108 C CB    . GLU A 170 ? 1.0740 0.2458 0.2318 -0.0100 -0.2550 0.0142  251 GLU A CB    
1109 C CG    . GLU A 170 ? 1.1615 0.2940 0.2794 -0.0243 -0.2706 0.0252  251 GLU A CG    
1110 C CD    . GLU A 170 ? 1.3737 0.4689 0.4794 -0.0149 -0.2983 0.0206  251 GLU A CD    
1111 O OE1   . GLU A 170 ? 1.2487 0.3460 0.3735 0.0033  -0.3079 0.0087  251 GLU A OE1   
1112 O OE2   . GLU A 170 ? 1.3425 0.4063 0.4202 -0.0258 -0.3114 0.0290  251 GLU A OE2   
1113 N N     . PHE A 171 ? 0.9678 0.2218 0.1962 0.0022  -0.2125 0.0031  252 PHE A N     
1114 C CA    . PHE A 171 ? 0.9200 0.2059 0.1835 0.0141  -0.2008 -0.0060 252 PHE A CA    
1115 C C     . PHE A 171 ? 0.9737 0.2549 0.2515 0.0294  -0.2152 -0.0158 252 PHE A C     
1116 O O     . PHE A 171 ? 0.9866 0.2387 0.2462 0.0312  -0.2346 -0.0159 252 PHE A O     
1117 C CB    . PHE A 171 ? 0.9253 0.2259 0.2030 0.0166  -0.1918 -0.0077 252 PHE A CB    
1118 C CG    . PHE A 171 ? 0.9472 0.2588 0.2183 0.0028  -0.1770 0.0010  252 PHE A CG    
1119 C CD1   . PHE A 171 ? 0.9762 0.3146 0.2605 -0.0002 -0.1592 0.0020  252 PHE A CD1   
1120 C CD2   . PHE A 171 ? 1.0054 0.3000 0.2579 -0.0069 -0.1824 0.0080  252 PHE A CD2   
1121 C CE1   . PHE A 171 ? 0.9862 0.3369 0.2670 -0.0112 -0.1464 0.0092  252 PHE A CE1   
1122 C CE2   . PHE A 171 ? 1.0180 0.3265 0.2686 -0.0197 -0.1692 0.0161  252 PHE A CE2   
1123 C CZ    . PHE A 171 ? 0.9724 0.3099 0.2378 -0.0211 -0.1510 0.0163  252 PHE A CZ    
1124 N N     . GLY A 172 ? 0.9114 0.2213 0.2217 0.0396  -0.2065 -0.0235 253 GLY A N     
1125 C CA    . GLY A 172 ? 0.9176 0.2310 0.2481 0.0541  -0.2182 -0.0330 253 GLY A CA    
1126 C C     . GLY A 172 ? 0.9644 0.2758 0.2969 0.0538  -0.2250 -0.0336 253 GLY A C     
1127 O O     . GLY A 172 ? 0.9184 0.2337 0.2428 0.0441  -0.2159 -0.0283 253 GLY A O     
1128 N N     . LEU A 173 ? 0.9510 0.2566 0.2951 0.0656  -0.2419 -0.0408 254 LEU A N     
1129 C CA    . LEU A 173 ? 0.9423 0.2458 0.2917 0.0668  -0.2516 -0.0425 254 LEU A CA    
1130 C C     . LEU A 173 ? 0.9986 0.2675 0.3078 0.0559  -0.2614 -0.0349 254 LEU A C     
1131 O O     . LEU A 173 ? 1.0096 0.2485 0.2903 0.0530  -0.2730 -0.0313 254 LEU A O     
1132 C CB    . LEU A 173 ? 0.9443 0.2508 0.3177 0.0828  -0.2690 -0.0524 254 LEU A CB    
1133 C CG    . LEU A 173 ? 0.9753 0.2844 0.3622 0.0851  -0.2806 -0.0551 254 LEU A CG    
1134 C CD1   . LEU A 173 ? 0.9568 0.2989 0.3694 0.0798  -0.2634 -0.0542 254 LEU A CD1   
1135 C CD2   . LEU A 173 ? 1.0025 0.3173 0.4153 0.1013  -0.2981 -0.0649 254 LEU A CD2   
1136 N N     . GLN A 174 ? 0.9801 0.2522 0.2848 0.0495  -0.2568 -0.0323 255 GLN A N     
1137 C CA    . GLN A 174 ? 1.0109 0.2533 0.2760 0.0396  -0.2632 -0.0254 255 GLN A CA    
1138 C C     . GLN A 174 ? 1.1044 0.3276 0.3668 0.0458  -0.2856 -0.0296 255 GLN A C     
1139 O O     . GLN A 174 ? 1.0671 0.3094 0.3630 0.0549  -0.2901 -0.0368 255 GLN A O     
1140 C CB    . GLN A 174 ? 1.0194 0.2749 0.2762 0.0299  -0.2438 -0.0205 255 GLN A CB    
1141 C CG    . GLN A 174 ? 0.9977 0.2745 0.2600 0.0240  -0.2220 -0.0166 255 GLN A CG    
1142 C CD    . GLN A 174 ? 1.0309 0.2885 0.2663 0.0160  -0.2237 -0.0094 255 GLN A CD    
1143 O OE1   . GLN A 174 ? 1.0828 0.3138 0.2834 0.0077  -0.2312 -0.0029 255 GLN A OE1   
1144 N NE2   . GLN A 174 ? 0.9734 0.2424 0.2228 0.0176  -0.2178 -0.0099 255 GLN A NE2   
1145 N N     . PRO A 175 ? 1.1244 0.3100 0.3465 0.0400  -0.3002 -0.0245 256 PRO A N     
1146 C CA    . PRO A 175 ? 1.1503 0.3135 0.3676 0.0466  -0.3248 -0.0287 256 PRO A CA    
1147 C C     . PRO A 175 ? 1.2399 0.4053 0.4570 0.0452  -0.3257 -0.0300 256 PRO A C     
1148 O O     . PRO A 175 ? 1.2608 0.4040 0.4702 0.0497  -0.3478 -0.0329 256 PRO A O     
1149 C CB    . PRO A 175 ? 1.2079 0.3269 0.3784 0.0401  -0.3404 -0.0219 256 PRO A CB    
1150 C CG    . PRO A 175 ? 1.2596 0.3793 0.4049 0.0258  -0.3207 -0.0120 256 PRO A CG    
1151 C CD    . PRO A 175 ? 1.1676 0.3289 0.3480 0.0273  -0.2969 -0.0144 256 PRO A CD    
1152 N N     . HIS A 176 ? 1.1908 0.3802 0.4159 0.0399  -0.3042 -0.0286 257 HIS A N     
1153 C CA    A HIS A 176 ? 1.1987 0.3876 0.4209 0.0388  -0.3052 -0.0302 257 HIS A CA    
1154 C CA    B HIS A 176 ? 1.1987 0.3873 0.4218 0.0392  -0.3063 -0.0305 257 HIS A CA    
1155 C C     . HIS A 176 ? 1.2138 0.4395 0.4815 0.0431  -0.2957 -0.0356 257 HIS A C     
1156 O O     . HIS A 176 ? 1.2248 0.4775 0.5103 0.0413  -0.2755 -0.0346 257 HIS A O     
1157 C CB    A HIS A 176 ? 1.2283 0.4068 0.4112 0.0286  -0.2901 -0.0236 257 HIS A CB    
1158 C CB    B HIS A 176 ? 1.2320 0.4041 0.4113 0.0293  -0.2954 -0.0241 257 HIS A CB    
1159 C CG    A HIS A 176 ? 1.2927 0.4394 0.4295 0.0208  -0.2948 -0.0160 257 HIS A CG    
1160 C CG    B HIS A 176 ? 1.3001 0.4337 0.4314 0.0232  -0.3066 -0.0177 257 HIS A CG    
1161 N ND1   A HIS A 176 ? 1.3110 0.4634 0.4374 0.0131  -0.2800 -0.0092 257 HIS A ND1   
1162 N ND1   B HIS A 176 ? 1.3341 0.4631 0.4355 0.0127  -0.2915 -0.0092 257 HIS A ND1   
1163 C CD2   A HIS A 176 ? 1.3334 0.4421 0.4317 0.0186  -0.3131 -0.0135 257 HIS A CD2   
1164 C CD2   B HIS A 176 ? 1.3365 0.4353 0.4453 0.0254  -0.3316 -0.0182 257 HIS A CD2   
1165 C CE1   A HIS A 176 ? 1.3305 0.4495 0.4134 0.0054  -0.2891 -0.0022 257 HIS A CE1   
1166 C CE1   B HIS A 176 ? 1.3480 0.4395 0.4088 0.0077  -0.3070 -0.0040 257 HIS A CE1   
1167 N NE2   A HIS A 176 ? 1.3482 0.4393 0.4115 0.0085  -0.3089 -0.0045 257 HIS A NE2   
1168 N NE2   B HIS A 176 ? 1.3578 0.4283 0.4201 0.0155  -0.3318 -0.0094 257 HIS A NE2   
1169 N N     . LYS A 177 ? 1.1264 0.3519 0.4114 0.0476  -0.3110 -0.0405 258 LYS A N     
1170 C CA    . LYS A 177 ? 1.0884 0.3455 0.4143 0.0493  -0.3049 -0.0442 258 LYS A CA    
1171 C C     . LYS A 177 ? 1.1249 0.3769 0.4300 0.0427  -0.2945 -0.0419 258 LYS A C     
1172 O O     . LYS A 177 ? 1.1396 0.3617 0.4022 0.0396  -0.2991 -0.0396 258 LYS A O     
1173 C CB    . LYS A 177 ? 1.0970 0.3545 0.4496 0.0554  -0.3284 -0.0496 258 LYS A CB    
1174 C CG    . LYS A 177 ? 1.1692 0.4421 0.5542 0.0649  -0.3373 -0.0541 258 LYS A CG    
1175 C CD    . LYS A 177 ? 1.3012 0.5781 0.7155 0.0710  -0.3605 -0.0595 258 LYS A CD    
1176 C CE    . LYS A 177 ? 1.4245 0.7108 0.8641 0.0830  -0.3727 -0.0651 258 LYS A CE    
1177 N NZ    . LYS A 177 ? 1.5442 0.8281 1.0061 0.0895  -0.3996 -0.0702 258 LYS A NZ    
1178 N N     . ILE A 178 ? 1.0446 0.3243 0.3774 0.0411  -0.2812 -0.0428 259 ILE A N     
1179 C CA    . ILE A 178 ? 1.0366 0.3101 0.3511 0.0369  -0.2736 -0.0420 259 ILE A CA    
1180 C C     . ILE A 178 ? 1.1238 0.3696 0.4223 0.0380  -0.2964 -0.0448 259 ILE A C     
1181 O O     . ILE A 178 ? 1.1191 0.3696 0.4459 0.0406  -0.3138 -0.0477 259 ILE A O     
1182 C CB    . ILE A 178 ? 1.0389 0.3445 0.3878 0.0349  -0.2588 -0.0423 259 ILE A CB    
1183 C CG1   . ILE A 178 ? 1.0200 0.3486 0.3779 0.0339  -0.2366 -0.0395 259 ILE A CG1   
1184 C CG2   . ILE A 178 ? 1.0383 0.3341 0.3715 0.0324  -0.2569 -0.0431 259 ILE A CG2   
1185 C CD1   . ILE A 178 ? 1.0843 0.4021 0.4059 0.0311  -0.2223 -0.0360 259 ILE A CD1   
1186 N N     . PRO A 179 ? 1.1189 0.3355 0.3716 0.0365  -0.2975 -0.0442 260 PRO A N     
1187 C CA    . PRO A 179 ? 1.1503 0.3353 0.3822 0.0382  -0.3213 -0.0471 260 PRO A CA    
1188 C C     . PRO A 179 ? 1.1895 0.3843 0.4551 0.0382  -0.3339 -0.0506 260 PRO A C     
1189 O O     . PRO A 179 ? 1.1681 0.3830 0.4526 0.0359  -0.3213 -0.0507 260 PRO A O     
1190 C CB    . PRO A 179 ? 1.1961 0.3567 0.3760 0.0372  -0.3129 -0.0464 260 PRO A CB    
1191 C CG    . PRO A 179 ? 1.2445 0.4178 0.4127 0.0343  -0.2901 -0.0415 260 PRO A CG    
1192 C CD    . PRO A 179 ? 1.1471 0.3587 0.3643 0.0339  -0.2777 -0.0410 260 PRO A CD    
1193 N N     . ASP A 180 ? 1.1882 0.3686 0.4625 0.0402  -0.3602 -0.0531 261 ASP A N     
1194 C CA    . ASP A 180 ? 1.1922 0.3800 0.5000 0.0388  -0.3773 -0.0557 261 ASP A CA    
1195 C C     . ASP A 180 ? 1.2097 0.4435 0.5777 0.0367  -0.3687 -0.0547 261 ASP A C     
1196 O O     . ASP A 180 ? 1.1986 0.4453 0.5950 0.0322  -0.3746 -0.0548 261 ASP A O     
1197 C CB    . ASP A 180 ? 1.2381 0.4056 0.5206 0.0364  -0.3796 -0.0572 261 ASP A CB    
1198 N N     . THR A 181 ? 1.1359 0.3937 0.5216 0.0395  -0.3542 -0.0535 262 THR A N     
1199 C CA    . THR A 181 ? 1.0887 0.3906 0.5273 0.0389  -0.3435 -0.0530 262 THR A CA    
1200 C C     . THR A 181 ? 1.0894 0.4026 0.5424 0.0464  -0.3446 -0.0547 262 THR A C     
1201 O O     . THR A 181 ? 1.0991 0.3843 0.5180 0.0503  -0.3518 -0.0551 262 THR A O     
1202 C CB    . THR A 181 ? 1.1608 0.4833 0.6009 0.0349  -0.3152 -0.0498 262 THR A CB    
1203 O OG1   . THR A 181 ? 1.1185 0.4385 0.5374 0.0382  -0.3007 -0.0487 262 THR A OG1   
1204 C CG2   . THR A 181 ? 1.1426 0.4485 0.5572 0.0300  -0.3109 -0.0488 262 THR A CG2   
1205 N N     . GLU A 182 ? 0.9961 0.3496 0.4968 0.0483  -0.3367 -0.0556 263 GLU A N     
1206 C CA    . GLU A 182 ? 0.9815 0.3492 0.4984 0.0574  -0.3357 -0.0585 263 GLU A CA    
1207 C C     . GLU A 182 ? 0.9866 0.3715 0.5008 0.0573  -0.3092 -0.0564 263 GLU A C     
1208 O O     . GLU A 182 ? 1.0012 0.3987 0.5281 0.0651  -0.3061 -0.0591 263 GLU A O     
1209 C CB    . GLU A 182 ? 0.9754 0.3774 0.5474 0.0623  -0.3464 -0.0624 263 GLU A CB    
1210 C CG    . GLU A 182 ? 1.1027 0.4883 0.6807 0.0635  -0.3761 -0.0650 263 GLU A CG    
1211 C CD    . GLU A 182 ? 1.4338 0.7812 0.9802 0.0717  -0.3976 -0.0683 263 GLU A CD    
1212 O OE1   . GLU A 182 ? 1.4121 0.7548 0.9469 0.0793  -0.3930 -0.0700 263 GLU A OE1   
1213 O OE2   . GLU A 182 ? 1.4571 0.7768 0.9888 0.0702  -0.4208 -0.0689 263 GLU A OE2   
1214 N N     . THR A 183 ? 0.9092 0.2921 0.4051 0.0495  -0.2917 -0.0521 264 THR A N     
1215 C CA    . THR A 183 ? 0.8856 0.2835 0.3779 0.0483  -0.2675 -0.0497 264 THR A CA    
1216 C C     . THR A 183 ? 0.9251 0.3009 0.3837 0.0519  -0.2657 -0.0491 264 THR A C     
1217 O O     . THR A 183 ? 0.9426 0.2868 0.3614 0.0491  -0.2711 -0.0470 264 THR A O     
1218 C CB    . THR A 183 ? 0.9173 0.3133 0.3946 0.0401  -0.2533 -0.0458 264 THR A CB    
1219 O OG1   . THR A 183 ? 0.9054 0.3179 0.4115 0.0351  -0.2566 -0.0453 264 THR A OG1   
1220 C CG2   . THR A 183 ? 0.8718 0.2823 0.3454 0.0388  -0.2298 -0.0431 264 THR A CG2   
1221 N N     . LEU A 184 ? 0.8844 0.2770 0.3574 0.0573  -0.2571 -0.0506 265 LEU A N     
1222 C CA    . LEU A 184 ? 0.9096 0.2826 0.3535 0.0595  -0.2558 -0.0494 265 LEU A CA    
1223 C C     . LEU A 184 ? 0.9142 0.2876 0.3368 0.0520  -0.2347 -0.0440 265 LEU A C     
1224 O O     . LEU A 184 ? 0.9013 0.2966 0.3400 0.0483  -0.2198 -0.0428 265 LEU A O     
1225 C CB    . LEU A 184 ? 0.9066 0.2959 0.3749 0.0700  -0.2574 -0.0543 265 LEU A CB    
1226 C CG    . LEU A 184 ? 0.9811 0.3773 0.4777 0.0803  -0.2774 -0.0611 265 LEU A CG    
1227 C CD1   . LEU A 184 ? 0.9848 0.4005 0.5045 0.0925  -0.2752 -0.0670 265 LEU A CD1   
1228 C CD2   . LEU A 184 ? 1.0479 0.4054 0.5161 0.0817  -0.3016 -0.0614 265 LEU A CD2   
1229 N N     . CYS A 185 ? 0.8743 0.2240 0.2618 0.0493  -0.2341 -0.0404 266 CYS A N     
1230 C CA    . CYS A 185 ? 0.8698 0.2224 0.2398 0.0423  -0.2150 -0.0352 266 CYS A CA    
1231 C C     . CYS A 185 ? 0.8696 0.2255 0.2419 0.0454  -0.2113 -0.0351 266 CYS A C     
1232 O O     . CYS A 185 ? 0.8905 0.2243 0.2469 0.0481  -0.2252 -0.0353 266 CYS A O     
1233 C CB    . CYS A 185 ? 0.9067 0.2331 0.2350 0.0348  -0.2154 -0.0300 266 CYS A CB    
1234 S SG    . CYS A 185 ? 0.9722 0.2913 0.2917 0.0328  -0.2191 -0.0311 266 CYS A SG    
1235 N N     . TYR A 186 ? 0.8236 0.2034 0.2125 0.0448  -0.1941 -0.0347 267 TYR A N     
1236 C CA    . TYR A 186 ? 0.8138 0.1967 0.2046 0.0481  -0.1902 -0.0352 267 TYR A CA    
1237 C C     . TYR A 186 ? 0.8686 0.2559 0.2458 0.0395  -0.1732 -0.0293 267 TYR A C     
1238 O O     . TYR A 186 ? 0.8501 0.2559 0.2385 0.0363  -0.1599 -0.0283 267 TYR A O     
1239 C CB    . TYR A 186 ? 0.8089 0.2196 0.2366 0.0576  -0.1867 -0.0416 267 TYR A CB    
1240 C CG    . TYR A 186 ? 0.8127 0.2230 0.2404 0.0643  -0.1860 -0.0443 267 TYR A CG    
1241 C CD1   . TYR A 186 ? 0.8449 0.2389 0.2690 0.0740  -0.2032 -0.0493 267 TYR A CD1   
1242 C CD2   . TYR A 186 ? 0.8055 0.2281 0.2338 0.0615  -0.1700 -0.0422 267 TYR A CD2   
1243 C CE1   . TYR A 186 ? 0.8377 0.2277 0.2588 0.0815  -0.2043 -0.0527 267 TYR A CE1   
1244 C CE2   . TYR A 186 ? 0.8083 0.2262 0.2323 0.0677  -0.1710 -0.0449 267 TYR A CE2   
1245 C CZ    . TYR A 186 ? 0.8529 0.2538 0.2726 0.0779  -0.1881 -0.0503 267 TYR A CZ    
1246 O OH    . TYR A 186 ? 0.8945 0.2883 0.3082 0.0854  -0.1903 -0.0540 267 TYR A OH    
1247 N N     . VAL A 187 ? 0.8404 0.2097 0.1931 0.0349  -0.1750 -0.0248 268 VAL A N     
1248 C CA    . VAL A 187 ? 0.8306 0.2040 0.1702 0.0255  -0.1607 -0.0183 268 VAL A CA    
1249 C C     . VAL A 187 ? 0.8586 0.2387 0.2050 0.0272  -0.1555 -0.0186 268 VAL A C     
1250 O O     . VAL A 187 ? 0.8596 0.2254 0.2018 0.0324  -0.1672 -0.0210 268 VAL A O     
1251 C CB    . VAL A 187 ? 0.8756 0.2251 0.1801 0.0153  -0.1652 -0.0109 268 VAL A CB    
1252 C CG1   . VAL A 187 ? 0.8848 0.2436 0.1795 0.0053  -0.1499 -0.0040 268 VAL A CG1   
1253 C CG2   . VAL A 187 ? 0.8748 0.2150 0.1686 0.0148  -0.1708 -0.0115 268 VAL A CG2   
1254 N N     . MET A 188 ? 0.8169 0.2163 0.1719 0.0235  -0.1395 -0.0165 269 MET A N     
1255 C CA    . MET A 188 ? 0.8206 0.2236 0.1787 0.0247  -0.1357 -0.0166 269 MET A CA    
1256 C C     . MET A 188 ? 0.8413 0.2479 0.1880 0.0137  -0.1251 -0.0092 269 MET A C     
1257 O O     . MET A 188 ? 0.8121 0.2282 0.1578 0.0088  -0.1165 -0.0065 269 MET A O     
1258 C CB    . MET A 188 ? 0.8430 0.2700 0.2286 0.0333  -0.1268 -0.0226 269 MET A CB    
1259 C CG    . MET A 188 ? 0.8875 0.3200 0.2915 0.0440  -0.1346 -0.0299 269 MET A CG    
1260 S SD    . MET A 188 ? 0.9009 0.3612 0.3341 0.0541  -0.1248 -0.0365 269 MET A SD    
1261 C CE    . MET A 188 ? 0.8261 0.3067 0.2678 0.0452  -0.1068 -0.0316 269 MET A CE    
1262 N N     . PRO A 189 ? 0.8237 0.2247 0.1636 0.0107  -0.1256 -0.0065 270 PRO A N     
1263 C CA    . PRO A 189 ? 0.8216 0.2314 0.1564 0.0004  -0.1152 0.0003  270 PRO A CA    
1264 C C     . PRO A 189 ? 0.8198 0.2549 0.1752 0.0041  -0.1010 -0.0026 270 PRO A C     
1265 O O     . PRO A 189 ? 0.7955 0.2391 0.1670 0.0130  -0.0995 -0.0087 270 PRO A O     
1266 C CB    . PRO A 189 ? 0.8506 0.2473 0.1769 -0.0018 -0.1220 0.0023  270 PRO A CB    
1267 C CG    . PRO A 189 ? 0.8972 0.2872 0.2314 0.0118  -0.1304 -0.0065 270 PRO A CG    
1268 C CD    . PRO A 189 ? 0.8424 0.2283 0.1787 0.0170  -0.1368 -0.0101 270 PRO A CD    
1269 N N     . SER A 190 ? 0.7689 0.2163 0.1236 -0.0025 -0.0909 0.0017  271 SER A N     
1270 C CA    . SER A 190 ? 0.7533 0.2210 0.1247 0.0006  -0.0793 -0.0007 271 SER A CA    
1271 C C     . SER A 190 ? 0.7902 0.2634 0.1719 0.0045  -0.0769 -0.0028 271 SER A C     
1272 O O     . SER A 190 ? 0.7878 0.2529 0.1618 0.0013  -0.0809 -0.0003 271 SER A O     
1273 C CB    . SER A 190 ? 0.7750 0.2539 0.1426 -0.0060 -0.0703 0.0040  271 SER A CB    
1274 O OG    . SER A 190 ? 0.7443 0.2394 0.1261 -0.0028 -0.0613 0.0020  271 SER A OG    
1275 N N     . SER A 191 ? 0.7382 0.2236 0.1356 0.0107  -0.0713 -0.0072 272 SER A N     
1276 C CA    . SER A 191 ? 0.7159 0.2075 0.1213 0.0148  -0.0673 -0.0094 272 SER A CA    
1277 C C     . SER A 191 ? 0.7689 0.2667 0.1725 0.0095  -0.0611 -0.0054 272 SER A C     
1278 O O     . SER A 191 ? 0.7365 0.2355 0.1417 0.0117  -0.0592 -0.0063 272 SER A O     
1279 C CB    . SER A 191 ? 0.7313 0.2355 0.1532 0.0205  -0.0624 -0.0135 272 SER A CB    
1280 O OG    . SER A 191 ? 0.7426 0.2554 0.1696 0.0174  -0.0566 -0.0119 272 SER A OG    
1281 N N     . SER A 192 ? 0.7386 0.2409 0.1387 0.0033  -0.0582 -0.0012 273 SER A N     
1282 C CA    . SER A 192 ? 0.7178 0.2284 0.1187 -0.0013 -0.0535 0.0025  273 SER A CA    
1283 C C     . SER A 192 ? 0.7417 0.2422 0.1341 -0.0058 -0.0600 0.0057  273 SER A C     
1284 O O     . SER A 192 ? 0.7395 0.2271 0.1208 -0.0100 -0.0676 0.0081  273 SER A O     
1285 C CB    . SER A 192 ? 0.7392 0.2581 0.1375 -0.0063 -0.0497 0.0059  273 SER A CB    
1286 O OG    . SER A 192 ? 0.7257 0.2550 0.1276 -0.0105 -0.0463 0.0095  273 SER A OG    
1287 N N     . ALA A 193 ? 0.6930 0.1975 0.0888 -0.0061 -0.0582 0.0064  274 ALA A N     
1288 C CA    . ALA A 193 ? 0.7032 0.1960 0.0900 -0.0109 -0.0661 0.0095  274 ALA A CA    
1289 C C     . ALA A 193 ? 0.7668 0.2656 0.1521 -0.0224 -0.0672 0.0171  274 ALA A C     
1290 O O     . ALA A 193 ? 0.7849 0.2751 0.1640 -0.0291 -0.0747 0.0213  274 ALA A O     
1291 C CB    . ALA A 193 ? 0.7018 0.1943 0.0905 -0.0070 -0.0653 0.0074  274 ALA A CB    
1292 N N     . ARG A 194 ? 0.7356 0.2493 0.1260 -0.0248 -0.0599 0.0189  275 ARG A N     
1293 C CA    . ARG A 194 ? 0.7443 0.2684 0.1341 -0.0357 -0.0587 0.0263  275 ARG A CA    
1294 C C     . ARG A 194 ? 0.8144 0.3219 0.1888 -0.0452 -0.0677 0.0320  275 ARG A C     
1295 O O     . ARG A 194 ? 0.8182 0.3296 0.1908 -0.0572 -0.0702 0.0398  275 ARG A O     
1296 C CB    . ARG A 194 ? 0.7789 0.3218 0.1742 -0.0340 -0.0483 0.0256  275 ARG A CB    
1297 C CG    . ARG A 194 ? 0.8222 0.3843 0.2213 -0.0439 -0.0437 0.0326  275 ARG A CG    
1298 C CD    . ARG A 194 ? 0.8671 0.4489 0.2706 -0.0395 -0.0328 0.0304  275 ARG A CD    
1299 N NE    . ARG A 194 ? 0.8342 0.4229 0.2486 -0.0272 -0.0284 0.0228  275 ARG A NE    
1300 C CZ    . ARG A 194 ? 0.8685 0.4759 0.2969 -0.0240 -0.0241 0.0216  275 ARG A CZ    
1301 N NH1   . ARG A 194 ? 0.7967 0.4206 0.2339 -0.0321 -0.0235 0.0275  275 ARG A NH1   
1302 N NH2   . ARG A 194 ? 0.8172 0.4262 0.2516 -0.0130 -0.0218 0.0149  275 ARG A NH2   
1303 N N     A CSO A 195 ? 0.8144 0.3035 0.1777 -0.0408 -0.0733 0.0287  276 CSO A N     
1304 C CA    A CSO A 195 ? 0.8434 0.3129 0.1890 -0.0498 -0.0836 0.0344  276 CSO A CA    
1305 C CB    A CSO A 195 ? 0.8848 0.3407 0.2188 -0.0465 -0.0873 0.0322  276 CSO A CB    
1306 S SG    A CSO A 195 ? 0.9226 0.3636 0.2591 -0.0303 -0.0938 0.0212  276 CSO A SG    
1307 C C     A CSO A 195 ? 0.8833 0.3309 0.2200 -0.0524 -0.0972 0.0357  276 CSO A C     
1308 O O     A CSO A 195 ? 0.8845 0.3179 0.2190 -0.0417 -0.1030 0.0285  276 CSO A O     
1309 O OD    A CSO A 195 ? 0.9340 0.3946 0.2839 -0.0231 -0.0818 0.0164  276 CSO A OD    
1310 N N     B CYS A 195 ? 0.7995 0.2885 0.1637 -0.0402 -0.0735 0.0283  276 CYS A N     
1311 C CA    B CYS A 195 ? 0.8274 0.2956 0.1743 -0.0471 -0.0841 0.0326  276 CYS A CA    
1312 C C     B CYS A 195 ? 0.8864 0.3347 0.2244 -0.0517 -0.0970 0.0352  276 CYS A C     
1313 O O     B CYS A 195 ? 0.8982 0.3347 0.2358 -0.0416 -0.1020 0.0283  276 CYS A O     
1314 C CB    B CYS A 195 ? 0.8394 0.2948 0.1808 -0.0377 -0.0874 0.0262  276 CYS A CB    
1315 S SG    B CYS A 195 ? 0.9104 0.3381 0.2281 -0.0452 -0.1014 0.0312  276 CYS A SG    
1316 N N     . ALA A 196 ? 0.8667 0.3114 0.1970 -0.0670 -0.1027 0.0451  277 ALA A N     
1317 C CA    . ALA A 196 ? 0.8987 0.3205 0.2181 -0.0729 -0.1177 0.0484  277 ALA A CA    
1318 C C     . ALA A 196 ? 0.9931 0.3803 0.2912 -0.0710 -0.1336 0.0469  277 ALA A C     
1319 O O     . ALA A 196 ? 1.0048 0.3687 0.2928 -0.0692 -0.1472 0.0453  277 ALA A O     
1320 C CB    . ALA A 196 ? 0.9178 0.3495 0.2391 -0.0915 -0.1191 0.0604  277 ALA A CB    
1321 N N     . GLN A 197 ? 0.9496 0.3315 0.2396 -0.0700 -0.1332 0.0468  278 GLN A N     
1322 C CA    . GLN A 197 ? 0.9533 0.3020 0.2228 -0.0677 -0.1494 0.0454  278 GLN A CA    
1323 C C     . GLN A 197 ? 0.9948 0.3307 0.2662 -0.0482 -0.1553 0.0326  278 GLN A C     
1324 O O     . GLN A 197 ? 1.0120 0.3176 0.2669 -0.0443 -0.1720 0.0301  278 GLN A O     
1325 C CB    . GLN A 197 ? 0.9831 0.3314 0.2440 -0.0712 -0.1468 0.0484  278 GLN A CB    
1326 C CG    . GLN A 197 ? 1.1034 0.4549 0.3531 -0.0920 -0.1455 0.0623  278 GLN A CG    
1327 C CD    . GLN A 197 ? 1.1075 0.4974 0.3742 -0.0971 -0.1255 0.0658  278 GLN A CD    
1328 O OE1   . GLN A 197 ? 0.9866 0.3995 0.2732 -0.0853 -0.1131 0.0580  278 GLN A OE1   
1329 N NE2   . GLN A 197 ? 1.0584 0.4558 0.3167 -0.1149 -0.1223 0.0779  278 GLN A NE2   
1330 N N     . PHE A 198 ? 0.9201 0.2793 0.2111 -0.0359 -0.1417 0.0245  279 PHE A N     
1331 C CA    . PHE A 198 ? 0.9202 0.2766 0.2175 -0.0177 -0.1426 0.0127  279 PHE A CA    
1332 C C     . PHE A 198 ? 0.9412 0.3161 0.2514 -0.0158 -0.1320 0.0112  279 PHE A C     
1333 O O     . PHE A 198 ? 0.9079 0.3069 0.2348 -0.0115 -0.1179 0.0085  279 PHE A O     
1334 C CB    . PHE A 198 ? 0.9195 0.2884 0.2282 -0.0080 -0.1357 0.0066  279 PHE A CB    
1335 C CG    . PHE A 198 ? 0.9570 0.3082 0.2523 -0.0109 -0.1461 0.0088  279 PHE A CG    
1336 C CD1   . PHE A 198 ? 0.9880 0.3448 0.2780 -0.0232 -0.1416 0.0170  279 PHE A CD1   
1337 C CD2   . PHE A 198 ? 0.9919 0.3196 0.2779 -0.0007 -0.1613 0.0025  279 PHE A CD2   
1338 C CE1   . PHE A 198 ? 0.9905 0.3277 0.2639 -0.0265 -0.1521 0.0196  279 PHE A CE1   
1339 C CE2   . PHE A 198 ? 1.0310 0.3396 0.3030 -0.0032 -0.1729 0.0047  279 PHE A CE2   
1340 C CZ    . PHE A 198 ? 0.9956 0.3073 0.2595 -0.0172 -0.1686 0.0139  279 PHE A CZ    
1341 N N     . PRO A 199 ? 0.9060 0.2677 0.2071 -0.0207 -0.1401 0.0140  280 PRO A N     
1342 C CA    . PRO A 199 ? 0.9007 0.2788 0.2123 -0.0216 -0.1315 0.0144  280 PRO A CA    
1343 C C     . PRO A 199 ? 0.8984 0.2871 0.2193 -0.0063 -0.1224 0.0047  280 PRO A C     
1344 O O     . PRO A 199 ? 0.8689 0.2748 0.2003 -0.0072 -0.1128 0.0056  280 PRO A O     
1345 C CB    . PRO A 199 ? 0.9476 0.3030 0.2440 -0.0298 -0.1465 0.0191  280 PRO A CB    
1346 C CG    . PRO A 199 ? 1.0041 0.3284 0.2810 -0.0285 -0.1630 0.0180  280 PRO A CG    
1347 C CD    . PRO A 199 ? 0.9429 0.2728 0.2226 -0.0279 -0.1591 0.0183  280 PRO A CD    
1348 N N     . ARG A 200 ? 0.8716 0.2502 0.1884 0.0075  -0.1259 -0.0041 281 ARG A N     
1349 C CA    . ARG A 200 ? 0.8749 0.2646 0.1992 0.0213  -0.1167 -0.0127 281 ARG A CA    
1350 C C     . ARG A 200 ? 0.8465 0.2496 0.1837 0.0307  -0.1099 -0.0185 281 ARG A C     
1351 O O     . ARG A 200 ? 0.8642 0.2588 0.1989 0.0305  -0.1174 -0.0184 281 ARG A O     
1352 C CB    . ARG A 200 ? 0.9128 0.2787 0.2197 0.0320  -0.1278 -0.0198 281 ARG A CB    
1353 C CG    . ARG A 200 ? 0.9804 0.3231 0.2694 0.0235  -0.1411 -0.0149 281 ARG A CG    
1354 C CD    . ARG A 200 ? 1.0108 0.3242 0.2787 0.0362  -0.1551 -0.0235 281 ARG A CD    
1355 N NE    . ARG A 200 ? 1.0327 0.3273 0.2922 0.0406  -0.1678 -0.0263 281 ARG A NE    
1356 C CZ    . ARG A 200 ? 1.2405 0.5088 0.4825 0.0544  -0.1816 -0.0352 281 ARG A CZ    
1357 N NH1   . ARG A 200 ? 1.1473 0.4046 0.3765 0.0654  -0.1838 -0.0426 281 ARG A NH1   
1358 N NH2   . ARG A 200 ? 1.1039 0.3551 0.3394 0.0582  -0.1941 -0.0374 281 ARG A NH2   
1359 N N     . ALA A 201 ? 0.8197 0.2408 0.1687 0.0397  -0.0981 -0.0239 282 ALA A N     
1360 C CA    . ALA A 201 ? 0.8236 0.2597 0.1875 0.0489  -0.0921 -0.0297 282 ALA A CA    
1361 C C     . ALA A 201 ? 0.8544 0.2746 0.2111 0.0604  -0.1041 -0.0371 282 ALA A C     
1362 O O     . ALA A 201 ? 0.8284 0.2515 0.1933 0.0629  -0.1074 -0.0388 282 ALA A O     
1363 C CB    . ALA A 201 ? 0.8088 0.2648 0.1833 0.0554  -0.0783 -0.0334 282 ALA A CB    
1364 N N     . GLN A 202 ? 0.8451 0.2451 0.1842 0.0676  -0.1129 -0.0416 283 GLN A N     
1365 C CA    . GLN A 202 ? 0.8668 0.2471 0.1955 0.0803  -0.1268 -0.0497 283 GLN A CA    
1366 C C     . GLN A 202 ? 0.9271 0.2887 0.2490 0.0735  -0.1413 -0.0454 283 GLN A C     
1367 O O     . GLN A 202 ? 0.9667 0.3201 0.2887 0.0843  -0.1508 -0.0520 283 GLN A O     
1368 C CB    . GLN A 202 ? 0.8991 0.2541 0.2041 0.0861  -0.1364 -0.0535 283 GLN A CB    
1369 C CG    . GLN A 202 ? 1.1097 0.4330 0.3959 0.0973  -0.1563 -0.0607 283 GLN A CG    
1370 C CD    . GLN A 202 ? 1.3503 0.6840 0.6474 0.1175  -0.1555 -0.0729 283 GLN A CD    
1371 O OE1   . GLN A 202 ? 1.2667 0.6313 0.5827 0.1261  -0.1389 -0.0780 283 GLN A OE1   
1372 N NE2   . GLN A 202 ? 1.1843 0.4925 0.4701 0.1250  -0.1742 -0.0775 283 GLN A NE2   
1373 N N     . ASP A 203 ? 0.8867 0.2410 0.2014 0.0560  -0.1438 -0.0345 284 ASP A N     
1374 C CA    . ASP A 203 ? 0.8907 0.2265 0.1950 0.0470  -0.1565 -0.0287 284 ASP A CA    
1375 C C     . ASP A 203 ? 0.9204 0.2720 0.2396 0.0467  -0.1514 -0.0283 284 ASP A C     
1376 O O     . ASP A 203 ? 0.9522 0.2861 0.2611 0.0432  -0.1635 -0.0258 284 ASP A O     
1377 C CB    . ASP A 203 ? 0.9283 0.2556 0.2212 0.0276  -0.1590 -0.0165 284 ASP A CB    
1378 C CG    . ASP A 203 ? 1.0051 0.3126 0.2821 0.0267  -0.1680 -0.0164 284 ASP A CG    
1379 O OD1   . ASP A 203 ? 1.0178 0.2968 0.2777 0.0352  -0.1843 -0.0218 284 ASP A OD1   
1380 O OD2   . ASP A 203 ? 0.9937 0.3125 0.2747 0.0181  -0.1603 -0.0112 284 ASP A OD2   
1381 N N     . LYS A 204 ? 0.8412 0.2227 0.1823 0.0506  -0.1354 -0.0309 285 LYS A N     
1382 C CA    . LYS A 204 ? 0.8257 0.2227 0.1818 0.0497  -0.1306 -0.0305 285 LYS A CA    
1383 C C     . LYS A 204 ? 0.8710 0.2822 0.2454 0.0652  -0.1293 -0.0404 285 LYS A C     
1384 O O     . LYS A 204 ? 0.8511 0.2685 0.2358 0.0662  -0.1314 -0.0412 285 LYS A O     
1385 C CB    . LYS A 204 ? 0.8186 0.2389 0.1867 0.0402  -0.1146 -0.0248 285 LYS A CB    
1386 C CG    . LYS A 204 ? 0.8893 0.3032 0.2448 0.0252  -0.1140 -0.0152 285 LYS A CG    
1387 C CD    . LYS A 204 ? 0.8510 0.2877 0.2185 0.0191  -0.0990 -0.0114 285 LYS A CD    
1388 C CE    . LYS A 204 ? 0.8211 0.2561 0.1794 0.0060  -0.0979 -0.0028 285 LYS A CE    
1389 N NZ    . LYS A 204 ? 0.8050 0.2614 0.1754 0.0030  -0.0847 -0.0008 285 LYS A NZ    
1390 N N     . VAL A 205 ? 0.8440 0.2611 0.2222 0.0771  -0.1259 -0.0478 286 VAL A N     
1391 C CA    A VAL A 205 ? 0.8220 0.2600 0.2210 0.0917  -0.1213 -0.0569 286 VAL A CA    
1392 C CA    B VAL A 205 ? 0.8258 0.2627 0.2238 0.0924  -0.1217 -0.0573 286 VAL A CA    
1393 C C     . VAL A 205 ? 0.8546 0.2812 0.2554 0.1017  -0.1370 -0.0629 286 VAL A C     
1394 O O     . VAL A 205 ? 0.8347 0.2829 0.2586 0.1081  -0.1338 -0.0672 286 VAL A O     
1395 C CB    A VAL A 205 ? 0.8583 0.3057 0.2579 0.1030  -0.1130 -0.0637 286 VAL A CB    
