data_6U37
# 
_entry.id   6U37 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6U37         
WWPDB D_1000243836 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6U37 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kovalevsky, A.' 1 ? 
'Gerlits, O.'    2 ? 
'Radic, Z.'      3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            295 
_citation.language                  ? 
_citation.page_first                4079 
_citation.page_last                 4092 
_citation.title                     
;Rational design, synthesis, and evaluation of uncharged, "smart" bis-oxime antidotes of organophosphate-inhibited human acetylcholinesterase.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA119.012400 
_citation.pdbx_database_id_PubMed   32019865 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gorecki, L.'      1 ?                   
primary 'Gerlits, O.'      2 ?                   
primary 'Kong, X.'         3 ?                   
primary 'Cheng, X.'        4 ?                   
primary 'Blumenthal, D.K.' 5 0000-0002-8614-1167 
primary 'Taylor, P.'       6 0000-0002-3081-131X 
primary 'Ballatore, C.'    7 0000-0002-2718-3850 
primary 'Kovalevsky, A.'   8 0000-0003-4459-9142 
primary 'Radic, Z.'        9 0000-0003-0806-3869 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6U37 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     124.363 
_cell.length_a_esd                 ? 
_cell.length_b                     124.363 
_cell.length_b_esd                 ? 
_cell.length_c                     129.147 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6U37 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                      60287.977 2   3.1.1.7 ? ? ? 
2 non-polymer syn 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP'                124.076   2   ?       ? ? ? 
3 non-polymer syn '(2E)-N-[2-(azepan-1-yl)ethyl]-2-(hydroxyimino)acetamide' 213.277   2   ?       ? ? ? 
4 non-polymer syn GLYCEROL                                                  92.094    4   ?       ? ? ? 
5 non-polymer syn 'NITRATE ION'                                             62.005    3   ?       ? ? ? 
6 water       nat water                                                     18.015    366 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFG
FLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWA
TVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALIN
AGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREA
LSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLM
RYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFG
FLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWA
TVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALIN
AGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREA
LSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLM
RYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLU n 
1 5   GLY n 
1 6   ARG n 
1 7   GLU n 
1 8   ASP n 
1 9   ALA n 
1 10  GLU n 
1 11  LEU n 
1 12  LEU n 
1 13  VAL n 
1 14  THR n 
1 15  VAL n 
1 16  ARG n 
1 17  GLY n 
1 18  GLY n 
1 19  ARG n 
1 20  LEU n 
1 21  ARG n 
1 22  GLY n 
1 23  ILE n 
1 24  ARG n 
1 25  LEU n 
1 26  LYS n 
1 27  THR n 
1 28  PRO n 
1 29  GLY n 
1 30  GLY n 
1 31  PRO n 
1 32  VAL n 
1 33  SER n 
1 34  ALA n 
1 35  PHE n 
1 36  LEU n 
1 37  GLY n 
1 38  ILE n 
1 39  PRO n 
1 40  PHE n 
1 41  ALA n 
1 42  GLU n 
1 43  PRO n 
1 44  PRO n 
1 45  MET n 
1 46  GLY n 
1 47  PRO n 
1 48  ARG n 
1 49  ARG n 
1 50  PHE n 
1 51  LEU n 
1 52  PRO n 
1 53  PRO n 
1 54  GLU n 
1 55  PRO n 
1 56  LYS n 
1 57  GLN n 
1 58  PRO n 
1 59  TRP n 
1 60  SER n 
1 61  GLY n 
1 62  VAL n 
1 63  VAL n 
1 64  ASP n 
1 65  ALA n 
1 66  THR n 
1 67  THR n 
1 68  PHE n 
1 69  GLN n 
1 70  SER n 
1 71  VAL n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  TYR n 
1 76  VAL n 
1 77  ASP n 
1 78  THR n 
1 79  LEU n 
1 80  TYR n 
1 81  PRO n 
1 82  GLY n 
1 83  PHE n 
1 84  GLU n 
1 85  GLY n 
1 86  THR n 
1 87  GLU n 
1 88  MET n 
1 89  TRP n 
1 90  ASN n 
1 91  PRO n 
1 92  ASN n 
1 93  ARG n 
1 94  GLU n 
1 95  LEU n 
1 96  SER n 
1 97  GLU n 
1 98  ASP n 
1 99  CYS n 
1 100 LEU n 
1 101 TYR n 
1 102 LEU n 
1 103 ASN n 
1 104 VAL n 
1 105 TRP n 
1 106 THR n 
1 107 PRO n 
1 108 TYR n 
1 109 PRO n 
1 110 ARG n 
1 111 PRO n 
1 112 THR n 
1 113 SER n 
1 114 PRO n 
1 115 THR n 
1 116 PRO n 
1 117 VAL n 
1 118 LEU n 
1 119 VAL n 
1 120 TRP n 
1 121 ILE n 
1 122 TYR n 
1 123 GLY n 
1 124 GLY n 
1 125 GLY n 
1 126 PHE n 
1 127 TYR n 
1 128 SER n 
1 129 GLY n 
1 130 ALA n 
1 131 SER n 
1 132 SER n 
1 133 LEU n 
1 134 ASP n 
1 135 VAL n 
1 136 TYR n 
1 137 ASP n 
1 138 GLY n 
1 139 ARG n 
1 140 PHE n 
1 141 LEU n 
1 142 VAL n 
1 143 GLN n 
1 144 ALA n 
1 145 GLU n 
1 146 ARG n 
1 147 THR n 
1 148 VAL n 
1 149 LEU n 
1 150 VAL n 
1 151 SER n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ARG n 
1 156 VAL n 
1 157 GLY n 
1 158 ALA n 
1 159 PHE n 
1 160 GLY n 
1 161 PHE n 
1 162 LEU n 
1 163 ALA n 
1 164 LEU n 
1 165 PRO n 
1 166 GLY n 
1 167 SER n 
1 168 ARG n 
1 169 GLU n 
1 170 ALA n 
1 171 PRO n 
1 172 GLY n 
1 173 ASN n 
1 174 VAL n 
1 175 GLY n 
1 176 LEU n 
1 177 LEU n 
1 178 ASP n 
1 179 GLN n 
1 180 ARG n 
1 181 LEU n 
1 182 ALA n 
1 183 LEU n 
1 184 GLN n 
1 185 TRP n 
1 186 VAL n 
1 187 GLN n 
1 188 GLU n 
1 189 ASN n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 GLY n 
1 195 GLY n 
1 196 ASP n 
1 197 PRO n 
1 198 THR n 
1 199 SER n 
1 200 VAL n 
1 201 THR n 
1 202 LEU n 
1 203 PHE n 
1 204 GLY n 
1 205 GLU n 
1 206 SER n 
1 207 ALA n 
1 208 GLY n 
1 209 ALA n 
1 210 ALA n 
1 211 SER n 
1 212 VAL n 
1 213 GLY n 
1 214 MET n 
1 215 HIS n 
1 216 LEU n 
1 217 LEU n 
1 218 SER n 
1 219 PRO n 
1 220 PRO n 
1 221 SER n 
1 222 ARG n 
1 223 GLY n 
1 224 LEU n 
1 225 PHE n 
1 226 HIS n 
1 227 ARG n 
1 228 ALA n 
1 229 VAL n 
1 230 LEU n 
1 231 GLN n 
1 232 SER n 
1 233 GLY n 
1 234 ALA n 
1 235 PRO n 
1 236 ASN n 
1 237 GLY n 
1 238 PRO n 
1 239 TRP n 
1 240 ALA n 
1 241 THR n 
1 242 VAL n 
1 243 GLY n 
1 244 MET n 
1 245 GLY n 
1 246 GLU n 
1 247 ALA n 
1 248 ARG n 
1 249 ARG n 
1 250 ARG n 
1 251 ALA n 
1 252 THR n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 HIS n 
1 257 LEU n 
1 258 VAL n 
1 259 GLY n 
1 260 CYS n 
1 261 PRO n 
1 262 PRO n 
1 263 GLY n 
1 264 GLY n 
1 265 THR n 
1 266 GLY n 
1 267 GLY n 
1 268 ASN n 
1 269 ASP n 
1 270 THR n 
1 271 GLU n 
1 272 LEU n 
1 273 VAL n 
1 274 ALA n 
1 275 CYS n 
1 276 LEU n 
1 277 ARG n 
1 278 THR n 
1 279 ARG n 
1 280 PRO n 
1 281 ALA n 
1 282 GLN n 
1 283 VAL n 
1 284 LEU n 
1 285 VAL n 
1 286 ASN n 
1 287 HIS n 
1 288 GLU n 
1 289 TRP n 
1 290 HIS n 
1 291 VAL n 
1 292 LEU n 
1 293 PRO n 
1 294 GLN n 
1 295 GLU n 
1 296 SER n 
1 297 VAL n 
1 298 PHE n 
1 299 ARG n 
1 300 PHE n 
1 301 SER n 
1 302 PHE n 
1 303 VAL n 
1 304 PRO n 
1 305 VAL n 
1 306 VAL n 
1 307 ASP n 
1 308 GLY n 
1 309 ASP n 
1 310 PHE n 
1 311 LEU n 
1 312 SER n 
1 313 ASP n 
1 314 THR n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 LEU n 
1 319 ILE n 
1 320 ASN n 
1 321 ALA n 
1 322 GLY n 
1 323 ASP n 
1 324 PHE n 
1 325 HIS n 
1 326 GLY n 
1 327 LEU n 
1 328 GLN n 
1 329 VAL n 
1 330 LEU n 
1 331 VAL n 
1 332 GLY n 
1 333 VAL n 
1 334 VAL n 
1 335 LYS n 
1 336 ASP n 
1 337 GLU n 
1 338 GLY n 
1 339 SER n 
1 340 TYR n 
1 341 PHE n 
1 342 LEU n 
1 343 VAL n 
1 344 TYR n 
1 345 GLY n 
1 346 ALA n 
1 347 PRO n 
1 348 GLY n 
1 349 PHE n 
1 350 SER n 
1 351 LYS n 
1 352 ASP n 
1 353 ASN n 
1 354 GLU n 
1 355 SER n 
1 356 LEU n 
1 357 ILE n 
1 358 SER n 
1 359 ARG n 
1 360 ALA n 
1 361 GLU n 
1 362 PHE n 
1 363 LEU n 
1 364 ALA n 
1 365 GLY n 
1 366 VAL n 
1 367 ARG n 
1 368 VAL n 
1 369 GLY n 
1 370 VAL n 
1 371 PRO n 
1 372 GLN n 
1 373 VAL n 
1 374 SER n 
1 375 ASP n 
1 376 LEU n 
1 377 ALA n 
1 378 ALA n 
1 379 GLU n 
1 380 ALA n 
1 381 VAL n 
1 382 VAL n 
1 383 LEU n 
1 384 HIS n 
1 385 TYR n 
1 386 THR n 
1 387 ASP n 
1 388 TRP n 
1 389 LEU n 
1 390 HIS n 
1 391 PRO n 
1 392 GLU n 
1 393 ASP n 
1 394 PRO n 
1 395 ALA n 
1 396 ARG n 
1 397 LEU n 
1 398 ARG n 
1 399 GLU n 
1 400 ALA n 
1 401 LEU n 
1 402 SER n 
1 403 ASP n 
1 404 VAL n 
1 405 VAL n 
1 406 GLY n 
1 407 ASP n 
1 408 HIS n 
1 409 ASN n 
1 410 VAL n 
1 411 VAL n 
1 412 CYS n 
1 413 PRO n 
1 414 VAL n 
1 415 ALA n 
1 416 GLN n 
1 417 LEU n 
1 418 ALA n 
1 419 GLY n 
1 420 ARG n 
1 421 LEU n 
1 422 ALA n 
1 423 ALA n 
1 424 GLN n 
1 425 GLY n 
1 426 ALA n 
1 427 ARG n 
1 428 VAL n 
1 429 TYR n 
1 430 ALA n 
1 431 TYR n 
1 432 VAL n 
1 433 PHE n 
1 434 GLU n 
1 435 HIS n 
1 436 ARG n 
1 437 ALA n 
1 438 SER n 
1 439 THR n 
1 440 LEU n 
1 441 SER n 
1 442 TRP n 
1 443 PRO n 
1 444 LEU n 
1 445 TRP n 
1 446 MET n 
1 447 GLY n 
1 448 VAL n 
1 449 PRO n 
1 450 HIS n 
1 451 GLY n 
1 452 TYR n 
1 453 GLU n 
1 454 ILE n 
1 455 GLU n 
1 456 PHE n 
1 457 ILE n 
1 458 PHE n 
1 459 GLY n 
1 460 ILE n 
1 461 PRO n 
1 462 LEU n 
1 463 ASP n 
1 464 PRO n 
1 465 SER n 
1 466 ARG n 
1 467 ASN n 
1 468 TYR n 
1 469 THR n 
1 470 ALA n 
1 471 GLU n 
1 472 GLU n 
1 473 LYS n 
1 474 ILE n 
1 475 PHE n 
1 476 ALA n 
1 477 GLN n 
1 478 ARG n 
1 479 LEU n 
1 480 MET n 
1 481 ARG n 
1 482 TYR n 
1 483 TRP n 
1 484 ALA n 
1 485 ASN n 
1 486 PHE n 
1 487 ALA n 
1 488 ARG n 
1 489 THR n 
1 490 GLY n 
1 491 ASP n 
1 492 PRO n 
1 493 ASN n 
1 494 GLU n 
1 495 PRO n 
1 496 ARG n 
1 497 ASP n 
1 498 PRO n 
1 499 LYS n 
1 500 ALA n 
1 501 PRO n 
1 502 GLN n 
1 503 TRP n 
1 504 PRO n 
1 505 PRO n 
1 506 TYR n 
1 507 THR n 
1 508 ALA n 
1 509 GLY n 
1 510 ALA n 
1 511 GLN n 
1 512 GLN n 
1 513 TYR n 
1 514 VAL n 
1 515 SER n 
1 516 LEU n 
1 517 ASP n 
1 518 LEU n 
1 519 ARG n 
1 520 PRO n 
1 521 LEU n 
1 522 GLU n 
1 523 VAL n 
1 524 ARG n 
1 525 ARG n 
1 526 GLY n 
1 527 LEU n 
1 528 ARG n 
1 529 ALA n 
1 530 GLN n 
1 531 ALA n 
1 532 CYS n 
1 533 ALA n 
1 534 PHE n 
1 535 TRP n 
1 536 ASN n 
1 537 ARG n 
1 538 PHE n 
1 539 LEU n 
1 540 PRO n 
1 541 LYS n 
1 542 LEU n 
1 543 LEU n 
1 544 SER n 
1 545 ALA n 
1 546 THR n 
1 547 ASP n 
1 548 THR n 
1 549 LEU n 
1 550 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   550 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLA
LPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVG
MGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSD
VVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYW
ANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6U37 A 4 ? 550 ? P22303 32 ? 578 ? 1 547 
2 1 6U37 B 4 ? 550 ? P22303 32 ? 578 ? 1 547 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6U37 GLY A 1 ? UNP P22303 ? ? 'expression tag' -2 1 
1 6U37 PRO A 2 ? UNP P22303 ? ? 'expression tag' -1 2 
1 6U37 LEU A 3 ? UNP P22303 ? ? 'expression tag' 0  3 
2 6U37 GLY B 1 ? UNP P22303 ? ? 'expression tag' -2 4 
2 6U37 PRO B 2 ? UNP P22303 ? ? 'expression tag' -1 5 
2 6U37 LEU B 3 ? UNP P22303 ? ? 'expression tag' 0  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                   ?                               'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                  ?                               
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                ?                               'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                           ?                               'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                  ?                               'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                 ?                               'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                           ?                               'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                   ?                               'C2 H5 N O2' 
75.067  
GOL non-polymer         . GLYCEROL                                                  'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 
92.094  
HIS 'L-peptide linking' y HISTIDINE                                                 ?                               
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                     ?                               'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                ?                               'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                   ?                               'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                    ?                               
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                ?                               
'C5 H11 N O2 S'  149.211 
NO3 non-polymer         . 'NITRATE ION'                                             ?                               'N O3 -1' 
62.005  
PHE 'L-peptide linking' y PHENYLALANINE                                             ?                               'C9 H11 N O2' 
165.189 
PQV non-polymer         . '(2E)-N-[2-(azepan-1-yl)ethyl]-2-(hydroxyimino)acetamide' ?                               
'C10 H19 N3 O2'  213.277 
PRO 'L-peptide linking' y PROLINE                                                   ?                               'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                    ?                               'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                 ?                               'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                ?                               
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                  ?                               'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                    ?                               'C5 H11 N O2' 
117.146 
VX  non-polymer         . 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP'                ?                               'C3 H9 O3 P' 
124.076 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6U37 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.87 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         74.73 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            283 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10-20 mM sodium citrate, 100 mM HEPES, pH 7, 8-8.5 % PEG6000 and 100 mM potassium nitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-10-27 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6U37 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.25 
_reflns.d_resolution_low                 40 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       97003 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             92.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.9 
_reflns.pdbx_Rmerge_I_obs                0.063 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.088 
_reflns.pdbx_Rpim_I_all                  0.062 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.987 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.25 
_reflns_shell.d_res_low                   2.33 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           9642 
_reflns_shell.percent_possible_all        91.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.594 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.834 
_reflns_shell.pdbx_Rpim_I_all             0.584 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.465 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6U37 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.25 
_refine.ls_d_res_low                             40 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     88333 
_refine.ls_number_reflns_R_free                  4445 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    84.0 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6O66 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8376 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             366 
_refine_hist.number_atoms_total               8820 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        40 
# 
_struct.entry_id                     6U37 
_struct.title                        'Structure of VX-phosphonylated hAChE in complex with oxime reactivator RS194B' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6U37 
_struct_keywords.text            'oxime reactivator complex, VX-phosphonylated conjugate, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 6 ? 
O N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 7   ? GLU A 10  ? GLU A 4   GLU A 7   5 ? 4  
HELX_P HELX_P2  AA2 MET A 45  ? ARG A 49  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 83  ? MET A 88  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 133 ? ASP A 137 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 138 ? ARG A 146 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 GLY A 157 ? LEU A 162 ? GLY A 154 LEU A 159 1 ? 6  
HELX_P HELX_P7  AA7 ASN A 173 ? VAL A 190 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 191 ? PHE A 193 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 206 ? LEU A 217 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 218 ? GLY A 223 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 GLY A 243 ? VAL A 258 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 268 ? THR A 278 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 280 ? ASN A 286 ? PRO A 277 ASN A 283 1 ? 7  
HELX_P HELX_P14 AB5 HIS A 287 ? LEU A 292 ? HIS A 284 LEU A 289 5 ? 6  
HELX_P HELX_P15 AB6 THR A 314 ? ALA A 321 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 AB7 SER A 339 ? GLY A 345 ? SER A 336 GLY A 342 5 ? 7  
HELX_P HELX_P17 AB8 SER A 358 ? VAL A 370 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 374 ? THR A 386 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 393 ? VAL A 410 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 410 ? ALA A 423 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P21 AC3 PRO A 443 ? GLY A 447 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 453 ? PHE A 458 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 459 ? ASP A 463 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 469 ? GLY A 490 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 528 ? ARG A 537 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 537 ? ALA A 545 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 GLU B 7   ? GLU B 10  ? GLU B 4   GLU B 7   5 ? 4  
HELX_P HELX_P28 AD1 MET B 45  ? ARG B 49  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 83  ? MET B 88  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 133 ? ASP B 137 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 138 ? ARG B 146 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 GLY B 157 ? LEU B 162 ? GLY B 154 LEU B 159 1 ? 6  
HELX_P HELX_P33 AD6 ASN B 173 ? VAL B 190 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 191 ? PHE B 193 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 206 ? LEU B 217 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 218 ? GLY B 223 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 GLY B 243 ? VAL B 258 ? GLY B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 AE2 ASN B 268 ? ARG B 279 ? ASN B 265 ARG B 276 1 ? 12 
HELX_P HELX_P39 AE3 PRO B 280 ? ASN B 286 ? PRO B 277 ASN B 283 1 ? 7  
HELX_P HELX_P40 AE4 HIS B 287 ? LEU B 292 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P41 AE5 THR B 314 ? ALA B 321 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 AE6 SER B 339 ? GLY B 345 ? SER B 336 GLY B 342 5 ? 7  
HELX_P HELX_P43 AE7 SER B 358 ? VAL B 370 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 374 ? TYR B 385 ? SER B 371 TYR B 382 1 ? 12 
HELX_P HELX_P45 AE9 ASP B 393 ? VAL B 410 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 410 ? ALA B 423 ? VAL B 407 ALA B 420 1 ? 14 
HELX_P HELX_P47 AF2 PRO B 443 ? GLY B 447 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 453 ? PHE B 458 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 459 ? ASP B 463 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 469 ? GLY B 490 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 528 ? ARG B 537 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 ARG B 537 ? ALA B 545 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?   ? A CYS 72  SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ?   ? A CYS 260 SG ? ? ? 1_555 A CYS 275 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3 disulf ?   ? A CYS 412 SG ? ? ? 1_555 A CYS 532 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ?   ? B CYS 72  SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf5 disulf ?   ? B CYS 260 SG ? ? ? 1_555 B CYS 275 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6 disulf ?   ? B CYS 412 SG ? ? ? 1_555 B CYS 532 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.033 ? 
covale1 covale one ? A SER 206 OG ? ? ? 1_555 C VX  .   P1 ? ? A SER 203 A VX  601 1_555 ? ? ? ? ? ? ? 1.621 ? 
covale2 covale one ? B SER 206 OG ? ? ? 1_555 J VX  .   P1 ? ? B SER 203 B VX  601 1_555 ? ? ? ? ? ? ? 1.620 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 108 A . ? TYR 105 A PRO 109 A ? PRO 106 A 1 -0.85 
2 CYS 260 A . ? CYS 257 A PRO 261 A ? PRO 258 A 1 -1.17 
3 GLY 263 A . ? GLY 260 A GLY 264 A ? GLY 261 A 1 -0.46 
4 TYR 108 B . ? TYR 105 B PRO 109 B ? PRO 106 B 1 -1.83 
5 CYS 260 B . ? CYS 257 B PRO 261 B ? PRO 258 B 1 -1.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 3  ? 
AA4 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA4 4  5  ? parallel      
AA4 5  6  ? parallel      
AA4 6  7  ? parallel      
AA4 7  8  ? parallel      
AA4 8  9  ? parallel      
AA4 9  10 ? parallel      
AA4 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 12  ? THR A 14  ? LEU A 9   THR A 11  
AA1 2  ARG A 19  ? ARG A 21  ? ARG A 16  ARG A 18  
AA1 3  VAL A 62  ? ASP A 64  ? VAL A 59  ASP A 61  
AA2 1  ILE A 23  ? LEU A 25  ? ILE A 20  LEU A 22  
AA2 2  VAL A 32  ? PRO A 39  ? VAL A 29  PRO A 36  
AA2 3  TYR A 101 ? PRO A 107 ? TYR A 98  PRO A 104 
AA2 4  VAL A 148 ? MET A 152 ? VAL A 145 MET A 149 
AA2 5  THR A 115 ? ILE A 121 ? THR A 112 ILE A 118 
AA2 6  GLY A 195 ? GLU A 205 ? GLY A 192 GLU A 202 
AA2 7  ARG A 227 ? GLN A 231 ? ARG A 224 GLN A 228 
AA2 8  GLN A 328 ? VAL A 334 ? GLN A 325 VAL A 331 
AA2 9  ARG A 427 ? PHE A 433 ? ARG A 424 PHE A 430 
AA2 10 GLN A 512 ? LEU A 516 ? GLN A 509 LEU A 513 
AA2 11 GLU A 522 ? ARG A 525 ? GLU A 519 ARG A 522 
AA3 1  LEU B 12  ? THR B 14  ? LEU B 9   THR B 11  
AA3 2  ARG B 19  ? ARG B 21  ? ARG B 16  ARG B 18  
AA3 3  VAL B 62  ? ASP B 64  ? VAL B 59  ASP B 61  
AA4 1  ILE B 23  ? LEU B 25  ? ILE B 20  LEU B 22  
AA4 2  VAL B 32  ? PRO B 39  ? VAL B 29  PRO B 36  
AA4 3  TYR B 101 ? PRO B 107 ? TYR B 98  PRO B 104 
AA4 4  VAL B 148 ? MET B 152 ? VAL B 145 MET B 149 
AA4 5  THR B 115 ? ILE B 121 ? THR B 112 ILE B 118 
AA4 6  GLY B 195 ? GLU B 205 ? GLY B 192 GLU B 202 
AA4 7  ARG B 227 ? GLN B 231 ? ARG B 224 GLN B 228 
AA4 8  GLN B 328 ? VAL B 334 ? GLN B 325 VAL B 331 
AA4 9  ARG B 427 ? PHE B 433 ? ARG B 424 PHE B 430 
AA4 10 GLN B 512 ? LEU B 516 ? GLN B 509 LEU B 513 
AA4 11 VAL B 523 ? ARG B 525 ? VAL B 520 ARG B 522 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 13  ? N VAL A 10  O LEU A 20  ? O LEU A 17  
AA1 2  3  N ARG A 19  ? N ARG A 16  O VAL A 63  ? O VAL A 60  
AA2 1  2  N LEU A 25  ? N LEU A 22  O VAL A 32  ? O VAL A 29  
AA2 2  3  N ILE A 38  ? N ILE A 35  O LEU A 102 ? O LEU A 99  
AA2 3  4  N ASN A 103 ? N ASN A 100 O SER A 151 ? O SER A 148 
AA2 4  5  O VAL A 148 ? O VAL A 145 N LEU A 118 ? N LEU A 115 
AA2 5  6  N THR A 115 ? N THR A 112 O ASP A 196 ? O ASP A 193 
AA2 6  7  N LEU A 202 ? N LEU A 199 O ARG A 227 ? O ARG A 224 
AA2 7  8  N LEU A 230 ? N LEU A 227 O LEU A 330 ? O LEU A 327 
AA2 8  9  N VAL A 333 ? N VAL A 330 O PHE A 433 ? O PHE A 430 
AA2 9  10 N VAL A 432 ? N VAL A 429 O LEU A 516 ? O LEU A 513 
AA2 10 11 N TYR A 513 ? N TYR A 510 O ARG A 524 ? O ARG A 521 
AA3 1  2  N VAL B 13  ? N VAL B 10  O LEU B 20  ? O LEU B 17  
AA3 2  3  N ARG B 19  ? N ARG B 16  O VAL B 63  ? O VAL B 60  
AA4 1  2  N LEU B 25  ? N LEU B 22  O VAL B 32  ? O VAL B 29  
AA4 2  3  N SER B 33  ? N SER B 30  O THR B 106 ? O THR B 103 
AA4 3  4  N TRP B 105 ? N TRP B 102 O LEU B 149 ? O LEU B 146 
AA4 4  5  O VAL B 148 ? O VAL B 145 N LEU B 118 ? N LEU B 115 
AA4 5  6  N THR B 115 ? N THR B 112 O ASP B 196 ? O ASP B 193 
AA4 6  7  N LEU B 202 ? N LEU B 199 O ARG B 227 ? O ARG B 224 
AA4 7  8  N ALA B 228 ? N ALA B 225 O LEU B 330 ? O LEU B 327 
AA4 8  9  N VAL B 329 ? N VAL B 326 O ARG B 427 ? O ARG B 424 
AA4 9  10 N VAL B 432 ? N VAL B 429 O LEU B 516 ? O LEU B 513 
AA4 10 11 N TYR B 513 ? N TYR B 510 O ARG B 524 ? O ARG B 521 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A VX  601 ? 9  'binding site for residue VX A 601'                  
AC2 Software A PQV 602 ? 6  'binding site for residue PQV A 602'                 
AC3 Software A GOL 603 ? 6  'binding site for residue GOL A 603'                 
AC4 Software A GOL 604 ? 8  'binding site for residue GOL A 604'                 
AC5 Software A NO3 605 ? 2  'binding site for residue NO3 A 605'                 
AC6 Software A NO3 606 ? 4  'binding site for residue NO3 A 606'                 
AC7 Software A NO3 607 ? 1  'binding site for residue NO3 A 607'                 
AC8 Software B PQV 602 ? 8  'binding site for residue PQV B 602'                 
AC9 Software B GOL 603 ? 4  'binding site for residue GOL B 603'                 
AD1 Software B GOL 604 ? 8  'binding site for residue GOL B 604'                 
AD2 Software B VX  601 ? 14 'binding site for Di-peptide VX B 601 and SER B 203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  GLY A 123 ? GLY A 120 . ? 1_555 ? 
2  AC1 9  GLY A 124 ? GLY A 121 . ? 1_555 ? 
3  AC1 9  GLY A 125 ? GLY A 122 . ? 1_555 ? 
4  AC1 9  SER A 206 ? SER A 203 . ? 1_555 ? 
5  AC1 9  ALA A 207 ? ALA A 204 . ? 1_555 ? 
6  AC1 9  PHE A 298 ? PHE A 295 . ? 1_555 ? 
7  AC1 9  PHE A 300 ? PHE A 297 . ? 1_555 ? 
8  AC1 9  HIS A 450 ? HIS A 447 . ? 1_555 ? 
9  AC1 9  GOL E .   ? GOL A 603 . ? 1_555 ? 
10 AC2 6  TYR A 75  ? TYR A 72  . ? 1_555 ? 
11 AC2 6  TYR A 127 ? TYR A 124 . ? 1_555 ? 
12 AC2 6  TRP A 289 ? TRP A 286 . ? 1_555 ? 
13 AC2 6  PHE A 298 ? PHE A 295 . ? 1_555 ? 
14 AC2 6  PHE A 341 ? PHE A 338 . ? 1_555 ? 
15 AC2 6  TYR A 344 ? TYR A 341 . ? 1_555 ? 
16 AC3 6  TRP A 89  ? TRP A 86  . ? 1_555 ? 
17 AC3 6  GLU A 205 ? GLU A 202 . ? 1_555 ? 
18 AC3 6  SER A 206 ? SER A 203 . ? 1_555 ? 
19 AC3 6  TYR A 340 ? TYR A 337 . ? 1_555 ? 
20 AC3 6  HIS A 450 ? HIS A 447 . ? 1_555 ? 
21 AC3 6  VX  C .   ? VX  A 601 . ? 1_555 ? 
22 AC4 8  GLU A 84  ? GLU A 81  . ? 1_555 ? 
23 AC4 8  MET A 88  ? MET A 85  . ? 1_555 ? 
24 AC4 8  THR A 439 ? THR A 436 . ? 1_555 ? 
25 AC4 8  LEU A 440 ? LEU A 437 . ? 1_555 ? 
26 AC4 8  SER A 441 ? SER A 438 . ? 1_555 ? 
27 AC4 8  TYR A 452 ? TYR A 449 . ? 1_555 ? 
28 AC4 8  GLU A 455 ? GLU A 452 . ? 1_555 ? 
29 AC4 8  TYR A 468 ? TYR A 465 . ? 1_555 ? 
30 AC5 2  GLU A 399 ? GLU A 396 . ? 1_555 ? 
31 AC5 2  TRP A 445 ? TRP A 442 . ? 1_555 ? 
32 AC6 4  GLY A 46  ? GLY A 43  . ? 1_555 ? 
33 AC6 4  PRO A 47  ? PRO A 44  . ? 1_555 ? 
34 AC6 4  ARG A 277 ? ARG A 274 . ? 1_555 ? 
35 AC6 4  HOH N .   ? HOH A 822 . ? 1_555 ? 
36 AC7 1  ASP A 323 ? ASP A 320 . ? 1_555 ? 
37 AC8 8  TYR B 75  ? TYR B 72  . ? 1_555 ? 
38 AC8 8  TYR B 127 ? TYR B 124 . ? 1_555 ? 
39 AC8 8  TRP B 289 ? TRP B 286 . ? 1_555 ? 
40 AC8 8  PHE B 298 ? PHE B 295 . ? 1_555 ? 
41 AC8 8  PHE B 300 ? PHE B 297 . ? 1_555 ? 
42 AC8 8  PHE B 341 ? PHE B 338 . ? 1_555 ? 
43 AC8 8  TYR B 344 ? TYR B 341 . ? 1_555 ? 
44 AC8 8  VX  J .   ? VX  B 601 . ? 1_555 ? 
45 AC9 4  TRP B 89  ? TRP B 86  . ? 1_555 ? 
46 AC9 4  GLU B 205 ? GLU B 202 . ? 1_555 ? 
47 AC9 4  TYR B 340 ? TYR B 337 . ? 1_555 ? 
48 AC9 4  VX  J .   ? VX  B 601 . ? 1_555 ? 
49 AD1 8  GLU B 84  ? GLU B 81  . ? 1_555 ? 
50 AD1 8  MET B 88  ? MET B 85  . ? 1_555 ? 
51 AD1 8  THR B 439 ? THR B 436 . ? 1_555 ? 
52 AD1 8  LEU B 440 ? LEU B 437 . ? 1_555 ? 
53 AD1 8  SER B 441 ? SER B 438 . ? 1_555 ? 
54 AD1 8  TYR B 452 ? TYR B 449 . ? 1_555 ? 
55 AD1 8  GLU B 455 ? GLU B 452 . ? 1_555 ? 
56 AD1 8  TYR B 468 ? TYR B 465 . ? 1_555 ? 
57 AD2 14 GLY B 124 ? GLY B 121 . ? 1_555 ? 
58 AD2 14 GLY B 125 ? GLY B 122 . ? 1_555 ? 
59 AD2 14 GLU B 205 ? GLU B 202 . ? 1_555 ? 
60 AD2 14 ALA B 207 ? ALA B 204 . ? 1_555 ? 
61 AD2 14 GLY B 208 ? GLY B 205 . ? 1_555 ? 
62 AD2 14 ALA B 209 ? ALA B 206 . ? 1_555 ? 
63 AD2 14 ALA B 210 ? ALA B 207 . ? 1_555 ? 
64 AD2 14 GLN B 231 ? GLN B 228 . ? 1_555 ? 
65 AD2 14 SER B 232 ? SER B 229 . ? 1_555 ? 
66 AD2 14 PHE B 298 ? PHE B 295 . ? 1_555 ? 
67 AD2 14 PHE B 300 ? PHE B 297 . ? 1_555 ? 
68 AD2 14 HIS B 450 ? HIS B 447 . ? 1_555 ? 
69 AD2 14 PQV K .   ? PQV B 602 . ? 1_555 ? 
70 AD2 14 GOL L .   ? GOL B 603 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          6U37 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    6U37 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.008041 
_atom_sites.fract_transf_matrix[1][2]   0.004642 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009285 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007743 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 7   ? -58.289 116.595 -28.957 1.00 77.39  ? 4   GLU A N   1 
ATOM   2    C CA  . GLU A 1 7   ? -58.622 116.601 -27.537 1.00 85.80  ? 4   GLU A CA  1 
ATOM   3    C C   . GLU A 1 7   ? -58.800 115.179 -27.006 1.00 86.21  ? 4   GLU A C   1 
ATOM   4    O O   . GLU A 1 7   ? -57.998 114.292 -27.303 1.00 74.64  ? 4   GLU A O   1 
ATOM   5    C CB  . GLU A 1 7   ? -59.889 117.428 -27.288 1.00 94.02  ? 4   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 7   ? -61.064 117.079 -28.196 1.00 93.45  ? 4   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 7   ? -62.365 117.694 -27.720 1.00 99.59  ? 4   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 7   ? -62.845 118.652 -28.363 1.00 89.96  ? 4   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 7   ? -62.904 117.225 -26.695 1.00 91.69  ? 4   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 8   ? -59.857 114.972 -26.216 1.00 84.60  ? 5   ASP A N   1 
ATOM   11   C CA  . ASP A 1 8   ? -60.167 113.656 -25.669 1.00 72.06  ? 5   ASP A CA  1 
ATOM   12   C C   . ASP A 1 8   ? -60.440 112.614 -26.746 1.00 64.55  ? 5   ASP A C   1 
ATOM   13   O O   . ASP A 1 8   ? -60.440 111.417 -26.437 1.00 53.00  ? 5   ASP A O   1 
ATOM   14   C CB  . ASP A 1 8   ? -61.371 113.759 -24.730 1.00 80.47  ? 5   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 8   ? -61.061 114.546 -23.472 1.00 81.78  ? 5   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 8   ? -60.319 114.027 -22.612 1.00 79.76  ? 5   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 8   ? -61.546 115.691 -23.351 1.00 79.53  ? 5   ASP A OD2 1 
ATOM   18   N N   . ALA A 1 9   ? -60.679 113.032 -27.992 1.00 72.44  ? 6   ALA A N   1 
ATOM   19   C CA  . ALA A 1 9   ? -60.870 112.067 -29.068 1.00 72.11  ? 6   ALA A CA  1 
ATOM   20   C C   . ALA A 1 9   ? -59.571 111.353 -29.419 1.00 73.47  ? 6   ALA A C   1 
ATOM   21   O O   . ALA A 1 9   ? -59.600 110.202 -29.869 1.00 62.60  ? 6   ALA A O   1 
ATOM   22   C CB  . ALA A 1 9   ? -61.443 112.761 -30.303 1.00 62.75  ? 6   ALA A CB  1 
ATOM   23   N N   . GLU A 1 10  ? -58.427 112.012 -29.218 1.00 63.39  ? 7   GLU A N   1 
ATOM   24   C CA  . GLU A 1 10  ? -57.144 111.393 -29.522 1.00 59.05  ? 7   GLU A CA  1 
ATOM   25   C C   . GLU A 1 10  ? -56.736 110.349 -28.493 1.00 50.07  ? 7   GLU A C   1 
ATOM   26   O O   . GLU A 1 10  ? -55.782 109.603 -28.739 1.00 46.59  ? 7   GLU A O   1 
ATOM   27   C CB  . GLU A 1 10  ? -56.061 112.466 -29.643 1.00 60.92  ? 7   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 10  ? -56.380 113.531 -30.679 1.00 60.03  ? 7   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 10  ? -55.149 114.039 -31.401 1.00 64.67  ? 7   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 10  ? -54.060 114.058 -30.789 1.00 54.96  ? 7   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 10  ? -55.270 114.412 -32.587 1.00 61.71  ? 7   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 11  ? -57.427 110.275 -27.357 1.00 42.03  ? 8   LEU A N   1 
ATOM   33   C CA  . LEU A 1 11  ? -57.178 109.230 -26.373 1.00 43.86  ? 8   LEU A CA  1 
ATOM   34   C C   . LEU A 1 11  ? -57.899 107.930 -26.701 1.00 34.52  ? 8   LEU A C   1 
ATOM   35   O O   . LEU A 1 11  ? -57.801 106.974 -25.926 1.00 42.65  ? 8   LEU A O   1 
ATOM   36   C CB  . LEU A 1 11  ? -57.586 109.710 -24.977 1.00 31.99  ? 8   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 11  ? -56.881 110.964 -24.455 1.00 39.60  ? 8   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 11  ? -57.337 111.286 -23.041 1.00 26.76  ? 8   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 11  ? -55.369 110.798 -24.511 1.00 27.10  ? 8   LEU A CD2 1 
ATOM   40   N N   . LEU A 1 12  ? -58.618 107.873 -27.820 1.00 44.47  ? 9   LEU A N   1 
ATOM   41   C CA  . LEU A 1 12  ? -59.310 106.670 -28.266 1.00 40.28  ? 9   LEU A CA  1 
ATOM   42   C C   . LEU A 1 12  ? -58.626 106.159 -29.526 1.00 39.81  ? 9   LEU A C   1 
ATOM   43   O O   . LEU A 1 12  ? -58.537 106.882 -30.524 1.00 49.97  ? 9   LEU A O   1 
ATOM   44   C CB  . LEU A 1 12  ? -60.789 106.954 -28.530 1.00 38.77  ? 9   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 12  ? -61.577 107.591 -27.384 1.00 47.44  ? 9   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 12  ? -63.035 107.783 -27.777 1.00 34.51  ? 9   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 12  ? -61.464 106.755 -26.118 1.00 41.16  ? 9   LEU A CD2 1 
ATOM   48   N N   . VAL A 1 13  ? -58.143 104.920 -29.478 1.00 33.77  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 13  ? -57.406 104.317 -30.583 1.00 38.09  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 13  ? -57.864 102.876 -30.750 1.00 32.95  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 13  ? -58.043 102.151 -29.766 1.00 37.23  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 13  ? -55.880 104.388 -30.352 1.00 42.65  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 13  ? -55.142 103.449 -31.295 1.00 32.83  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 13  ? -55.384 105.810 -30.539 1.00 42.34  ? 10  VAL A CG2 1 
ATOM   55   N N   . THR A 1 14  ? -58.060 102.465 -32.000 1.00 28.82  ? 11  THR A N   1 
ATOM   56   C CA  . THR A 1 14  ? -58.402 101.092 -32.341 1.00 39.75  ? 11  THR A CA  1 
ATOM   57   C C   . THR A 1 14  ? -57.189 100.415 -32.964 1.00 35.93  ? 11  THR A C   1 
ATOM   58   O O   . THR A 1 14  ? -56.583 100.953 -33.897 1.00 37.40  ? 11  THR A O   1 
ATOM   59   C CB  . THR A 1 14  ? -59.588 101.043 -33.308 1.00 39.96  ? 11  THR A CB  1 
ATOM   60   O OG1 . THR A 1 14  ? -60.739 101.631 -32.687 1.00 43.60  ? 11  THR A OG1 1 
ATOM   61   C CG2 . THR A 1 14  ? -59.905 99.604  -33.693 1.00 26.32  ? 11  THR A CG2 1 
ATOM   62   N N   . VAL A 1 15  ? -56.832 99.244  -32.439 1.00 37.01  ? 12  VAL A N   1 
ATOM   63   C CA  . VAL A 1 15  ? -55.751 98.443  -33.002 1.00 38.72  ? 12  VAL A CA  1 
ATOM   64   C C   . VAL A 1 15  ? -56.346 97.161  -33.568 1.00 36.30  ? 12  VAL A C   1 
ATOM   65   O O   . VAL A 1 15  ? -57.571 96.991  -33.588 1.00 48.69  ? 12  VAL A O   1 
ATOM   66   C CB  . VAL A 1 15  ? -54.664 98.145  -31.953 1.00 43.84  ? 12  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 15  ? -53.991 99.435  -31.507 1.00 29.88  ? 12  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 15  ? -55.260 97.412  -30.761 1.00 35.26  ? 12  VAL A CG2 1 
ATOM   69   N N   . ARG A 1 16  ? -55.487 96.251  -34.034 1.00 37.12  ? 13  ARG A N   1 
ATOM   70   C CA  . ARG A 1 16  ? -55.982 95.017  -34.635 1.00 40.36  ? 13  ARG A CA  1 
ATOM   71   C C   . ARG A 1 16  ? -56.714 94.148  -33.619 1.00 43.09  ? 13  ARG A C   1 
ATOM   72   O O   . ARG A 1 16  ? -57.658 93.436  -33.981 1.00 53.57  ? 13  ARG A O   1 
ATOM   73   C CB  . ARG A 1 16  ? -54.827 94.242  -35.272 1.00 45.16  ? 13  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 16  ? -55.257 92.977  -36.001 1.00 60.22  ? 13  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 16  ? -54.102 92.345  -36.758 1.00 56.45  ? 13  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 16  ? -53.554 93.244  -37.769 1.00 64.87  ? 13  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 16  ? -52.648 92.888  -38.674 1.00 74.86  ? 13  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 16  ? -52.188 91.644  -38.700 1.00 58.33  ? 13  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 16  ? -52.204 93.773  -39.556 1.00 53.75  ? 13  ARG A NH2 1 
ATOM   80   N N   . GLY A 1 17  ? -56.308 94.200  -32.348 1.00 44.35  ? 14  GLY A N   1 
ATOM   81   C CA  . GLY A 1 17  ? -56.958 93.388  -31.335 1.00 41.01  ? 14  GLY A CA  1 
ATOM   82   C C   . GLY A 1 17  ? -58.246 93.978  -30.809 1.00 41.13  ? 14  GLY A C   1 
ATOM   83   O O   . GLY A 1 17  ? -59.146 93.238  -30.400 1.00 35.79  ? 14  GLY A O   1 
ATOM   84   N N   . GLY A 1 18  ? -58.363 95.303  -30.809 1.00 36.06  ? 15  GLY A N   1 
ATOM   85   C CA  . GLY A 1 18  ? -59.571 95.934  -30.314 1.00 25.89  ? 15  GLY A CA  1 
ATOM   86   C C   . GLY A 1 18  ? -59.360 97.422  -30.112 1.00 32.91  ? 15  GLY A C   1 
ATOM   87   O O   . GLY A 1 18  ? -58.506 98.036  -30.755 1.00 37.01  ? 15  GLY A O   1 
ATOM   88   N N   . ARG A 1 19  ? -60.144 97.980  -29.195 1.00 30.48  ? 16  ARG A N   1 
ATOM   89   C CA  . ARG A 1 19  ? -60.159 99.409  -28.923 1.00 36.20  ? 16  ARG A CA  1 
ATOM   90   C C   . ARG A 1 19  ? -59.464 99.703  -27.599 1.00 32.98  ? 16  ARG A C   1 
ATOM   91   O O   . ARG A 1 19  ? -59.479 98.885  -26.674 1.00 30.24  ? 16  ARG A O   1 
ATOM   92   C CB  . ARG A 1 19  ? -61.596 99.935  -28.888 1.00 37.30  ? 16  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 19  ? -62.402 99.600  -30.134 1.00 54.63  ? 16  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 19  ? -63.850 99.294  -29.789 1.00 47.18  ? 16  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 19  ? -64.533 100.444 -29.204 1.00 57.21  ? 16  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 19  ? -65.721 100.383 -28.612 1.00 53.44  ? 16  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 19  ? -66.359 99.224  -28.519 1.00 47.50  ? 16  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 19  ? -66.269 101.480 -28.107 1.00 58.76  ? 16  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 20  ? -58.862 100.888 -27.514 1.00 24.71  ? 17  LEU A N   1 
ATOM   100  C CA  . LEU A 1 20  ? -58.097 101.292 -26.344 1.00 32.58  ? 17  LEU A CA  1 
ATOM   101  C C   . LEU A 1 20  ? -58.437 102.729 -25.980 1.00 32.91  ? 17  LEU A C   1 
ATOM   102  O O   . LEU A 1 20  ? -58.727 103.554 -26.850 1.00 38.55  ? 17  LEU A O   1 
ATOM   103  C CB  . LEU A 1 20  ? -56.585 101.174 -26.591 1.00 30.13  ? 17  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 20  ? -56.034 99.818  -27.035 1.00 32.13  ? 17  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 20  ? -54.621 99.974  -27.574 1.00 35.23  ? 17  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 20  ? -56.062 98.827  -25.885 1.00 23.50  ? 17  LEU A CD2 1 
ATOM   107  N N   . ARG A 1 21  ? -58.395 103.021 -24.681 1.00 24.93  ? 18  ARG A N   1 
ATOM   108  C CA  . ARG A 1 21  ? -58.507 104.384 -24.176 1.00 33.48  ? 18  ARG A CA  1 
ATOM   109  C C   . ARG A 1 21  ? -57.225 104.732 -23.437 1.00 37.07  ? 18  ARG A C   1 
ATOM   110  O O   . ARG A 1 21  ? -56.850 104.046 -22.479 1.00 31.47  ? 18  ARG A O   1 
ATOM   111  C CB  . ARG A 1 21  ? -59.715 104.554 -23.252 1.00 34.42  ? 18  ARG A CB  1 
ATOM   112  C CG  . ARG A 1 21  ? -59.721 105.901 -22.539 1.00 38.26  ? 18  ARG A CG  1 
ATOM   113  C CD  . ARG A 1 21  ? -60.936 106.086 -21.650 1.00 45.15  ? 18  ARG A CD  1 
ATOM   114  N NE  . ARG A 1 21  ? -62.149 106.366 -22.414 1.00 45.66  ? 18  ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 21  ? -63.083 105.462 -22.691 1.00 54.30  ? 18  ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 21  ? -62.949 104.214 -22.264 1.00 56.42  ? 18  ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 21  ? -64.155 105.808 -23.392 1.00 51.36  ? 18  ARG A NH2 1 
ATOM   118  N N   . GLY A 1 22  ? -56.558 105.799 -23.878 1.00 31.62  ? 19  GLY A N   1 
ATOM   119  C CA  . GLY A 1 22  ? -55.319 106.238 -23.280 1.00 31.64  ? 19  GLY A CA  1 
ATOM   120  C C   . GLY A 1 22  ? -55.524 107.340 -22.255 1.00 34.11  ? 19  GLY A C   1 
ATOM   121  O O   . GLY A 1 22  ? -56.639 107.642 -21.826 1.00 38.11  ? 19  GLY A O   1 
ATOM   122  N N   . ILE A 1 23  ? -54.408 107.949 -21.861 1.00 32.65  ? 20  ILE A N   1 
ATOM   123  C CA  . ILE A 1 23  ? -54.404 109.015 -20.868 1.00 35.74  ? 20  ILE A CA  1 
ATOM   124  C C   . ILE A 1 23  ? -53.494 110.133 -21.359 1.00 36.61  ? 20  ILE A C   1 
ATOM   125  O O   . ILE A 1 23  ? -52.523 109.897 -22.084 1.00 35.84  ? 20  ILE A O   1 
ATOM   126  C CB  . ILE A 1 23  ? -53.956 108.497 -19.479 1.00 28.73  ? 20  ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 23  ? -54.171 109.563 -18.401 1.00 35.74  ? 20  ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 23  ? -52.501 108.043 -19.514 1.00 28.31  ? 20  ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 23  ? -53.767 109.116 -17.012 1.00 29.62  ? 20  ILE A CD1 1 
ATOM   130  N N   . ARG A 1 24  ? -53.826 111.362 -20.973 1.00 36.39  ? 21  ARG A N   1 
ATOM   131  C CA  . ARG A 1 24  ? -53.022 112.525 -21.319 1.00 33.91  ? 21  ARG A CA  1 
ATOM   132  C C   . ARG A 1 24  ? -52.020 112.813 -20.208 1.00 36.51  ? 21  ARG A C   1 
ATOM   133  O O   . ARG A 1 24  ? -52.401 112.970 -19.044 1.00 42.34  ? 21  ARG A O   1 
ATOM   134  C CB  . ARG A 1 24  ? -53.909 113.748 -21.555 1.00 35.23  ? 21  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 24  ? -53.166 115.069 -21.445 1.00 43.13  ? 21  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 24  ? -53.976 116.212 -22.020 1.00 52.22  ? 21  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 24  ? -54.275 115.992 -23.431 1.00 71.02  ? 21  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 24  ? -54.781 116.916 -24.241 1.00 71.34  ? 21  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 24  ? -55.022 116.624 -25.511 1.00 67.47  ? 21  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 24  ? -55.041 118.132 -23.784 1.00 57.95  ? 21  ARG A NH2 1 
ATOM   141  N N   . LEU A 1 25  ? -50.744 112.883 -20.572 1.00 38.18  ? 22  LEU A N   1 
ATOM   142  C CA  . LEU A 1 25  ? -49.676 113.194 -19.634 1.00 36.49  ? 22  LEU A CA  1 
ATOM   143  C C   . LEU A 1 25  ? -49.211 114.629 -19.842 1.00 29.71  ? 22  LEU A C   1 
ATOM   144  O O   . LEU A 1 25  ? -49.086 115.093 -20.979 1.00 39.20  ? 22  LEU A O   1 
ATOM   145  C CB  . LEU A 1 25  ? -48.501 112.230 -19.807 1.00 31.46  ? 22  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 25  ? -48.832 110.741 -19.694 1.00 34.29  ? 22  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 25  ? -47.558 109.912 -19.742 1.00 41.80  ? 22  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 25  ? -49.618 110.453 -18.421 1.00 28.59  ? 22  LEU A CD2 1 
ATOM   149  N N   . LYS A 1 26  ? -48.950 115.324 -18.740 1.00 25.12  ? 23  LYS A N   1 
ATOM   150  C CA  . LYS A 1 26  ? -48.559 116.725 -18.774 1.00 37.09  ? 23  LYS A CA  1 
ATOM   151  C C   . LYS A 1 26  ? -47.043 116.857 -18.698 1.00 38.34  ? 23  LYS A C   1 
ATOM   152  O O   . LYS A 1 26  ? -46.382 116.148 -17.934 1.00 43.35  ? 23  LYS A O   1 
ATOM   153  C CB  . LYS A 1 26  ? -49.207 117.497 -17.622 1.00 31.65  ? 23  LYS A CB  1 
ATOM   154  C CG  . LYS A 1 26  ? -50.723 117.330 -17.530 1.00 54.67  ? 23  LYS A CG  1 
ATOM   155  C CD  . LYS A 1 26  ? -51.430 117.969 -18.717 1.00 71.08  ? 23  LYS A CD  1 
ATOM   156  C CE  . LYS A 1 26  ? -51.535 119.479 -18.555 1.00 70.65  ? 23  LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 26  ? -52.030 120.131 -19.802 1.00 60.25  ? 23  LYS A NZ  1 
ATOM   158  N N   . THR A 1 27  ? -46.502 117.763 -19.498 1.00 41.87  ? 24  THR A N   1 
ATOM   159  C CA  . THR A 1 27  ? -45.104 118.159 -19.474 1.00 41.48  ? 24  THR A CA  1 
ATOM   160  C C   . THR A 1 27  ? -45.044 119.677 -19.450 1.00 44.93  ? 24  THR A C   1 
ATOM   161  O O   . THR A 1 27  ? -46.003 120.348 -19.847 1.00 42.28  ? 24  THR A O   1 
ATOM   162  C CB  . THR A 1 27  ? -44.332 117.629 -20.694 1.00 37.85  ? 24  THR A CB  1 
ATOM   163  O OG1 . THR A 1 27  ? -44.726 118.349 -21.869 1.00 50.84  ? 24  THR A OG1 1 
ATOM   164  C CG2 . THR A 1 27  ? -44.594 116.142 -20.902 1.00 32.46  ? 24  THR A CG2 1 
ATOM   165  N N   . PRO A 1 28  ? -43.929 120.254 -18.987 1.00 44.90  ? 25  PRO A N   1 
ATOM   166  C CA  . PRO A 1 28  ? -43.791 121.720 -19.018 1.00 44.71  ? 25  PRO A CA  1 
ATOM   167  C C   . PRO A 1 28  ? -43.860 122.317 -20.416 1.00 44.56  ? 25  PRO A C   1 
ATOM   168  O O   . PRO A 1 28  ? -44.012 123.539 -20.534 1.00 43.87  ? 25  PRO A O   1 
ATOM   169  C CB  . PRO A 1 28  ? -42.415 121.960 -18.380 1.00 47.30  ? 25  PRO A CB  1 
ATOM   170  C CG  . PRO A 1 28  ? -42.188 120.769 -17.517 1.00 43.46  ? 25  PRO A CG  1 
ATOM   171  C CD  . PRO A 1 28  ? -42.824 119.615 -18.250 1.00 42.25  ? 25  PRO A CD  1 
ATOM   172  N N   . GLY A 1 29  ? -43.775 121.504 -21.467 1.00 42.99  ? 26  GLY A N   1 
ATOM   173  C CA  . GLY A 1 29  ? -43.811 122.016 -22.822 1.00 48.07  ? 26  GLY A CA  1 
ATOM   174  C C   . GLY A 1 29  ? -45.072 121.665 -23.585 1.00 44.94  ? 26  GLY A C   1 
ATOM   175  O O   . GLY A 1 29  ? -45.261 122.119 -24.717 1.00 56.26  ? 26  GLY A O   1 
ATOM   176  N N   . GLY A 1 30  ? -45.942 120.856 -22.984 1.00 47.33  ? 27  GLY A N   1 
ATOM   177  C CA  . GLY A 1 30  ? -47.177 120.468 -23.622 1.00 40.23  ? 27  GLY A CA  1 
ATOM   178  C C   . GLY A 1 30  ? -47.615 119.066 -23.252 1.00 43.40  ? 27  GLY A C   1 
ATOM   179  O O   . GLY A 1 30  ? -46.853 118.280 -22.681 1.00 44.82  ? 27  GLY A O   1 
ATOM   180  N N   . PRO A 1 31  ? -48.859 118.726 -23.574 1.00 45.20  ? 28  PRO A N   1 
ATOM   181  C CA  . PRO A 1 31  ? -49.380 117.401 -23.227 1.00 38.48  ? 28  PRO A CA  1 
ATOM   182  C C   . PRO A 1 31  ? -48.879 116.318 -24.173 1.00 38.47  ? 28  PRO A C   1 
ATOM   183  O O   . PRO A 1 31  ? -48.376 116.582 -25.266 1.00 39.36  ? 28  PRO A O   1 
ATOM   184  C CB  . PRO A 1 31  ? -50.896 117.578 -23.354 1.00 46.82  ? 28  PRO A CB  1 
ATOM   185  C CG  . PRO A 1 31  ? -51.050 118.643 -24.384 1.00 48.13  ? 28  PRO A CG  1 
ATOM   186  C CD  . PRO A 1 31  ? -49.884 119.580 -24.197 1.00 51.82  ? 28  PRO A CD  1 
ATOM   187  N N   . VAL A 1 32  ? -49.031 115.076 -23.719 1.00 37.54  ? 29  VAL A N   1 
ATOM   188  C CA  . VAL A 1 32  ? -48.629 113.891 -24.470 1.00 31.72  ? 29  VAL A CA  1 
ATOM   189  C C   . VAL A 1 32  ? -49.684 112.813 -24.264 1.00 23.95  ? 29  VAL A C   1 
ATOM   190  O O   . VAL A 1 32  ? -50.159 112.603 -23.143 1.00 40.86  ? 29  VAL A O   1 
ATOM   191  C CB  . VAL A 1 32  ? -47.234 113.385 -24.036 1.00 42.36  ? 29  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 32  ? -46.974 111.983 -24.569 1.00 33.16  ? 29  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 32  ? -46.146 114.337 -24.507 1.00 33.98  ? 29  VAL A CG2 1 
ATOM   194  N N   . SER A 1 33  ? -50.059 112.137 -25.347 1.00 25.76  ? 30  SER A N   1 
ATOM   195  C CA  . SER A 1 33  ? -51.002 111.030 -25.277 1.00 30.95  ? 30  SER A CA  1 
ATOM   196  C C   . SER A 1 33  ? -50.247 109.733 -25.016 1.00 36.34  ? 30  SER A C   1 
ATOM   197  O O   . SER A 1 33  ? -49.299 109.403 -25.736 1.00 35.49  ? 30  SER A O   1 
ATOM   198  C CB  . SER A 1 33  ? -51.811 110.923 -26.570 1.00 25.48  ? 30  SER A CB  1 
ATOM   199  O OG  . SER A 1 33  ? -52.539 112.113 -26.816 1.00 41.15  ? 30  SER A OG  1 
ATOM   200  N N   . ALA A 1 34  ? -50.671 109.001 -23.988 1.00 30.80  ? 31  ALA A N   1 
ATOM   201  C CA  . ALA A 1 34  ? -50.017 107.765 -23.584 1.00 30.50  ? 31  ALA A CA  1 
ATOM   202  C C   . ALA A 1 34  ? -51.034 106.637 -23.520 1.00 29.20  ? 31  ALA A C   1 
ATOM   203  O O   . ALA A 1 34  ? -52.177 106.841 -23.102 1.00 41.42  ? 31  ALA A O   1 
ATOM   204  C CB  . ALA A 1 34  ? -49.326 107.919 -22.224 1.00 27.25  ? 31  ALA A CB  1 
ATOM   205  N N   . PHE A 1 35  ? -50.607 105.444 -23.933 1.00 28.02  ? 32  PHE A N   1 
ATOM   206  C CA  . PHE A 1 35  ? -51.438 104.240 -23.925 1.00 23.53  ? 32  PHE A CA  1 
ATOM   207  C C   . PHE A 1 35  ? -50.645 103.167 -23.185 1.00 32.16  ? 32  PHE A C   1 
ATOM   208  O O   . PHE A 1 35  ? -49.851 102.439 -23.787 1.00 31.72  ? 32  PHE A O   1 
ATOM   209  C CB  . PHE A 1 35  ? -51.807 103.815 -25.344 1.00 23.93  ? 32  PHE A CB  1 
ATOM   210  C CG  . PHE A 1 35  ? -52.587 104.855 -26.100 1.00 33.41  ? 32  PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 35  ? -51.939 105.903 -26.734 1.00 31.25  ? 32  PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 35  ? -53.968 104.787 -26.171 1.00 37.74  ? 32  PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 35  ? -52.653 106.864 -27.423 1.00 39.35  ? 32  PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 35  ? -54.688 105.745 -26.860 1.00 37.98  ? 32  PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 35  ? -54.029 106.785 -27.485 1.00 41.14  ? 32  PHE A CZ  1 
ATOM   216  N N   . LEU A 1 36  ? -50.864 103.076 -21.876 1.00 34.39  ? 33  LEU A N   1 
ATOM   217  C CA  . LEU A 1 36  ? -50.059 102.242 -20.994 1.00 25.15  ? 33  LEU A CA  1 
ATOM   218  C C   . LEU A 1 36  ? -50.796 100.949 -20.672 1.00 32.73  ? 33  LEU A C   1 
ATOM   219  O O   . LEU A 1 36  ? -51.948 100.979 -20.228 1.00 34.94  ? 33  LEU A O   1 
ATOM   220  C CB  . LEU A 1 36  ? -49.731 102.992 -19.702 1.00 24.47  ? 33  LEU A CB  1 
ATOM   221  C CG  . LEU A 1 36  ? -49.266 104.440 -19.863 1.00 23.28  ? 33  LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 36  ? -49.060 105.093 -18.504 1.00 29.58  ? 33  LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 36  ? -47.995 104.509 -20.694 1.00 28.60  ? 33  LEU A CD2 1 
ATOM   224  N N   . GLY A 1 37  ? -50.126 99.820  -20.886 1.00 25.97  ? 34  GLY A N   1 
ATOM   225  C CA  . GLY A 1 37  ? -50.683 98.533  -20.519 1.00 24.23  ? 34  GLY A CA  1 
ATOM   226  C C   . GLY A 1 37  ? -51.459 97.852  -21.627 1.00 30.05  ? 34  GLY A C   1 
ATOM   227  O O   . GLY A 1 37  ? -52.493 97.228  -21.374 1.00 34.65  ? 34  GLY A O   1 
ATOM   228  N N   . ILE A 1 38  ? -50.970 97.961  -22.858 1.00 29.57  ? 35  ILE A N   1 
ATOM   229  C CA  . ILE A 1 38  ? -51.609 97.316  -24.001 1.00 24.39  ? 35  ILE A CA  1 
ATOM   230  C C   . ILE A 1 38  ? -51.183 95.853  -24.036 1.00 21.12  ? 35  ILE A C   1 
ATOM   231  O O   . ILE A 1 38  ? -49.984 95.561  -24.147 1.00 34.43  ? 35  ILE A O   1 
ATOM   232  C CB  . ILE A 1 38  ? -51.253 98.025  -25.317 1.00 24.02  ? 35  ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 38  ? -51.575 99.517  -25.224 1.00 24.49  ? 35  ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 38  ? -51.997 97.388  -26.480 1.00 21.90  ? 35  ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 38  ? -51.126 100.312 -26.429 1.00 23.60  ? 35  ILE A CD1 1 
ATOM   236  N N   . PRO A 1 39  ? -52.116 94.905  -23.942 1.00 32.04  ? 36  PRO A N   1 
ATOM   237  C CA  . PRO A 1 39  ? -51.743 93.484  -24.016 1.00 26.00  ? 36  PRO A CA  1 
ATOM   238  C C   . PRO A 1 39  ? -51.344 93.105  -25.435 1.00 32.85  ? 36  PRO A C   1 
ATOM   239  O O   . PRO A 1 39  ? -52.115 93.287  -26.380 1.00 31.64  ? 36  PRO A O   1 
ATOM   240  C CB  . PRO A 1 39  ? -53.018 92.759  -23.571 1.00 23.90  ? 36  PRO A CB  1 
ATOM   241  C CG  . PRO A 1 39  ? -54.121 93.709  -23.905 1.00 27.73  ? 36  PRO A CG  1 
ATOM   242  C CD  . PRO A 1 39  ? -53.559 95.091  -23.705 1.00 30.55  ? 36  PRO A CD  1 
ATOM   243  N N   . PHE A 1 40  ? -50.128 92.581  -25.581 1.00 23.74  ? 37  PHE A N   1 
ATOM   244  C CA  . PHE A 1 40  ? -49.645 92.096  -26.866 1.00 19.75  ? 37  PHE A CA  1 
ATOM   245  C C   . PHE A 1 40  ? -49.484 90.585  -26.900 1.00 21.19  ? 37  PHE A C   1 
ATOM   246  O O   . PHE A 1 40  ? -49.056 90.044  -27.926 1.00 32.57  ? 37  PHE A O   1 
ATOM   247  C CB  . PHE A 1 40  ? -48.314 92.771  -27.230 1.00 33.46  ? 37  PHE A CB  1 
ATOM   248  C CG  . PHE A 1 40  ? -47.167 92.403  -26.326 1.00 23.43  ? 37  PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 40  ? -46.338 91.336  -26.634 1.00 20.08  ? 37  PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 40  ? -46.907 93.136  -25.180 1.00 25.66  ? 37  PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 40  ? -45.280 90.998  -25.809 1.00 33.05  ? 37  PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 40  ? -45.849 92.805  -24.353 1.00 28.33  ? 37  PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 40  ? -45.036 91.735  -24.667 1.00 29.08  ? 37  PHE A CZ  1 
ATOM   254  N N   . ALA A 1 41  ? -49.815 89.889  -25.816 1.00 21.35  ? 38  ALA A N   1 
ATOM   255  C CA  . ALA A 1 41  ? -49.673 88.443  -25.771 1.00 27.87  ? 38  ALA A CA  1 
ATOM   256  C C   . ALA A 1 41  ? -50.656 87.868  -24.764 1.00 31.81  ? 38  ALA A C   1 
ATOM   257  O O   . ALA A 1 41  ? -51.111 88.554  -23.845 1.00 28.02  ? 38  ALA A O   1 
ATOM   258  C CB  . ALA A 1 41  ? -48.242 88.028  -25.408 1.00 27.05  ? 38  ALA A CB  1 
ATOM   259  N N   . GLU A 1 42  ? -50.984 86.595  -24.956 1.00 20.50  ? 39  GLU A N   1 
ATOM   260  C CA  . GLU A 1 42  ? -51.771 85.881  -23.966 1.00 30.36  ? 39  GLU A CA  1 
ATOM   261  C C   . GLU A 1 42  ? -50.965 85.743  -22.677 1.00 43.79  ? 39  GLU A C   1 
ATOM   262  O O   . GLU A 1 42  ? -49.741 85.584  -22.727 1.00 38.61  ? 39  GLU A O   1 
ATOM   263  C CB  . GLU A 1 42  ? -52.172 84.502  -24.487 1.00 32.35  ? 39  GLU A CB  1 
ATOM   264  C CG  . GLU A 1 42  ? -53.182 84.546  -25.619 1.00 49.81  ? 39  GLU A CG  1 
ATOM   265  C CD  . GLU A 1 42  ? -54.518 85.111  -25.177 1.00 52.93  ? 39  GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 42  ? -54.972 84.764  -24.066 1.00 52.38  ? 39  GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 42  ? -55.109 85.909  -25.935 1.00 51.45  ? 39  GLU A OE2 1 
ATOM   268  N N   . PRO A 1 43  ? -51.611 85.819  -21.517 1.00 41.54  ? 40  PRO A N   1 
ATOM   269  C CA  . PRO A 1 43  ? -50.887 85.683  -20.247 1.00 35.65  ? 40  PRO A CA  1 
ATOM   270  C C   . PRO A 1 43  ? -50.163 84.352  -20.169 1.00 38.85  ? 40  PRO A C   1 
ATOM   271  O O   . PRO A 1 43  ? -50.798 83.286  -20.156 1.00 38.90  ? 40  PRO A O   1 
ATOM   272  C CB  . PRO A 1 43  ? -52.001 85.776  -19.194 1.00 34.84  ? 40  PRO A CB  1 
ATOM   273  C CG  . PRO A 1 43  ? -53.089 86.547  -19.870 1.00 42.14  ? 40  PRO A CG  1 
ATOM   274  C CD  . PRO A 1 43  ? -53.036 86.134  -21.314 1.00 33.89  ? 40  PRO A CD  1 
ATOM   275  N N   . PRO A 1 44  ? -48.827 84.372  -20.114 1.00 37.63  ? 41  PRO A N   1 
ATOM   276  C CA  . PRO A 1 44  ? -48.044 83.119  -20.095 1.00 30.30  ? 41  PRO A CA  1 
ATOM   277  C C   . PRO A 1 44  ? -48.085 82.440  -18.733 1.00 31.91  ? 41  PRO A C   1 