1396 C CB    B VAL A 205 ? 0.8750 0.3143 0.2681 0.1038  -0.1166 -0.0642 286 VAL A CB    
1397 C CG1   A VAL A 205 ? 0.8755 0.2946 0.2533 0.1142  -0.1276 -0.0704 286 VAL A CG1   
1398 C CG1   B VAL A 205 ? 0.8665 0.3209 0.2749 0.1229  -0.1163 -0.0758 286 VAL A CG1   
1399 C CG2   A VAL A 205 ? 0.8323 0.3129 0.2589 0.1133  -0.1014 -0.0701 286 VAL A CG2   
1400 C CG2   B VAL A 205 ? 0.8627 0.3209 0.2610 0.0963  -0.0992 -0.0595 286 VAL A CG2   
1401 N N     . HIS A 206 ? 0.8382 0.2311 0.2156 0.1011  -0.1547 -0.0622 287 HIS A N     
1402 C CA    . HIS A 206 ? 0.8677 0.2449 0.2436 0.1099  -0.1724 -0.0673 287 HIS A CA    
1403 C C     . HIS A 206 ? 0.8849 0.2766 0.2774 0.1039  -0.1706 -0.0639 287 HIS A C     
1404 O O     . HIS A 206 ? 0.8749 0.2754 0.2842 0.1152  -0.1770 -0.0709 287 HIS A O     
1405 C CB    . HIS A 206 ? 0.9268 0.2614 0.2703 0.1039  -0.1920 -0.0629 287 HIS A CB    
1406 C CG    . HIS A 206 ? 1.0048 0.3191 0.3422 0.1071  -0.2107 -0.0643 287 HIS A CG    
1407 N ND1   . HIS A 206 ? 1.0530 0.3539 0.3779 0.0912  -0.2155 -0.0541 287 HIS A ND1   
1408 C CD2   . HIS A 206 ? 1.0477 0.3539 0.3897 0.1251  -0.2254 -0.0750 287 HIS A CD2   
1409 C CE1   . HIS A 206 ? 1.0572 0.3399 0.3777 0.0989  -0.2336 -0.0583 287 HIS A CE1   
1410 N NE2   . HIS A 206 ? 1.0587 0.3437 0.3902 0.1196  -0.2409 -0.0709 287 HIS A NE2   
1411 N N     . TYR A 207 ? 0.8386 0.2328 0.2265 0.0869  -0.1626 -0.0537 288 TYR A N     
1412 C CA    . TYR A 207 ? 0.8220 0.2258 0.2210 0.0812  -0.1619 -0.0507 288 TYR A CA    
1413 C C     . TYR A 207 ? 0.8347 0.2740 0.2665 0.0872  -0.1498 -0.0552 288 TYR A C     
1414 O O     . TYR A 207 ? 0.8158 0.2619 0.2618 0.0897  -0.1556 -0.0573 288 TYR A O     
1415 C CB    . TYR A 207 ? 0.8500 0.2468 0.2333 0.0635  -0.1565 -0.0397 288 TYR A CB    
1416 C CG    . TYR A 207 ? 0.9056 0.2682 0.2584 0.0560  -0.1710 -0.0342 288 TYR A CG    
1417 C CD1   . TYR A 207 ? 0.9501 0.2904 0.2916 0.0584  -0.1884 -0.0351 288 TYR A CD1   
1418 C CD2   . TYR A 207 ? 0.9357 0.2874 0.2709 0.0462  -0.1687 -0.0276 288 TYR A CD2   
1419 C CE1   . TYR A 207 ? 0.9696 0.2758 0.2808 0.0507  -0.2030 -0.0292 288 TYR A CE1   
1420 C CE2   . TYR A 207 ? 0.9683 0.2888 0.2757 0.0373  -0.1826 -0.0212 288 TYR A CE2   
1421 C CZ    . TYR A 207 ? 1.0318 0.3290 0.3261 0.0390  -0.1994 -0.0216 288 TYR A CZ    
1422 O OH    . TYR A 207 ? 1.0666 0.3306 0.3310 0.0288  -0.2140 -0.0141 288 TYR A OH    
1423 N N     . TYR A 208 ? 0.7785 0.2394 0.2215 0.0887  -0.1342 -0.0563 289 TYR A N     
1424 C CA    . TYR A 208 ? 0.7407 0.2357 0.2134 0.0924  -0.1217 -0.0592 289 TYR A CA    
1425 C C     . TYR A 208 ? 0.8041 0.3119 0.2958 0.1094  -0.1276 -0.0695 289 TYR A C     
1426 O O     . TYR A 208 ? 0.7747 0.3065 0.2931 0.1116  -0.1254 -0.0716 289 TYR A O     
1427 C CB    . TYR A 208 ? 0.7218 0.2316 0.1954 0.0887  -0.1046 -0.0567 289 TYR A CB    
1428 C CG    . TYR A 208 ? 0.7312 0.2384 0.1959 0.0735  -0.0968 -0.0475 289 TYR A CG    
1429 C CD1   . TYR A 208 ? 0.7552 0.2391 0.1955 0.0655  -0.1016 -0.0422 289 TYR A CD1   
1430 C CD2   . TYR A 208 ? 0.7386 0.2675 0.2196 0.0672  -0.0849 -0.0441 289 TYR A CD2   
1431 C CE1   . TYR A 208 ? 0.7453 0.2307 0.1798 0.0534  -0.0937 -0.0348 289 TYR A CE1   
1432 C CE2   . TYR A 208 ? 0.7542 0.2802 0.2266 0.0556  -0.0785 -0.0371 289 TYR A CE2   
1433 C CZ    . TYR A 208 ? 0.8072 0.3130 0.2575 0.0497  -0.0825 -0.0330 289 TYR A CZ    
1434 O OH    . TYR A 208 ? 0.7651 0.2714 0.2096 0.0400  -0.0763 -0.0270 289 TYR A OH    
1435 N N     . ILE A 209 ? 0.8080 0.3004 0.2866 0.1217  -0.1354 -0.0763 290 ILE A N     
1436 C CA    . ILE A 209 ? 0.7948 0.2981 0.2899 0.1406  -0.1422 -0.0877 290 ILE A CA    
1437 C C     . ILE A 209 ? 0.8580 0.3520 0.3603 0.1434  -0.1601 -0.0895 290 ILE A C     
1438 O O     . ILE A 209 ? 0.8520 0.3714 0.3836 0.1529  -0.1610 -0.0956 290 ILE A O     
1439 C CB    . ILE A 209 ? 0.8334 0.3159 0.3075 0.1543  -0.1492 -0.0953 290 ILE A CB    
1440 C CG1   . ILE A 209 ? 0.8236 0.3177 0.2922 0.1532  -0.1316 -0.0946 290 ILE A CG1   
1441 C CG2   . ILE A 209 ? 0.8437 0.3340 0.3330 0.1769  -0.1596 -0.1088 290 ILE A CG2   
1442 C CD1   . ILE A 209 ? 0.8957 0.3600 0.3350 0.1618  -0.1402 -0.0994 290 ILE A CD1   
1443 N N     . LYS A 210 ? 0.8345 0.2930 0.3101 0.1342  -0.1742 -0.0836 291 LYS A N     
1444 C CA    . LYS A 210 ? 0.8351 0.2786 0.3109 0.1352  -0.1926 -0.0842 291 LYS A CA    
1445 C C     . LYS A 210 ? 0.8437 0.3110 0.3429 0.1262  -0.1860 -0.0799 291 LYS A C     
1446 O O     . LYS A 210 ? 0.8568 0.3299 0.3735 0.1324  -0.1977 -0.0840 291 LYS A O     
1447 C CB    . LYS A 210 ? 0.8850 0.2844 0.3225 0.1253  -0.2074 -0.0773 291 LYS A CB    
1448 C CG    . LYS A 210 ? 0.9983 0.3673 0.4136 0.1360  -0.2229 -0.0827 291 LYS A CG    
1449 C CD    . LYS A 210 ? 1.1883 0.5337 0.5985 0.1464  -0.2478 -0.0882 291 LYS A CD    
1450 N N     . LEU A 211 ? 0.7908 0.2716 0.2911 0.1125  -0.1687 -0.0722 292 LEU A N     
1451 C CA    . LEU A 211 ? 0.7660 0.2675 0.2865 0.1037  -0.1623 -0.0682 292 LEU A CA    
1452 C C     . LEU A 211 ? 0.8054 0.3448 0.3652 0.1137  -0.1572 -0.0748 292 LEU A C     
1453 O O     . LEU A 211 ? 0.7961 0.3459 0.3765 0.1141  -0.1654 -0.0759 292 LEU A O     
1454 C CB    . LEU A 211 ? 0.7566 0.2638 0.2691 0.0896  -0.1452 -0.0599 292 LEU A CB    
1455 C CG    . LEU A 211 ? 0.7789 0.3053 0.3099 0.0803  -0.1381 -0.0556 292 LEU A CG    
1456 C CD1   . LEU A 211 ? 0.7740 0.2851 0.3016 0.0772  -0.1536 -0.0546 292 LEU A CD1   
1457 C CD2   . LEU A 211 ? 0.7976 0.3245 0.3165 0.0686  -0.1235 -0.0484 292 LEU A CD2   
1458 N N     . LYS A 212 ? 0.7811 0.3404 0.3502 0.1219  -0.1445 -0.0792 293 LYS A N     
1459 C CA    . LYS A 212 ? 0.7566 0.3561 0.3619 0.1318  -0.1362 -0.0854 293 LYS A CA    
1460 C C     . LYS A 212 ? 0.8248 0.4275 0.4479 0.1470  -0.1536 -0.0946 293 LYS A C     
1461 O O     . LYS A 212 ? 0.7898 0.4210 0.4463 0.1476  -0.1546 -0.0958 293 LYS A O     
1462 C CB    . LYS A 212 ? 0.7604 0.3732 0.3627 0.1398  -0.1208 -0.0893 293 LYS A CB    
1463 C CG    . LYS A 212 ? 0.8743 0.5341 0.5132 0.1462  -0.1066 -0.0933 293 LYS A CG    
1464 C CD    . LYS A 212 ? 0.9779 0.6499 0.6110 0.1572  -0.0923 -0.0990 293 LYS A CD    
1465 C CE    . LYS A 212 ? 1.1615 0.8833 0.8298 0.1602  -0.0750 -0.1007 293 LYS A CE    
1466 N NZ    . LYS A 212 ? 1.2325 0.9820 0.9376 0.1709  -0.0834 -0.1076 293 LYS A NZ    
1467 N N     . ASP A 213 ? 0.8384 0.4098 0.4385 0.1585  -0.1693 -0.1006 294 ASP A N     
1468 C CA    . ASP A 213 ? 0.8390 0.4052 0.4501 0.1747  -0.1898 -0.1100 294 ASP A CA    
1469 C C     . ASP A 213 ? 0.8688 0.4283 0.4884 0.1663  -0.2045 -0.1058 294 ASP A C     
1470 O O     . ASP A 213 ? 0.8553 0.4353 0.5058 0.1760  -0.2140 -0.1120 294 ASP A O     
1471 C CB    . ASP A 213 ? 0.8954 0.4187 0.4712 0.1844  -0.2063 -0.1146 294 ASP A CB    
1472 C CG    . ASP A 213 ? 1.0506 0.5744 0.6152 0.1960  -0.1973 -0.1210 294 ASP A CG    
1473 O OD1   . ASP A 213 ? 1.0342 0.5970 0.6231 0.2021  -0.1788 -0.1249 294 ASP A OD1   
1474 O OD2   . ASP A 213 ? 1.1434 0.6275 0.6734 0.1986  -0.2093 -0.1217 294 ASP A OD2   
1475 N N     . LEU A 214 ? 0.8306 0.3619 0.4226 0.1490  -0.2066 -0.0957 295 LEU A N     
1476 C CA    . LEU A 214 ? 0.8271 0.3475 0.4202 0.1401  -0.2197 -0.0913 295 LEU A CA    
1477 C C     . LEU A 214 ? 0.8653 0.4265 0.4987 0.1351  -0.2107 -0.0899 295 LEU A C     
1478 O O     . LEU A 214 ? 0.8780 0.4455 0.5321 0.1381  -0.2253 -0.0925 295 LEU A O     
1479 C CB    . LEU A 214 ? 0.8438 0.3301 0.3982 0.1233  -0.2194 -0.0811 295 LEU A CB    
1480 C CG    . LEU A 214 ? 0.8961 0.3664 0.4442 0.1144  -0.2327 -0.0767 295 LEU A CG    
1481 C CD1   . LEU A 214 ? 0.9131 0.3573 0.4533 0.1245  -0.2595 -0.0821 295 LEU A CD1   
1482 C CD2   . LEU A 214 ? 0.9192 0.3655 0.4325 0.0987  -0.2264 -0.0672 295 LEU A CD2   
1483 N N     . ARG A 215 ? 0.8028 0.3902 0.4469 0.1269  -0.1881 -0.0854 296 ARG A N     
1484 C CA    . ARG A 215 ? 0.7772 0.4024 0.4578 0.1197  -0.1789 -0.0824 296 ARG A CA    
1485 C C     . ARG A 215 ? 0.8336 0.4969 0.5571 0.1338  -0.1819 -0.0909 296 ARG A C     
1486 O O     . ARG A 215 ? 0.8072 0.4886 0.5601 0.1308  -0.1905 -0.0904 296 ARG A O     
1487 C CB    . ARG A 215 ? 0.7693 0.4117 0.4488 0.1094  -0.1550 -0.0761 296 ARG A CB    
1488 C CG    . ARG A 215 ? 0.7938 0.4696 0.5065 0.0984  -0.1473 -0.0709 296 ARG A CG    
1489 C CD    . ARG A 215 ? 0.8664 0.5724 0.5910 0.0943  -0.1243 -0.0678 296 ARG A CD    
1490 N NE    . ARG A 215 ? 0.8969 0.6219 0.6288 0.1100  -0.1153 -0.0758 296 ARG A NE    
1491 C CZ    . ARG A 215 ? 1.0318 0.7693 0.7574 0.1093  -0.0959 -0.0744 296 ARG A CZ    
1492 N NH1   . ARG A 215 ? 0.8512 0.5843 0.5645 0.0937  -0.0844 -0.0650 296 ARG A NH1   
1493 N NH2   . ARG A 215 ? 0.8721 0.6243 0.6014 0.1252  -0.0890 -0.0828 296 ARG A NH2   
1494 N N     . ASP A 216 ? 0.8144 0.4896 0.5410 0.1497  -0.1754 -0.0991 297 ASP A N     
1495 C CA    . ASP A 216 ? 0.8031 0.5175 0.5692 0.1665  -0.1756 -0.1090 297 ASP A CA    
1496 C C     . ASP A 216 ? 0.8855 0.5902 0.6639 0.1777  -0.2017 -0.1159 297 ASP A C     
1497 O O     . ASP A 216 ? 0.8741 0.6169 0.6959 0.1839  -0.2048 -0.1202 297 ASP A O     
1498 C CB    . ASP A 216 ? 0.8298 0.5510 0.5873 0.1828  -0.1639 -0.1173 297 ASP A CB    
1499 C CG    . ASP A 216 ? 1.0071 0.7407 0.7542 0.1732  -0.1383 -0.1112 297 ASP A CG    
1500 O OD1   . ASP A 216 ? 1.0132 0.7571 0.7662 0.1542  -0.1278 -0.1006 297 ASP A OD1   
1501 O OD2   . ASP A 216 ? 1.0846 0.8148 0.8159 0.1850  -0.1302 -0.1172 297 ASP A OD2   
1502 N N     . GLN A 217 ? 0.8766 0.5307 0.6174 0.1787  -0.2211 -0.1160 298 GLN A N     
1503 C CA    . GLN A 217 ? 0.8883 0.5229 0.6318 0.1881  -0.2490 -0.1215 298 GLN A CA    
1504 C C     . GLN A 217 ? 0.9512 0.5934 0.7143 0.1744  -0.2578 -0.1151 298 GLN A C     
1505 O O     . GLN A 217 ? 0.9260 0.5834 0.7199 0.1831  -0.2743 -0.1208 298 GLN A O     
1506 C CB    . GLN A 217 ? 0.9422 0.5173 0.6339 0.1885  -0.2655 -0.1205 298 GLN A CB    
1507 C CG    . GLN A 217 ? 1.1897 0.7378 0.8771 0.2000  -0.2961 -0.1268 298 GLN A CG    
1508 C CD    . GLN A 217 ? 1.4750 0.9639 1.1087 0.1918  -0.3106 -0.1208 298 GLN A CD    
1509 N N     . LEU A 218 ? 0.9322 0.5623 0.6768 0.1539  -0.2482 -0.1039 299 LEU A N     
1510 C CA    . LEU A 218 ? 0.9350 0.5662 0.6913 0.1398  -0.2566 -0.0974 299 LEU A CA    
1511 C C     . LEU A 218 ? 0.9808 0.6660 0.7916 0.1376  -0.2491 -0.0974 299 LEU A C     
1512 O O     . LEU A 218 ? 0.9707 0.6644 0.8070 0.1367  -0.2662 -0.0982 299 LEU A O     
1513 C CB    . LEU A 218 ? 0.9568 0.5618 0.6781 0.1209  -0.2473 -0.0867 299 LEU A CB    
1514 C CG    . LEU A 218 ? 1.0525 0.6047 0.7208 0.1186  -0.2566 -0.0844 299 LEU A CG    
1515 C CD1   . LEU A 218 ? 1.0647 0.6010 0.7064 0.1014  -0.2454 -0.0748 299 LEU A CD1   
1516 C CD2   . LEU A 218 ? 1.0927 0.6145 0.7500 0.1238  -0.2851 -0.0875 299 LEU A CD2   
1517 N N     . LYS A 219 ? 0.9431 0.6648 0.7714 0.1364  -0.2242 -0.0962 300 LYS A N     
1518 C CA    . LYS A 219 ? 0.9206 0.6979 0.8002 0.1331  -0.2131 -0.0951 300 LYS A CA    
1519 C C     . LYS A 219 ? 1.0047 0.8144 0.9249 0.1528  -0.2238 -0.1064 300 LYS A C     
1520 O O     . LYS A 219 ? 0.9770 0.8286 0.9441 0.1495  -0.2251 -0.1055 300 LYS A O     
1521 C CB    . LYS A 219 ? 0.9324 0.7359 0.8132 0.1278  -0.1836 -0.0911 300 LYS A CB    
1522 C CG    . LYS A 219 ? 0.9856 0.7702 0.8410 0.1066  -0.1730 -0.0791 300 LYS A CG    
1523 C CD    . LYS A 219 ? 1.0471 0.8563 0.9034 0.1019  -0.1458 -0.0752 300 LYS A CD    
1524 N N     . GLY A 220 ? 1.0038 0.7924 0.9052 0.1727  -0.2328 -0.1167 301 GLY A N     
1525 C CA    . GLY A 220 ? 0.9978 0.8088 0.9306 0.1956  -0.2459 -0.1296 301 GLY A CA    
1526 C C     . GLY A 220 ? 1.0780 0.8813 1.0296 0.1962  -0.2746 -0.1311 301 GLY A C     
1527 O O     . GLY A 220 ? 1.0460 0.8906 1.0461 0.2073  -0.2815 -0.1379 301 GLY A O     
1528 N N     . ILE A 221 ? 1.0888 0.8401 1.0020 0.1843  -0.2914 -0.1246 302 ILE A N     
1529 C CA    . ILE A 221 ? 1.0938 0.8279 1.0151 0.1824  -0.3203 -0.1247 302 ILE A CA    
1530 C C     . ILE A 221 ? 1.1193 0.8924 1.0840 0.1663  -0.3177 -0.1174 302 ILE A C     
1531 O O     . ILE A 221 ? 1.0968 0.8828 1.0941 0.1696  -0.3388 -0.1204 302 ILE A O     
1532 C CB    . ILE A 221 ? 1.1779 0.8449 1.0399 0.1734  -0.3353 -0.1192 302 ILE A CB    
1533 N N     . GLU A 222 ? 1.0717 0.8624 1.0369 0.1488  -0.2932 -0.1078 303 GLU A N     
1534 C CA    . GLU A 222 ? 1.3633 1.1894 1.3662 0.1307  -0.2883 -0.0991 303 GLU A CA    
1535 C C     . GLU A 222 ? 1.6195 1.5139 1.6854 0.1390  -0.2793 -0.1038 303 GLU A C     
1536 O O     . GLU A 222 ? 1.0954 1.0241 1.2043 0.1278  -0.2840 -0.0988 303 GLU A O     
1537 C CB    . GLU A 222 ? 1.3896 1.2098 1.3691 0.1112  -0.2651 -0.0879 303 GLU A CB    
1538 C CG    . GLU A 222 ? 1.5456 1.3141 1.4829 0.0960  -0.2768 -0.0803 303 GLU A CG    
1539 O "O5'" . DC  B 1   ? 1.9963 1.2116 0.5019 -0.6424 -0.0766 0.4623  1   DC  C "O5'" 
1540 C "C5'" . DC  B 1   ? 2.0427 1.1825 0.4827 -0.6644 -0.1053 0.4791  1   DC  C "C5'" 
1541 C "C4'" . DC  B 1   ? 2.0688 1.1493 0.4728 -0.6332 -0.1243 0.4596  1   DC  C "C4'" 
1542 O "O4'" . DC  B 1   ? 2.0441 1.1551 0.4286 -0.6186 -0.0936 0.4516  1   DC  C "O4'" 
1543 C "C3'" . DC  B 1   ? 2.0599 1.1250 0.5042 -0.5933 -0.1424 0.4306  1   DC  C "C3'" 
1544 O "O3'" . DC  B 1   ? 2.1165 1.0992 0.5205 -0.5834 -0.1810 0.4251  1   DC  C "O3'" 
1545 C "C2'" . DC  B 1   ? 2.0213 1.1390 0.4899 -0.5607 -0.1100 0.4085  1   DC  C "C2'" 
1546 C "C1'" . DC  B 1   ? 2.0372 1.1513 0.4478 -0.5746 -0.0932 0.4209  1   DC  C "C1'" 
1547 N N1    . DC  B 1   ? 2.0022 1.1862 0.4303 -0.5586 -0.0506 0.4104  1   DC  C N1    
1548 C C2    . DC  B 1   ? 2.0076 1.1809 0.4189 -0.5257 -0.0455 0.3889  1   DC  C C2    
1549 O O2    . DC  B 1   ? 2.0288 1.1386 0.4146 -0.5107 -0.0755 0.3791  1   DC  C O2    
1550 N N3    . DC  B 1   ? 1.9898 1.2233 0.4142 -0.5109 -0.0085 0.3792  1   DC  C N3    
1551 C C4    . DC  B 1   ? 1.9660 1.2704 0.4201 -0.5267 0.0233  0.3897  1   DC  C C4    
1552 N N4    . DC  B 1   ? 1.9538 1.3149 0.4189 -0.5090 0.0582  0.3783  1   DC  C N4    
1553 C C5    . DC  B 1   ? 1.9482 1.2686 0.4241 -0.5602 0.0193  0.4115  1   DC  C C5    
1554 C C6    . DC  B 1   ? 1.9675 1.2251 0.4283 -0.5755 -0.0182 0.4213  1   DC  C C6    
1555 P P     . DA  B 2   ? 2.1325 1.0783 0.5679 -0.5539 -0.2132 0.4033  2   DA  C P     
1556 O OP1   . DA  B 2   ? 2.1906 1.0503 0.5749 -0.5619 -0.2551 0.4105  2   DA  C OP1   
1557 O OP2   . DA  B 2   ? 2.0957 1.0850 0.5897 -0.5561 -0.2064 0.4019  2   DA  C OP2   
1558 O "O5'" . DA  B 2   ? 2.1041 1.0692 0.5591 -0.5111 -0.1996 0.3743  2   DA  C "O5'" 
1559 C "C5'" . DA  B 2   ? 2.1179 1.0386 0.5271 -0.4972 -0.2109 0.3671  2   DA  C "C5'" 
1560 C "C4'" . DA  B 2   ? 2.0825 1.0316 0.5222 -0.4578 -0.1962 0.3395  2   DA  C "C4'" 
1561 O "O4'" . DA  B 2   ? 2.0404 1.0561 0.4928 -0.4582 -0.1548 0.3396  2   DA  C "O4'" 
1562 C "C3'" . DA  B 2   ? 2.0545 1.0202 0.5551 -0.4307 -0.2030 0.3185  2   DA  C "C3'" 
1563 O "O3'" . DA  B 2   ? 2.0695 1.0083 0.5706 -0.3979 -0.2173 0.2965  2   DA  C "O3'" 
1564 C "C2'" . DA  B 2   ? 1.9984 1.0443 0.5465 -0.4268 -0.1641 0.3143  2   DA  C "C2'" 
1565 C "C1'" . DA  B 2   ? 1.9926 1.0577 0.5052 -0.4314 -0.1386 0.3192  2   DA  C "C1'" 
1566 N N9    . DA  B 2   ? 1.9303 1.0678 0.4670 -0.4415 -0.1001 0.3256  2   DA  C N9    
1567 C C8    . DA  B 2   ? 1.8934 1.0686 0.4553 -0.4666 -0.0888 0.3418  2   DA  C C8    
1568 N N7    . DA  B 2   ? 1.8549 1.0964 0.4352 -0.4700 -0.0526 0.3442  2   DA  C N7    
1569 C C5    . DA  B 2   ? 1.8532 1.0982 0.4163 -0.4449 -0.0394 0.3281  2   DA  C C5    
1570 C C6    . DA  B 2   ? 1.8089 1.1084 0.3771 -0.4329 -0.0041 0.3206  2   DA  C C6    
1571 N N6    . DA  B 2   ? 1.7702 1.1375 0.3663 -0.4447 0.0267  0.3286  2   DA  C N6    
1572 N N1    . DA  B 2   ? 1.8085 1.0902 0.3538 -0.4064 -0.0028 0.3033  2   DA  C N1    
1573 C C2    . DA  B 2   ? 1.8413 1.0582 0.3623 -0.3942 -0.0343 0.2951  2   DA  C C2    
1574 N N3    . DA  B 2   ? 1.8779 1.0420 0.3922 -0.4033 -0.0680 0.3010  2   DA  C N3    
1575 C C4    . DA  B 2   ? 1.8922 1.0728 0.4280 -0.4282 -0.0689 0.3172  2   DA  C C4    
1576 P P     . DG  B 3   ? 2.0511 0.9795 0.5979 -0.3694 -0.2378 0.2754  3   DG  C P     
1577 O OP1   . DG  B 3   ? 2.0970 0.9551 0.6105 -0.3620 -0.2757 0.2719  3   DG  C OP1   
1578 O OP2   . DG  B 3   ? 2.0244 0.9829 0.6126 -0.3787 -0.2328 0.2797  3   DG  C OP2   
1579 O "O5'" . DG  B 3   ? 2.0061 0.9765 0.5858 -0.3382 -0.2155 0.2530  3   DG  C "O5'" 
1580 C "C5'" . DG  B 3   ? 2.0040 0.9658 0.5510 -0.3292 -0.2088 0.2482  3   DG  C "C5'" 
1581 C "C4'" . DG  B 3   ? 1.9552 0.9758 0.5350 -0.3109 -0.1765 0.2343  3   DG  C "C4'" 
1582 O "O4'" . DG  B 3   ? 1.9148 0.9852 0.4981 -0.3307 -0.1453 0.2479  3   DG  C "O4'" 
1583 C "C3'" . DG  B 3   ? 1.9287 0.9786 0.5699 -0.2864 -0.1745 0.2153  3   DG  C "C3'" 
1584 O "O3'" . DG  B 3   ? 1.9434 1.0020 0.5944 -0.2595 -0.1686 0.1964  3   DG  C "O3'" 
1585 C "C2'" . DG  B 3   ? 1.8760 0.9856 0.5514 -0.2979 -0.1460 0.2220  3   DG  C "C2'" 
1586 C "C1'" . DG  B 3   ? 1.8583 0.9849 0.4961 -0.3147 -0.1234 0.2350  3   DG  C "C1'" 
1587 N N9    . DG  B 3   ? 1.7888 0.9650 0.4424 -0.3365 -0.0986 0.2496  3   DG  C N9    
1588 C C8    . DG  B 3   ? 1.7699 0.9472 0.4332 -0.3612 -0.1054 0.2660  3   DG  C C8    
1589 N N7    . DG  B 3   ? 1.7288 0.9590 0.4079 -0.3776 -0.0788 0.2770  3   DG  C N7    
1590 C C5    . DG  B 3   ? 1.6979 0.9638 0.3757 -0.3616 -0.0520 0.2668  3   DG  C C5    
1591 C C6    . DG  B 3   ? 1.6426 0.9723 0.3343 -0.3664 -0.0167 0.2704  3   DG  C C6    
1592 O O6    . DG  B 3   ? 1.6097 0.9799 0.3189 -0.3882 -0.0013 0.2851  3   DG  C O6    
1593 N N1    . DG  B 3   ? 1.6393 0.9844 0.3226 -0.3422 0.0003  0.2546  3   DG  C N1    
1594 C C2    . DG  B 3   ? 1.6715 0.9746 0.3350 -0.3189 -0.0158 0.2387  3   DG  C C2    
1595 N N2    . DG  B 3   ? 1.6605 0.9833 0.3170 -0.2980 0.0024  0.2248  3   DG  C N2    
1596 N N3    . DG  B 3   ? 1.7104 0.9575 0.3645 -0.3150 -0.0483 0.2356  3   DG  C N3    
1597 C C4    . DG  B 3   ? 1.7306 0.9619 0.3917 -0.3365 -0.0645 0.2499  3   DG  C C4    
1598 P P     . DC  B 4   ? 1.9401 1.0016 0.6384 -0.2306 -0.1802 0.1749  4   DC  C P     
1599 O OP1   . DC  B 4   ? 1.9698 0.9852 0.6438 -0.2162 -0.2043 0.1659  4   DC  C OP1   
1600 O OP2   . DC  B 4   ? 1.9247 0.9912 0.6565 -0.2350 -0.1888 0.1770  4   DC  C OP2   
1601 O "O5'" . DC  B 4   ? 1.8926 1.0106 0.6240 -0.2150 -0.1495 0.1628  4   DC  C "O5'" 
1602 C "C5'" . DC  B 4   ? 1.8781 1.0045 0.5817 -0.2106 -0.1335 0.1604  4   DC  C "C5'" 
1603 C "C4'" . DC  B 4   ? 1.8254 1.0113 0.5510 -0.2110 -0.0994 0.1601  4   DC  C "C4'" 
1604 O "O4'" . DC  B 4   ? 1.8018 1.0061 0.5198 -0.2375 -0.0874 0.1791  4   DC  C "O4'" 
1605 C "C3'" . DC  B 4   ? 1.7822 1.0069 0.5664 -0.1948 -0.0904 0.1472  4   DC  C "C3'" 
1606 O "O3'" . DC  B 4   ? 1.7831 1.0119 0.5786 -0.1697 -0.0885 0.1289  4   DC  C "O3'" 
1607 C "C2'" . DC  B 4   ? 1.7417 1.0194 0.5410 -0.2070 -0.0612 0.1557  4   DC  C "C2'" 
1608 C "C1'" . DC  B 4   ? 1.7392 1.0029 0.4937 -0.2344 -0.0594 0.1762  4   DC  C "C1'" 
1609 N N1    . DC  B 4   ? 1.6719 0.9585 0.4436 -0.2585 -0.0537 0.1926  4   DC  C N1    
1610 C C2    . DC  B 4   ? 1.6159 0.9595 0.4047 -0.2672 -0.0241 0.1988  4   DC  C C2    
1611 O O2    . DC  B 4   ? 1.5998 0.9732 0.3880 -0.2533 -0.0027 0.1897  4   DC  C O2    
1612 N N3    . DC  B 4   ? 1.5893 0.9533 0.3948 -0.2903 -0.0208 0.2143  4   DC  C N3    
1613 C C4    . DC  B 4   ? 1.6044 0.9318 0.4084 -0.3036 -0.0461 0.2228  4   DC  C C4    
1614 N N4    . DC  B 4   ? 1.5894 0.9359 0.4086 -0.3273 -0.0438 0.2385  4   DC  C N4    
1615 C C5    . DC  B 4   ? 1.6420 0.9115 0.4290 -0.2927 -0.0760 0.2153  4   DC  C C5    
1616 C C6    . DC  B 4   ? 1.6666 0.9197 0.4398 -0.2706 -0.0783 0.2005  4   DC  C C6    
1617 P P     . DT  B 5   ? 1.7591 1.0168 0.6110 -0.1495 -0.0849 0.1132  5   DT  C P     
1618 O OP1   . DT  B 5   ? 1.7714 1.0102 0.6222 -0.1283 -0.0957 0.0978  5   DT  C OP1   
1619 O OP2   . DT  B 5   ? 1.7508 1.0072 0.6317 -0.1565 -0.0961 0.1175  5   DT  C OP2   
1620 O "O5'" . DT  B 5   ? 1.7135 1.0262 0.5833 -0.1484 -0.0534 0.1125  5   DT  C "O5'" 
1621 C "C5'" . DT  B 5   ? 1.6946 1.0189 0.5355 -0.1444 -0.0361 0.1106  5   DT  C "C5'" 
1622 C "C4'" . DT  B 5   ? 1.6395 1.0194 0.5012 -0.1472 -0.0071 0.1129  5   DT  C "C4'" 
1623 O "O4'" . DT  B 5   ? 1.6114 1.0051 0.4743 -0.1723 -0.0021 0.1309  5   DT  C "O4'" 
1624 C "C3'" . DT  B 5   ? 1.6014 1.0151 0.5146 -0.1306 0.0002  0.1003  5   DT  C "C3'" 
1625 O "O3'" . DT  B 5   ? 1.5991 1.0490 0.5147 -0.1184 0.0232  0.0924  5   DT  C "O3'" 
1626 C "C2'" . DT  B 5   ? 1.5618 0.9963 0.5050 -0.1472 0.0015  0.1116  5   DT  C "C2'" 
1627 C "C1'" . DT  B 5   ? 1.5494 0.9867 0.4596 -0.1715 0.0100  0.1297  5   DT  C "C1'" 
1628 N N1    . DT  B 5   ? 1.4946 0.9277 0.4137 -0.1954 0.0009  0.1459  5   DT  C N1    
1629 C C2    . DT  B 5   ? 1.4428 0.9177 0.3754 -0.2130 0.0190  0.1585  5   DT  C C2    
1630 O O2    . DT  B 5   ? 1.4203 0.9399 0.3623 -0.2086 0.0433  0.1562  5   DT  C O2    
1631 N N3    . DT  B 5   ? 1.4184 0.8813 0.3544 -0.2355 0.0064  0.1735  5   DT  C N3    
1632 C C4    . DT  B 5   ? 1.4346 0.8472 0.3588 -0.2408 -0.0217 0.1766  5   DT  C C4    
1633 O O4    . DT  B 5   ? 1.4228 0.8269 0.3481 -0.2617 -0.0316 0.1906  5   DT  C O4    
1634 C C5    . DT  B 5   ? 1.4699 0.8437 0.3820 -0.2201 -0.0383 0.1621  5   DT  C C5    
1635 C C7    . DT  B 5   ? 1.4922 0.8140 0.3946 -0.2209 -0.0689 0.1624  5   DT  C C7    
1636 C C6    . DT  B 5   ? 1.4881 0.8745 0.3993 -0.1996 -0.0264 0.1483  5   DT  C C6    
1637 P P     . DC  B 6   ? 1.5868 1.0669 0.5463 -0.0968 0.0308  0.0766  6   DC  C P     
1638 O OP1   . DC  B 6   ? 1.5985 1.0874 0.5392 -0.0792 0.0434  0.0650  6   DC  C OP1   
1639 O OP2   . DC  B 6   ? 1.5867 1.0431 0.5717 -0.0897 0.0098  0.0701  6   DC  C OP2   
1640 O "O5'" . DC  B 6   ? 1.5441 1.0736 0.5367 -0.1082 0.0485  0.0852  6   DC  C "O5'" 
1641 C "C5'" . DC  B 6   ? 1.5169 1.0818 0.4966 -0.1178 0.0715  0.0934  6   DC  C "C5'" 
1642 C "C4'" . DC  B 6   ? 1.4690 1.0784 0.4878 -0.1298 0.0829  0.1019  6   DC  C "C4'" 
1643 O "O4'" . DC  B 6   ? 1.4536 1.0442 0.4702 -0.1542 0.0693  0.1182  6   DC  C "O4'" 
1644 C "C3'" . DC  B 6   ? 1.4428 1.0725 0.5095 -0.1141 0.0815  0.0903  6   DC  C "C3'" 
1645 O "O3'" . DC  B 6   ? 1.4347 1.1190 0.5265 -0.1110 0.1035  0.0893  6   DC  C "O3'" 
1646 C "C2'" . DC  B 6   ? 1.4204 1.0325 0.5065 -0.1289 0.0636  0.0991  6   DC  C "C2'" 
1647 C "C1'" . DC  B 6   ? 1.4054 1.0125 0.4656 -0.1559 0.0645  0.1183  6   DC  C "C1'" 
1648 N N1    . DC  B 6   ? 1.3662 0.9325 0.4203 -0.1714 0.0406  0.1279  6   DC  C N1    
1649 C C2    . DC  B 6   ? 1.3263 0.9029 0.3894 -0.1957 0.0389  0.1444  6   DC  C C2    
1650 O O2    . DC  B 6   ? 1.3039 0.9263 0.3840 -0.2049 0.0573  0.1513  6   DC  C O2    
1651 N N3    . DC  B 6   ? 1.3164 0.8521 0.3705 -0.2078 0.0156  0.1518  6   DC  C N3    
1652 C C4    . DC  B 6   ? 1.3307 0.8209 0.3689 -0.1962 -0.0037 0.1434  6   DC  C C4    
1653 N N4    . DC  B 6   ? 1.3369 0.7887 0.3663 -0.2066 -0.0264 0.1499  6   DC  C N4    
1654 C C5    . DC  B 6   ? 1.3558 0.8383 0.3876 -0.1729 -0.0017 0.1275  6   DC  C C5    
1655 C C6    . DC  B 6   ? 1.3642 0.8834 0.4029 -0.1617 0.0200  0.1205  6   DC  C C6    
1656 P P     . DT  B 7   ? 1.4307 1.1422 0.5648 -0.0888 0.1076  0.0740  7   DT  C P     
1657 O OP1   . DT  B 7   ? 1.4331 1.1805 0.5632 -0.0736 0.1291  0.0653  7   DT  C OP1   
1658 O OP2   . DT  B 7   ? 1.4421 1.1146 0.5814 -0.0755 0.0873  0.0632  7   DT  C OP2   
1659 O "O5'" . DT  B 7   ? 1.3892 1.1321 0.5627 -0.1050 0.1091  0.0849  7   DT  C "O5'" 
1660 C "C5'" . DT  B 7   ? 1.3547 1.1318 0.5288 -0.1264 0.1233  0.1006  7   DT  C "C5'" 
1661 C "C4'" . DT  B 7   ? 1.3167 1.1025 0.5212 -0.1455 0.1143  0.1126  7   DT  C "C4'" 
1662 O "O4'" . DT  B 7   ? 1.3174 1.0544 0.5005 -0.1613 0.0933  0.1221  7   DT  C "O4'" 
1663 C "C3'" . DT  B 7   ? 1.2896 1.0866 0.5363 -0.1317 0.1078  0.1026  7   DT  C "C3'" 
1664 O "O3'" . DT  B 7   ? 1.2790 1.1216 0.5593 -0.1437 0.1167  0.1112  7   DT  C "O3'" 
1665 C "C2'" . DT  B 7   ? 1.2809 1.0283 0.5228 -0.1369 0.0831  0.1042  7   DT  C "C2'" 
1666 C "C1'" . DT  B 7   ? 1.2716 0.9998 0.4841 -0.1627 0.0782  0.1216  7   DT  C "C1'" 
1667 N N1    . DT  B 7   ? 1.2345 0.9059 0.4250 -0.1671 0.0544  0.1233  7   DT  C N1    
1668 C C2    . DT  B 7   ? 1.2019 0.8551 0.3885 -0.1898 0.0407  0.1380  7   DT  C C2    
1669 O O2    . DT  B 7   ? 1.1683 0.8486 0.3694 -0.2084 0.0460  0.1506  7   DT  C O2    
1670 N N3    . DT  B 7   ? 1.2121 0.8136 0.3778 -0.1896 0.0190  0.1370  7   DT  C N3    
1671 C C4    . DT  B 7   ? 1.2246 0.7944 0.3755 -0.1709 0.0105  0.1241  7   DT  C C4    
1672 O O4    . DT  B 7   ? 1.2235 0.7508 0.3584 -0.1729 -0.0093 0.1248  7   DT  C O4    
1673 C C5    . DT  B 7   ? 1.2430 0.8337 0.3996 -0.1498 0.0251  0.1103  7   DT  C C5    
1674 C C7    . DT  B 7   ? 1.2683 0.8284 0.4124 -0.1301 0.0160  0.0964  7   DT  C C7    
1675 C C6    . DT  B 7   ? 1.2349 0.8730 0.4092 -0.1484 0.0458  0.1103  7   DT  C C6    
1676 P P     . DG  B 8   ? 1.2612 1.1395 0.5870 -0.1268 0.1207  0.1001  8   DG  C P     
1677 O OP1   . DG  B 8   ? 1.2466 1.1789 0.5834 -0.1192 0.1444  0.0971  8   DG  C OP1   
1678 O OP2   . DG  B 8   ? 1.2726 1.1167 0.6000 -0.1056 0.1069  0.0849  8   DG  C OP2   
1679 O "O5'" . DG  B 8   ? 1.2229 1.1102 0.5760 -0.1489 0.1105  0.1140  8   DG  C "O5'" 
1680 C "C5'" . DG  B 8   ? 1.1884 1.0875 0.5343 -0.1781 0.1135  0.1336  8   DG  C "C5'" 
1681 C "C4'" . DG  B 8   ? 1.1632 1.0333 0.5151 -0.1970 0.0917  0.1444  8   DG  C "C4'" 
1682 O "O4'" . DG  B 8   ? 1.1642 0.9748 0.4817 -0.1973 0.0743  0.1436  8   DG  C "O4'" 
1683 C "C3'" . DG  B 8   ? 1.1435 1.0188 0.5320 -0.1873 0.0813  0.1371  8   DG  C "C3'" 
1684 O "O3'" . DG  B 8   ? 1.1520 1.0472 0.5625 -0.2106 0.0762  0.1520  8   DG  C "O3'" 
1685 C "C2'" . DG  B 8   ? 1.1400 0.9573 0.5105 -0.1779 0.0608  0.1293  8   DG  C "C2'" 
1686 C "C1'" . DG  B 8   ? 1.1396 0.9214 0.4700 -0.1934 0.0546  0.1394  8   DG  C "C1'" 
1687 N N9    . DG  B 8   ? 1.1073 0.8404 0.4118 -0.1794 0.0426  0.1294  8   DG  C N9    
1688 C C8    . DG  B 8   ? 1.0846 0.8121 0.3816 -0.1561 0.0485  0.1142  8   DG  C C8    
1689 N N7    . DG  B 8   ? 1.0810 0.7637 0.3546 -0.1502 0.0348  0.1095  8   DG  C N7    
1690 C C5    . DG  B 8   ? 1.0702 0.7260 0.3333 -0.1694 0.0191  0.1216  8   DG  C C5    
1691 C C6    . DG  B 8   ? 1.0452 0.6510 0.2849 -0.1712 -0.0007 0.1219  8   DG  C C6    
1692 O O6    . DG  B 8   ? 1.0232 0.6010 0.2479 -0.1571 -0.0073 0.1123  8   DG  C O6    
1693 N N1    . DG  B 8   ? 1.0664 0.6555 0.3010 -0.1920 -0.0144 0.1353  8   DG  C N1    
1694 C C2    . DG  B 8   ? 1.0762 0.6936 0.3270 -0.2110 -0.0099 0.1479  8   DG  C C2    
1695 N N2    . DG  B 8   ? 1.0920 0.6835 0.3327 -0.2305 -0.0271 0.1602  8   DG  C N2    
1696 N N3    . DG  B 8   ? 1.0753 0.7430 0.3503 -0.2108 0.0093  0.1486  8   DG  C N3    
1697 C C4    . DG  B 8   ? 1.0871 0.7713 0.3671 -0.1883 0.0231  0.1344  8   DG  C C4    
1698 P P     . DT  B 9   ? 1.1533 1.0628 0.6040 -0.2065 0.0662  0.1485  9   DT  C P     
1699 O OP1   . DT  B 9   ? 1.1354 1.0924 0.6141 -0.2277 0.0728  0.1628  9   DT  C OP1   
1700 O OP2   . DT  B 9   ? 1.1547 1.0695 0.6192 -0.1762 0.0704  0.1290  9   DT  C OP2   
1701 O "O5'" . DT  B 9   ? 1.1618 1.0134 0.5954 -0.2153 0.0402  0.1522  9   DT  C "O5'" 
1702 C "C5'" . DT  B 9   ? 1.1571 0.9824 0.5660 -0.2411 0.0298  0.1684  9   DT  C "C5'" 
1703 C "C4'" . DT  B 9   ? 1.1616 0.9286 0.5523 -0.2402 0.0052  0.1662  9   DT  C "C4'" 
1704 O "O4'" . DT  B 9   ? 1.1579 0.8902 0.5207 -0.2230 0.0040  0.1550  9   DT  C "O4'" 
1705 C "C3'" . DT  B 9   ? 1.1494 0.9113 0.5652 -0.2284 -0.0066 0.1572  9   DT  C "C3'" 
1706 O "O3'" . DT  B 9   ? 1.1811 0.9165 0.5931 -0.2470 -0.0272 0.1679  9   DT  C "O3'" 
1707 C "C2'" . DT  B 9   ? 1.1376 0.8653 0.5383 -0.2033 -0.0107 0.1405  9   DT  C "C2'" 
1708 C "C1'" . DT  B 9   ? 1.1333 0.8311 0.4970 -0.2095 -0.0122 0.1449  9   DT  C "C1'" 
1709 N N1    . DT  B 9   ? 1.0875 0.7636 0.4347 -0.1873 -0.0096 0.1305  9   DT  C N1    
1710 C C2    . DT  B 9   ? 1.0823 0.7104 0.4016 -0.1863 -0.0249 0.1292  9   DT  C C2    
1711 O O2    . DT  B 9   ? 1.0870 0.6866 0.3927 -0.2012 -0.0412 0.1382  9   DT  C O2    
1712 N N3    . DT  B 9   ? 1.0795 0.6934 0.3879 -0.1668 -0.0220 0.1165  9   DT  C N3    
1713 C C4    . DT  B 9   ? 1.0604 0.6988 0.3793 -0.1491 -0.0065 0.1055  9   DT  C C4    
1714 O O4    . DT  B 9   ? 1.0498 0.6689 0.3558 -0.1343 -0.0077 0.0957  9   DT  C O4    
1715 C C5    . DT  B 9   ? 1.0544 0.7403 0.4003 -0.1495 0.0085  0.1066  9   DT  C C5    
1716 C C7    . DT  B 9   ? 1.0427 0.7551 0.4008 -0.1292 0.0237  0.0941  9   DT  C C7    
1717 C C6    . DT  B 9   ? 1.0570 0.7610 0.4168 -0.1682 0.0068  0.1188  9   DT  C C6    
1718 P P     . DA  B 10  ? 1.1807 0.9261 0.6232 -0.2488 -0.0387 0.1679  10  DA  C P     
1719 O OP1   . DA  B 10  ? 1.1696 0.9500 0.6309 -0.2750 -0.0368 0.1850  10  DA  C OP1   
1720 O OP2   . DA  B 10  ? 1.1757 0.9375 0.6390 -0.2223 -0.0308 0.1511  10  DA  C OP2   
1721 O "O5'" . DA  B 10  ? 1.1870 0.8716 0.6046 -0.2514 -0.0648 0.1678  10  DA  C "O5'" 
1722 C "C5'" . DA  B 10  ? 1.1841 0.8285 0.5660 -0.2637 -0.0754 0.1755  10  DA  C "C5'" 
1723 C "C4'" . DA  B 10  ? 1.1800 0.7735 0.5388 -0.2458 -0.0895 0.1631  10  DA  C "C4'" 
1724 O "O4'" . DA  B 10  ? 1.1562 0.7536 0.5094 -0.2245 -0.0752 0.1503  10  DA  C "O4'" 
1725 C "C3'" . DA  B 10  ? 1.1742 0.7534 0.5455 -0.2332 -0.1020 0.1536  10  DA  C "C3'" 
1726 O "O3'" . DA  B 10  ? 1.2181 0.7486 0.5661 -0.2405 -0.1259 0.1570  10  DA  C "O3'" 
1727 C "C2'" . DA  B 10  ? 1.1424 0.7209 0.5159 -0.2047 -0.0919 0.1356  10  DA  C "C2'" 
1728 C "C1'" . DA  B 10  ? 1.1279 0.7016 0.4809 -0.2030 -0.0825 0.1356  10  DA  C "C1'" 
1729 N N9    . DA  B 10  ? 1.0665 0.6608 0.4281 -0.1825 -0.0652 0.1232  10  DA  C N9    
1730 C C8    . DA  B 10  ? 1.0261 0.6637 0.4132 -0.1755 -0.0482 0.1195  10  DA  C C8    
1731 N N7    . DA  B 10  ? 1.0073 0.6512 0.3929 -0.1575 -0.0366 0.1085  10  DA  C N7    
1732 C C5    . DA  B 10  ? 1.0056 0.6101 0.3651 -0.1532 -0.0459 0.1052  10  DA  C C5    
1733 C C6    . DA  B 10  ? 0.9770 0.5672 0.3236 -0.1372 -0.0424 0.0949  10  DA  C C6    
1734 N N6    . DA  B 10  ? 0.9337 0.5457 0.2901 -0.1223 -0.0284 0.0859  10  DA  C N6    
1735 N N1    . DA  B 10  ? 0.9986 0.5500 0.3222 -0.1365 -0.0555 0.0940  10  DA  C N1    
1736 C C2    . DA  B 10  ? 1.0244 0.5501 0.3364 -0.1497 -0.0716 0.1020  10  DA  C C2    
1737 N N3    . DA  B 10  ? 1.0394 0.5718 0.3585 -0.1663 -0.0772 0.1125  10  DA  C N3    
1738 C C4    . DA  B 10  ? 1.0389 0.6129 0.3833 -0.1676 -0.0633 0.1138  10  DA  C C4    
1739 P P     . DC  B 11  ? 1.2291 0.7384 0.5831 -0.2360 -0.1441 0.1524  11  DC  C P     
1740 O OP1   . DC  B 11  ? 1.2556 0.7315 0.5911 -0.2577 -0.1670 0.1651  11  DC  C OP1   
1741 O OP2   . DC  B 11  ? 1.2078 0.7583 0.5959 -0.2301 -0.1332 0.1488  11  DC  C OP2   
1742 O "O5'" . DC  B 11  ? 1.2253 0.7012 0.5628 -0.2098 -0.1479 0.1353  11  DC  C "O5'" 
1743 C "C5'" . DC  B 11  ? 1.2163 0.6568 0.5245 -0.2068 -0.1550 0.1336  11  DC  C "C5'" 
1744 C "C4'" . DC  B 11  ? 1.1932 0.6251 0.4992 -0.1800 -0.1489 0.1166  11  DC  C "C4'" 
1745 O "O4'" . DC  B 11  ? 1.1475 0.6153 0.4683 -0.1721 -0.1267 0.1127  11  DC  C "O4'" 
1746 C "C3'" . DC  B 11  ? 1.1817 0.6107 0.4989 -0.1640 -0.1519 0.1055  11  DC  C "C3'" 
1747 O "O3'" . DC  B 11  ? 1.2138 0.5990 0.5095 -0.1595 -0.1722 0.1015  11  DC  C "O3'" 
1748 C "C2'" . DC  B 11  ? 1.1546 0.6013 0.4822 -0.1427 -0.1347 0.0926  11  DC  C "C2'" 
1749 C "C1'" . DC  B 11  ? 1.1250 0.5909 0.4514 -0.1490 -0.1214 0.0978  11  DC  C "C1'" 
1750 N N1    . DC  B 11  ? 1.0598 0.5665 0.4085 -0.1408 -0.1005 0.0934  11  DC  C N1    
1751 C C2    . DC  B 11  ? 1.0337 0.5438 0.3782 -0.1282 -0.0898 0.0859  11  DC  C C2    
1752 O O2    . DC  B 11  ? 1.0442 0.5261 0.3693 -0.1241 -0.0975 0.0831  11  DC  C O2    
1753 N N3    . DC  B 11  ? 0.9953 0.5386 0.3570 -0.1205 -0.0728 0.0817  11  DC  C N3    
1754 C C4    . DC  B 11  ? 0.9715 0.5457 0.3551 -0.1244 -0.0659 0.0846  11  DC  C C4    
1755 N N4    . DC  B 11  ? 0.9473 0.5515 0.3460 -0.1146 -0.0506 0.0792  11  DC  C N4    
1756 C C5    . DC  B 11  ? 0.9781 0.5525 0.3689 -0.1380 -0.0762 0.0928  11  DC  C C5    
1757 C C6    . DC  B 11  ? 1.0165 0.5558 0.3887 -0.1461 -0.0935 0.0971  11  DC  C C6    
1758 P P     . DG  B 12  ? 1.2343 0.6056 0.5322 -0.1533 -0.1840 0.0963  12  DG  C P     
1759 O OP1   . DG  B 12  ? 1.2695 0.6008 0.5447 -0.1659 -0.2087 0.1031  12  DG  C OP1   
1760 O OP2   . DG  B 12  ? 1.2192 0.6288 0.5451 -0.1554 -0.1721 0.0978  12  DG  C OP2   
1761 O "O5'" . DG  B 12  ? 1.2023 0.5601 0.4941 -0.1267 -0.1804 0.0794  12  DG  C "O5'" 
1762 C "C5'" . DG  B 12  ? 1.1695 0.4984 0.4407 -0.1174 -0.1877 0.0735  12  DG  C "C5'" 
1763 C "C4'" . DG  B 12  ? 1.1332 0.4572 0.4050 -0.0929 -0.1832 0.0579  12  DG  C "C4'" 
1764 O "O4'" . DG  B 12  ? 1.0761 0.4348 0.3686 -0.0842 -0.1617 0.0532  12  DG  C "O4'" 
1765 C "C3'" . DG  B 12  ? 1.1273 0.4416 0.3979 -0.0849 -0.1895 0.0519  12  DG  C "C3'" 
1766 O "O3'" . DG  B 12  ? 1.1575 0.4509 0.4155 -0.0645 -0.1933 0.0387  12  DG  C "O3'" 
1767 C "C2'" . DG  B 12  ? 1.0896 0.4428 0.3857 -0.0824 -0.1706 0.0509  12  DG  C "C2'" 
1768 C "C1'" . DG  B 12  ? 1.0443 0.4171 0.3495 -0.0751 -0.1545 0.0473  12  DG  C "C1'" 
1769 N N9    . DG  B 12  ? 0.9868 0.3971 0.3144 -0.0788 -0.1373 0.0505  12  DG  C N9    
1770 C C8    . DG  B 12  ? 0.9738 0.4053 0.3127 -0.0950 -0.1340 0.0612  12  DG  C C8    
1771 N N7    . DG  B 12  ? 0.9319 0.3954 0.2886 -0.0924 -0.1174 0.0604  12  DG  C N7    
1772 C C5    . DG  B 12  ? 0.9036 0.3646 0.2601 -0.0751 -0.1104 0.0496  12  DG  C C5    
1773 C C6    . DG  B 12  ? 0.8587 0.3423 0.2281 -0.0658 -0.0950 0.0444  12  DG  C C6    
1774 O O6    . DG  B 12  ? 0.8500 0.3600 0.2333 -0.0688 -0.0844 0.0470  12  DG  C O6    
1775 N N1    . DG  B 12  ? 0.8318 0.3046 0.1971 -0.0511 -0.0933 0.0348  12  DG  C N1    
1776 C C2    . DG  B 12  ? 0.8532 0.2997 0.2044 -0.0445 -0.1037 0.0300  12  DG  C C2    
1777 N N2    . DG  B 12  ? 0.8318 0.2764 0.1841 -0.0307 -0.0991 0.0212  12  DG  C N2    
1778 N N3    . DG  B 12  ? 0.8805 0.3040 0.2174 -0.0512 -0.1184 0.0336  12  DG  C N3    
1779 C C4    . DG  B 12  ? 0.9158 0.3467 0.2557 -0.0672 -0.1215 0.0438  12  DG  C C4    
1780 P P     . DT  B 13  ? 1.1929 0.4637 0.4378 -0.0522 -0.2035 0.0300  13  DT  C P     
1781 O OP1   . DT  B 13  ? 1.2563 0.4874 0.4757 -0.0441 -0.2220 0.0243  13  DT  C OP1   
1782 O OP2   . DT  B 13  ? 1.1810 0.4564 0.4309 -0.0651 -0.2082 0.0375  13  DT  C OP2   
1783 O "O5'" . DT  B 13  ? 1.1685 0.4618 0.4262 -0.0330 -0.1847 0.0186  13  DT  C "O5'" 
1784 C "C5'" . DT  B 13  ? 1.0962 0.4190 0.3729 -0.0346 -0.1700 0.0201  13  DT  C "C5'" 
1785 C "C4'" . DT  B 13  ? 1.0220 0.3653 0.3105 -0.0199 -0.1525 0.0117  13  DT  C "C4'" 
1786 O "O4'" . DT  B 13  ? 0.9463 0.3200 0.2553 -0.0274 -0.1385 0.0172  13  DT  C "O4'" 
1787 C "C3'" . DT  B 13  ? 0.9733 0.3212 0.2620 -0.0086 -0.1457 0.0048  13  DT  C "C3'" 
1788 O "O3'" . DT  B 13  ? 0.9696 0.3176 0.2557 0.0084  -0.1388 -0.0056 13  DT  C "O3'" 
1789 C "C2'" . DT  B 13  ? 0.9318 0.3104 0.2416 -0.0152 -0.1321 0.0099  13  DT  C "C2'" 
1790 C "C1'" . DT  B 13  ? 0.9224 0.3178 0.2451 -0.0221 -0.1253 0.0146  13  DT  C "C1'" 
1791 N N1    . DT  B 13  ? 0.9098 0.3287 0.2490 -0.0350 -0.1197 0.0233  13  DT  C N1    
1792 C C2    . DT  B 13  ? 0.8801 0.3255 0.2364 -0.0324 -0.1045 0.0225  13  DT  C C2    
1793 O O2    . DT  B 13  ? 0.8911 0.3414 0.2503 -0.0217 -0.0960 0.0160  13  DT  C O2    
1794 N N3    . DT  B 13  ? 0.8421 0.3085 0.2124 -0.0426 -0.1005 0.0294  13  DT  C N3    
1795 C C4    . DT  B 13  ? 0.8685 0.3358 0.2402 -0.0566 -0.1088 0.0380  13  DT  C C4    
1796 O O4    . DT  B 13  ? 0.8680 0.3600 0.2555 -0.0637 -0.1026 0.0432  13  DT  C O4    
1797 C C5    . DT  B 13  ? 0.9114 0.3495 0.2654 -0.0608 -0.1255 0.0396  13  DT  C C5    
1798 C C7    . DT  B 13  ? 0.9263 0.3619 0.2810 -0.0777 -0.1374 0.0497  13  DT  C C7    
1799 C C6    . DT  B 13  ? 0.9237 0.3377 0.2610 -0.0495 -0.1304 0.0319  13  DT  C C6    
1800 P P     . DG  B 14  ? 0.9785 0.3218 0.2546 0.0226  -0.1346 -0.0144 14  DG  C P     
1801 O OP1   . DG  B 14  ? 1.0004 0.3394 0.2712 0.0389  -0.1323 -0.0246 14  DG  C OP1   
1802 O OP2   . DG  B 14  ? 1.0212 0.3415 0.2798 0.0181  -0.1487 -0.0124 14  DG  C OP2   
1803 O "O5'" . DG  B 14  ? 0.9278 0.3007 0.2225 0.0211  -0.1171 -0.0123 14  DG  C "O5'" 
1804 C "C5'" . DG  B 14  ? 0.9380 0.3350 0.2517 0.0223  -0.1037 -0.0124 14  DG  C "C5'" 
1805 C "C4'" . DG  B 14  ? 0.9356 0.3546 0.2640 0.0177  -0.0919 -0.0085 14  DG  C "C4'" 
1806 O "O4'" . DG  B 14  ? 0.9255 0.3504 0.2618 0.0045  -0.0957 -0.0003 14  DG  C "O4'" 
1807 C "C3'" . DG  B 14  ? 0.9713 0.3884 0.2918 0.0228  -0.0879 -0.0110 14  DG  C "C3'" 
1808 O "O3'" . DG  B 14  ? 0.9920 0.4291 0.3251 0.0258  -0.0737 -0.0119 14  DG  C "O3'" 
1809 C "C2'" . DG  B 14  ? 0.9549 0.3701 0.2764 0.0119  -0.0950 -0.0040 14  DG  C "C2'" 
1810 C "C1'" . DG  B 14  ? 0.9201 0.3524 0.2601 0.0026  -0.0925 0.0018  14  DG  C "C1'" 
1811 N N9    . DG  B 14  ? 0.8906 0.3253 0.2361 -0.0095 -0.1003 0.0093  14  DG  C N9    
1812 C C8    . DG  B 14  ? 0.9129 0.3297 0.2477 -0.0167 -0.1150 0.0128  14  DG  C C8    
1813 N N7    . DG  B 14  ? 0.9185 0.3474 0.2656 -0.0293 -0.1182 0.0208  14  DG  C N7    
1814 C C5    . DG  B 14  ? 0.8809 0.3365 0.2465 -0.0284 -0.1045 0.0213  14  DG  C C5    
1815 C C6    . DG  B 14  ? 0.8450 0.3253 0.2296 -0.0369 -0.0999 0.0273  14  DG  C C6    
1816 O O6    . DG  B 14  ? 0.8711 0.3583 0.2627 -0.0485 -0.1062 0.0344  14  DG  C O6    
1817 N N1    . DG  B 14  ? 0.8077 0.3066 0.2040 -0.0307 -0.0869 0.0243  14  DG  C N1    
1818 C C2    . DG  B 14  ? 0.8180 0.3128 0.2098 -0.0199 -0.0796 0.0178  14  DG  C C2    
1819 N N2    . DG  B 14  ? 0.8059 0.3175 0.2093 -0.0160 -0.0695 0.0162  14  DG  C N2    
1820 N N3    . DG  B 14  ? 0.8495 0.3255 0.2263 -0.0132 -0.0824 0.0131  14  DG  C N3    
1821 C C4    . DG  B 14  ? 0.8727 0.3298 0.2366 -0.0169 -0.0946 0.0146  14  DG  C C4    
1822 P P     . DA  B 15  ? 1.0184 0.4582 0.3450 0.0309  -0.0653 -0.0139 15  DA  C P     
1823 O OP1   . DA  B 15  ? 1.0500 0.5025 0.3825 0.0385  -0.0538 -0.0184 15  DA  C OP1   
1824 O OP2   . DA  B 15  ? 1.0343 0.4528 0.3391 0.0334  -0.0741 -0.0155 15  DA  C OP2   
1825 O "O5'" . DA  B 15  ? 0.9979 0.4517 0.3386 0.0224  -0.0614 -0.0075 15  DA  C "O5'" 
1826 C "C5'" . DA  B 15  ? 0.9420 0.4143 0.3010 0.0203  -0.0531 -0.0060 15  DA  C "C5'" 
1827 C "C4'" . DA  B 15  ? 0.9159 0.3971 0.2840 0.0149  -0.0514 -0.0015 15  DA  C "C4'" 
1828 O "O4'" . DA  B 15  ? 0.9014 0.3833 0.2745 0.0084  -0.0593 0.0023  15  DA  C "O4'" 
1829 C "C3'" . DA  B 15  ? 0.9486 0.4234 0.3063 0.0162  -0.0505 -0.0008 15  DA  C "C3'" 
1830 O "O3'" . DA  B 15  ? 0.9783 0.4635 0.3457 0.0147  -0.0445 0.0013  15  DA  C "O3'" 
1831 C "C2'" . DA  B 15  ? 0.9369 0.4031 0.2905 0.0119  -0.0617 0.0020  15  DA  C "C2'" 
1832 C "C1'" . DA  B 15  ? 0.9016 0.3806 0.2722 0.0063  -0.0637 0.0048  15  DA  C "C1'" 
1833 N N9    . DA  B 15  ? 0.8921 0.3648 0.2609 0.0005  -0.0747 0.0077  15  DA  C N9    
1834 C C8    . DA  B 15  ? 0.9087 0.3627 0.2619 0.0006  -0.0838 0.0066  15  DA  C C8    
1835 N N7    . DA  B 15  ? 0.9012 0.3532 0.2575 -0.0076 -0.0940 0.0110  15  DA  C N7    
1836 C C5    . DA  B 15  ? 0.8595 0.3336 0.2359 -0.0125 -0.0899 0.0149  15  DA  C C5    
1837 C C6    . DA  B 15  ? 0.8337 0.3212 0.2247 -0.0217 -0.0950 0.0207  15  DA  C C6    
1838 N N6    . DA  B 15  ? 0.8588 0.3377 0.2462 -0.0303 -0.1069 0.0250  15  DA  C N6    
1839 N N1    . DA  B 15  ? 0.8119 0.3231 0.2216 -0.0219 -0.0876 0.0219  15  DA  C N1    
1840 C C2    . DA  B 15  ? 0.8066 0.3232 0.2184 -0.0142 -0.0777 0.0179  15  DA  C C2    
1841 N N3    . DA  B 15  ? 0.8310 0.3357 0.2308 -0.0073 -0.0730 0.0136  15  DA  C N3    
1842 C C4    . DA  B 15  ? 0.8495 0.3349 0.2327 -0.0066 -0.0786 0.0123  15  DA  C C4    
1843 P P     . DG  B 16  ? 0.9913 0.4704 0.3488 0.0149  -0.0424 0.0032  16  DG  C P     
1844 O OP1   . DG  B 16  ? 0.9873 0.4751 0.3506 0.0148  -0.0330 0.0036  16  DG  C OP1   
1845 O OP2   . DG  B 16  ? 1.0177 0.4805 0.3542 0.0176  -0.0462 0.0019  16  DG  C OP2   
1846 O "O5'" . DG  B 16  ? 0.9997 0.4815 0.3663 0.0116  -0.0493 0.0062  16  DG  C "O5'" 
1847 C "C5'" . DG  B 16  ? 0.9856 0.4799 0.3680 0.0107  -0.0466 0.0069  16  DG  C "C5'" 
1848 C "C4'" . DG  B 16  ? 0.9730 0.4718 0.3644 0.0100  -0.0537 0.0083  16  DG  C "C4'" 
1849 O "O4'" . DG  B 16  ? 0.9621 0.4633 0.3567 0.0075  -0.0599 0.0090  16  DG  C "O4'" 
1850 C "C3'" . DG  B 16  ? 0.9935 0.4814 0.3760 0.0110  -0.0593 0.0099  16  DG  C "C3'" 
1851 O "O3'" . DG  B 16  ? 1.0110 0.5068 0.4060 0.0131  -0.0617 0.0097  16  DG  C "O3'" 
1852 C "C2'" . DG  B 16  ? 0.9729 0.4536 0.3493 0.0096  -0.0684 0.0108  16  DG  C "C2'" 
1853 C "C1'" . DG  B 16  ? 0.9494 0.4446 0.3409 0.0069  -0.0689 0.0107  16  DG  C "C1'" 
1854 N N9    . DG  B 16  ? 0.9094 0.3966 0.2938 0.0036  -0.0760 0.0116  16  DG  C N9    
1855 C C8    . DG  B 16  ? 0.8967 0.3676 0.2627 0.0047  -0.0765 0.0100  16  DG  C C8    
1856 N N7    . DG  B 16  ? 0.8896 0.3540 0.2522 0.0011  -0.0853 0.0111  16  DG  C N7    
1857 C C5    . DG  B 16  ? 0.8675 0.3484 0.2499 -0.0042 -0.0895 0.0145  16  DG  C C5    
1858 C C6    . DG  B 16  ? 0.8438 0.3273 0.2332 -0.0117 -0.0999 0.0183  16  DG  C C6    
1859 O O6    . DG  B 16  ? 0.8701 0.3384 0.2479 -0.0154 -0.1084 0.0192  16  DG  C O6    
1860 N N1    . DG  B 16  ? 0.8162 0.3241 0.2293 -0.0151 -0.0994 0.0211  16  DG  C N1    
1861 C C2    . DG  B 16  ? 0.8220 0.3450 0.2472 -0.0097 -0.0919 0.0192  16  DG  C C2    
1862 N N2    . DG  B 16  ? 0.8156 0.3627 0.2630 -0.0115 -0.0923 0.0211  16  DG  C N2    
1863 N N3    . DG  B 16  ? 0.8446 0.3606 0.2611 -0.0030 -0.0844 0.0158  16  DG  C N3    
1864 C C4    . DG  B 16  ? 0.8710 0.3671 0.2671 -0.0015 -0.0833 0.0142  16  DG  C C4    
1865 P P     . DC  B 17  ? 1.0318 0.5156 0.4196 0.0153  -0.0687 0.0109  17  DC  C P     
1866 O OP1   . DC  B 17  ? 1.0442 0.5319 0.4398 0.0181  -0.0668 0.0096  17  DC  C OP1   
1867 O OP2   . DC  B 17  ? 1.0580 0.5230 0.4237 0.0132  -0.0689 0.0133  17  DC  C OP2   
1868 O "O5'" . DC  B 17  ? 1.0063 0.4975 0.4053 0.0171  -0.0788 0.0105  17  DC  C "O5'" 
1869 C "C5'" . DC  B 17  ? 0.9572 0.4704 0.3781 0.0194  -0.0781 0.0085  17  DC  C "C5'" 
1870 C "C4'" . DC  B 17  ? 0.9193 0.4427 0.3525 0.0195  -0.0873 0.0091  17  DC  C "C4'" 
1871 O "O4'" . DC  B 17  ? 0.8916 0.4128 0.3207 0.0128  -0.0892 0.0118  17  DC  C "O4'" 
1872 C "C3'" . DC  B 17  ? 0.9208 0.4315 0.3487 0.0232  -0.0992 0.0093  17  DC  C "C3'" 
1873 O "O3'" . DC  B 17  ? 0.9222 0.4530 0.3723 0.0285  -0.1043 0.0070  17  DC  C "O3'" 
1874 C "C2'" . DC  B 17  ? 0.9118 0.4091 0.3272 0.0177  -0.1063 0.0124  17  DC  C "C2'" 
1875 C "C1'" . DC  B 17  ? 0.8860 0.3989 0.3120 0.0119  -0.1014 0.0134  17  DC  C "C1'" 
1876 N N1    . DC  B 17  ? 0.8673 0.3632 0.2754 0.0064  -0.1039 0.0154  17  DC  C N1    
1877 C C2    . DC  B 17  ? 0.8436 0.3454 0.2594 0.0001  -0.1112 0.0179  17  DC  C C2    
1878 O O2    . DC  B 17  ? 0.8487 0.3718 0.2872 -0.0019 -0.1152 0.0194  17  DC  C O2    
1879 N N3    . DC  B 17  ? 0.8339 0.3175 0.2314 -0.0036 -0.1143 0.0187  17  DC  C N3    
1880 C C4    . DC  B 17  ? 0.8316 0.2950 0.2052 0.0000  -0.1093 0.0164  17  DC  C C4    
1881 N N4    . DC  B 17  ? 0.8334 0.2796 0.1891 -0.0016 -0.1129 0.0159  17  DC  C N4    
1882 C C5    . DC  B 17  ? 0.8483 0.3098 0.2162 0.0051  -0.1000 0.0147  17  DC  C C5    
1883 C C6    . DC  B 17  ? 0.8717 0.3481 0.2566 0.0075  -0.0983 0.0145  17  DC  C C6    
1884 P P     . DG  B 18  ? 0.9516 0.4746 0.4031 0.0362  -0.1175 0.0052  18  DG  C P     
1885 O OP1   . DG  B 18  ? 0.9531 0.4978 0.4255 0.0456  -0.1162 0.0001  18  DG  C OP1   
1886 O OP2   . DG  B 18  ? 0.9844 0.4749 0.4082 0.0356  -0.1213 0.0070  18  DG  C OP2   
1887 O "O5'" . DG  B 18  ? 0.9419 0.4702 0.4016 0.0321  -0.1287 0.0078  18  DG  C "O5'" 
1888 C "C5'" . DG  B 18  ? 0.9060 0.4655 0.3930 0.0302  -0.1284 0.0081  18  DG  C "C5'" 
1889 C "C4'" . DG  B 18  ? 0.8940 0.4506 0.3831 0.0234  -0.1408 0.0121  18  DG  C "C4'" 
1890 O "O4'" . DG  B 18  ? 0.8846 0.4212 0.3518 0.0146  -0.1384 0.0155  18  DG  C "O4'" 
1891 C "C3'" . DG  B 18  ? 0.9247 0.4627 0.4065 0.0281  -0.1577 0.0116  18  DG  C "C3'" 
1892 O "O3'" . DG  B 18  ? 0.9399 0.5017 0.4491 0.0269  -0.1683 0.0126  18  DG  C "O3'" 
1893 C "C2'" . DG  B 18  ? 0.9288 0.4317 0.3771 0.0216  -0.1614 0.0149  18  DG  C "C2'" 
1894 C "C1'" . DG  B 18  ? 0.8970 0.4100 0.3481 0.0126  -0.1525 0.0175  18  DG  C "C1'" 
1895 N N9    . DG  B 18  ? 0.8860 0.3717 0.3063 0.0088  -0.1481 0.0185  18  DG  C N9    
1896 C C8    . DG  B 18  ? 0.8890 0.3554 0.2859 0.0121  -0.1397 0.0171  18  DG  C C8    
1897 N N7    . DG  B 18  ? 0.8849 0.3335 0.2592 0.0087  -0.1360 0.0178  18  DG  C N7    
1898 C C5    . DG  B 18  ? 0.8812 0.3347 0.2630 0.0029  -0.1433 0.0196  18  DG  C C5    
1899 C C6    . DG  B 18  ? 0.8630 0.3001 0.2266 -0.0013 -0.1454 0.0201  18  DG  C C6    
1900 O O6    . DG  B 18  ? 0.8862 0.3046 0.2249 0.0008  -0.1393 0.0182  18  DG  C O6    
1901 N N1    . DG  B 18  ? 0.8435 0.2877 0.2204 -0.0083 -0.1567 0.0229  18  DG  C N1    
1902 C C2    . DG  B 18  ? 0.8475 0.3174 0.2552 -0.0114 -0.1629 0.0254  18  DG  C C2    
1903 N N2    . DG  B 18  ? 0.8289 0.3036 0.2468 -0.0203 -0.1742 0.0293  18  DG  C N2    
1904 N N3    . DG  B 18  ? 0.8458 0.3351 0.2725 -0.0058 -0.1593 0.0239  18  DG  C N3    
1905 C C4    . DG  B 18  ? 0.8699 0.3468 0.2805 0.0015  -0.1506 0.0208  18  DG  C C4    
1906 P P     . DA  B 19  ? 0.9659 0.5169 0.4773 0.0307  -0.1894 0.0125  19  DA  C P     
1907 O OP1   . DA  B 19  ? 0.9616 0.5508 0.5118 0.0375  -0.1933 0.0095  19  DA  C OP1   
1908 O OP2   . DA  B 19  ? 0.9997 0.5114 0.4781 0.0360  -0.1955 0.0113  19  DA  C OP2   
1909 O "O5'" . DA  B 19  ? 0.9599 0.5015 0.4649 0.0181  -0.1986 0.0183  19  DA  C "O5'" 
1910 C "C5'" . DA  B 19  ? 0.9429 0.5124 0.4701 0.0080  -0.1936 0.0221  19  DA  C "C5'" 
1911 C "C4'" . DA  B 19  ? 0.9605 0.5108 0.4753 -0.0032 -0.2072 0.0272  19  DA  C "C4'" 
1912 O "O4'" . DA  B 19  ? 0.9601 0.4768 0.4378 -0.0061 -0.2010 0.0275  19  DA  C "O4'" 
1913 C "C3'" . DA  B 19  ? 0.9864 0.5175 0.4957 -0.0008 -0.2295 0.0274  19  DA  C "C3'" 
1914 O "O3'" . DA  B 19  ? 1.0365 0.5795 0.5641 -0.0118 -0.2431 0.0325  19  DA  C "O3'" 
1915 C "C2'" . DA  B 19  ? 0.9847 0.4676 0.4465 0.0008  -0.2314 0.0265  19  DA  C "C2'" 
1916 C "C1'" . DA  B 19  ? 0.9565 0.4361 0.4049 -0.0058 -0.2159 0.0278  19  DA  C "C1'" 
1917 N N9    . DA  B 19  ? 0.9310 0.3815 0.3435 -0.0011 -0.2053 0.0252  19  DA  C N9    
1918 C C8    . DA  B 19  ? 0.9186 0.3656 0.3236 0.0072  -0.1957 0.0222  19  DA  C C8    
1919 N N7    . DA  B 19  ? 0.9219 0.3460 0.2964 0.0080  -0.1858 0.0214  19  DA  C N7    
1920 C C5    . DA  B 19  ? 0.9212 0.3327 0.2816 0.0018  -0.1886 0.0228  19  DA  C C5    
1921 C C6    . DA  B 19  ? 0.9178 0.3058 0.2466 0.0013  -0.1818 0.0217  19  DA  C C6    
1922 N N6    . DA  B 19  ? 0.9296 0.3061 0.2375 0.0057  -0.1689 0.0200  19  DA  C N6    
1923 N N1    . DA  B 19  ? 0.9223 0.2998 0.2426 -0.0039 -0.1893 0.0225  19  DA  C N1    
1924 C C2    . DA  B 19  ? 0.9255 0.3147 0.2674 -0.0105 -0.2030 0.0255  19  DA  C C2    
1925 N N3    . DA  B 19  ? 0.9204 0.3354 0.2951 -0.0120 -0.2095 0.0276  19  DA  C N3    
1926 C C4    . DA  B 19  ? 0.9247 0.3500 0.3069 -0.0044 -0.2013 0.0254  19  DA  C C4    
1927 P P     . DT  B 20  ? 1.0882 0.6214 0.6217 -0.0121 -0.2695 0.0339  20  DT  C P     
1928 O OP1   . DT  B 20  ? 1.0741 0.6486 0.6514 -0.0216 -0.2762 0.0387  20  DT  C OP1   
1929 O OP2   . DT  B 20  ? 1.1040 0.6236 0.6292 0.0020  -0.2755 0.0286  20  DT  C OP2   
1930 O "O5'" . DT  B 20  ? 1.1164 0.6014 0.6067 -0.0192 -0.2804 0.0363  20  DT  C "O5'" 
1931 C "C5'" . DT  B 20  ? 1.0953 0.5760 0.5768 -0.0304 -0.2745 0.0399  20  DT  C "C5'" 
1932 C "C4'" . DT  B 20  ? 1.0987 0.5289 0.5326 -0.0315 -0.2835 0.0393  20  DT  C "C4'" 
1933 O "O4'" . DT  B 20  ? 1.0800 0.4894 0.4818 -0.0227 -0.2666 0.0346  20  DT  C "O4'" 
1934 C "C3'" . DT  B 20  ? 1.1249 0.5252 0.5415 -0.0293 -0.3078 0.0390  20  DT  C "C3'" 
1935 O "O3'" . DT  B 20  ? 1.1780 0.5599 0.5854 -0.0402 -0.3256 0.0428  20  DT  C "O3'" 
1936 C "C2'" . DT  B 20  ? 1.1172 0.4786 0.4874 -0.0188 -0.3013 0.0342  20  DT  C "C2'" 
1937 C "C1'" . DT  B 20  ? 1.0910 0.4563 0.4508 -0.0187 -0.2774 0.0327  20  DT  C "C1'" 
1938 N N1    . DT  B 20  ? 1.0507 0.4020 0.3848 -0.0089 -0.2609 0.0287  20  DT  C N1    
1939 C C2    . DT  B 20  ? 1.0478 0.3741 0.3459 -0.0072 -0.2499 0.0265  20  DT  C C2    
1940 O O2    . DT  B 20  ? 1.0744 0.3847 0.3564 -0.0113 -0.2545 0.0264  20  DT  C O2    
1941 N N3    . DT  B 20  ? 1.0217 0.3424 0.3032 -0.0002 -0.2342 0.0242  20  DT  C N3    
1942 C C4    . DT  B 20  ? 1.0001 0.3335 0.2949 0.0048  -0.2296 0.0240  20  DT  C C4    
1943 O O4    . DT  B 20  ? 0.9856 0.3116 0.2633 0.0088  -0.2156 0.0228  20  DT  C O4    
1944 C C5    . DT  B 20  ? 1.0018 0.3585 0.3325 0.0047  -0.2422 0.0251  20  DT  C C5    
1945 C C7    . DT  B 20  ? 0.9890 0.3587 0.3355 0.0121  -0.2403 0.0237  20  DT  C C7    
1946 C C6    . DT  B 20  ? 1.0086 0.3760 0.3588 -0.0020 -0.2558 0.0274  20  DT  C C6    
1947 P P     . DG  B 21  ? 1.2292 0.5903 0.6330 -0.0430 -0.3564 0.0447  21  DG  C P     
1948 O OP1   . DG  B 21  ? 1.2470 0.6205 0.6735 -0.0587 -0.3708 0.0513  21  DG  C OP1   
1949 O OP2   . DG  B 21  ? 1.2160 0.5921 0.6395 -0.0338 -0.3617 0.0426  21  DG  C OP2   
1950 O "O5'" . DG  B 21  ? 1.2567 0.5588 0.5987 -0.0371 -0.3623 0.0407  21  DG  C "O5'" 
1951 C "C5'" . DG  B 21  ? 1.2500 0.5294 0.5609 -0.0393 -0.3533 0.0393  21  DG  C "C5'" 
1952 C "C4'" . DG  B 21  ? 1.2623 0.4942 0.5164 -0.0289 -0.3517 0.0337  21  DG  C "C4'" 
1953 O "O4'" . DG  B 21  ? 1.2264 0.4680 0.4747 -0.0195 -0.3271 0.0304  21  DG  C "O4'" 
1954 C "C3'" . DG  B 21  ? 1.2803 0.4784 0.5093 -0.0252 -0.3752 0.0330  21  DG  C "C3'" 
1955 O "O3'" . DG  B 21  ? 1.3462 0.4959 0.5203 -0.0210 -0.3805 0.0291  21  DG  C "O3'" 
1956 C "C2'" . DG  B 21  ? 1.2567 0.4629 0.4860 -0.0155 -0.3628 0.0312  21  DG  C "C2'" 
1957 C "C1'" . DG  B 21  ? 1.2308 0.4438 0.4482 -0.0115 -0.3336 0.0284  21  DG  C "C1'" 
1958 N N9    . DG  B 21  ? 1.1819 0.4135 0.4094 -0.0050 -0.3155 0.0275  21  DG  C N9    
1959 C C8    . DG  B 21  ? 1.1478 0.4053 0.4091 -0.0029 -0.3185 0.0287  21  DG  C C8    
1960 N N7    . DG  B 21  ? 1.1269 0.3914 0.3858 0.0033  -0.3014 0.0273  21  DG  C N7    
1961 C C5    . DG  B 21  ? 1.1204 0.3649 0.3436 0.0045  -0.2854 0.0255  21  DG  C C5    
1962 C C6    . DG  B 21  ? 1.1023 0.3441 0.3079 0.0090  -0.2646 0.0243  21  DG  C C6    
1963 O O6    . DG  B 21  ? 1.0995 0.3542 0.3174 0.0124  -0.2567 0.0247  21  DG  C O6    
1964 N N1    . DG  B 21  ? 1.0988 0.3219 0.2711 0.0096  -0.2531 0.0223  21  DG  C N1    
1965 C C2    . DG  B 21  ? 1.1174 0.3223 0.2719 0.0076  -0.2620 0.0207  21  DG  C C2    
1966 N N2    . DG  B 21  ? 1.1312 0.3191 0.2527 0.0111  -0.2492 0.0175  21  DG  C N2    
1967 N N3    . DG  B 21  ? 1.1392 0.3421 0.3072 0.0026  -0.2831 0.0221  21  DG  C N3    
1968 C C4    . DG  B 21  ? 1.1455 0.3711 0.3498 0.0006  -0.2932 0.0250  21  DG  C C4    
1969 P P     . DG  B 22  ? 1.3789 0.4877 0.5268 -0.0253 -0.4130 0.0296  22  DG  C P     
1970 O OP1   . DG  B 22  ? 1.3722 0.4979 0.5513 -0.0385 -0.4245 0.0342  22  DG  C OP1   
1971 O OP2   . DG  B 22  ? 1.3964 0.4910 0.5387 -0.0220 -0.4315 0.0304  22  DG  C OP2   