ATOM   278  O O   . PRO A 1 44  ? -47.083 82.322  -18.021 1.00 38.92  ? 41  PRO A O   1 
ATOM   279  C CB  . PRO A 1 44  ? -46.641 83.605  -20.466 1.00 33.43  ? 41  PRO A CB  1 
ATOM   280  C CG  . PRO A 1 44  ? -46.576 84.990  -19.902 1.00 32.77  ? 41  PRO A CG  1 
ATOM   281  C CD  . PRO A 1 44  ? -47.963 85.566  -20.061 1.00 28.33  ? 41  PRO A CD  1 
ATOM   282  N N   . MET A 1 45  ? -49.271 81.972  -18.360 1.00 41.79  ? 42  MET A N   1 
ATOM   283  C CA  . MET A 1 45  ? -49.499 81.379  -17.055 1.00 40.64  ? 42  MET A CA  1 
ATOM   284  C C   . MET A 1 45  ? -49.917 79.921  -17.197 1.00 42.21  ? 42  MET A C   1 
ATOM   285  O O   . MET A 1 45  ? -50.318 79.465  -18.272 1.00 36.65  ? 42  MET A O   1 
ATOM   286  C CB  . MET A 1 45  ? -50.570 82.152  -16.280 1.00 36.51  ? 42  MET A CB  1 
ATOM   287  C CG  . MET A 1 45  ? -50.262 83.628  -16.091 1.00 32.45  ? 42  MET A CG  1 
ATOM   288  S SD  . MET A 1 45  ? -51.465 84.429  -15.016 1.00 66.76  ? 42  MET A SD  1 
ATOM   289  C CE  . MET A 1 45  ? -51.344 83.393  -13.560 1.00 49.39  ? 42  MET A CE  1 
ATOM   290  N N   . GLY A 1 46  ? -49.831 79.198  -16.082 1.00 36.73  ? 43  GLY A N   1 
ATOM   291  C CA  . GLY A 1 46  ? -50.204 77.805  -16.040 1.00 36.86  ? 43  GLY A CA  1 
ATOM   292  C C   . GLY A 1 46  ? -49.334 76.949  -16.936 1.00 44.41  ? 43  GLY A C   1 
ATOM   293  O O   . GLY A 1 46  ? -48.104 76.936  -16.821 1.00 37.14  ? 43  GLY A O   1 
ATOM   294  N N   . PRO A 1 47  ? -49.963 76.210  -17.855 1.00 45.44  ? 44  PRO A N   1 
ATOM   295  C CA  . PRO A 1 47  ? -49.187 75.400  -18.808 1.00 40.30  ? 44  PRO A CA  1 
ATOM   296  C C   . PRO A 1 47  ? -48.362 76.227  -19.779 1.00 35.44  ? 44  PRO A C   1 
ATOM   297  O O   . PRO A 1 47  ? -47.482 75.667  -20.446 1.00 38.35  ? 44  PRO A O   1 
ATOM   298  C CB  . PRO A 1 47  ? -50.266 74.594  -19.543 1.00 37.12  ? 44  PRO A CB  1 
ATOM   299  C CG  . PRO A 1 47  ? -51.501 75.427  -19.419 1.00 33.25  ? 44  PRO A CG  1 
ATOM   300  C CD  . PRO A 1 47  ? -51.415 76.089  -18.074 1.00 31.83  ? 44  PRO A CD  1 
ATOM   301  N N   . ARG A 1 48  ? -48.612 77.533  -19.878 1.00 37.27  ? 45  ARG A N   1 
ATOM   302  C CA  . ARG A 1 48  ? -47.846 78.403  -20.760 1.00 43.41  ? 45  ARG A CA  1 
ATOM   303  C C   . ARG A 1 48  ? -46.531 78.867  -20.149 1.00 41.78  ? 45  ARG A C   1 
ATOM   304  O O   . ARG A 1 48  ? -45.755 79.540  -20.837 1.00 34.59  ? 45  ARG A O   1 
ATOM   305  C CB  . ARG A 1 48  ? -48.683 79.624  -21.148 1.00 40.67  ? 45  ARG A CB  1 
ATOM   306  C CG  . ARG A 1 48  ? -49.723 79.352  -22.221 1.00 48.64  ? 45  ARG A CG  1 
ATOM   307  C CD  . ARG A 1 48  ? -50.729 80.488  -22.305 1.00 65.57  ? 45  ARG A CD  1 
ATOM   308  N NE  . ARG A 1 48  ? -51.512 80.439  -23.536 1.00 75.24  ? 45  ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 48  ? -52.573 79.659  -23.719 1.00 82.05  ? 45  ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 48  ? -53.223 79.685  -24.874 1.00 75.80  ? 45  ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 48  ? -52.982 78.850  -22.751 1.00 77.47  ? 45  ARG A NH2 1 
ATOM   312  N N   . ARG A 1 49  ? -46.266 78.538  -18.886 1.00 33.95  ? 46  ARG A N   1 
ATOM   313  C CA  . ARG A 1 49  ? -44.996 78.905  -18.274 1.00 35.11  ? 46  ARG A CA  1 
ATOM   314  C C   . ARG A 1 49  ? -43.847 78.224  -19.007 1.00 28.83  ? 46  ARG A C   1 
ATOM   315  O O   . ARG A 1 49  ? -43.930 77.045  -19.363 1.00 29.30  ? 46  ARG A O   1 
ATOM   316  C CB  . ARG A 1 49  ? -44.991 78.521  -16.792 1.00 31.54  ? 46  ARG A CB  1 
ATOM   317  C CG  . ARG A 1 49  ? -43.718 78.906  -16.049 1.00 32.77  ? 46  ARG A CG  1 
ATOM   318  C CD  . ARG A 1 49  ? -43.740 78.422  -14.604 1.00 29.02  ? 46  ARG A CD  1 
ATOM   319  N NE  . ARG A 1 49  ? -44.610 79.228  -13.752 1.00 26.06  ? 46  ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 49  ? -44.808 78.997  -12.457 1.00 28.70  ? 46  ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 49  ? -44.200 77.980  -11.862 1.00 29.04  ? 46  ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 49  ? -45.615 79.781  -11.756 1.00 24.24  ? 46  ARG A NH2 1 
ATOM   323  N N   . PHE A 1 50  ? -42.780 78.988  -19.250 1.00 27.62  ? 47  PHE A N   1 
ATOM   324  C CA  . PHE A 1 50  ? -41.571 78.572  -19.961 1.00 32.03  ? 47  PHE A CA  1 
ATOM   325  C C   . PHE A 1 50  ? -41.797 78.366  -21.454 1.00 35.53  ? 47  PHE A C   1 
ATOM   326  O O   . PHE A 1 50  ? -40.898 77.867  -22.143 1.00 38.84  ? 47  PHE A O   1 
ATOM   327  C CB  . PHE A 1 50  ? -40.963 77.294  -19.368 1.00 22.26  ? 47  PHE A CB  1 
ATOM   328  C CG  . PHE A 1 50  ? -40.759 77.350  -17.883 1.00 25.47  ? 47  PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 50  ? -40.179 78.459  -17.289 1.00 29.00  ? 47  PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 50  ? -41.156 76.295  -17.078 1.00 26.19  ? 47  PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 50  ? -39.992 78.511  -15.919 1.00 27.94  ? 47  PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 50  ? -40.974 76.341  -15.709 1.00 34.17  ? 47  PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 50  ? -40.390 77.450  -15.129 1.00 23.91  ? 47  PHE A CZ  1 
ATOM   334  N N   . LEU A 1 51  ? -42.962 78.735  -21.979 1.00 36.89  ? 48  LEU A N   1 
ATOM   335  C CA  . LEU A 1 51  ? -43.272 78.541  -23.386 1.00 37.27  ? 48  LEU A CA  1 
ATOM   336  C C   . LEU A 1 51  ? -43.197 79.857  -24.146 1.00 30.97  ? 48  LEU A C   1 
ATOM   337  O O   . LEU A 1 51  ? -43.330 80.936  -23.560 1.00 30.52  ? 48  LEU A O   1 
ATOM   338  C CB  . LEU A 1 51  ? -44.669 77.930  -23.545 1.00 33.48  ? 48  LEU A CB  1 
ATOM   339  C CG  . LEU A 1 51  ? -44.837 76.490  -23.057 1.00 41.43  ? 48  LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 51  ? -46.193 75.943  -23.472 1.00 34.13  ? 48  LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 51  ? -43.714 75.609  -23.581 1.00 34.35  ? 48  LEU A CD2 1 
ATOM   342  N N   . PRO A 1 52  ? -42.967 79.804  -25.458 1.00 32.62  ? 49  PRO A N   1 
ATOM   343  C CA  . PRO A 1 52  ? -42.934 81.035  -26.241 1.00 31.70  ? 49  PRO A CA  1 
ATOM   344  C C   . PRO A 1 52  ? -44.271 81.743  -26.182 1.00 30.28  ? 49  PRO A C   1 
ATOM   345  O O   . PRO A 1 52  ? -45.320 81.111  -25.957 1.00 27.43  ? 49  PRO A O   1 
ATOM   346  C CB  . PRO A 1 52  ? -42.619 80.541  -27.660 1.00 22.14  ? 49  PRO A CB  1 
ATOM   347  C CG  . PRO A 1 52  ? -41.911 79.250  -27.457 1.00 26.59  ? 49  PRO A CG  1 
ATOM   348  C CD  . PRO A 1 52  ? -42.553 78.632  -26.249 1.00 36.13  ? 49  PRO A CD  1 
ATOM   349  N N   . PRO A 1 53  ? -44.284 83.061  -26.372 1.00 25.56  ? 50  PRO A N   1 
ATOM   350  C CA  . PRO A 1 53  ? -45.540 83.804  -26.250 1.00 25.46  ? 50  PRO A CA  1 
ATOM   351  C C   . PRO A 1 53  ? -46.449 83.590  -27.450 1.00 38.59  ? 50  PRO A C   1 
ATOM   352  O O   . PRO A 1 53  ? -45.998 83.398  -28.583 1.00 33.27  ? 50  PRO A O   1 
ATOM   353  C CB  . PRO A 1 53  ? -45.078 85.262  -26.161 1.00 23.39  ? 50  PRO A CB  1 
ATOM   354  C CG  . PRO A 1 53  ? -43.805 85.281  -26.936 1.00 21.32  ? 50  PRO A CG  1 
ATOM   355  C CD  . PRO A 1 53  ? -43.146 83.950  -26.663 1.00 20.30  ? 50  PRO A CD  1 
ATOM   356  N N   . GLU A 1 54  ? -47.755 83.617  -27.178 1.00 41.73  ? 51  GLU A N   1 
ATOM   357  C CA  . GLU A 1 54  ? -48.805 83.585  -28.180 1.00 40.38  ? 51  GLU A CA  1 
ATOM   358  C C   . GLU A 1 54  ? -49.432 84.966  -28.316 1.00 36.49  ? 51  GLU A C   1 
ATOM   359  O O   . GLU A 1 54  ? -49.574 85.677  -27.315 1.00 34.64  ? 51  GLU A O   1 
ATOM   360  C CB  . GLU A 1 54  ? -49.894 82.571  -27.812 1.00 39.49  ? 51  GLU A CB  1 
ATOM   361  C CG  . GLU A 1 54  ? -49.417 81.132  -27.759 1.00 52.91  ? 51  GLU A CG  1 
ATOM   362  C CD  . GLU A 1 54  ? -50.442 80.207  -27.133 1.00 71.69  ? 51  GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 54  ? -51.250 80.685  -26.309 1.00 63.90  ? 51  GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 54  ? -50.444 79.004  -27.468 1.00 73.62  ? 51  GLU A OE2 1 
ATOM   365  N N   . PRO A 1 55  ? -49.806 85.378  -29.528 1.00 39.14  ? 52  PRO A N   1 
ATOM   366  C CA  . PRO A 1 55  ? -50.391 86.713  -29.699 1.00 37.67  ? 52  PRO A CA  1 
ATOM   367  C C   . PRO A 1 55  ? -51.680 86.868  -28.907 1.00 40.49  ? 52  PRO A C   1 
ATOM   368  O O   . PRO A 1 55  ? -52.454 85.922  -28.740 1.00 36.95  ? 52  PRO A O   1 
ATOM   369  C CB  . PRO A 1 55  ? -50.650 86.799  -31.208 1.00 39.21  ? 52  PRO A CB  1 
ATOM   370  C CG  . PRO A 1 55  ? -49.720 85.797  -31.812 1.00 37.50  ? 52  PRO A CG  1 
ATOM   371  C CD  . PRO A 1 55  ? -49.631 84.682  -30.813 1.00 38.06  ? 52  PRO A CD  1 
ATOM   372  N N   . LYS A 1 56  ? -51.898 88.083  -28.408 1.00 32.29  ? 53  LYS A N   1 
ATOM   373  C CA  . LYS A 1 56  ? -53.113 88.389  -27.665 1.00 34.89  ? 53  LYS A CA  1 
ATOM   374  C C   . LYS A 1 56  ? -54.327 88.279  -28.577 1.00 38.95  ? 53  LYS A C   1 
ATOM   375  O O   . LYS A 1 56  ? -54.390 88.935  -29.622 1.00 34.96  ? 53  LYS A O   1 
ATOM   376  C CB  . LYS A 1 56  ? -53.018 89.791  -27.065 1.00 30.52  ? 53  LYS A CB  1 
ATOM   377  C CG  . LYS A 1 56  ? -54.302 90.295  -26.421 1.00 35.53  ? 53  LYS A CG  1 
ATOM   378  C CD  . LYS A 1 56  ? -54.647 89.517  -25.161 1.00 37.39  ? 53  LYS A CD  1 
ATOM   379  C CE  . LYS A 1 56  ? -55.840 90.135  -24.448 1.00 38.91  ? 53  LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 56  ? -56.166 89.424  -23.181 1.00 37.80  ? 53  LYS A NZ  1 
ATOM   381  N N   . GLN A 1 57  ? -55.284 87.442  -28.187 1.00 44.48  ? 54  GLN A N   1 
ATOM   382  C CA  . GLN A 1 57  ? -56.494 87.282  -28.974 1.00 43.68  ? 54  GLN A CA  1 
ATOM   383  C C   . GLN A 1 57  ? -57.329 88.561  -28.928 1.00 34.22  ? 54  GLN A C   1 
ATOM   384  O O   . GLN A 1 57  ? -57.281 89.308  -27.947 1.00 35.32  ? 54  GLN A O   1 
ATOM   385  C CB  . GLN A 1 57  ? -57.314 86.100  -28.461 1.00 41.68  ? 54  GLN A CB  1 
ATOM   386  C CG  . GLN A 1 57  ? -56.641 84.744  -28.639 1.00 48.89  ? 54  GLN A CG  1 
ATOM   387  C CD  . GLN A 1 57  ? -56.538 84.321  -30.095 1.00 69.67  ? 54  GLN A CD  1 
ATOM   388  O OE1 . GLN A 1 57  ? -55.733 84.857  -30.858 1.00 65.96  ? 54  GLN A OE1 1 
ATOM   389  N NE2 . GLN A 1 57  ? -57.355 83.349  -30.486 1.00 77.02  ? 54  GLN A NE2 1 
ATOM   390  N N   . PRO A 1 58  ? -58.090 88.844  -29.987 1.00 43.02  ? 55  PRO A N   1 
ATOM   391  C CA  . PRO A 1 58  ? -58.892 90.073  -30.009 1.00 39.93  ? 55  PRO A CA  1 
ATOM   392  C C   . PRO A 1 58  ? -59.897 90.111  -28.868 1.00 35.26  ? 55  PRO A C   1 
ATOM   393  O O   . PRO A 1 58  ? -60.404 89.081  -28.418 1.00 28.77  ? 55  PRO A O   1 
ATOM   394  C CB  . PRO A 1 58  ? -59.594 90.015  -31.371 1.00 42.86  ? 55  PRO A CB  1 
ATOM   395  C CG  . PRO A 1 58  ? -58.722 89.136  -32.206 1.00 36.79  ? 55  PRO A CG  1 
ATOM   396  C CD  . PRO A 1 58  ? -58.169 88.110  -31.261 1.00 35.82  ? 55  PRO A CD  1 
ATOM   397  N N   . TRP A 1 59  ? -60.180 91.323  -28.400 1.00 32.15  ? 56  TRP A N   1 
ATOM   398  C CA  . TRP A 1 59  ? -61.046 91.543  -27.255 1.00 36.76  ? 56  TRP A CA  1 
ATOM   399  C C   . TRP A 1 59  ? -62.232 92.413  -27.649 1.00 48.34  ? 56  TRP A C   1 
ATOM   400  O O   . TRP A 1 59  ? -62.202 93.133  -28.651 1.00 34.94  ? 56  TRP A O   1 
ATOM   401  C CB  . TRP A 1 59  ? -60.281 92.204  -26.101 1.00 27.50  ? 56  TRP A CB  1 
ATOM   402  C CG  . TRP A 1 59  ? -59.707 93.540  -26.459 1.00 31.92  ? 56  TRP A CG  1 
ATOM   403  C CD1 . TRP A 1 59  ? -60.335 94.750  -26.383 1.00 32.52  ? 56  TRP A CD1 1 
ATOM   404  C CD2 . TRP A 1 59  ? -58.389 93.804  -26.955 1.00 30.75  ? 56  TRP A CD2 1 
ATOM   405  N NE1 . TRP A 1 59  ? -59.489 95.750  -26.798 1.00 31.84  ? 56  TRP A NE1 1 
ATOM   406  C CE2 . TRP A 1 59  ? -58.288 95.195  -27.155 1.00 36.54  ? 56  TRP A CE2 1 
ATOM   407  C CE3 . TRP A 1 59  ? -57.284 92.998  -27.249 1.00 35.73  ? 56  TRP A CE3 1 
ATOM   408  C CZ2 . TRP A 1 59  ? -57.127 95.798  -27.634 1.00 27.42  ? 56  TRP A CZ2 1 
ATOM   409  C CZ3 . TRP A 1 59  ? -56.133 93.599  -27.725 1.00 34.53  ? 56  TRP A CZ3 1 
ATOM   410  C CH2 . TRP A 1 59  ? -56.064 94.985  -27.913 1.00 27.62  ? 56  TRP A CH2 1 
ATOM   411  N N   . SER A 1 60  ? -63.282 92.335  -26.837 1.00 43.22  ? 57  SER A N   1 
ATOM   412  C CA  . SER A 1 60  ? -64.468 93.159  -27.000 1.00 41.01  ? 57  SER A CA  1 
ATOM   413  C C   . SER A 1 60  ? -64.404 94.367  -26.072 1.00 38.64  ? 57  SER A C   1 
ATOM   414  O O   . SER A 1 60  ? -63.731 94.347  -25.037 1.00 45.49  ? 57  SER A O   1 
ATOM   415  C CB  . SER A 1 60  ? -65.739 92.353  -26.721 1.00 39.82  ? 57  SER A CB  1 
ATOM   416  O OG  . SER A 1 60  ? -65.794 91.184  -27.521 1.00 51.17  ? 57  SER A OG  1 
ATOM   417  N N   . GLY A 1 61  ? -65.110 95.424  -26.457 1.00 34.71  ? 58  GLY A N   1 
ATOM   418  C CA  . GLY A 1 61  ? -65.150 96.628  -25.653 1.00 48.24  ? 58  GLY A CA  1 
ATOM   419  C C   . GLY A 1 61  ? -63.860 97.427  -25.729 1.00 47.68  ? 58  GLY A C   1 
ATOM   420  O O   . GLY A 1 61  ? -63.031 97.263  -26.630 1.00 49.15  ? 58  GLY A O   1 
ATOM   421  N N   . VAL A 1 62  ? -63.692 98.308  -24.746 1.00 46.92  ? 59  VAL A N   1 
ATOM   422  C CA  . VAL A 1 62  ? -62.555 99.218  -24.678 1.00 38.42  ? 59  VAL A CA  1 
ATOM   423  C C   . VAL A 1 62  ? -61.659 98.781  -23.526 1.00 45.54  ? 59  VAL A C   1 
ATOM   424  O O   . VAL A 1 62  ? -62.068 98.829  -22.359 1.00 41.53  ? 59  VAL A O   1 
ATOM   425  C CB  . VAL A 1 62  ? -63.007 100.675 -24.501 1.00 41.59  ? 59  VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 62  ? -61.812 101.614 -24.566 1.00 36.33  ? 59  VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 62  ? -64.042 101.039 -25.554 1.00 42.81  ? 59  VAL A CG2 1 
ATOM   428  N N   . VAL A 1 63  ? -60.443 98.356  -23.853 1.00 36.12  ? 60  VAL A N   1 
ATOM   429  C CA  . VAL A 1 63  ? -59.450 98.032  -22.836 1.00 35.93  ? 60  VAL A CA  1 
ATOM   430  C C   . VAL A 1 63  ? -58.891 99.327  -22.266 1.00 36.17  ? 60  VAL A C   1 
ATOM   431  O O   . VAL A 1 63  ? -58.493 100.229 -23.013 1.00 34.53  ? 60  VAL A O   1 
ATOM   432  C CB  . VAL A 1 63  ? -58.334 97.152  -23.423 1.00 34.68  ? 60  VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 63  ? -57.077 97.241  -22.570 1.00 30.70  ? 60  VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 63  ? -58.798 95.711  -23.521 1.00 31.70  ? 60  VAL A CG2 1 
ATOM   435  N N   . ASP A 1 64  ? -58.870 99.429  -20.940 1.00 34.41  ? 61  ASP A N   1 
ATOM   436  C CA  . ASP A 1 64  ? -58.331 100.615 -20.289 1.00 38.34  ? 61  ASP A CA  1 
ATOM   437  C C   . ASP A 1 64  ? -56.813 100.623 -20.412 1.00 39.81  ? 61  ASP A C   1 
ATOM   438  O O   . ASP A 1 64  ? -56.144 99.673  -19.991 1.00 33.01  ? 61  ASP A O   1 
ATOM   439  C CB  . ASP A 1 64  ? -58.749 100.656 -18.823 1.00 39.69  ? 61  ASP A CB  1 
ATOM   440  C CG  . ASP A 1 64  ? -58.412 101.977 -18.160 1.00 46.90  ? 61  ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 64  ? -59.254 102.899 -18.205 1.00 48.44  ? 61  ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 64  ? -57.301 102.097 -17.603 1.00 45.33  ? 61  ASP A OD2 1 
ATOM   443  N N   . ALA A 1 65  ? -56.271 101.691 -20.994 1.00 38.82  ? 62  ALA A N   1 
ATOM   444  C CA  . ALA A 1 65  ? -54.829 101.827 -21.144 1.00 26.99  ? 62  ALA A CA  1 
ATOM   445  C C   . ALA A 1 65  ? -54.350 103.123 -20.506 1.00 29.50  ? 62  ALA A C   1 
ATOM   446  O O   . ALA A 1 65  ? -53.614 103.896 -21.128 1.00 30.21  ? 62  ALA A O   1 
ATOM   447  C CB  . ALA A 1 65  ? -54.431 101.775 -22.621 1.00 30.79  ? 62  ALA A CB  1 
ATOM   448  N N   . THR A 1 66  ? -54.758 103.364 -19.261 1.00 29.53  ? 63  THR A N   1 
ATOM   449  C CA  . THR A 1 66  ? -54.447 104.602 -18.561 1.00 35.98  ? 63  THR A CA  1 
ATOM   450  C C   . THR A 1 66  ? -53.397 104.432 -17.472 1.00 24.67  ? 63  THR A C   1 
ATOM   451  O O   . THR A 1 66  ? -53.033 105.420 -16.825 1.00 28.94  ? 63  THR A O   1 
ATOM   452  C CB  . THR A 1 66  ? -55.722 105.198 -17.952 1.00 32.82  ? 63  THR A CB  1 
ATOM   453  O OG1 . THR A 1 66  ? -56.285 104.273 -17.014 1.00 29.59  ? 63  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 66  ? -56.745 105.490 -19.039 1.00 29.05  ? 63  THR A CG2 1 
ATOM   455  N N   . THR A 1 67  ? -52.903 103.216 -17.247 1.00 24.36  ? 64  THR A N   1 
ATOM   456  C CA  . THR A 1 67  ? -51.902 102.985 -16.218 1.00 27.81  ? 64  THR A CA  1 
ATOM   457  C C   . THR A 1 67  ? -51.060 101.777 -16.598 1.00 22.60  ? 64  THR A C   1 
ATOM   458  O O   . THR A 1 67  ? -51.484 100.918 -17.376 1.00 23.41  ? 64  THR A O   1 
ATOM   459  C CB  . THR A 1 67  ? -52.542 102.774 -14.839 1.00 36.21  ? 64  THR A CB  1 
ATOM   460  O OG1 . THR A 1 67  ? -51.515 102.588 -13.857 1.00 42.08  ? 64  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 67  ? -53.451 101.554 -14.852 1.00 15.88  ? 64  THR A CG2 1 
ATOM   462  N N   . PHE A 1 68  ? -49.853 101.726 -16.040 1.00 23.79  ? 65  PHE A N   1 
ATOM   463  C CA  . PHE A 1 68  ? -48.959 100.606 -16.288 1.00 27.00  ? 65  PHE A CA  1 
ATOM   464  C C   . PHE A 1 68  ? -49.536 99.319  -15.710 1.00 22.56  ? 65  PHE A C   1 
ATOM   465  O O   . PHE A 1 68  ? -50.221 99.321  -14.684 1.00 23.47  ? 65  PHE A O   1 
ATOM   466  C CB  . PHE A 1 68  ? -47.582 100.871 -15.682 1.00 21.33  ? 65  PHE A CB  1 
ATOM   467  C CG  . PHE A 1 68  ? -46.809 101.957 -16.374 1.00 18.92  ? 65  PHE A CG  1 
ATOM   468  C CD1 . PHE A 1 68  ? -46.270 101.747 -17.633 1.00 22.88  ? 65  PHE A CD1 1 
ATOM   469  C CD2 . PHE A 1 68  ? -46.605 103.182 -15.759 1.00 23.45  ? 65  PHE A CD2 1 
ATOM   470  C CE1 . PHE A 1 68  ? -45.553 102.742 -18.271 1.00 27.03  ? 65  PHE A CE1 1 
ATOM   471  C CE2 . PHE A 1 68  ? -45.888 104.181 -16.392 1.00 24.32  ? 65  PHE A CE2 1 
ATOM   472  C CZ  . PHE A 1 68  ? -45.361 103.961 -17.650 1.00 31.50  ? 65  PHE A CZ  1 
ATOM   473  N N   . GLN A 1 69  ? -49.247 98.210  -16.382 1.00 16.92  ? 66  GLN A N   1 
ATOM   474  C CA  . GLN A 1 69  ? -49.723 96.906  -15.952 1.00 20.63  ? 66  GLN A CA  1 
ATOM   475  C C   . GLN A 1 69  ? -48.742 96.298  -14.951 1.00 30.21  ? 66  GLN A C   1 
ATOM   476  O O   . GLN A 1 69  ? -47.859 96.975  -14.417 1.00 21.54  ? 66  GLN A O   1 
ATOM   477  C CB  . GLN A 1 69  ? -49.946 96.001  -17.162 1.00 21.00  ? 66  GLN A CB  1 
ATOM   478  C CG  . GLN A 1 69  ? -51.388 95.959  -17.644 1.00 30.79  ? 66  GLN A CG  1 
ATOM   479  C CD  . GLN A 1 69  ? -52.297 95.195  -16.698 1.00 38.73  ? 66  GLN A CD  1 
ATOM   480  O OE1 . GLN A 1 69  ? -51.830 94.498  -15.796 1.00 39.31  ? 66  GLN A OE1 1 
ATOM   481  N NE2 . GLN A 1 69  ? -53.603 95.322  -16.902 1.00 36.14  ? 66  GLN A NE2 1 
ATOM   482  N N   . SER A 1 70  ? -48.890 95.003  -14.690 1.00 26.25  ? 67  SER A N   1 
ATOM   483  C CA  . SER A 1 70  ? -48.100 94.332  -13.671 1.00 31.70  ? 67  SER A CA  1 
ATOM   484  C C   . SER A 1 70  ? -46.670 94.098  -14.143 1.00 31.58  ? 67  SER A C   1 
ATOM   485  O O   . SER A 1 70  ? -46.396 93.968  -15.340 1.00 32.72  ? 67  SER A O   1 
ATOM   486  C CB  . SER A 1 70  ? -48.742 92.998  -13.291 1.00 20.05  ? 67  SER A CB  1 
ATOM   487  O OG  . SER A 1 70  ? -50.045 93.190  -12.768 1.00 30.53  ? 67  SER A OG  1 
ATOM   488  N N   . VAL A 1 71  ? -45.757 94.044  -13.181 1.00 26.75  ? 68  VAL A N   1 
ATOM   489  C CA  . VAL A 1 71  ? -44.357 93.728  -13.431 1.00 26.16  ? 68  VAL A CA  1 
ATOM   490  C C   . VAL A 1 71  ? -44.195 92.216  -13.425 1.00 22.41  ? 68  VAL A C   1 
ATOM   491  O O   . VAL A 1 71  ? -44.818 91.516  -12.618 1.00 23.46  ? 68  VAL A O   1 
ATOM   492  C CB  . VAL A 1 71  ? -43.453 94.394  -12.374 1.00 28.09  ? 68  VAL A CB  1 
ATOM   493  C CG1 . VAL A 1 71  ? -41.992 94.044  -12.612 1.00 27.56  ? 68  VAL A CG1 1 
ATOM   494  C CG2 . VAL A 1 71  ? -43.655 95.901  -12.377 1.00 22.03  ? 68  VAL A CG2 1 
ATOM   495  N N   . CYS A 1 72  ? -43.372 91.702  -14.337 1.00 19.12  ? 69  CYS A N   1 
ATOM   496  C CA  . CYS A 1 72  ? -43.103 90.271  -14.362 1.00 17.35  ? 69  CYS A CA  1 
ATOM   497  C C   . CYS A 1 72  ? -42.398 89.845  -13.080 1.00 24.83  ? 69  CYS A C   1 
ATOM   498  O O   . CYS A 1 72  ? -41.640 90.611  -12.479 1.00 22.12  ? 69  CYS A O   1 
ATOM   499  C CB  . CYS A 1 72  ? -42.253 89.905  -15.579 1.00 27.64  ? 69  CYS A CB  1 
ATOM   500  S SG  . CYS A 1 72  ? -42.968 90.376  -17.171 1.00 35.13  ? 69  CYS A SG  1 
ATOM   501  N N   . TYR A 1 73  ? -42.669 88.611  -12.655 1.00 21.18  ? 70  TYR A N   1 
ATOM   502  C CA  . TYR A 1 73  ? -42.078 88.092  -11.428 1.00 25.47  ? 70  TYR A CA  1 
ATOM   503  C C   . TYR A 1 73  ? -40.558 88.137  -11.505 1.00 27.69  ? 70  TYR A C   1 
ATOM   504  O O   . TYR A 1 73  ? -39.956 87.642  -12.463 1.00 22.00  ? 70  TYR A O   1 
ATOM   505  C CB  . TYR A 1 73  ? -42.554 86.663  -11.174 1.00 24.79  ? 70  TYR A CB  1 
ATOM   506  C CG  . TYR A 1 73  ? -43.651 86.563  -10.140 1.00 31.59  ? 70  TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 73  ? -44.984 86.481  -10.518 1.00 29.73  ? 70  TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 73  ? -43.352 86.557  -8.784  1.00 27.39  ? 70  TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 73  ? -45.989 86.390  -9.573  1.00 31.01  ? 70  TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 73  ? -44.350 86.467  -7.832  1.00 25.35  ? 70  TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 73  ? -45.666 86.384  -8.233  1.00 31.93  ? 70  TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 73  ? -46.663 86.294  -7.289  1.00 45.47  ? 70  TYR A OH  1 
ATOM   513  N N   . GLN A 1 74  ? -39.939 88.736  -10.492 1.00 20.92  ? 71  GLN A N   1 
ATOM   514  C CA  . GLN A 1 74  ? -38.503 88.964  -10.521 1.00 22.94  ? 71  GLN A CA  1 
ATOM   515  C C   . GLN A 1 74  ? -37.993 89.159  -9.102  1.00 27.48  ? 71  GLN A C   1 
ATOM   516  O O   . GLN A 1 74  ? -38.752 89.480  -8.184  1.00 20.78  ? 71  GLN A O   1 
ATOM   517  C CB  . GLN A 1 74  ? -38.154 90.178  -11.387 1.00 19.40  ? 71  GLN A CB  1 
ATOM   518  C CG  . GLN A 1 74  ? -38.732 91.486  -10.873 1.00 14.90  ? 71  GLN A CG  1 
ATOM   519  C CD  . GLN A 1 74  ? -38.575 92.622  -11.864 1.00 19.00  ? 71  GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 74  ? -38.011 93.668  -11.544 1.00 21.66  ? 71  GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 74  ? -39.082 92.423  -13.075 1.00 23.70  ? 71  GLN A NE2 1 
ATOM   522  N N   . TYR A 1 75  ? -36.688 88.959  -8.943  1.00 27.31  ? 72  TYR A N   1 
ATOM   523  C CA  . TYR A 1 75  ? -36.031 89.214  -7.671  1.00 20.08  ? 72  TYR A CA  1 
ATOM   524  C C   . TYR A 1 75  ? -36.069 90.702  -7.346  1.00 26.58  ? 72  TYR A C   1 
ATOM   525  O O   . TYR A 1 75  ? -35.932 91.552  -8.231  1.00 30.72  ? 72  TYR A O   1 
ATOM   526  C CB  . TYR A 1 75  ? -34.586 88.714  -7.722  1.00 21.90  ? 72  TYR A CB  1 
ATOM   527  C CG  . TYR A 1 75  ? -33.736 89.104  -6.535  1.00 25.38  ? 72  TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 75  ? -33.742 88.345  -5.372  1.00 27.30  ? 72  TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 75  ? -32.913 90.223  -6.583  1.00 28.37  ? 72  TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 75  ? -32.961 88.695  -4.286  1.00 28.10  ? 72  TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 75  ? -32.131 90.581  -5.503  1.00 30.36  ? 72  TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 75  ? -32.158 89.814  -4.358  1.00 32.80  ? 72  TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 75  ? -31.379 90.168  -3.281  1.00 37.05  ? 72  TYR A OH  1 
ATOM   534  N N   . VAL A 1 76  ? -36.262 91.016  -6.068  1.00 20.96  ? 73  VAL A N   1 
ATOM   535  C CA  . VAL A 1 76  ? -36.312 92.391  -5.583  1.00 19.43  ? 73  VAL A CA  1 
ATOM   536  C C   . VAL A 1 76  ? -35.038 92.667  -4.799  1.00 26.25  ? 73  VAL A C   1 
ATOM   537  O O   . VAL A 1 76  ? -34.698 91.922  -3.871  1.00 28.19  ? 73  VAL A O   1 
ATOM   538  C CB  . VAL A 1 76  ? -37.560 92.641  -4.720  1.00 31.80  ? 73  VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 76  ? -37.504 94.026  -4.094  1.00 23.93  ? 73  VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 76  ? -38.820 92.484  -5.559  1.00 25.41  ? 73  VAL A CG2 1 
ATOM   541  N N   . ASP A 1 77  ? -34.337 93.736  -5.171  1.00 30.89  ? 74  ASP A N   1 
ATOM   542  C CA  . ASP A 1 77  ? -33.062 94.060  -4.547  1.00 29.53  ? 74  ASP A CA  1 
ATOM   543  C C   . ASP A 1 77  ? -33.272 94.506  -3.105  1.00 28.79  ? 74  ASP A C   1 
ATOM   544  O O   . ASP A 1 77  ? -34.102 95.377  -2.826  1.00 28.89  ? 74  ASP A O   1 
ATOM   545  C CB  . ASP A 1 77  ? -32.352 95.152  -5.349  1.00 31.32  ? 74  ASP A CB  1 
ATOM   546  C CG  . ASP A 1 77  ? -30.909 95.355  -4.919  1.00 40.82  ? 74  ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 77  ? -30.671 95.716  -3.747  1.00 32.18  ? 74  ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 77  ? -30.009 95.148  -5.759  1.00 38.97  ? 74  ASP A OD2 1 
ATOM   549  N N   . THR A 1 78  ? -32.512 93.903  -2.186  1.00 29.50  ? 75  THR A N   1 
ATOM   550  C CA  . THR A 1 78  ? -32.604 94.223  -0.765  1.00 39.56  ? 75  THR A CA  1 
ATOM   551  C C   . THR A 1 78  ? -31.242 94.557  -0.164  1.00 38.34  ? 75  THR A C   1 
ATOM   552  O O   . THR A 1 78  ? -31.070 94.460  1.056   1.00 38.72  ? 75  THR A O   1 
ATOM   553  C CB  . THR A 1 78  ? -33.246 93.070  0.013   1.00 39.88  ? 75  THR A CB  1 
ATOM   554  O OG1 . THR A 1 78  ? -32.494 91.869  -0.203  1.00 36.19  ? 75  THR A OG1 1 
ATOM   555  C CG2 . THR A 1 78  ? -34.684 92.853  -0.435  1.00 32.59  ? 75  THR A CG2 1 
ATOM   556  N N   . LEU A 1 79  ? -30.269 94.950  -0.991  1.00 32.48  ? 76  LEU A N   1 
ATOM   557  C CA  . LEU A 1 79  ? -28.935 95.239  -0.474  1.00 36.06  ? 76  LEU A CA  1 
ATOM   558  C C   . LEU A 1 79  ? -28.936 96.485  0.404   1.00 34.61  ? 76  LEU A C   1 
ATOM   559  O O   . LEU A 1 79  ? -28.283 96.512  1.454   1.00 36.67  ? 76  LEU A O   1 
ATOM   560  C CB  . LEU A 1 79  ? -27.946 95.397  -1.629  1.00 33.71  ? 76  LEU A CB  1 
ATOM   561  C CG  . LEU A 1 79  ? -26.484 95.622  -1.236  1.00 43.37  ? 76  LEU A CG  1 
ATOM   562  C CD1 . LEU A 1 79  ? -25.953 94.447  -0.427  1.00 41.08  ? 76  LEU A CD1 1 
ATOM   563  C CD2 . LEU A 1 79  ? -25.619 95.863  -2.464  1.00 32.99  ? 76  LEU A CD2 1 
ATOM   564  N N   . TYR A 1 80  ? -29.662 97.524  -0.005  1.00 34.43  ? 77  TYR A N   1 
ATOM   565  C CA  . TYR A 1 80  ? -29.765 98.772  0.751   1.00 31.84  ? 77  TYR A CA  1 
ATOM   566  C C   . TYR A 1 80  ? -31.233 99.170  0.835   1.00 29.92  ? 77  TYR A C   1 
ATOM   567  O O   . TYR A 1 80  ? -31.723 99.960  0.017   1.00 33.06  ? 77  TYR A O   1 
ATOM   568  C CB  . TYR A 1 80  ? -28.929 99.879  0.110   1.00 20.68  ? 77  TYR A CB  1 
ATOM   569  C CG  . TYR A 1 80  ? -27.442 99.612  0.119   1.00 36.97  ? 77  TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 80  ? -26.717 99.654  1.304   1.00 33.87  ? 77  TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 80  ? -26.759 99.329  -1.056  1.00 30.00  ? 77  TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 80  ? -25.355 99.413  1.318   1.00 38.26  ? 77  TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 80  ? -25.397 99.088  -1.052  1.00 39.73  ? 77  TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 80  ? -24.701 99.131  0.137   1.00 38.57  ? 77  TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 80  ? -23.346 98.891  0.145   1.00 44.26  ? 77  TYR A OH  1 
ATOM   576  N N   . PRO A 1 81  ? -31.966 98.633  1.811   1.00 34.72  ? 78  PRO A N   1 
ATOM   577  C CA  . PRO A 1 81  ? -33.379 99.004  1.961   1.00 31.50  ? 78  PRO A CA  1 
ATOM   578  C C   . PRO A 1 81  ? -33.540 100.495 2.218   1.00 33.25  ? 78  PRO A C   1 
ATOM   579  O O   . PRO A 1 81  ? -32.787 101.099 2.984   1.00 38.88  ? 78  PRO A O   1 
ATOM   580  C CB  . PRO A 1 81  ? -33.837 98.173  3.166   1.00 28.33  ? 78  PRO A CB  1 
ATOM   581  C CG  . PRO A 1 81  ? -32.884 97.021  3.212   1.00 33.56  ? 78  PRO A CG  1 
ATOM   582  C CD  . PRO A 1 81  ? -31.568 97.570  2.748   1.00 29.37  ? 78  PRO A CD  1 
ATOM   583  N N   . GLY A 1 82  ? -34.536 101.087 1.560   1.00 23.80  ? 79  GLY A N   1 
ATOM   584  C CA  . GLY A 1 82  ? -34.805 102.503 1.682   1.00 26.78  ? 79  GLY A CA  1 
ATOM   585  C C   . GLY A 1 82  ? -33.913 103.405 0.858   1.00 37.47  ? 79  GLY A C   1 
ATOM   586  O O   . GLY A 1 82  ? -34.127 104.624 0.858   1.00 33.23  ? 79  GLY A O   1 
ATOM   587  N N   . PHE A 1 83  ? -32.928 102.854 0.154   1.00 30.47  ? 80  PHE A N   1 
ATOM   588  C CA  . PHE A 1 83  ? -31.983 103.651 -0.617  1.00 30.85  ? 80  PHE A CA  1 
ATOM   589  C C   . PHE A 1 83  ? -32.539 103.916 -2.011  1.00 30.37  ? 80  PHE A C   1 
ATOM   590  O O   . PHE A 1 83  ? -33.010 102.996 -2.686  1.00 26.34  ? 80  PHE A O   1 
ATOM   591  C CB  . PHE A 1 83  ? -30.632 102.939 -0.704  1.00 25.08  ? 80  PHE A CB  1 
ATOM   592  C CG  . PHE A 1 83  ? -29.581 103.715 -1.444  1.00 22.11  ? 80  PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 83  ? -29.287 105.021 -1.092  1.00 24.10  ? 80  PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 83  ? -28.872 103.130 -2.481  1.00 20.93  ? 80  PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 83  ? -28.315 105.735 -1.768  1.00 22.73  ? 80  PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 83  ? -27.896 103.837 -3.158  1.00 20.90  ? 80  PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 83  ? -27.619 105.142 -2.803  1.00 24.99  ? 80  PHE A CZ  1 