1972 O "O5'" . DG  B 22  ? 1.4124 0.4753 0.4976 -0.0162 -0.4059 0.0229  22  DG  C "O5'" 
1973 C "C5'" . DG  B 22  ? 1.4019 0.4730 0.4806 -0.0132 -0.3823 0.0195  22  DG  C "C5'" 
1974 C "C4'" . DG  B 22  ? 1.4355 0.4800 0.4640 -0.0001 -0.3650 0.0131  22  DG  C "C4'" 
1975 O "O4'" . DG  B 22  ? 1.4090 0.4809 0.4530 0.0036  -0.3421 0.0143  22  DG  C "O4'" 
1976 C "C3'" . DG  B 22  ? 1.4964 0.4917 0.4722 0.0061  -0.3824 0.0102  22  DG  C "C3'" 
1977 O "O3'" . DG  B 22  ? 1.5702 0.5350 0.4960 0.0161  -0.3725 0.0028  22  DG  C "O3'" 
1978 C "C2'" . DG  B 22  ? 1.4568 0.4595 0.4334 0.0094  -0.3750 0.0127  22  DG  C "C2'" 
1979 C "C1'" . DG  B 22  ? 1.4081 0.4524 0.4149 0.0102  -0.3444 0.0134  22  DG  C "C1'" 
1980 N N9    . DG  B 22  ? 1.3479 0.4185 0.3855 0.0089  -0.3398 0.0177  22  DG  C N9    
1981 C C8    . DG  B 22  ? 1.3207 0.4097 0.3971 0.0035  -0.3574 0.0218  22  DG  C C8    
1982 N N7    . DG  B 22  ? 1.2850 0.3976 0.3846 0.0054  -0.3477 0.0238  22  DG  C N7    
1983 C C5    . DG  B 22  ? 1.2600 0.3705 0.3364 0.0103  -0.3222 0.0219  22  DG  C C5    
1984 C C6    . DG  B 22  ? 1.2235 0.3478 0.3051 0.0134  -0.3049 0.0232  22  DG  C C6    
1985 O O6    . DG  B 22  ? 1.2042 0.3481 0.3152 0.0137  -0.3077 0.0253  22  DG  C O6    
1986 N N1    . DG  B 22  ? 1.2186 0.3361 0.2714 0.0165  -0.2819 0.0213  22  DG  C N1    
1987 C C2    . DG  B 22  ? 1.2509 0.3485 0.2703 0.0189  -0.2766 0.0175  22  DG  C C2    
1988 N N2    . DG  B 22  ? 1.2713 0.3690 0.2688 0.0226  -0.2532 0.0159  22  DG  C N2    
1989 N N3    . DG  B 22  ? 1.2783 0.3594 0.2894 0.0179  -0.2934 0.0152  22  DG  C N3    
1990 C C4    . DG  B 22  ? 1.2943 0.3819 0.3346 0.0126  -0.3162 0.0181  22  DG  C C4    
1991 P P     . DA  B 23  ? 1.6371 0.5475 0.4963 0.0254  -0.3846 -0.0023 23  DA  C P     
1992 O OP1   . DA  B 23  ? 1.6823 0.5656 0.5056 0.0330  -0.3847 -0.0103 23  DA  C OP1   
1993 O OP2   . DA  B 23  ? 1.6406 0.5315 0.5001 0.0196  -0.4151 0.0020  23  DA  C OP2   
1994 O "O5'" . DA  B 23  ? 1.6200 0.5374 0.4594 0.0329  -0.3573 -0.0027 23  DA  C "O5'" 
1995 C "C5'" . DA  B 23  ? 1.5965 0.5345 0.4348 0.0390  -0.3265 -0.0064 23  DA  C "C5'" 
1996 C "C4'" . DA  B 23  ? 1.5810 0.5231 0.3994 0.0432  -0.3042 -0.0049 23  DA  C "C4'" 
1997 O "O4'" . DA  B 23  ? 1.5314 0.5028 0.3904 0.0356  -0.3015 0.0026  23  DA  C "O4'" 
1998 C "C3'" . DA  B 23  ? 1.6169 0.5151 0.3744 0.0494  -0.3110 -0.0066 23  DA  C "C3'" 
1999 O "O3'" . DA  B 23  ? 1.6556 0.5572 0.3840 0.0569  -0.2824 -0.0096 23  DA  C "O3'" 
2000 C "C2'" . DA  B 23  ? 1.5867 0.4846 0.3569 0.0423  -0.3235 0.0014  23  DA  C "C2'" 
2001 C "C1'" . DA  B 23  ? 1.5224 0.4710 0.3508 0.0364  -0.3060 0.0059  23  DA  C "C1'" 
2002 N N9    . DA  B 23  ? 1.4647 0.4275 0.3314 0.0295  -0.3222 0.0120  23  DA  C N9    
2003 C C8    . DA  B 23  ? 1.4512 0.4114 0.3415 0.0247  -0.3498 0.0133  23  DA  C C8    
2004 N N7    . DA  B 23  ? 1.4050 0.3869 0.3336 0.0205  -0.3574 0.0180  23  DA  C N7    
2005 C C5    . DA  B 23  ? 1.3781 0.3748 0.3068 0.0224  -0.3343 0.0200  23  DA  C C5    
2006 C C6    . DA  B 23  ? 1.3269 0.3463 0.2855 0.0209  -0.3304 0.0241  23  DA  C C6    
2007 N N6    . DA  B 23  ? 1.2862 0.3209 0.2835 0.0188  -0.3492 0.0261  23  DA  C N6    
2008 N N1    . DA  B 23  ? 1.3112 0.3371 0.2586 0.0221  -0.3071 0.0257  23  DA  C N1    
2009 C C2    . DA  B 23  ? 1.3385 0.3549 0.2518 0.0244  -0.2870 0.0235  23  DA  C C2    
2010 N N3    . DA  B 23  ? 1.3874 0.3847 0.2708 0.0278  -0.2872 0.0187  23  DA  C N3    
2011 C C4    . DA  B 23  ? 1.4057 0.3926 0.2983 0.0267  -0.3121 0.0170  23  DA  C C4    
2012 P P     . DC  B 24  ? 1.7436 0.6031 0.4001 0.0661  -0.2795 -0.0135 24  DC  C P     
2013 O OP1   . DC  B 24  ? 1.7637 0.6370 0.4048 0.0758  -0.2510 -0.0202 24  DC  C OP1   
2014 O OP2   . DC  B 24  ? 1.7581 0.5716 0.3816 0.0682  -0.3117 -0.0164 24  DC  C OP2   
2015 O "O5'" . DC  B 24  ? 1.7392 0.6001 0.3890 0.0596  -0.2730 -0.0043 24  DC  C "O5'" 
2016 C "C5'" . DC  B 24  ? 1.7134 0.6146 0.4003 0.0537  -0.2507 0.0015  24  DC  C "C5'" 
2017 C "C4'" . DC  B 24  ? 1.7102 0.6036 0.3966 0.0459  -0.2591 0.0106  24  DC  C "C4'" 
2018 O "O4'" . DC  B 24  ? 1.6724 0.5746 0.4028 0.0403  -0.2828 0.0134  24  DC  C "O4'" 
2019 C "C3'" . DC  B 24  ? 1.7606 0.6051 0.3841 0.0478  -0.2719 0.0123  24  DC  C "C3'" 
2020 O "O3'" . DC  B 24  ? 1.7954 0.6417 0.3950 0.0447  -0.2507 0.0183  24  DC  C "O3'" 
2021 C "C2'" . DC  B 24  ? 1.7357 0.5649 0.3767 0.0425  -0.3046 0.0167  24  DC  C "C2'" 
2022 C "C1'" . DC  B 24  ? 1.6613 0.5384 0.3733 0.0370  -0.2997 0.0191  24  DC  C "C1'" 
2023 N N1    . DC  B 24  ? 1.5936 0.4751 0.3456 0.0333  -0.3286 0.0206  24  DC  C N1    
2024 C C2    . DC  B 24  ? 1.5327 0.4362 0.3236 0.0287  -0.3320 0.0261  24  DC  C C2    
2025 O O2    . DC  B 24  ? 1.5193 0.4354 0.3104 0.0268  -0.3124 0.0300  24  DC  C O2    
2026 N N3    . DC  B 24  ? 1.4976 0.4080 0.3252 0.0266  -0.3573 0.0269  24  DC  C N3    
2027 C C4    . DC  B 24  ? 1.5053 0.4014 0.3324 0.0268  -0.3796 0.0238  24  DC  C C4    
2028 N N4    . DC  B 24  ? 1.4631 0.3727 0.3319 0.0237  -0.4029 0.0253  24  DC  C N4    
2029 C C5    . DC  B 24  ? 1.5538 0.4226 0.3388 0.0304  -0.3789 0.0186  24  DC  C C5    
2030 C C6    . DC  B 24  ? 1.5893 0.4525 0.3384 0.0346  -0.3526 0.0165  24  DC  C C6    
2031 P P     . DA  B 25  ? 1.8638 0.6701 0.3873 0.0486  -0.2443 0.0187  25  DA  C P     
2032 O OP1   . DA  B 25  ? 1.8815 0.7082 0.3921 0.0552  -0.2128 0.0133  25  DA  C OP1   
2033 O OP2   . DA  B 25  ? 1.8876 0.6459 0.3730 0.0528  -0.2752 0.0154  25  DA  C OP2   
2034 O "O5'" . DA  B 25  ? 1.8492 0.6535 0.3665 0.0379  -0.2396 0.0307  25  DA  C "O5'" 
2035 C "C5'" . DA  B 25  ? 1.7921 0.6371 0.3610 0.0303  -0.2256 0.0363  25  DA  C "C5'" 
2036 C "C4'" . DA  B 25  ? 1.7669 0.5985 0.3436 0.0220  -0.2440 0.0453  25  DA  C "C4'" 
2037 O "O4'" . DA  B 25  ? 1.7300 0.5619 0.3449 0.0238  -0.2726 0.0424  25  DA  C "O4'" 
2038 C "C3'" . DA  B 25  ? 1.8106 0.5939 0.3234 0.0190  -0.2544 0.0517  25  DA  C "C3'" 
2039 O "O3'" . DA  B 25  ? 1.8326 0.6217 0.3465 0.0088  -0.2442 0.0621  25  DA  C "O3'" 
2040 C "C2'" . DA  B 25  ? 1.8015 0.5541 0.3156 0.0216  -0.2929 0.0500  25  DA  C "C2'" 
2041 C "C1'" . DA  B 25  ? 1.7523 0.5454 0.3411 0.0218  -0.2996 0.0471  25  DA  C "C1'" 
2042 N N9    . DA  B 25  ? 1.7314 0.5149 0.3386 0.0264  -0.3289 0.0414  25  DA  C N9    
2043 C C8    . DA  B 25  ? 1.7542 0.5190 0.3387 0.0324  -0.3380 0.0342  25  DA  C C8    
2044 N N7    . DA  B 25  ? 1.7340 0.5001 0.3501 0.0335  -0.3640 0.0311  25  DA  C N7    
2045 C C5    . DA  B 25  ? 1.6790 0.4675 0.3415 0.0292  -0.3719 0.0358  25  DA  C C5    
2046 C C6    . DA  B 25  ? 1.6183 0.4220 0.3306 0.0284  -0.3966 0.0355  25  DA  C C6    
2047 N N6    . DA  B 25  ? 1.6166 0.4139 0.3404 0.0296  -0.4192 0.0314  25  DA  C N6    
2048 N N1    . DA  B 25  ? 1.5763 0.4017 0.3255 0.0263  -0.3978 0.0396  25  DA  C N1    
2049 C C2    . DA  B 25  ? 1.5927 0.4212 0.3290 0.0239  -0.3774 0.0444  25  DA  C C2    
2050 N N3    . DA  B 25  ? 1.6344 0.4526 0.3286 0.0220  -0.3527 0.0464  25  DA  C N3    
2051 C C4    . DA  B 25  ? 1.6764 0.4754 0.3345 0.0254  -0.3506 0.0417  25  DA  C C4    
2052 P P     . DG  B 26  ? 1.8814 0.6271 0.3309 0.0013  -0.2472 0.0725  26  DG  C P     
2053 O OP1   . DG  B 26  ? 1.8947 0.6645 0.3468 -0.0091 -0.2184 0.0812  26  DG  C OP1   
2054 O OP2   . DG  B 26  ? 1.9223 0.6285 0.3097 0.0077  -0.2536 0.0684  26  DG  C OP2   
2055 O "O5'" . DG  B 26  ? 1.8547 0.5787 0.3214 -0.0013 -0.2816 0.0766  26  DG  C "O5'" 
2056 C "C5'" . DG  B 26  ? 1.7852 0.5426 0.3149 -0.0037 -0.2843 0.0778  26  DG  C "C5'" 
2057 C "C4'" . DG  B 26  ? 1.7773 0.5094 0.3158 -0.0030 -0.3190 0.0802  26  DG  C "C4'" 
2058 O "O4'" . DG  B 26  ? 1.7468 0.4811 0.3127 0.0060  -0.3422 0.0713  26  DG  C "O4'" 
2059 C "C3'" . DG  B 26  ? 1.8261 0.5021 0.3005 -0.0077 -0.3365 0.0884  26  DG  C "C3'" 
2060 O "O3'" . DG  B 26  ? 1.8355 0.5037 0.3261 -0.0117 -0.3523 0.0946  26  DG  C "O3'" 
2061 C "C2'" . DG  B 26  ? 1.8252 0.4705 0.2811 0.0009  -0.3652 0.0817  26  DG  C "C2'" 
2062 C "C1'" . DG  B 26  ? 1.7809 0.4674 0.3096 0.0079  -0.3736 0.0728  26  DG  C "C1'" 
2063 N N9    . DG  B 26  ? 1.7741 0.4541 0.3026 0.0152  -0.3878 0.0643  26  DG  C N9    
2064 C C8    . DG  B 26  ? 1.7996 0.4707 0.2930 0.0183  -0.3749 0.0595  26  DG  C C8    
2065 N N7    . DG  B 26  ? 1.7918 0.4599 0.2979 0.0243  -0.3930 0.0520  26  DG  C N7    
2066 C C5    . DG  B 26  ? 1.7488 0.4320 0.3076 0.0244  -0.4166 0.0520  26  DG  C C5    
2067 C C6    . DG  B 26  ? 1.7219 0.4103 0.3159 0.0280  -0.4439 0.0467  26  DG  C C6    
2068 O O6    . DG  B 26  ? 1.7218 0.4029 0.3096 0.0309  -0.4522 0.0409  26  DG  C O6    
2069 N N1    . DG  B 26  ? 1.6821 0.3885 0.3251 0.0279  -0.4619 0.0486  26  DG  C N1    
2070 C C2    . DG  B 26  ? 1.6916 0.4056 0.3454 0.0258  -0.4560 0.0540  26  DG  C C2    
2071 N N2    . DG  B 26  ? 1.6897 0.4199 0.3909 0.0286  -0.4768 0.0535  26  DG  C N2    
2072 N N3    . DG  B 26  ? 1.7113 0.4143 0.3284 0.0213  -0.4336 0.0597  26  DG  C N3    
2073 C C4    . DG  B 26  ? 1.7388 0.4303 0.3124 0.0202  -0.4133 0.0587  26  DG  C C4    
2074 P P     . DC  B 27  ? 1.9036 0.5190 0.3336 -0.0207 -0.3653 0.1067  27  DC  C P     
2075 O OP1   . DC  B 27  ? 1.9134 0.5434 0.3688 -0.0283 -0.3590 0.1139  27  DC  C OP1   
2076 O OP2   . DC  B 27  ? 1.9348 0.5228 0.2960 -0.0256 -0.3498 0.1110  27  DC  C OP2   
2077 O "O5'" . DC  B 27  ? 1.9372 0.5173 0.3653 -0.0124 -0.4085 0.1032  27  DC  C "O5'" 
2078 C "C5'" . DC  B 27  ? 1.9199 0.5295 0.4156 -0.0034 -0.4261 0.0954  27  DC  C "C5'" 
2079 C "C4'" . DC  B 27  ? 1.9371 0.5230 0.4328 0.0056  -0.4618 0.0894  27  DC  C "C4'" 
2080 O "O4'" . DC  B 27  ? 1.9000 0.4982 0.3988 0.0101  -0.4563 0.0816  27  DC  C "O4'" 
2081 C "C3'" . DC  B 27  ? 2.0142 0.5359 0.4447 0.0037  -0.4887 0.0956  27  DC  C "C3'" 
2082 O "O3'" . DC  B 27  ? 2.0742 0.5845 0.5298 0.0089  -0.5211 0.0954  27  DC  C "O3'" 
2083 C "C2'" . DC  B 27  ? 1.9941 0.4965 0.3988 0.0090  -0.5003 0.0893  27  DC  C "C2'" 
2084 C "C1'" . DC  B 27  ? 1.9354 0.4938 0.4079 0.0148  -0.4896 0.0795  27  DC  C "C1'" 
2085 N N1    . DC  B 27  ? 1.9157 0.4711 0.3693 0.0179  -0.4845 0.0729  27  DC  C N1    
2086 C C2    . DC  B 27  ? 1.8877 0.4549 0.3790 0.0244  -0.5069 0.0650  27  DC  C C2    
2087 O O2    . DC  B 27  ? 1.8856 0.4672 0.4251 0.0277  -0.5300 0.0635  27  DC  C O2    
2088 N N3    . DC  B 27  ? 1.8634 0.4260 0.3369 0.0268  -0.5028 0.0591  27  DC  C N3    
2089 C C4    . DC  B 27  ? 1.8889 0.4374 0.3102 0.0254  -0.4773 0.0596  27  DC  C C4    
2090 N N4    . DC  B 27  ? 1.9106 0.4512 0.3133 0.0298  -0.4764 0.0525  27  DC  C N4    
2091 C C5    . DC  B 27  ? 1.9137 0.4554 0.2993 0.0192  -0.4522 0.0675  27  DC  C C5    
2092 C C6    . DC  B 27  ? 1.9264 0.4717 0.3301 0.0145  -0.4569 0.0745  27  DC  C C6    
2093 P P     . DT  B 28  ? 2.1585 0.6075 0.5576 0.0046  -0.5461 0.1051  28  DT  C P     
2094 O OP1   . DT  B 28  ? 2.1635 0.6269 0.5989 0.0048  -0.5494 0.1077  28  DT  C OP1   
2095 O OP2   . DT  B 28  ? 2.2040 0.6144 0.5241 -0.0062 -0.5295 0.1140  28  DT  C OP2   
2096 O "O5'" . DT  B 28  ? 2.1774 0.5968 0.5760 0.0148  -0.5897 0.0994  28  DT  C "O5'" 
2097 C "C5'" . DT  B 28  ? 2.1741 0.5782 0.5471 0.0170  -0.5959 0.0951  28  DT  C "C5'" 
2098 C "C4'" . DT  B 28  ? 2.1500 0.5701 0.5753 0.0280  -0.6270 0.0857  28  DT  C "C4'" 
2099 O "O4'" . DT  B 28  ? 2.1048 0.5592 0.5552 0.0294  -0.6111 0.0783  28  DT  C "O4'" 
2100 C "C3'" . DT  B 28  ? 2.2065 0.5683 0.5877 0.0315  -0.6684 0.0864  28  DT  C "C3'" 
2101 O "O3'" . DT  B 28  ? 2.2142 0.5893 0.6505 0.0413  -0.7029 0.0806  28  DT  C "O3'" 
2102 C "C2'" . DT  B 28  ? 2.2017 0.5513 0.5504 0.0307  -0.6636 0.0826  28  DT  C "C2'" 
2103 C "C1'" . DT  B 28  ? 2.1306 0.5452 0.5400 0.0314  -0.6340 0.0759  28  DT  C "C1'" 
2104 N N1    . DT  B 28  ? 2.1067 0.5180 0.4748 0.0278  -0.6052 0.0746  28  DT  C N1    
2105 C C2    . DT  B 28  ? 2.0553 0.4741 0.4351 0.0317  -0.6124 0.0668  28  DT  C C2    
2106 O O2    . DT  B 28  ? 2.0216 0.4552 0.4485 0.0360  -0.6385 0.0618  28  DT  C O2    
2107 N N3    . DT  B 28  ? 2.0492 0.4631 0.3888 0.0302  -0.5860 0.0648  28  DT  C N3    
2108 C C4    . DT  B 28  ? 2.0702 0.4713 0.3565 0.0255  -0.5547 0.0699  28  DT  C C4    
2109 O O4    . DT  B 28  ? 2.0640 0.4659 0.3218 0.0269  -0.5332 0.0659  28  DT  C O4    
2110 C C5    . DT  B 28  ? 2.0968 0.4901 0.3718 0.0192  -0.5490 0.0797  28  DT  C C5    
2111 C C7    . DT  B 28  ? 2.0966 0.4802 0.3190 0.0111  -0.5151 0.0876  28  DT  C C7    
2112 C C6    . DT  B 28  ? 2.1105 0.5058 0.4241 0.0207  -0.5756 0.0814  28  DT  C C6    
2113 O "O5'" . DA  C 1   ? 2.3843 0.6336 0.6029 0.0531  -0.7266 0.0188  1   DA  D "O5'" 
2114 C "C5'" . DA  C 1   ? 2.3309 0.6302 0.6273 0.0486  -0.7293 0.0166  1   DA  D "C5'" 
2115 C "C4'" . DA  C 1   ? 2.2797 0.6165 0.6518 0.0425  -0.7488 0.0223  1   DA  D "C4'" 
2116 O "O4'" . DA  C 1   ? 2.2542 0.6068 0.6310 0.0429  -0.7295 0.0279  1   DA  D "O4'" 
2117 C "C3'" . DA  C 1   ? 2.2393 0.6423 0.7011 0.0365  -0.7424 0.0221  1   DA  D "C3'" 
2118 O "O3'" . DA  C 1   ? 2.2394 0.6593 0.7575 0.0322  -0.7765 0.0255  1   DA  D "O3'" 
2119 C "C2'" . DA  C 1   ? 2.1881 0.6388 0.6764 0.0370  -0.6982 0.0243  1   DA  D "C2'" 
2120 C "C1'" . DA  C 1   ? 2.1810 0.6004 0.6256 0.0401  -0.6988 0.0290  1   DA  D "C1'" 
2121 N N9    . DA  C 1   ? 2.1404 0.5622 0.5489 0.0420  -0.6586 0.0305  1   DA  D N9    
2122 C C8    . DA  C 1   ? 2.1345 0.5520 0.5048 0.0450  -0.6291 0.0263  1   DA  D C8    
2123 N N7    . DA  C 1   ? 2.1218 0.5436 0.4650 0.0454  -0.5969 0.0297  1   DA  D N7    
2124 C C5    . DA  C 1   ? 2.0993 0.5228 0.4592 0.0421  -0.6075 0.0367  1   DA  D C5    
2125 C C6    . DA  C 1   ? 2.0704 0.4946 0.4142 0.0395  -0.5886 0.0438  1   DA  D C6    
2126 N N6    . DA  C 1   ? 2.0720 0.4970 0.3776 0.0387  -0.5529 0.0457  1   DA  D N6    
2127 N N1    . DA  C 1   ? 2.0566 0.4785 0.4232 0.0377  -0.6096 0.0491  1   DA  D N1    
2128 C C2    . DA  C 1   ? 2.0559 0.4781 0.4606 0.0393  -0.6462 0.0471  1   DA  D C2    
2129 N N3    . DA  C 1   ? 2.0658 0.4896 0.4903 0.0404  -0.6665 0.0414  1   DA  D N3    
2130 C C4    . DA  C 1   ? 2.1033 0.5255 0.5017 0.0414  -0.6459 0.0366  1   DA  D C4    
2131 P P     . DG  C 2   ? 2.1929 0.6814 0.8094 0.0245  -0.7790 0.0268  2   DG  D P     
2132 O OP1   . DG  C 2   ? 2.2032 0.6835 0.8484 0.0209  -0.8248 0.0286  2   DG  D OP1   
2133 O OP2   . DG  C 2   ? 2.1975 0.7048 0.8208 0.0213  -0.7571 0.0234  2   DG  D OP2   
2134 O "O5'" . DG  C 2   ? 2.1255 0.6664 0.7903 0.0263  -0.7514 0.0301  2   DG  D "O5'" 
2135 C "C5'" . DG  C 2   ? 2.0897 0.6234 0.7608 0.0301  -0.7688 0.0332  2   DG  D "C5'" 
2136 C "C4'" . DG  C 2   ? 2.0244 0.6014 0.7294 0.0326  -0.7378 0.0352  2   DG  D "C4'" 
2137 O "O4'" . DG  C 2   ? 2.0184 0.5736 0.6652 0.0348  -0.7050 0.0357  2   DG  D "O4'" 
2138 C "C3'" . DG  C 2   ? 1.9601 0.6103 0.7456 0.0288  -0.7162 0.0346  2   DG  D "C3'" 
2139 O "O3'" . DG  C 2   ? 1.9415 0.6284 0.7853 0.0320  -0.7257 0.0360  2   DG  D "O3'" 
2140 C "C2'" . DG  C 2   ? 1.9312 0.5930 0.6947 0.0295  -0.6713 0.0342  2   DG  D "C2'" 
2141 C "C1'" . DG  C 2   ? 1.9515 0.5600 0.6424 0.0341  -0.6705 0.0364  2   DG  D "C1'" 
2142 N N9    . DG  C 2   ? 1.9205 0.5157 0.5608 0.0345  -0.6354 0.0362  2   DG  D N9    
2143 C C8    . DG  C 2   ? 1.9214 0.5049 0.5293 0.0340  -0.6207 0.0323  2   DG  D C8    
2144 N N7    . DG  C 2   ? 1.9198 0.4951 0.4857 0.0357  -0.5891 0.0328  2   DG  D N7    
2145 C C5    . DG  C 2   ? 1.9000 0.4785 0.4680 0.0355  -0.5834 0.0383  2   DG  D C5    
2146 C C6    . DG  C 2   ? 1.8653 0.4384 0.3987 0.0349  -0.5547 0.0424  2   DG  D C6    
2147 O O6    . DG  C 2   ? 1.8650 0.4344 0.3620 0.0349  -0.5258 0.0417  2   DG  D O6    
2148 N N1    . DG  C 2   ? 1.8542 0.4320 0.4052 0.0340  -0.5609 0.0478  2   DG  D N1    
2149 C C2    . DG  C 2   ? 1.8773 0.4641 0.4728 0.0359  -0.5911 0.0479  2   DG  D C2    
2150 N N2    . DG  C 2   ? 1.9012 0.4858 0.5028 0.0367  -0.5952 0.0525  2   DG  D N2    
2151 N N3    . DG  C 2   ? 1.8767 0.4716 0.5061 0.0370  -0.6173 0.0439  2   DG  D N3    
2152 C C4    . DG  C 2   ? 1.8976 0.4862 0.5095 0.0357  -0.6124 0.0398  2   DG  D C4    
2153 P P     . DC  C 3   ? 1.8881 0.6535 0.8251 0.0292  -0.7140 0.0354  3   DC  D P     
2154 O OP1   . DC  C 3   ? 1.8772 0.6593 0.8629 0.0317  -0.7487 0.0355  3   DC  D OP1   
2155 O OP2   . DC  C 3   ? 1.8766 0.6630 0.8258 0.0210  -0.6972 0.0347  3   DC  D OP2   
2156 O "O5'" . DC  C 3   ? 1.8420 0.6325 0.7874 0.0347  -0.6804 0.0356  3   DC  D "O5'" 
2157 C "C5'" . DC  C 3   ? 1.8321 0.5912 0.7458 0.0420  -0.6879 0.0369  3   DC  D "C5'" 
2158 C "C4'" . DC  C 3   ? 1.8031 0.5701 0.7001 0.0435  -0.6513 0.0382  3   DC  D "C4'" 
2159 O "O4'" . DC  C 3   ? 1.8083 0.5432 0.6439 0.0392  -0.6304 0.0393  3   DC  D "O4'" 
2160 C "C3'" . DC  C 3   ? 1.7471 0.5807 0.7091 0.0431  -0.6233 0.0364  3   DC  D "C3'" 
2161 O "O3'" . DC  C 3   ? 1.7453 0.5960 0.7349 0.0507  -0.6247 0.0360  3   DC  D "O3'" 
2162 C "C2'" . DC  C 3   ? 1.7318 0.5624 0.6593 0.0386  -0.5859 0.0373  3   DC  D "C2'" 
2163 C "C1'" . DC  C 3   ? 1.7621 0.5266 0.6075 0.0383  -0.5930 0.0398  3   DC  D "C1'" 
2164 N N1    . DC  C 3   ? 1.7297 0.4781 0.5294 0.0342  -0.5682 0.0394  3   DC  D N1    
2165 C C2    . DC  C 3   ? 1.7190 0.4550 0.4778 0.0336  -0.5397 0.0421  3   DC  D C2    
2166 O O2    . DC  C 3   ? 1.7315 0.4670 0.4908 0.0350  -0.5361 0.0456  3   DC  D O2    
2167 N N3    . DC  C 3   ? 1.7049 0.4292 0.4244 0.0317  -0.5177 0.0408  3   DC  D N3    
2168 C C4    . DC  C 3   ? 1.7106 0.4326 0.4290 0.0310  -0.5239 0.0365  3   DC  D C4    
2169 N N4    . DC  C 3   ? 1.7244 0.4343 0.4030 0.0314  -0.5023 0.0340  3   DC  D N4    
2170 C C5    . DC  C 3   ? 1.7178 0.4491 0.4756 0.0300  -0.5539 0.0345  3   DC  D C5    
2171 C C6    . DC  C 3   ? 1.7127 0.4593 0.5116 0.0313  -0.5743 0.0363  3   DC  D C6    
2172 P P     . DT  C 4   ? 1.7074 0.6283 0.7741 0.0542  -0.6072 0.0328  4   DT  D P     
2173 O OP1   . DT  C 4   ? 1.7016 0.6271 0.7943 0.0651  -0.6290 0.0306  4   DT  D OP1   
2174 O OP2   . DT  C 4   ? 1.6710 0.6341 0.7830 0.0476  -0.6027 0.0316  4   DT  D OP2   
2175 O "O5'" . DT  C 4   ? 1.6837 0.6088 0.7284 0.0523  -0.5686 0.0343  4   DT  D "O5'" 
2176 C "C5'" . DT  C 4   ? 1.6829 0.5640 0.6723 0.0538  -0.5646 0.0377  4   DT  D "C5'" 
2177 C "C4'" . DT  C 4   ? 1.6532 0.5425 0.6238 0.0486  -0.5267 0.0397  4   DT  D "C4'" 
2178 O "O4'" . DT  C 4   ? 1.6531 0.5161 0.5763 0.0416  -0.5168 0.0414  4   DT  D "O4'" 
2179 C "C3'" . DT  C 4   ? 1.6062 0.5570 0.6364 0.0484  -0.5021 0.0364  4   DT  D "C3'" 
2180 O "O3'" . DT  C 4   ? 1.6190 0.5796 0.6517 0.0505  -0.4828 0.0373  4   DT  D "O3'" 
2181 C "C2'" . DT  C 4   ? 1.5899 0.5444 0.6044 0.0405  -0.4823 0.0367  4   DT  D "C2'" 
2182 C "C1'" . DT  C 4   ? 1.6100 0.5070 0.5499 0.0377  -0.4840 0.0404  4   DT  D "C1'" 
2183 N N1    . DT  C 4   ? 1.5657 0.4484 0.4758 0.0330  -0.4775 0.0394  4   DT  D N1    
2184 C C2    . DT  C 4   ? 1.5617 0.4275 0.4260 0.0300  -0.4522 0.0410  4   DT  D C2    
2185 O O2    . DT  C 4   ? 1.5788 0.4361 0.4208 0.0292  -0.4369 0.0446  4   DT  D O2    
2186 N N3    . DT  C 4   ? 1.5611 0.4183 0.4046 0.0282  -0.4471 0.0382  4   DT  D N3    
2187 C C4    . DT  C 4   ? 1.5478 0.4101 0.4111 0.0273  -0.4646 0.0349  4   DT  D C4    
2188 O O4    . DT  C 4   ? 1.5613 0.4093 0.3975 0.0264  -0.4593 0.0323  4   DT  D O4    
2189 C C5    . DT  C 4   ? 1.5383 0.4219 0.4530 0.0279  -0.4897 0.0348  4   DT  D C5    
2190 C C7    . DT  C 4   ? 1.5342 0.4259 0.4755 0.0246  -0.5115 0.0329  4   DT  D C7    
2191 C C6    . DT  C 4   ? 1.5393 0.4347 0.4766 0.0315  -0.4936 0.0365  4   DT  D C6    
2192 P P     . DG  C 5   ? 1.5701 0.5877 0.6687 0.0562  -0.4706 0.0329  5   DG  D P     
2193 O OP1   . DG  C 5   ? 1.5543 0.5635 0.6638 0.0664  -0.4917 0.0311  5   DG  D OP1   
2194 O OP2   . DG  C 5   ? 1.5337 0.5954 0.6799 0.0539  -0.4671 0.0297  5   DG  D OP2   
2195 O "O5'" . DG  C 5   ? 1.5280 0.5514 0.6100 0.0513  -0.4365 0.0352  5   DG  D "O5'" 
2196 C "C5'" . DG  C 5   ? 1.5086 0.4885 0.5343 0.0474  -0.4314 0.0408  5   DG  D "C5'" 
2197 C "C4'" . DG  C 5   ? 1.4560 0.4406 0.4596 0.0389  -0.3998 0.0435  5   DG  D "C4'" 
2198 O "O4'" . DG  C 5   ? 1.4572 0.4262 0.4339 0.0346  -0.4005 0.0436  5   DG  D "O4'" 
2199 C "C3'" . DG  C 5   ? 1.3765 0.4119 0.4269 0.0389  -0.3756 0.0400  5   DG  D "C3'" 
2200 O "O3'" . DG  C 5   ? 1.3245 0.3583 0.3597 0.0351  -0.3541 0.0434  5   DG  D "O3'" 
2201 C "C2'" . DG  C 5   ? 1.3883 0.4361 0.4399 0.0342  -0.3657 0.0383  5   DG  D "C2'" 
2202 C "C1'" . DG  C 5   ? 1.4402 0.4391 0.4321 0.0309  -0.3751 0.0416  5   DG  D "C1'" 
2203 N N9    . DG  C 5   ? 1.4346 0.4306 0.4250 0.0298  -0.3848 0.0390  5   DG  D N9    
2204 C C8    . DG  C 5   ? 1.4155 0.4279 0.4432 0.0319  -0.4060 0.0360  5   DG  D C8    
2205 N N7    . DG  C 5   ? 1.4013 0.4062 0.4190 0.0287  -0.4112 0.0347  5   DG  D N7    
2206 C C5    . DG  C 5   ? 1.4091 0.3923 0.3801 0.0262  -0.3914 0.0356  5   DG  D C5    
2207 C C6    . DG  C 5   ? 1.3989 0.3625 0.3370 0.0244  -0.3885 0.0337  5   DG  D C6    
2208 O O6    . DG  C 5   ? 1.4154 0.3759 0.3602 0.0232  -0.4039 0.0314  5   DG  D O6    
2209 N N1    . DG  C 5   ? 1.3870 0.3366 0.2836 0.0240  -0.3644 0.0345  5   DG  D N1    
2210 C C2    . DG  C 5   ? 1.3929 0.3458 0.2807 0.0231  -0.3464 0.0382  5   DG  D C2    
2211 N N2    . DG  C 5   ? 1.3951 0.3377 0.2448 0.0218  -0.3236 0.0392  5   DG  D N2    
2212 N N3    . DG  C 5   ? 1.4114 0.3769 0.3262 0.0236  -0.3516 0.0408  5   DG  D N3    
2213 C C4    . DG  C 5   ? 1.4223 0.4034 0.3786 0.0263  -0.3737 0.0386  5   DG  D C4    
2214 P P     . DT  C 6   ? 1.2429 0.3214 0.3153 0.0340  -0.3268 0.0410  6   DT  D P     
2215 O OP1   . DT  C 6   ? 1.2484 0.3240 0.3226 0.0355  -0.3235 0.0428  6   DT  D OP1   
2216 O OP2   . DT  C 6   ? 1.2124 0.3325 0.3355 0.0378  -0.3273 0.0351  6   DT  D OP2   
2217 O "O5'" . DT  C 6   ? 1.2119 0.2830 0.2508 0.0257  -0.3035 0.0440  6   DT  D "O5'" 
2218 C "C5'" . DT  C 6   ? 1.2386 0.2750 0.2267 0.0198  -0.2977 0.0503  6   DT  D "C5'" 
2219 C "C4'" . DT  C 6   ? 1.2481 0.2893 0.2153 0.0145  -0.2739 0.0509  6   DT  D "C4'" 
2220 O "O4'" . DT  C 6   ? 1.2718 0.3059 0.2305 0.0168  -0.2827 0.0470  6   DT  D "O4'" 
2221 C "C3'" . DT  C 6   ? 1.2080 0.2900 0.2091 0.0132  -0.2491 0.0484  6   DT  D "C3'" 
2222 O "O3'" . DT  C 6   ? 1.2067 0.2830 0.1781 0.0069  -0.2273 0.0526  6   DT  D "O3'" 
2223 C "C2'" . DT  C 6   ? 1.2032 0.3057 0.2273 0.0164  -0.2497 0.0422  6   DT  D "C2'" 
2224 C "C1'" . DT  C 6   ? 1.2363 0.3013 0.2183 0.0168  -0.2653 0.0427  6   DT  D "C1'" 
2225 N N1    . DT  C 6   ? 1.2483 0.3190 0.2505 0.0200  -0.2828 0.0381  6   DT  D N1    
2226 C C2    . DT  C 6   ? 1.2595 0.3165 0.2374 0.0199  -0.2827 0.0355  6   DT  D C2    
2227 O O2    . DT  C 6   ? 1.2527 0.2976 0.1961 0.0191  -0.2665 0.0356  6   DT  D O2    
2228 N N3    . DT  C 6   ? 1.2630 0.3229 0.2606 0.0210  -0.3025 0.0325  6   DT  D N3    
2229 C C4    . DT  C 6   ? 1.2738 0.3523 0.3138 0.0220  -0.3205 0.0322  6   DT  D C4    
2230 O O4    . DT  C 6   ? 1.2769 0.3577 0.3317 0.0212  -0.3372 0.0305  6   DT  D O4    
2231 C C5    . DT  C 6   ? 1.2831 0.3777 0.3471 0.0242  -0.3181 0.0338  6   DT  D C5    
2232 C C7    . DT  C 6   ? 1.2900 0.4103 0.4027 0.0278  -0.3347 0.0321  6   DT  D C7    
2233 C C6    . DT  C 6   ? 1.2586 0.3448 0.3001 0.0231  -0.3012 0.0366  6   DT  D C6    
2234 P P     . DC  C 7   ? 1.1925 0.3047 0.1895 0.0040  -0.2005 0.0519  7   DC  D P     
2235 O OP1   . DC  C 7   ? 1.2016 0.3010 0.1673 -0.0041 -0.1859 0.0593  7   DC  D OP1   
2236 O OP2   . DC  C 7   ? 1.1670 0.3092 0.2138 0.0081  -0.2039 0.0478  7   DC  D OP2   
2237 O "O5'" . DC  C 7   ? 1.1951 0.3195 0.1903 0.0066  -0.1892 0.0464  7   DC  D "O5'" 
2238 C "C5'" . DC  C 7   ? 1.2515 0.3512 0.1998 0.0054  -0.1839 0.0477  7   DC  D "C5'" 
2239 C "C4'" . DC  C 7   ? 1.2822 0.3906 0.2321 0.0105  -0.1792 0.0407  7   DC  D "C4'" 
2240 O "O4'" . DC  C 7   ? 1.2741 0.3790 0.2419 0.0143  -0.2017 0.0369  7   DC  D "O4'" 
2241 C "C3'" . DC  C 7   ? 1.2748 0.4208 0.2581 0.0112  -0.1591 0.0370  7   DC  D "C3'" 
2242 O "O3'" . DC  C 7   ? 1.3254 0.4694 0.2820 0.0133  -0.1424 0.0345  7   DC  D "O3'" 
2243 C "C2'" . DC  C 7   ? 1.2362 0.3984 0.2566 0.0147  -0.1719 0.0318  7   DC  D "C2'" 
2244 C "C1'" . DC  C 7   ? 1.2433 0.3743 0.2407 0.0167  -0.1957 0.0314  7   DC  D "C1'" 
2245 N N1    . DC  C 7   ? 1.2177 0.3586 0.2505 0.0176  -0.2162 0.0297  7   DC  D N1    
2246 C C2    . DC  C 7   ? 1.2077 0.3364 0.2350 0.0191  -0.2321 0.0264  7   DC  D C2    
2247 O O2    . DC  C 7   ? 1.2412 0.3515 0.2356 0.0212  -0.2281 0.0236  7   DC  D O2    
2248 N N3    . DC  C 7   ? 1.1735 0.3113 0.2320 0.0183  -0.2520 0.0262  7   DC  D N3    
2249 C C4    . DC  C 7   ? 1.1622 0.3210 0.2553 0.0182  -0.2556 0.0280  7   DC  D C4    
2250 N N4    . DC  C 7   ? 1.1477 0.3181 0.2718 0.0181  -0.2746 0.0275  7   DC  D N4    
2251 C C5    . DC  C 7   ? 1.1714 0.3389 0.2674 0.0184  -0.2409 0.0303  7   DC  D C5    
2252 C C6    . DC  C 7   ? 1.1915 0.3492 0.2572 0.0170  -0.2221 0.0317  7   DC  D C6    
2253 P P     . DC  C 8   ? 1.3342 0.5122 0.3120 0.0136  -0.1171 0.0321  8   DC  D P     
2254 O OP1   . DC  C 8   ? 1.3688 0.5379 0.3076 0.0152  -0.1007 0.0319  8   DC  D OP1   
2255 O OP2   . DC  C 8   ? 1.3100 0.5112 0.3222 0.0081  -0.1114 0.0362  8   DC  D OP2   
2256 O "O5'" . DC  C 8   ? 1.3227 0.5138 0.3252 0.0197  -0.1228 0.0242  8   DC  D "O5'" 
2257 C "C5'" . DC  C 8   ? 1.3366 0.5041 0.3129 0.0256  -0.1343 0.0190  8   DC  D "C5'" 
2258 C "C4'" . DC  C 8   ? 1.3250 0.5053 0.3323 0.0277  -0.1441 0.0141  8   DC  D "C4'" 
2259 O "O4'" . DC  C 8   ? 1.2956 0.4721 0.3226 0.0240  -0.1657 0.0167  8   DC  D "O4'" 
2260 C "C3'" . DC  C 8   ? 1.3078 0.5246 0.3553 0.0267  -0.1294 0.0128  8   DC  D "C3'" 
2261 O "O3'" . DC  C 8   ? 1.3449 0.5645 0.3975 0.0310  -0.1313 0.0067  8   DC  D "O3'" 
2262 C "C2'" . DC  C 8   ? 1.2684 0.5001 0.3529 0.0214  -0.1401 0.0165  8   DC  D "C2'" 
2263 C "C1'" . DC  C 8   ? 1.2513 0.4590 0.3240 0.0217  -0.1640 0.0163  8   DC  D "C1'" 
2264 N N1    . DC  C 8   ? 1.1911 0.4058 0.2908 0.0182  -0.1792 0.0199  8   DC  D N1    
2265 C C2    . DC  C 8   ? 1.1563 0.3659 0.2673 0.0170  -0.2002 0.0193  8   DC  D C2    
2266 O O2    . DC  C 8   ? 1.1541 0.3466 0.2468 0.0181  -0.2081 0.0165  8   DC  D O2    
2267 N N3    . DC  C 8   ? 1.1221 0.3453 0.2636 0.0151  -0.2123 0.0217  8   DC  D N3    
2268 C C4    . DC  C 8   ? 1.1144 0.3523 0.2721 0.0155  -0.2050 0.0237  8   DC  D C4    
2269 N N4    . DC  C 8   ? 1.0970 0.3475 0.2833 0.0159  -0.2180 0.0247  8   DC  D N4    
2270 C C5    . DC  C 8   ? 1.1430 0.3834 0.2887 0.0157  -0.1849 0.0247  8   DC  D C5    
2271 C C6    . DC  C 8   ? 1.1641 0.3954 0.2835 0.0164  -0.1720 0.0230  8   DC  D C6    
2272 P P     . DA  C 9   ? 1.3425 0.5657 0.3784 0.0387  -0.1140 0.0004  9   DA  D P     
2273 O OP1   . DA  C 9   ? 1.3844 0.5845 0.3746 0.0432  -0.1087 -0.0004 9   DA  D OP1   
2274 O OP2   . DA  C 9   ? 1.3126 0.5693 0.3808 0.0369  -0.0968 0.0011  9   DA  D OP2   
2275 O "O5'" . DA  C 9   ? 1.3093 0.5204 0.3446 0.0427  -0.1292 -0.0055 9   DA  D "O5'" 
2276 C "C5'" . DA  C 9   ? 1.2767 0.4531 0.2814 0.0448  -0.1492 -0.0072 9   DA  D "C5'" 
2277 C "C4'" . DA  C 9   ? 1.2296 0.4034 0.2557 0.0402  -0.1698 -0.0070 9   DA  D "C4'" 
2278 O "O4'" . DA  C 9   ? 1.1960 0.3821 0.2520 0.0309  -0.1802 -0.0001 9   DA  D "O4'" 
2279 C "C3'" . DA  C 9   ? 1.1947 0.3879 0.2469 0.0403  -0.1650 -0.0099 9   DA  D "C3'" 
2280 O "O3'" . DA  C 9   ? 1.2201 0.3891 0.2587 0.0414  -0.1841 -0.0133 9   DA  D "O3'" 
2281 C "C2'" . DA  C 9   ? 1.1319 0.3562 0.2304 0.0304  -0.1644 -0.0033 9   DA  D "C2'" 
2282 C "C1'" . DA  C 9   ? 1.1376 0.3502 0.2347 0.0252  -0.1810 0.0016  9   DA  D "C1'" 
2283 N N9    . DA  C 9   ? 1.0885 0.3267 0.2178 0.0198  -0.1767 0.0071  9   DA  D N9    
2284 C C8    . DA  C 9   ? 1.0819 0.3369 0.2183 0.0208  -0.1588 0.0085  9   DA  D C8    
2285 N N7    . DA  C 9   ? 1.0765 0.3493 0.2407 0.0166  -0.1607 0.0126  9   DA  D N7    
2286 C C5    . DA  C 9   ? 1.0598 0.3273 0.2339 0.0131  -0.1810 0.0141  9   DA  D C5    
2287 C C6    . DA  C 9   ? 1.0282 0.3108 0.2321 0.0094  -0.1924 0.0175  9   DA  D C6    
2288 N N6    . DA  C 9   ? 1.0084 0.3089 0.2316 0.0101  -0.1856 0.0193  9   DA  D N6    
2289 N N1    . DA  C 9   ? 1.0106 0.2891 0.2235 0.0053  -0.2118 0.0188  9   DA  D N1    
2290 C C2    . DA  C 9   ? 1.0292 0.2864 0.2211 0.0044  -0.2204 0.0169  9   DA  D C2    
2291 N N3    . DA  C 9   ? 1.0485 0.2870 0.2092 0.0091  -0.2121 0.0128  9   DA  D N3    
2292 C C4    . DA  C 9   ? 1.0604 0.3076 0.2153 0.0136  -0.1913 0.0114  9   DA  D C4    
2293 P P     . DT  C 10  ? 1.2071 0.3812 0.2586 0.0426  -0.1856 -0.0172 10  DT  D P     
2294 O OP1   . DT  C 10  ? 1.2324 0.3685 0.2480 0.0487  -0.2029 -0.0231 10  DT  D OP1   
2295 O OP2   . DT  C 10  ? 1.1918 0.3924 0.2572 0.0477  -0.1621 -0.0199 10  DT  D OP2   
2296 O "O5'" . DT  C 10  ? 1.1672 0.3615 0.2610 0.0284  -0.1968 -0.0092 10  DT  D "O5'" 
2297 C "C5'" . DT  C 10  ? 1.1487 0.3291 0.2442 0.0201  -0.2194 -0.0045 10  DT  D "C5'" 
2298 C "C4'" . DT  C 10  ? 1.1113 0.3243 0.2532 0.0079  -0.2213 0.0033  10  DT  D "C4'" 
2299 O "O4'" . DT  C 10  ? 1.0861 0.3236 0.2462 0.0081  -0.2073 0.0060  10  DT  D "O4'" 
2300 C "C3'" . DT  C 10  ? 1.0976 0.3318 0.2644 0.0035  -0.2141 0.0043  10  DT  D "C3'" 
2301 O "O3'" . DT  C 10  ? 1.1261 0.3500 0.2984 -0.0061 -0.2343 0.0078  10  DT  D "O3'" 
2302 C "C2'" . DT  C 10  ? 1.0422 0.3160 0.2476 -0.0014 -0.2000 0.0092  10  DT  D "C2'" 
2303 C "C1'" . DT  C 10  ? 1.0411 0.3116 0.2426 -0.0002 -0.2041 0.0109  10  DT  D "C1'" 
2304 N N1    . DT  C 10  ? 1.0074 0.3028 0.2267 0.0020  -0.1875 0.0122  10  DT  D N1    
2305 C C2    . DT  C 10  ? 0.9847 0.2995 0.2319 -0.0029 -0.1929 0.0167  10  DT  D C2    
2306 O O2    . DT  C 10  ? 0.9906 0.3059 0.2504 -0.0092 -0.2099 0.0200  10  DT  D O2    
2307 N N3    . DT  C 10  ? 0.9602 0.2922 0.2188 0.0005  -0.1792 0.0169  10  DT  D N3    
2308 C C4    . DT  C 10  ? 0.9782 0.3121 0.2260 0.0059  -0.1609 0.0143  10  DT  D C4    
2309 O O4    . DT  C 10  ? 0.9730 0.3208 0.2327 0.0073  -0.1522 0.0154  10  DT  D O4    
2310 C C5    . DT  C 10  ? 1.0055 0.3241 0.2287 0.0100  -0.1545 0.0101  10  DT  D C5    
2311 C C7    . DT  C 10  ? 1.0153 0.3390 0.2289 0.0156  -0.1347 0.0074  10  DT  D C7    
2312 C C6    . DT  C 10  ? 1.0161 0.3162 0.2260 0.0088  -0.1678 0.0087  10  DT  D C6    
2313 P P     . DC  C 11  ? 1.1343 0.3711 0.3270 -0.0142 -0.2344 0.0108  11  DC  D P     
2314 O OP1   . DC  C 11  ? 1.1766 0.3791 0.3474 -0.0180 -0.2574 0.0105  11  DC  D OP1   
2315 O OP2   . DC  C 11  ? 1.0937 0.3453 0.2892 -0.0063 -0.2130 0.0064  11  DC  D OP2   
2316 O "O5'" . DC  C 11  ? 1.1334 0.4063 0.3698 -0.0280 -0.2354 0.0202  11  DC  D "O5'" 
2317 C "C5'" . DC  C 11  ? 1.1489 0.4202 0.3943 -0.0358 -0.2531 0.0252  11  DC  D "C5'" 
2318 C "C4'" . DC  C 11  ? 1.1375 0.4517 0.4274 -0.0445 -0.2473 0.0321  11  DC  D "C4'" 
2319 O "O4'" . DC  C 11  ? 1.1207 0.4524 0.4173 -0.0350 -0.2297 0.0289  11  DC  D "O4'" 
2320 C "C3'" . DC  C 11  ? 1.1505 0.4904 0.4655 -0.0539 -0.2393 0.0369  11  DC  D "C3'" 
2321 O "O3'" . DC  C 11  ? 1.1722 0.5310 0.5157 -0.0694 -0.2523 0.0458  11  DC  D "O3'" 
2322 C "C2'" . DC  C 11  ? 1.1136 0.4839 0.4462 -0.0470 -0.2154 0.0346  11  DC  D "C2'" 
2323 C "C1'" . DC  C 11  ? 1.0737 0.4427 0.4026 -0.0382 -0.2143 0.0316  11  DC  D "C1'" 
2324 N N1    . DC  C 11  ? 1.0120 0.3865 0.3338 -0.0267 -0.1939 0.0262  11  DC  D N1    
2325 C C2    . DC  C 11  ? 0.9527 0.3520 0.2959 -0.0235 -0.1847 0.0266  11  DC  D C2    
2326 O O2    . DC  C 11  ? 0.9443 0.3616 0.3117 -0.0279 -0.1929 0.0302  11  DC  D O2    
2327 N N3    . DC  C 11  ? 0.9198 0.3200 0.2544 -0.0148 -0.1688 0.0226  11  DC  D N3    
2328 C C4    . DC  C 11  ? 0.9402 0.3246 0.2516 -0.0098 -0.1599 0.0187  11  DC  D C4    
2329 N N4    . DC  C 11  ? 0.9433 0.3315 0.2495 -0.0030 -0.1449 0.0159  11  DC  D N4    
2330 C C5    . DC  C 11  ? 0.9846 0.3469 0.2760 -0.0110 -0.1677 0.0172  11  DC  D C5    
2331 C C6    . DC  C 11  ? 1.0019 0.3585 0.2983 -0.0196 -0.1849 0.0210  11  DC  D C6    
2332 P P     . DG  C 12  ? 1.1722 0.5484 0.5346 -0.0843 -0.2514 0.0534  12  DG  D P     
2333 O OP1   . DG  C 12  ? 1.1937 0.5661 0.5662 -0.1004 -0.2743 0.0618  12  DG  D OP1   
2334 O OP2   . DG  C 12  ? 1.1790 0.5340 0.5161 -0.0784 -0.2440 0.0487  12  DG  D OP2   
2335 O "O5'" . DG  C 12  ? 1.1181 0.5442 0.5187 -0.0849 -0.2316 0.0559  12  DG  D "O5'" 
2336 C "C5'" . DG  C 12  ? 1.0767 0.5312 0.5065 -0.0864 -0.2342 0.0586  12  DG  D "C5'" 
2337 C "C4'" . DG  C 12  ? 1.0416 0.5388 0.5009 -0.0827 -0.2136 0.0582  12  DG  D "C4'" 
2338 O "O4'" . DG  C 12  ? 1.0198 0.5094 0.4644 -0.0663 -0.1994 0.0497  12  DG  D "O4'" 
2339 C "C3'" . DG  C 12  ? 1.0469 0.5652 0.5184 -0.0918 -0.2017 0.0631  12  DG  D "C3'" 
2340 O "O3'" . DG  C 12  ? 1.0589 0.6232 0.5689 -0.0978 -0.1954 0.0680  12  DG  D "O3'" 
2341 C "C2'" . DG  C 12  ? 1.0232 0.5335 0.4774 -0.0786 -0.1835 0.0555  12  DG  D "C2'" 
2342 C "C1'" . DG  C 12  ? 1.0021 0.5092 0.4528 -0.0641 -0.1805 0.0485  12  DG  D "C1'" 
2343 N N9    . DG  C 12  ? 0.9692 0.4521 0.3921 -0.0518 -0.1714 0.0411  12  DG  D N9    
2344 C C8    . DG  C 12  ? 0.9808 0.4306 0.3732 -0.0497 -0.1750 0.0382  12  DG  D C8    
2345 N N7    . DG  C 12  ? 0.9695 0.4088 0.3451 -0.0381 -0.1636 0.0318  12  DG  D N7    
2346 C C5    . DG  C 12  ? 0.9144 0.3772 0.3083 -0.0331 -0.1535 0.0308  12  DG  D C5    
2347 C C6    . DG  C 12  ? 0.8868 0.3500 0.2745 -0.0228 -0.1404 0.0258  12  DG  D C6    
2348 O O6    . DG  C 12  ? 0.9055 0.3513 0.2717 -0.0163 -0.1339 0.0216  12  DG  D O6    
2349 N N1    . DG  C 12  ? 0.8620 0.3499 0.2724 -0.0203 -0.1351 0.0261  12  DG  D N1    
2350 C C2    . DG  C 12  ? 0.8594 0.3724 0.2970 -0.0257 -0.1404 0.0299  12  DG  D C2    
2351 N N2    . DG  C 12  ? 0.8578 0.3919 0.3137 -0.0197 -0.1346 0.0280  12  DG  D N2    
2352 N N3    . DG  C 12  ? 0.8719 0.3888 0.3182 -0.0363 -0.1516 0.0351  12  DG  D N3    
2353 C C4    . DG  C 12  ? 0.9110 0.4004 0.3337 -0.0402 -0.1581 0.0357  12  DG  D C4    
2354 P P     . DC  C 13  ? 1.0789 0.6753 0.6076 -0.1088 -0.1821 0.0747  13  DC  D P     
2355 O OP1   . DC  C 13  ? 1.0753 0.7100 0.6401 -0.1216 -0.1873 0.0831  13  DC  D OP1   
2356 O OP2   . DC  C 13  ? 1.0988 0.6659 0.6007 -0.1155 -0.1841 0.0769  13  DC  D OP2   
2357 O "O5'" . DC  C 13  ? 1.0443 0.6606 0.5789 -0.0930 -0.1603 0.0668  13  DC  D "O5'" 
2358 C "C5'" . DC  C 13  ? 1.0048 0.6369 0.5543 -0.0803 -0.1578 0.0610  13  DC  D "C5'" 
2359 C "C4'" . DC  C 13  ? 0.9744 0.6172 0.5231 -0.0665 -0.1389 0.0538  13  DC  D "C4'" 
2360 O "O4'" . DC  C 13  ? 0.9687 0.5755 0.4865 -0.0565 -0.1371 0.0473  13  DC  D "O4'" 
2361 C "C3'" . DC  C 13  ? 0.9657 0.6303 0.5212 -0.0717 -0.1237 0.0566  13  DC  D "C3'" 
2362 O "O3'" . DC  C 13  ? 0.9726 0.6703 0.5493 -0.0621 -0.1113 0.0524  13  DC  D "O3'" 
2363 C "C2'" . DC  C 13  ? 0.9588 0.5910 0.4834 -0.0667 -0.1180 0.0524  13  DC  D "C2'" 
2364 C "C1'" . DC  C 13  ? 0.9406 0.5481 0.4498 -0.0535 -0.1223 0.0450  13  DC  D "C1'" 
2365 N N1    . DC  C 13  ? 0.9005 0.4697 0.3777 -0.0508 -0.1247 0.0421  13  DC  D N1    
2366 C C2    . DC  C 13  ? 0.8734 0.4288 0.3358 -0.0382 -0.1165 0.0350  13  DC  D C2    
2367 O O2    . DC  C 13  ? 0.8751 0.4467 0.3489 -0.0303 -0.1080 0.0316  13  DC  D O2    
2368 N N3    . DC  C 13  ? 0.8689 0.3947 0.3052 -0.0352 -0.1177 0.0321  13  DC  D N3    
2369 C C4    . DC  C 13  ? 0.8843 0.3908 0.3071 -0.0424 -0.1280 0.0349  13  DC  D C4    
2370 N N4    . DC  C 13  ? 0.8947 0.3732 0.2918 -0.0366 -0.1291 0.0305  13  DC  D N4    
2371 C C5    . DC  C 13  ? 0.9115 0.4266 0.3464 -0.0557 -0.1387 0.0423  13  DC  D C5    
2372 C C6    . DC  C 13  ? 0.9013 0.4492 0.3643 -0.0603 -0.1360 0.0462  13  DC  D C6    
2373 P P     . DT  C 14  ? 0.9698 0.7006 0.5595 -0.0657 -0.0945 0.0548  14  DT  D P     
2374 O OP1   . DT  C 14  ? 0.9618 0.7345 0.5833 -0.0593 -0.0897 0.0527  14  DT  D OP1   
2375 O OP2   . DT  C 14  ? 0.9729 0.6999 0.5560 -0.0840 -0.0967 0.0645  14  DT  D OP2   
2376 O "O5'" . DT  C 14  ? 0.9366 0.6484 0.5044 -0.0525 -0.0830 0.0466  14  DT  D "O5'" 
2377 C "C5'" . DT  C 14  ? 0.8926 0.6007 0.4600 -0.0359 -0.0808 0.0377  14  DT  D "C5'" 
2378 C "C4'" . DT  C 14  ? 0.8712 0.5539 0.4146 -0.0281 -0.0737 0.0323  14  DT  D "C4'" 
2379 O "O4'" . DT  C 14  ? 0.8590 0.5071 0.3794 -0.0325 -0.0813 0.0337  14  DT  D "O4'" 
2380 C "C3'" . DT  C 14  ? 0.8641 0.5571 0.4040 -0.0298 -0.0606 0.0326  14  DT  D "C3'" 
2381 O "O3'" . DT  C 14  ? 0.8843 0.5814 0.4241 -0.0158 -0.0526 0.0248  14  DT  D "O3'" 
2382 C "C2'" . DT  C 14  ? 0.8589 0.5206 0.3744 -0.0358 -0.0631 0.0346  14  DT  D "C2'" 
2383 C "C1'" . DT  C 14  ? 0.8476 0.4824 0.3515 -0.0313 -0.0732 0.0319  14  DT  D "C1'" 
2384 N N1    . DT  C 14  ? 0.8142 0.4205 0.2984 -0.0385 -0.0813 0.0348  14  DT  D N1    
2385 C C2    . DT  C 14  ? 0.7903 0.3698 0.2543 -0.0315 -0.0813 0.0300  14  DT  D C2    
2386 O O2    . DT  C 14  ? 0.7949 0.3721 0.2562 -0.0218 -0.0749 0.0247  14  DT  D O2    
2387 N N3    . DT  C 14  ? 0.7900 0.3458 0.2372 -0.0364 -0.0895 0.0317  14  DT  D N3    
2388 C C4    . DT  C 14  ? 0.8169 0.3684 0.2632 -0.0481 -0.0996 0.0379  14  DT  D C4    
2389 O O4    . DT  C 14  ? 0.8490 0.3743 0.2764 -0.0496 -0.1079 0.0377  14  DT  D O4    
2390 C C5    . DT  C 14  ? 0.8257 0.4058 0.2941 -0.0576 -0.0995 0.0443  14  DT  D C5    
2391 C C7    . DT  C 14  ? 0.8403 0.4190 0.3103 -0.0735 -0.1105 0.0532  14  DT  D C7    
2392 C C6    . DT  C 14  ? 0.8157 0.4233 0.3026 -0.0519 -0.0896 0.0422  14  DT  D C6    
2393 P P     . DC  C 15  ? 0.8991 0.6111 0.4374 -0.0130 -0.0390 0.0227  15  DC  D P     
2394 O OP1   . DC  C 15  ? 0.9145 0.6392 0.4614 0.0025  -0.0348 0.0145  15  DC  D OP1   
2395 O OP2   . DC  C 15  ? 0.9010 0.6341 0.4468 -0.0265 -0.0349 0.0306  15  DC  D OP2   
2396 O "O5'" . DC  C 15  ? 0.8841 0.5636 0.3976 -0.0128 -0.0384 0.0211  15  DC  D "O5'" 
2397 C "C5'" . DC  C 15  ? 0.8635 0.5195 0.3665 -0.0043 -0.0423 0.0159  15  DC  D "C5'" 
2398 C "C4'" . DC  C 15  ? 0.8476 0.4778 0.3316 -0.0076 -0.0429 0.0165  15  DC  D "C4'" 
2399 O "O4'" . DC  C 15  ? 0.8550 0.4741 0.3334 -0.0174 -0.0502 0.0218  15  DC  D "O4'" 
2400 C "C3'" . DC  C 15  ? 0.8450 0.4763 0.3218 -0.0090 -0.0356 0.0163  15  DC  D "C3'" 
2401 O "O3'" . DC  C 15  ? 0.8262 0.4496 0.2978 0.0009  -0.0322 0.0100  15  DC  D "O3'" 
2402 C "C2'" . DC  C 15  ? 0.8579 0.4695 0.3211 -0.0174 -0.0404 0.0202  15  DC  D "C2'" 
2403 C "C1'" . DC  C 15  ? 0.8586 0.4597 0.3215 -0.0196 -0.0494 0.0219  15  DC  D "C1'" 
2404 N N1    . DC  C 15  ? 0.8435 0.4347 0.2999 -0.0307 -0.0574 0.0279  15  DC  D N1    
2405 C C2    . DC  C 15  ? 0.8377 0.4026 0.2782 -0.0300 -0.0643 0.0265  15  DC  D C2    
2406 O O2    . DC  C 15  ? 0.8488 0.4025 0.2822 -0.0215 -0.0614 0.0212  15  DC  D O2    
2407 N N3    . DC  C 15  ? 0.8261 0.3788 0.2592 -0.0388 -0.0740 0.0312  15  DC  D N3    
2408 C C4    . DC  C 15  ? 0.8190 0.3852 0.2611 -0.0502 -0.0773 0.0383  15  DC  D C4    
2409 N N4    . DC  C 15  ? 0.8196 0.3700 0.2529 -0.0597 -0.0891 0.0433  15  DC  D N4    
2410 C C5    . DC  C 15  ? 0.8151 0.4124 0.2758 -0.0523 -0.0688 0.0406  15  DC  D C5    
2411 C C6    . DC  C 15  ? 0.8206 0.4290 0.2872 -0.0412 -0.0591 0.0345  15  DC  D C6    
2412 P P     . DA  C 16  ? 0.8105 0.4313 0.2734 0.0029  -0.0262 0.0077  16  DA  D P     
2413 O OP1   . DA  C 16  ? 0.8367 0.4553 0.2996 0.0139  -0.0245 0.0011  16  DA  D OP1   
2414 O OP2   . DA  C 16  ? 0.8073 0.4444 0.2715 -0.0039 -0.0215 0.0118  16  DA  D OP2   
2415 O "O5'" . DA  C 16  ? 0.7725 0.3704 0.2230 -0.0009 -0.0300 0.0088  16  DA  D "O5'" 
2416 C "C5'" . DA  C 16  ? 0.7658 0.3486 0.2130 0.0029  -0.0332 0.0064  16  DA  D "C5'" 
2417 C "C4'" . DA  C 16  ? 0.7448 0.3119 0.1823 0.0002  -0.0354 0.0069  16  DA  D "C4'" 
2418 O "O4'" . DA  C 16  ? 0.7463 0.3089 0.1798 -0.0068 -0.0403 0.0110  16  DA  D "O4'" 
2419 C "C3'" . DA  C 16  ? 0.7229 0.2874 0.1554 0.0003  -0.0333 0.0056  16  DA  D "C3'" 
2420 O "O3'" . DA  C 16  ? 0.7359 0.2879 0.1645 0.0028  -0.0349 0.0033  16  DA  D "O3'" 
2421 C "C2'" . DA  C 16  ? 0.7186 0.2839 0.1462 -0.0078 -0.0355 0.0104  16  DA  D "C2'" 
2422 C "C1'" . DA  C 16  ? 0.7368 0.2938 0.1629 -0.0109 -0.0414 0.0125  16  DA  D "C1'" 
2423 N N9    . DA  C 16  ? 0.7487 0.3077 0.1733 -0.0202 -0.0458 0.0184  16  DA  D N9    
2424 C C8    . DA  C 16  ? 0.7492 0.3259 0.1806 -0.0264 -0.0430 0.0229  16  DA  D C8    
2425 N N7    . DA  C 16  ? 0.7622 0.3376 0.1924 -0.0364 -0.0491 0.0291  16  DA  D N7    
2426 C C5    . DA  C 16  ? 0.7721 0.3248 0.1921 -0.0351 -0.0573 0.0276  16  DA  D C5    
2427 C C6    . DA  C 16  ? 0.7860 0.3227 0.1977 -0.0419 -0.0683 0.0313  16  DA  D C6    
2428 N N6    . DA  C 16  ? 0.8028 0.3449 0.2169 -0.0542 -0.0736 0.0391  16  DA  D N6    
2429 N N1    . DA  C 16  ? 0.7826 0.2971 0.1823 -0.0358 -0.0741 0.0268  16  DA  D N1    
2430 C C2    . DA  C 16  ? 0.7804 0.2934 0.1803 -0.0248 -0.0680 0.0201  16  DA  D C2    
2431 N N3    . DA  C 16  ? 0.7872 0.3139 0.1958 -0.0197 -0.0585 0.0172  16  DA  D N3    
2432 C C4    . DA  C 16  ? 0.7623 0.3069 0.1796 -0.0246 -0.0542 0.0208  16  DA  D C4    
2433 F F24   . 1FC C 17  ? 0.8298 0.3565 0.2375 0.0053  -0.0433 -0.0029 17  1FC D F24   
2434 C "C2'" . 1FC C 17  ? 0.7437 0.2766 0.1457 0.0047  -0.0392 -0.0022 17  1FC D "C2'" 
2435 C "C3'" . 1FC C 17  ? 0.7476 0.2929 0.1521 0.0010  -0.0344 0.0014  17  1FC D "C3'" 
2436 O "O3'" . 1FC C 17  ? 0.7599 0.3107 0.1552 -0.0038 -0.0317 0.0049  17  1FC D "O3'" 
2437 C "C4'" . 1FC C 17  ? 0.7266 0.2815 0.1404 0.0069  -0.0301 -0.0017 17  1FC D "C4'" 
2438 C "C5'" . 1FC C 17  ? 0.7287 0.2890 0.1514 0.0061  -0.0296 -0.0002 17  1FC D "C5'" 
2439 O "O5'" . 1FC C 17  ? 0.7309 0.2810 0.1538 0.0046  -0.0335 0.0004  17  1FC D "O5'" 
2440 P P     . 1FC C 17  ? 0.7384 0.2870 0.1673 0.0070  -0.0335 -0.0004 17  1FC D P     
2441 O OP2   . 1FC C 17  ? 0.7743 0.3274 0.2079 0.0113  -0.0313 -0.0025 17  1FC D OP2   
2442 O OP1   . 1FC C 17  ? 0.7032 0.2430 0.1311 0.0079  -0.0356 -0.0016 17  1FC D OP1   
2443 C "C1'" . 1FC C 17  ? 0.7168 0.2533 0.1247 0.0108  -0.0369 -0.0064 17  1FC D "C1'" 
2444 O "O4'" . 1FC C 17  ? 0.7157 0.2618 0.1315 0.0116  -0.0329 -0.0057 17  1FC D "O4'" 
2445 N N1    . 1FC C 17  ? 0.7042 0.2334 0.1184 0.0135  -0.0411 -0.0092 17  1FC D N1    
2446 C C6    . 1FC C 17  ? 0.6790 0.2109 0.1035 0.0148  -0.0399 -0.0097 17  1FC D C6    
2447 C C5    . 1FC C 17  ? 0.7129 0.2409 0.1443 0.0158  -0.0431 -0.0114 17  1FC D C5    
2448 C C21   . 1FC C 17  ? 0.7228 0.2540 0.1630 0.0153  -0.0409 -0.0103 17  1FC D C21   
2449 O O23   . 1FC C 17  ? 0.6927 0.2280 0.1326 0.0149  -0.0372 -0.0086 17  1FC D O23   
2450 O O22   . 1FC C 17  ? 0.7048 0.2340 0.1519 0.0143  -0.0436 -0.0107 17  1FC D O22   
2451 C C4    . 1FC C 17  ? 0.7200 0.2406 0.1485 0.0164  -0.0490 -0.0134 17  1FC D C4    
2452 N N4    . 1FC C 17  ? 0.7560 0.2741 0.1932 0.0163  -0.0535 -0.0145 17  1FC D N4    
2453 N N3    . 1FC C 17  ? 0.7304 0.2462 0.1477 0.0161  -0.0510 -0.0133 17  1FC D N3    
2454 C C2    . 1FC C 17  ? 0.7244 0.2441 0.1334 0.0141  -0.0468 -0.0109 17  1FC D C2    
2455 O O2    . 1FC C 17  ? 0.7323 0.2475 0.1293 0.0122  -0.0482 -0.0097 17  1FC D O2    
2456 P P     . DG  C 18  ? 0.7499 0.3048 0.1436 -0.0137 -0.0325 0.0120  18  DG  D P     
2457 O OP1   . DG  C 18  ? 0.7585 0.3269 0.1465 -0.0183 -0.0262 0.0156  18  DG  D OP1   
2458 O OP2   . DG  C 18  ? 0.7262 0.2851 0.1313 -0.0135 -0.0335 0.0124  18  DG  D OP2   
2459 O "O5'" . DG  C 18  ? 0.7490 0.2828 0.1313 -0.0174 -0.0417 0.0136  18  DG  D "O5'" 
2460 C "C5'" . DG  C 18  ? 0.7661 0.2898 0.1338 -0.0193 -0.0444 0.0144  18  DG  D "C5'" 
2461 C "C4'" . DG  C 18  ? 0.7798 0.2848 0.1363 -0.0255 -0.0546 0.0183  18  DG  D "C4'" 
2462 O "O4'" . DG  C 18  ? 0.7860 0.2948 0.1416 -0.0354 -0.0552 0.0253  18  DG  D "O4'" 
2463 C "C3'" . DG  C 18  ? 0.7856 0.2760 0.1227 -0.0295 -0.0596 0.0208  18  DG  D "C3'" 
2464 O "O3'" . DG  C 18  ? 0.8035 0.2718 0.1340 -0.0289 -0.0723 0.0201  18  DG  D "O3'" 
2465 C "C2'" . DG  C 18  ? 0.7995 0.2986 0.1273 -0.0418 -0.0550 0.0297  18  DG  D "C2'" 
2466 C "C1'" . DG  C 18  ? 0.8043 0.3081 0.1433 -0.0463 -0.0570 0.0328  18  DG  D "C1'" 
2467 N N9    . DG  C 18  ? 0.8347 0.3605 0.1796 -0.0552 -0.0488 0.0393  18  DG  D N9    
2468 C C8    . DG  C 18  ? 0.8415 0.3932 0.1973 -0.0515 -0.0363 0.0374  18  DG  D C8    
2469 N N7    . DG  C 18  ? 0.8457 0.4172 0.2104 -0.0598 -0.0316 0.0435  18  DG  D N7    
2470 C C5    . DG  C 18  ? 0.8552 0.4109 0.2138 -0.0709 -0.0423 0.0504  18  DG  D C5    
2471 C C6    . DG  C 18  ? 0.8608 0.4255 0.2257 -0.0840 -0.0450 0.0591  18  DG  D C6    
2472 O O6    . DG  C 18  ? 0.8624 0.4552 0.2420 -0.0888 -0.0370 0.0629  18  DG  D O6    
2473 N N1    . DG  C 18  ? 0.8645 0.4015 0.2174 -0.0913 -0.0596 0.0632  18  DG  D N1    
2474 C C2    . DG  C 18  ? 0.8750 0.3819 0.2127 -0.0853 -0.0697 0.0588  18  DG  D C2    
2475 N N2    . DG  C 18  ? 0.8687 0.3499 0.1948 -0.0919 -0.0846 0.0626  18  DG  D N2    
2476 N N3    . DG  C 18  ? 0.8464 0.3484 0.1813 -0.0729 -0.0666 0.0506  18  DG  D N3    
2477 C C4    . DG  C 18  ? 0.8465 0.3730 0.1924 -0.0668 -0.0531 0.0471  18  DG  D C4    
2478 P P     . DT  C 19  ? 0.8209 0.2663 0.1312 -0.0305 -0.0829 0.0212  19  DT  D P     
2479 O OP1   . DT  C 19  ? 0.8331 0.2650 0.1496 -0.0212 -0.0933 0.0146  19  DT  D OP1   
2480 O OP2   . DT  C 19  ? 0.8332 0.2834 0.1333 -0.0311 -0.0767 0.0215  19  DT  D OP2   
2481 O "O5'" . DT  C 19  ? 0.8342 0.2673 0.1275 -0.0439 -0.0891 0.0307  19  DT  D "O5'" 
2482 C "C5'" . DT  C 19  ? 0.8464 0.2683 0.1414 -0.0455 -0.0979 0.0318  19  DT  D "C5'" 
2483 C "C4'" . DT  C 19  ? 0.9037 0.3175 0.1829 -0.0615 -0.1022 0.0428  19  DT  D "C4'" 
2484 O "O4'" . DT  C 19  ? 0.8954 0.3362 0.1842 -0.0691 -0.0887 0.0480  19  DT  D "O4'" 
2485 C "C3'" . DT  C 19  ? 0.9654 0.3608 0.2190 -0.0705 -0.1087 0.0493  19  DT  D "C3'" 
2486 O "O3'" . DT  C 19  ? 1.0146 0.3782 0.2538 -0.0708 -0.1269 0.0497  19  DT  D "O3'" 
2487 C "C2'" . DT  C 19  ? 0.9575 0.3682 0.2049 -0.0876 -0.1000 0.0611  19  DT  D "C2'" 
2488 C "C1'" . DT  C 19  ? 0.9212 0.3576 0.1935 -0.0859 -0.0908 0.0595  19  DT  D "C1'" 
2489 N N1    . DT  C 19  ? 0.9148 0.3843 0.1967 -0.0921 -0.0742 0.0640  19  DT  D N1    
2490 C C2    . DT  C 19  ? 0.9209 0.4041 0.2095 -0.1055 -0.0724 0.0730  19  DT  D C2    
2491 O O2    . DT  C 19  ? 0.9468 0.4118 0.2285 -0.1153 -0.0851 0.0791  19  DT  D O2    
2492 N N3    . DT  C 19  ? 0.9018 0.4201 0.2046 -0.1075 -0.0565 0.0748  19  DT  D N3    
2493 C C4    . DT  C 19  ? 0.8855 0.4235 0.1935 -0.0967 -0.0428 0.0681  19  DT  D C4    
2494 O O4    . DT  C 19  ? 0.8799 0.4495 0.2011 -0.0981 -0.0299 0.0697  19  DT  D O4    
2495 C C5    . DT  C 19  ? 0.8863 0.4052 0.1851 -0.0833 -0.0466 0.0589  19  DT  D C5    
2496 C C7    . DT  C 19  ? 0.8893 0.4225 0.1905 -0.0711 -0.0353 0.0510  19  DT  D C7    
2497 C C6    . DT  C 19  ? 0.8952 0.3828 0.1830 -0.0821 -0.0615 0.0576  19  DT  D C6    
2498 P P     . DA  C 20  ? 1.0792 0.4123 0.2867 -0.0803 -0.1403 0.0569  20  DA  D P     
2499 O OP1   . DA  C 20  ? 1.1277 0.4310 0.3297 -0.0698 -0.1593 0.0501  20  DA  D OP1   
2500 O OP2   . DA  C 20  ? 1.0659 0.4087 0.2644 -0.0820 -0.1303 0.0583  20  DA  D OP2   
2501 O "O5'" . DA  C 20  ? 1.1018 0.4310 0.2965 -0.1009 -0.1426 0.0708  20  DA  D "O5'" 
2502 C "C5'" . DA  C 20  ? 1.1352 0.4544 0.3341 -0.1036 -0.1522 0.0721  20  DA  D "C5'" 
2503 C "C4'" . DA  C 20  ? 1.1685 0.4862 0.3548 -0.1266 -0.1539 0.0874  20  DA  D "C4'" 
2504 O "O4'" . DA  C 20  ? 1.1467 0.5051 0.3511 -0.1334 -0.1334 0.0918  20  DA  D "O4'" 
2505 C "C3'" . DA  C 20  ? 1.2163 0.5096 0.3705 -0.1420 -0.1629 0.0987  20  DA  D "C3'" 
2506 O "O3'" . DA  C 20  ? 1.2820 0.5524 0.4221 -0.1582 -0.1781 0.1092  20  DA  D "O3'" 
2507 C "C2'" . DA  C 20  ? 1.1805 0.5078 0.3369 -0.1518 -0.1415 0.1056  20  DA  D "C2'" 
2508 C "C1'" . DA  C 20  ? 1.1455 0.5106 0.3335 -0.1506 -0.1270 0.1040  20  DA  D "C1'" 
2509 N N9    . DA  C 20  ? 1.0866 0.4911 0.2904 -0.1456 -0.1044 0.1009  20  DA  D N9    
2510 C C8    . DA  C 20  ? 1.0718 0.4820 0.2749 -0.1314 -0.0962 0.0917  20  DA  D C8    
2511 N N7    . DA  C 20  ? 1.0508 0.4963 0.2678 -0.1287 -0.0771 0.0902  20  DA  D N7    
2512 C C5    . DA  C 20  ? 1.0310 0.4986 0.2611 -0.1420 -0.0717 0.0989  20  DA  D C5    
2513 C C6    . DA  C 20  ? 1.0031 0.5130 0.2542 -0.1446 -0.0539 0.1009  20  DA  D C6    
2514 N N6    . DA  C 20  ? 0.9991 0.5344 0.2581 -0.1327 -0.0378 0.0935  20  DA  D N6    
2515 N N1    . DA  C 20  ? 0.9909 0.5151 0.2520 -0.1609 -0.0544 0.1116  20  DA  D N1    
2516 C C2    . DA  C 20  ? 1.0120 0.5068 0.2621 -0.1731 -0.0725 0.1191  20  DA  D C2    
2517 N N3    . DA  C 20  ? 1.0376 0.4897 0.2676 -0.1697 -0.0908 0.1165  20  DA  D N3    
2518 C C4    . DA  C 20  ? 1.0488 0.4910 0.2704 -0.1538 -0.0887 0.1064  20  DA  D C4    
2519 P P     . DC  C 21  ? 1.3447 0.5766 0.4467 -0.1767 -0.1956 0.1225  21  DC  D P     
2520 O OP1   . DC  C 21  ? 1.3906 0.5861 0.4820 -0.1799 -0.2194 0.1242  21  DC  D OP1   
2521 O OP2   . DC  C 21  ? 1.3372 0.5547 0.4220 -0.1679 -0.1973 0.1179  21  DC  D OP2   
2522 O "O5'" . DC  C 21  ? 1.3427 0.6041 0.4440 -0.2015 -0.1797 0.1392  21  DC  D "O5'" 
2523 C "C5'" . DC  C 21  ? 1.3386 0.6240 0.4606 -0.2126 -0.1743 0.1453  21  DC  D "C5'" 
2524 C "C4'" . DC  C 21  ? 1.3442 0.6682 0.4711 -0.2319 -0.1544 0.1586  21  DC  D "C4'" 
2525 O "O4'" . DC  C 21  ? 1.3041 0.6700 0.4540 -0.2167 -0.1303 0.1488  21  DC  D "O4'" 
2526 C "C3'" . DC  C 21  ? 1.3972 0.7055 0.4896 -0.2511 -0.1562 0.1728  21  DC  D "C3'" 
2527 O "O3'" . DC  C 21  ? 1.4525 0.7737 0.5432 -0.2789 -0.1546 0.1910  21  DC  D "O3'" 
2528 C "C2'" . DC  C 21  ? 1.3579 0.6984 0.4546 -0.2407 -0.1324 0.1668  21  DC  D "C2'" 
2529 C "C1'" . DC  C 21  ? 1.2930 0.6789 0.4307 -0.2291 -0.1152 0.1581  21  DC  D "C1'" 
2530 N N1    . DC  C 21  ? 1.2300 0.6452 0.3806 -0.2099 -0.0951 0.1458  21  DC  D N1    
2531 C C2    . DC  C 21  ? 1.1814 0.6468 0.3579 -0.2098 -0.0727 0.1458  21  DC  D C2    
2532 O O2    . DC  C 21  ? 1.1643 0.6516 0.3564 -0.2252 -0.0699 0.1556  21  DC  D O2    
2533 N N3    . DC  C 21  ? 1.1398 0.6275 0.3246 -0.1918 -0.0565 0.1343  21  DC  D N3    
2534 C C4    . DC  C 21  ? 1.1332 0.5956 0.3019 -0.1766 -0.0619 0.1243  21  DC  D C4    
2535 N N4    . DC  C 21  ? 1.0966 0.5790 0.2729 -0.1601 -0.0477 0.1135  21  DC  D N4    
2536 C C5    . DC  C 21  ? 1.1799 0.5947 0.3251 -0.1771 -0.0840 0.1246  21  DC  D C5    
2537 C C6    . DC  C 21  ? 1.2176 0.6100 0.3536 -0.1933 -0.0997 0.1351  21  DC  D C6    
2538 P P     . DA  C 22  ? 1.5174 0.8019 0.5677 -0.3064 -0.1706 0.2103  22  DA  D P     
2539 O OP1   . DA  C 22  ? 1.5534 0.7942 0.5946 -0.3123 -0.1996 0.2131  22  DA  D OP1   
2540 O OP2   . DA  C 22  ? 1.5264 0.7915 0.5460 -0.3009 -0.1693 0.2084  22  DA  D OP2   
2541 O "O5'" . DA  C 22  ? 1.5033 0.8354 0.5659 -0.3328 -0.1507 0.2278  22  DA  D "O5'" 
2542 C "C5'" . DA  C 22  ? 1.4745 0.8418 0.5738 -0.3382 -0.1449 0.2298  22  DA  D "C5'" 
2543 C "C4'" . DA  C 22  ? 1.4412 0.8734 0.5658 -0.3437 -0.1141 0.2342  22  DA  D "C4'" 
2544 O "O4'" . DA  C 22  ? 1.4135 0.8677 0.5488 -0.3162 -0.0955 0.2166  22  DA  D "O4'" 
2545 C "C3'" . DA  C 22  ? 1.4579 0.9048 0.5610 -0.3714 -0.1031 0.2540  22  DA  D "C3'" 
2546 O "O3'" . DA  C 22  ? 1.4696 0.9721 0.6048 -0.3873 -0.0862 0.2641  22  DA  D "O3'" 
2547 C "C2'" . DA  C 22  ? 1.4311 0.8878 0.5194 -0.3539 -0.0847 0.2441  22  DA  D "C2'" 