ATOM   598  N N   . GLU A 1 84  ? -32.478 105.181 -2.435  1.00 24.99  ? 81  GLU A N   1 
ATOM   599  C CA  . GLU A 1 84  ? -33.017 105.558 -3.738  1.00 30.58  ? 81  GLU A CA  1 
ATOM   600  C C   . GLU A 1 84  ? -32.219 104.933 -4.876  1.00 30.22  ? 81  GLU A C   1 
ATOM   601  O O   . GLU A 1 84  ? -32.793 104.539 -5.898  1.00 29.58  ? 81  GLU A O   1 
ATOM   602  C CB  . GLU A 1 84  ? -33.041 107.082 -3.867  1.00 29.23  ? 81  GLU A CB  1 
ATOM   603  C CG  . GLU A 1 84  ? -33.200 107.592 -5.291  1.00 42.88  ? 81  GLU A CG  1 
ATOM   604  C CD  . GLU A 1 84  ? -33.334 109.101 -5.361  1.00 54.46  ? 81  GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 84  ? -34.416 109.618 -5.013  1.00 68.81  ? 81  GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 84  ? -32.354 109.770 -5.754  1.00 55.04  ? 81  GLU A OE2 1 
ATOM   607  N N   . GLY A 1 85  ? -30.898 104.821 -4.714  1.00 26.51  ? 82  GLY A N   1 
ATOM   608  C CA  . GLY A 1 85  ? -30.061 104.338 -5.800  1.00 25.09  ? 82  GLY A CA  1 
ATOM   609  C C   . GLY A 1 85  ? -30.376 102.919 -6.231  1.00 22.29  ? 82  GLY A C   1 
ATOM   610  O O   . GLY A 1 85  ? -30.175 102.563 -7.395  1.00 23.10  ? 82  GLY A O   1 
ATOM   611  N N   . THR A 1 86  ? -30.868 102.091 -5.311  1.00 24.61  ? 83  THR A N   1 
ATOM   612  C CA  . THR A 1 86  ? -31.227 100.714 -5.627  1.00 23.58  ? 83  THR A CA  1 
ATOM   613  C C   . THR A 1 86  ? -32.716 100.528 -5.880  1.00 20.41  ? 83  THR A C   1 
ATOM   614  O O   . THR A 1 86  ? -33.096 99.800  -6.802  1.00 21.98  ? 83  THR A O   1 
ATOM   615  C CB  . THR A 1 86  ? -30.791 99.772  -4.498  1.00 22.62  ? 83  THR A CB  1 
ATOM   616  O OG1 . THR A 1 86  ? -31.243 100.288 -3.239  1.00 25.95  ? 83  THR A OG1 1 
ATOM   617  C CG2 . THR A 1 86  ? -29.278 99.629  -4.473  1.00 23.14  ? 83  THR A CG2 1 
ATOM   618  N N   . GLU A 1 87  ? -33.572 101.173 -5.087  1.00 24.37  ? 84  GLU A N   1 
ATOM   619  C CA  . GLU A 1 87  ? -35.009 100.965 -5.197  1.00 28.32  ? 84  GLU A CA  1 
ATOM   620  C C   . GLU A 1 87  ? -35.633 101.681 -6.388  1.00 25.27  ? 84  GLU A C   1 
ATOM   621  O O   . GLU A 1 87  ? -36.806 101.433 -6.689  1.00 24.26  ? 84  GLU A O   1 
ATOM   622  C CB  . GLU A 1 87  ? -35.699 101.400 -3.903  1.00 26.93  ? 84  GLU A CB  1 
ATOM   623  C CG  . GLU A 1 87  ? -35.387 100.485 -2.728  1.00 40.91  ? 84  GLU A CG  1 
ATOM   624  C CD  . GLU A 1 87  ? -35.912 101.015 -1.411  1.00 42.43  ? 84  GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 87  ? -35.918 100.247 -0.425  1.00 46.96  ? 84  GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 87  ? -36.316 102.196 -1.359  1.00 55.81  ? 84  GLU A OE2 1 
ATOM   627  N N   . MET A 1 88  ? -34.889 102.551 -7.075  1.00 24.47  ? 85  MET A N   1 
ATOM   628  C CA  . MET A 1 88  ? -35.401 103.138 -8.308  1.00 24.78  ? 85  MET A CA  1 
ATOM   629  C C   . MET A 1 88  ? -35.510 102.110 -9.425  1.00 19.76  ? 85  MET A C   1 
ATOM   630  O O   . MET A 1 88  ? -36.197 102.363 -10.420 1.00 28.09  ? 85  MET A O   1 
ATOM   631  C CB  . MET A 1 88  ? -34.512 104.300 -8.754  1.00 24.61  ? 85  MET A CB  1 
ATOM   632  C CG  . MET A 1 88  ? -33.072 103.908 -9.043  1.00 23.66  ? 85  MET A CG  1 
ATOM   633  S SD  . MET A 1 88  ? -32.081 105.288 -9.647  1.00 27.41  ? 85  MET A SD  1 
ATOM   634  C CE  . MET A 1 88  ? -32.811 105.554 -11.261 1.00 22.27  ? 85  MET A CE  1 
ATOM   635  N N   . TRP A 1 89  ? -34.849 100.961 -9.283  1.00 21.27  ? 86  TRP A N   1 
ATOM   636  C CA  . TRP A 1 89  ? -34.930 99.881  -10.256 1.00 22.22  ? 86  TRP A CA  1 
ATOM   637  C C   . TRP A 1 89  ? -35.865 98.760  -9.823  1.00 25.03  ? 86  TRP A C   1 
ATOM   638  O O   . TRP A 1 89  ? -36.184 97.891  -10.642 1.00 19.14  ? 86  TRP A O   1 
ATOM   639  C CB  . TRP A 1 89  ? -33.533 99.303  -10.522 1.00 22.20  ? 86  TRP A CB  1 
ATOM   640  C CG  . TRP A 1 89  ? -32.482 100.345 -10.762 1.00 23.74  ? 86  TRP A CG  1 
ATOM   641  C CD1 . TRP A 1 89  ? -31.538 100.776 -9.875  1.00 29.75  ? 86  TRP A CD1 1 
ATOM   642  C CD2 . TRP A 1 89  ? -32.269 101.091 -11.967 1.00 28.34  ? 86  TRP A CD2 1 
ATOM   643  N NE1 . TRP A 1 89  ? -30.750 101.742 -10.453 1.00 26.90  ? 86  TRP A NE1 1 
ATOM   644  C CE2 . TRP A 1 89  ? -31.178 101.953 -11.737 1.00 29.54  ? 86  TRP A CE2 1 
ATOM   645  C CE3 . TRP A 1 89  ? -32.895 101.112 -13.217 1.00 25.14  ? 86  TRP A CE3 1 
ATOM   646  C CZ2 . TRP A 1 89  ? -30.700 102.828 -12.712 1.00 22.31  ? 86  TRP A CZ2 1 
ATOM   647  C CZ3 . TRP A 1 89  ? -32.418 101.981 -14.183 1.00 31.23  ? 86  TRP A CZ3 1 
ATOM   648  C CH2 . TRP A 1 89  ? -31.331 102.827 -13.925 1.00 23.89  ? 86  TRP A CH2 1 
ATOM   649  N N   . ASN A 1 90  ? -36.304 98.755  -8.565  1.00 17.74  ? 87  ASN A N   1 
ATOM   650  C CA  . ASN A 1 90  ? -37.208 97.727  -8.081  1.00 22.08  ? 87  ASN A CA  1 
ATOM   651  C C   . ASN A 1 90  ? -38.597 97.903  -8.694  1.00 21.00  ? 87  ASN A C   1 
ATOM   652  O O   . ASN A 1 90  ? -38.950 98.992  -9.153  1.00 20.27  ? 87  ASN A O   1 
ATOM   653  C CB  . ASN A 1 90  ? -37.289 97.772  -6.556  1.00 25.21  ? 87  ASN A CB  1 
ATOM   654  C CG  . ASN A 1 90  ? -36.104 97.100  -5.891  1.00 28.64  ? 87  ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 90  ? -35.443 96.250  -6.488  1.00 26.63  ? 87  ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 90  ? -35.835 97.472  -4.645  1.00 23.47  ? 87  ASN A ND2 1 
ATOM   657  N N   . PRO A 1 91  ? -39.399 96.837  -8.723  1.00 21.79  ? 88  PRO A N   1 
ATOM   658  C CA  . PRO A 1 91  ? -40.740 96.941  -9.316  1.00 29.78  ? 88  PRO A CA  1 
ATOM   659  C C   . PRO A 1 91  ? -41.600 97.966  -8.590  1.00 25.72  ? 88  PRO A C   1 
ATOM   660  O O   . PRO A 1 91  ? -41.643 98.008  -7.358  1.00 22.00  ? 88  PRO A O   1 
ATOM   661  C CB  . PRO A 1 91  ? -41.304 95.523  -9.164  1.00 23.47  ? 88  PRO A CB  1 
ATOM   662  C CG  . PRO A 1 91  ? -40.105 94.647  -9.075  1.00 25.13  ? 88  PRO A CG  1 
ATOM   663  C CD  . PRO A 1 91  ? -39.073 95.451  -8.344  1.00 27.30  ? 88  PRO A CD  1 
ATOM   664  N N   . ASN A 1 92  ? -42.283 98.803  -9.371  1.00 27.73  ? 89  ASN A N   1 
ATOM   665  C CA  . ASN A 1 92  ? -43.217 99.788  -8.842  1.00 22.14  ? 89  ASN A CA  1 
ATOM   666  C C   . ASN A 1 92  ? -44.668 99.397  -9.092  1.00 22.50  ? 89  ASN A C   1 
ATOM   667  O O   . ASN A 1 92  ? -45.571 100.209 -8.860  1.00 29.67  ? 89  ASN A O   1 
ATOM   668  C CB  . ASN A 1 92  ? -42.925 101.170 -9.433  1.00 28.14  ? 89  ASN A CB  1 
ATOM   669  C CG  . ASN A 1 92  ? -42.988 101.185 -10.947 1.00 23.59  ? 89  ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 92  ? -42.867 100.146 -11.596 1.00 22.14  ? 89  ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 92  ? -43.172 102.369 -11.519 1.00 25.40  ? 89  ASN A ND2 1 
ATOM   672  N N   . ARG A 1 93  ? -44.909 98.179  -9.569  1.00 22.74  ? 90  ARG A N   1 
ATOM   673  C CA  . ARG A 1 93  ? -46.241 97.605  -9.687  1.00 19.75  ? 90  ARG A CA  1 
ATOM   674  C C   . ARG A 1 93  ? -46.215 96.205  -9.088  1.00 26.10  ? 90  ARG A C   1 
ATOM   675  O O   . ARG A 1 93  ? -45.155 95.670  -8.755  1.00 30.36  ? 90  ARG A O   1 
ATOM   676  C CB  . ARG A 1 93  ? -46.713 97.558  -11.148 1.00 22.18  ? 90  ARG A CB  1 
ATOM   677  C CG  . ARG A 1 93  ? -46.884 98.921  -11.805 1.00 29.81  ? 90  ARG A CG  1 
ATOM   678  C CD  . ARG A 1 93  ? -47.977 99.735  -11.131 1.00 29.39  ? 90  ARG A CD  1 
ATOM   679  N NE  . ARG A 1 93  ? -48.299 100.946 -11.881 1.00 24.40  ? 90  ARG A NE  1 
ATOM   680  C CZ  . ARG A 1 93  ? -47.677 102.111 -11.724 1.00 24.92  ? 90  ARG A CZ  1 
ATOM   681  N NH1 . ARG A 1 93  ? -46.695 102.228 -10.842 1.00 33.90  ? 90  ARG A NH1 1 
ATOM   682  N NH2 . ARG A 1 93  ? -48.038 103.160 -12.451 1.00 32.78  ? 90  ARG A NH2 1 
ATOM   683  N N   . GLU A 1 94  ? -47.396 95.608  -8.949  1.00 30.31  ? 91  GLU A N   1 
ATOM   684  C CA  . GLU A 1 94  ? -47.482 94.270  -8.384  1.00 28.53  ? 91  GLU A CA  1 
ATOM   685  C C   . GLU A 1 94  ? -46.862 93.244  -9.327  1.00 29.11  ? 91  GLU A C   1 
ATOM   686  O O   . GLU A 1 94  ? -46.908 93.380  -10.552 1.00 30.67  ? 91  GLU A O   1 
ATOM   687  C CB  . GLU A 1 94  ? -48.935 93.894  -8.096  1.00 30.38  ? 91  GLU A CB  1 
ATOM   688  C CG  . GLU A 1 94  ? -49.586 94.705  -6.988  1.00 62.06  ? 91  GLU A CG  1 
ATOM   689  C CD  . GLU A 1 94  ? -50.882 94.086  -6.503  1.00 79.15  ? 91  GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 94  ? -51.043 93.924  -5.275  1.00 86.48  ? 91  GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 94  ? -51.736 93.751  -7.351  1.00 70.93  ? 91  GLU A OE2 1 
ATOM   692  N N   . LEU A 1 95  ? -46.275 92.206  -8.737  1.00 25.79  ? 92  LEU A N   1 
ATOM   693  C CA  . LEU A 1 95  ? -45.676 91.131  -9.512  1.00 21.96  ? 92  LEU A CA  1 
ATOM   694  C C   . LEU A 1 95  ? -46.746 90.152  -9.976  1.00 28.10  ? 92  LEU A C   1 
ATOM   695  O O   . LEU A 1 95  ? -47.687 89.842  -9.239  1.00 32.07  ? 92  LEU A O   1 
ATOM   696  C CB  . LEU A 1 95  ? -44.619 90.397  -8.686  1.00 22.69  ? 92  LEU A CB  1 
ATOM   697  C CG  . LEU A 1 95  ? -43.436 91.226  -8.183  1.00 21.16  ? 92  LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 95  ? -42.451 90.347  -7.429  1.00 15.02  ? 92  LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 95  ? -42.750 91.943  -9.336  1.00 26.14  ? 92  LEU A CD2 1 
ATOM   700  N N   . SER A 1 96  ? -46.593 89.664  -11.204 1.00 23.62  ? 93  SER A N   1 
ATOM   701  C CA  . SER A 1 96  ? -47.540 88.723  -11.785 1.00 27.53  ? 93  SER A CA  1 
ATOM   702  C C   . SER A 1 96  ? -46.916 88.106  -13.026 1.00 28.29  ? 93  SER A C   1 
ATOM   703  O O   . SER A 1 96  ? -46.145 88.759  -13.735 1.00 29.64  ? 93  SER A O   1 
ATOM   704  C CB  . SER A 1 96  ? -48.867 89.405  -12.145 1.00 22.40  ? 93  SER A CB  1 
ATOM   705  O OG  . SER A 1 96  ? -49.733 88.512  -12.822 1.00 24.11  ? 93  SER A OG  1 
ATOM   706  N N   . GLU A 1 97  ? -47.253 86.838  -13.277 1.00 18.97  ? 94  GLU A N   1 
ATOM   707  C CA  . GLU A 1 97  ? -46.879 86.222  -14.543 1.00 23.08  ? 94  GLU A CA  1 
ATOM   708  C C   . GLU A 1 97  ? -47.677 86.798  -15.704 1.00 29.00  ? 94  GLU A C   1 
ATOM   709  O O   . GLU A 1 97  ? -47.226 86.721  -16.852 1.00 34.69  ? 94  GLU A O   1 
ATOM   710  C CB  . GLU A 1 97  ? -47.068 84.706  -14.477 1.00 23.81  ? 94  GLU A CB  1 
ATOM   711  C CG  . GLU A 1 97  ? -46.230 84.019  -13.411 1.00 24.83  ? 94  GLU A CG  1 
ATOM   712  C CD  . GLU A 1 97  ? -46.245 82.508  -13.542 1.00 33.88  ? 94  GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 97  ? -45.647 81.987  -14.508 1.00 27.47  ? 94  GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 97  ? -46.862 81.842  -12.684 1.00 31.50  ? 94  GLU A OE2 1 
ATOM   715  N N   . ASP A 1 98  ? -48.850 87.369  -15.426 1.00 34.78  ? 95  ASP A N   1 
ATOM   716  C CA  . ASP A 1 98  ? -49.633 88.101  -16.419 1.00 32.11  ? 95  ASP A CA  1 
ATOM   717  C C   . ASP A 1 98  ? -49.041 89.504  -16.520 1.00 30.46  ? 95  ASP A C   1 
ATOM   718  O O   . ASP A 1 98  ? -49.512 90.466  -15.908 1.00 26.51  ? 95  ASP A O   1 
ATOM   719  C CB  . ASP A 1 98  ? -51.105 88.126  -16.025 1.00 29.87  ? 95  ASP A CB  1 
ATOM   720  C CG  . ASP A 1 98  ? -51.987 88.785  -17.072 1.00 31.87  ? 95  ASP A CG  1 
ATOM   721  O OD1 . ASP A 1 98  ? -51.472 89.173  -18.142 1.00 33.28  ? 95  ASP A OD1 1 
ATOM   722  O OD2 . ASP A 1 98  ? -53.203 88.913  -16.820 1.00 33.21  ? 95  ASP A OD2 1 
ATOM   723  N N   . CYS A 1 99  ? -47.974 89.614  -17.313 1.00 26.89  ? 96  CYS A N   1 
ATOM   724  C CA  . CYS A 1 99  ? -47.221 90.857  -17.397 1.00 29.34  ? 96  CYS A CA  1 
ATOM   725  C C   . CYS A 1 99  ? -46.873 91.282  -18.815 1.00 22.41  ? 96  CYS A C   1 
ATOM   726  O O   . CYS A 1 99  ? -46.251 92.336  -18.982 1.00 24.13  ? 96  CYS A O   1 
ATOM   727  C CB  . CYS A 1 99  ? -45.921 90.745  -16.586 1.00 27.34  ? 96  CYS A CB  1 
ATOM   728  S SG  . CYS A 1 99  ? -44.789 89.471  -17.197 1.00 27.96  ? 96  CYS A SG  1 
ATOM   729  N N   . LEU A 1 100 ? -47.246 90.512  -19.837 1.00 25.17  ? 97  LEU A N   1 
ATOM   730  C CA  . LEU A 1 100 ? -46.848 90.813  -21.212 1.00 21.75  ? 97  LEU A CA  1 
ATOM   731  C C   . LEU A 1 100 ? -47.725 91.942  -21.749 1.00 22.11  ? 97  LEU A C   1 
ATOM   732  O O   . LEU A 1 100 ? -48.707 91.735  -22.467 1.00 27.21  ? 97  LEU A O   1 
ATOM   733  C CB  . LEU A 1 100 ? -46.924 89.564  -22.079 1.00 20.73  ? 97  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 100 ? -45.938 88.468  -21.666 1.00 27.41  ? 97  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 100 ? -45.931 87.322  -22.664 1.00 24.88  ? 97  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 100 ? -44.538 89.047  -21.498 1.00 22.90  ? 97  LEU A CD2 1 
ATOM   737  N N   . TYR A 1 101 ? -47.341 93.166  -21.396 1.00 20.35  ? 98  TYR A N   1 
ATOM   738  C CA  . TYR A 1 101 ? -48.023 94.373  -21.836 1.00 25.17  ? 98  TYR A CA  1 
ATOM   739  C C   . TYR A 1 101 ? -46.989 95.383  -22.311 1.00 28.11  ? 98  TYR A C   1 
ATOM   740  O O   . TYR A 1 101 ? -45.851 95.396  -21.835 1.00 25.82  ? 98  TYR A O   1 
ATOM   741  C CB  . TYR A 1 101 ? -48.874 94.983  -20.711 1.00 19.54  ? 98  TYR A CB  1 
ATOM   742  C CG  . TYR A 1 101 ? -49.948 94.060  -20.178 1.00 30.12  ? 98  TYR A CG  1 
ATOM   743  C CD1 . TYR A 1 101 ? -51.252 94.138  -20.646 1.00 34.02  ? 98  TYR A CD1 1 
ATOM   744  C CD2 . TYR A 1 101 ? -49.657 93.111  -19.206 1.00 30.62  ? 98  TYR A CD2 1 
ATOM   745  C CE1 . TYR A 1 101 ? -52.238 93.297  -20.162 1.00 25.45  ? 98  TYR A CE1 1 
ATOM   746  C CE2 . TYR A 1 101 ? -50.635 92.265  -18.717 1.00 33.84  ? 98  TYR A CE2 1 
ATOM   747  C CZ  . TYR A 1 101 ? -51.924 92.362  -19.199 1.00 32.28  ? 98  TYR A CZ  1 
ATOM   748  O OH  . TYR A 1 101 ? -52.900 91.523  -18.716 1.00 30.19  ? 98  TYR A OH  1 
ATOM   749  N N   . LEU A 1 102 ? -47.390 96.227  -23.257 1.00 19.69  ? 99  LEU A N   1 
ATOM   750  C CA  . LEU A 1 102 ? -46.520 97.266  -23.788 1.00 21.34  ? 99  LEU A CA  1 
ATOM   751  C C   . LEU A 1 102 ? -47.187 98.629  -23.649 1.00 23.18  ? 99  LEU A C   1 
ATOM   752  O O   . LEU A 1 102 ? -48.384 98.740  -23.370 1.00 27.04  ? 99  LEU A O   1 
ATOM   753  C CB  . LEU A 1 102 ? -46.145 96.988  -25.254 1.00 20.95  ? 99  LEU A CB  1 
ATOM   754  C CG  . LEU A 1 102 ? -47.212 96.824  -26.343 1.00 26.91  ? 99  LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 102 ? -47.719 98.166  -26.861 1.00 25.09  ? 99  LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 102 ? -46.656 95.993  -27.489 1.00 18.46  ? 99  LEU A CD2 1 
ATOM   757  N N   . ASN A 1 103 ? -46.388 99.674  -23.853 1.00 21.43  ? 100 ASN A N   1 
ATOM   758  C CA  . ASN A 1 103 ? -46.836 101.050 -23.709 1.00 17.60  ? 100 ASN A CA  1 
ATOM   759  C C   . ASN A 1 103 ? -46.463 101.841 -24.953 1.00 27.96  ? 100 ASN A C   1 
ATOM   760  O O   . ASN A 1 103 ? -45.458 101.558 -25.610 1.00 29.49  ? 100 ASN A O   1 
ATOM   761  C CB  . ASN A 1 103 ? -46.221 101.708 -22.467 1.00 29.67  ? 100 ASN A CB  1 
ATOM   762  C CG  . ASN A 1 103 ? -46.130 100.756 -21.291 1.00 33.18  ? 100 ASN A CG  1 
ATOM   763  O OD1 . ASN A 1 103 ? -47.116 100.511 -20.597 1.00 32.48  ? 100 ASN A OD1 1 
ATOM   764  N ND2 . ASN A 1 103 ? -44.940 100.213 -21.062 1.00 27.35  ? 100 ASN A ND2 1 
ATOM   765  N N   . VAL A 1 104 ? -47.287 102.837 -25.276 1.00 29.91  ? 101 VAL A N   1 
ATOM   766  C CA  . VAL A 1 104 ? -47.082 103.684 -26.446 1.00 20.94  ? 101 VAL A CA  1 
ATOM   767  C C   . VAL A 1 104 ? -47.279 105.135 -26.033 1.00 20.17  ? 101 VAL A C   1 
ATOM   768  O O   . VAL A 1 104 ? -48.353 105.506 -25.544 1.00 37.17  ? 101 VAL A O   1 
ATOM   769  C CB  . VAL A 1 104 ? -48.034 103.324 -27.601 1.00 24.93  ? 101 VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 104 ? -47.854 104.297 -28.757 1.00 27.71  ? 101 VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 104 ? -47.800 101.894 -28.066 1.00 18.36  ? 101 VAL A CG2 1 
ATOM   772  N N   . TRP A 1 105 ? -46.245 105.950 -26.223 1.00 27.49  ? 102 TRP A N   1 
ATOM   773  C CA  . TRP A 1 105 ? -46.335 107.395 -26.068 1.00 22.40  ? 102 TRP A CA  1 
ATOM   774  C C   . TRP A 1 105 ? -46.354 108.034 -27.451 1.00 39.63  ? 102 TRP A C   1 
ATOM   775  O O   . TRP A 1 105 ? -45.505 107.722 -28.294 1.00 34.19  ? 102 TRP A O   1 
ATOM   776  C CB  . TRP A 1 105 ? -45.159 107.946 -25.257 1.00 29.54  ? 102 TRP A CB  1 
ATOM   777  C CG  . TRP A 1 105 ? -45.135 107.545 -23.812 1.00 29.53  ? 102 TRP A CG  1 
ATOM   778  C CD1 . TRP A 1 105 ? -45.632 108.253 -22.755 1.00 25.36  ? 102 TRP A CD1 1 
ATOM   779  C CD2 . TRP A 1 105 ? -44.565 106.351 -23.262 1.00 21.74  ? 102 TRP A CD2 1 
ATOM   780  N NE1 . TRP A 1 105 ? -45.413 107.570 -21.583 1.00 23.66  ? 102 TRP A NE1 1 
ATOM   781  C CE2 . TRP A 1 105 ? -44.760 106.399 -21.867 1.00 30.29  ? 102 TRP A CE2 1 
ATOM   782  C CE3 . TRP A 1 105 ? -43.913 105.245 -23.815 1.00 28.81  ? 102 TRP A CE3 1 
ATOM   783  C CZ2 . TRP A 1 105 ? -44.327 105.383 -21.018 1.00 22.39  ? 102 TRP A CZ2 1 
ATOM   784  C CZ3 . TRP A 1 105 ? -43.484 104.237 -22.970 1.00 25.52  ? 102 TRP A CZ3 1 
ATOM   785  C CH2 . TRP A 1 105 ? -43.693 104.313 -21.587 1.00 26.81  ? 102 TRP A CH2 1 
ATOM   786  N N   . THR A 1 106 ? -47.320 108.915 -27.683 1.00 36.94  ? 103 THR A N   1 
ATOM   787  C CA  . THR A 1 106 ? -47.428 109.623 -28.947 1.00 35.81  ? 103 THR A CA  1 
ATOM   788  C C   . THR A 1 106 ? -47.666 111.102 -28.683 1.00 38.38  ? 103 THR A C   1 
ATOM   789  O O   . THR A 1 106 ? -48.327 111.465 -27.703 1.00 36.08  ? 103 THR A O   1 
ATOM   790  C CB  . THR A 1 106 ? -48.561 109.047 -29.815 1.00 39.45  ? 103 THR A CB  1 
ATOM   791  O OG1 . THR A 1 106 ? -48.577 109.698 -31.092 1.00 42.95  ? 103 THR A OG1 1 
ATOM   792  C CG2 . THR A 1 106 ? -49.914 109.224 -29.143 1.00 31.00  ? 103 THR A CG2 1 
ATOM   793  N N   . PRO A 1 107 ? -47.113 111.978 -29.518 1.00 35.50  ? 104 PRO A N   1 
ATOM   794  C CA  . PRO A 1 107 ? -47.236 113.418 -29.264 1.00 40.32  ? 104 PRO A CA  1 
ATOM   795  C C   . PRO A 1 107 ? -48.667 113.904 -29.435 1.00 44.99  ? 104 PRO A C   1 
ATOM   796  O O   . PRO A 1 107 ? -49.488 113.293 -30.122 1.00 29.42  ? 104 PRO A O   1 
ATOM   797  C CB  . PRO A 1 107 ? -46.314 114.049 -30.315 1.00 38.53  ? 104 PRO A CB  1 
ATOM   798  C CG  . PRO A 1 107 ? -45.421 112.936 -30.773 1.00 46.70  ? 104 PRO A CG  1 
ATOM   799  C CD  . PRO A 1 107 ? -46.231 111.691 -30.661 1.00 35.18  ? 104 PRO A CD  1 
ATOM   800  N N   . TYR A 1 108 ? -48.958 115.028 -28.781 1.00 39.49  ? 105 TYR A N   1 
ATOM   801  C CA  . TYR A 1 108 ? -50.213 115.726 -28.996 1.00 49.71  ? 105 TYR A CA  1 
ATOM   802  C C   . TYR A 1 108 ? -49.946 117.079 -29.633 1.00 52.44  ? 105 TYR A C   1 
ATOM   803  O O   . TYR A 1 108 ? -49.124 117.847 -29.115 1.00 43.53  ? 105 TYR A O   1 
ATOM   804  C CB  . TYR A 1 108 ? -50.989 115.915 -27.690 1.00 52.47  ? 105 TYR A CB  1 
ATOM   805  C CG  . TYR A 1 108 ? -52.288 116.663 -27.900 1.00 54.64  ? 105 TYR A CG  1 
ATOM   806  C CD1 . TYR A 1 108 ? -52.387 118.019 -27.618 1.00 58.70  ? 105 TYR A CD1 1 
ATOM   807  C CD2 . TYR A 1 108 ? -53.406 116.017 -28.412 1.00 55.96  ? 105 TYR A CD2 1 
ATOM   808  C CE1 . TYR A 1 108 ? -53.568 118.708 -27.823 1.00 67.68  ? 105 TYR A CE1 1 
ATOM   809  C CE2 . TYR A 1 108 ? -54.591 116.698 -28.622 1.00 67.61  ? 105 TYR A CE2 1 
ATOM   810  C CZ  . TYR A 1 108 ? -54.667 118.042 -28.325 1.00 74.30  ? 105 TYR A CZ  1 
ATOM   811  O OH  . TYR A 1 108 ? -55.845 118.723 -28.530 1.00 82.86  ? 105 TYR A OH  1 
ATOM   812  N N   . PRO A 1 109 ? -50.615 117.416 -30.748 1.00 52.09  ? 106 PRO A N   1 
ATOM   813  C CA  . PRO A 1 109 ? -51.594 116.561 -31.431 1.00 48.71  ? 106 PRO A CA  1 
ATOM   814  C C   . PRO A 1 109 ? -50.949 115.360 -32.118 1.00 40.26  ? 106 PRO A C   1 
ATOM   815  O O   . PRO A 1 109 ? -49.759 115.407 -32.431 1.00 43.71  ? 106 PRO A O   1 
ATOM   816  C CB  . PRO A 1 109 ? -52.223 117.505 -32.460 1.00 42.19  ? 106 PRO A CB  1 
ATOM   817  C CG  . PRO A 1 109 ? -51.170 118.520 -32.725 1.00 59.46  ? 106 PRO A CG  1 
ATOM   818  C CD  . PRO A 1 109 ? -50.470 118.724 -31.411 1.00 49.59  ? 106 PRO A CD  1 
ATOM   819  N N   . ARG A 1 110 ? -51.727 114.303 -32.323 1.00 30.80  ? 107 ARG A N   1 
ATOM   820  C CA  . ARG A 1 110 ? -51.197 113.088 -32.924 1.00 32.56  ? 107 ARG A CA  1 
ATOM   821  C C   . ARG A 1 110 ? -50.601 113.405 -34.292 1.00 39.96  ? 107 ARG A C   1 
ATOM   822  O O   . ARG A 1 110 ? -51.215 114.145 -35.073 1.00 46.79  ? 107 ARG A O   1 
ATOM   823  C CB  . ARG A 1 110 ? -52.295 112.034 -33.058 1.00 31.86  ? 107 ARG A CB  1 
ATOM   824  C CG  . ARG A 1 110 ? -51.799 110.673 -33.519 1.00 34.89  ? 107 ARG A CG  1 
ATOM   825  C CD  . ARG A 1 110 ? -52.954 109.709 -33.717 1.00 36.37  ? 107 ARG A CD  1 
ATOM   826  N NE  . ARG A 1 110 ? -53.832 109.672 -32.553 1.00 48.87  ? 107 ARG A NE  1 
ATOM   827  C CZ  . ARG A 1 110 ? -54.947 108.952 -32.481 1.00 54.99  ? 107 ARG A CZ  1 
ATOM   828  N NH1 . ARG A 1 110 ? -55.323 108.205 -33.510 1.00 56.87  ? 107 ARG A NH1 1 
ATOM   829  N NH2 . ARG A 1 110 ? -55.686 108.981 -31.381 1.00 60.82  ? 107 ARG A NH2 1 
ATOM   830  N N   . PRO A 1 111 ? -49.414 112.892 -34.610 1.00 55.73  ? 108 PRO A N   1 
ATOM   831  C CA  . PRO A 1 111 ? -48.806 113.192 -35.912 1.00 58.34  ? 108 PRO A CA  1 
ATOM   832  C C   . PRO A 1 111 ? -49.675 112.694 -37.058 1.00 56.57  ? 108 PRO A C   1 
ATOM   833  O O   . PRO A 1 111 ? -50.136 111.550 -37.062 1.00 50.91  ? 108 PRO A O   1 
ATOM   834  C CB  . PRO A 1 111 ? -47.465 112.451 -35.854 1.00 48.16  ? 108 PRO A CB  1 
ATOM   835  C CG  . PRO A 1 111 ? -47.176 112.302 -34.396 1.00 41.39  ? 108 PRO A CG  1 
ATOM   836  C CD  . PRO A 1 111 ? -48.511 112.116 -33.742 1.00 47.25  ? 108 PRO A CD  1 
ATOM   837  N N   . THR A 1 112 ? -49.903 113.575 -38.033 1.00 51.92  ? 109 THR A N   1 
ATOM   838  C CA  . THR A 1 112 ? -50.685 113.207 -39.206 1.00 59.79  ? 109 THR A CA  1 
ATOM   839  C C   . THR A 1 112 ? -49.851 112.444 -40.226 1.00 58.79  ? 109 THR A C   1 
ATOM   840  O O   . THR A 1 112 ? -50.400 111.662 -41.011 1.00 52.55  ? 109 THR A O   1 
ATOM   841  C CB  . THR A 1 112 ? -51.286 114.456 -39.851 1.00 50.59  ? 109 THR A CB  1 
ATOM   842  O OG1 . THR A 1 112 ? -50.233 115.346 -40.244 1.00 54.31  ? 109 THR A OG1 1 
ATOM   843  C CG2 . THR A 1 112 ? -52.204 115.170 -38.870 1.00 49.75  ? 109 THR A CG2 1 
ATOM   844  N N   . SER A 1 113 ? -48.532 112.654 -40.228 1.00 55.77  ? 110 SER A N   1 
ATOM   845  C CA  . SER A 1 113 ? -47.560 112.000 -41.085 1.00 60.02  ? 110 SER A CA  1 
ATOM   846  C C   . SER A 1 113 ? -46.843 110.889 -40.325 1.00 60.06  ? 110 SER A C   1 
ATOM   847  O O   . SER A 1 113 ? -46.733 110.942 -39.096 1.00 61.10  ? 110 SER A O   1 
ATOM   848  C CB  . SER A 1 113 ? -46.530 113.010 -41.601 1.00 60.76  ? 110 SER A CB  1 
ATOM   849  O OG  . SER A 1 113 ? -47.164 114.098 -42.251 1.00 74.20  ? 110 SER A OG  1 
ATOM   850  N N   . PRO A 1 114 ? -46.361 109.863 -41.026 1.00 59.98  ? 111 PRO A N   1 
ATOM   851  C CA  . PRO A 1 114 ? -45.619 108.791 -40.347 1.00 52.32  ? 111 PRO A CA  1 
ATOM   852  C C   . PRO A 1 114 ? -44.379 109.331 -39.647 1.00 54.38  ? 111 PRO A C   1 
ATOM   853  O O   . PRO A 1 114 ? -43.557 110.026 -40.247 1.00 54.89  ? 111 PRO A O   1 
ATOM   854  C CB  . PRO A 1 114 ? -45.259 107.834 -41.489 1.00 58.70  ? 111 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 114 ? -46.298 108.087 -42.530 1.00 55.66  ? 111 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 114 ? -46.598 109.556 -42.447 1.00 51.85  ? 111 PRO A CD  1 
ATOM   857  N N   . THR A 1 115 ? -44.254 109.001 -38.360 1.00 43.12  ? 112 THR A N   1 
ATOM   858  C CA  . THR A 1 115 ? -43.198 109.480 -37.484 1.00 47.82  ? 112 THR A CA  1 
ATOM   859  C C   . THR A 1 115 ? -42.276 108.336 -37.074 1.00 45.25  ? 112 THR A C   1 
ATOM   860  O O   . THR A 1 115 ? -42.754 107.233 -36.784 1.00 43.21  ? 112 THR A O   1 
ATOM   861  C CB  . THR A 1 115 ? -43.798 110.131 -36.229 1.00 53.13  ? 112 THR A CB  1 
ATOM   862  O OG1 . THR A 1 115 ? -44.578 111.271 -36.611 1.00 45.55  ? 112 THR A OG1 1 
ATOM   863  C CG2 . THR A 1 115 ? -42.712 110.572 -35.263 1.00 48.41  ? 112 THR A CG2 1 
ATOM   864  N N   . PRO A 1 116 ? -40.959 108.557 -37.066 1.00 46.95  ? 113 PRO A N   1 
ATOM   865  C CA  . PRO A 1 116 ? -40.037 107.509 -36.609 1.00 48.63  ? 113 PRO A CA  1 
ATOM   866  C C   . PRO A 1 116 ? -40.365 107.047 -35.196 1.00 39.47  ? 113 PRO A C   1 
ATOM   867  O O   . PRO A 1 116 ? -40.769 107.837 -34.340 1.00 30.12  ? 113 PRO A O   1 
ATOM   868  C CB  . PRO A 1 116 ? -38.667 108.192 -36.677 1.00 46.84  ? 113 PRO A CB  1 
ATOM   869  C CG  . PRO A 1 116 ? -38.827 109.229 -37.736 1.00 44.99  ? 113 PRO A CG  1 
ATOM   870  C CD  . PRO A 1 116 ? -40.243 109.721 -37.619 1.00 46.63  ? 113 PRO A CD  1 
ATOM   871  N N   . VAL A 1 117 ? -40.180 105.751 -34.958 1.00 32.98  ? 114 VAL A N   1 
ATOM   872  C CA  . VAL A 1 117 ? -40.585 105.102 -33.717 1.00 40.38  ? 114 VAL A CA  1 
ATOM   873  C C   . VAL A 1 117 ? -39.343 104.659 -32.958 1.00 35.53  ? 114 VAL A C   1 
ATOM   874  O O   . VAL A 1 117 ? -38.447 104.028 -33.532 1.00 35.30  ? 114 VAL A O   1 
ATOM   875  C CB  . VAL A 1 117 ? -41.514 103.905 -33.988 1.00 40.71  ? 114 VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 117 ? -41.946 103.260 -32.680 1.00 33.75  ? 114 VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 117 ? -42.723 104.347 -34.799 1.00 33.84  ? 114 VAL A CG2 1 
ATOM   878  N N   . LEU A 1 118 ? -39.293 104.990 -31.671 1.00 37.24  ? 115 LEU A N   1 
ATOM   879  C CA  . LEU A 1 118 ? -38.266 104.498 -30.763 1.00 32.65  ? 115 LEU A CA  1 
ATOM   880  C C   . LEU A 1 118 ? -38.861 103.401 -29.892 1.00 35.05  ? 115 LEU A C   1 
ATOM   881  O O   . LEU A 1 118 ? -39.969 103.553 -29.368 1.00 34.09  ? 115 LEU A O   1 
ATOM   882  C CB  . LEU A 1 118 ? -37.717 105.629 -29.891 1.00 26.47  ? 115 LEU A CB  1 
ATOM   883  C CG  . LEU A 1 118 ? -36.713 106.584 -30.536 1.00 31.31  ? 115 LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 118 ? -36.508 107.810 -29.661 1.00 32.99  ? 115 LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 118 ? -35.392 105.872 -30.774 1.00 29.80  ? 115 LEU A CD2 1 
ATOM   886  N N   . VAL A 1 119 ? -38.133 102.298 -29.745 1.00 22.81  ? 116 VAL A N   1 
ATOM   887  C CA  . VAL A 1 119 ? -38.585 101.155 -28.959 1.00 29.58  ? 116 VAL A CA  1 
ATOM   888  C C   . VAL A 1 119 ? -37.555 100.888 -27.871 1.00 37.22  ? 116 VAL A C   1 
ATOM   889  O O   . VAL A 1 119 ? -36.394 100.579 -28.169 1.00 30.87  ? 116 VAL A O   1 
ATOM   890  C CB  . VAL A 1 119 ? -38.803 99.909  -29.830 1.00 25.06  ? 116 VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 119 ? -39.196 98.725  -28.965 1.00 16.27  ? 116 VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 119 ? -39.866 100.180 -30.882 1.00 26.16  ? 116 VAL A CG2 1 
ATOM   893  N N   . TRP A 1 120 ? -37.981 100.998 -26.616 1.00 24.14  ? 117 TRP A N   1 
ATOM   894  C CA  . TRP A 1 120 ? -37.102 100.846 -25.466 1.00 22.17  ? 117 TRP A CA  1 
ATOM   895  C C   . TRP A 1 120 ? -37.178 99.429  -24.914 1.00 27.99  ? 117 TRP A C   1 
ATOM   896  O O   . TRP A 1 120 ? -38.266 98.865  -24.764 1.00 30.76  ? 117 TRP A O   1 
ATOM   897  C CB  . TRP A 1 120 ? -37.463 101.852 -24.371 1.00 22.68  ? 117 TRP A CB  1 
ATOM   898  C CG  . TRP A 1 120 ? -36.733 101.631 -23.079 1.00 32.09  ? 117 TRP A CG  1 
ATOM   899  C CD1 . TRP A 1 120 ? -37.243 101.094 -21.933 1.00 32.85  ? 117 TRP A CD1 1 
ATOM   900  C CD2 . TRP A 1 120 ? -35.361 101.937 -22.803 1.00 37.45  ? 117 TRP A CD2 1 
ATOM   901  N NE1 . TRP A 1 120 ? -36.274 101.050 -20.959 1.00 27.90  ? 117 TRP A NE1 1 
ATOM   902  C CE2 . TRP A 1 120 ? -35.110 101.562 -21.468 1.00 26.66  ? 117 TRP A CE2 1 
ATOM   903  C CE3 . TRP A 1 120 ? -34.321 102.493 -23.553 1.00 33.22  ? 117 TRP A CE3 1 
ATOM   904  C CZ2 . TRP A 1 120 ? -33.863 101.725 -20.869 1.00 28.83  ? 117 TRP A CZ2 1 
ATOM   905  C CZ3 . TRP A 1 120 ? -33.084 102.655 -22.957 1.00 32.92  ? 117 TRP A CZ3 1 
ATOM   906  C CH2 . TRP A 1 120 ? -32.865 102.272 -21.628 1.00 28.60  ? 117 TRP A CH2 1 
ATOM   907  N N   . ILE A 1 121 ? -36.013 98.859  -24.618 1.00 20.96  ? 118 ILE A N   1 
ATOM   908  C CA  . ILE A 1 121 ? -35.895 97.546  -23.995 1.00 21.72  ? 118 ILE A CA  1 
ATOM   909  C C   . ILE A 1 121 ? -35.084 97.732  -22.721 1.00 25.26  ? 118 ILE A C   1 
ATOM   910  O O   . ILE A 1 121 ? -33.879 98.008  -22.781 1.00 28.93  ? 118 ILE A O   1 
ATOM   911  C CB  . ILE A 1 121 ? -35.236 96.519  -24.925 1.00 22.17  ? 118 ILE A CB  1 
ATOM   912  C CG1 . ILE A 1 121 ? -36.014 96.409  -26.238 1.00 22.77  ? 118 ILE A CG1 1 
ATOM   913  C CG2 . ILE A 1 121 ? -35.148 95.163  -24.243 1.00 17.17  ? 118 ILE A CG2 1 
ATOM   914  C CD1 . ILE A 1 121 ? -35.404 95.441  -27.230 1.00 26.33  ? 118 ILE A CD1 1 
ATOM   915  N N   . TYR A 1 122 ? -35.738 97.588  -21.571 1.00 21.45  ? 119 TYR A N   1 
ATOM   916  C CA  . TYR A 1 122 ? -35.072 97.856  -20.306 1.00 24.62  ? 119 TYR A CA  1 
ATOM   917  C C   . TYR A 1 122 ? -34.029 96.785  -19.997 1.00 22.80  ? 119 TYR A C   1 
ATOM   918  O O   . TYR A 1 122 ? -34.076 95.660  -20.503 1.00 16.69  ? 119 TYR A O   1 
ATOM   919  C CB  . TYR A 1 122 ? -36.088 97.942  -19.164 1.00 20.93  ? 119 TYR A CB  1 
ATOM   920  C CG  . TYR A 1 122 ? -36.981 96.728  -19.006 1.00 19.02  ? 119 TYR A CG  1 
ATOM   921  C CD1 . TYR A 1 122 ? -36.527 95.582  -18.365 1.00 24.71  ? 119 TYR A CD1 1 
ATOM   922  C CD2 . TYR A 1 122 ? -38.288 96.740  -19.475 1.00 20.81  ? 119 TYR A CD2 1 
ATOM   923  C CE1 . TYR A 1 122 ? -37.343 94.475  -18.213 1.00 26.85  ? 119 TYR A CE1 1 
ATOM   924  C CE2 . TYR A 1 122 ? -39.112 95.639  -19.326 1.00 19.78  ? 119 TYR A CE2 1 
ATOM   925  C CZ  . TYR A 1 122 ? -38.635 94.511  -18.695 1.00 24.32  ? 119 TYR A CZ  1 
ATOM   926  O OH  . TYR A 1 122 ? -39.452 93.414  -18.545 1.00 21.98  ? 119 TYR A OH  1 
ATOM   927  N N   . GLY A 1 123 ? -33.074 97.156  -19.146 1.00 19.82  ? 120 GLY A N   1 
ATOM   928  C CA  . GLY A 1 123 ? -32.065 96.241  -18.667 1.00 25.80  ? 120 GLY A CA  1 
ATOM   929  C C   . GLY A 1 123 ? -32.432 95.635  -17.324 1.00 31.78  ? 120 GLY A C   1 
ATOM   930  O O   . GLY A 1 123 ? -33.567 95.721  -16.852 1.00 23.29  ? 120 GLY A O   1 
ATOM   931  N N   . GLY A 1 124 ? -31.437 95.011  -16.703 1.00 23.85  ? 121 GLY A N   1 
ATOM   932  C CA  . GLY A 1 124 ? -31.643 94.368  -15.422 1.00 19.58  ? 121 GLY A CA  1 
ATOM   933  C C   . GLY A 1 124 ? -31.058 92.973  -15.363 1.00 26.34  ? 121 GLY A C   1 
ATOM   934  O O   . GLY A 1 124 ? -31.583 92.105  -14.660 1.00 25.97  ? 121 GLY A O   1 
ATOM   935  N N   . GLY A 1 125 ? -29.977 92.748  -16.108 1.00 25.19  ? 122 GLY A N   1 
ATOM   936  C CA  . GLY A 1 125 ? -29.287 91.470  -16.089 1.00 23.85  ? 122 GLY A CA  1 
ATOM   937  C C   . GLY A 1 125 ? -30.132 90.279  -16.473 1.00 17.03  ? 122 GLY A C   1 
ATOM   938  O O   . GLY A 1 125 ? -29.816 89.155  -16.075 1.00 23.10  ? 122 GLY A O   1 
ATOM   939  N N   . PHE A 1 126 ? -31.204 90.494  -17.235 1.00 24.14  ? 123 PHE A N   1 
ATOM   940  C CA  . PHE A 1 126 ? -32.165 89.468  -17.635 1.00 21.10  ? 123 PHE A CA  1 
ATOM   941  C C   . PHE A 1 126 ? -32.859 88.808  -16.448 1.00 17.36  ? 123 PHE A C   1 
ATOM   942  O O   . PHE A 1 126 ? -33.507 87.768  -16.617 1.00 19.20  ? 123 PHE A O   1 
ATOM   943  C CB  . PHE A 1 126 ? -31.515 88.393  -18.518 1.00 19.69  ? 123 PHE A CB  1 
ATOM   944  C CG  . PHE A 1 126 ? -31.012 88.910  -19.834 1.00 24.43  ? 123 PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 126 ? -31.894 89.204  -20.861 1.00 17.43  ? 123 PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 126 ? -29.656 89.093  -20.049 1.00 22.41  ? 123 PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 126 ? -31.434 89.679  -22.076 1.00 24.81  ? 123 PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 126 ? -29.188 89.566  -21.262 1.00 21.04  ? 123 PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 126 ? -30.079 89.859  -22.277 1.00 28.51  ? 123 PHE A CZ  1 
ATOM   950  N N   . TYR A 1 127 ? -32.746 89.383  -15.249 1.00 18.68  ? 124 TYR A N   1 
ATOM   951  C CA  . TYR A 1 127 ? -33.425 88.859  -14.075 1.00 23.77  ? 124 TYR A CA  1 
ATOM   952  C C   . TYR A 1 127 ? -34.405 89.842  -13.452 1.00 22.26  ? 124 TYR A C   1 
ATOM   953  O O   . TYR A 1 127 ? -35.179 89.440  -12.575 1.00 31.15  ? 124 TYR A O   1 
ATOM   954  C CB  . TYR A 1 127 ? -32.406 88.421  -13.007 1.00 24.85  ? 124 TYR A CB  1 
ATOM   955  C CG  . TYR A 1 127 ? -31.736 89.556  -12.257 1.00 23.16  ? 124 TYR A CG  1 
ATOM   956  C CD1 . TYR A 1 127 ? -32.304 90.085  -11.102 1.00 23.41  ? 124 TYR A CD1 1 
ATOM   957  C CD2 . TYR A 1 127 ? -30.529 90.085  -12.692 1.00 23.08  ? 124 TYR A CD2 1 
ATOM   958  C CE1 . TYR A 1 127 ? -31.698 91.119  -10.416 1.00 23.55  ? 124 TYR A CE1 1 
ATOM   959  C CE2 . TYR A 1 127 ? -29.915 91.120  -12.010 1.00 28.48  ? 124 TYR A CE2 1 
ATOM   960  C CZ  . TYR A 1 127 ? -30.504 91.631  -10.872 1.00 23.02  ? 124 TYR A CZ  1 
ATOM   961  O OH  . TYR A 1 127 ? -29.901 92.659  -10.186 1.00 25.83  ? 124 TYR A OH  1 
ATOM   962  N N   . SER A 1 128 ? -34.393 91.106  -13.865 1.00 21.47  ? 125 SER A N   1 
ATOM   963  C CA  . SER A 1 128 ? -35.261 92.118  -13.282 1.00 19.49  ? 125 SER A CA  1 
ATOM   964  C C   . SER A 1 128 ? -35.545 93.184  -14.332 1.00 24.04  ? 125 SER A C   1 
ATOM   965  O O   . SER A 1 128 ? -35.095 93.094  -15.479 1.00 22.37  ? 125 SER A O   1 
ATOM   966  C CB  . SER A 1 128 ? -34.627 92.729  -12.029 1.00 27.17  ? 125 SER A CB  1 
ATOM   967  O OG  . SER A 1 128 ? -33.424 93.406  -12.346 1.00 21.59  ? 125 SER A OG  1 
ATOM   968  N N   . GLY A 1 129 ? -36.294 94.199  -13.931 1.00 18.41  ? 126 GLY A N   1 
ATOM   969  C CA  . GLY A 1 129 ? -36.614 95.308  -14.800 1.00 20.49  ? 126 GLY A CA  1 
ATOM   970  C C   . GLY A 1 129 ? -38.100 95.374  -15.118 1.00 22.67  ? 126 GLY A C   1 
ATOM   971  O O   . GLY A 1 129 ? -38.841 94.392  -15.010 1.00 18.76  ? 126 GLY A O   1 
ATOM   972  N N   . ALA A 1 130 ? -38.531 96.565  -15.527 1.00 23.27  ? 127 ALA A N   1 
ATOM   973  C CA  . ALA A 1 130 ? -39.922 96.809  -15.877 1.00 23.54  ? 127 ALA A CA  1 
ATOM   974  C C   . ALA A 1 130 ? -40.005 98.099  -16.676 1.00 20.52  ? 127 ALA A C   1 
ATOM   975  O O   . ALA A 1 130 ? -39.225 99.030  -16.458 1.00 21.73  ? 127 ALA A O   1 
ATOM   976  C CB  . ALA A 1 130 ? -40.812 96.895  -14.631 1.00 18.80  ? 127 ALA A CB  1 
ATOM   977  N N   . SER A 1 131 ? -40.960 98.144  -17.604 1.00 25.06  ? 128 SER A N   1 
ATOM   978  C CA  . SER A 1 131 ? -41.176 99.341  -18.407 1.00 24.46  ? 128 SER A CA  1 
ATOM   979  C C   . SER A 1 131 ? -41.917 100.435 -17.651 1.00 25.99  ? 128 SER A C   1 
ATOM   980  O O   . SER A 1 131 ? -42.055 101.544 -18.179 1.00 27.65  ? 128 SER A O   1 
ATOM   981  C CB  . SER A 1 131 ? -41.946 98.989  -19.683 1.00 25.97  ? 128 SER A CB  1 
ATOM   982  O OG  . SER A 1 131 ? -43.204 98.411  -19.378 1.00 30.55  ? 128 SER A OG  1 
ATOM   983  N N   . SER A 1 132 ? -42.385 100.156 -16.437 1.00 24.72  ? 129 SER A N   1 
ATOM   984  C CA  . SER A 1 132 ? -43.161 101.108 -15.653 1.00 22.20  ? 129 SER A CA  1 
ATOM   985  C C   . SER A 1 132 ? -42.303 101.985 -14.752 1.00 27.31  ? 129 SER A C   1 
ATOM   986  O O   . SER A 1 132 ? -42.850 102.842 -14.050 1.00 23.61  ? 129 SER A O   1 
ATOM   987  C CB  . SER A 1 132 ? -44.194 100.364 -14.802 1.00 24.04  ? 129 SER A CB  1 
ATOM   988  O OG  . SER A 1 132 ? -43.567 99.429  -13.942 1.00 24.15  ? 129 SER A OG  1 
ATOM   989  N N   . LEU A 1 133 ? -40.986 101.794 -14.750 1.00 17.62  ? 130 LEU A N   1 
ATOM   990  C CA  . LEU A 1 133 ? -40.121 102.556 -13.860 1.00 26.33  ? 130 LEU A CA  1 
ATOM   991  C C   . LEU A 1 133 ? -40.178 104.043 -14.194 1.00 25.56  ? 130 LEU A C   1 
ATOM   992  O O   . LEU A 1 133 ? -40.345 104.439 -15.351 1.00 23.76  ? 130 LEU A O   1 
ATOM   993  C CB  . LEU A 1 133 ? -38.681 102.048 -13.953 1.00 21.45  ? 130 LEU A CB  1 
ATOM   994  C CG  . LEU A 1 133 ? -38.461 100.585 -13.561 1.00 26.14  ? 130 LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 133 ? -36.978 100.242 -13.567 1.00 17.09  ? 130 LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 133 ? -39.077 100.293 -12.201 1.00 25.07  ? 130 LEU A CD2 1 
ATOM   997  N N   . ASP A 1 134 ? -40.041 104.871 -13.154 1.00 20.26  ? 131 ASP A N   1 
ATOM   998  C CA  . ASP A 1 134 ? -40.125 106.317 -13.334 1.00 23.21  ? 131 ASP A CA  1 
ATOM   999  C C   . ASP A 1 134 ? -39.028 106.840 -14.252 1.00 32.60  ? 131 ASP A C   1 
ATOM   1000 O O   . ASP A 1 134 ? -39.252 107.796 -15.003 1.00 30.43  ? 131 ASP A O   1 
ATOM   1001 C CB  . ASP A 1 134 ? -40.054 107.021 -11.978 1.00 16.20  ? 131 ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 134 ? -41.257 106.728 -11.104 1.00 26.47  ? 131 ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 134 ? -42.196 106.059 -11.585 1.00 29.99  ? 131 ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 134 ? -41.263 107.167 -9.934  1.00 31.85  ? 131 ASP A OD2 1 
ATOM   1005 N N   . VAL A 1 135 ? -37.842 106.229 -14.212 1.00 31.68  ? 132 VAL A N   1 
ATOM   1006 C CA  . VAL A 1 135 ? -36.730 106.685 -15.038 1.00 30.99  ? 132 VAL A CA  1 
ATOM   1007 C C   . VAL A 1 135 ? -36.928 106.365 -16.512 1.00 24.08  ? 132 VAL A C   1 
ATOM   1008 O O   . VAL A 1 135 ? -36.187 106.882 -17.356 1.00 25.83  ? 132 VAL A O   1 
ATOM   1009 C CB  . VAL A 1 135 ? -35.411 106.081 -14.508 1.00 22.29  ? 132 VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 135 ? -35.294 104.616 -14.897 1.00 17.80  ? 132 VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 135 ? -34.206 106.885 -14.985 1.00 31.41  ? 132 VAL A CG2 1 
ATOM   1012 N N   . TYR A 1 136 ? -37.917 105.539 -16.851 1.00 25.43  ? 133 TYR A N   1 
ATOM   1013 C CA  . TYR A 1 136 ? -38.244 105.234 -18.237 1.00 23.85  ? 133 TYR A CA  1 
ATOM   1014 C C   . TYR A 1 136 ? -39.444 106.027 -18.743 1.00 28.87  ? 133 TYR A C   1 
ATOM   1015 O O   . TYR A 1 136 ? -39.987 105.699 -19.803 1.00 31.97  ? 133 TYR A O   1 
ATOM   1016 C CB  . TYR A 1 136 ? -38.509 103.735 -18.406 1.00 20.36  ? 133 TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 136 ? -37.368 102.840 -17.972 1.00 31.99  ? 133 TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 136 ? -36.049 103.267 -18.055 1.00 26.28  ? 133 TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 136 ? -37.614 101.566 -17.479 1.00 25.00  ? 133 TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 136 ? -35.007 102.447 -17.657 1.00 24.40  ? 133 TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 136 ? -36.581 100.741 -17.080 1.00 25.67  ? 133 TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 136 ? -35.280 101.186 -17.170 1.00 28.54  ? 133 TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 136 ? -34.249 100.365 -16.773 1.00 22.24  ? 133 TYR A OH  1 
ATOM   1024 N N   . ASP A 1 137 ? -39.872 107.053 -18.007 1.00 30.12  ? 134 ASP A N   1 
ATOM   1025 C CA  . ASP A 1 137 ? -41.016 107.868 -18.400 1.00 30.71  ? 134 ASP A CA  1 
ATOM   1026 C C   . ASP A 1 137 ? -40.736 108.577 -19.720 1.00 31.04  ? 134 ASP A C   1 
ATOM   1027 O O   . ASP A 1 137 ? -39.867 109.451 -19.791 1.00 31.18  ? 134 ASP A O   1 
ATOM   1028 C CB  . ASP A 1 137 ? -41.349 108.882 -17.302 1.00 29.06  ? 134 ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 137 ? -42.688 109.564 -17.518 1.00 39.72  ? 134 ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 137 ? -43.384 109.229 -18.500 1.00 35.66  ? 134 ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 137 ? -43.046 110.436 -16.699 1.00 36.88  ? 134 ASP A OD2 1 
ATOM   1032 N N   . GLY A 1 138 ? -41.473 108.212 -20.766 1.00 29.04  ? 135 GLY A N   1 
ATOM   1033 C CA  . GLY A 1 138 ? -41.196 108.721 -22.093 1.00 40.89  ? 135 GLY A CA  1 
ATOM   1034 C C   . GLY A 1 138 ? -41.985 109.950 -22.493 1.00 38.94  ? 135 GLY A C   1 
ATOM   1035 O O   . GLY A 1 138 ? -42.079 110.267 -23.682 1.00 33.40  ? 135 GLY A O   1 
ATOM   1036 N N   . ARG A 1 139 ? -42.551 110.660 -21.515 1.00 34.07  ? 136 ARG A N   1 
ATOM   1037 C CA  . ARG A 1 139 ? -43.364 111.826 -21.843 1.00 37.01  ? 136 ARG A CA  1 
ATOM   1038 C C   . ARG A 1 139 ? -42.508 113.013 -22.272 1.00 42.05  ? 136 ARG A C   1 
ATOM   1039 O O   . ARG A 1 139 ? -42.972 113.860 -23.044 1.00 42.29  ? 136 ARG A O   1 
ATOM   1040 C CB  . ARG A 1 139 ? -44.246 112.209 -20.654 1.00 29.51  ? 136 ARG A CB  1 
ATOM   1041 C CG  . ARG A 1 139 ? -43.498 112.841 -19.492 1.00 27.29  ? 136 ARG A CG  1 
ATOM   1042 C CD  . ARG A 1 139 ? -44.444 113.196 -18.359 1.00 26.64  ? 136 ARG A CD  1 
ATOM   1043 N NE  . ARG A 1 139 ? -45.038 112.005 -17.760 1.00 29.86  ? 136 ARG A NE  1 
ATOM   1044 C CZ  . ARG A 1 139 ? -45.986 112.031 -16.829 1.00 36.51  ? 136 ARG A CZ  1 
ATOM   1045 N NH1 . ARG A 1 139 ? -46.457 113.190 -16.391 1.00 29.79  ? 136 ARG A NH1 1 
ATOM   1046 N NH2 . ARG A 1 139 ? -46.465 110.896 -16.339 1.00 34.45  ? 136 ARG A NH2 1 
ATOM   1047 N N   . PHE A 1 140 ? -41.265 113.092 -21.793 1.00 32.74  ? 137 PHE A N   1 
ATOM   1048 C CA  . PHE A 1 140 ? -40.417 114.232 -22.125 1.00 35.37  ? 137 PHE A CA  1 
ATOM   1049 C C   . PHE A 1 140 ? -39.723 114.043 -23.468 1.00 38.64  ? 137 PHE A C   1 
ATOM   1050 O O   . PHE A 1 140 ? -39.567 115.005 -24.229 1.00 32.87  ? 137 PHE A O   1 
ATOM   1051 C CB  . PHE A 1 140 ? -39.390 114.461 -21.017 1.00 26.37  ? 137 PHE A CB  1 
ATOM   1052 C CG  . PHE A 1 140 ? -39.999 114.635 -19.655 1.00 32.95  ? 137 PHE A CG  1 
ATOM   1053 C CD1 . PHE A 1 140 ? -40.035 113.581 -18.758 1.00 31.60  ? 137 PHE A CD1 1 
ATOM   1054 C CD2 . PHE A 1 140 ? -40.542 115.851 -19.274 1.00 32.41  ? 137 PHE A CD2 1 
ATOM   1055 C CE1 . PHE A 1 140 ? -40.597 113.736 -17.505 1.00 27.94  ? 137 PHE A CE1 1 
ATOM   1056 C CE2 . PHE A 1 140 ? -41.106 116.013 -18.022 1.00 35.59  ? 137 PHE A CE2 1 
ATOM   1057 C CZ  . PHE A 1 140 ? -41.133 114.954 -17.137 1.00 27.34  ? 137 PHE A CZ  1 
ATOM   1058 N N   . LEU A 1 141 ? -39.298 112.815 -23.774 1.00 34.65  ? 138 LEU A N   1 
ATOM   1059 C CA  . LEU A 1 141 ? -38.669 112.550 -25.064 1.00 39.17  ? 138 LEU A CA  1 
ATOM   1060 C C   . LEU A 1 141 ? -39.670 112.693 -26.204 1.00 42.43  ? 138 LEU A C   1 
ATOM   1061 O O   . LEU A 1 141 ? -39.321 113.171 -27.290 1.00 44.24  ? 138 LEU A O   1 
ATOM   1062 C CB  . LEU A 1 141 ? -38.049 111.153 -25.064 1.00 31.44  ? 138 LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 141 ? -37.383 110.684 -26.358 1.00 41.84  ? 138 LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 141 ? -36.197 111.569 -26.704 1.00 38.26  ? 138 LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 141 ? -36.956 109.229 -26.241 1.00 36.27  ? 138 LEU A CD2 1 
ATOM   1066 N N   . VAL A 1 142 ? -40.920 112.290 -25.972 1.00 38.30  ? 139 VAL A N   1 
ATOM   1067 C CA  . VAL A 1 142 ? -41.935 112.364 -27.018 1.00 36.91  ? 139 VAL A CA  1 
ATOM   1068 C C   . VAL A 1 142 ? -42.372 113.807 -27.243 1.00 36.04  ? 139 VAL A C   1 
ATOM   1069 O O   . VAL A 1 142 ? -42.607 114.228 -28.382 1.00 35.77  ? 139 VAL A O   1 
ATOM   1070 C CB  . VAL A 1 142 ? -43.121 111.449 -26.663 1.00 33.83  ? 139 VAL A CB  1 
ATOM   1071 C CG1 . VAL A 1 142 ? -44.346 111.800 -27.490 1.00 35.07  ? 139 VAL A CG1 1 
ATOM   1072 C CG2 . VAL A 1 142 ? -42.738 109.997 -26.878 1.00 25.42  ? 139 VAL A CG2 1 
ATOM   1073 N N   . GLN A 1 143 ? -42.476 114.592 -26.170 1.00 31.09  ? 140 GLN A N   1 
ATOM   1074 C CA  . GLN A 1 143 ? -42.908 115.979 -26.316 1.00 39.25  ? 140 GLN A CA  1 
ATOM   1075 C C   . GLN A 1 143 ? -41.833 116.822 -26.991 1.00 39.07  ? 140 GLN A C   1 
ATOM   1076 O O   . GLN A 1 143 ? -42.122 117.587 -27.919 1.00 51.32  ? 140 GLN A O   1 
ATOM   1077 C CB  . GLN A 1 143 ? -43.273 116.561 -24.948 1.00 37.27  ? 140 GLN A CB  1 
ATOM   1078 C CG  . GLN A 1 143 ? -43.971 117.919 -24.999 1.00 42.49  ? 140 GLN A CG  1 
ATOM   1079 C CD  . GLN A 1 143 ? -43.009 119.076 -25.204 1.00 53.46  ? 140 GLN A CD  1 
ATOM   1080 O OE1 . GLN A 1 143 ? -41.841 119.005 -24.819 1.00 51.43  ? 140 GLN A OE1 1 
ATOM   1081 N NE2 . GLN A 1 143 ? -43.494 120.146 -25.823 1.00 55.09  ? 140 GLN A NE2 1 
ATOM   1082 N N   . ALA A 1 144 ? -40.584 116.696 -26.539 1.00 38.36  ? 141 ALA A N   1 
ATOM   1083 C CA  . ALA A 1 144 ? -39.532 117.587 -27.015 1.00 43.10  ? 141 ALA A CA  1 
ATOM   1084 C C   . ALA A 1 144 ? -39.116 117.276 -28.448 1.00 36.19  ? 141 ALA A C   1 
ATOM   1085 O O   . ALA A 1 144 ? -38.660 118.174 -29.164 1.00 42.80  ? 141 ALA A O   1 
ATOM   1086 C CB  . ALA A 1 144 ? -38.320 117.512 -26.087 1.00 40.67  ? 141 ALA A CB  1 
ATOM   1087 N N   . GLU A 1 145 ? -39.265 116.027 -28.886 1.00 37.71  ? 142 GLU A N   1 
ATOM   1088 C CA  . GLU A 1 145 ? -38.786 115.614 -30.197 1.00 31.25  ? 142 GLU A CA  1 
ATOM   1089 C C   . GLU A 1 145 ? -39.882 115.096 -31.117 1.00 43.85  ? 142 GLU A C   1 
ATOM   1090 O O   . GLU A 1 145 ? -39.583 114.735 -32.262 1.00 39.60  ? 142 GLU A O   1 
ATOM   1091 C CB  . GLU A 1 145 ? -37.694 114.548 -30.043 1.00 42.52  ? 142 GLU A CB  1 
ATOM   1092 C CG  . GLU A 1 145 ? -36.442 115.066 -29.352 1.00 40.64  ? 142 GLU A CG  1 
ATOM   1093 C CD  . GLU A 1 145 ? -35.746 116.151 -30.153 1.00 40.94  ? 142 GLU A CD  1 
ATOM   1094 O OE1 . GLU A 1 145 ? -35.726 116.052 -31.398 1.00 39.61  ? 142 GLU A OE1 1 
ATOM   1095 O OE2 . GLU A 1 145 ? -35.225 117.107 -29.539 1.00 33.35  ? 142 GLU A OE2 1 
ATOM   1096 N N   . ARG A 1 146 ? -41.133 115.050 -30.655 1.00 46.43  ? 143 ARG A N   1 
ATOM   1097 C CA  . ARG A 1 146 ? -42.281 114.673 -31.484 1.00 47.11  ? 143 ARG A CA  1 
ATOM   1098 C C   . ARG A 1 146 ? -42.075 113.318 -32.155 1.00 39.82  ? 143 ARG A C   1 
ATOM   1099 O O   . ARG A 1 146 ? -42.411 113.120 -33.324 1.00 42.58  ? 143 ARG A O   1 
ATOM   1100 C CB  . ARG A 1 146 ? -42.588 115.754 -32.522 1.00 46.66  ? 143 ARG A CB  1 
ATOM   1101 C CG  . ARG A 1 146 ? -42.938 117.103 -31.915 1.00 53.70  ? 143 ARG A CG  1 
ATOM   1102 C CD  . ARG A 1 146 ? -43.863 117.894 -32.823 1.00 64.16  ? 143 ARG A CD  1 
ATOM   1103 N NE  . ARG A 1 146 ? -45.151 117.229 -32.995 1.00 57.73  ? 143 ARG A NE  1 
ATOM   1104 C CZ  . ARG A 1 146 ? -46.182 117.372 -32.167 1.00 60.66  ? 143 ARG A CZ  1 
ATOM   1105 N NH1 . ARG A 1 146 ? -46.077 118.159 -31.104 1.00 51.02  ? 143 ARG A NH1 1 
ATOM   1106 N NH2 . ARG A 1 146 ? -47.317 116.728 -32.400 1.00 54.45  ? 143 ARG A NH2 1 
ATOM   1107 N N   . THR A 1 147 ? -41.516 112.375 -31.405 1.00 37.96  ? 144 THR A N   1 
ATOM   1108 C CA  . THR A 1 147 ? -41.339 111.006 -31.862 1.00 37.62  ? 144 THR A CA  1 
ATOM   1109 C C   . THR A 1 147 ? -42.313 110.088 -31.134 1.00 33.28  ? 144 THR A C   1 
ATOM   1110 O O   . THR A 1 147 ? -42.908 110.456 -30.118 1.00 39.86  ? 144 THR A O   1 
ATOM   1111 C CB  . THR A 1 147 ? -39.900 110.527 -31.639 1.00 40.56  ? 144 THR A CB  1 
ATOM   1112 O OG1 . THR A 1 147 ? -39.784 109.153 -32.029 1.00 46.02  ? 144 THR A OG1 1 
ATOM   1113 C CG2 . THR A 1 147 ? -39.513 110.667 -30.174 1.00 34.41  ? 144 THR A CG2 1 
ATOM   1114 N N   . VAL A 1 148 ? -42.478 108.885 -31.675 1.00 27.85  ? 145 VAL A N   1 
ATOM   1115 C CA  . VAL A 1 148 ? -43.316 107.855 -31.071 1.00 37.03  ? 145 VAL A CA  1 
ATOM   1116 C C   . VAL A 1 148 ? -42.418 106.896 -30.304 1.00 41.53  ? 145 VAL A C   1 
ATOM   1117 O O   . VAL A 1 148 ? -41.447 106.365 -30.858 1.00 39.83  ? 145 VAL A O   1 
ATOM   1118 C CB  . VAL A 1 148 ? -44.142 107.111 -32.134 1.00 29.06  ? 145 VAL A CB  1 
ATOM   1119 C CG1 . VAL A 1 148 ? -44.871 105.932 -31.509 1.00 34.76  ? 145 VAL A CG1 1 
ATOM   1120 C CG2 . VAL A 1 148 ? -45.129 108.060 -32.797 1.00 39.79  ? 145 VAL A CG2 1 
ATOM   1121 N N   . LEU A 1 149 ? -42.732 106.678 -29.029 1.00 34.21  ? 146 LEU A N   1 
ATOM   1122 C CA  . LEU A 1 149 ? -41.936 105.823 -28.159 1.00 31.23  ? 146 LEU A CA  1 
ATOM   1123 C C   . LEU A 1 149 ? -42.768 104.631 -27.712 1.00 27.16  ? 146 LEU A C   1 
ATOM   1124 O O   . LEU A 1 149 ? -43.908 104.795 -27.263 1.00 25.56  ? 146 LEU A O   1 
ATOM   1125 C CB  . LEU A 1 149 ? -41.420 106.599 -26.944 1.00 28.44  ? 146 LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 149 ? -40.595 105.805 -25.929 1.00 29.90  ? 146 LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 149 ? -39.423 105.113 -26.603 1.00 28.78  ? 146 LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 149 ? -40.103 106.713 -24.819 1.00 37.18  ? 146 LEU A CD2 1 
ATOM   1129 N N   . VAL A 1 150 ? -42.195 103.437 -27.838 1.00 23.45  ? 147 VAL A N   1 
ATOM   1130 C CA  . VAL A 1 150 ? -42.829 102.194 -27.420 1.00 24.56  ? 147 VAL A CA  1 
ATOM   1131 C C   . VAL A 1 150 ? -41.891 101.480 -26.458 1.00 34.58  ? 147 VAL A C   1 
ATOM   1132 O O   . VAL A 1 150 ? -40.671 101.481 -26.651 1.00 27.71  ? 147 VAL A O   1 
ATOM   1133 C CB  . VAL A 1 150 ? -43.163 101.290 -28.627 1.00 21.55  ? 147 VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 150 ? -43.954 100.066 -28.181 1.00 19.68  ? 147 VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 150 ? -43.929 102.070 -29.687 1.00 24.21  ? 147 VAL A CG2 1 
ATOM   1136 N N   . SER A 1 151 ? -42.459 100.881 -25.413 1.00 26.22  ? 148 SER A N   1 
ATOM   1137 C CA  . SER A 1 151 ? -41.695 100.067 -24.480 1.00 31.28  ? 148 SER A CA  1 
ATOM   1138 C C   . SER A 1 151 ? -42.560 98.904  -24.026 1.00 27.37  ? 148 SER A C   1 
ATOM   1139 O O   . SER A 1 151 ? -43.767 99.064  -23.821 1.00 29.08  ? 148 SER A O   1 
ATOM   1140 C CB  . SER A 1 151 ? -41.220 100.879 -23.269 1.00 25.65  ? 148 SER A CB  1 
ATOM   1141 O OG  . SER A 1 151 ? -42.313 101.312 -22.480 1.00 23.57  ? 148 SER A OG  1 
ATOM   1142 N N   . MET A 1 152 ? -41.942 97.735  -23.874 1.00 25.01  ? 149 MET A N   1 
ATOM   1143 C CA  . MET A 1 152 ? -42.667 96.519  -23.543 1.00 23.22  ? 149 MET A CA  1 
ATOM   1144 C C   . MET A 1 152 ? -42.063 95.863  -22.311 1.00 32.23  ? 149 MET A C   1 
ATOM   1145 O O   . MET A 1 152 ? -40.910 96.108  -21.945 1.00 24.63  ? 149 MET A O   1 
ATOM   1146 C CB  . MET A 1 152 ? -42.658 95.520  -24.710 1.00 19.23  ? 149 MET A CB  1 
ATOM   1147 C CG  . MET A 1 152 ? -41.446 94.595  -24.734 1.00 23.61  ? 149 MET A CG  1 
ATOM   1148 S SD  . MET A 1 152 ? -39.889 95.452  -25.048 1.00 29.91  ? 149 MET A SD  1 
ATOM   1149 C CE  . MET A 1 152 ? -40.132 95.971  -26.744 1.00 31.61  ? 149 MET A CE  1 
ATOM   1150 N N   . ASN A 1 153 ? -42.872 95.027  -21.667 1.00 28.09  ? 150 ASN A N   1 
ATOM   1151 C CA  . ASN A 1 153 ? -42.396 94.129  -20.628 1.00 23.86  ? 150 ASN A CA  1 
ATOM   1152 C C   . ASN A 1 153 ? -42.069 92.777  -21.245 1.00 27.00  ? 150 ASN A C   1 
ATOM   1153 O O   . ASN A 1 153 ? -42.769 92.307  -22.146 1.00 25.41  ? 150 ASN A O   1 
ATOM   1154 C CB  . ASN A 1 153 ? -43.445 93.956  -19.527 1.00 19.24  ? 150 ASN A CB  1 
ATOM   1155 C CG  . ASN A 1 153 ? -43.383 95.051  -18.482 1.00 24.09  ? 150 ASN A CG  1 
ATOM   1156 O OD1 . ASN A 1 153 ? -42.713 96.065  -18.666 1.00 28.48  ? 150 ASN A OD1 1 
ATOM   1157 N ND2 . ASN A 1 153 ? -44.088 94.849  -17.374 1.00 26.04  ? 150 ASN A ND2 1 
ATOM   1158 N N   . TYR A 1 154 ? -40.994 92.160  -20.764 1.00 16.95  ? 151 TYR A N   1 
ATOM   1159 C CA  . TYR A 1 154 ? -40.629 90.819  -21.190 1.00 21.91  ? 151 TYR A CA  1 
ATOM   1160 C C   . TYR A 1 154 ? -40.259 89.997  -19.966 1.00 20.33  ? 151 TYR A C   1 
ATOM   1161 O O   . TYR A 1 154 ? -39.760 90.527  -18.970 1.00 19.16  ? 151 TYR A O   1 
ATOM   1162 C CB  . TYR A 1 154 ? -39.472 90.830  -22.206 1.00 25.59  ? 151 TYR A CB  1 
ATOM   1163 C CG  . TYR A 1 154 ? -38.184 91.441  -21.698 1.00 23.41  ? 151 TYR A CG  1 
ATOM   1164 C CD1 . TYR A 1 154 ? -37.940 92.802  -21.828 1.00 22.09  ? 151 TYR A CD1 1 
ATOM   1165 C CD2 . TYR A 1 154 ? -37.206 90.653  -21.104 1.00 22.73  ? 151 TYR A CD2 1 
ATOM   1166 C CE1 . TYR A 1 154 ? -36.762 93.363  -21.372 1.00 20.47  ? 151 TYR A CE1 1 
ATOM   1167 C CE2 . TYR A 1 154 ? -36.025 91.206  -20.644 1.00 21.71  ? 151 TYR A CE2 1 
ATOM   1168 C CZ  . TYR A 1 154 ? -35.809 92.560  -20.780 1.00 24.71  ? 151 TYR A CZ  1 
ATOM   1169 O OH  . TYR A 1 154 ? -34.634 93.115  -20.324 1.00 19.38  ? 151 TYR A OH  1 
ATOM   1170 N N   . ARG A 1 155 ? -40.521 88.695  -20.050 1.00 16.61  ? 152 ARG A N   1 
ATOM   1171 C CA  . ARG A 1 155 ? -40.251 87.807  -18.929 1.00 22.18  ? 152 ARG A CA  1 
ATOM   1172 C C   . ARG A 1 155 ? -38.759 87.757  -18.628 1.00 28.94  ? 152 ARG A C   1 
ATOM   1173 O O   . ARG A 1 155 ? -37.925 87.662  -19.533 1.00 25.17  ? 152 ARG A O   1 
ATOM   1174 C CB  . ARG A 1 155 ? -40.778 86.403  -19.228 1.00 28.00  ? 152 ARG A CB  1 
ATOM   1175 C CG  . ARG A 1 155 ? -42.284 86.257  -19.073 1.00 28.35  ? 152 ARG A CG  1 
ATOM   1176 C CD  . ARG A 1 155 ? -42.763 84.915  -19.602 1.00 20.13  ? 152 ARG A CD  1 
ATOM   1177 N NE  . ARG A 1 155 ? -42.758 84.873  -21.061 1.00 26.65  ? 152 ARG A NE  1 
ATOM   1178 C CZ  . ARG A 1 155 ? -43.002 83.781  -21.778 1.00 25.19  ? 152 ARG A CZ  1 
ATOM   1179 N NH1 . ARG A 1 155 ? -43.265 82.632  -21.172 1.00 25.77  ? 152 ARG A NH1 1 
ATOM   1180 N NH2 . ARG A 1 155 ? -42.978 83.838  -23.103 1.00 30.15  ? 152 ARG A NH2 1 
ATOM   1181 N N   . VAL A 1 156 ? -38.426 87.827  -17.341 1.00 23.81  ? 153 VAL A N   1 
ATOM   1182 C CA  . VAL A 1 156 ? -37.048 87.800  -16.876 1.00 16.91  ? 153 VAL A CA  1 
ATOM   1183 C C   . VAL A 1 156 ? -36.866 86.597  -15.957 1.00 23.38  ? 153 VAL A C   1 
ATOM   1184 O O   . VAL A 1 156 ? -37.823 85.914  -15.590 1.00 21.74  ? 153 VAL A O   1 
ATOM   1185 C CB  . VAL A 1 156 ? -36.649 89.103  -16.157 1.00 23.72  ? 153 VAL A CB  1 
ATOM   1186 C CG1 . VAL A 1 156 ? -36.655 90.270  -17.130 1.00 18.32  ? 153 VAL A CG1 1 
ATOM   1187 C CG2 . VAL A 1 156 ? -37.589 89.370  -14.991 1.00 14.20  ? 153 VAL A CG2 1 
ATOM   1188 N N   . GLY A 1 157 ? -35.613 86.348  -15.587 1.00 23.32  ? 154 GLY A N   1 
ATOM   1189 C CA  . GLY A 1 157 ? -35.301 85.252  -14.693 1.00 16.65  ? 154 GLY A CA  1 
ATOM   1190 C C   . GLY A 1 157 ? -35.646 83.906  -15.301 1.00 17.26  ? 154 GLY A C   1 
ATOM   1191 O O   . GLY A 1 157 ? -35.565 83.694  -16.516 1.00 23.84  ? 154 GLY A O   1 
ATOM   1192 N N   . ALA A 1 158 ? -36.048 82.976  -14.431 1.00 19.32  ? 155 ALA A N   1 
ATOM   1193 C CA  . ALA A 1 158 ? -36.399 81.635  -14.888 1.00 21.68  ? 155 ALA A CA  1 
ATOM   1194 C C   . ALA A 1 158 ? -37.608 81.651  -15.813 1.00 27.20  ? 155 ALA A C   1 
ATOM   1195 O O   . ALA A 1 158 ? -37.684 80.848  -16.750 1.00 21.23  ? 155 ALA A O   1 
ATOM   1196 C CB  . ALA A 1 158 ? -36.662 80.724  -13.689 1.00 15.39  ? 155 ALA A CB  1 
ATOM   1197 N N   . PHE A 1 159 ? -38.558 82.557  -15.574 1.00 25.57  ? 156 PHE A N   1 
ATOM   1198 C CA  . PHE A 1 159 ? -39.760 82.610  -16.397 1.00 24.57  ? 156 PHE A CA  1 
ATOM   1199 C C   . PHE A 1 159 ? -39.464 83.018  -17.833 1.00 20.35  ? 156 PHE A C   1 
ATOM   1200 O O   . PHE A 1 159 ? -40.279 82.749  -18.721 1.00 27.14  ? 156 PHE A O   1 
ATOM   1201 C CB  . PHE A 1 159 ? -40.773 83.575  -15.780 1.00 23.56  ? 156 PHE A CB  1 
ATOM   1202 C CG  . PHE A 1 159 ? -41.047 83.312  -14.330 1.00 26.35  ? 156 PHE A CG  1 
ATOM   1203 C CD1 . PHE A 1 159 ? -40.347 83.990  -13.346 1.00 23.04  ? 156 PHE A CD1 1 
ATOM   1204 C CD2 . PHE A 1 159 ? -41.998 82.381  -13.949 1.00 26.75  ? 156 PHE A CD2 1 
ATOM   1205 C CE1 . PHE A 1 159 ? -40.594 83.748  -12.010 1.00 26.44  ? 156 PHE A CE1 1 
ATOM   1206 C CE2 . PHE A 1 159 ? -42.250 82.135  -12.614 1.00 24.83  ? 156 PHE A CE2 1 
ATOM   1207 C CZ  . PHE A 1 159 ? -41.546 82.819  -11.644 1.00 24.24  ? 156 PHE A CZ  1 
ATOM   1208 N N   . GLY A 1 160 ? -38.321 83.648  -18.082 1.00 29.72  ? 157 GLY A N   1 
ATOM   1209 C CA  . GLY A 1 160 ? -37.996 84.090  -19.421 1.00 24.84  ? 157 GLY A CA  1 
ATOM   1210 C C   . GLY A 1 160 ? -36.805 83.388  -20.039 1.00 28.73  ? 157 GLY A C   1 
ATOM   1211 O O   . GLY A 1 160 ? -36.649 83.398  -21.264 1.00 28.66  ? 157 GLY A O   1 
ATOM   1212 N N   . PHE A 1 161 ? -35.950 82.772  -19.215 1.00 24.73  ? 158 PHE A N   1 
ATOM   1213 C CA  . PHE A 1 161 ? -34.699 82.240  -19.740 1.00 24.99  ? 158 PHE A CA  1 
ATOM   1214 C C   . PHE A 1 161 ? -34.259 80.924  -19.107 1.00 26.63  ? 158 PHE A C   1 
ATOM   1215 O O   . PHE A 1 161 ? -33.119 80.500  -19.340 1.00 28.94  ? 158 PHE A O   1 
ATOM   1216 C CB  . PHE A 1 161 ? -33.587 83.287  -19.595 1.00 19.67  ? 158 PHE A CB  1 
ATOM   1217 C CG  . PHE A 1 161 ? -33.889 84.580  -20.296 1.00 20.95  ? 158 PHE A CG  1 
ATOM   1218 C CD1 . PHE A 1 161 ? -34.372 85.670  -19.591 1.00 18.87  ? 158 PHE A CD1 1 
ATOM   1219 C CD2 . PHE A 1 161 ? -33.720 84.695  -21.666 1.00 27.28  ? 158 PHE A CD2 1 
ATOM   1220 C CE1 . PHE A 1 161 ? -34.662 86.857  -20.236 1.00 17.88  ? 158 PHE A CE1 1 
ATOM   1221 C CE2 . PHE A 1 161 ? -34.009 85.880  -22.317 1.00 26.46  ? 158 PHE A CE2 1 
ATOM   1222 C CZ  . PHE A 1 161 ? -34.481 86.963  -21.600 1.00 23.10  ? 158 PHE A CZ  1 
ATOM   1223 N N   . LEU A 1 162 ? -35.106 80.258  -18.325 1.00 26.95  ? 159 LEU A N   1 
ATOM   1224 C CA  . LEU A 1 162 ? -34.803 78.891  -17.923 1.00 26.32  ? 159 LEU A CA  1 
ATOM   1225 C C   . LEU A 1 162 ? -34.895 77.988  -19.144 1.00 32.56  ? 159 LEU A C   1 
ATOM   1226 O O   . LEU A 1 162 ? -35.916 77.969  -19.838 1.00 32.00  ? 159 LEU A O   1 
ATOM   1227 C CB  . LEU A 1 162 ? -35.759 78.415  -16.830 1.00 24.70  ? 159 LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 162 ? -35.558 76.982  -16.325 1.00 22.33  ? 159 LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 162 ? -35.677 76.928  -14.812 1.00 24.81  ? 159 LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 162 ? -36.552 76.024  -16.970 1.00 25.32  ? 159 LEU A CD2 1 
ATOM   1231 N N   . ALA A 1 163 ? -33.827 77.241  -19.413 1.00 29.12  ? 160 ALA A N   1 
ATOM   1232 C CA  . ALA A 1 163 ? -33.705 76.491  -20.655 1.00 29.73  ? 160 ALA A CA  1 
ATOM   1233 C C   . ALA A 1 163 ? -33.261 75.067  -20.368 1.00 37.95  ? 160 ALA A C   1 
ATOM   1234 O O   . ALA A 1 163 ? -32.189 74.850  -19.793 1.00 39.27  ? 160 ALA A O   1 
ATOM   1235 C CB  . ALA A 1 163 ? -32.717 77.171  -21.609 1.00 37.33  ? 160 ALA A CB  1 
ATOM   1236 N N   . LEU A 1 164 ? -34.090 74.104  -20.759 1.00 32.88  ? 161 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 164 ? -33.657 72.725  -20.923 1.00 40.18  ? 161 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 164 ? -33.455 72.502  -22.417 1.00 42.13  ? 161 LEU A C   1 