2548 C "C1'" . DA  C 22  ? 1.3817 0.8645 0.5058 -0.3230 -0.0739 0.2228  22  DA  D "C1'" 
2549 N N9    . DA  C 22  ? 1.3392 0.8122 0.4516 -0.2976 -0.0677 0.2067  22  DA  D N9    
2550 C C8    . DA  C 22  ? 1.3497 0.7722 0.4345 -0.2863 -0.0856 0.1994  22  DA  D C8    
2551 N N7    . DA  C 22  ? 1.3214 0.7479 0.4069 -0.2626 -0.0767 0.1841  22  DA  D N7    
2552 C C5    . DA  C 22  ? 1.2692 0.7496 0.3822 -0.2572 -0.0516 0.1806  22  DA  D C5    
2553 C C6    . DA  C 22  ? 1.2218 0.7290 0.3466 -0.2352 -0.0335 0.1663  22  DA  D C6    
2554 N N6    . DA  C 22  ? 1.2231 0.7057 0.3332 -0.2159 -0.0381 0.1535  22  DA  D N6    
2555 N N1    . DA  C 22  ? 1.1861 0.7460 0.3369 -0.2344 -0.0113 0.1661  22  DA  D N1    
2556 C C2    . DA  C 22  ? 1.1826 0.7700 0.3511 -0.2544 -0.0072 0.1793  22  DA  D C2    
2557 N N3    . DA  C 22  ? 1.2179 0.7851 0.3799 -0.2773 -0.0233 0.1939  22  DA  D N3    
2558 C C4    . DA  C 22  ? 1.2737 0.7850 0.4053 -0.2775 -0.0455 0.1938  22  DA  D C4    
2559 P P     . DG  C 23  ? 1.5128 1.0315 0.6362 -0.4265 -0.0824 0.2907  23  DG  D P     
2560 O OP1   . DG  C 23  ? 1.4947 1.0471 0.6569 -0.4409 -0.0836 0.2986  23  DG  D OP1   
2561 O OP2   . DG  C 23  ? 1.5482 1.0053 0.6223 -0.4434 -0.1053 0.3026  23  DG  D OP2   
2562 O "O5'" . DG  C 23  ? 1.4924 1.0632 0.6166 -0.4233 -0.0482 0.2907  23  DG  D "O5'" 
2563 C "C5'" . DG  C 23  ? 1.4485 1.0818 0.6151 -0.4062 -0.0229 0.2795  23  DG  D "C5'" 
2564 C "C4'" . DG  C 23  ? 1.4334 1.0934 0.5877 -0.3916 0.0035  0.2719  23  DG  D "C4'" 
2565 O "O4'" . DG  C 23  ? 1.4281 1.0505 0.5653 -0.3620 -0.0036 0.2523  23  DG  D "O4'" 
2566 C "C3'" . DG  C 23  ? 1.4583 1.1162 0.5726 -0.4155 0.0127  0.2898  23  DG  D "C3'" 
2567 O "O3'" . DG  C 23  ? 1.4659 1.1845 0.5928 -0.4098 0.0455  0.2876  23  DG  D "O3'" 
2568 C "C2'" . DG  C 23  ? 1.4678 1.0654 0.5382 -0.4002 -0.0012 0.2802  23  DG  D "C2'" 
2569 C "C1'" . DG  C 23  ? 1.4208 1.0314 0.5187 -0.3632 0.0054  0.2550  23  DG  D "C1'" 
2570 N N9    . DG  C 23  ? 1.3903 0.9511 0.4640 -0.3404 -0.0089 0.2398  23  DG  D N9    
2571 C C8    . DG  C 23  ? 1.4111 0.9090 0.4530 -0.3445 -0.0361 0.2422  23  DG  D C8    
2572 N N7    . DG  C 23  ? 1.4088 0.8777 0.4368 -0.3204 -0.0425 0.2263  23  DG  D N7    
2573 C C5    . DG  C 23  ? 1.3605 0.8729 0.4093 -0.3004 -0.0183 0.2133  23  DG  D C5    
2574 C C6    . DG  C 23  ? 1.3266 0.8328 0.3725 -0.2721 -0.0140 0.1945  23  DG  D C6    
2575 O O6    . DG  C 23  ? 1.3396 0.8026 0.3670 -0.2588 -0.0306 0.1854  23  DG  D O6    
2576 N N1    . DG  C 23  ? 1.2852 0.8423 0.3535 -0.2589 0.0117  0.1860  23  DG  D N1    
2577 C C2    . DG  C 23  ? 1.2638 0.8747 0.3572 -0.2702 0.0315  0.1940  23  DG  D C2    
2578 N N2    . DG  C 23  ? 1.2348 0.8891 0.3476 -0.2522 0.0536  0.1826  23  DG  D N2    
2579 N N3    . DG  C 23  ? 1.2808 0.9021 0.3808 -0.2972 0.0283  0.2120  23  DG  D N3    
2580 C C4    . DG  C 23  ? 1.3405 0.9092 0.4161 -0.3117 0.0027  0.2210  23  DG  D C4    
2581 P P     . DA  C 24  ? 1.4742 1.2466 0.6065 -0.4413 0.0666  0.3098  24  DA  D P     
2582 O OP1   . DA  C 24  ? 1.4562 1.2697 0.6399 -0.4518 0.0657  0.3153  24  DA  D OP1   
2583 O OP2   . DA  C 24  ? 1.5087 1.2408 0.5902 -0.4701 0.0567  0.3299  24  DA  D OP2   
2584 O "O5'" . DA  C 24  ? 1.4468 1.2701 0.5829 -0.4189 0.1005  0.2970  24  DA  D "O5'" 
2585 C "C5'" . DA  C 24  ? 1.4110 1.2634 0.5842 -0.3847 0.1103  0.2738  24  DA  D "C5'" 
2586 C "C4'" . DA  C 24  ? 1.4069 1.2527 0.5547 -0.3558 0.1239  0.2560  24  DA  D "C4'" 
2587 O "O4'" . DA  C 24  ? 1.4133 1.1896 0.5296 -0.3428 0.1003  0.2465  24  DA  D "O4'" 
2588 C "C3'" . DA  C 24  ? 1.4267 1.2923 0.5391 -0.3659 0.1468  0.2652  24  DA  D "C3'" 
2589 O "O3'" . DA  C 24  ? 1.4459 1.3549 0.5711 -0.3380 0.1717  0.2478  24  DA  D "O3'" 
2590 C "C2'" . DA  C 24  ? 1.4421 1.2355 0.4974 -0.3672 0.1281  0.2662  24  DA  D "C2'" 
2591 C "C1'" . DA  C 24  ? 1.4166 1.1720 0.4856 -0.3392 0.1076  0.2457  24  DA  D "C1'" 
2592 N N9    . DA  C 24  ? 1.3977 1.0800 0.4297 -0.3414 0.0793  0.2464  24  DA  D N9    
2593 C C8    . DA  C 24  ? 1.3999 1.0422 0.4181 -0.3659 0.0554  0.2621  24  DA  D C8    
2594 N N7    . DA  C 24  ? 1.4123 0.9923 0.4021 -0.3578 0.0311  0.2562  24  DA  D N7    
2595 C C5    . DA  C 24  ? 1.3946 0.9747 0.3820 -0.3269 0.0393  0.2359  24  DA  D C5    
2596 C C6    . DA  C 24  ? 1.3886 0.9203 0.3547 -0.3056 0.0230  0.2213  24  DA  D C6    
2597 N N6    . DA  C 24  ? 1.4084 0.8817 0.3507 -0.3111 -0.0051 0.2246  24  DA  D N6    
2598 N N1    . DA  C 24  ? 1.3724 0.9179 0.3412 -0.2786 0.0361  0.2034  24  DA  D N1    
2599 C C2    . DA  C 24  ? 1.3553 0.9578 0.3467 -0.2711 0.0632  0.1990  24  DA  D C2    
2600 N N3    . DA  C 24  ? 1.3495 1.0035 0.3640 -0.2873 0.0813  0.2104  24  DA  D N3    
2601 C C4    . DA  C 24  ? 1.3790 1.0195 0.3911 -0.3162 0.0682  0.2293  24  DA  D C4    
2602 P P     . DG  C 25  ? 1.4708 1.4349 0.5827 -0.3439 0.2057  0.2544  25  DG  D P     
2603 O OP1   . DG  C 25  ? 1.4387 1.4734 0.6024 -0.3266 0.2270  0.2434  25  DG  D OP1   
2604 O OP2   . DG  C 25  ? 1.4810 1.4419 0.5670 -0.3838 0.2060  0.2818  25  DG  D OP2   
2605 O "O5'" . DG  C 25  ? 1.4995 1.4260 0.5623 -0.3191 0.2086  0.2388  25  DG  D "O5'" 
2606 C "C5'" . DG  C 25  ? 1.4920 1.3862 0.5603 -0.2856 0.1953  0.2152  25  DG  D "C5'" 
2607 C "C4'" . DG  C 25  ? 1.5165 1.3526 0.5292 -0.2748 0.1858  0.2082  25  DG  D "C4'" 
2608 O "O4'" . DG  C 25  ? 1.5192 1.2907 0.5111 -0.2886 0.1552  0.2161  25  DG  D "O4'" 
2609 C "C3'" . DG  C 25  ? 1.5386 1.3818 0.5025 -0.2845 0.2052  0.2170  25  DG  D "C3'" 
2610 O "O3'" . DG  C 25  ? 1.5868 1.4138 0.5244 -0.2542 0.2102  0.1971  25  DG  D "O3'" 
2611 C "C2'" . DG  C 25  ? 1.5419 1.3271 0.4635 -0.3131 0.1833  0.2360  25  DG  D "C2'" 
2612 C "C1'" . DG  C 25  ? 1.5166 1.2496 0.4502 -0.2986 0.1525  0.2240  25  DG  D "C1'" 
2613 N N9    . DG  C 25  ? 1.4718 1.1492 0.3847 -0.3212 0.1241  0.2384  25  DG  D N9    
2614 C C8    . DG  C 25  ? 1.4508 1.1307 0.3692 -0.3543 0.1171  0.2604  25  DG  D C8    
2615 N N7    . DG  C 25  ? 1.4589 1.0781 0.3553 -0.3654 0.0875  0.2671  25  DG  D N7    
2616 C C5    . DG  C 25  ? 1.4584 1.0361 0.3379 -0.3378 0.0747  0.2482  25  DG  D C5    
2617 C C6    . DG  C 25  ? 1.4604 0.9697 0.3148 -0.3336 0.0436  0.2447  25  DG  D C6    
2618 O O6    . DG  C 25  ? 1.4807 0.9498 0.3231 -0.3519 0.0197  0.2566  25  DG  D O6    
2619 N N1    . DG  C 25  ? 1.4415 0.9304 0.2863 -0.3038 0.0405  0.2244  25  DG  D N1    
2620 C C2    . DG  C 25  ? 1.4224 0.9474 0.2764 -0.2812 0.0631  0.2095  25  DG  D C2    
2621 N N2    . DG  C 25  ? 1.4279 0.9229 0.2682 -0.2560 0.0541  0.1921  25  DG  D N2    
2622 N N3    . DG  C 25  ? 1.4186 1.0050 0.2936 -0.2829 0.0918  0.2115  25  DG  D N3    
2623 C C4    . DG  C 25  ? 1.4490 1.0608 0.3375 -0.3117 0.0966  0.2311  25  DG  D C4    
2624 P P     . DC  C 26  ? 1.6085 1.4736 0.5177 -0.2446 0.2419  0.1932  26  DC  D P     
2625 O OP1   . DC  C 26  ? 1.5946 1.5017 0.5404 -0.2117 0.2562  0.1712  26  DC  D OP1   
2626 O OP2   . DC  C 26  ? 1.6040 1.5037 0.5014 -0.2777 0.2600  0.2173  26  DC  D OP2   
2627 O "O5'" . DC  C 26  ? 1.6458 1.4443 0.4920 -0.2347 0.2283  0.1866  26  DC  D "O5'" 
2628 C "C5'" . DC  C 26  ? 1.6615 1.4030 0.4686 -0.2589 0.2065  0.2027  26  DC  D "C5'" 
2629 C "C4'" . DC  C 26  ? 1.6672 1.3403 0.4496 -0.2401 0.1789  0.1886  26  DC  D "C4'" 
2630 O "O4'" . DC  C 26  ? 1.6431 1.2736 0.4363 -0.2549 0.1491  0.1970  26  DC  D "O4'" 
2631 C "C3'" . DC  C 26  ? 1.7048 1.3346 0.4189 -0.2409 0.1764  0.1904  26  DC  D "C3'" 
2632 O "O3'" . DC  C 26  ? 1.7455 1.3371 0.4465 -0.2112 0.1622  0.1693  26  DC  D "O3'" 
2633 C "C2'" . DC  C 26  ? 1.7023 1.2847 0.3902 -0.2715 0.1535  0.2112  26  DC  D "C2'" 
2634 C "C1'" . DC  C 26  ? 1.6512 1.2238 0.3893 -0.2705 0.1315  0.2082  26  DC  D "C1'" 
2635 N N1    . DC  C 26  ? 1.5866 1.1465 0.3274 -0.3045 0.1180  0.2311  26  DC  D N1    
2636 C C2    . DC  C 26  ? 1.5768 1.0720 0.3007 -0.3114 0.0842  0.2349  26  DC  D C2    
2637 O O2    . DC  C 26  ? 1.5854 1.0385 0.2949 -0.2904 0.0668  0.2200  26  DC  D O2    
2638 N N3    . DC  C 26  ? 1.5673 1.0487 0.2928 -0.3407 0.0704  0.2545  26  DC  D N3    
2639 C C4    . DC  C 26  ? 1.5463 1.0749 0.2882 -0.3651 0.0888  0.2716  26  DC  D C4    
2640 N N4    . DC  C 26  ? 1.5460 1.0548 0.2858 -0.3948 0.0721  0.2913  26  DC  D N4    
2641 C C5    . DC  C 26  ? 1.5308 1.1292 0.2923 -0.3597 0.1243  0.2688  26  DC  D C5    
2642 C C6    . DC  C 26  ? 1.5445 1.1558 0.3044 -0.3283 0.1378  0.2479  26  DC  D C6    
2643 P P     . DT  C 27  ? 1.7932 1.3531 0.4289 -0.1994 0.1659  0.1625  27  DT  D P     
2644 O OP1   . DT  C 27  ? 1.8038 1.3456 0.4481 -0.1652 0.1561  0.1377  27  DT  D OP1   
2645 O OP2   . DT  C 27  ? 1.7992 1.4046 0.4110 -0.2091 0.1988  0.1717  27  DT  D OP2   
2646 O "O5'" . DT  C 27  ? 1.8245 1.3156 0.4144 -0.2205 0.1376  0.1769  27  DT  D "O5'" 
2647 C "C5'" . DT  C 27  ? 1.8202 1.2611 0.4232 -0.2141 0.1040  0.1706  27  DT  D "C5'" 
2648 C "C4'" . DT  C 27  ? 1.8334 1.2159 0.3933 -0.2370 0.0794  0.1868  27  DT  D "C4'" 
2649 O "O4'" . DT  C 27  ? 1.7965 1.1917 0.3745 -0.2663 0.0779  0.2070  27  DT  D "O4'" 
2650 C "C3'" . DT  C 27  ? 1.8719 1.2276 0.3604 -0.2461 0.0847  0.1953  27  DT  D "C3'" 
2651 O "O3'" . DT  C 27  ? 1.9352 1.2218 0.3891 -0.2407 0.0528  0.1912  27  DT  D "O3'" 
2652 C "C2'" . DT  C 27  ? 1.8431 1.2120 0.3173 -0.2831 0.0933  0.2222  27  DT  D "C2'" 
2653 C "C1'" . DT  C 27  ? 1.8055 1.1678 0.3281 -0.2921 0.0724  0.2266  27  DT  D "C1'" 
2654 N N1    . DT  C 27  ? 1.7394 1.1315 0.2780 -0.3244 0.0813  0.2491  27  DT  D N1    
2655 C C2    . DT  C 27  ? 1.7201 1.0724 0.2591 -0.3447 0.0536  0.2623  27  DT  D C2    
2656 O O2    . DT  C 27  ? 1.7323 1.0272 0.2580 -0.3370 0.0229  0.2566  27  DT  D O2    
2657 N N3    . DT  C 27  ? 1.6981 1.0808 0.2549 -0.3739 0.0621  0.2824  27  DT  D N3    
2658 C C4    . DT  C 27  ? 1.6757 1.1271 0.2526 -0.3853 0.0957  0.2908  27  DT  D C4    
2659 O O4    . DT  C 27  ? 1.6600 1.1317 0.2538 -0.4136 0.0976  0.3098  27  DT  D O4    
2660 C C5    . DT  C 27  ? 1.6741 1.1680 0.2511 -0.3612 0.1251  0.2752  27  DT  D C5    
2661 C C7    . DT  C 27  ? 1.6425 1.2150 0.2422 -0.3684 0.1631  0.2812  27  DT  D C7    
2662 C C6    . DT  C 27  ? 1.7014 1.1618 0.2580 -0.3321 0.1160  0.2552  27  DT  D C6    
2663 P P     . DG  C 28  ? 1.9800 1.2263 0.3647 -0.2316 0.0502  0.1863  28  DG  D P     
2664 O OP1   . DG  C 28  ? 1.9868 1.2214 0.3860 -0.1982 0.0408  0.1615  28  DG  D OP1   
2665 O OP2   . DG  C 28  ? 1.9814 1.2613 0.3294 -0.2446 0.0823  0.1976  28  DG  D OP2   
2666 O "O5'" . DG  C 28  ? 2.0264 1.2023 0.3716 -0.2500 0.0155  0.1996  28  DG  D "O5'" 
2667 C "C5'" . DG  C 28  ? 2.0223 1.1695 0.4038 -0.2482 -0.0153 0.1967  28  DG  D "C5'" 
2668 C "C4'" . DG  C 28  ? 2.0363 1.1437 0.3921 -0.2774 -0.0361 0.2182  28  DG  D "C4'" 
2669 O "O4'" . DG  C 28  ? 1.9991 1.1498 0.3792 -0.3018 -0.0177 0.2352  28  DG  D "O4'" 
2670 C "C3'" . DG  C 28  ? 2.0781 1.1376 0.3560 -0.2926 -0.0439 0.2311  28  DG  D "C3'" 
2671 O "O3'" . DG  C 28  ? 2.1238 1.1163 0.3814 -0.2954 -0.0833 0.2333  28  DG  D "O3'" 
2672 C "C2'" . DG  C 28  ? 2.0583 1.1469 0.3199 -0.3259 -0.0219 0.2557  28  DG  D "C2'" 
2673 C "C1'" . DG  C 28  ? 2.0110 1.1330 0.3388 -0.3325 -0.0225 0.2584  28  DG  D "C1'" 
2674 N N9    . DG  C 28  ? 1.9561 1.1338 0.2985 -0.3566 0.0064  0.2755  28  DG  D N9    
2675 C C8    . DG  C 28  ? 1.9215 1.1623 0.2723 -0.3534 0.0448  0.2739  28  DG  D C8    
2676 N N7    . DG  C 28  ? 1.8942 1.1792 0.2633 -0.3789 0.0636  0.2917  28  DG  D N7    
2677 C C5    . DG  C 28  ? 1.9021 1.1490 0.2758 -0.4001 0.0350  0.3056  28  DG  D C5    
2678 C C6    . DG  C 28  ? 1.8834 1.1473 0.2721 -0.4333 0.0360  0.3282  28  DG  D C6    
2679 O O6    . DG  C 28  ? 1.8554 1.1767 0.2597 -0.4519 0.0641  0.3414  28  DG  D O6    
2680 N N1    . DG  C 28  ? 1.9008 1.1053 0.2824 -0.4452 -0.0015 0.3359  28  DG  D N1    
2681 C C2    . DG  C 28  ? 1.9273 1.0671 0.2900 -0.4271 -0.0345 0.3234  28  DG  D C2    
2682 N N2    . DG  C 28  ? 1.9481 1.0374 0.3061 -0.4404 -0.0682 0.3323  28  DG  D N2    
2683 N N3    . DG  C 28  ? 1.9397 1.0670 0.2926 -0.3968 -0.0352 0.3026  28  DG  D N3    
2684 C C4    . DG  C 28  ? 1.9325 1.1129 0.2889 -0.3857 -0.0001 0.2954  28  DG  D C4    
2685 C C     . ACT D .   ? 1.1083 0.5944 0.5113 0.0155  -0.0535 0.0082  401 ACT A C     
2686 O O     . ACT D .   ? 1.0974 0.5920 0.5021 0.0130  -0.0469 0.0085  401 ACT A O     
2687 O OXT   . ACT D .   ? 1.0718 0.5420 0.4631 0.0132  -0.0582 0.0116  401 ACT A OXT   
2688 C CH3   . ACT D .   ? 1.1148 0.6090 0.5286 0.0225  -0.0565 0.0031  401 ACT A CH3   
2689 O O     . HOH E .   ? 1.4018 0.4342 0.4978 0.0190  -0.3575 0.0015  501 HOH A O     
2690 O O     . HOH E .   ? 1.1900 0.3805 0.3354 -0.0001 -0.2450 0.0023  502 HOH A O     
2691 O O     . HOH E .   ? 1.2060 0.3960 0.3227 -0.0035 -0.2335 0.0024  503 HOH A O     
2692 O O     . HOH E .   ? 0.9864 0.3214 0.3105 0.0939  -0.1735 -0.0574 504 HOH A O     
2693 O O     . HOH E .   ? 0.9017 0.4397 0.3354 0.0348  -0.0285 -0.0189 505 HOH A O     
2694 O O     . HOH E .   ? 0.8480 0.3049 0.2264 0.0450  -0.0788 -0.0367 506 HOH A O     
2695 O O     . HOH E .   ? 1.3857 0.5127 0.4078 0.0333  -0.2540 -0.0385 507 HOH A O     
2696 O O     . HOH E .   ? 1.0261 0.6206 0.3158 -0.0158 0.0120  0.0156  508 HOH A O     
2697 O O     . HOH E .   ? 1.0211 0.3164 0.3761 0.0578  -0.2762 -0.0434 509 HOH A O     
2698 O O     . HOH E .   ? 1.1168 0.2993 0.2718 -0.0050 -0.2505 0.0091  510 HOH A O     
2699 O O     . HOH E .   ? 0.9051 0.6109 0.6166 0.0600  -0.1018 -0.0481 511 HOH A O     
2700 O O     . HOH E .   ? 0.9292 0.3180 0.2241 0.0419  -0.1159 -0.0428 512 HOH A O     
2701 O O     . HOH E .   ? 0.8320 0.3051 0.2064 0.0141  -0.0650 -0.0055 513 HOH A O     
2702 O O     . HOH E .   ? 1.0207 0.4239 0.4074 0.0327  -0.1163 -0.0324 514 HOH A O     
2703 O O     . HOH E .   ? 0.8153 0.2629 0.1712 -0.0150 -0.0910 0.0111  515 HOH A O     
2704 O O     . HOH E .   ? 0.9019 0.3977 0.2601 0.0917  -0.0554 -0.0585 516 HOH A O     
2705 O O     . HOH E .   ? 1.1822 0.6432 0.3689 0.1167  -0.0338 -0.0808 517 HOH A O     
2706 O O     . HOH E .   ? 0.9290 0.4056 0.5319 0.0726  -0.2784 -0.0627 518 HOH A O     
2707 O O     . HOH E .   ? 0.7753 0.2884 0.2332 0.0158  -0.0722 -0.0178 519 HOH A O     
2708 O O     . HOH E .   ? 0.7659 0.4058 0.2885 0.0530  -0.0010 -0.0314 520 HOH A O     
2709 O O     . HOH E .   ? 1.0711 0.5753 0.4496 0.0232  -0.0253 -0.0057 521 HOH A O     
2710 O O     . HOH E .   ? 0.8179 0.3919 0.2602 0.0309  0.0027  -0.0133 522 HOH A O     
2711 O O     . HOH E .   ? 0.9774 0.4112 0.2040 0.0746  -0.0594 -0.0568 523 HOH A O     
2712 O O     . HOH E .   ? 0.8974 0.3718 0.3086 0.0284  -0.0895 -0.0195 524 HOH A O     
2713 O O     . HOH E .   ? 1.1717 0.7210 0.6353 0.0709  -0.0803 -0.0211 525 HOH A O     
2714 O O     . HOH E .   ? 0.7899 0.3332 0.2283 0.0166  -0.0206 -0.0057 526 HOH A O     
2715 O O     . HOH E .   ? 1.2235 0.5939 0.5578 0.0811  -0.1242 -0.0589 527 HOH A O     
2716 O O     . HOH E .   ? 1.2307 0.7235 0.4795 0.1028  -0.0304 -0.0697 528 HOH A O     
2717 O O     . HOH E .   ? 1.2355 0.4843 0.5800 0.0756  -0.3256 -0.0513 529 HOH A O     
2718 O O     . HOH E .   ? 0.9477 0.7278 0.6674 0.0927  -0.0442 -0.0621 530 HOH A O     
2719 O O     . HOH E .   ? 1.2579 0.4855 0.4808 0.0024  -0.2234 0.0034  531 HOH A O     
2720 O O     . HOH E .   ? 1.0565 0.5696 0.4729 0.0182  -0.0536 0.0056  532 HOH A O     
2721 O O     . HOH E .   ? 0.9505 0.5689 0.5131 -0.0577 -0.0234 0.0342  533 HOH A O     
2722 O O     . HOH E .   ? 1.1251 0.5561 0.3111 -0.0425 -0.0587 0.0304  534 HOH A O     
2723 O O     . HOH E .   ? 1.1750 0.6486 0.5953 0.1313  -0.1172 -0.0587 535 HOH A O     
2724 O O     . HOH E .   ? 1.1680 0.4045 0.4865 0.0224  -0.2936 -0.0540 536 HOH A O     
2725 O O     . HOH E .   ? 0.8836 0.3476 0.3048 0.0199  -0.0914 -0.0246 537 HOH A O     
2726 O O     . HOH E .   ? 1.3047 0.5574 0.3544 -0.0462 -0.1474 0.0337  538 HOH A O     
2727 O O     . HOH E .   ? 1.2788 0.4369 0.4932 0.0422  -0.3433 -0.0426 539 HOH A O     
2728 O O     . HOH E .   ? 1.0211 0.4310 0.5047 0.1436  -0.2437 -0.0892 540 HOH A O     
2729 O O     . HOH E .   ? 0.9647 0.6913 0.5400 0.1442  0.0065  -0.0864 541 HOH A O     
2730 O O     . HOH E .   ? 0.9818 0.5838 0.3909 0.1608  -0.0371 -0.0886 542 HOH A O     
2731 O O     . HOH E .   ? 0.9512 0.4922 0.6454 -0.0154 -0.2602 -0.0247 543 HOH A O     
2732 O O     . HOH E .   ? 1.2353 0.6639 0.5463 0.1361  -0.0901 -0.0882 544 HOH A O     
2733 O O     . HOH E .   ? 0.9490 0.4194 0.4586 -0.0397 -0.1248 0.0077  545 HOH A O     
2734 O O     . HOH E .   ? 0.8751 0.4181 0.2508 0.0055  -0.0300 -0.0025 546 HOH A O     
2735 O O     . HOH E .   ? 1.2329 0.3585 0.3874 0.0184  -0.3037 -0.0029 547 HOH A O     
2736 O O     . HOH E .   ? 1.3251 0.5295 0.6573 0.0537  -0.3824 -0.0548 548 HOH A O     
2737 O O     . HOH E .   ? 1.0805 0.2850 0.3040 0.0300  -0.2664 -0.0141 549 HOH A O     
2738 O O     . HOH E .   ? 0.7650 0.2654 0.1573 0.0065  -0.0591 -0.0057 550 HOH A O     
2739 O O     . HOH E .   ? 1.0348 0.5052 0.4592 -0.0223 -0.0556 0.0229  551 HOH A O     
2740 O O     . HOH E .   ? 0.9944 0.3920 0.3659 0.0331  -0.1073 0.0029  552 HOH A O     
2741 O O     . HOH E .   ? 0.9826 0.5389 0.3781 -0.0747 -0.0612 0.0522  553 HOH A O     
2742 O O     . HOH E .   ? 0.9567 0.5448 0.6667 0.0172  -0.2292 -0.0371 554 HOH A O     
2743 O O     . HOH E .   ? 0.8358 0.2684 0.1836 0.0060  -0.0928 -0.0019 555 HOH A O     
2744 O O     . HOH E .   ? 0.8672 0.6276 0.5017 -0.0237 0.0326  0.0158  556 HOH A O     
2745 O O     . HOH E .   ? 1.1694 0.4366 0.4138 -0.0115 -0.1937 0.0088  557 HOH A O     
2746 O O     . HOH E .   ? 1.1357 0.5481 0.5060 0.0333  -0.1170 -0.0379 558 HOH A O     
2747 O O     . HOH E .   ? 0.9021 0.3579 0.3165 0.0277  -0.0795 -0.0175 559 HOH A O     
2748 O O     . HOH E .   ? 0.7319 0.4427 0.4382 -0.0700 -0.0598 0.0302  560 HOH A O     
2749 O O     . HOH E .   ? 1.0751 0.3592 0.3488 0.0433  -0.2018 -0.0574 561 HOH A O     
2750 O O     . HOH E .   ? 1.1176 0.5597 0.4590 0.0452  -0.0703 -0.0255 562 HOH A O     
2751 O O     . HOH E .   ? 1.0105 0.5016 0.4261 0.0355  -0.0840 0.0024  563 HOH A O     
2752 O O     . HOH E .   ? 0.8799 0.3840 0.2939 -0.0180 -0.0240 0.0243  564 HOH A O     
2753 O O     . HOH E .   ? 1.1517 0.6036 0.5864 -0.0231 -0.0780 0.0172  565 HOH A O     
2754 O O     . HOH E .   ? 0.8072 0.3545 0.4481 -0.0036 -0.1977 -0.0245 566 HOH A O     
2755 O O     . HOH E .   ? 0.9464 0.5333 0.6773 0.0844  -0.2734 -0.0710 567 HOH A O     
2756 O O     . HOH E .   ? 0.9602 0.6348 0.4629 -0.0036 0.0511  0.0112  568 HOH A O     
2757 O O     . HOH E .   ? 1.3277 0.6242 0.5733 -0.0855 -0.1870 0.0549  569 HOH A O     
2758 O O     . HOH E .   ? 1.0209 0.4496 0.3667 0.0407  -0.0963 -0.0393 570 HOH A O     
2759 O O     . HOH E .   ? 1.1334 0.8818 0.9331 -0.0282 -0.1206 -0.0033 571 HOH A O     
2760 O O     . HOH E .   ? 1.4914 0.7565 0.7331 0.0032  -0.1907 -0.0032 572 HOH A O     
2761 O O     . HOH E .   ? 0.9025 0.5031 0.2812 0.0990  -0.0099 -0.0569 573 HOH A O     
2762 O O     . HOH E .   ? 1.4256 0.6096 0.5229 0.0779  -0.2162 -0.0810 574 HOH A O     
2763 O O     . HOH E .   ? 0.9222 0.5527 0.3830 0.0199  0.0391  -0.0034 575 HOH A O     
2764 O O     . HOH E .   ? 0.9854 0.6498 0.4889 0.1340  -0.0485 -0.0620 576 HOH A O     
2765 O O     . HOH E .   ? 1.2297 0.5589 0.2742 -0.0089 -0.0849 0.0049  577 HOH A O     
2766 O O     . HOH E .   ? 1.3168 0.5041 0.5673 0.0336  -0.3101 -0.0605 578 HOH A O     
2767 O O     . HOH E .   ? 0.7863 0.3534 0.1864 0.0177  -0.0218 -0.0087 579 HOH A O     
2768 O O     . HOH E .   ? 1.0901 0.4872 0.5051 0.0088  -0.1419 -0.0251 580 HOH A O     
2769 O O     . HOH E .   ? 0.9154 0.3138 0.2642 0.0314  -0.1298 -0.0383 581 HOH A O     
2770 O O     . HOH E .   ? 1.0034 0.5650 0.4346 -0.0206 0.0121  0.0250  582 HOH A O     
2771 O O     . HOH E .   ? 0.9401 0.3388 0.3114 0.0577  -0.1111 -0.0397 583 HOH A O     
2772 O O     . HOH E .   ? 1.0066 0.5128 0.4039 0.0300  -0.0382 -0.0145 584 HOH A O     
2773 O O     . HOH E .   ? 0.9857 0.5341 0.2874 -0.0400 -0.0191 0.0301  585 HOH A O     
2774 O O     . HOH E .   ? 1.0009 0.6018 0.6255 -0.0679 -0.0912 0.0269  586 HOH A O     
2775 O O     . HOH E .   ? 0.9638 0.4290 0.3539 0.0327  -0.0788 -0.0303 587 HOH A O     
2776 O O     . HOH E .   ? 0.7559 0.2821 0.1705 0.0014  -0.0446 0.0028  588 HOH A O     
2777 O O     . HOH E .   ? 1.0023 0.6093 0.4950 0.0542  -0.0618 -0.0134 589 HOH A O     
2778 O O     . HOH E .   ? 0.9602 0.4215 0.4783 -0.0312 -0.1517 -0.0039 590 HOH A O     
2779 O O     . HOH E .   ? 1.2175 0.6485 0.6265 0.0100  -0.0876 -0.0009 591 HOH A O     
2780 O O     . HOH E .   ? 1.1825 0.6152 0.5797 0.0458  -0.0930 -0.0159 592 HOH A O     
2781 O O     . HOH E .   ? 0.9810 0.5242 0.4280 0.0226  -0.0298 -0.0121 593 HOH A O     
2782 O O     . HOH E .   ? 0.9790 0.3898 0.3543 0.0382  -0.1120 -0.0381 594 HOH A O     
2783 O O     . HOH E .   ? 0.8333 0.2619 0.1771 0.0331  -0.0873 -0.0191 595 HOH A O     
2784 O O     . HOH E .   ? 1.0546 0.7047 0.5606 0.1655  -0.0158 -0.0995 596 HOH A O     
2785 O O     . HOH E .   ? 1.2109 0.3832 0.4570 0.0629  -0.3262 -0.0351 597 HOH A O     
2786 O O     . HOH E .   ? 0.9716 0.3870 0.2377 0.0681  -0.0819 -0.0554 598 HOH A O     
2787 O O     . HOH E .   ? 1.2291 0.3836 0.4687 0.0529  -0.3658 -0.0434 599 HOH A O     
2788 O O     . HOH E .   ? 0.8707 0.4276 0.3182 0.0099  -0.0087 -0.0002 600 HOH A O     
2789 O O     . HOH E .   ? 1.0180 0.4038 0.4504 0.0003  -0.1771 -0.0273 601 HOH A O     
2790 O O     . HOH E .   ? 0.9299 0.4652 0.3531 0.0059  -0.0386 0.0029  602 HOH A O     
2791 O O     . HOH E .   ? 1.1058 0.7444 0.5967 -0.0337 0.0363  0.0307  603 HOH A O     
2792 O O     . HOH E .   ? 1.0152 0.8863 0.8588 0.0331  -0.0542 -0.0313 604 HOH A O     
2793 O O     . HOH E .   ? 1.3370 0.9582 0.8941 0.0589  -0.1501 -0.0039 605 HOH A O     
2794 O O     . HOH E .   ? 1.0886 0.6628 0.4860 0.0933  0.0120  -0.0515 606 HOH A O     
2795 O O     . HOH E .   ? 1.1980 0.6329 0.5680 0.1523  -0.1131 -0.0935 607 HOH A O     
2796 O O     . HOH E .   ? 1.3085 0.7036 0.5768 -0.1383 -0.1377 0.0918  608 HOH A O     
2797 O O     . HOH E .   ? 1.1010 0.5823 0.7247 0.0375  -0.2850 -0.0498 609 HOH A O     
2798 O O     . HOH E .   ? 1.1893 0.8548 0.6183 -0.0117 0.0042  0.0157  610 HOH A O     
2799 O O     . HOH E .   ? 1.2738 0.5262 0.4917 -0.0428 -0.2003 0.0307  611 HOH A O     
2800 O O     . HOH E .   ? 1.1263 0.5571 0.5235 0.0038  -0.0795 0.0106  612 HOH A O     
2801 O O     . HOH E .   ? 1.1238 0.4814 0.4162 0.0589  -0.1329 -0.0573 613 HOH A O     
2802 O O     . HOH E .   ? 1.0198 0.7366 0.9395 -0.0876 -0.2707 0.0131  614 HOH A O     
2803 O O     . HOH E .   ? 1.6176 0.6502 0.5723 -0.0874 -0.2892 0.0718  615 HOH A O     
2804 O O     . HOH E .   ? 1.3127 0.6441 0.5216 -0.1502 -0.1606 0.1010  616 HOH A O     
2805 O O     . HOH E .   ? 1.6846 0.8163 0.5274 -0.0623 -0.1702 0.0481  617 HOH A O     
2806 O O     . HOH E .   ? 0.9653 0.3606 0.3568 0.0276  -0.1174 -0.0242 618 HOH A O     
2807 O O     . HOH E .   ? 1.0422 0.5005 0.3141 0.0839  -0.0551 -0.0609 619 HOH A O     
2808 O O     . HOH E .   ? 1.1453 0.7336 0.2667 0.0477  0.0569  -0.0246 620 HOH A O     
2809 O O     . HOH E .   ? 1.1371 0.7603 0.9255 0.0497  -0.2811 -0.0565 621 HOH A O     
2810 O O     . HOH E .   ? 1.1349 0.7869 0.4346 -0.0486 0.0324  0.0401  622 HOH A O     
2811 O O     . HOH E .   ? 0.8947 0.7783 0.7088 0.0615  -0.0235 -0.0444 623 HOH A O     
2812 O O     . HOH E .   ? 0.9549 0.5686 0.3786 -0.0666 -0.0370 0.0489  624 HOH A O     
2813 O O     . HOH E .   ? 1.0388 0.5650 0.4390 0.0288  -0.0160 -0.0110 625 HOH A O     
2814 O O     . HOH E .   ? 1.2434 0.9112 1.0385 0.0268  -0.2252 -0.0417 626 HOH A O     
2815 O O     . HOH E .   ? 1.1014 0.8155 0.8642 -0.0750 -0.1090 0.0255  627 HOH A O     
2816 O O     . HOH E .   ? 1.2086 0.7195 0.6159 0.0121  -0.0413 0.0066  628 HOH A O     
2817 O O     . HOH E .   ? 0.9742 0.5456 0.4240 0.0025  -0.0467 0.0094  629 HOH A O     
2818 O O     . HOH E .   ? 1.6029 0.6811 0.6271 0.0256  -0.3084 -0.0290 630 HOH A O     
2819 O O     . HOH E .   ? 0.9972 0.5093 0.4025 0.0004  -0.0205 0.0128  631 HOH A O     
2820 O O     . HOH E .   ? 1.0391 0.5616 0.4444 -0.0160 -0.0054 0.0241  632 HOH A O     
2821 O O     . HOH E .   ? 1.2483 0.5854 0.6502 0.0051  -0.2132 -0.0359 633 HOH A O     
2822 O O     . HOH E .   ? 1.6868 0.8144 0.7259 0.1029  -0.2361 -0.1016 634 HOH A O     
2823 O O     . HOH E .   ? 1.2217 0.5608 0.5589 0.1380  -0.1842 -0.0844 635 HOH A O     
2824 O O     . HOH E .   ? 1.1021 0.6549 0.8273 0.0019  -0.2870 -0.0350 636 HOH A O     
2825 O O     . HOH E .   ? 1.0889 0.4788 0.3784 0.0549  -0.1088 -0.0510 637 HOH A O     
2826 O O     . HOH E .   ? 1.3526 0.6017 0.7488 0.0027  -0.3380 -0.0476 638 HOH A O     
2827 O O     . HOH E .   ? 1.0960 0.5997 0.5954 -0.0702 -0.0730 0.0410  639 HOH A O     
2828 O O     . HOH E .   ? 1.2712 0.8792 0.5936 0.1437  0.0036  -0.0857 640 HOH A O     
2829 O O     . HOH E .   ? 1.2566 0.5150 0.5254 0.0785  -0.2121 -0.0472 641 HOH A O     
2830 O O     . HOH E .   ? 0.9389 0.7906 0.8009 0.0051  -0.0837 -0.0186 642 HOH A O     
2831 O O     . HOH E .   ? 1.3505 0.8602 0.5151 0.1170  0.0003  -0.0771 643 HOH A O     
2832 O O     . HOH E .   ? 1.2031 0.5244 0.5344 0.0630  -0.1552 -0.0507 644 HOH A O     
2833 O O     . HOH E .   ? 1.3296 0.7216 0.3908 -0.0191 -0.0464 0.0145  645 HOH A O     
2834 O O     . HOH E .   ? 1.3793 0.5662 0.6755 0.0864  -0.3546 -0.0516 646 HOH A O     
2835 O O     . HOH E .   ? 1.2098 0.6111 0.5925 0.0243  -0.1016 -0.0001 647 HOH A O     