ATOM   1239 O O   . LEU A 1 164 ? -34.415 72.188  -23.132 1.00 43.37  ? 161 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 164 ? -34.677 71.742  -20.345 1.00 41.50  ? 161 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 164 ? -34.809 71.709  -18.820 1.00 41.58  ? 161 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 164 ? -35.856 70.693  -18.396 1.00 45.02  ? 161 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 164 ? -33.470 71.400  -18.171 1.00 33.73  ? 161 LEU A CD2 1 
ATOM   1244 N N   . PRO A 1 165 ? -32.232 72.675  -22.921 1.00 44.39  ? 162 PRO A N   1 
ATOM   1245 C CA  . PRO A 1 165 ? -32.026 72.716  -24.375 1.00 49.88  ? 162 PRO A CA  1 
ATOM   1246 C C   . PRO A 1 165 ? -32.483 71.437  -25.062 1.00 45.09  ? 162 PRO A C   1 
ATOM   1247 O O   . PRO A 1 165 ? -32.226 70.327  -24.592 1.00 45.58  ? 162 PRO A O   1 
ATOM   1248 C CB  . PRO A 1 165 ? -30.512 72.916  -24.512 1.00 47.77  ? 162 PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 165 ? -30.093 73.534  -23.216 1.00 44.93  ? 162 PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 165 ? -30.986 72.923  -22.177 1.00 34.70  ? 162 PRO A CD  1 
ATOM   1251 N N   . GLY A 1 166 ? -33.174 71.610  -26.190 1.00 53.73  ? 163 GLY A N   1 
ATOM   1252 C CA  . GLY A 1 166 ? -33.705 70.523  -26.973 1.00 58.65  ? 163 GLY A CA  1 
ATOM   1253 C C   . GLY A 1 166 ? -35.159 70.203  -26.688 1.00 59.62  ? 163 GLY A C   1 
ATOM   1254 O O   . GLY A 1 166 ? -35.879 69.777  -27.598 1.00 63.30  ? 163 GLY A O   1 
ATOM   1255 N N   . SER A 1 167 ? -35.607 70.403  -25.451 1.00 50.21  ? 164 SER A N   1 
ATOM   1256 C CA  . SER A 1 167 ? -36.976 70.074  -25.087 1.00 55.21  ? 164 SER A CA  1 
ATOM   1257 C C   . SER A 1 167 ? -37.948 71.112  -25.643 1.00 50.01  ? 164 SER A C   1 
ATOM   1258 O O   . SER A 1 167 ? -37.568 72.224  -26.020 1.00 47.36  ? 164 SER A O   1 
ATOM   1259 C CB  . SER A 1 167 ? -37.120 69.986  -23.568 1.00 48.11  ? 164 SER A CB  1 
ATOM   1260 O OG  . SER A 1 167 ? -36.918 71.252  -22.963 1.00 53.38  ? 164 SER A OG  1 
ATOM   1261 N N   . ARG A 1 168 ? -39.225 70.730  -25.690 1.00 47.22  ? 165 ARG A N   1 
ATOM   1262 C CA  . ARG A 1 168 ? -40.280 71.634  -26.125 1.00 56.83  ? 165 ARG A CA  1 
ATOM   1263 C C   . ARG A 1 168 ? -41.001 72.317  -24.972 1.00 45.76  ? 165 ARG A C   1 
ATOM   1264 O O   . ARG A 1 168 ? -41.720 73.294  -25.206 1.00 45.42  ? 165 ARG A O   1 
ATOM   1265 C CB  . ARG A 1 168 ? -41.310 70.885  -26.981 1.00 60.17  ? 165 ARG A CB  1 
ATOM   1266 C CG  . ARG A 1 168 ? -40.855 70.591  -28.403 1.00 77.18  ? 165 ARG A CG  1 
ATOM   1267 C CD  . ARG A 1 168 ? -40.529 71.873  -29.156 1.00 73.03  ? 165 ARG A CD  1 
ATOM   1268 N NE  . ARG A 1 168 ? -39.111 72.213  -29.079 1.00 92.26  ? 165 ARG A NE  1 
ATOM   1269 C CZ  . ARG A 1 168 ? -38.609 73.402  -29.395 1.00 90.40  ? 165 ARG A CZ  1 
ATOM   1270 N NH1 . ARG A 1 168 ? -39.411 74.375  -29.805 1.00 72.74  ? 165 ARG A NH1 1 
ATOM   1271 N NH2 . ARG A 1 168 ? -37.304 73.620  -29.296 1.00 79.44  ? 165 ARG A NH2 1 
ATOM   1272 N N   . GLU A 1 169 ? -40.830 71.828  -23.743 1.00 44.19  ? 166 GLU A N   1 
ATOM   1273 C CA  . GLU A 1 169 ? -41.488 72.431  -22.592 1.00 44.00  ? 166 GLU A CA  1 
ATOM   1274 C C   . GLU A 1 169 ? -40.739 73.643  -22.054 1.00 48.58  ? 166 GLU A C   1 
ATOM   1275 O O   . GLU A 1 169 ? -41.359 74.509  -21.427 1.00 48.71  ? 166 GLU A O   1 
ATOM   1276 C CB  . GLU A 1 169 ? -41.655 71.398  -21.474 1.00 46.21  ? 166 GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 169 ? -42.518 70.195  -21.837 1.00 50.38  ? 166 GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 169 ? -41.747 69.115  -22.576 1.00 66.68  ? 166 GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 169 ? -40.577 69.356  -22.941 1.00 64.29  ? 166 GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 169 ? -42.313 68.022  -22.787 1.00 62.56  ? 166 GLU A OE2 1 
ATOM   1281 N N   . ALA A 1 170 ? -39.430 73.723  -22.280 1.00 40.94  ? 167 ALA A N   1 
ATOM   1282 C CA  . ALA A 1 170 ? -38.625 74.857  -21.823 1.00 39.13  ? 167 ALA A CA  1 
ATOM   1283 C C   . ALA A 1 170 ? -37.472 75.062  -22.791 1.00 35.19  ? 167 ALA A C   1 
ATOM   1284 O O   . ALA A 1 170 ? -36.322 74.704  -22.507 1.00 45.03  ? 167 ALA A O   1 
ATOM   1285 C CB  . ALA A 1 170 ? -38.113 74.637  -20.400 1.00 32.96  ? 167 ALA A CB  1 
ATOM   1286 N N   . PRO A 1 171 ? -37.744 75.647  -23.963 1.00 38.17  ? 168 PRO A N   1 
ATOM   1287 C CA  . PRO A 1 171 ? -36.679 75.815  -24.962 1.00 36.87  ? 168 PRO A CA  1 
ATOM   1288 C C   . PRO A 1 171 ? -35.718 76.948  -24.656 1.00 43.75  ? 168 PRO A C   1 
ATOM   1289 O O   . PRO A 1 171 ? -34.627 76.982  -25.240 1.00 42.20  ? 168 PRO A O   1 
ATOM   1290 C CB  . PRO A 1 171 ? -37.458 76.093  -26.253 1.00 39.81  ? 168 PRO A CB  1 
ATOM   1291 C CG  . PRO A 1 171 ? -38.694 76.785  -25.777 1.00 39.35  ? 168 PRO A CG  1 
ATOM   1292 C CD  . PRO A 1 171 ? -39.038 76.165  -24.441 1.00 34.58  ? 168 PRO A CD  1 
ATOM   1293 N N   . GLY A 1 172 ? -36.081 77.871  -23.771 1.00 43.65  ? 169 GLY A N   1 
ATOM   1294 C CA  . GLY A 1 172 ? -35.247 79.012  -23.467 1.00 32.33  ? 169 GLY A CA  1 
ATOM   1295 C C   . GLY A 1 172 ? -35.468 80.168  -24.427 1.00 34.31  ? 169 GLY A C   1 
ATOM   1296 O O   . GLY A 1 172 ? -36.128 80.052  -25.463 1.00 34.82  ? 169 GLY A O   1 
ATOM   1297 N N   . ASN A 1 173 ? -34.903 81.316  -24.052 1.00 29.72  ? 170 ASN A N   1 
ATOM   1298 C CA  . ASN A 1 173 ? -34.949 82.546  -24.843 1.00 34.74  ? 170 ASN A CA  1 
ATOM   1299 C C   . ASN A 1 173 ? -36.372 83.047  -25.073 1.00 33.51  ? 170 ASN A C   1 
ATOM   1300 O O   . ASN A 1 173 ? -36.601 83.872  -25.964 1.00 32.10  ? 170 ASN A O   1 
ATOM   1301 C CB  . ASN A 1 173 ? -34.237 82.369  -26.190 1.00 30.72  ? 170 ASN A CB  1 
ATOM   1302 C CG  . ASN A 1 173 ? -32.799 81.922  -26.034 1.00 37.91  ? 170 ASN A CG  1 
ATOM   1303 O OD1 . ASN A 1 173 ? -32.131 82.274  -25.065 1.00 34.06  ? 170 ASN A OD1 1 
ATOM   1304 N ND2 . ASN A 1 173 ? -32.315 81.139  -26.991 1.00 34.96  ? 170 ASN A ND2 1 
ATOM   1305 N N   . VAL A 1 174 ? -37.343 82.570  -24.288 1.00 28.85  ? 171 VAL A N   1 
ATOM   1306 C CA  . VAL A 1 174 ? -38.716 83.024  -24.473 1.00 26.26  ? 171 VAL A CA  1 
ATOM   1307 C C   . VAL A 1 174 ? -38.873 84.488  -24.086 1.00 25.18  ? 171 VAL A C   1 
ATOM   1308 O O   . VAL A 1 174 ? -39.794 85.156  -24.568 1.00 29.37  ? 171 VAL A O   1 
ATOM   1309 C CB  . VAL A 1 174 ? -39.700 82.135  -23.686 1.00 31.35  ? 171 VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 174 ? -39.548 80.679  -24.101 1.00 27.01  ? 171 VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 174 ? -39.496 82.291  -22.189 1.00 31.15  ? 171 VAL A CG2 1 
ATOM   1312 N N   . GLY A 1 175 ? -37.990 85.009  -23.231 1.00 23.51  ? 172 GLY A N   1 
ATOM   1313 C CA  . GLY A 1 175 ? -38.011 86.433  -22.944 1.00 17.87  ? 172 GLY A CA  1 
ATOM   1314 C C   . GLY A 1 175 ? -37.632 87.267  -24.152 1.00 30.13  ? 172 GLY A C   1 
ATOM   1315 O O   . GLY A 1 175 ? -38.195 88.342  -24.378 1.00 26.97  ? 172 GLY A O   1 
ATOM   1316 N N   . LEU A 1 176 ? -36.669 86.786  -24.943 1.00 26.51  ? 173 LEU A N   1 
ATOM   1317 C CA  . LEU A 1 176 ? -36.350 87.447  -26.204 1.00 25.69  ? 173 LEU A CA  1 
ATOM   1318 C C   . LEU A 1 176 ? -37.505 87.344  -27.191 1.00 29.52  ? 173 LEU A C   1 
ATOM   1319 O O   . LEU A 1 176 ? -37.724 88.266  -27.985 1.00 24.11  ? 173 LEU A O   1 
ATOM   1320 C CB  . LEU A 1 176 ? -35.082 86.846  -26.811 1.00 30.87  ? 173 LEU A CB  1 
ATOM   1321 C CG  . LEU A 1 176 ? -33.767 87.127  -26.083 1.00 26.86  ? 173 LEU A CG  1 
ATOM   1322 C CD1 . LEU A 1 176 ? -32.638 86.304  -26.680 1.00 27.84  ? 173 LEU A CD1 1 
ATOM   1323 C CD2 . LEU A 1 176 ? -33.436 88.610  -26.138 1.00 27.33  ? 173 LEU A CD2 1 
ATOM   1324 N N   . LEU A 1 177 ? -38.251 86.237  -27.155 1.00 28.24  ? 174 LEU A N   1 
ATOM   1325 C CA  . LEU A 1 177 ? -39.409 86.101  -28.030 1.00 26.67  ? 174 LEU A CA  1 
ATOM   1326 C C   . LEU A 1 177 ? -40.541 87.030  -27.609 1.00 35.15  ? 174 LEU A C   1 
ATOM   1327 O O   . LEU A 1 177 ? -41.341 87.447  -28.453 1.00 28.83  ? 174 LEU A O   1 
ATOM   1328 C CB  . LEU A 1 177 ? -39.883 84.648  -28.051 1.00 24.56  ? 174 LEU A CB  1 
ATOM   1329 C CG  . LEU A 1 177 ? -38.895 83.640  -28.643 1.00 29.18  ? 174 LEU A CG  1 
ATOM   1330 C CD1 . LEU A 1 177 ? -39.479 82.236  -28.630 1.00 22.38  ? 174 LEU A CD1 1 
ATOM   1331 C CD2 . LEU A 1 177 ? -38.499 84.045  -30.054 1.00 26.22  ? 174 LEU A CD2 1 
ATOM   1332 N N   . ASP A 1 178 ? -40.628 87.363  -26.317 1.00 33.11  ? 175 ASP A N   1 
ATOM   1333 C CA  . ASP A 1 178 ? -41.588 88.375  -25.889 1.00 20.93  ? 175 ASP A CA  1 
ATOM   1334 C C   . ASP A 1 178 ? -41.265 89.725  -26.514 1.00 19.37  ? 175 ASP A C   1 
ATOM   1335 O O   . ASP A 1 178 ? -42.166 90.444  -26.962 1.00 25.21  ? 175 ASP A O   1 
ATOM   1336 C CB  . ASP A 1 178 ? -41.608 88.491  -24.363 1.00 24.49  ? 175 ASP A CB  1 
ATOM   1337 C CG  . ASP A 1 178 ? -41.948 87.183  -23.677 1.00 35.11  ? 175 ASP A CG  1 
ATOM   1338 O OD1 . ASP A 1 178 ? -41.235 86.810  -22.721 1.00 38.58  ? 175 ASP A OD1 1 
ATOM   1339 O OD2 . ASP A 1 178 ? -42.920 86.522  -24.096 1.00 32.06  ? 175 ASP A OD2 1 
ATOM   1340 N N   . GLN A 1 179 ? -39.980 90.086  -26.552 1.00 26.77  ? 176 GLN A N   1 
ATOM   1341 C CA  . GLN A 1 179 ? -39.576 91.335  -27.187 1.00 27.46  ? 176 GLN A CA  1 
ATOM   1342 C C   . GLN A 1 179 ? -39.847 91.304  -28.685 1.00 22.53  ? 176 GLN A C   1 
ATOM   1343 O O   . GLN A 1 179 ? -40.293 92.303  -29.261 1.00 27.14  ? 176 GLN A O   1 
ATOM   1344 C CB  . GLN A 1 179 ? -38.096 91.603  -26.918 1.00 25.31  ? 176 GLN A CB  1 
ATOM   1345 C CG  . GLN A 1 179 ? -37.709 91.582  -25.450 1.00 27.88  ? 176 GLN A CG  1 
ATOM   1346 C CD  . GLN A 1 179 ? -36.209 91.657  -25.248 1.00 36.70  ? 176 GLN A CD  1 
ATOM   1347 O OE1 . GLN A 1 179 ? -35.449 91.788  -26.208 1.00 27.77  ? 176 GLN A OE1 1 
ATOM   1348 N NE2 . GLN A 1 179 ? -35.773 91.571  -23.996 1.00 24.07  ? 176 GLN A NE2 1 
ATOM   1349 N N   . ARG A 1 180 ? -39.581 90.165  -29.330 1.00 19.70  ? 177 ARG A N   1 
ATOM   1350 C CA  . ARG A 1 180 ? -39.841 90.042  -30.761 1.00 29.80  ? 177 ARG A CA  1 
ATOM   1351 C C   . ARG A 1 180 ? -41.326 90.185  -31.066 1.00 26.85  ? 177 ARG A C   1 
ATOM   1352 O O   . ARG A 1 180 ? -41.708 90.873  -32.020 1.00 30.85  ? 177 ARG A O   1 
ATOM   1353 C CB  . ARG A 1 180 ? -39.314 88.702  -31.276 1.00 26.88  ? 177 ARG A CB  1 
ATOM   1354 C CG  . ARG A 1 180 ? -39.736 88.372  -32.698 1.00 31.33  ? 177 ARG A CG  1 
ATOM   1355 C CD  . ARG A 1 180 ? -39.267 86.984  -33.104 1.00 29.08  ? 177 ARG A CD  1 
ATOM   1356 N NE  . ARG A 1 180 ? -37.818 86.917  -33.263 1.00 32.84  ? 177 ARG A NE  1 
ATOM   1357 C CZ  . ARG A 1 180 ? -37.146 85.797  -33.507 1.00 35.68  ? 177 ARG A CZ  1 
ATOM   1358 N NH1 . ARG A 1 180 ? -37.793 84.644  -33.615 1.00 36.66  ? 177 ARG A NH1 1 
ATOM   1359 N NH2 . ARG A 1 180 ? -35.827 85.827  -33.642 1.00 39.35  ? 177 ARG A NH2 1 
ATOM   1360 N N   . LEU A 1 181 ? -42.180 89.542  -30.264 1.00 28.15  ? 178 LEU A N   1 
ATOM   1361 C CA  . LEU A 1 181 ? -43.620 89.669  -30.462 1.00 28.58  ? 178 LEU A CA  1 
ATOM   1362 C C   . LEU A 1 181 ? -44.069 91.115  -30.299 1.00 25.69  ? 178 LEU A C   1 
ATOM   1363 O O   . LEU A 1 181 ? -44.955 91.585  -31.023 1.00 34.27  ? 178 LEU A O   1 
ATOM   1364 C CB  . LEU A 1 181 ? -44.365 88.759  -29.485 1.00 21.13  ? 178 LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 181 ? -45.886 88.694  -29.622 1.00 34.98  ? 178 LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 181 ? -46.280 88.226  -31.015 1.00 28.73  ? 178 LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 181 ? -46.474 87.777  -28.563 1.00 26.86  ? 178 LEU A CD2 1 
ATOM   1368 N N   . ALA A 1 182 ? -43.462 91.840  -29.356 1.00 25.12  ? 179 ALA A N   1 
ATOM   1369 C CA  . ALA A 1 182 ? -43.766 93.257  -29.206 1.00 22.72  ? 179 ALA A CA  1 
ATOM   1370 C C   . ALA A 1 182 ? -43.304 94.059  -30.416 1.00 36.23  ? 179 ALA A C   1 
ATOM   1371 O O   . ALA A 1 182 ? -43.920 95.075  -30.755 1.00 29.38  ? 179 ALA A O   1 
ATOM   1372 C CB  . ALA A 1 182 ? -43.126 93.802  -27.931 1.00 17.47  ? 179 ALA A CB  1 
ATOM   1373 N N   . LEU A 1 183 ? -42.227 93.624  -31.075 1.00 35.44  ? 180 LEU A N   1 
ATOM   1374 C CA  . LEU A 1 183 ? -41.795 94.293  -32.297 1.00 39.78  ? 180 LEU A CA  1 
ATOM   1375 C C   . LEU A 1 183 ? -42.744 93.993  -33.450 1.00 26.19  ? 180 LEU A C   1 
ATOM   1376 O O   . LEU A 1 183 ? -43.050 94.879  -34.256 1.00 31.69  ? 180 LEU A O   1 
ATOM   1377 C CB  . LEU A 1 183 ? -40.366 93.879  -32.650 1.00 25.88  ? 180 LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 183 ? -39.292 94.307  -31.649 1.00 29.60  ? 180 LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 183 ? -37.901 93.979  -32.170 1.00 33.80  ? 180 LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 183 ? -39.420 95.789  -31.336 1.00 32.20  ? 180 LEU A CD2 1 
ATOM   1381 N N   . GLN A 1 184 ? -43.217 92.747  -33.546 1.00 23.54  ? 181 GLN A N   1 
ATOM   1382 C CA  . GLN A 1 184 ? -44.245 92.420  -34.528 1.00 26.74  ? 181 GLN A CA  1 
ATOM   1383 C C   . GLN A 1 184 ? -45.524 93.204  -34.270 1.00 36.47  ? 181 GLN A C   1 
ATOM   1384 O O   . GLN A 1 184 ? -46.224 93.582  -35.217 1.00 40.46  ? 181 GLN A O   1 
ATOM   1385 C CB  . GLN A 1 184 ? -44.530 90.918  -34.511 1.00 25.89  ? 181 GLN A CB  1 
ATOM   1386 C CG  . GLN A 1 184 ? -43.360 90.056  -34.954 1.00 35.41  ? 181 GLN A CG  1 
ATOM   1387 C CD  . GLN A 1 184 ? -43.602 88.579  -34.716 1.00 38.30  ? 181 GLN A CD  1 
ATOM   1388 O OE1 . GLN A 1 184 ? -44.420 88.200  -33.877 1.00 49.78  ? 181 GLN A OE1 1 
ATOM   1389 N NE2 . GLN A 1 184 ? -42.892 87.735  -35.455 1.00 38.28  ? 181 GLN A NE2 1 
ATOM   1390 N N   . TRP A 1 185 ? -45.844 93.459  -32.998 1.00 35.26  ? 182 TRP A N   1 
ATOM   1391 C CA  . TRP A 1 185 ? -47.002 94.285  -32.674 1.00 35.04  ? 182 TRP A CA  1 
ATOM   1392 C C   . TRP A 1 185 ? -46.808 95.715  -33.159 1.00 35.09  ? 182 TRP A C   1 
ATOM   1393 O O   . TRP A 1 185 ? -47.758 96.352  -33.629 1.00 38.08  ? 182 TRP A O   1 
ATOM   1394 C CB  . TRP A 1 185 ? -47.256 94.259  -31.166 1.00 27.98  ? 182 TRP A CB  1 
ATOM   1395 C CG  . TRP A 1 185 ? -48.541 94.914  -30.747 1.00 27.27  ? 182 TRP A CG  1 
ATOM   1396 C CD1 . TRP A 1 185 ? -49.733 94.295  -30.503 1.00 24.36  ? 182 TRP A CD1 1 
ATOM   1397 C CD2 . TRP A 1 185 ? -48.761 96.313  -30.519 1.00 21.59  ? 182 TRP A CD2 1 
ATOM   1398 N NE1 . TRP A 1 185 ? -50.681 95.221  -30.138 1.00 28.22  ? 182 TRP A NE1 1 
ATOM   1399 C CE2 . TRP A 1 185 ? -50.110 96.467  -30.141 1.00 23.64  ? 182 TRP A CE2 1 
ATOM   1400 C CE3 . TRP A 1 185 ? -47.949 97.448  -30.597 1.00 23.92  ? 182 TRP A CE3 1 
ATOM   1401 C CZ2 . TRP A 1 185 ? -50.665 97.710  -29.844 1.00 22.33  ? 182 TRP A CZ2 1 
ATOM   1402 C CZ3 . TRP A 1 185 ? -48.502 98.682  -30.303 1.00 19.58  ? 182 TRP A CZ3 1 
ATOM   1403 C CH2 . TRP A 1 185 ? -49.847 98.803  -29.931 1.00 23.23  ? 182 TRP A CH2 1 
ATOM   1404 N N   . VAL A 1 186 ? -45.583 96.236  -33.051 1.00 30.80  ? 183 VAL A N   1 
ATOM   1405 C CA  . VAL A 1 186 ? -45.306 97.589  -33.522 1.00 29.63  ? 183 VAL A CA  1 
ATOM   1406 C C   . VAL A 1 186 ? -45.459 97.670  -35.036 1.00 33.30  ? 183 VAL A C   1 
ATOM   1407 O O   . VAL A 1 186 ? -46.014 98.639  -35.566 1.00 35.33  ? 183 VAL A O   1 
ATOM   1408 C CB  . VAL A 1 186 ? -43.905 98.035  -33.063 1.00 39.28  ? 183 VAL A CB  1 
ATOM   1409 C CG1 . VAL A 1 186 ? -43.502 99.334  -33.744 1.00 32.07  ? 183 VAL A CG1 1 
ATOM   1410 C CG2 . VAL A 1 186 ? -43.872 98.198  -31.552 1.00 24.47  ? 183 VAL A CG2 1 
ATOM   1411 N N   . GLN A 1 187 ? -44.989 96.648  -35.756 1.00 27.04  ? 184 GLN A N   1 
ATOM   1412 C CA  . GLN A 1 187 ? -45.111 96.656  -37.211 1.00 41.25  ? 184 GLN A CA  1 
ATOM   1413 C C   . GLN A 1 187 ? -46.567 96.647  -37.657 1.00 41.46  ? 184 GLN A C   1 
ATOM   1414 O O   . GLN A 1 187 ? -46.894 97.193  -38.718 1.00 40.18  ? 184 GLN A O   1 
ATOM   1415 C CB  . GLN A 1 187 ? -44.368 95.460  -37.807 1.00 33.17  ? 184 GLN A CB  1 
ATOM   1416 C CG  . GLN A 1 187 ? -42.858 95.604  -37.786 1.00 32.84  ? 184 GLN A CG  1 
ATOM   1417 C CD  . GLN A 1 187 ? -42.381 96.792  -38.598 1.00 39.01  ? 184 GLN A CD  1 
ATOM   1418 O OE1 . GLN A 1 187 ? -42.835 97.012  -39.721 1.00 37.74  ? 184 GLN A OE1 1 
ATOM   1419 N NE2 . GLN A 1 187 ? -41.469 97.571  -38.028 1.00 39.23  ? 184 GLN A NE2 1 
ATOM   1420 N N   . GLU A 1 188 ? -47.455 96.051  -36.862 1.00 34.81  ? 185 GLU A N   1 
ATOM   1421 C CA  . GLU A 1 188 ? -48.850 95.888  -37.242 1.00 35.04  ? 185 GLU A CA  1 
ATOM   1422 C C   . GLU A 1 188 ? -49.772 96.964  -36.682 1.00 31.33  ? 185 GLU A C   1 
ATOM   1423 O O   . GLU A 1 188 ? -50.902 97.093  -37.164 1.00 43.90  ? 185 GLU A O   1 
ATOM   1424 C CB  . GLU A 1 188 ? -49.362 94.514  -36.794 1.00 30.92  ? 185 GLU A CB  1 
ATOM   1425 C CG  . GLU A 1 188 ? -48.661 93.335  -37.450 1.00 42.30  ? 185 GLU A CG  1 
ATOM   1426 C CD  . GLU A 1 188 ? -49.212 92.002  -36.981 1.00 54.52  ? 185 GLU A CD  1 
ATOM   1427 O OE1 . GLU A 1 188 ? -48.593 90.958  -37.280 1.00 51.79  ? 185 GLU A OE1 1 
ATOM   1428 O OE2 . GLU A 1 188 ? -50.265 92.000  -36.309 1.00 51.05  ? 185 GLU A OE2 1 
ATOM   1429 N N   . ASN A 1 189 ? -49.331 97.738  -35.687 1.00 28.31  ? 186 ASN A N   1 
ATOM   1430 C CA  . ASN A 1 189 ? -50.246 98.658  -35.019 1.00 25.12  ? 186 ASN A CA  1 
ATOM   1431 C C   . ASN A 1 189 ? -49.688 100.044 -34.730 1.00 28.37  ? 186 ASN A C   1 
ATOM   1432 O O   . ASN A 1 189 ? -50.471 100.913 -34.336 1.00 31.96  ? 186 ASN A O   1 
ATOM   1433 C CB  . ASN A 1 189 ? -50.734 98.048  -33.696 1.00 28.13  ? 186 ASN A CB  1 
ATOM   1434 C CG  . ASN A 1 189 ? -51.464 96.735  -33.893 1.00 33.07  ? 186 ASN A CG  1 
ATOM   1435 O OD1 . ASN A 1 189 ? -52.654 96.714  -34.211 1.00 44.33  ? 186 ASN A OD1 1 
ATOM   1436 N ND2 . ASN A 1 189 ? -50.754 95.628  -33.704 1.00 35.05  ? 186 ASN A ND2 1 
ATOM   1437 N N   . VAL A 1 190 ? -48.388 100.297 -34.905 1.00 27.16  ? 187 VAL A N   1 
ATOM   1438 C CA  . VAL A 1 190 ? -47.848 101.604 -34.542 1.00 27.19  ? 187 VAL A CA  1 
ATOM   1439 C C   . VAL A 1 190 ? -48.340 102.700 -35.478 1.00 30.95  ? 187 VAL A C   1 
ATOM   1440 O O   . VAL A 1 190 ? -48.241 103.886 -35.141 1.00 28.23  ? 187 VAL A O   1 
ATOM   1441 C CB  . VAL A 1 190 ? -46.308 101.573 -34.508 1.00 32.96  ? 187 VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 190 ? -45.731 101.812 -35.899 1.00 29.95  ? 187 VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 190 ? -45.773 102.593 -33.511 1.00 27.16  ? 187 VAL A CG2 1 
ATOM   1444 N N   . ALA A 1 191 ? -48.873 102.338 -36.649 1.00 34.12  ? 188 ALA A N   1 
ATOM   1445 C CA  . ALA A 1 191 ? -49.411 103.348 -37.554 1.00 38.52  ? 188 ALA A CA  1 
ATOM   1446 C C   . ALA A 1 191 ? -50.666 103.998 -36.986 1.00 34.36  ? 188 ALA A C   1 
ATOM   1447 O O   . ALA A 1 191 ? -50.937 105.171 -37.272 1.00 33.49  ? 188 ALA A O   1 
ATOM   1448 C CB  . ALA A 1 191 ? -49.706 102.729 -38.921 1.00 29.82  ? 188 ALA A CB  1 
ATOM   1449 N N   . ALA A 1 192 ? -51.436 103.262 -36.180 1.00 34.79  ? 189 ALA A N   1 
ATOM   1450 C CA  . ALA A 1 192 ? -52.638 103.821 -35.574 1.00 23.09  ? 189 ALA A CA  1 
ATOM   1451 C C   . ALA A 1 192 ? -52.324 104.939 -34.590 1.00 38.24  ? 189 ALA A C   1 
ATOM   1452 O O   . ALA A 1 192 ? -53.210 105.742 -34.280 1.00 34.84  ? 189 ALA A O   1 
ATOM   1453 C CB  . ALA A 1 192 ? -53.436 102.721 -34.874 1.00 19.81  ? 189 ALA A CB  1 
ATOM   1454 N N   . PHE A 1 193 ? -51.091 105.008 -34.093 1.00 37.86  ? 190 PHE A N   1 
ATOM   1455 C CA  . PHE A 1 193 ? -50.667 106.063 -33.184 1.00 28.19  ? 190 PHE A CA  1 
ATOM   1456 C C   . PHE A 1 193 ? -49.890 107.166 -33.887 1.00 33.89  ? 190 PHE A C   1 
ATOM   1457 O O   . PHE A 1 193 ? -49.414 108.092 -33.222 1.00 38.96  ? 190 PHE A O   1 
ATOM   1458 C CB  . PHE A 1 193 ? -49.817 105.474 -32.053 1.00 33.81  ? 190 PHE A CB  1 
ATOM   1459 C CG  . PHE A 1 193 ? -50.506 104.386 -31.278 1.00 23.88  ? 190 PHE A CG  1 
ATOM   1460 C CD1 . PHE A 1 193 ? -50.405 103.063 -31.677 1.00 20.11  ? 190 PHE A CD1 1 
ATOM   1461 C CD2 . PHE A 1 193 ? -51.251 104.686 -30.150 1.00 27.43  ? 190 PHE A CD2 1 
ATOM   1462 C CE1 . PHE A 1 193 ? -51.038 102.060 -30.967 1.00 25.84  ? 190 PHE A CE1 1 
ATOM   1463 C CE2 . PHE A 1 193 ? -51.886 103.687 -29.436 1.00 29.23  ? 190 PHE A CE2 1 
ATOM   1464 C CZ  . PHE A 1 193 ? -51.779 102.372 -29.845 1.00 25.81  ? 190 PHE A CZ  1 
ATOM   1465 N N   . GLY A 1 194 ? -49.752 107.092 -35.208 1.00 37.04  ? 191 GLY A N   1 
ATOM   1466 C CA  . GLY A 1 194 ? -48.987 108.073 -35.949 1.00 37.24  ? 191 GLY A CA  1 
ATOM   1467 C C   . GLY A 1 194 ? -47.535 107.720 -36.169 1.00 46.39  ? 191 GLY A C   1 
ATOM   1468 O O   . GLY A 1 194 ? -46.750 108.601 -36.537 1.00 40.16  ? 191 GLY A O   1 
ATOM   1469 N N   . GLY A 1 195 ? -47.151 106.465 -35.959 1.00 40.24  ? 192 GLY A N   1 
ATOM   1470 C CA  . GLY A 1 195 ? -45.771 106.043 -36.086 1.00 38.32  ? 192 GLY A CA  1 
ATOM   1471 C C   . GLY A 1 195 ? -45.492 105.354 -37.409 1.00 42.17  ? 192 GLY A C   1 
ATOM   1472 O O   . GLY A 1 195 ? -46.380 104.770 -38.025 1.00 43.33  ? 192 GLY A O   1 
ATOM   1473 N N   . ASP A 1 196 ? -44.231 105.429 -37.838 1.00 37.14  ? 193 ASP A N   1 
ATOM   1474 C CA  . ASP A 1 196 ? -43.809 104.832 -39.097 1.00 34.34  ? 193 ASP A CA  1 
ATOM   1475 C C   . ASP A 1 196 ? -43.247 103.443 -38.824 1.00 37.12  ? 193 ASP A C   1 
ATOM   1476 O O   . ASP A 1 196 ? -42.196 103.330 -38.174 1.00 43.47  ? 193 ASP A O   1 
ATOM   1477 C CB  . ASP A 1 196 ? -42.759 105.701 -39.776 1.00 45.33  ? 193 ASP A CB  1 
ATOM   1478 C CG  . ASP A 1 196 ? -42.582 105.367 -41.247 1.00 41.84  ? 193 ASP A CG  1 
ATOM   1479 O OD1 . ASP A 1 196 ? -42.451 106.306 -42.059 1.00 53.71  ? 193 ASP A OD1 1 
ATOM   1480 O OD2 . ASP A 1 196 ? -42.593 104.168 -41.596 1.00 36.50  ? 193 ASP A OD2 1 
ATOM   1481 N N   . PRO A 1 197 ? -43.889 102.369 -39.293 1.00 39.17  ? 194 PRO A N   1 
ATOM   1482 C CA  . PRO A 1 197 ? -43.308 101.029 -39.113 1.00 26.29  ? 194 PRO A CA  1 
ATOM   1483 C C   . PRO A 1 197 ? -42.082 100.769 -39.975 1.00 35.03  ? 194 PRO A C   1 
ATOM   1484 O O   . PRO A 1 197 ? -41.453 99.715  -39.815 1.00 39.53  ? 194 PRO A O   1 
ATOM   1485 C CB  . PRO A 1 197 ? -44.462 100.093 -39.492 1.00 27.71  ? 194 PRO A CB  1 
ATOM   1486 C CG  . PRO A 1 197 ? -45.305 100.899 -40.423 1.00 29.05  ? 194 PRO A CG  1 
ATOM   1487 C CD  . PRO A 1 197 ? -45.212 102.320 -39.939 1.00 34.67  ? 194 PRO A CD  1 
ATOM   1488 N N   . THR A 1 198 ? -41.724 101.681 -40.878 1.00 38.05  ? 195 THR A N   1 
ATOM   1489 C CA  . THR A 1 198 ? -40.525 101.540 -41.694 1.00 47.05  ? 195 THR A CA  1 
ATOM   1490 C C   . THR A 1 198 ? -39.333 102.299 -41.128 1.00 39.54  ? 195 THR A C   1 
ATOM   1491 O O   . THR A 1 198 ? -38.256 102.272 -41.731 1.00 52.38  ? 195 THR A O   1 
ATOM   1492 C CB  . THR A 1 198 ? -40.794 102.009 -43.129 1.00 41.39  ? 195 THR A CB  1 
ATOM   1493 O OG1 . THR A 1 198 ? -41.031 103.423 -43.137 1.00 35.56  ? 195 THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 198 ? -42.005 101.293 -43.707 1.00 28.82  ? 195 THR A CG2 1 
ATOM   1495 N N   . SER A 1 199 ? -39.496 102.974 -39.981 1.00 43.31  ? 196 SER A N   1 
ATOM   1496 C CA  . SER A 1 199 ? -38.408 103.700 -39.320 1.00 35.67  ? 196 SER A CA  1 
ATOM   1497 C C   . SER A 1 199 ? -38.517 103.416 -37.819 1.00 35.20  ? 196 SER A C   1 
ATOM   1498 O O   . SER A 1 199 ? -38.964 104.253 -37.033 1.00 39.18  ? 196 SER A O   1 
ATOM   1499 C CB  . SER A 1 199 ? -38.465 105.197 -39.622 1.00 29.70  ? 196 SER A CB  1 
ATOM   1500 O OG  . SER A 1 199 ? -37.368 105.879 -39.038 1.00 40.60  ? 196 SER A OG  1 
ATOM   1501 N N   . VAL A 1 200 ? -38.101 102.215 -37.425 1.00 37.06  ? 197 VAL A N   1 
ATOM   1502 C CA  . VAL A 1 200 ? -38.154 101.769 -36.037 1.00 38.85  ? 197 VAL A CA  1 
ATOM   1503 C C   . VAL A 1 200 ? -36.725 101.630 -35.530 1.00 41.01  ? 197 VAL A C   1 
ATOM   1504 O O   . VAL A 1 200 ? -35.917 100.900 -36.118 1.00 31.40  ? 197 VAL A O   1 
ATOM   1505 C CB  . VAL A 1 200 ? -38.921 100.446 -35.895 1.00 37.94  ? 197 VAL A CB  1 
ATOM   1506 C CG1 . VAL A 1 200 ? -38.898 99.973  -34.451 1.00 31.06  ? 197 VAL A CG1 1 
ATOM   1507 C CG2 . VAL A 1 200 ? -40.352 100.609 -36.387 1.00 29.85  ? 197 VAL A CG2 1 
ATOM   1508 N N   . THR A 1 201 ? -36.415 102.325 -34.438 1.00 37.30  ? 198 THR A N   1 
ATOM   1509 C CA  . THR A 1 201 ? -35.081 102.326 -33.850 1.00 33.61  ? 198 THR A CA  1 
ATOM   1510 C C   . THR A 1 201 ? -35.144 101.696 -32.466 1.00 33.53  ? 198 THR A C   1 
ATOM   1511 O O   . THR A 1 201 ? -35.827 102.215 -31.576 1.00 25.29  ? 198 THR A O   1 
ATOM   1512 C CB  . THR A 1 201 ? -34.518 103.746 -33.761 1.00 33.60  ? 198 THR A CB  1 
ATOM   1513 O OG1 . THR A 1 201 ? -34.381 104.293 -35.078 1.00 36.19  ? 198 THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 201 ? -33.160 103.738 -33.073 1.00 24.84  ? 198 THR A CG2 1 
ATOM   1515 N N   . LEU A 1 202 ? -34.434 100.586 -32.288 1.00 31.51  ? 199 LEU A N   1 
ATOM   1516 C CA  . LEU A 1 202 ? -34.331 99.953  -30.981 1.00 27.49  ? 199 LEU A CA  1 
ATOM   1517 C C   . LEU A 1 202 ? -33.235 100.617 -30.160 1.00 32.59  ? 199 LEU A C   1 
ATOM   1518 O O   . LEU A 1 202 ? -32.140 100.884 -30.661 1.00 42.07  ? 199 LEU A O   1 
ATOM   1519 C CB  . LEU A 1 202 ? -34.027 98.461  -31.125 1.00 24.38  ? 199 LEU A CB  1 
ATOM   1520 C CG  . LEU A 1 202 ? -34.975 97.591  -31.948 1.00 34.64  ? 199 LEU A CG  1 
ATOM   1521 C CD1 . LEU A 1 202 ? -34.561 96.130  -31.853 1.00 26.26  ? 199 LEU A CD1 1 
ATOM   1522 C CD2 . LEU A 1 202 ? -36.404 97.775  -31.483 1.00 42.43  ? 199 LEU A CD2 1 
ATOM   1523 N N   . PHE A 1 203 ? -33.534 100.885 -28.891 1.00 30.74  ? 200 PHE A N   1 
ATOM   1524 C CA  . PHE A 1 203 ? -32.516 101.355 -27.961 1.00 28.28  ? 200 PHE A CA  1 
ATOM   1525 C C   . PHE A 1 203 ? -32.775 100.756 -26.588 1.00 37.12  ? 200 PHE A C   1 
ATOM   1526 O O   . PHE A 1 203 ? -33.918 100.717 -26.125 1.00 33.53  ? 200 PHE A O   1 
ATOM   1527 C CB  . PHE A 1 203 ? -32.455 102.893 -27.897 1.00 29.90  ? 200 PHE A CB  1 
ATOM   1528 C CG  . PHE A 1 203 ? -33.618 103.550 -27.200 1.00 30.98  ? 200 PHE A CG  1 
ATOM   1529 C CD1 . PHE A 1 203 ? -33.388 104.524 -26.241 1.00 29.32  ? 200 PHE A CD1 1 
ATOM   1530 C CD2 . PHE A 1 203 ? -34.927 103.246 -27.534 1.00 36.48  ? 200 PHE A CD2 1 
ATOM   1531 C CE1 . PHE A 1 203 ? -34.437 105.155 -25.602 1.00 31.58  ? 200 PHE A CE1 1 
ATOM   1532 C CE2 . PHE A 1 203 ? -35.982 103.874 -26.898 1.00 29.17  ? 200 PHE A CE2 1 
ATOM   1533 C CZ  . PHE A 1 203 ? -35.737 104.829 -25.930 1.00 19.46  ? 200 PHE A CZ  1 
ATOM   1534 N N   . GLY A 1 204 ? -31.710 100.264 -25.958 1.00 38.57  ? 201 GLY A N   1 
ATOM   1535 C CA  . GLY A 1 204 ? -31.795 99.630  -24.661 1.00 33.67  ? 201 GLY A CA  1 
ATOM   1536 C C   . GLY A 1 204 ? -30.500 99.818  -23.901 1.00 34.70  ? 201 GLY A C   1 
ATOM   1537 O O   . GLY A 1 204 ? -29.526 100.369 -24.417 1.00 34.37  ? 201 GLY A O   1 
ATOM   1538 N N   . GLU A 1 205 ? -30.494 99.342  -22.658 1.00 27.04  ? 202 GLU A N   1 
ATOM   1539 C CA  . GLU A 1 205 ? -29.361 99.535  -21.767 1.00 25.85  ? 202 GLU A CA  1 
ATOM   1540 C C   . GLU A 1 205 ? -29.084 98.248  -21.005 1.00 30.92  ? 202 GLU A C   1 
ATOM   1541 O O   . GLU A 1 205 ? -30.014 97.528  -20.634 1.00 31.68  ? 202 GLU A O   1 
ATOM   1542 C CB  . GLU A 1 205 ? -29.622 100.696 -20.796 1.00 27.93  ? 202 GLU A CB  1 
ATOM   1543 C CG  . GLU A 1 205 ? -28.393 101.196 -20.058 1.00 21.51  ? 202 GLU A CG  1 
ATOM   1544 C CD  . GLU A 1 205 ? -28.214 100.530 -18.711 1.00 35.84  ? 202 GLU A CD  1 
ATOM   1545 O OE1 . GLU A 1 205 ? -29.145 99.825  -18.269 1.00 28.87  ? 202 GLU A OE1 1 
ATOM   1546 O OE2 . GLU A 1 205 ? -27.146 100.716 -18.092 1.00 35.68  ? 202 GLU A OE2 1 
ATOM   1547 N N   . SER A 1 206 ? -27.797 97.963  -20.788 1.00 34.97  ? 203 SER A N   1 
ATOM   1548 C CA  . SER A 1 206 ? -27.327 96.788  -20.043 1.00 26.92  ? 203 SER A CA  1 
ATOM   1549 C C   . SER A 1 206 ? -27.883 95.539  -20.717 1.00 25.31  ? 203 SER A C   1 
ATOM   1550 O O   . SER A 1 206 ? -27.536 95.286  -21.884 1.00 24.90  ? 203 SER A O   1 
ATOM   1551 C CB  . SER A 1 206 ? -27.683 96.957  -18.565 1.00 39.66  ? 203 SER A CB  1 
ATOM   1552 O OG  . SER A 1 206 ? -26.746 96.285  -17.739 1.00 48.17  ? 203 SER A OG  1 
ATOM   1553 N N   . ALA A 1 207 ? -28.717 94.737  -20.048 1.00 23.34  ? 204 ALA A N   1 
ATOM   1554 C CA  . ALA A 1 207 ? -29.308 93.573  -20.699 1.00 24.58  ? 204 ALA A CA  1 
ATOM   1555 C C   . ALA A 1 207 ? -30.228 93.980  -21.840 1.00 22.43  ? 204 ALA A C   1 
ATOM   1556 O O   . ALA A 1 207 ? -30.441 93.200  -22.776 1.00 16.70  ? 204 ALA A O   1 
ATOM   1557 C CB  . ALA A 1 207 ? -30.067 92.727  -19.676 1.00 22.88  ? 204 ALA A CB  1 
ATOM   1558 N N   . GLY A 1 208 ? -30.785 95.191  -21.781 1.00 20.18  ? 205 GLY A N   1 
ATOM   1559 C CA  . GLY A 1 208 ? -31.560 95.690  -22.903 1.00 23.10  ? 205 GLY A CA  1 
ATOM   1560 C C   . GLY A 1 208 ? -30.702 95.942  -24.127 1.00 28.46  ? 205 GLY A C   1 
ATOM   1561 O O   . GLY A 1 208 ? -31.103 95.631  -25.252 1.00 26.53  ? 205 GLY A O   1 
ATOM   1562 N N   . ALA A 1 209 ? -29.508 96.507  -23.928 1.00 28.38  ? 206 ALA A N   1 
ATOM   1563 C CA  . ALA A 1 209 ? -28.582 96.686  -25.041 1.00 26.86  ? 206 ALA A CA  1 