2836 O O     . HOH E .   ? 1.0418 0.6152 0.4603 0.0263  0.0175  -0.0072 648 HOH A O     
2837 O O     . HOH E .   ? 0.8665 0.4137 0.2984 0.0265  -0.0147 -0.0116 649 HOH A O     
2838 O O     . HOH E .   ? 1.3593 0.5913 0.7180 0.0829  -0.3643 -0.0581 650 HOH A O     
2839 O O     . HOH E .   ? 1.1671 0.5824 0.5789 0.0091  -0.1048 -0.0088 651 HOH A O     
2840 O O     . HOH E .   ? 1.4802 0.5503 0.6315 0.0482  -0.3607 -0.0191 652 HOH A O     
2841 O O     . HOH E .   ? 1.3792 0.7823 0.4932 -0.0563 -0.0579 0.0413  653 HOH A O     
2842 O O     . HOH E .   ? 1.2234 0.6421 0.4109 -0.0653 -0.0707 0.0469  654 HOH A O     
2843 O O     . HOH E .   ? 1.0363 0.8944 0.9426 -0.0624 -0.1073 0.0168  655 HOH A O     
2844 O O     . HOH E .   ? 1.2465 0.6604 0.6606 -0.0070 -0.1010 0.0054  656 HOH A O     
2845 O O     . HOH E .   ? 1.3249 0.4987 0.4071 0.0394  -0.2354 -0.0457 657 HOH A O     
2846 O O     . HOH E .   ? 1.0038 0.4692 0.3210 0.1101  -0.0649 -0.0733 658 HOH A O     
2847 O O     . HOH E .   ? 1.2573 0.3644 0.3466 -0.0107 -0.2909 0.0156  659 HOH A O     
2848 O O     . HOH E .   ? 1.4747 0.6849 0.6586 -0.0341 -0.2236 0.0280  660 HOH A O     
2849 O O     . HOH E .   ? 1.1294 0.7785 0.8263 -0.0802 -0.1097 0.0298  661 HOH A O     
2850 O O     . HOH E .   ? 1.2377 0.5228 0.5116 0.0498  -0.1927 -0.0611 662 HOH A O     
2851 O O     . HOH E .   ? 1.6854 0.7984 0.6666 0.1355  -0.2212 -0.1216 663 HOH A O     
2852 O O     . HOH E .   ? 1.1020 0.6885 0.3904 -0.0608 0.0003  0.0460  664 HOH A O     
2853 O O     . HOH E .   ? 1.2409 0.7477 0.5401 0.1356  -0.0409 -0.0866 665 HOH A O     
2854 O O     . HOH E .   ? 0.9290 0.8432 0.8748 0.0475  -0.1121 -0.0450 666 HOH A O     
2855 O O     . HOH E .   ? 1.3685 0.4510 0.4883 0.0204  -0.3343 -0.0035 667 HOH A O     
2856 O O     . HOH E .   ? 1.1075 0.4773 0.4717 0.0498  -0.1284 -0.0083 668 HOH A O     
2857 O O     . HOH E .   ? 1.2097 0.5875 0.6131 -0.0293 -0.1199 0.0204  669 HOH A O     
2858 O O     . HOH E .   ? 1.0253 0.9912 0.8501 0.1369  0.0187  -0.0847 670 HOH A O     
2859 O O     . HOH E .   ? 1.6206 0.6606 0.7661 0.0614  -0.3967 -0.0268 671 HOH A O     
2860 O O     . HOH E .   ? 1.3143 0.5263 0.6839 0.1237  -0.3919 -0.0750 672 HOH A O     
2861 O O     . HOH E .   ? 0.9249 0.8818 0.9196 -0.1274 -0.0885 0.0564  673 HOH A O     
2862 O O     . HOH F .   ? 2.2394 0.5996 0.4614 -0.0049 -0.5266 0.1103  101 HOH C O     
2863 O O     . HOH F .   ? 1.1726 0.5021 0.4478 0.0169  -0.1984 0.0226  102 HOH C O     
2864 O O     . HOH F .   ? 1.2493 0.6964 0.6190 -0.0620 -0.1371 0.0408  103 HOH C O     
2865 O O     . HOH F .   ? 1.8258 0.5553 0.3837 -0.0298 -0.3134 0.1085  104 HOH C O     
2866 O O     . HOH F .   ? 1.1256 0.5362 0.4290 0.0188  -0.0878 -0.0054 105 HOH C O     
2867 O O     . HOH F .   ? 1.0487 0.5691 0.4553 -0.0941 -0.1095 0.0625  106 HOH C O     
2868 O O     . HOH F .   ? 1.8570 0.7377 0.6922 0.0243  -0.4103 0.0075  107 HOH C O     
2869 O O     . HOH F .   ? 0.9409 0.4483 0.3397 0.0010  -0.0552 0.0062  108 HOH C O     
2870 O O     . HOH F .   ? 1.2479 0.8293 0.4800 -0.1147 0.0029  0.0838  109 HOH C O     
2871 O O     . HOH F .   ? 1.1740 0.5150 0.4447 0.0068  -0.1413 -0.0042 110 HOH C O     
2872 O O     . HOH F .   ? 1.8204 0.9957 0.9997 0.0141  -0.3425 0.0280  111 HOH C O     
2873 O O     . HOH F .   ? 1.1342 0.8025 0.7441 0.0252  -0.1769 0.0140  112 HOH C O     
2874 O O     . HOH F .   ? 1.3939 0.6544 0.6401 -0.0212 -0.2884 0.0275  113 HOH C O     
2875 O O     . HOH F .   ? 1.9715 0.6157 0.4734 0.0386  -0.4309 0.0307  114 HOH C O     
2876 O O     . HOH F .   ? 1.4538 0.5909 0.5104 0.0170  -0.2545 0.0090  115 HOH C O     
2877 O O     . HOH F .   ? 1.2122 0.6082 0.5523 0.0182  -0.1734 0.0194  116 HOH C O     
2878 O O     . HOH F .   ? 1.1189 0.5603 0.5354 -0.0323 -0.2341 0.0367  117 HOH C O     
2879 O O     . HOH F .   ? 1.0424 0.6240 0.5359 0.0010  -0.1156 0.0193  118 HOH C O     
2880 O O     . HOH F .   ? 1.6038 0.5940 0.5921 0.0102  -0.4124 0.0223  119 HOH C O     
2881 O O     . HOH F .   ? 1.1629 0.8594 0.5832 -0.1227 -0.0103 0.0875  120 HOH C O     
2882 O O     . HOH F .   ? 2.0582 0.6787 0.4699 0.0354  -0.3846 0.0401  121 HOH C O     
2883 O O     . HOH F .   ? 1.0319 0.5520 0.4425 0.0021  -0.0554 0.0089  122 HOH C O     
2884 O O     . HOH F .   ? 1.5573 0.5594 0.3893 0.0345  -0.2347 0.0153  123 HOH C O     
2885 O O     . HOH F .   ? 1.1979 0.6210 0.5200 0.0044  -0.0981 0.0067  124 HOH C O     
2886 O O     . HOH F .   ? 1.1910 0.5999 0.5105 0.0110  -0.1203 0.0169  125 HOH C O     
2887 O O     . HOH F .   ? 1.0116 0.4530 0.4285 0.0272  -0.2177 0.0173  126 HOH C O     
2888 O O     . HOH F .   ? 1.3160 0.7667 0.5939 -0.1826 -0.1192 0.1216  127 HOH C O     
2889 O O     . HOH F .   ? 2.1421 0.6145 0.3836 -0.0365 -0.3940 0.1288  128 HOH C O     
2890 O O     . HOH F .   ? 1.0335 0.5111 0.4109 -0.0032 -0.0719 0.0059  129 HOH C O     
2891 O O     . HOH F .   ? 1.2438 0.6280 0.5651 -0.0458 -0.1533 0.0287  130 HOH C O     
2892 O O     . HOH F .   ? 1.0559 0.5787 0.4496 -0.1164 -0.1074 0.0766  131 HOH C O     
2893 O O     . HOH F .   ? 1.1422 0.7654 0.4559 -0.0921 0.0038  0.0678  132 HOH C O     
2894 O O     . HOH F .   ? 0.9808 0.4276 0.3607 0.0250  -0.1324 0.0141  133 HOH C O     
2895 O O     . HOH F .   ? 1.7539 0.6299 0.6212 0.0191  -0.4547 0.0211  134 HOH C O     
2896 O O     . HOH F .   ? 1.3453 0.6764 0.6337 -0.0678 -0.1857 0.0401  135 HOH C O     
2897 O O     . HOH F .   ? 1.2222 0.6246 0.5414 -0.0102 -0.1224 0.0103  136 HOH C O     
2898 O O     . HOH F .   ? 1.6694 0.5929 0.4169 0.0218  -0.2604 0.0386  137 HOH C O     
2899 O O     . HOH F .   ? 1.2961 0.8348 0.7921 -0.0314 -0.2005 0.0377  138 HOH C O     
2900 O O     . HOH F .   ? 1.4242 0.8344 0.7287 0.0092  -0.1002 0.0105  139 HOH C O     
2901 O O     . HOH F .   ? 1.8262 0.5848 0.5067 0.0152  -0.4029 0.0675  140 HOH C O     
2902 O O     . HOH F .   ? 1.1435 0.8173 0.5962 -0.1170 -0.0392 0.0821  141 HOH C O     
2903 O O     . HOH F .   ? 1.9260 0.7003 0.6454 0.0388  -0.4425 -0.0120 142 HOH C O     
2904 O O     . HOH F .   ? 0.9633 0.5303 0.4649 -0.0089 -0.1577 0.0265  143 HOH C O     
2905 O O     . HOH F .   ? 1.3599 0.5178 0.4787 0.0006  -0.2930 0.0165  144 HOH C O     
2906 O O     . HOH F .   ? 1.1287 0.5015 0.4235 0.0137  -0.1486 0.0198  145 HOH C O     
2907 O O     . HOH F .   ? 1.1886 0.7400 0.5878 -0.1746 -0.1159 0.1138  146 HOH C O     
2908 O O     . HOH F .   ? 1.8041 0.5245 0.5020 0.0255  -0.4710 0.0656  147 HOH C O     
2909 O O     . HOH F .   ? 1.9954 1.4023 0.6485 -0.5090 0.0182  0.3699  148 HOH C O     
2910 O O     . HOH F .   ? 1.0601 0.6251 0.4696 -0.0983 -0.0762 0.0670  149 HOH C O     
2911 O O     . HOH F .   ? 2.2562 0.7589 0.5437 -0.0068 -0.4092 0.0977  150 HOH C O     
2912 O O     . HOH F .   ? 1.0244 0.4989 0.3926 0.0311  -0.0543 -0.0154 151 HOH C O     
2913 O O     . HOH F .   ? 2.1289 0.7846 0.5111 0.0437  -0.3215 0.0309  152 HOH C O     
2914 O O     . HOH F .   ? 1.8047 0.6919 0.4995 0.0071  -0.2548 0.0587  153 HOH C O     
2915 O O     . HOH F .   ? 1.3995 0.5818 0.6117 0.0024  -0.3797 0.0299  154 HOH C O     
2916 O O     . HOH F .   ? 1.5915 0.6456 0.6670 0.0093  -0.4146 0.0280  155 HOH C O     
2917 O O     . HOH F .   ? 1.0846 0.7947 0.4911 -0.0957 0.0120  0.0712  156 HOH C O     
2918 O O     . HOH F .   ? 1.2982 0.7161 0.5940 0.0236  -0.0721 -0.0050 157 HOH C O     
2919 O O     . HOH F .   ? 1.0305 0.5700 0.4618 0.0120  -0.0481 0.0056  158 HOH C O     
2920 O O     . HOH F .   ? 1.3221 0.6857 0.5902 0.0185  -0.1164 -0.0075 159 HOH C O     
2921 O O     . HOH F .   ? 2.2362 0.6345 0.4156 -0.0190 -0.4471 0.1170  160 HOH C O     
2922 O O     . HOH F .   ? 1.9686 0.7493 0.6406 0.0434  -0.3979 0.0036  161 HOH C O     
2923 O O     . HOH F .   ? 1.7835 0.6589 0.4480 -0.0104 -0.2362 0.0774  162 HOH C O     
2924 O O     . HOH G .   ? 0.7550 0.3198 0.1965 0.0180  -0.0303 -0.0042 101 HOH D O     
2925 O O     . HOH G .   ? 1.4264 0.7009 0.6360 -0.0554 -0.1823 0.0403  102 HOH D O     
2926 O O     . HOH G .   ? 1.2588 0.5712 0.4987 -0.0038 -0.1745 0.0080  103 HOH D O     
2927 O O     . HOH G .   ? 0.7256 0.2686 0.1608 0.0183  -0.0335 -0.0083 104 HOH D O     
2928 O O     . HOH G .   ? 1.4089 0.6908 0.5405 0.0299  -0.1153 0.0016  105 HOH D O     
2929 O O     . HOH G .   ? 1.7340 1.3302 0.3899 -0.4547 0.1432  0.3380  106 HOH D O     
2930 O O     . HOH G .   ? 1.3473 0.4975 0.3750 0.0269  -0.2058 0.0073  107 HOH D O     
2931 O O     . HOH G .   ? 1.0988 0.5020 0.4169 -0.0075 -0.1309 0.0139  108 HOH D O     
2932 O O     . HOH G .   ? 0.8395 0.4494 0.2315 -0.0291 -0.0115 0.0244  109 HOH D O     
2933 O O     . HOH G .   ? 1.0051 0.5550 0.4363 -0.0054 -0.0494 0.0117  110 HOH D O     
2934 O O     . HOH G .   ? 1.1333 0.5186 0.4197 0.0094  -0.1203 0.0143  111 HOH D O     
2935 O O     . HOH G .   ? 1.3154 0.6226 0.5941 -0.0243 -0.2518 0.0274  112 HOH D O     
2936 O O     . HOH G .   ? 1.5877 0.6077 0.6375 0.0190  -0.4358 0.0306  113 HOH D O     
2937 O O     . HOH G .   ? 1.7311 0.6962 0.9142 0.0843  -0.6825 0.0233  114 HOH D O     
2938 O O     . HOH G .   ? 1.2346 0.4172 0.3505 0.0081  -0.2466 0.0090  115 HOH D O     
2939 O O     . HOH G .   ? 1.4501 0.5618 0.5796 0.0216  -0.3812 0.0299  116 HOH D O     
2940 O O     . HOH G .   ? 1.8684 1.2715 0.8677 -0.4264 -0.1023 0.2949  117 HOH D O     
2941 O O     . HOH G .   ? 1.0249 0.6120 0.4923 -0.0036 -0.0614 0.0153  118 HOH D O     
2942 O O     . HOH G .   ? 2.1016 0.6599 0.5486 0.0415  -0.5008 0.0293  119 HOH D O     
2943 O O     . HOH G .   ? 1.5320 0.8920 0.9198 -0.1224 -0.3203 0.0734  120 HOH D O     
2944 O O     . HOH G .   ? 1.5723 0.7288 0.8001 0.0487  -0.4242 0.0258  121 HOH D O     
2945 O O     . HOH G .   ? 1.4288 0.5123 0.3500 0.0290  -0.2006 0.0172  122 HOH D O     
2946 O O     . HOH G .   ? 0.7517 0.3440 0.1958 0.0187  -0.0235 -0.0044 123 HOH D O     
2947 O O     . HOH G .   ? 1.0898 0.4838 0.3032 -0.0744 -0.0972 0.0528  124 HOH D O     
2948 O O     . HOH G .   ? 1.2543 0.5581 0.4389 0.0160  -0.1319 0.0164  125 HOH D O     
2949 O O     . HOH G .   ? 1.0181 0.6328 0.4654 -0.0568 -0.0463 0.0430  126 HOH D O     
2950 O O     . HOH G .   ? 0.7036 0.2423 0.1422 0.0125  -0.0332 -0.0053 127 HOH D O     
2951 O O     . HOH G .   ? 1.4160 0.5146 0.3308 -0.0199 -0.1443 0.0709  128 HOH D O     
2952 O O     . HOH G .   ? 1.1570 0.5388 0.4747 -0.0274 -0.1666 0.0225  129 HOH D O     
2953 O O     . HOH G .   ? 1.1472 0.3234 0.3006 0.0297  -0.2812 0.0324  130 HOH D O     
2954 O O     . HOH G .   ? 2.0649 0.6301 0.5769 0.0402  -0.5534 0.0219  131 HOH D O     
2955 O O     . HOH G .   ? 1.2286 0.6290 0.4452 -0.1924 -0.1282 0.1300  132 HOH D O     
2956 O O     . HOH G .   ? 2.2463 0.7018 0.5239 0.0457  -0.4928 0.0342  133 HOH D O     
2957 O O     . HOH G .   ? 1.1839 0.7844 0.7030 -0.0292 -0.1402 0.0348  134 HOH D O     
2958 O O     . HOH G .   ? 1.3028 0.5002 0.4139 0.0149  -0.1990 0.0361  135 HOH D O     
2959 O O     . HOH G .   ? 1.5004 0.5141 0.3556 0.0171  -0.2291 0.0388  136 HOH D O     
2960 O O     . HOH G .   ? 0.8287 0.3523 0.2400 -0.0027 -0.0493 0.0069  137 HOH D O     
2961 O O     . HOH G .   ? 1.6741 1.1980 0.5337 -0.4178 0.0327  0.3012  138 HOH D O     
2962 O O     . HOH G .   ? 1.2817 0.8673 0.7376 -0.0910 -0.0950 0.0628  139 HOH D O     
2963 O O     . HOH G .   ? 1.1907 0.6834 0.4208 -0.1049 -0.0454 0.0747  140 HOH D O     
2964 O O     . HOH G .   ? 1.1643 0.3087 0.2946 0.0333  -0.2775 0.0392  141 HOH D O     
2965 O O     . HOH G .   ? 0.9603 0.4087 0.2216 -0.0586 -0.0719 0.0413  142 HOH D O     
2966 O O     . HOH G .   ? 1.2472 0.8157 0.7536 -0.0468 -0.1727 0.0434  143 HOH D O     
2967 O O     A HOH G .   ? 0.9458 0.3048 0.2048 0.0094  -0.1282 0.0061  144 HOH D O     
2968 O O     B HOH G .   ? 0.8644 0.2470 0.1471 0.0072  -0.1190 0.0081  144 HOH D O     
2969 O O     . HOH G .   ? 1.3663 0.4636 0.5101 0.0588  -0.3683 0.0322  145 HOH D O     
2970 O O     . HOH G .   ? 1.2128 0.4560 0.3126 0.0118  -0.1298 0.0294  146 HOH D O     
2971 O O     . HOH G .   ? 1.0566 0.7495 0.6061 0.0119  -0.0605 0.0111  147 HOH D O     
2972 O O     . HOH G .   ? 1.1988 0.4479 0.3883 0.0203  -0.2129 0.0286  148 HOH D O     
2973 O O     . HOH G .   ? 1.0378 0.7366 0.5565 -0.0578 -0.0457 0.0473  149 HOH D O     
2974 O O     . HOH G .   ? 1.2454 0.9866 0.4505 -0.3180 0.0506  0.2245  150 HOH D O     
2975 O O     . HOH G .   ? 1.0459 0.7182 0.5353 0.0246  -0.0160 -0.0028 151 HOH D O     
2976 O O     . HOH G .   ? 1.4586 0.6858 0.5943 -0.0989 -0.1975 0.0713  152 HOH D O     
2977 O O     . HOH G .   ? 0.9993 0.5963 0.4424 -0.0805 -0.0680 0.0569  153 HOH D O     
2978 O O     . HOH G .   ? 1.1813 0.4985 0.4050 0.0138  -0.1519 0.0211  154 HOH D O     
2979 O O     . HOH G .   ? 1.3989 0.5213 0.4169 0.0300  -0.2324 -0.0047 155 HOH D O     
2980 O O     . HOH G .   ? 2.0611 1.8557 0.7777 -0.2373 0.2685  0.1935  156 HOH D O     
2981 O O     . HOH G .   ? 1.1030 0.8552 0.7414 -0.1193 -0.1473 0.0855  157 HOH D O     
2982 O O     . HOH G .   ? 1.8088 0.6452 0.7478 0.0215  -0.6013 0.0331  158 HOH D O     
2983 O O     . HOH G .   ? 1.4437 0.5479 0.6157 0.0650  -0.4074 0.0274  159 HOH D O     
2984 O O     . HOH G .   ? 1.4189 0.5235 0.3586 0.0367  -0.1900 0.0052  160 HOH D O     
2985 O O     . HOH G .   ? 1.3126 0.9928 0.8061 -0.0390 -0.0304 0.0350  161 HOH D O     
2986 O O     . HOH G .   ? 1.0388 0.5869 0.4738 0.0106  -0.0340 0.0009  162 HOH D O     
2987 O O     . HOH G .   ? 1.5547 0.6064 0.4187 0.0235  -0.1914 0.0285  163 HOH D O     
2988 O O     . HOH G .   ? 1.3820 0.5967 0.5627 -0.0143 -0.2693 0.0172  164 HOH D O     
2989 O O     . HOH G .   ? 1.1951 0.3783 0.3397 0.0262  -0.2478 0.0362  165 HOH D O     
2990 O O     . HOH G .   ? 1.5494 0.6267 0.4454 0.0872  -0.1832 -0.0454 166 HOH D O     
2991 O O     . HOH G .   ? 1.0964 0.8741 0.7063 -0.0045 -0.0594 0.0222  167 HOH D O     
2992 O O     . HOH G .   ? 1.7167 0.6974 0.8456 0.0980  -0.5387 0.0242  168 HOH D O     
2993 O O     . HOH G .   ? 1.3142 0.6120 0.5118 0.0172  -0.1515 -0.0013 169 HOH D O     
2994 O O     . HOH G .   ? 1.2031 0.4664 0.4005 -0.0808 -0.1897 0.0563  170 HOH D O     
2995 O O     . HOH G .   ? 1.2342 0.4759 0.3654 0.0108  -0.1550 0.0340  171 HOH D O     
2996 O O     . HOH G .   ? 1.6371 0.6767 0.4421 0.0015  -0.1517 0.0540  172 HOH D O     
2997 O O     . HOH G .   ? 1.0902 0.5615 0.3221 -0.0725 -0.0514 0.0519  173 HOH D O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   82  ?   ?   ?   A . n 
A 1 2   LYS 2   83  ?   ?   ?   A . n 
A 1 3   LYS 3   84  ?   ?   ?   A . n 
A 1 4   SER 4   85  ?   ?   ?   A . n 
A 1 5   GLY 5   86  ?   ?   ?   A . n 
A 1 6   LYS 6   87  ?   ?   ?   A . n 
A 1 7   SER 7   88  ?   ?   ?   A . n 
A 1 8   ALA 8   89  ?   ?   ?   A . n 
A 1 9   LYS 9   90  ?   ?   ?   A . n 
A 1 10  SER 10  91  ?   ?   ?   A . n 
A 1 11  LYS 11  92  ?   ?   ?   A . n 
A 1 12  GLU 12  93  ?   ?   ?   A . n 
A 1 13  LYS 13  94  ?   ?   ?   A . n 
A 1 14  GLN 14  95  ?   ?   ?   A . n 
A 1 15  GLU 15  96  ?   ?   ?   A . n 
A 1 16  LYS 16  97  ?   ?   ?   A . n 
A 1 17  ILE 17  98  ?   ?   ?   A . n 
A 1 18  THR 18  99  ?   ?   ?   A . n 
A 1 19  ASP 19  100 ?   ?   ?   A . n 
A 1 20  THR 20  101 ?   ?   ?   A . n 
A 1 21  PHE 21  102 ?   ?   ?   A . n 
A 1 22  LYS 22  103 ?   ?   ?   A . n 
A 1 23  VAL 23  104 ?   ?   ?   A . n 
A 1 24  LYS 24  105 ?   ?   ?   A . n 
A 1 25  ARG 25  106 ?   ?   ?   A . n 
A 1 26  LYS 26  107 107 LYS LYS A . n 
A 1 27  VAL 27  108 108 VAL VAL A . n 
A 1 28  ASP 28  109 109 ASP ASP A . n 
A 1 29  ARG 29  110 110 ARG ARG A . n 
A 1 30  PHE 30  111 111 PHE PHE A . n 
A 1 31  ASN 31  112 112 ASN ASN A . n 
A 1 32  GLY 32  113 113 GLY GLY A . n 
A 1 33  VAL 33  114 114 VAL VAL A . n 
A 1 34  SER 34  115 115 SER SER A . n 
A 1 35  GLU 35  116 116 GLU GLU A . n 
A 1 36  ALA 36  117 117 ALA ALA A . n 
A 1 37  GLU 37  118 118 GLU GLU A . n 
A 1 38  LEU 38  119 119 LEU LEU A . n 
A 1 39  LEU 39  120 120 LEU LEU A . n 
A 1 40  THR 40  121 121 THR THR A . n 
A 1 41  LYS 41  122 122 LYS LYS A . n 
A 1 42  THR 42  123 123 THR THR A . n 
A 1 43  LEU 43  124 124 LEU LEU A . n 
A 1 44  PRO 44  125 125 PRO PRO A . n 
A 1 45  ASP 45  126 126 ASP ASP A . n 
A 1 46  ILE 46  127 127 ILE ILE A . n 
A 1 47  LEU 47  128 128 LEU LEU A . n 
A 1 48  THR 48  129 129 THR THR A . n 
A 1 49  PHE 49  130 130 PHE PHE A . n 
A 1 50  ASN 50  131 131 ASN ASN A . n 
A 1 51  LEU 51  132 132 LEU LEU A . n 
A 1 52  ASP 52  133 133 ASP ASP A . n 
A 1 53  ILE 53  134 134 ILE ILE A . n 
A 1 54  VAL 54  135 135 VAL VAL A . n 
A 1 55  ILE 55  136 136 ILE ILE A . n 
A 1 56  ILE 56  137 137 ILE ILE A . n 
A 1 57  GLY 57  138 138 GLY GLY A . n 
A 1 58  ILE 58  139 139 ILE ILE A . n 
A 1 59  ASN 59  140 140 ASN ASN A . n 
A 1 60  PRO 60  141 141 PRO PRO A . n 
A 1 61  GLY 61  142 142 GLY GLY A . n 
A 1 62  LEU 62  143 143 LEU LEU A . n 
A 1 63  MET 63  144 144 MET MET A . n 
A 1 64  ALA 64  145 145 ALA ALA A . n 
A 1 65  ALA 65  146 146 ALA ALA A . n 
A 1 66  TYR 66  147 147 TYR TYR A . n 
A 1 67  LYS 67  148 148 LYS LYS A . n 
A 1 68  GLY 68  149 149 GLY GLY A . n 
A 1 69  HIS 69  150 150 HIS HIS A . n 
A 1 70  HIS 70  151 151 HIS HIS A . n 
A 1 71  TYR 71  152 152 TYR TYR A . n 
A 1 72  PRO 72  153 153 PRO PRO A . n 
A 1 73  GLY 73  154 154 GLY GLY A . n 
A 1 74  PRO 74  155 155 PRO PRO A . n 
A 1 75  GLY 75  156 156 GLY GLY A . n 
A 1 76  ASN 76  157 157 ASN ASN A . n 
A 1 77  HIS 77  158 158 HIS HIS A . n 
A 1 78  PHE 78  159 159 PHE PHE A . n 
A 1 79  TRP 79  160 160 TRP TRP A . n 
A 1 80  LYS 80  161 161 LYS LYS A . n 
A 1 81  CYS 81  162 162 CYS CYS A . n 
A 1 82  LEU 82  163 163 LEU LEU A . n 
A 1 83  PHE 83  164 164 PHE PHE A . n 
A 1 84  MET 84  165 165 MET MET A . n 
A 1 85  SER 85  166 166 SER SER A . n 
A 1 86  GLY 86  167 167 GLY GLY A . n 
A 1 87  LEU 87  168 168 LEU LEU A . n 
A 1 88  SER 88  169 169 SER SER A . n 
A 1 89  GLU 89  170 170 GLU GLU A . n 
A 1 90  VAL 90  171 171 VAL VAL A . n 
A 1 91  GLN 91  172 172 GLN GLN A . n 
A 1 92  LEU 92  173 173 LEU LEU A . n 
A 1 93  ASN 93  174 174 ASN ASN A . n 
A 1 94  HIS 94  175 175 HIS HIS A . n 
A 1 95  MET 95  176 176 MET MET A . n 
A 1 96  ASP 96  177 177 ASP ASP A . n 
A 1 97  ASP 97  178 178 ASP ASP A . n 
A 1 98  HIS 98  179 179 HIS HIS A . n 
A 1 99  THR 99  180 180 THR THR A . n 
A 1 100 LEU 100 181 181 LEU LEU A . n 
A 1 101 PRO 101 182 182 PRO PRO A . n 
A 1 102 GLY 102 183 183 GLY GLY A . n 
A 1 103 LYS 103 184 184 LYS LYS A . n 
A 1 104 TYR 104 185 185 TYR TYR A . n 
A 1 105 GLY 105 186 186 GLY GLY A . n 
A 1 106 ILE 106 187 187 ILE ILE A . n 
A 1 107 GLY 107 188 188 GLY GLY A . n 
A 1 108 PHE 108 189 189 PHE PHE A . n 
A 1 109 THR 109 190 190 THR THR A . n 
A 1 110 ASN 110 191 191 ASN ASN A . n 
A 1 111 MET 111 192 192 MET MET A . n 
A 1 112 VAL 112 193 193 VAL VAL A . n 
A 1 113 GLU 113 194 194 GLU GLU A . n 
A 1 114 ARG 114 195 195 ARG ARG A . n 
A 1 115 THR 115 196 196 THR THR A . n 
A 1 116 THR 116 197 197 THR THR A . n 
A 1 117 PRO 117 198 198 PRO PRO A . n 
A 1 118 GLY 118 199 199 GLY GLY A . n 
A 1 119 SER 119 200 200 SER SER A . n 
A 1 120 LYS 120 201 201 LYS LYS A . n 
A 1 121 ASP 121 202 202 ASP ASP A . n 
A 1 122 LEU 122 203 203 LEU LEU A . n 
A 1 123 SER 123 204 204 SER SER A . n 
A 1 124 SER 124 205 205 SER SER A . n 
A 1 125 LYS 125 206 206 LYS LYS A . n 
A 1 126 GLU 126 207 207 GLU GLU A . n 
A 1 127 PHE 127 208 208 PHE PHE A . n 
A 1 128 ARG 128 209 209 ARG ARG A . n 
A 1 129 GLU 129 210 210 GLU GLU A . n 
A 1 130 GLY 130 211 211 GLY GLY A . n 
A 1 131 GLY 131 212 212 GLY GLY A . n 
A 1 132 ARG 132 213 213 ARG ARG A . n 
A 1 133 ILE 133 214 214 ILE ILE A . n 
A 1 134 LEU 134 215 215 LEU LEU A . n 
A 1 135 VAL 135 216 216 VAL VAL A . n 
A 1 136 GLN 136 217 217 GLN GLN A . n 
A 1 137 LYS 137 218 218 LYS LYS A . n 
A 1 138 LEU 138 219 219 LEU LEU A . n 
A 1 139 GLN 139 220 220 GLN GLN A . n 
A 1 140 LYS 140 221 221 LYS LYS A . n 
A 1 141 TYR 141 222 222 TYR TYR A . n 
A 1 142 GLN 142 223 223 GLN GLN A . n 
A 1 143 PRO 143 224 224 PRO PRO A . n 
A 1 144 ARG 144 225 225 ARG ARG A . n 
A 1 145 ILE 145 226 226 ILE ILE A . n 
A 1 146 ALA 146 227 227 ALA ALA A . n 
A 1 147 VAL 147 228 228 VAL VAL A . n 
A 1 148 PHE 148 229 229 PHE PHE A . n 
A 1 149 ASN 149 230 230 ASN ASN A . n 
A 1 150 GLY 150 231 231 GLY GLY A . n 
A 1 151 LYS 151 232 232 LYS LYS A . n 
A 1 152 CYS 152 233 233 CYS CYS A . n 
A 1 153 ILE 153 234 234 ILE ILE A . n 
A 1 154 TYR 154 235 235 TYR TYR A . n 
A 1 155 GLU 155 236 236 GLU GLU A . n 
A 1 156 ILE 156 237 237 ILE ILE A . n 
A 1 157 PHE 157 238 238 PHE PHE A . n 
A 1 158 SER 158 239 239 SER SER A . n 
A 1 159 LYS 159 240 240 LYS LYS A . n 
A 1 160 GLU 160 241 241 GLU GLU A . n 
A 1 161 VAL 161 242 242 VAL VAL A . n 
A 1 162 PHE 162 243 243 PHE PHE A . n 
A 1 163 GLY 163 244 244 GLY GLY A . n 
A 1 164 VAL 164 245 245 VAL VAL A . n 
A 1 165 LYS 165 246 246 LYS LYS A . n 
A 1 166 VAL 166 247 247 VAL VAL A . n 
A 1 167 LYS 167 248 248 LYS LYS A . n 
A 1 168 ASN 168 249 249 ASN ASN A . n 
A 1 169 LEU 169 250 250 LEU LEU A . n 
A 1 170 GLU 170 251 251 GLU GLU A . n 
A 1 171 PHE 171 252 252 PHE PHE A . n 
A 1 172 GLY 172 253 253 GLY GLY A . n 
A 1 173 LEU 173 254 254 LEU LEU A . n 
A 1 174 GLN 174 255 255 GLN GLN A . n 
A 1 175 PRO 175 256 256 PRO PRO A . n 
A 1 176 HIS 176 257 257 HIS HIS A . n 
A 1 177 LYS 177 258 258 LYS LYS A . n 
A 1 178 ILE 178 259 259 ILE ILE A . n 
A 1 179 PRO 179 260 260 PRO PRO A . n 
A 1 180 ASP 180 261 261 ASP ASP A . n 
A 1 181 THR 181 262 262 THR THR A . n 
A 1 182 GLU 182 263 263 GLU GLU A . n 
A 1 183 THR 183 264 264 THR THR A . n 
A 1 184 LEU 184 265 265 LEU LEU A . n 
A 1 185 CYS 185 266 266 CYS CYS A . n 
A 1 186 TYR 186 267 267 TYR TYR A . n 
A 1 187 VAL 187 268 268 VAL VAL A . n 
A 1 188 MET 188 269 269 MET MET A . n 
A 1 189 PRO 189 270 270 PRO PRO A . n 
A 1 190 SER 190 271 271 SER SER A . n 
A 1 191 SER 191 272 272 SER SER A . n 
A 1 192 SER 192 273 273 SER SER A . n 
A 1 193 ALA 193 274 274 ALA ALA A . n 
A 1 194 ARG 194 275 275 ARG ARG A . n 
A 1 195 CSO 195 276 276 CSO CSO A . y 
A 1 195 CYS 195 276 276 CYS CYS A . y 
A 1 196 ALA 196 277 277 ALA ALA A . n 
A 1 197 GLN 197 278 278 GLN GLN A . n 
A 1 198 PHE 198 279 279 PHE PHE A . n 
A 1 199 PRO 199 280 280 PRO PRO A . n 
A 1 200 ARG 200 281 281 ARG ARG A . n 
A 1 201 ALA 201 282 282 ALA ALA A . n 
A 1 202 GLN 202 283 283 GLN GLN A . n 
A 1 203 ASP 203 284 284 ASP ASP A . n 
A 1 204 LYS 204 285 285 LYS LYS A . n 
A 1 205 VAL 205 286 286 VAL VAL A . n 
A 1 206 HIS 206 287 287 HIS HIS A . n 
A 1 207 TYR 207 288 288 TYR TYR A . n 
A 1 208 TYR 208 289 289 TYR TYR A . n 
A 1 209 ILE 209 290 290 ILE ILE A . n 
A 1 210 LYS 210 291 291 LYS LYS A . n 
A 1 211 LEU 211 292 292 LEU LEU A . n 
A 1 212 LYS 212 293 293 LYS LYS A . n 
A 1 213 ASP 213 294 294 ASP ASP A . n 
A 1 214 LEU 214 295 295 LEU LEU A . n 
A 1 215 ARG 215 296 296 ARG ARG A . n 
A 1 216 ASP 216 297 297 ASP ASP A . n 
A 1 217 GLN 217 298 298 GLN GLN A . n 
A 1 218 LEU 218 299 299 LEU LEU A . n 
A 1 219 LYS 219 300 300 LYS LYS A . n 
A 1 220 GLY 220 301 301 GLY GLY A . n 
A 1 221 ILE 221 302 302 ILE ILE A . n 
A 1 222 GLU 222 303 303 GLU GLU A . n 
A 1 223 ARG 223 304 ?   ?   ?   A . n 
A 1 224 ASN 224 305 ?   ?   ?   A . n 
A 1 225 MET 225 306 ?   ?   ?   A . n 
A 1 226 ASP 226 307 ?   ?   ?   A . n 
A 1 227 VAL 227 308 ?   ?   ?   A . n 
B 2 1   DC  1   1   1   DC  DC  C . n 
B 2 2   DA  2   2   2   DA  DA  C . n 
B 2 3   DG  3   3   3   DG  DG  C . n 
B 2 4   DC  4   4   4   DC  DC  C . n 
B 2 5   DT  5   5   5   DT  DT  C . n 
B 2 6   DC  6   6   6   DC  DC  C . n 
B 2 7   DT  7   7   7   DT  DT  C . n 
B 2 8   DG  8   8   8   DG  DG  C . n 
B 2 9   DT  9   9   9   DT  DT  C . n 
B 2 10  DA  10  10  10  DA  DA  C . n 
B 2 11  DC  11  11  11  DC  DC  C . n 
B 2 12  DG  12  12  12  DG  DG  C . n 
B 2 13  DT  13  13  13  DT  DT  C . n 
B 2 14  DG  14  14  14  DG  DG  C . n 
B 2 15  DA  15  15  15  DA  DA  C . n 
B 2 16  DG  16  16  16  DG  DG  C . n 
B 2 17  DC  17  17  17  DC  DC  C . n 
B 2 18  DG  18  18  18  DG  DG  C . n 
B 2 19  DA  19  19  19  DA  DA  C . n 
B 2 20  DT  20  20  20  DT  DT  C . n 
B 2 21  DG  21  21  21  DG  DG  C . n 
B 2 22  DG  22  22  22  DG  DG  C . n 
B 2 23  DA  23  23  23  DA  DA  C . n 
B 2 24  DC  24  24  24  DC  DC  C . n 
B 2 25  DA  25  25  25  DA  DA  C . n 
B 2 26  DG  26  26  26  DG  DG  C . n 
B 2 27  DC  27  27  27  DC  DC  C . n 
B 2 28  DT  28  28  28  DT  DT  C . n 
C 3 1   DA  1   1   1   DA  DA  D . n 
C 3 2   DG  2   2   2   DG  DG  D . n 
C 3 3   DC  3   3   3   DC  DC  D . n 
C 3 4   DT  4   4   4   DT  DT  D . n 
C 3 5   DG  5   5   5   DG  DG  D . n 
C 3 6   DT  6   6   6   DT  DT  D . n 
C 3 7   DC  7   7   7   DC  DC  D . n 
C 3 8   DC  8   8   8   DC  DC  D . n 
C 3 9   DA  9   9   9   DA  DA  D . n 
C 3 10  DT  10  10  10  DT  DT  D . n 
C 3 11  DC  11  11  11  DC  DC  D . n 
C 3 12  DG  12  12  12  DG  DG  D . n 
C 3 13  DC  13  13  13  DC  DC  D . n 
C 3 14  DT  14  14  14  DT  DT  D . n 
C 3 15  DC  15  15  15  DC  DC  D . n 
C 3 16  DA  16  16  16  DA  DA  D . n 
C 3 17  1FC 17  17  17  1FC 1FC D . n 
C 3 18  DG  18  18  18  DG  DG  D . n 
C 3 19  DT  19  19  19  DT  DT  D . n 
C 3 20  DA  20  20  20  DA  DA  D . n 
C 3 21  DC  21  21  21  DC  DC  D . n 
C 3 22  DA  22  22  22  DA  DA  D . n 
C 3 23  DG  23  23  23  DG  DG  D . n 
C 3 24  DA  24  24  24  DA  DA  D . n 
C 3 25  DG  25  25  25  DG  DG  D . n 
C 3 26  DC  26  26  26  DC  DC  D . n 
C 3 27  DT  27  27  27  DT  DT  D . n 
C 3 28  DG  28  28  28  DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ACT 1   401 1   ACT ACT A . 
E 5 HOH 1   501 436 HOH HOH A . 
E 5 HOH 2   502 298 HOH HOH A . 
E 5 HOH 3   503 556 HOH HOH A . 
E 5 HOH 4   504 29  HOH HOH A . 
E 5 HOH 5   505 15  HOH HOH A . 
E 5 HOH 6   506 357 HOH HOH A . 
E 5 HOH 7   507 299 HOH HOH A . 
E 5 HOH 8   508 370 HOH HOH A . 
E 5 HOH 9   509 308 HOH HOH A . 
E 5 HOH 10  510 237 HOH HOH A . 
E 5 HOH 11  511 360 HOH HOH A . 
E 5 HOH 12  512 32  HOH HOH A . 
E 5 HOH 13  513 320 HOH HOH A . 
E 5 HOH 14  514 23  HOH HOH A . 
E 5 HOH 15  515 22  HOH HOH A . 
E 5 HOH 16  516 291 HOH HOH A . 
E 5 HOH 17  517 375 HOH HOH A . 
E 5 HOH 18  518 442 HOH HOH A . 
E 5 HOH 19  519 19  HOH HOH A . 
E 5 HOH 20  520 285 HOH HOH A . 
E 5 HOH 21  521 362 HOH HOH A . 
E 5 HOH 22  522 59  HOH HOH A . 
E 5 HOH 23  523 163 HOH HOH A . 
E 5 HOH 24  524 312 HOH HOH A . 
E 5 HOH 25  525 269 HOH HOH A . 
E 5 HOH 26  526 50  HOH HOH A . 
E 5 HOH 27  527 553 HOH HOH A . 
E 5 HOH 28  528 374 HOH HOH A . 
E 5 HOH 29  529 462 HOH HOH A . 
E 5 HOH 30  530 502 HOH HOH A . 
E 5 HOH 31  531 608 HOH HOH A . 
E 5 HOH 32  532 349 HOH HOH A . 
E 5 HOH 33  533 505 HOH HOH A . 
E 5 HOH 34  534 246 HOH HOH A . 
E 5 HOH 35  535 35  HOH HOH A . 
E 5 HOH 36  536 381 HOH HOH A . 
E 5 HOH 37  537 26  HOH HOH A . 
E 5 HOH 38  538 72  HOH HOH A . 
E 5 HOH 39  539 303 HOH HOH A . 
E 5 HOH 40  540 203 HOH HOH A . 
E 5 HOH 41  541 143 HOH HOH A . 
E 5 HOH 42  542 353 HOH HOH A . 
E 5 HOH 43  543 255 HOH HOH A . 
E 5 HOH 44  544 37  HOH HOH A . 
E 5 HOH 45  545 234 HOH HOH A . 
E 5 HOH 46  546 258 HOH HOH A . 
E 5 HOH 47  547 560 HOH HOH A . 
E 5 HOH 48  548 307 HOH HOH A . 
E 5 HOH 49  549 9   HOH HOH A . 
E 5 HOH 50  550 384 HOH HOH A . 
E 5 HOH 51  551 568 HOH HOH A . 
E 5 HOH 52  552 271 HOH HOH A . 
E 5 HOH 53  553 80  HOH HOH A . 
E 5 HOH 54  554 359 HOH HOH A . 
E 5 HOH 55  555 321 HOH HOH A . 
E 5 HOH 56  556 364 HOH HOH A . 
E 5 HOH 57  557 510 HOH HOH A . 
E 5 HOH 58  558 456 HOH HOH A . 
E 5 HOH 59  559 13  HOH HOH A . 
E 5 HOH 60  560 366 HOH HOH A . 
E 5 HOH 61  561 378 HOH HOH A . 
E 5 HOH 62  562 463 HOH HOH A . 
E 5 HOH 63  563 253 HOH HOH A . 
E 5 HOH 64  564 49  HOH HOH A . 
E 5 HOH 65  565 439 HOH HOH A . 
E 5 HOH 66  566 8   HOH HOH A . 
E 5 HOH 67  567 435 HOH HOH A . 
E 5 HOH 68  568 267 HOH HOH A . 
E 5 HOH 69  569 343 HOH HOH A . 
E 5 HOH 70  570 290 HOH HOH A . 
E 5 HOH 71  571 623 HOH HOH A . 
E 5 HOH 72  572 546 HOH HOH A . 
E 5 HOH 73  573 443 HOH HOH A . 
E 5 HOH 74  574 486 HOH HOH A . 
E 5 HOH 75  575 363 HOH HOH A . 
E 5 HOH 76  576 272 HOH HOH A . 
E 5 HOH 77  577 373 HOH HOH A . 
E 5 HOH 78  578 380 HOH HOH A . 
E 5 HOH 79  579 292 HOH HOH A . 
E 5 HOH 80  580 194 HOH HOH A . 
E 5 HOH 81  581 30  HOH HOH A . 
E 5 HOH 82  582 266 HOH HOH A . 
E 5 HOH 83  583 482 HOH HOH A . 
E 5 HOH 84  584 317 HOH HOH A . 
E 5 HOH 85  585 441 HOH HOH A . 
E 5 HOH 86  586 33  HOH HOH A . 
E 5 HOH 87  587 233 HOH HOH A . 
E 5 HOH 88  588 238 HOH HOH A . 
E 5 HOH 89  589 251 HOH HOH A . 
E 5 HOH 90  590 278 HOH HOH A . 
E 5 HOH 91  591 221 HOH HOH A . 
E 5 HOH 92  592 354 HOH HOH A . 
E 5 HOH 93  593 346 HOH HOH A . 
E 5 HOH 94  594 239 HOH HOH A . 
E 5 HOH 95  595 54  HOH HOH A . 
E 5 HOH 96  596 344 HOH HOH A . 
E 5 HOH 97  597 385 HOH HOH A . 
E 5 HOH 98  598 376 HOH HOH A . 
E 5 HOH 99  599 77  HOH HOH A . 
E 5 HOH 100 600 284 HOH HOH A . 
E 5 HOH 101 601 195 HOH HOH A . 
E 5 HOH 102 602 351 HOH HOH A . 
E 5 HOH 103 603 547 HOH HOH A . 
E 5 HOH 104 604 555 HOH HOH A . 
E 5 HOH 105 605 592 HOH HOH A . 
E 5 HOH 106 606 196 HOH HOH A . 
E 5 HOH 107 607 538 HOH HOH A . 
E 5 HOH 108 608 180 HOH HOH A . 
E 5 HOH 109 609 583 HOH HOH A . 
E 5 HOH 110 610 531 HOH HOH A . 
E 5 HOH 111 611 545 HOH HOH A . 
E 5 HOH 112 612 245 HOH HOH A . 
E 5 HOH 113 613 314 HOH HOH A . 
E 5 HOH 114 614 433 HOH HOH A . 
E 5 HOH 115 615 586 HOH HOH A . 
E 5 HOH 116 616 81  HOH HOH A . 
E 5 HOH 117 617 516 HOH HOH A . 
E 5 HOH 118 618 277 HOH HOH A . 
E 5 HOH 119 619 369 HOH HOH A . 
E 5 HOH 120 620 293 HOH HOH A . 
E 5 HOH 121 621 582 HOH HOH A . 
E 5 HOH 122 622 197 HOH HOH A . 
E 5 HOH 123 623 452 HOH HOH A . 
E 5 HOH 124 624 393 HOH HOH A . 
E 5 HOH 125 625 324 HOH HOH A . 
E 5 HOH 126 626 445 HOH HOH A . 
E 5 HOH 127 627 367 HOH HOH A . 
E 5 HOH 128 628 347 HOH HOH A . 
E 5 HOH 129 629 446 HOH HOH A . 
E 5 HOH 130 630 301 HOH HOH A . 
E 5 HOH 131 631 573 HOH HOH A . 
E 5 HOH 132 632 365 HOH HOH A . 
E 5 HOH 133 633 576 HOH HOH A . 
E 5 HOH 134 634 493 HOH HOH A . 
E 5 HOH 135 635 202 HOH HOH A . 
E 5 HOH 136 636 358 HOH HOH A . 
E 5 HOH 137 637 377 HOH HOH A . 
E 5 HOH 138 638 581 HOH HOH A . 
E 5 HOH 139 639 268 HOH HOH A . 
E 5 HOH 140 640 231 HOH HOH A . 
E 5 HOH 141 641 512 HOH HOH A . 
E 5 HOH 142 642 554 HOH HOH A . 
E 5 HOH 143 643 274 HOH HOH A . 
E 5 HOH 144 644 605 HOH HOH A . 
E 5 HOH 145 645 71  HOH HOH A . 
E 5 HOH 146 646 249 HOH HOH A . 
E 5 HOH 147 647 235 HOH HOH A . 
E 5 HOH 148 648 58  HOH HOH A . 
E 5 HOH 149 649 283 HOH HOH A . 
E 5 HOH 150 650 316 HOH HOH A . 
E 5 HOH 151 651 276 HOH HOH A . 
E 5 HOH 152 652 437 HOH HOH A . 
E 5 HOH 153 653 584 HOH HOH A . 
E 5 HOH 154 654 69  HOH HOH A . 
E 5 HOH 155 655 548 HOH HOH A . 
E 5 HOH 156 656 449 HOH HOH A . 
E 5 HOH 157 657 164 HOH HOH A . 
E 5 HOH 158 658 432 HOH HOH A . 
E 5 HOH 159 659 12  HOH HOH A . 
E 5 HOH 160 660 84  HOH HOH A . 
E 5 HOH 161 661 444 HOH HOH A . 
E 5 HOH 162 662 485 HOH HOH A . 
E 5 HOH 163 663 544 HOH HOH A . 
E 5 HOH 164 664 371 HOH HOH A . 
E 5 HOH 165 665 36  HOH HOH A . 
E 5 HOH 166 666 535 HOH HOH A . 
E 5 HOH 167 667 474 HOH HOH A . 
E 5 HOH 168 668 270 HOH HOH A . 
E 5 HOH 169 669 448 HOH HOH A . 
E 5 HOH 170 670 44  HOH HOH A . 
E 5 HOH 171 671 76  HOH HOH A . 
E 5 HOH 172 672 11  HOH HOH A . 
E 5 HOH 173 673 43  HOH HOH A . 
F 5 HOH 1   101 334 HOH HOH C . 
F 5 HOH 2   102 475 HOH HOH C . 
F 5 HOH 3   103 561 HOH HOH C . 
F 5 HOH 4   104 345 HOH HOH C . 
F 5 HOH 5   105 219 HOH HOH C . 
F 5 HOH 6   106 391 HOH HOH C . 
F 5 HOH 7   107 517 HOH HOH C . 
F 5 HOH 8   108 322 HOH HOH C . 
F 5 HOH 9   109 589 HOH HOH C . 
F 5 HOH 10  110 92  HOH HOH C . 
F 5 HOH 11  111 113 HOH HOH C . 
F 5 HOH 12  112 593 HOH HOH C . 
F 5 HOH 13  113 406 HOH HOH C . 
F 5 HOH 14  114 423 HOH HOH C . 
F 5 HOH 15  115 327 HOH HOH C . 
F 5 HOH 16  116 189 HOH HOH C . 
F 5 HOH 17  117 404 HOH HOH C . 
F 5 HOH 18  118 558 HOH HOH C . 
F 5 HOH 19  119 417 HOH HOH C . 
F 5 HOH 20  120 616 HOH HOH C . 
F 5 HOH 21  121 428 HOH HOH C . 
F 5 HOH 22  122 152 HOH HOH C . 
F 5 HOH 23  123 328 HOH HOH C . 
F 5 HOH 24  124 397 HOH HOH C . 
F 5 HOH 25  125 400 HOH HOH C . 
F 5 HOH 26  126 93  HOH HOH C . 
F 5 HOH 27  127 100 HOH HOH C . 
F 5 HOH 28  128 613 HOH HOH C . 
F 5 HOH 29  129 503 HOH HOH C . 
F 5 HOH 30  130 614 HOH HOH C . 
F 5 HOH 31  131 208 HOH HOH C . 
F 5 HOH 32  132 388 HOH HOH C . 
F 5 HOH 33  133 188 HOH HOH C . 
F 5 HOH 34  134 329 HOH HOH C . 
F 5 HOH 35  135 557 HOH HOH C . 
F 5 HOH 36  136 529 HOH HOH C . 
F 5 HOH 37  137 412 HOH HOH C . 
F 5 HOH 38  138 403 HOH HOH C . 
F 5 HOH 39  139 210 HOH HOH C . 
F 5 HOH 40  140 243 HOH HOH C . 
F 5 HOH 41  141 390 HOH HOH C . 
F 5 HOH 42  142 522 HOH HOH C . 
F 5 HOH 43  143 105 HOH HOH C . 
F 5 HOH 44  144 326 HOH HOH C . 
F 5 HOH 45  145 106 HOH HOH C . 
F 5 HOH 46  146 389 HOH HOH C . 
F 5 HOH 47  147 119 HOH HOH C . 
F 5 HOH 48  148 515 HOH HOH C . 
F 5 HOH 49  149 392 HOH HOH C . 
F 5 HOH 50  150 426 HOH HOH C . 
F 5 HOH 51  151 319 HOH HOH C . 
F 5 HOH 52  152 422 HOH HOH C . 
F 5 HOH 53  153 598 HOH HOH C . 
F 5 HOH 54  154 415 HOH HOH C . 
F 5 HOH 55  155 413 HOH HOH C . 
F 5 HOH 56  156 577 HOH HOH C . 
F 5 HOH 57  157 395 HOH HOH C . 
F 5 HOH 58  158 348 HOH HOH C . 
F 5 HOH 59  159 591 HOH HOH C . 
F 5 HOH 60  160 540 HOH HOH C . 
F 5 HOH 61  161 621 HOH HOH C . 
F 5 HOH 62  162 597 HOH HOH C . 
G 5 HOH 1   101 46  HOH HOH D . 
G 5 HOH 2   102 82  HOH HOH D . 
G 5 HOH 3   103 190 HOH HOH D . 
G 5 HOH 4   104 45  HOH HOH D . 
G 5 HOH 5   105 467 HOH HOH D . 
G 5 HOH 6   106 99  HOH HOH D . 
G 5 HOH 7   107 408 HOH HOH D . 
G 5 HOH 8   108 398 HOH HOH D . 
G 5 HOH 9   109 248 HOH HOH D . 
G 5 HOH 10  110 102 HOH HOH D . 
G 5 HOH 11  111 399 HOH HOH D . 
G 5 HOH 12  112 175 HOH HOH D . 
G 5 HOH 13  113 114 HOH HOH D . 
G 5 HOH 14  114 465 HOH HOH D . 
G 5 HOH 15  115 109 HOH HOH D . 
G 5 HOH 16  116 88  HOH HOH D . 
G 5 HOH 17  117 611 HOH HOH D . 
G 5 HOH 18  118 483 HOH HOH D . 
G 5 HOH 19  119 424 HOH HOH D . 
G 5 HOH 20  120 612 HOH HOH D . 
G 5 HOH 21  121 418 HOH HOH D . 
G 5 HOH 22  122 110 HOH HOH D . 
G 5 HOH 23  123 361 HOH HOH D . 
G 5 HOH 24  124 297 HOH HOH D . 
G 5 HOH 25  125 107 HOH HOH D . 
G 5 HOH 26  126 394 HOH HOH D . 
G 5 HOH 27  127 21  HOH HOH D . 
G 5 HOH 28  128 7   HOH HOH D . 
G 5 HOH 29  129 525 HOH HOH D . 
G 5 HOH 30  130 131 HOH HOH D . 
G 5 HOH 31  131 523 HOH HOH D . 
G 5 HOH 32  132 609 HOH HOH D . 
G 5 HOH 33  133 332 HOH HOH D . 
G 5 HOH 34  134 478 HOH HOH D . 
G 5 HOH 35  135 14  HOH HOH D . 
G 5 HOH 36  136 75  HOH HOH D . 
G 5 HOH 37  137 18  HOH HOH D . 
G 5 HOH 38  138 514 HOH HOH D . 
G 5 HOH 39  139 477 HOH HOH D . 
G 5 HOH 40  140 70  HOH HOH D . 
G 5 HOH 41  141 10  HOH HOH D . 
G 5 HOH 42  142 430 HOH HOH D . 
G 5 HOH 43  143 602 HOH HOH D . 
G 5 HOH 44  144 96  HOH HOH D . 
G 5 HOH 45  145 89  HOH HOH D . 
G 5 HOH 46  146 401 HOH HOH D . 
G 5 HOH 47  147 494 HOH HOH D . 
G 5 HOH 48  148 416 HOH HOH D . 
G 5 HOH 49  149 244 HOH HOH D . 
G 5 HOH 50  150 338 HOH HOH D . 
G 5 HOH 51  151 261 HOH HOH D . 
G 5 HOH 52  152 587 HOH HOH D . 
G 5 HOH 53  153 174 HOH HOH D . 
G 5 HOH 54  154 108 HOH HOH D . 
G 5 HOH 55  155 325 HOH HOH D . 
G 5 HOH 56  156 604 HOH HOH D . 
G 5 HOH 57  157 479 HOH HOH D . 
G 5 HOH 58  158 601 HOH HOH D . 
G 5 HOH 59  159 421 HOH HOH D . 
G 5 HOH 60  160 409 HOH HOH D . 
G 5 HOH 61  161 151 HOH HOH D . 
G 5 HOH 62  162 350 HOH HOH D . 
G 5 HOH 63  163 411 HOH HOH D . 
G 5 HOH 64  164 153 HOH HOH D . 
G 5 HOH 65  165 466 HOH HOH D . 
G 5 HOH 66  166 617 HOH HOH D . 
G 5 HOH 67  167 468 HOH HOH D . 
G 5 HOH 68  168 185 HOH HOH D . 
G 5 HOH 69  169 104 HOH HOH D . 
G 5 HOH 70  170 386 HOH HOH D . 
G 5 HOH 71  171 27  HOH HOH D . 
G 5 HOH 72  172 620 HOH HOH D . 
G 5 HOH 73  173 25  HOH HOH D . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    CSO 
_pdbx_struct_mod_residue.label_seq_id     195 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     CSO 
_pdbx_struct_mod_residue.auth_seq_id      276 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5260  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  18330 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-11-20 
2 'Structure model' 1 1 2019-12-11 
3 'Structure model' 1 2 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 3 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                 
2 2 'Structure model' '_citation.page_first'                     
3 2 'Structure model' '_citation.page_last'                      
4 2 'Structure model' '_citation.title'                          
5 3 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         20.2822 
_pdbx_refine_tls.origin_y         -1.1546 
_pdbx_refine_tls.origin_z         30.1390 
_pdbx_refine_tls.T[1][1]          0.2698 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          0.0005 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          -0.0432 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          -0.2005 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          0.0022 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          -0.3167 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          0.9822 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          -0.0817 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          1.2400 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          1.9759 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          -0.0224 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          2.2055 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          -0.1023 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          0.0916 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.0276 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.0854 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          -0.0256 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0115 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.1897 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          0.1549 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          0.1279 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 107 ? ? A 303 ? '{ *|* }' 
2 'X-RAY DIFFRACTION' 1 ? ? C 107 ? ? C 303 ? '{ *|* }' 
3 'X-RAY DIFFRACTION' 1 ? ? D 107 ? ? D 303 ? '{ *|* }' 
4 'X-RAY DIFFRACTION' 1 ? ? E 107 ? ? E 303 ? '{ *|* }' 
5 'X-RAY DIFFRACTION' 1 ? ? F 107 ? ? F 303 ? '{ *|* }' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER      ? ? ? 2.10.3 1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? .      2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.7.4  3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .      4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25   5 
# 
_pdbx_entry_details.entry_id                 6U17 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DC 4  ? ? "C1'" C DC 4  ? ? N1 C DC 4  ? ? 110.60 108.30 2.30 0.30 N 
2 1 "O4'" C DC 24 ? ? "C1'" C DC 24 ? ? N1 C DC 24 ? ? 110.18 108.30 1.88 0.30 N 
3 1 "O4'" D DT 4  ? ? "C1'" D DT 4  ? ? N1 D DT 4  ? ? 110.44 108.30 2.14 0.30 N 
4 1 "O4'" D DC 8  ? ? "C1'" D DC 8  ? ? N1 D DC 8  ? ? 110.39 108.30 2.09 0.30 N 
5 1 "O4'" D DG 23 ? ? "C1'" D DG 23 ? ? N9 D DG 23 ? ? 110.66 108.30 2.36 0.30 N 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 669 ? 6.28 . 
2 1 O ? A HOH 670 ? 6.57 . 
3 1 O ? A HOH 671 ? 6.65 . 
4 1 O ? A HOH 672 ? 6.65 . 
5 1 O ? A HOH 673 ? 6.91 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 107 ? CG  ? A LYS 26  CG  
2  1 Y 1 A LYS 107 ? CD  ? A LYS 26  CD  
3  1 Y 1 A LYS 107 ? CE  ? A LYS 26  CE  
4  1 Y 1 A LYS 107 ? NZ  ? A LYS 26  NZ  
5  1 Y 1 A GLU 116 ? CG  ? A GLU 35  CG  
6  1 Y 1 A GLU 116 ? CD  ? A GLU 35  CD  
7  1 Y 1 A GLU 116 ? OE1 ? A GLU 35  OE1 
8  1 Y 1 A GLU 116 ? OE2 ? A GLU 35  OE2 
9  1 Y 1 A GLU 170 ? CG  ? A GLU 89  CG  
10 1 Y 1 A GLU 170 ? CD  ? A GLU 89  CD  
11 1 Y 1 A GLU 170 ? OE1 ? A GLU 89  OE1 
12 1 Y 1 A GLU 170 ? OE2 ? A GLU 89  OE2 
13 1 Y 1 A LYS 184 ? CG  ? A LYS 103 CG  
14 1 Y 1 A LYS 184 ? CD  ? A LYS 103 CD  
15 1 Y 1 A LYS 184 ? CE  ? A LYS 103 CE  
16 1 Y 1 A LYS 184 ? NZ  ? A LYS 103 NZ  
17 1 Y 1 A LYS 201 ? CE  ? A LYS 120 CE  
18 1 Y 1 A LYS 201 ? NZ  ? A LYS 120 NZ  
19 1 Y 1 A LYS 206 ? CD  ? A LYS 125 CD  
20 1 Y 1 A LYS 206 ? CE  ? A LYS 125 CE  
21 1 Y 1 A LYS 206 ? NZ  ? A LYS 125 NZ  
22 1 Y 1 A GLN 217 ? CD  ? A GLN 136 CD  
23 1 Y 1 A GLN 217 ? OE1 ? A GLN 136 OE1 
24 1 Y 1 A GLN 217 ? NE2 ? A GLN 136 NE2 
25 1 Y 1 A GLU 236 ? CD  ? A GLU 155 CD  
26 1 Y 1 A GLU 236 ? OE1 ? A GLU 155 OE1 
27 1 Y 1 A GLU 236 ? OE2 ? A GLU 155 OE2 
28 1 Y 1 A LYS 240 ? CE  ? A LYS 159 CE  
29 1 Y 1 A LYS 240 ? NZ  ? A LYS 159 NZ  
30 1 Y 1 A LYS 246 ? CE  ? A LYS 165 CE  
31 1 Y 1 A LYS 246 ? NZ  ? A LYS 165 NZ  
32 1 Y 1 A LYS 248 ? CG  ? A LYS 167 CG  
33 1 Y 1 A LYS 248 ? CD  ? A LYS 167 CD  
34 1 Y 1 A LYS 248 ? CE  ? A LYS 167 CE  
35 1 Y 1 A LYS 248 ? NZ  ? A LYS 167 NZ  
36 1 Y 1 A ASN 249 ? CG  ? A ASN 168 CG  
37 1 Y 1 A ASN 249 ? OD1 ? A ASN 168 OD1 
38 1 Y 1 A ASN 249 ? ND2 ? A ASN 168 ND2 
39 1 Y 1 A ASP 261 ? CG  ? A ASP 180 CG  
40 1 Y 1 A ASP 261 ? OD1 ? A ASP 180 OD1 
41 1 Y 1 A ASP 261 ? OD2 ? A ASP 180 OD2 
42 1 Y 1 A LYS 291 ? CE  ? A LYS 210 CE  
43 1 Y 1 A LYS 291 ? NZ  ? A LYS 210 NZ  
44 1 Y 1 A GLN 298 ? OE1 ? A GLN 217 OE1 
45 1 Y 1 A GLN 298 ? NE2 ? A GLN 217 NE2 
46 1 Y 1 A LYS 300 ? CE  ? A LYS 219 CE  
47 1 Y 1 A LYS 300 ? NZ  ? A LYS 219 NZ  
48 1 Y 1 A ILE 302 ? CG1 ? A ILE 221 CG1 
49 1 Y 1 A ILE 302 ? CG2 ? A ILE 221 CG2 
50 1 Y 1 A ILE 302 ? CD1 ? A ILE 221 CD1 
51 1 Y 1 A GLU 303 ? CD  ? A GLU 222 CD  
52 1 Y 1 A GLU 303 ? OE1 ? A GLU 222 OE1 
53 1 Y 1 A GLU 303 ? OE2 ? A GLU 222 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 82  ? A SER 1   
2  1 Y 1 A LYS 83  ? A LYS 2   
3  1 Y 1 A LYS 84  ? A LYS 3   
4  1 Y 1 A SER 85  ? A SER 4   
5  1 Y 1 A GLY 86  ? A GLY 5   
6  1 Y 1 A LYS 87  ? A LYS 6   
7  1 Y 1 A SER 88  ? A SER 7   
8  1 Y 1 A ALA 89  ? A ALA 8   
9  1 Y 1 A LYS 90  ? A LYS 9   
10 1 Y 1 A SER 91  ? A SER 10  
11 1 Y 1 A LYS 92  ? A LYS 11  
12 1 Y 1 A GLU 93  ? A GLU 12  
13 1 Y 1 A LYS 94  ? A LYS 13  
14 1 Y 1 A GLN 95  ? A GLN 14  
15 1 Y 1 A GLU 96  ? A GLU 15  
16 1 Y 1 A LYS 97  ? A LYS 16  
17 1 Y 1 A ILE 98  ? A ILE 17  
18 1 Y 1 A THR 99  ? A THR 18  
19 1 Y 1 A ASP 100 ? A ASP 19  
20 1 Y 1 A THR 101 ? A THR 20  
21 1 Y 1 A PHE 102 ? A PHE 21  
22 1 Y 1 A LYS 103 ? A LYS 22  
23 1 Y 1 A VAL 104 ? A VAL 23  
24 1 Y 1 A LYS 105 ? A LYS 24  
25 1 Y 1 A ARG 106 ? A ARG 25  
26 1 Y 1 A ARG 304 ? A ARG 223 
27 1 Y 1 A ASN 305 ? A ASN 224 
28 1 Y 1 A MET 306 ? A MET 225 
29 1 Y 1 A ASP 307 ? A ASP 226 
30 1 Y 1 A VAL 308 ? A VAL 227 
# 
_ndb_struct_conf_na.entry_id   6U17 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 28 1_555 0.087  -0.086 0.179  3.056   -7.168  -6.747 1  C_DC1:DG28_D  C 1  ? D 28 ? 19 1 
1 B DA 2  1_555 C DT 27 1_555 -0.277 -0.196 0.054  5.983   -10.091 2.806  2  C_DA2:DT27_D  C 2  ? D 27 ? 20 1 
1 B DG 3  1_555 C DC 26 1_555 -0.415 -0.179 -0.064 5.827   -11.301 1.051  3  C_DG3:DC26_D  C 3  ? D 26 ? 19 1 
1 B DC 4  1_555 C DG 25 1_555 0.283  -0.147 0.201  -3.465  -15.442 0.788  4  C_DC4:DG25_D  C 4  ? D 25 ? 19 1 
1 B DT 5  1_555 C DA 24 1_555 -0.256 -0.112 0.058  -1.158  -9.606  -4.034 5  C_DT5:DA24_D  C 5  ? D 24 ? 20 1 
1 B DC 6  1_555 C DG 23 1_555 0.352  -0.269 0.184  -8.664  -9.063  -1.202 6  C_DC6:DG23_D  C 6  ? D 23 ? 19 1 
1 B DT 7  1_555 C DA 22 1_555 0.130  -0.215 0.145  -5.378  -8.906  -2.458 7  C_DT7:DA22_D  C 7  ? D 22 ? 20 1 
1 B DG 8  1_555 C DC 21 1_555 -0.384 -0.154 -0.079 -6.180  -8.049  -0.297 8  C_DG8:DC21_D  C 8  ? D 21 ? 19 1 
1 B DT 9  1_555 C DA 20 1_555 -0.040 -0.157 -0.008 -0.110  -9.748  -1.853 9  C_DT9:DA20_D  C 9  ? D 20 ? 20 1 
1 B DA 10 1_555 C DT 19 1_555 -0.005 -0.154 0.147  5.572   -12.672 2.915  10 C_DA10:DT19_D C 10 ? D 19 ? 20 1 
1 B DC 11 1_555 C DG 18 1_555 0.239  -0.160 -0.267 11.269  -12.237 1.398  11 C_DC11:DG18_D C 11 ? D 18 ? 19 1 
1 B DT 13 1_555 C DA 16 1_555 -0.312 -0.015 0.154  -12.140 -13.052 -1.423 12 C_DT13:DA16_D C 13 ? D 16 ? 20 1 
1 B DG 14 1_555 C DC 15 1_555 -0.126 -0.080 -0.072 -0.561  -7.615  1.449  13 C_DG14:DC15_D C 14 ? D 15 ? 19 1 
1 B DA 15 1_555 C DT 14 1_555 0.291  -0.211 0.084  -1.017  -6.421  -1.783 14 C_DA15:DT14_D C 15 ? D 14 ? 20 1 
1 B DG 16 1_555 C DC 13 1_555 -0.218 -0.174 0.059  2.190   -7.762  -2.257 15 C_DG16:DC13_D C 16 ? D 13 ? 19 1 
1 B DC 17 1_555 C DG 12 1_555 0.162  -0.185 0.081  0.243   -9.799  -2.678 16 C_DC17:DG12_D C 17 ? D 12 ? 19 1 
1 B DG 18 1_555 C DC 11 1_555 -0.324 -0.184 -0.094 -0.312  -16.357 1.439  17 C_DG18:DC11_D C 18 ? D 11 ? 19 1 
1 B DA 19 1_555 C DT 10 1_555 0.015  -0.129 -0.221 -6.014  -13.480 1.502  18 C_DA19:DT10_D C 19 ? D 10 ? 20 1 
1 B DT 20 1_555 C DA 9  1_555 0.014  -0.119 0.018  -2.717  -14.499 0.778  19 C_DT20:DA9_D  C 20 ? D 9  ? 20 1 
1 B DG 21 1_555 C DC 8  1_555 -0.158 -0.283 -0.085 -0.480  -6.431  -1.139 20 C_DG21:DC8_D  C 21 ? D 8  ? 19 1 
1 B DG 22 1_555 C DC 7  1_555 -0.285 -0.235 -0.171 -0.723  -13.369 -0.352 21 C_DG22:DC7_D  C 22 ? D 7  ? 19 1 
1 B DA 23 1_555 C DT 6  1_555 0.031  -0.138 -0.015 -1.419  -8.779  -3.325 22 C_DA23:DT6_D  C 23 ? D 6  ? 20 1 
1 B DC 24 1_555 C DG 5  1_555 0.202  -0.242 -0.034 2.193   -6.415  -2.953 23 C_DC24:DG5_D  C 24 ? D 5  ? 19 1 
1 B DA 25 1_555 C DT 4  1_555 0.050  -0.190 0.163  11.190  -12.293 -2.856 24 C_DA25:DT4_D  C 25 ? D 4  ? 20 1 
1 B DG 26 1_555 C DC 3  1_555 -0.193 -0.170 0.166  9.167   -11.681 -1.072 25 C_DG26:DC3_D  C 26 ? D 3  ? 19 1 
1 B DC 27 1_555 C DG 2  1_555 0.511  -0.226 -0.020 3.389   -13.272 -4.155 26 C_DC27:DG2_D  C 27 ? D 2  ? 19 1 
1 B DT 28 1_555 C DA 1  1_555 0.114  -0.110 0.128  -0.867  -14.900 5.892  27 C_DT28:DA1_D  C 28 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 C DG 28 1_555 B DA 2  1_555 C DT 27 1_555 0.461  0.104  3.306 3.313  0.255  36.106 0.131  -0.269 3.335 0.410  
-5.331 36.254 1  CC_DC1DA2:DT27DG28_DD   C 1  ? D 28 ? C 2  ? D 27 ? 
1 B DA 2  1_555 C DT 27 1_555 B DG 3  1_555 C DC 26 1_555 -0.222 -0.070 3.356 -2.254 6.525  31.624 -1.310 -0.010 3.284 11.798 
4.076  32.350 2  CC_DA2DG3:DC26DT27_DD   C 2  ? D 27 ? C 3  ? D 26 ? 
1 B DG 3  1_555 C DC 26 1_555 B DC 4  1_555 C DG 25 1_555 -0.013 -0.351 3.454 -3.217 -0.397 39.035 -0.473 -0.388 3.448 -0.594 
4.804  39.164 3  CC_DG3DC4:DG25DC26_DD   C 3  ? D 26 ? C 4  ? D 25 ? 
1 B DC 4  1_555 C DG 25 1_555 B DT 5  1_555 C DA 24 1_555 -0.380 -0.355 3.206 2.294  4.411  31.731 -1.409 1.086  3.095 8.005  
-4.164 32.108 4  CC_DC4DT5:DA24DG25_DD   C 4  ? D 25 ? C 5  ? D 24 ? 
1 B DT 5  1_555 C DA 24 1_555 B DC 6  1_555 C DG 23 1_555 0.531  -0.052 3.395 0.301  2.672  42.176 -0.356 -0.705 3.389 3.709  
-0.418 42.257 5  CC_DT5DC6:DG23DA24_DD   C 5  ? D 24 ? C 6  ? D 23 ? 
1 B DC 6  1_555 C DG 23 1_555 B DT 7  1_555 C DA 22 1_555 -0.288 -0.129 3.236 1.384  4.614  29.838 -1.170 0.829  3.165 8.888  
-2.665 30.215 6  CC_DC6DT7:DA22DG23_DD   C 6  ? D 23 ? C 7  ? D 22 ? 
1 B DT 7  1_555 C DA 22 1_555 B DG 8  1_555 C DC 21 1_555 0.246  0.600  3.315 0.624  4.222  38.128 0.373  -0.294 3.364 6.439  
-0.951 38.357 7  CC_DT7DG8:DC21DA22_DD   C 7  ? D 22 ? C 8  ? D 21 ? 
1 B DG 8  1_555 C DC 21 1_555 B DT 9  1_555 C DA 20 1_555 -0.326 -0.451 3.162 -0.564 3.122  28.804 -1.563 0.531  3.102 6.251  
1.130  28.975 8  CC_DG8DT9:DA20DC21_DD   C 8  ? D 21 ? C 9  ? D 20 ? 
1 B DT 9  1_555 C DA 20 1_555 B DA 10 1_555 C DT 19 1_555 0.200  0.701  3.214 -0.780 2.430  37.386 0.776  -0.413 3.247 3.786  
1.216  37.470 9  CC_DT9DA10:DT19DA20_DD  C 9  ? D 20 ? C 10 ? D 19 ? 
1 B DA 10 1_555 C DT 19 1_555 B DC 11 1_555 C DG 18 1_555 0.134  0.017  3.175 4.757  -1.234 33.039 0.229  0.534  3.160 -2.156 
-8.307 33.393 10 CC_DA10DC11:DG18DT19_DD C 10 ? D 19 ? C 11 ? D 18 ? 
1 B DT 13 1_555 C DA 16 1_555 B DG 14 1_555 C DC 15 1_555 0.423  0.648  3.170 0.205  6.905  33.708 0.029  -0.683 3.238 11.755 
-0.348 34.388 11 CC_DT13DG14:DC15DA16_DD C 13 ? D 16 ? C 14 ? D 15 ? 
1 B DG 14 1_555 C DC 15 1_555 B DA 15 1_555 C DT 14 1_555 -0.959 -0.103 3.338 -4.847 2.900  36.582 -0.567 0.834  3.415 4.586  
7.666  37.001 12 CC_DG14DA15:DT14DC15_DD C 14 ? D 15 ? C 15 ? D 14 ? 
1 B DA 15 1_555 C DT 14 1_555 B DG 16 1_555 C DC 13 1_555 -0.438 0.049  3.261 -0.907 3.604  34.085 -0.483 0.600  3.260 6.125  
1.542  34.281 13 CC_DA15DG16:DC13DT14_DD C 15 ? D 14 ? C 16 ? D 13 ? 
1 B DG 16 1_555 C DC 13 1_555 B DC 17 1_555 C DG 12 1_555 -0.323 -0.031 3.347 -0.314 1.736  37.618 -0.279 0.459  3.344 2.690  
0.487  37.658 14 CC_DG16DC17:DG12DC13_DD C 16 ? D 13 ? C 17 ? D 12 ? 
1 B DC 17 1_555 C DG 12 1_555 B DG 18 1_555 C DC 11 1_555 0.292  0.378  3.333 1.181  10.378 32.089 -1.105 -0.303 3.301 18.183 
-2.069 33.703 15 CC_DC17DG18:DC11DG12_DD C 17 ? D 12 ? C 18 ? D 11 ? 
1 B DG 18 1_555 C DC 11 1_555 B DA 19 1_555 C DT 10 1_555 -0.156 0.054  3.340 -1.499 5.390  40.130 -0.538 0.053  3.323 7.809  
2.172  40.502 16 CC_DG18DA19:DT10DC11_DD C 18 ? D 11 ? C 19 ? D 10 ? 
1 B DA 19 1_555 C DT 10 1_555 B DT 20 1_555 C DA 9  1_555 -0.426 -0.497 3.190 -1.447 1.385  28.891 -1.293 0.541  3.180 2.771  
2.897  28.959 17 CC_DA19DT20:DA9DT10_DD  C 19 ? D 10 ? C 20 ? D 9  ? 
1 B DT 20 1_555 C DA 9  1_555 B DG 21 1_555 C DC 8  1_555 0.799  0.880  3.303 2.737  5.430  35.540 0.622  -0.888 3.446 8.816  
-4.444 36.040 18 CC_DT20DG21:DC8DA9_DD   C 20 ? D 9  ? C 21 ? D 8  ? 
1 B DG 21 1_555 C DC 8  1_555 B DG 22 1_555 C DC 7  1_555 -1.140 0.759  3.324 -2.415 4.112  34.467 0.617  1.523  3.458 6.898  
4.052  34.785 19 CC_DG21DG22:DC7DC8_DD   C 21 ? D 8  ? C 22 ? D 7  ? 
1 B DG 22 1_555 C DC 7  1_555 B DA 23 1_555 C DT 6  1_555 -0.291 0.068  3.296 -2.836 1.625  38.013 -0.103 0.082  3.309 2.489  
4.345  38.148 20 CC_DG22DA23:DT6DC7_DD   C 22 ? D 7  ? C 23 ? D 6  ? 
1 B DA 23 1_555 C DT 6  1_555 B DC 24 1_555 C DG 5  1_555 0.952  -0.298 3.229 0.212  0.265  32.117 -0.585 -1.683 3.233 0.478  
-0.383 32.119 21 CC_DA23DC24:DG5DT6_DD   C 23 ? D 6  ? C 24 ? D 5  ? 
1 B DC 24 1_555 C DG 5  1_555 B DA 25 1_555 C DT 4  1_555 -0.247 0.618  3.171 0.754  6.567  36.746 0.110  0.485  3.225 10.314 
-1.184 37.316 22 CC_DC24DA25:DT4DG5_DD   C 24 ? D 5  ? C 25 ? D 4  ? 
1 B DA 25 1_555 C DT 4  1_555 B DG 26 1_555 C DC 3  1_555 -0.406 -0.236 3.419 -2.783 5.121  31.766 -1.375 0.214  3.363 9.257  
5.032  32.283 23 CC_DA25DG26:DC3DT4_DD   C 25 ? D 4  ? C 26 ? D 3  ? 
1 B DG 26 1_555 C DC 3  1_555 B DC 27 1_555 C DG 2  1_555 0.031  -0.433 3.425 1.361  2.818  33.076 -1.248 0.182  3.376 4.936  
-2.383 33.219 24 CC_DG26DC27:DG2DC3_DD   C 26 ? D 3  ? C 27 ? D 2  ? 
1 B DC 27 1_555 C DG 2  1_555 B DT 28 1_555 C DA 1  1_555 0.441  -0.178 3.408 2.512  6.721  29.439 -1.757 -0.314 3.312 12.985 
-4.853 30.282 25 CC_DC27DT28:DA1DG2_DD   C 27 ? D 2  ? C 28 ? D 1  ? 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 1FC ? ? 1FC ? ? 'SUBJECT OF INVESTIGATION' ? 
2 ACT ? ? ACT ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ACETATE ION' ACT 
5 water         HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#