ATOM   1564 C C   . ALA A 1 209 ? -28.140 95.343  -25.604 1.00 24.75  ? 206 ALA A C   1 
ATOM   1565 O O   . ALA A 1 209 ? -28.036 95.176  -26.825 1.00 24.65  ? 206 ALA A O   1 
ATOM   1566 C CB  . ALA A 1 209 ? -27.373 97.507  -24.594 1.00 24.05  ? 206 ALA A CB  1 
ATOM   1567 N N   . ALA A 1 210 ? -27.874 94.371  -24.728 1.00 26.14  ? 207 ALA A N   1 
ATOM   1568 C CA  . ALA A 1 210 ? -27.554 93.027  -25.193 1.00 25.49  ? 207 ALA A CA  1 
ATOM   1569 C C   . ALA A 1 210 ? -28.722 92.421  -25.959 1.00 30.67  ? 207 ALA A C   1 
ATOM   1570 O O   . ALA A 1 210 ? -28.524 91.703  -26.946 1.00 25.35  ? 207 ALA A O   1 
ATOM   1571 C CB  . ALA A 1 210 ? -27.166 92.139  -24.011 1.00 17.33  ? 207 ALA A CB  1 
ATOM   1572 N N   . SER A 1 211 ? -29.952 92.705  -25.521 1.00 24.64  ? 208 SER A N   1 
ATOM   1573 C CA  . SER A 1 211 ? -31.125 92.227  -26.245 1.00 33.14  ? 208 SER A CA  1 
ATOM   1574 C C   . SER A 1 211 ? -31.214 92.861  -27.627 1.00 21.52  ? 208 SER A C   1 
ATOM   1575 O O   . SER A 1 211 ? -31.537 92.182  -28.609 1.00 25.67  ? 208 SER A O   1 
ATOM   1576 C CB  . SER A 1 211 ? -32.394 92.512  -25.442 1.00 25.19  ? 208 SER A CB  1 
ATOM   1577 O OG  . SER A 1 211 ? -32.417 91.764  -24.239 1.00 23.08  ? 208 SER A OG  1 
ATOM   1578 N N   . VAL A 1 212 ? -30.933 94.164  -27.721 1.00 17.44  ? 209 VAL A N   1 
ATOM   1579 C CA  . VAL A 1 212 ? -30.930 94.837  -29.017 1.00 22.77  ? 209 VAL A CA  1 
ATOM   1580 C C   . VAL A 1 212 ? -29.900 94.201  -29.943 1.00 35.40  ? 209 VAL A C   1 
ATOM   1581 O O   . VAL A 1 212 ? -30.146 94.024  -31.143 1.00 32.63  ? 209 VAL A O   1 
ATOM   1582 C CB  . VAL A 1 212 ? -30.674 96.345  -28.834 1.00 27.01  ? 209 VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 212 ? -30.495 97.024  -30.181 1.00 29.18  ? 209 VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 212 ? -31.815 96.986  -28.062 1.00 18.66  ? 209 VAL A CG2 1 
ATOM   1585 N N   . GLY A 1 213 ? -28.739 93.834  -29.399 1.00 31.04  ? 210 GLY A N   1 
ATOM   1586 C CA  . GLY A 1 213 ? -27.716 93.206  -30.218 1.00 30.03  ? 210 GLY A CA  1 
ATOM   1587 C C   . GLY A 1 213 ? -28.105 91.817  -30.685 1.00 30.74  ? 210 GLY A C   1 
ATOM   1588 O O   . GLY A 1 213 ? -27.768 91.411  -31.801 1.00 33.22  ? 210 GLY A O   1 
ATOM   1589 N N   . MET A 1 214 ? -28.822 91.069  -29.842 1.00 30.05  ? 211 MET A N   1 
ATOM   1590 C CA  . MET A 1 214 ? -29.238 89.725  -30.230 1.00 27.84  ? 211 MET A CA  1 
ATOM   1591 C C   . MET A 1 214 ? -30.334 89.758  -31.287 1.00 33.95  ? 211 MET A C   1 
ATOM   1592 O O   . MET A 1 214 ? -30.458 88.814  -32.076 1.00 32.01  ? 211 MET A O   1 
ATOM   1593 C CB  . MET A 1 214 ? -29.701 88.940  -29.003 1.00 27.08  ? 211 MET A CB  1 
ATOM   1594 C CG  . MET A 1 214 ? -28.602 88.709  -27.982 1.00 35.49  ? 211 MET A CG  1 
ATOM   1595 S SD  . MET A 1 214 ? -29.134 87.734  -26.567 1.00 45.26  ? 211 MET A SD  1 
ATOM   1596 C CE  . MET A 1 214 ? -27.724 87.931  -25.479 1.00 33.72  ? 211 MET A CE  1 
ATOM   1597 N N   . HIS A 1 215 ? -31.138 90.823  -31.317 1.00 22.11  ? 212 HIS A N   1 
ATOM   1598 C CA  . HIS A 1 215 ? -32.109 90.970  -32.396 1.00 36.22  ? 212 HIS A CA  1 
ATOM   1599 C C   . HIS A 1 215 ? -31.425 91.324  -33.710 1.00 34.86  ? 212 HIS A C   1 
ATOM   1600 O O   . HIS A 1 215 ? -31.938 90.991  -34.784 1.00 33.15  ? 212 HIS A O   1 
ATOM   1601 C CB  . HIS A 1 215 ? -33.154 92.025  -32.030 1.00 21.46  ? 212 HIS A CB  1 
ATOM   1602 C CG  . HIS A 1 215 ? -34.087 91.595  -30.942 1.00 34.36  ? 212 HIS A CG  1 
ATOM   1603 N ND1 . HIS A 1 215 ? -34.819 90.429  -31.008 1.00 40.11  ? 212 HIS A ND1 1 
ATOM   1604 C CD2 . HIS A 1 215 ? -34.411 92.176  -29.762 1.00 27.32  ? 212 HIS A CD2 1 
ATOM   1605 C CE1 . HIS A 1 215 ? -35.551 90.308  -29.915 1.00 28.57  ? 212 HIS A CE1 1 
ATOM   1606 N NE2 . HIS A 1 215 ? -35.322 91.355  -29.142 1.00 34.54  ? 212 HIS A NE2 1 
ATOM   1607 N N   . LEU A 1 216 ? -30.272 91.996  -33.644 1.00 32.67  ? 213 LEU A N   1 
ATOM   1608 C CA  . LEU A 1 216 ? -29.479 92.227  -34.847 1.00 34.67  ? 213 LEU A CA  1 
ATOM   1609 C C   . LEU A 1 216 ? -28.947 90.923  -35.421 1.00 29.37  ? 213 LEU A C   1 
ATOM   1610 O O   . LEU A 1 216 ? -28.842 90.779  -36.644 1.00 40.42  ? 213 LEU A O   1 
ATOM   1611 C CB  . LEU A 1 216 ? -28.319 93.174  -34.539 1.00 29.74  ? 213 LEU A CB  1 
ATOM   1612 C CG  . LEU A 1 216 ? -28.642 94.656  -34.358 1.00 37.57  ? 213 LEU A CG  1 
ATOM   1613 C CD1 . LEU A 1 216 ? -27.461 95.387  -33.742 1.00 31.46  ? 213 LEU A CD1 1 
ATOM   1614 C CD2 . LEU A 1 216 ? -29.007 95.270  -35.695 1.00 38.14  ? 213 LEU A CD2 1 
ATOM   1615 N N   . LEU A 1 217 ? -28.613 89.965  -34.561 1.00 35.12  ? 214 LEU A N   1 
ATOM   1616 C CA  . LEU A 1 217 ? -28.024 88.701  -34.977 1.00 34.26  ? 214 LEU A CA  1 
ATOM   1617 C C   . LEU A 1 217 ? -29.059 87.611  -35.220 1.00 33.42  ? 214 LEU A C   1 
ATOM   1618 O O   . LEU A 1 217 ? -28.682 86.486  -35.566 1.00 41.08  ? 214 LEU A O   1 
ATOM   1619 C CB  . LEU A 1 217 ? -27.012 88.230  -33.927 1.00 32.65  ? 214 LEU A CB  1 
ATOM   1620 C CG  . LEU A 1 217 ? -25.925 89.245  -33.562 1.00 36.21  ? 214 LEU A CG  1 
ATOM   1621 C CD1 . LEU A 1 217 ? -25.053 88.723  -32.430 1.00 35.24  ? 214 LEU A CD1 1 
ATOM   1622 C CD2 . LEU A 1 217 ? -25.080 89.589  -34.780 1.00 38.78  ? 214 LEU A CD2 1 
ATOM   1623 N N   . SER A 1 218 ? -30.346 87.910  -35.047 1.00 38.82  ? 215 SER A N   1 
ATOM   1624 C CA  . SER A 1 218 ? -31.405 86.943  -35.297 1.00 47.72  ? 215 SER A CA  1 
ATOM   1625 C C   . SER A 1 218 ? -32.180 87.361  -36.537 1.00 43.47  ? 215 SER A C   1 
ATOM   1626 O O   . SER A 1 218 ? -32.792 88.440  -36.541 1.00 38.88  ? 215 SER A O   1 
ATOM   1627 C CB  . SER A 1 218 ? -32.339 86.835  -34.093 1.00 41.17  ? 215 SER A CB  1 
ATOM   1628 O OG  . SER A 1 218 ? -33.190 85.707  -34.208 1.00 40.26  ? 215 SER A OG  1 
ATOM   1629 N N   . PRO A 1 219 ? -32.172 86.559  -37.599 1.00 41.59  ? 216 PRO A N   1 
ATOM   1630 C CA  . PRO A 1 219 ? -32.841 86.953  -38.851 1.00 44.84  ? 216 PRO A CA  1 
ATOM   1631 C C   . PRO A 1 219 ? -34.322 87.253  -38.664 1.00 38.62  ? 216 PRO A C   1 
ATOM   1632 O O   . PRO A 1 219 ? -34.805 88.262  -39.199 1.00 35.29  ? 216 PRO A O   1 
ATOM   1633 C CB  . PRO A 1 219 ? -32.619 85.739  -39.767 1.00 35.16  ? 216 PRO A CB  1 
ATOM   1634 C CG  . PRO A 1 219 ? -31.356 85.129  -39.260 1.00 44.06  ? 216 PRO A CG  1 
ATOM   1635 C CD  . PRO A 1 219 ? -31.355 85.343  -37.767 1.00 38.75  ? 216 PRO A CD  1 
ATOM   1636 N N   . PRO A 1 220 ? -35.092 86.424  -37.938 1.00 33.60  ? 217 PRO A N   1 
ATOM   1637 C CA  . PRO A 1 220 ? -36.525 86.746  -37.802 1.00 37.14  ? 217 PRO A CA  1 
ATOM   1638 C C   . PRO A 1 220 ? -36.790 88.071  -37.108 1.00 39.90  ? 217 PRO A C   1 
ATOM   1639 O O   . PRO A 1 220 ? -37.846 88.675  -37.333 1.00 40.98  ? 217 PRO A O   1 
ATOM   1640 C CB  . PRO A 1 220 ? -37.079 85.566  -36.992 1.00 23.33  ? 217 PRO A CB  1 
ATOM   1641 C CG  . PRO A 1 220 ? -36.131 84.465  -37.234 1.00 40.82  ? 217 PRO A CG  1 
ATOM   1642 C CD  . PRO A 1 220 ? -34.793 85.130  -37.294 1.00 39.08  ? 217 PRO A CD  1 
ATOM   1643 N N   . SER A 1 221 ? -35.865 88.547  -36.277 1.00 40.02  ? 218 SER A N   1 
ATOM   1644 C CA  . SER A 1 221 ? -36.037 89.824  -35.599 1.00 34.36  ? 218 SER A CA  1 
ATOM   1645 C C   . SER A 1 221 ? -35.460 90.991  -36.386 1.00 42.48  ? 218 SER A C   1 
ATOM   1646 O O   . SER A 1 221 ? -35.948 92.119  -36.250 1.00 36.49  ? 218 SER A O   1 
ATOM   1647 C CB  . SER A 1 221 ? -35.387 89.777  -34.213 1.00 27.94  ? 218 SER A CB  1 
ATOM   1648 O OG  . SER A 1 221 ? -35.928 88.727  -33.430 1.00 36.74  ? 218 SER A OG  1 
ATOM   1649 N N   . ARG A 1 222 ? -34.438 90.741  -37.210 1.00 46.10  ? 219 ARG A N   1 
ATOM   1650 C CA  . ARG A 1 222 ? -33.759 91.826  -37.913 1.00 46.05  ? 219 ARG A CA  1 
ATOM   1651 C C   . ARG A 1 222 ? -34.695 92.561  -38.865 1.00 46.57  ? 219 ARG A C   1 
ATOM   1652 O O   . ARG A 1 222 ? -34.542 93.771  -39.075 1.00 47.93  ? 219 ARG A O   1 
ATOM   1653 C CB  . ARG A 1 222 ? -32.546 91.276  -38.666 1.00 44.52  ? 219 ARG A CB  1 
ATOM   1654 C CG  . ARG A 1 222 ? -31.755 92.321  -39.438 1.00 36.13  ? 219 ARG A CG  1 
ATOM   1655 C CD  . ARG A 1 222 ? -31.304 93.456  -38.533 1.00 41.05  ? 219 ARG A CD  1 
ATOM   1656 N NE  . ARG A 1 222 ? -30.621 94.509  -39.280 1.00 44.49  ? 219 ARG A NE  1 
ATOM   1657 C CZ  . ARG A 1 222 ? -31.242 95.505  -39.904 1.00 50.92  ? 219 ARG A CZ  1 
ATOM   1658 N NH1 . ARG A 1 222 ? -32.566 95.585  -39.875 1.00 49.06  ? 219 ARG A NH1 1 
ATOM   1659 N NH2 . ARG A 1 222 ? -30.541 96.420  -40.559 1.00 51.56  ? 219 ARG A NH2 1 
ATOM   1660 N N   . GLY A 1 223 ? -35.669 91.861  -39.442 1.00 39.77  ? 220 GLY A N   1 
ATOM   1661 C CA  . GLY A 1 223 ? -36.611 92.496  -40.342 1.00 37.59  ? 220 GLY A CA  1 
ATOM   1662 C C   . GLY A 1 223 ? -37.655 93.367  -39.679 1.00 47.94  ? 220 GLY A C   1 
ATOM   1663 O O   . GLY A 1 223 ? -38.457 93.987  -40.383 1.00 49.74  ? 220 GLY A O   1 
ATOM   1664 N N   . LEU A 1 224 ? -37.665 93.440  -38.348 1.00 37.22  ? 221 LEU A N   1 
ATOM   1665 C CA  . LEU A 1 224 ? -38.667 94.203  -37.617 1.00 29.03  ? 221 LEU A CA  1 
ATOM   1666 C C   . LEU A 1 224 ? -38.191 95.592  -37.211 1.00 36.42  ? 221 LEU A C   1 
ATOM   1667 O O   . LEU A 1 224 ? -38.994 96.377  -36.696 1.00 41.04  ? 221 LEU A O   1 
ATOM   1668 C CB  . LEU A 1 224 ? -39.105 93.432  -36.366 1.00 30.04  ? 221 LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 224 ? -39.727 92.059  -36.626 1.00 28.93  ? 221 LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 224 ? -39.916 91.299  -35.324 1.00 32.61  ? 221 LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 224 ? -41.051 92.203  -37.364 1.00 28.80  ? 221 LEU A CD2 1 
ATOM   1672 N N   . PHE A 1 225 ? -36.918 95.914  -37.425 1.00 36.38  ? 222 PHE A N   1 
ATOM   1673 C CA  . PHE A 1 225 ? -36.390 97.222  -37.072 1.00 31.55  ? 222 PHE A CA  1 
ATOM   1674 C C   . PHE A 1 225 ? -35.306 97.598  -38.072 1.00 36.66  ? 222 PHE A C   1 
ATOM   1675 O O   . PHE A 1 225 ? -34.901 96.793  -38.914 1.00 39.02  ? 222 PHE A O   1 
ATOM   1676 C CB  . PHE A 1 225 ? -35.855 97.244  -35.634 1.00 28.96  ? 222 PHE A CB  1 
ATOM   1677 C CG  . PHE A 1 225 ? -34.714 96.298  -35.394 1.00 30.17  ? 222 PHE A CG  1 
ATOM   1678 C CD1 . PHE A 1 225 ? -34.945 94.948  -35.183 1.00 26.15  ? 222 PHE A CD1 1 
ATOM   1679 C CD2 . PHE A 1 225 ? -33.410 96.760  -35.369 1.00 31.60  ? 222 PHE A CD2 1 
ATOM   1680 C CE1 . PHE A 1 225 ? -33.895 94.078  -34.959 1.00 35.77  ? 222 PHE A CE1 1 
ATOM   1681 C CE2 . PHE A 1 225 ? -32.359 95.896  -35.145 1.00 33.88  ? 222 PHE A CE2 1 
ATOM   1682 C CZ  . PHE A 1 225 ? -32.601 94.553  -34.940 1.00 33.84  ? 222 PHE A CZ  1 
ATOM   1683 N N   . HIS A 1 226 ? -34.837 98.840  -37.970 1.00 34.67  ? 223 HIS A N   1 
ATOM   1684 C CA  . HIS A 1 226 ? -33.908 99.394  -38.945 1.00 43.22  ? 223 HIS A CA  1 
ATOM   1685 C C   . HIS A 1 226 ? -32.707 100.099 -38.336 1.00 39.39  ? 223 HIS A C   1 
ATOM   1686 O O   . HIS A 1 226 ? -31.710 100.291 -39.043 1.00 42.08  ? 223 HIS A O   1 
ATOM   1687 C CB  . HIS A 1 226 ? -34.642 100.371 -39.876 1.00 41.69  ? 223 HIS A CB  1 
ATOM   1688 C CG  . HIS A 1 226 ? -36.000 99.893  -40.287 1.00 53.03  ? 223 HIS A CG  1 
ATOM   1689 N ND1 . HIS A 1 226 ? -37.115 100.050 -39.492 1.00 55.56  ? 223 HIS A ND1 1 
ATOM   1690 C CD2 . HIS A 1 226 ? -36.418 99.238  -41.396 1.00 47.14  ? 223 HIS A CD2 1 
ATOM   1691 C CE1 . HIS A 1 226 ? -38.163 99.522  -40.098 1.00 48.78  ? 223 HIS A CE1 1 
ATOM   1692 N NE2 . HIS A 1 226 ? -37.768 99.025  -41.256 1.00 59.98  ? 223 HIS A NE2 1 
ATOM   1693 N N   . ARG A 1 227 ? -32.760 100.491 -37.066 1.00 33.58  ? 224 ARG A N   1 
ATOM   1694 C CA  . ARG A 1 227 ? -31.629 101.105 -36.389 1.00 28.85  ? 224 ARG A CA  1 
ATOM   1695 C C   . ARG A 1 227 ? -31.514 100.513 -34.992 1.00 39.91  ? 224 ARG A C   1 
ATOM   1696 O O   . ARG A 1 227 ? -32.472 99.953  -34.453 1.00 39.76  ? 224 ARG A O   1 
ATOM   1697 C CB  . ARG A 1 227 ? -31.772 102.629 -36.315 1.00 35.33  ? 224 ARG A CB  1 
ATOM   1698 C CG  . ARG A 1 227 ? -31.752 103.318 -37.668 1.00 36.15  ? 224 ARG A CG  1 
ATOM   1699 C CD  . ARG A 1 227 ? -32.194 104.762 -37.548 1.00 34.77  ? 224 ARG A CD  1 
ATOM   1700 N NE  . ARG A 1 227 ? -32.036 105.491 -38.802 1.00 55.23  ? 224 ARG A NE  1 
ATOM   1701 C CZ  . ARG A 1 227 ? -32.975 105.584 -39.737 1.00 57.93  ? 224 ARG A CZ  1 
ATOM   1702 N NH1 . ARG A 1 227 ? -34.147 104.989 -39.564 1.00 58.47  ? 224 ARG A NH1 1 
ATOM   1703 N NH2 . ARG A 1 227 ? -32.741 106.271 -40.847 1.00 62.57  ? 224 ARG A NH2 1 
ATOM   1704 N N   . ALA A 1 228 ? -30.326 100.641 -34.408 1.00 35.61  ? 225 ALA A N   1 
ATOM   1705 C CA  . ALA A 1 228 ? -30.050 100.058 -33.104 1.00 32.98  ? 225 ALA A CA  1 
ATOM   1706 C C   . ALA A 1 228 ? -29.201 101.010 -32.278 1.00 33.92  ? 225 ALA A C   1 
ATOM   1707 O O   . ALA A 1 228 ? -28.284 101.650 -32.799 1.00 32.70  ? 225 ALA A O   1 
ATOM   1708 C CB  . ALA A 1 228 ? -29.337 98.706  -33.237 1.00 26.66  ? 225 ALA A CB  1 
ATOM   1709 N N   . VAL A 1 229 ? -29.519 101.101 -30.989 1.00 36.30  ? 226 VAL A N   1 
ATOM   1710 C CA  . VAL A 1 229 ? -28.731 101.861 -30.025 1.00 31.32  ? 226 VAL A CA  1 
ATOM   1711 C C   . VAL A 1 229 ? -28.451 100.948 -28.841 1.00 35.40  ? 226 VAL A C   1 
ATOM   1712 O O   . VAL A 1 229 ? -29.385 100.408 -28.236 1.00 33.51  ? 226 VAL A O   1 
ATOM   1713 C CB  . VAL A 1 229 ? -29.444 103.142 -29.564 1.00 23.65  ? 226 VAL A CB  1 
ATOM   1714 C CG1 . VAL A 1 229 ? -28.581 103.903 -28.567 1.00 25.21  ? 226 VAL A CG1 1 
ATOM   1715 C CG2 . VAL A 1 229 ? -29.799 104.021 -30.751 1.00 30.64  ? 226 VAL A CG2 1 
ATOM   1716 N N   . LEU A 1 230 ? -27.173 100.774 -28.513 1.00 32.14  ? 227 LEU A N   1 
ATOM   1717 C CA  . LEU A 1 230 ? -26.746 99.888  -27.434 1.00 25.96  ? 227 LEU A CA  1 
ATOM   1718 C C   . LEU A 1 230 ? -26.019 100.721 -26.387 1.00 28.82  ? 227 LEU A C   1 
ATOM   1719 O O   . LEU A 1 230 ? -24.890 101.166 -26.616 1.00 32.96  ? 227 LEU A O   1 
ATOM   1720 C CB  . LEU A 1 230 ? -25.854 98.763  -27.961 1.00 26.37  ? 227 LEU A CB  1 
ATOM   1721 C CG  . LEU A 1 230 ? -26.508 97.693  -28.843 1.00 26.18  ? 227 LEU A CG  1 
ATOM   1722 C CD1 . LEU A 1 230 ? -26.672 98.163  -30.284 1.00 31.98  ? 227 LEU A CD1 1 
ATOM   1723 C CD2 . LEU A 1 230 ? -25.716 96.397  -28.787 1.00 23.56  ? 227 LEU A CD2 1 
ATOM   1724 N N   . GLN A 1 231 ? -26.666 100.928 -25.243 1.00 24.91  ? 228 GLN A N   1 
ATOM   1725 C CA  . GLN A 1 231 ? -26.121 101.739 -24.161 1.00 26.33  ? 228 GLN A CA  1 
ATOM   1726 C C   . GLN A 1 231 ? -25.575 100.812 -23.080 1.00 30.97  ? 228 GLN A C   1 
ATOM   1727 O O   . GLN A 1 231 ? -26.343 100.119 -22.404 1.00 24.13  ? 228 GLN A O   1 
ATOM   1728 C CB  . GLN A 1 231 ? -27.189 102.670 -23.592 1.00 27.20  ? 228 GLN A CB  1 
ATOM   1729 C CG  . GLN A 1 231 ? -27.933 103.482 -24.641 1.00 21.18  ? 228 GLN A CG  1 
ATOM   1730 C CD  . GLN A 1 231 ? -29.047 104.321 -24.045 1.00 37.85  ? 228 GLN A CD  1 
ATOM   1731 O OE1 . GLN A 1 231 ? -29.899 104.844 -24.764 1.00 32.92  ? 228 GLN A OE1 1 
ATOM   1732 N NE2 . GLN A 1 231 ? -29.047 104.452 -22.723 1.00 33.94  ? 228 GLN A NE2 1 
ATOM   1733 N N   . SER A 1 232 ? -24.250 100.797 -22.926 1.00 27.80  ? 229 SER A N   1 
ATOM   1734 C CA  . SER A 1 232 ? -23.581 100.066 -21.847 1.00 18.50  ? 229 SER A CA  1 
ATOM   1735 C C   . SER A 1 232 ? -23.959 98.585  -21.851 1.00 17.50  ? 229 SER A C   1 
ATOM   1736 O O   . SER A 1 232 ? -24.348 98.017  -20.828 1.00 21.58  ? 229 SER A O   1 
ATOM   1737 C CB  . SER A 1 232 ? -23.887 100.702 -20.489 1.00 19.33  ? 229 SER A CB  1 
ATOM   1738 O OG  . SER A 1 232 ? -23.485 102.060 -20.455 1.00 29.82  ? 229 SER A OG  1 
ATOM   1739 N N   . GLY A 1 233 ? -23.839 97.958  -23.012 1.00 16.71  ? 230 GLY A N   1 
ATOM   1740 C CA  . GLY A 1 233 ? -24.168 96.550  -23.126 1.00 16.81  ? 230 GLY A CA  1 
ATOM   1741 C C   . GLY A 1 233 ? -23.943 96.063  -24.540 1.00 13.94  ? 230 GLY A C   1 
ATOM   1742 O O   . GLY A 1 233 ? -23.948 96.841  -25.500 1.00 25.07  ? 230 GLY A O   1 
ATOM   1743 N N   . ALA A 1 234 ? -23.750 94.750  -24.649 1.00 21.25  ? 231 ALA A N   1 
ATOM   1744 C CA  . ALA A 1 234 ? -23.491 94.106  -25.928 1.00 20.51  ? 231 ALA A CA  1 
ATOM   1745 C C   . ALA A 1 234 ? -23.852 92.636  -25.804 1.00 25.97  ? 231 ALA A C   1 
ATOM   1746 O O   . ALA A 1 234 ? -23.769 92.075  -24.706 1.00 26.22  ? 231 ALA A O   1 
ATOM   1747 C CB  . ALA A 1 234 ? -22.021 94.268  -26.342 1.00 21.96  ? 231 ALA A CB  1 
ATOM   1748 N N   . PRO A 1 235 ? -24.260 91.986  -26.899 1.00 25.60  ? 232 PRO A N   1 
ATOM   1749 C CA  . PRO A 1 235 ? -24.625 90.563  -26.808 1.00 22.64  ? 232 PRO A CA  1 
ATOM   1750 C C   . PRO A 1 235 ? -23.436 89.633  -26.639 1.00 30.73  ? 232 PRO A C   1 
ATOM   1751 O O   . PRO A 1 235 ? -23.636 88.470  -26.268 1.00 25.14  ? 232 PRO A O   1 
ATOM   1752 C CB  . PRO A 1 235 ? -25.347 90.302  -28.136 1.00 24.85  ? 232 PRO A CB  1 
ATOM   1753 C CG  . PRO A 1 235 ? -24.753 91.297  -29.075 1.00 20.24  ? 232 PRO A CG  1 
ATOM   1754 C CD  . PRO A 1 235 ? -24.480 92.528  -28.251 1.00 21.91  ? 232 PRO A CD  1 
ATOM   1755 N N   . ASN A 1 236 ? -22.215 90.098  -26.895 1.00 28.00  ? 233 ASN A N   1 
ATOM   1756 C CA  . ASN A 1 236 ? -21.029 89.255  -26.822 1.00 34.96  ? 233 ASN A CA  1 
ATOM   1757 C C   . ASN A 1 236 ? -20.346 89.301  -25.460 1.00 30.30  ? 233 ASN A C   1 
ATOM   1758 O O   . ASN A 1 236 ? -19.256 88.739  -25.309 1.00 42.52  ? 233 ASN A O   1 
ATOM   1759 C CB  . ASN A 1 236 ? -20.032 89.651  -27.915 1.00 28.28  ? 233 ASN A CB  1 
ATOM   1760 C CG  . ASN A 1 236 ? -19.856 91.152  -28.028 1.00 31.00  ? 233 ASN A CG  1 
ATOM   1761 O OD1 . ASN A 1 236 ? -20.830 91.894  -28.147 1.00 34.99  ? 233 ASN A OD1 1 
ATOM   1762 N ND2 . ASN A 1 236 ? -18.609 91.608  -27.988 1.00 28.09  ? 233 ASN A ND2 1 
ATOM   1763 N N   . GLY A 1 237 ? -20.954 89.949  -24.470 1.00 39.41  ? 234 GLY A N   1 
ATOM   1764 C CA  . GLY A 1 237 ? -20.380 90.025  -23.149 1.00 44.62  ? 234 GLY A CA  1 
ATOM   1765 C C   . GLY A 1 237 ? -20.304 88.668  -22.478 1.00 42.74  ? 234 GLY A C   1 
ATOM   1766 O O   . GLY A 1 237 ? -21.034 87.735  -22.827 1.00 45.00  ? 234 GLY A O   1 
ATOM   1767 N N   . PRO A 1 238 ? -19.411 88.532  -21.493 1.00 30.55  ? 235 PRO A N   1 
ATOM   1768 C CA  . PRO A 1 238 ? -19.283 87.252  -20.779 1.00 28.16  ? 235 PRO A CA  1 
ATOM   1769 C C   . PRO A 1 238 ? -20.470 86.920  -19.891 1.00 26.72  ? 235 PRO A C   1 
ATOM   1770 O O   . PRO A 1 238 ? -20.504 85.826  -19.315 1.00 29.01  ? 235 PRO A O   1 
ATOM   1771 C CB  . PRO A 1 238 ? -18.011 87.450  -19.944 1.00 27.11  ? 235 PRO A CB  1 
ATOM   1772 C CG  . PRO A 1 238 ? -17.955 88.922  -19.711 1.00 29.72  ? 235 PRO A CG  1 
ATOM   1773 C CD  . PRO A 1 238 ? -18.489 89.554  -20.969 1.00 27.21  ? 235 PRO A CD  1 
ATOM   1774 N N   . TRP A 1 239 ? -21.441 87.825  -19.765 1.00 23.90  ? 236 TRP A N   1 
ATOM   1775 C CA  . TRP A 1 239 ? -22.602 87.629  -18.912 1.00 29.55  ? 236 TRP A CA  1 
ATOM   1776 C C   . TRP A 1 239 ? -23.909 87.496  -19.679 1.00 25.42  ? 236 TRP A C   1 
ATOM   1777 O O   . TRP A 1 239 ? -24.898 87.035  -19.103 1.00 25.85  ? 236 TRP A O   1 
ATOM   1778 C CB  . TRP A 1 239 ? -22.733 88.801  -17.930 1.00 19.16  ? 236 TRP A CB  1 
ATOM   1779 C CG  . TRP A 1 239 ? -22.714 90.126  -18.630 1.00 27.67  ? 236 TRP A CG  1 
ATOM   1780 C CD1 . TRP A 1 239 ? -21.623 90.910  -18.871 1.00 23.58  ? 236 TRP A CD1 1 
ATOM   1781 C CD2 . TRP A 1 239 ? -23.834 90.810  -19.204 1.00 21.78  ? 236 TRP A CD2 1 
ATOM   1782 N NE1 . TRP A 1 239 ? -21.996 92.044  -19.550 1.00 20.87  ? 236 TRP A NE1 1 
ATOM   1783 C CE2 . TRP A 1 239 ? -23.348 92.007  -19.768 1.00 24.05  ? 236 TRP A CE2 1 
ATOM   1784 C CE3 . TRP A 1 239 ? -25.202 90.531  -19.290 1.00 23.12  ? 236 TRP A CE3 1 
ATOM   1785 C CZ2 . TRP A 1 239 ? -24.181 92.923  -20.408 1.00 26.26  ? 236 TRP A CZ2 1 
ATOM   1786 C CZ3 . TRP A 1 239 ? -26.026 91.440  -19.929 1.00 17.08  ? 236 TRP A CZ3 1 
ATOM   1787 C CH2 . TRP A 1 239 ? -25.513 92.622  -20.478 1.00 22.64  ? 236 TRP A CH2 1 
ATOM   1788 N N   . ALA A 1 240 ? -23.938 87.887  -20.954 1.00 23.79  ? 237 ALA A N   1 
ATOM   1789 C CA  . ALA A 1 240 ? -25.191 87.975  -21.693 1.00 23.09  ? 237 ALA A CA  1 
ATOM   1790 C C   . ALA A 1 240 ? -25.684 86.630  -22.208 1.00 25.23  ? 237 ALA A C   1 
ATOM   1791 O O   . ALA A 1 240 ? -26.882 86.490  -22.473 1.00 30.73  ? 237 ALA A O   1 
ATOM   1792 C CB  . ALA A 1 240 ? -25.040 88.947  -22.866 1.00 18.87  ? 237 ALA A CB  1 
ATOM   1793 N N   . THR A 1 241 ? -24.803 85.645  -22.361 1.00 21.38  ? 238 THR A N   1 
ATOM   1794 C CA  . THR A 1 241 ? -25.181 84.346  -22.895 1.00 22.98  ? 238 THR A CA  1 
ATOM   1795 C C   . THR A 1 241 ? -24.641 83.239  -22.001 1.00 22.67  ? 238 THR A C   1 
ATOM   1796 O O   . THR A 1 241 ? -23.807 83.466  -21.120 1.00 26.45  ? 238 THR A O   1 
ATOM   1797 C CB  . THR A 1 241 ? -24.677 84.155  -24.332 1.00 27.81  ? 238 THR A CB  1 
ATOM   1798 O OG1 . THR A 1 241 ? -23.267 84.406  -24.386 1.00 36.62  ? 238 THR A OG1 1 
ATOM   1799 C CG2 . THR A 1 241 ? -25.396 85.102  -25.278 1.00 25.37  ? 238 THR A CG2 1 
ATOM   1800 N N   . VAL A 1 242 ? -25.133 82.025  -22.244 1.00 23.93  ? 239 VAL A N   1 
ATOM   1801 C CA  . VAL A 1 242 ? -24.722 80.849  -21.488 1.00 25.23  ? 239 VAL A CA  1 
ATOM   1802 C C   . VAL A 1 242 ? -24.798 79.642  -22.412 1.00 28.76  ? 239 VAL A C   1 
ATOM   1803 O O   . VAL A 1 242 ? -25.593 79.610  -23.357 1.00 29.89  ? 239 VAL A O   1 
ATOM   1804 C CB  . VAL A 1 242 ? -25.592 80.655  -20.221 1.00 32.93  ? 239 VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 242 ? -26.994 80.181  -20.590 1.00 29.06  ? 239 VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 242 ? -24.926 79.696  -19.248 1.00 33.05  ? 239 VAL A CG2 1 
ATOM   1807 N N   . GLY A 1 243 ? -23.947 78.648  -22.146 1.00 34.30  ? 240 GLY A N   1 
ATOM   1808 C CA  . GLY A 1 243 ? -23.928 77.446  -22.950 1.00 27.89  ? 240 GLY A CA  1 
ATOM   1809 C C   . GLY A 1 243 ? -25.095 76.523  -22.653 1.00 40.68  ? 240 GLY A C   1 
ATOM   1810 O O   . GLY A 1 243 ? -25.801 76.662  -21.655 1.00 41.28  ? 240 GLY A O   1 
ATOM   1811 N N   . MET A 1 244 ? -25.293 75.558  -23.555 1.00 33.65  ? 241 MET A N   1 
ATOM   1812 C CA  . MET A 1 244 ? -26.390 74.609  -23.391 1.00 41.65  ? 241 MET A CA  1 
ATOM   1813 C C   . MET A 1 244 ? -26.187 73.734  -22.161 1.00 40.11  ? 241 MET A C   1 
ATOM   1814 O O   . MET A 1 244 ? -27.135 73.480  -21.408 1.00 43.15  ? 241 MET A O   1 
ATOM   1815 C CB  . MET A 1 244 ? -26.534 73.744  -24.644 1.00 34.73  ? 241 MET A CB  1 
ATOM   1816 C CG  . MET A 1 244 ? -27.183 74.457  -25.820 1.00 50.87  ? 241 MET A CG  1 
ATOM   1817 S SD  . MET A 1 244 ? -27.522 73.364  -27.215 1.00 66.47  ? 241 MET A SD  1 
ATOM   1818 C CE  . MET A 1 244 ? -25.862 72.992  -27.775 1.00 47.73  ? 241 MET A CE  1 
ATOM   1819 N N   . GLY A 1 245 ? -24.958 73.265  -21.939 1.00 37.66  ? 242 GLY A N   1 
ATOM   1820 C CA  . GLY A 1 245 ? -24.701 72.415  -20.788 1.00 31.00  ? 242 GLY A CA  1 
ATOM   1821 C C   . GLY A 1 245 ? -24.872 73.144  -19.469 1.00 35.24  ? 242 GLY A C   1 
ATOM   1822 O O   . GLY A 1 245 ? -25.442 72.600  -18.519 1.00 39.50  ? 242 GLY A O   1 
ATOM   1823 N N   . GLU A 1 246 ? -24.384 74.385  -19.391 1.00 32.38  ? 243 GLU A N   1 
ATOM   1824 C CA  . GLU A 1 246 ? -24.509 75.148  -18.153 1.00 38.39  ? 243 GLU A CA  1 
ATOM   1825 C C   . GLU A 1 246 ? -25.953 75.567  -17.905 1.00 40.16  ? 243 GLU A C   1 
ATOM   1826 O O   . GLU A 1 246 ? -26.404 75.607  -16.754 1.00 32.34  ? 243 GLU A O   1 
ATOM   1827 C CB  . GLU A 1 246 ? -23.588 76.368  -18.194 1.00 31.11  ? 243 GLU A CB  1 
ATOM   1828 C CG  . GLU A 1 246 ? -23.646 77.246  -16.950 1.00 41.32  ? 243 GLU A CG  1 
ATOM   1829 C CD  . GLU A 1 246 ? -23.130 76.550  -15.705 1.00 34.11  ? 243 GLU A CD  1 
ATOM   1830 O OE1 . GLU A 1 246 ? -22.369 75.569  -15.836 1.00 47.86  ? 243 GLU A OE1 1 
ATOM   1831 O OE2 . GLU A 1 246 ? -23.486 76.989  -14.591 1.00 46.20  ? 243 GLU A OE2 1 
ATOM   1832 N N   . ALA A 1 247 ? -26.696 75.881  -18.971 1.00 37.08  ? 244 ALA A N   1 
ATOM   1833 C CA  . ALA A 1 247 ? -28.102 76.234  -18.808 1.00 31.85  ? 244 ALA A CA  1 
ATOM   1834 C C   . ALA A 1 247 ? -28.923 75.052  -18.310 1.00 40.19  ? 244 ALA A C   1 
ATOM   1835 O O   . ALA A 1 247 ? -29.890 75.242  -17.563 1.00 36.22  ? 244 ALA A O   1 
ATOM   1836 C CB  . ALA A 1 247 ? -28.672 76.757  -20.127 1.00 32.46  ? 244 ALA A CB  1 
ATOM   1837 N N   . ARG A 1 248 ? -28.555 73.832  -18.707 1.00 37.29  ? 245 ARG A N   1 
ATOM   1838 C CA  . ARG A 1 248 ? -29.258 72.653  -18.214 1.00 35.03  ? 245 ARG A CA  1 
ATOM   1839 C C   . ARG A 1 248 ? -28.933 72.390  -16.749 1.00 32.87  ? 245 ARG A C   1 
ATOM   1840 O O   . ARG A 1 248 ? -29.803 71.962  -15.981 1.00 30.72  ? 245 ARG A O   1 
ATOM   1841 C CB  . ARG A 1 248 ? -28.907 71.438  -19.074 1.00 36.63  ? 245 ARG A CB  1 
ATOM   1842 C CG  . ARG A 1 248 ? -29.476 70.124  -18.564 1.00 34.44  ? 245 ARG A CG  1 
ATOM   1843 C CD  . ARG A 1 248 ? -29.308 69.015  -19.589 1.00 34.63  ? 245 ARG A CD  1 
ATOM   1844 N NE  . ARG A 1 248 ? -30.068 69.286  -20.806 1.00 47.75  ? 245 ARG A NE  1 
ATOM   1845 C CZ  . ARG A 1 248 ? -31.337 68.933  -20.986 1.00 45.46  ? 245 ARG A CZ  1 
ATOM   1846 N NH1 . ARG A 1 248 ? -31.991 68.291  -20.027 1.00 34.87  ? 245 ARG A NH1 1 
ATOM   1847 N NH2 . ARG A 1 248 ? -31.952 69.221  -22.125 1.00 43.90  ? 245 ARG A NH2 1 
ATOM   1848 N N   . ARG A 1 249 ? -27.688 72.646  -16.341 1.00 32.83  ? 246 ARG A N   1 
ATOM   1849 C CA  . ARG A 1 249 ? -27.313 72.443  -14.945 1.00 36.01  ? 246 ARG A CA  1 
ATOM   1850 C C   . ARG A 1 249 ? -28.032 73.429  -14.031 1.00 28.39  ? 246 ARG A C   1 
ATOM   1851 O O   . ARG A 1 249 ? -28.481 73.059  -12.940 1.00 29.68  ? 246 ARG A O   1 
ATOM   1852 C CB  . ARG A 1 249 ? -25.799 72.573  -14.781 1.00 31.93  ? 246 ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 249 ? -25.301 72.208  -13.391 1.00 42.86  ? 246 ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 249 ? -23.914 72.771  -13.126 1.00 33.52  ? 246 ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 249 ? -23.916 74.231  -13.104 1.00 52.88  ? 246 ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 249 ? -24.230 74.961  -12.038 1.00 41.13  ? 246 ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 249 ? -24.572 74.369  -10.902 1.00 46.40  ? 246 ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 249 ? -24.205 76.285  -12.109 1.00 38.26  ? 246 ARG A NH2 1 
ATOM   1859 N N   . ARG A 1 250 ? -28.151 74.687  -14.460 1.00 27.55  ? 247 ARG A N   1 
ATOM   1860 C CA  . ARG A 1 250 ? -28.822 75.688  -13.637 1.00 25.51  ? 247 ARG A CA  1 
ATOM   1861 C C   . ARG A 1 250 ? -30.317 75.409  -13.538 1.00 31.56  ? 247 ARG A C   1 
ATOM   1862 O O   . ARG A 1 250 ? -30.915 75.579  -12.469 1.00 29.29  ? 247 ARG A O   1 
ATOM   1863 C CB  . ARG A 1 250 ? -28.566 77.085  -14.201 1.00 32.05  ? 247 ARG A CB  1 
ATOM   1864 C CG  . ARG A 1 250 ? -27.098 77.484  -14.202 1.00 28.52  ? 247 ARG A CG  1 
ATOM   1865 C CD  . ARG A 1 250 ? -26.890 78.866  -14.799 1.00 30.25  ? 247 ARG A CD  1 
ATOM   1866 N NE  . ARG A 1 250 ? -25.480 79.248  -14.805 1.00 32.41  ? 247 ARG A NE  1 
ATOM   1867 C CZ  . ARG A 1 250 ? -25.022 80.412  -15.255 1.00 36.27  ? 247 ARG A CZ  1 
ATOM   1868 N NH1 . ARG A 1 250 ? -25.863 81.316  -15.739 1.00 27.15  ? 247 ARG A NH1 1 
ATOM   1869 N NH2 . ARG A 1 250 ? -23.722 80.673  -15.221 1.00 29.37  ? 247 ARG A NH2 1 
ATOM   1870 N N   . ALA A 1 251 ? -30.937 74.978  -14.639 1.00 23.86  ? 248 ALA A N   1 
ATOM   1871 C CA  . ALA A 1 251 ? -32.357 74.644  -14.601 1.00 30.35  ? 248 ALA A CA  1 
ATOM   1872 C C   . ALA A 1 251 ? -32.615 73.432  -13.716 1.00 28.86  ? 248 ALA A C   1 
ATOM   1873 O O   . ALA A 1 251 ? -33.634 73.371  -13.018 1.00 32.50  ? 248 ALA A O   1 
ATOM   1874 C CB  . ALA A 1 251 ? -32.877 74.397  -16.017 1.00 24.71  ? 248 ALA A CB  1 
ATOM   1875 N N   . THR A 1 252 ? -31.702 72.458  -13.729 1.00 32.12  ? 249 THR A N   1 
ATOM   1876 C CA  . THR A 1 252 ? -31.864 71.282  -12.881 1.00 26.62  ? 249 THR A CA  1 
ATOM   1877 C C   . THR A 1 252 ? -31.607 71.619  -11.417 1.00 24.98  ? 249 THR A C   1 
ATOM   1878 O O   . THR A 1 252 ? -32.276 71.085  -10.524 1.00 30.43  ? 249 THR A O   1 
ATOM   1879 C CB  . THR A 1 252 ? -30.929 70.165  -13.351 1.00 34.39  ? 249 THR A CB  1 
ATOM   1880 O OG1 . THR A 1 252 ? -31.169 69.893  -14.737 1.00 32.24  ? 249 THR A OG1 1 
ATOM   1881 C CG2 . THR A 1 252 ? -31.163 68.894  -12.546 1.00 23.50  ? 249 THR A CG2 1 
ATOM   1882 N N   . GLN A 1 253 ? -30.647 72.509  -11.152 1.00 28.62  ? 250 GLN A N   1 
ATOM   1883 C CA  . GLN A 1 253 ? -30.368 72.903  -9.774  1.00 30.63  ? 250 GLN A CA  1 
ATOM   1884 C C   . GLN A 1 253 ? -31.528 73.691  -9.178  1.00 30.53  ? 250 GLN A C   1 
ATOM   1885 O O   . GLN A 1 253 ? -31.878 73.499  -8.008  1.00 32.15  ? 250 GLN A O   1 
ATOM   1886 C CB  . GLN A 1 253 ? -29.072 73.712  -9.711  1.00 30.55  ? 250 GLN A CB  1 
ATOM   1887 C CG  . GLN A 1 253 ? -28.779 74.352  -8.355  1.00 31.27  ? 250 GLN A CG  1 
ATOM   1888 C CD  . GLN A 1 253 ? -28.329 73.359  -7.297  1.00 47.66  ? 250 GLN A CD  1 
ATOM   1889 O OE1 . GLN A 1 253 ? -28.386 72.145  -7.495  1.00 58.86  ? 250 GLN A OE1 1 
ATOM   1890 N NE2 . GLN A 1 253 ? -27.873 73.877  -6.162  1.00 59.47  ? 250 GLN A NE2 1 
ATOM   1891 N N   . LEU A 1 254 ? -32.139 74.580  -9.966  1.00 32.20  ? 251 LEU A N   1 
ATOM   1892 C CA  . LEU A 1 254 ? -33.315 75.299  -9.486  1.00 29.40  ? 251 LEU A CA  1 
ATOM   1893 C C   . LEU A 1 254 ? -34.461 74.340  -9.196  1.00 28.59  ? 251 LEU A C   1 
ATOM   1894 O O   . LEU A 1 254 ? -35.184 74.504  -8.206  1.00 35.71  ? 251 LEU A O   1 
ATOM   1895 C CB  . LEU A 1 254 ? -33.748 76.353  -10.505 1.00 30.32  ? 251 LEU A CB  1 
ATOM   1896 C CG  . LEU A 1 254 ? -34.979 77.171  -10.103 1.00 31.47  ? 251 LEU A CG  1 
ATOM   1897 C CD1 . LEU A 1 254 ? -34.659 78.078  -8.923  1.00 22.53  ? 251 LEU A CD1 1 
ATOM   1898 C CD2 . LEU A 1 254 ? -35.518 77.976  -11.276 1.00 28.43  ? 251 LEU A CD2 1 
ATOM   1899 N N   . ALA A 1 255 ? -34.640 73.329  -10.050 1.00 26.15  ? 252 ALA A N   1 
ATOM   1900 C CA  . ALA A 1 255 ? -35.676 72.331  -9.807  1.00 30.13  ? 252 ALA A CA  1 
ATOM   1901 C C   . ALA A 1 255 ? -35.411 71.566  -8.517  1.00 28.42  ? 252 ALA A C   1 
ATOM   1902 O O   . ALA A 1 255 ? -36.337 71.299  -7.743  1.00 26.73  ? 252 ALA A O   1 
ATOM   1903 C CB  . ALA A 1 255 ? -35.769 71.372  -10.994 1.00 30.45  ? 252 ALA A CB  1 
ATOM   1904 N N   . HIS A 1 256 ? -34.149 71.207  -8.268  1.00 26.72  ? 253 HIS A N   1 
ATOM   1905 C CA  . HIS A 1 256 ? -33.811 70.497  -7.038  1.00 26.98  ? 253 HIS A CA  1 
ATOM   1906 C C   . HIS A 1 256 ? -34.090 71.353  -5.809  1.00 23.66  ? 253 HIS A C   1 
ATOM   1907 O O   . HIS A 1 256 ? -34.552 70.845  -4.781  1.00 31.65  ? 253 HIS A O   1 
ATOM   1908 C CB  . HIS A 1 256 ? -32.344 70.068  -7.067  1.00 24.20  ? 253 HIS A CB  1 
ATOM   1909 C CG  . HIS A 1 256 ? -31.831 69.587  -5.745  1.00 36.62  ? 253 HIS A CG  1 
ATOM   1910 N ND1 . HIS A 1 256 ? -32.155 68.353  -5.224  1.00 33.80  ? 253 HIS A ND1 1 
ATOM   1911 C CD2 . HIS A 1 256 ? -31.022 70.179  -4.834  1.00 28.58  ? 253 HIS A CD2 1 
ATOM   1912 C CE1 . HIS A 1 256 ? -31.565 68.204  -4.052  1.00 40.96  ? 253 HIS A CE1 1 
ATOM   1913 N NE2 . HIS A 1 256 ? -30.872 69.297  -3.792  1.00 38.84  ? 253 HIS A NE2 1 
ATOM   1914 N N   . LEU A 1 257 ? -33.819 72.657  -5.898  1.00 28.21  ? 254 LEU A N   1 
ATOM   1915 C CA  . LEU A 1 257 ? -34.019 73.542  -4.757  1.00 30.37  ? 254 LEU A CA  1 
ATOM   1916 C C   . LEU A 1 257 ? -35.491 73.728  -4.410  1.00 29.83  ? 254 LEU A C   1 
ATOM   1917 O O   . LEU A 1 257 ? -35.801 74.110  -3.276  1.00 30.67  ? 254 LEU A O   1 
ATOM   1918 C CB  . LEU A 1 257 ? -33.372 74.901  -5.027  1.00 23.16  ? 254 LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 257 ? -31.842 74.919  -5.049  1.00 30.17  ? 254 LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 257 ? -31.325 76.289  -5.460  1.00 23.29  ? 254 LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 257 ? -31.284 74.517  -3.692  1.00 19.79  ? 254 LEU A CD2 1 
ATOM   1922 N N   . VAL A 1 258 ? -36.398 73.471  -5.347  1.00 29.50  ? 255 VAL A N   1 
ATOM   1923 C CA  . VAL A 1 258 ? -37.827 73.605  -5.100  1.00 29.63  ? 255 VAL A CA  1 
ATOM   1924 C C   . VAL A 1 258 ? -38.508 72.238  -5.026  1.00 35.37  ? 255 VAL A C   1 
ATOM   1925 O O   . VAL A 1 258 ? -39.732 72.150  -5.104  1.00 38.68  ? 255 VAL A O   1 
ATOM   1926 C CB  . VAL A 1 258 ? -38.494 74.507  -6.152  1.00 30.22  ? 255 VAL A CB  1 
ATOM   1927 C CG1 . VAL A 1 258 ? -37.877 75.898  -6.121  1.00 31.55  ? 255 VAL A CG1 1 
ATOM   1928 C CG2 . VAL A 1 258 ? -38.372 73.893  -7.537  1.00 28.45  ? 255 VAL A CG2 1 
ATOM   1929 N N   . GLY A 1 259 ? -37.729 71.170  -4.875  1.00 33.45  ? 256 GLY A N   1 
ATOM   1930 C CA  . GLY A 1 259 ? -38.300 69.847  -4.713  1.00 36.32  ? 256 GLY A CA  1 
ATOM   1931 C C   . GLY A 1 259 ? -38.720 69.164  -5.994  1.00 41.29  ? 256 GLY A C   1 
ATOM   1932 O O   . GLY A 1 259 ? -39.665 68.369  -5.980  1.00 40.57  ? 256 GLY A O   1 
ATOM   1933 N N   . CYS A 1 260 ? -38.046 69.447  -7.105  1.00 35.10  ? 257 CYS A N   1 
ATOM   1934 C CA  . CYS A 1 260 ? -38.357 68.833  -8.383  1.00 41.90  ? 257 CYS A CA  1 
ATOM   1935 C C   . CYS A 1 260 ? -37.149 68.060  -8.895  1.00 44.26  ? 257 CYS A C   1 
ATOM   1936 O O   . CYS A 1 260 ? -36.047 68.623  -8.971  1.00 43.80  ? 257 CYS A O   1 
ATOM   1937 C CB  . CYS A 1 260 ? -38.775 69.892  -9.416  1.00 35.04  ? 257 CYS A CB  1 
ATOM   1938 S SG  . CYS A 1 260 ? -40.360 70.695  -9.079  1.00 51.88  ? 257 CYS A SG  1 
ATOM   1939 N N   . PRO A 1 261 ? -37.303 66.777  -9.255  1.00 51.49  ? 258 PRO A N   1 
ATOM   1940 C CA  . PRO A 1 261 ? -38.568 66.041  -9.168  1.00 57.96  ? 258 PRO A CA  1 
ATOM   1941 C C   . PRO A 1 261 ? -38.823 65.498  -7.764  1.00 64.51  ? 258 PRO A C   1 
ATOM   1942 O O   . PRO A 1 261 ? -37.873 65.357  -6.992  1.00 59.70  ? 258 PRO A O   1 
ATOM   1943 C CB  . PRO A 1 261 ? -38.368 64.902  -10.166 1.00 61.82  ? 258 PRO A CB  1 
ATOM   1944 C CG  . PRO A 1 261 ? -36.906 64.623  -10.093 1.00 60.85  ? 258 PRO A CG  1 
ATOM   1945 C CD  . PRO A 1 261 ? -36.232 65.954  -9.846  1.00 56.85  ? 258 PRO A CD  1 
ATOM   1946 N N   . PRO A 1 262 ? -40.083 65.212  -7.437  1.00 66.88  ? 259 PRO A N   1 
ATOM   1947 C CA  . PRO A 1 262 ? -40.390 64.635  -6.119  1.00 71.49  ? 259 PRO A CA  1 
ATOM   1948 C C   . PRO A 1 262 ? -39.688 63.299  -5.932  1.00 80.56  ? 259 PRO A C   1 
ATOM   1949 O O   . PRO A 1 262 ? -39.906 62.350  -6.689  1.00 84.55  ? 259 PRO A O   1 
ATOM   1950 C CB  . PRO A 1 262 ? -41.916 64.478  -6.149  1.00 66.16  ? 259 PRO A CB  1 
ATOM   1951 C CG  . PRO A 1 262 ? -42.379 65.459  -7.175  1.00 61.83  ? 259 PRO A CG  1 
ATOM   1952 C CD  . PRO A 1 262 ? -41.301 65.490  -8.216  1.00 57.52  ? 259 PRO A CD  1 
ATOM   1953 N N   . GLY A 1 263 ? -38.832 63.234  -4.915  1.00 84.81  ? 260 GLY A N   1 
ATOM   1954 C CA  . GLY A 1 263 ? -38.083 62.026  -4.631  1.00 91.27  ? 260 GLY A CA  1 
ATOM   1955 C C   . GLY A 1 263 ? -38.963 60.853  -4.253  1.00 98.30  ? 260 GLY A C   1 
ATOM   1956 O O   . GLY A 1 263 ? -39.771 60.951  -3.324  1.00 100.85 ? 260 GLY A O   1 
ATOM   1957 N N   . GLY A 1 264 ? -38.821 59.740  -4.966  1.00 94.40  ? 261 GLY A N   1 
ATOM   1958 C CA  . GLY A 1 264 ? -37.876 59.646  -6.065  1.00 93.29  ? 261 GLY A CA  1 
ATOM   1959 C C   . GLY A 1 264 ? -38.515 59.200  -7.365  1.00 99.52  ? 261 GLY A C   1 
ATOM   1960 O O   . GLY A 1 264 ? -38.707 58.006  -7.597  1.00 99.82  ? 261 GLY A O   1 
ATOM   1961 N N   . THR A 1 265 ? -38.846 60.164  -8.218  1.00 94.88  ? 262 THR A N   1 
ATOM   1962 C CA  . THR A 1 265 ? -39.486 59.909  -9.499  1.00 89.33  ? 262 THR A CA  1 
ATOM   1963 C C   . THR A 1 265 ? -38.533 60.264  -10.638 1.00 89.28  ? 262 THR A C   1 
ATOM   1964 O O   . THR A 1 265 ? -37.419 60.752  -10.423 1.00 76.02  ? 262 THR A O   1 
ATOM   1965 C CB  . THR A 1 265 ? -40.796 60.693  -9.612  1.00 89.61  ? 262 THR A CB  1 
ATOM   1966 O OG1 . THR A 1 265 ? -40.526 62.097  -9.516  1.00 83.85  ? 262 THR A OG1 1 
ATOM   1967 C CG2 . THR A 1 265 ? -41.753 60.288  -8.500  1.00 66.45  ? 262 THR A CG2 1 
ATOM   1968 N N   . GLY A 1 266 ? -38.988 60.010  -11.864 1.00 94.21  ? 263 GLY A N   1 
ATOM   1969 C CA  . GLY A 1 266 ? -38.158 60.258  -13.027 1.00 84.98  ? 263 GLY A CA  1 
ATOM   1970 C C   . GLY A 1 266 ? -37.826 61.727  -13.199 1.00 89.52  ? 263 GLY A C   1 
ATOM   1971 O O   . GLY A 1 266 ? -38.492 62.619  -12.668 1.00 82.63  ? 263 GLY A O   1 
ATOM   1972 N N   . GLY A 1 267 ? -36.769 61.978  -13.968 1.00 90.47  ? 264 GLY A N   1 
ATOM   1973 C CA  . GLY A 1 267 ? -36.274 63.330  -14.124 1.00 71.18  ? 264 GLY A CA  1 
ATOM   1974 C C   . GLY A 1 267 ? -36.029 63.773  -15.551 1.00 74.15  ? 264 GLY A C   1 
ATOM   1975 O O   . GLY A 1 267 ? -35.203 64.661  -15.784 1.00 64.37  ? 264 GLY A O   1 
ATOM   1976 N N   . ASN A 1 268 ? -36.727 63.177  -16.517 1.00 67.54  ? 265 ASN A N   1 
ATOM   1977 C CA  . ASN A 1 268 ? -36.608 63.660  -17.883 1.00 57.48  ? 265 ASN A CA  1 
ATOM   1978 C C   . ASN A 1 268 ? -37.188 65.069  -17.988 1.00 53.94  ? 265 ASN A C   1 
ATOM   1979 O O   . ASN A 1 268 ? -37.900 65.545  -17.098 1.00 50.98  ? 265 ASN A O   1 
ATOM   1980 C CB  . ASN A 1 268 ? -37.292 62.704  -18.868 1.00 54.02  ? 265 ASN A CB  1 
ATOM   1981 C CG  . ASN A 1 268 ? -38.762 62.472  -18.555 1.00 64.51  ? 265 ASN A CG  1 
ATOM   1982 O OD1 . ASN A 1 268 ? -39.495 63.397  -18.210 1.00 66.88  ? 265 ASN A OD1 1 
ATOM   1983 N ND2 . ASN A 1 268 ? -39.200 61.225  -18.690 1.00 66.95  ? 265 ASN A ND2 1 
ATOM   1984 N N   . ASP A 1 269 ? -36.870 65.741  -19.097 1.00 51.02  ? 266 ASP A N   1 
ATOM   1985 C CA  . ASP A 1 269 ? -37.200 67.158  -19.226 1.00 46.86  ? 266 ASP A CA  1 
ATOM   1986 C C   . ASP A 1 269 ? -38.699 67.413  -19.126 1.00 51.63  ? 266 ASP A C   1 
ATOM   1987 O O   . ASP A 1 269 ? -39.114 68.481  -18.664 1.00 50.70  ? 266 ASP A O   1 
ATOM   1988 C CB  . ASP A 1 269 ? -36.653 67.704  -20.545 1.00 44.13  ? 266 ASP A CB  1 
ATOM   1989 C CG  . ASP A 1 269 ? -35.138 67.718  -20.583 1.00 52.80  ? 266 ASP A CG  1 
ATOM   1990 O OD1 . ASP A 1 269 ? -34.513 67.325  -19.575 1.00 46.58  ? 266 ASP A OD1 1 
ATOM   1991 O OD2 . ASP A 1 269 ? -34.570 68.123  -21.619 1.00 54.39  ? 266 ASP A OD2 1 
ATOM   1992 N N   . THR A 1 270 ? -39.526 66.451  -19.541 1.00 50.94  ? 267 THR A N   1 
ATOM   1993 C CA  . THR A 1 270 ? -40.971 66.643  -19.465 1.00 57.53  ? 267 THR A CA  1 
ATOM   1994 C C   . THR A 1 270 ? -41.453 66.624  -18.018 1.00 48.65  ? 267 THR A C   1 
ATOM   1995 O O   . THR A 1 270 ? -42.234 67.488  -17.602 1.00 42.17  ? 267 THR A O   1 
ATOM   1996 C CB  . THR A 1 270 ? -41.689 65.572  -20.287 1.00 50.16  ? 267 THR A CB  1 
ATOM   1997 O OG1 . THR A 1 270 ? -41.276 65.662  -21.656 1.00 43.55  ? 267 THR A OG1 1 
ATOM   1998 C CG2 . THR A 1 270 ? -43.198 65.761  -20.208 1.00 42.66  ? 267 THR A CG2 1 
ATOM   1999 N N   . GLU A 1 271 ? -40.996 65.645  -17.234 1.00 49.86  ? 268 GLU A N   1 
ATOM   2000 C CA  . GLU A 1 271 ? -41.409 65.565  -15.837 1.00 50.44  ? 268 GLU A CA  1 
ATOM   2001 C C   . GLU A 1 271 ? -40.810 66.692  -15.005 1.00 54.45  ? 268 GLU A C   1 
ATOM   2002 O O   . GLU A 1 271 ? -41.400 67.098  -13.998 1.00 48.26  ? 268 GLU A O   1 
ATOM   2003 C CB  . GLU A 1 271 ? -41.019 64.209  -15.250 1.00 50.80  ? 268 GLU A CB  1 
ATOM   2004 C CG  . GLU A 1 271 ? -41.645 63.020  -15.962 1.00 72.08  ? 268 GLU A CG  1 
ATOM   2005 C CD  . GLU A 1 271 ? -40.989 61.705  -15.589 1.00 81.62  ? 268 GLU A CD  1 
ATOM   2006 O OE1 . GLU A 1 271 ? -41.707 60.782  -15.149 1.00 77.24  ? 268 GLU A OE1 1 
ATOM   2007 O OE2 . GLU A 1 271 ? -39.752 61.594  -15.733 1.00 70.58  ? 268 GLU A OE2 1 
ATOM   2008 N N   . LEU A 1 272 ? -39.647 67.210  -15.409 1.00 52.45  ? 269 LEU A N   1 
ATOM   2009 C CA  . LEU A 1 272 ? -39.009 68.273  -14.639 1.00 44.62  ? 269 LEU A CA  1 
ATOM   2010 C C   . LEU A 1 272 ? -39.740 69.599  -14.815 1.00 44.71  ? 269 LEU A C   1 
ATOM   2011 O O   . LEU A 1 272 ? -39.978 70.317  -13.837 1.00 41.59  ? 269 LEU A O   1 
ATOM   2012 C CB  . LEU A 1 272 ? -37.542 68.406  -15.048 1.00 48.91  ? 269 LEU A CB  1 
ATOM   2013 C CG  . LEU A 1 272 ? -36.601 69.013  -14.006 1.00 50.72  ? 269 LEU A CG  1 
ATOM   2014 C CD1 . LEU A 1 272 ? -36.555 68.136  -12.766 1.00 39.07  ? 269 LEU A CD1 1 
ATOM   2015 C CD2 . LEU A 1 272 ? -35.206 69.204  -14.582 1.00 43.76  ? 269 LEU A CD2 1 
ATOM   2016 N N   . VAL A 1 273 ? -40.104 69.941  -16.053 1.00 40.08  ? 270 VAL A N   1 
ATOM   2017 C CA  . VAL A 1 273 ? -40.826 71.187  -16.295 1.00 35.80  ? 270 VAL A CA  1 
ATOM   2018 C C   . VAL A 1 273 ? -42.245 71.097  -15.748 1.00 39.85  ? 270 VAL A C   1 
ATOM   2019 O O   . VAL A 1 273 ? -42.796 72.085  -15.247 1.00 39.46  ? 270 VAL A O   1 
ATOM   2020 C CB  . VAL A 1 273 ? -40.813 71.528  -17.797 1.00 32.56  ? 270 VAL A CB  1 
ATOM   2021 C CG1 . VAL A 1 273 ? -41.591 72.807  -18.061 1.00 36.58  ? 270 VAL A CG1 1 
ATOM   2022 C CG2 . VAL A 1 273 ? -39.385 71.668  -18.294 1.00 34.99  ? 270 VAL A CG2 1 
ATOM   2023 N N   . ALA A 1 274 ? -42.859 69.913  -15.830 1.00 39.47  ? 271 ALA A N   1 
ATOM   2024 C CA  . ALA A 1 274 ? -44.198 69.736  -15.275 1.00 33.05  ? 271 ALA A CA  1 
ATOM   2025 C C   . ALA A 1 274 ? -44.208 69.991  -13.774 1.00 43.14  ? 271 ALA A C   1 
ATOM   2026 O O   . ALA A 1 274 ? -45.155 70.582  -13.242 1.00 43.83  ? 271 ALA A O   1 
ATOM   2027 C CB  . ALA A 1 274 ? -44.715 68.332  -15.587 1.00 37.95  ? 271 ALA A CB  1 
ATOM   2028 N N   . CYS A 1 275 ? -43.158 69.554  -13.073 1.00 36.05  ? 272 CYS A N   1 
ATOM   2029 C CA  . CYS A 1 275 ? -43.050 69.841  -11.648 1.00 36.09  ? 272 CYS A CA  1 
ATOM   2030 C C   . CYS A 1 275 ? -42.781 71.319  -11.394 1.00 37.07  ? 272 CYS A C   1 
ATOM   2031 O O   . CYS A 1 275 ? -43.265 71.875  -10.401 1.00 37.47  ? 272 CYS A O   1 
ATOM   2032 C CB  . CYS A 1 275 ? -41.949 68.981  -11.026 1.00 36.63  ? 272 CYS A CB  1 
ATOM   2033 S SG  . CYS A 1 275 ? -41.720 69.193  -9.243  1.00 68.82  ? 272 CYS A SG  1 
ATOM   2034 N N   . LEU A 1 276 ? -42.017 71.970  -12.275 1.00 36.46  ? 273 LEU A N   1 
ATOM   2035 C CA  . LEU A 1 276 ? -41.734 73.391  -12.103 1.00 28.57  ? 273 LEU A CA  1 
ATOM   2036 C C   . LEU A 1 276 ? -42.970 74.248  -12.342 1.00 36.27  ? 273 LEU A C   1 
ATOM   2037 O O   . LEU A 1 276 ? -43.107 75.317  -11.736 1.00 36.40  ? 273 LEU A O   1 
ATOM   2038 C CB  . LEU A 1 276 ? -40.606 73.824  -13.040 1.00 27.57  ? 273 LEU A CB  1 
ATOM   2039 C CG  . LEU A 1 276 ? -39.183 73.415  -12.658 1.00 38.11  ? 273 LEU A CG  1 
ATOM   2040 C CD1 . LEU A 1 276 ? -38.196 73.868  -13.722 1.00 26.27  ? 273 LEU A CD1 1 
ATOM   2041 C CD2 . LEU A 1 276 ? -38.810 73.990  -11.301 1.00 25.20  ? 273 LEU A CD2 1 
ATOM   2042 N N   . ARG A 1 277 ? -43.877 73.805  -13.216 1.00 30.86  ? 274 ARG A N   1 
ATOM   2043 C CA  . ARG A 1 277 ? -45.068 74.593  -13.505 1.00 38.50  ? 274 ARG A CA  1 
ATOM   2044 C C   . ARG A 1 277 ? -46.092 74.540  -12.379 1.00 36.71  ? 274 ARG A C   1 
ATOM   2045 O O   . ARG A 1 277 ? -46.998 75.380  -12.345 1.00 46.16  ? 274 ARG A O   1 
ATOM   2046 C CB  . ARG A 1 277 ? -45.706 74.131  -14.817 1.00 40.80  ? 274 ARG A CB  1 
ATOM   2047 C CG  . ARG A 1 277 ? -45.041 74.705  -16.062 1.00 41.75  ? 274 ARG A CG  1 
ATOM   2048 C CD  . ARG A 1 277 ? -45.902 74.498  -17.299 1.00 38.26  ? 274 ARG A CD  1 
ATOM   2049 N NE  . ARG A 1 277 ? -45.539 73.294  -18.040 1.00 52.32  ? 274 ARG A NE  1 
ATOM   2050 C CZ  . ARG A 1 277 ? -44.844 73.298  -19.173 1.00 45.86  ? 274 ARG A CZ  1 
ATOM   2051 N NH1 . ARG A 1 277 ? -44.438 74.445  -19.700 1.00 36.00  ? 274 ARG A NH1 1 
ATOM   2052 N NH2 . ARG A 1 277 ? -44.557 72.155  -19.782 1.00 50.76  ? 274 ARG A NH2 1 
ATOM   2053 N N   . THR A 1 278 ? -45.972 73.583  -11.460 1.00 33.26  ? 275 THR A N   1 
ATOM   2054 C CA  . THR A 1 278 ? -46.867 73.505  -10.314 1.00 30.90  ? 275 THR A CA  1 
ATOM   2055 C C   . THR A 1 278 ? -46.412 74.368  -9.145  1.00 38.08  ? 275 THR A C   1 
ATOM   2056 O O   . THR A 1 278 ? -47.205 74.610  -8.228  1.00 40.67  ? 275 THR A O   1 
ATOM   2057 C CB  . THR A 1 278 ? -47.005 72.054  -9.839  1.00 36.30  ? 275 THR A CB  1 
ATOM   2058 O OG1 . THR A 1 278 ? -45.745 71.591  -9.337  1.00 43.29  ? 275 THR A OG1 1 
ATOM   2059 C CG2 . THR A 1 278 ? -47.449 71.158  -10.985 1.00 32.52  ? 275 THR A CG2 1 
ATOM   2060 N N   . ARG A 1 279 ? -45.167 74.834  -9.154  1.00 33.38  ? 276 ARG A N   1 
ATOM   2061 C CA  . ARG A 1 279 ? -44.653 75.643  -8.059  1.00 32.08  ? 276 ARG A CA  1 
ATOM   2062 C C   . ARG A 1 279 ? -45.133 77.086  -8.196  1.00 30.44  ? 276 ARG A C   1 
ATOM   2063 O O   . ARG A 1 279 ? -45.227 77.606  -9.311  1.00 31.51  ? 276 ARG A O   1 
ATOM   2064 C CB  . ARG A 1 279 ? -43.126 75.608  -8.038  1.00 27.33  ? 276 ARG A CB  1 
ATOM   2065 C CG  . ARG A 1 279 ? -42.539 74.237  -7.751  1.00 32.51  ? 276 ARG A CG  1 
ATOM   2066 C CD  . ARG A 1 279 ? -42.923 73.759  -6.362  1.00 36.87  ? 276 ARG A CD  1 
ATOM   2067 N NE  . ARG A 1 279 ? -42.328 72.465  -6.043  1.00 38.66  ? 276 ARG A NE  1 
ATOM   2068 C CZ  . ARG A 1 279 ? -42.912 71.295  -6.281  1.00 50.78  ? 276 ARG A CZ  1 
ATOM   2069 N NH1 . ARG A 1 279 ? -44.112 71.254  -6.845  1.00 50.97  ? 276 ARG A NH1 1 
ATOM   2070 N NH2 . ARG A 1 279 ? -42.297 70.166  -5.957  1.00 46.83  ? 276 ARG A NH2 1 
ATOM   2071 N N   . PRO A 1 280 ? -45.452 77.748  -7.084  1.00 31.59  ? 277 PRO A N   1 
ATOM   2072 C CA  . PRO A 1 280 ? -45.788 79.174  -7.150  1.00 35.26  ? 277 PRO A CA  1 
ATOM   2073 C C   . PRO A 1 280 ? -44.620 79.980  -7.697  1.00 32.33  ? 277 PRO A C   1 
ATOM   2074 O O   . PRO A 1 280 ? -43.453 79.615  -7.533  1.00 33.31  ? 277 PRO A O   1 
ATOM   2075 C CB  . PRO A 1 280 ? -46.089 79.539  -5.691  1.00 23.69  ? 277 PRO A CB  1 
ATOM   2076 C CG  . PRO A 1 280 ? -46.453 78.240  -5.044  1.00 27.57  ? 277 PRO A CG  1 
ATOM   2077 C CD  . PRO A 1 280 ? -45.610 77.202  -5.725  1.00 25.93  ? 277 PRO A CD  1 
ATOM   2078 N N   . ALA A 1 281 ? -44.951 81.090  -8.360  1.00 25.29  ? 278 ALA A N   1 
ATOM   2079 C CA  . ALA A 1 281 ? -43.927 81.892  -9.023  1.00 26.39  ? 278 ALA A CA  1 
ATOM   2080 C C   . ALA A 1 281 ? -42.917 82.443  -8.025  1.00 29.10  ? 278 ALA A C   1 
ATOM   2081 O O   . ALA A 1 281 ? -41.717 82.510  -8.318  1.00 19.29  ? 278 ALA A O   1 
ATOM   2082 C CB  . ALA A 1 281 ? -44.580 83.028  -9.809  1.00 21.30  ? 278 ALA A CB  1 
ATOM   2083 N N   . GLN A 1 282 ? -43.382 82.840  -6.837  1.00 27.99  ? 279 GLN A N   1 
ATOM   2084 C CA  . GLN A 1 282 ? -42.475 83.396  -5.838  1.00 24.42  ? 279 GLN A CA  1 
ATOM   2085 C C   . GLN A 1 282 ? -41.480 82.355  -5.338  1.00 26.18  ? 279 GLN A C   1 
ATOM   2086 O O   . GLN A 1 282 ? -40.354 82.707  -4.967  1.00 25.13  ? 279 GLN A O   1 
ATOM   2087 C CB  . GLN A 1 282 ? -43.274 83.976  -4.670  1.00 17.38  ? 279 GLN A CB  1 
ATOM   2088 C CG  . GLN A 1 282 ? -42.436 84.760  -3.673  1.00 18.03  ? 279 GLN A CG  1 
ATOM   2089 C CD  . GLN A 1 282 ? -41.765 85.968  -4.300  1.00 28.82  ? 279 GLN A CD  1 
ATOM   2090 O OE1 . GLN A 1 282 ? -42.422 86.804  -4.920  1.00 27.19  ? 279 GLN A OE1 1 
ATOM   2091 N NE2 . GLN A 1 282 ? -40.450 86.060  -4.147  1.00 22.41  ? 279 GLN A NE2 1 
ATOM   2092 N N   . VAL A 1 283 ? -41.868 81.078  -5.328  1.00 22.83  ? 280 VAL A N   1 
ATOM   2093 C CA  . VAL A 1 283 ? -40.965 80.030  -4.864  1.00 25.83  ? 280 VAL A CA  1 
ATOM   2094 C C   . VAL A 1 283 ? -39.762 79.907  -5.793  1.00 28.58  ? 280 VAL A C   1 
ATOM   2095 O O   . VAL A 1 283 ? -38.623 79.750  -5.337  1.00 28.29  ? 280 VAL A O   1 
ATOM   2096 C CB  . VAL A 1 283 ? -41.721 78.695  -4.731  1.00 26.84  ? 280 VAL A CB  1 
ATOM   2097 C CG1 . VAL A 1 283 ? -40.758 77.566  -4.399  1.00 23.47  ? 280 VAL A CG1 1 
ATOM   2098 C CG2 . VAL A 1 283 ? -42.802 78.805  -3.667  1.00 19.71  ? 280 VAL A CG2 1 
ATOM   2099 N N   . LEU A 1 284 ? -39.991 79.982  -7.106  1.00 25.75  ? 281 LEU A N   1 
ATOM   2100 C CA  . LEU A 1 284 ? -38.883 79.906  -8.052  1.00 24.16  ? 281 LEU A CA  1 
ATOM   2101 C C   . LEU A 1 284 ? -37.964 81.115  -7.926  1.00 31.47  ? 281 LEU A C   1 
ATOM   2102 O O   . LEU A 1 284 ? -36.742 80.991  -8.074  1.00 31.61  ? 281 LEU A O   1 
ATOM   2103 C CB  . LEU A 1 284 ? -39.415 79.786  -9.480  1.00 14.24  ? 281 LEU A CB  1 
ATOM   2104 C CG  . LEU A 1 284 ? -40.254 78.549  -9.806  1.00 35.27  ? 281 LEU A CG  1 
ATOM   2105 C CD1 . LEU A 1 284 ? -40.648 78.543  -11.276 1.00 23.84  ? 281 LEU A CD1 1 
ATOM   2106 C CD2 . LEU A 1 284 ? -39.504 77.277  -9.444  1.00 23.03  ? 281 LEU A CD2 1 
ATOM   2107 N N   . VAL A 1 285 ? -38.532 82.290  -7.650  1.00 24.64  ? 282 VAL A N   1 
ATOM   2108 C CA  . VAL A 1 285 ? -37.721 83.496  -7.513  1.00 24.52  ? 282 VAL A CA  1 
ATOM   2109 C C   . VAL A 1 285 ? -36.826 83.405  -6.283  1.00 24.64  ? 282 VAL A C   1 
ATOM   2110 O O   . VAL A 1 285 ? -35.669 83.842  -6.307  1.00 26.39  ? 282 VAL A O   1 
ATOM   2111 C CB  . VAL A 1 285 ? -38.627 84.741  -7.467  1.00 25.74  ? 282 VAL A CB  1 
ATOM   2112 C CG1 . VAL A 1 285 ? -37.811 85.991  -7.174  1.00 25.82  ? 282 VAL A CG1 1 
ATOM   2113 C CG2 . VAL A 1 285 ? -39.388 84.894  -8.775  1.00 25.66  ? 282 VAL A CG2 1 
ATOM   2114 N N   . ASN A 1 286 ? -37.336 82.820  -5.196  1.00 22.51  ? 283 ASN A N   1 
ATOM   2115 C CA  . ASN A 1 286 ? -36.604 82.784  -3.935  1.00 25.68  ? 283 ASN A CA  1 
ATOM   2116 C C   . ASN A 1 286 ? -35.357 81.910  -3.982  1.00 23.63  ? 283 ASN A C   1 
ATOM   2117 O O   . ASN A 1 286 ? -34.568 81.944  -3.031  1.00 31.41  ? 283 ASN A O   1 
ATOM   2118 C CB  . ASN A 1 286 ? -37.522 82.303  -2.809  1.00 25.79  ? 283 ASN A CB  1 
ATOM   2119 C CG  . ASN A 1 286 ? -38.647 83.276  -2.519  1.00 25.88  ? 283 ASN A CG  1 
ATOM   2120 O OD1 . ASN A 1 286 ? -38.606 84.433  -2.939  1.00 25.39  ? 283 ASN A OD1 1 
ATOM   2121 N ND2 . ASN A 1 286 ? -39.658 82.813  -1.793  1.00 28.64  ? 283 ASN A ND2 1 
ATOM   2122 N N   . HIS A 1 287 ? -35.156 81.133  -5.047  1.00 30.00  ? 284 HIS A N   1 
ATOM   2123 C CA  . HIS A 1 287 ? -33.983 80.274  -5.172  1.00 34.92  ? 284 HIS A CA  1 
ATOM   2124 C C   . HIS A 1 287 ? -33.192 80.566  -6.442  1.00 32.93  ? 284 HIS A C   1 
ATOM   2125 O O   . HIS A 1 287 ? -32.399 79.727  -6.882  1.00 38.06  ? 284 HIS A O   1 
ATOM   2126 C CB  . HIS A 1 287 ? -34.393 78.801  -5.130  1.00 21.54  ? 284 HIS A CB  1 
ATOM   2127 C CG  . HIS A 1 287 ? -35.052 78.396  -3.850  1.00 25.44  ? 284 HIS A CG  1 
ATOM   2128 N ND1 . HIS A 1 287 ? -34.343 78.154  -2.693  1.00 31.58  ? 284 HIS A ND1 1 
ATOM   2129 C CD2 . HIS A 1 287 ? -36.354 78.190  -3.543  1.00 26.15  ? 284 HIS A CD2 1 
ATOM   2130 C CE1 . HIS A 1 287 ? -35.180 77.819  -1.728  1.00 31.20  ? 284 HIS A CE1 1 
ATOM   2131 N NE2 . HIS A 1 287 ? -36.407 77.832  -2.218  1.00 33.35  ? 284 HIS A NE2 1 
ATOM   2132 N N   . GLU A 1 288 ? -33.384 81.746  -7.034  1.00 32.27  ? 285 GLU A N   1 
ATOM   2133 C CA  . GLU A 1 288 ? -32.739 82.051  -8.307  1.00 34.08  ? 285 GLU A CA  1 
ATOM   2134 C C   . GLU A 1 288 ? -31.241 82.276  -8.139  1.00 34.78  ? 285 GLU A C   1 
ATOM   2135 O O   . GLU A 1 288 ? -30.440 81.776  -8.938  1.00 39.47  ? 285 GLU A O   1 
ATOM   2136 C CB  . GLU A 1 288 ? -33.395 83.274  -8.944  1.00 28.68  ? 285 GLU A CB  1 
ATOM   2137 C CG  . GLU A 1 288 ? -32.695 83.771  -10.194 1.00 41.49  ? 285 GLU A CG  1 
ATOM   2138 C CD  . GLU A 1 288 ? -33.370 84.987  -10.790 1.00 34.32  ? 285 GLU A CD  1 
ATOM   2139 O OE1 . GLU A 1 288 ? -34.606 84.958  -10.972 1.00 44.41  ? 285 GLU A OE1 1 
ATOM   2140 O OE2 . GLU A 1 288 ? -32.665 85.977  -11.066 1.00 49.11  ? 285 GLU A OE2 1 
ATOM   2141 N N   . TRP A 1 289 ? -30.840 83.025  -7.110  1.00 28.41  ? 286 TRP A N   1 
ATOM   2142 C CA  . TRP A 1 289 ? -29.433 83.362  -6.935  1.00 49.87  ? 286 TRP A CA  1 
ATOM   2143 C C   . TRP A 1 289 ? -28.606 82.201  -6.399  1.00 51.21  ? 286 TRP A C   1 
ATOM   2144 O O   . TRP A 1 289 ? -27.377 82.224  -6.526  1.00 57.79  ? 286 TRP A O   1 
ATOM   2145 C CB  . TRP A 1 289 ? -29.293 84.574  -6.013  1.00 42.73  ? 286 TRP A CB  1 
ATOM   2146 C CG  . TRP A 1 289 ? -29.739 85.835  -6.664  1.00 48.29  ? 286 TRP A CG  1 
ATOM   2147 C CD1 . TRP A 1 289 ? -30.870 86.543  -6.392  1.00 38.93  ? 286 TRP A CD1 1 
ATOM   2148 C CD2 . TRP A 1 289 ? -29.069 86.535  -7.718  1.00 44.16  ? 286 TRP A CD2 1 
ATOM   2149 N NE1 . TRP A 1 289 ? -30.943 87.647  -7.205  1.00 41.70  ? 286 TRP A NE1 1 
ATOM   2150 C CE2 . TRP A 1 289 ? -29.849 87.664  -8.029  1.00 37.63  ? 286 TRP A CE2 1 
ATOM   2151 C CE3 . TRP A 1 289 ? -27.883 86.317  -8.425  1.00 45.42  ? 286 TRP A CE3 1 
ATOM   2152 C CZ2 . TRP A 1 289 ? -29.481 88.574  -9.017  1.00 33.45  ? 286 TRP A CZ2 1 
ATOM   2153 C CZ3 . TRP A 1 289 ? -27.519 87.220  -9.403  1.00 38.01  ? 286 TRP A CZ3 1 
ATOM   2154 C CH2 . TRP A 1 289 ? -28.317 88.333  -9.693  1.00 47.95  ? 286 TRP A CH2 1 
ATOM   2155 N N   . HIS A 1 290 ? -29.246 81.183  -5.827  1.00 43.45  ? 287 HIS A N   1 
ATOM   2156 C CA  . HIS A 1 290 ? -28.550 80.003  -5.335  1.00 40.93  ? 287 HIS A CA  1 
ATOM   2157 C C   . HIS A 1 290 ? -28.271 78.998  -6.440  1.00 39.74  ? 287 HIS A C   1 
ATOM   2158 O O   . HIS A 1 290 ? -28.118 77.803  -6.163  1.00 53.79  ? 287 HIS A O   1 
ATOM   2159 C CB  . HIS A 1 290 ? -29.359 79.354  -4.210  1.00 44.28  ? 287 HIS A CB  1 
ATOM   2160 C CG  . HIS A 1 290 ? -29.849 80.329  -3.183  1.00 57.38  ? 287 HIS A CG  1 
ATOM   2161 N ND1 . HIS A 1 290 ? -29.147 81.466  -2.843  1.00 66.99  ? 287 HIS A ND1 1 
ATOM   2162 C CD2 . HIS A 1 290 ? -30.975 80.345  -2.432  1.00 65.50  ? 287 HIS A CD2 1 
ATOM   2163 C CE1 . HIS A 1 290 ? -29.817 82.136  -1.922  1.00 63.18  ? 287 HIS A CE1 1 
ATOM   2164 N NE2 . HIS A 1 290 ? -30.930 81.477  -1.655  1.00 76.50  ? 287 HIS A NE2 1 
ATOM   2165 N N   . VAL A 1 291 ? -28.217 79.463  -7.685  1.00 36.76  ? 288 VAL A N   1 
ATOM   2166 C CA  . VAL A 1 291 ? -27.954 78.600  -8.827  1.00 34.98  ? 288 VAL A CA  1 
ATOM   2167 C C   . VAL A 1 291 ? -26.619 78.909  -9.503  1.00 41.09  ? 288 VAL A C   1 
ATOM   2168 O O   . VAL A 1 291 ? -26.056 78.016  -10.158 1.00 45.70  ? 288 VAL A O   1 
ATOM   2169 C CB  . VAL A 1 291 ? -29.115 78.679  -9.845  1.00 31.22  ? 288 VAL A CB  1 
ATOM   2170 C CG1 . VAL A 1 291 ? -28.655 79.179  -11.208 1.00 34.97  ? 288 VAL A CG1 1 
ATOM   2171 C CG2 . VAL A 1 291 ? -29.813 77.338  -9.972  1.00 37.15  ? 288 VAL A CG2 1 
ATOM   2172 N N   . LEU A 1 292 ? -26.095 80.125  -9.363  1.00 36.57  ? 289 LEU A N   1 
ATOM   2173 C CA  . LEU A 1 292 ? -24.830 80.487  -9.983  1.00 41.28  ? 289 LEU A CA  1 
ATOM   2174 C C   . LEU A 1 292 ? -23.708 79.577  -9.483  1.00 54.68  ? 289 LEU A C   1 
ATOM   2175 O O   . LEU A 1 292 ? -23.733 79.117  -8.337  1.00 44.46  ? 289 LEU A O   1 
ATOM   2176 C CB  . LEU A 1 292 ? -24.493 81.945  -9.681  1.00 35.99  ? 289 LEU A CB  1 
ATOM   2177 C CG  . LEU A 1 292 ? -25.316 83.003  -10.416 1.00 39.48  ? 289 LEU A CG  1 
ATOM   2178 C CD1 . LEU A 1 292 ? -24.965 84.400  -9.923  1.00 38.91  ? 289 LEU A CD1 1 
ATOM   2179 C CD2 . LEU A 1 292 ? -25.092 82.893  -11.915 1.00 31.45  ? 289 LEU A CD2 1 
ATOM   2180 N N   . PRO A 1 293 ? -22.706 79.304  -10.324 1.00 62.78  ? 290 PRO A N   1 
ATOM   2181 C CA  . PRO A 1 293 ? -21.639 78.374  -9.927  1.00 66.48  ? 290 PRO A CA  1 
ATOM   2182 C C   . PRO A 1 293 ? -20.757 78.906  -8.807  1.00 73.33  ? 290 PRO A C   1 
ATOM   2183 O O   . PRO A 1 293 ? -20.590 78.237  -7.783  1.00 77.07  ? 290 PRO A O   1 
ATOM   2184 C CB  . PRO A 1 293 ? -20.843 78.181  -11.225 1.00 54.97  ? 290 PRO A CB  1 
ATOM   2185 C CG  . PRO A 1 293 ? -21.136 79.397  -12.041 1.00 55.18  ? 290 PRO A CG  1 
ATOM   2186 C CD  . PRO A 1 293 ? -22.549 79.774  -11.711 1.00 57.66  ? 290 PRO A CD  1 
ATOM   2187 N N   . GLN A 1 294 ? -20.187 80.097  -8.981  1.00 64.79  ? 291 GLN A N   1 
ATOM   2188 C CA  . GLN A 1 294 ? -19.258 80.659  -8.014  1.00 70.24  ? 291 GLN A CA  1 
ATOM   2189 C C   . GLN A 1 294 ? -19.729 82.031  -7.553  1.00 67.66  ? 291 GLN A C   1 
ATOM   2190 O O   . GLN A 1 294 ? -20.601 82.655  -8.165  1.00 61.88  ? 291 GLN A O   1 
ATOM   2191 C CB  . GLN A 1 294 ? -17.841 80.778  -8.598  1.00 70.52  ? 291 GLN A CB  1 
ATOM   2192 C CG  . GLN A 1 294 ? -17.462 79.675  -9.572  1.00 85.46  ? 291 GLN A CG  1 
ATOM   2193 C CD  . GLN A 1 294 ? -17.768 80.041  -11.012 1.00 81.57  ? 291 GLN A CD  1 
ATOM   2194 O OE1 . GLN A 1 294 ? -18.028 81.203  -11.327 1.00 74.73  ? 291 GLN A OE1 1 
ATOM   2195 N NE2 . GLN A 1 294 ? -17.736 79.050  -11.894 1.00 74.71  ? 291 GLN A NE2 1 
ATOM   2196 N N   . GLU A 1 295 ? -19.138 82.490  -6.451  1.00 53.36  ? 292 GLU A N   1 
ATOM   2197 C CA  . GLU A 1 295 ? -19.348 83.856  -5.993  1.00 46.35  ? 292 GLU A CA  1 
ATOM   2198 C C   . GLU A 1 295 ? -18.778 84.831  -7.014  1.00 53.20  ? 292 GLU A C   1 
ATOM   2199 O O   . GLU A 1 295 ? -17.626 84.696  -7.439  1.00 49.30  ? 292 GLU A O   1 
ATOM   2200 C CB  . GLU A 1 295 ? -18.687 84.067  -4.633  1.00 54.21  ? 292 GLU A CB  1 
ATOM   2201 C CG  . GLU A 1 295 ? -18.636 85.518  -4.184  1.00 62.53  ? 292 GLU A CG  1 
ATOM   2202 C CD  . GLU A 1 295 ? -17.591 85.759  -3.112  1.00 77.66  ? 292 GLU A CD  1 
ATOM   2203 O OE1 . GLU A 1 295 ? -16.757 84.857  -2.880  1.00 75.41  ? 292 GLU A OE1 1 
ATOM   2204 O OE2 . GLU A 1 295 ? -17.600 86.850  -2.503  1.00 62.26  ? 292 GLU A OE2 1 
ATOM   2205 N N   . SER A 1 296 ? -19.579 85.817  -7.406  1.00 51.01  ? 293 SER A N   1 
ATOM   2206 C CA  . SER A 1 296 ? -19.172 86.722  -8.471  1.00 46.44  ? 293 SER A CA  1 
ATOM   2207 C C   . SER A 1 296 ? -20.051 87.963  -8.452  1.00 41.42  ? 293 SER A C   1 
ATOM   2208 O O   . SER A 1 296 ? -21.065 88.028  -7.752  1.00 39.35  ? 293 SER A O   1 
ATOM   2209 C CB  . SER A 1 296 ? -19.250 86.036  -9.837  1.00 46.68  ? 293 SER A CB  1 
ATOM   2210 O OG  . SER A 1 296 ? -20.573 85.606  -10.110 1.00 42.46  ? 293 SER A OG  1 
ATOM   2211 N N   . VAL A 1 297 ? -19.634 88.954  -9.236  1.00 34.10  ? 294 VAL A N   1 
ATOM   2212 C CA  . VAL A 1 297 ? -20.454 90.109  -9.566  1.00 30.24  ? 294 VAL A CA  1 
ATOM   2213 C C   . VAL A 1 297 ? -20.600 90.152  -11.082 1.00 29.44  ? 294 VAL A C   1 
ATOM   2214 O O   . VAL A 1 297 ? -19.786 89.597  -11.824 1.00 31.07  ? 294 VAL A O   1 
ATOM   2215 C CB  . VAL A 1 297 ? -19.866 91.432  -9.033  1.00 29.46  ? 294 VAL A CB  1 
ATOM   2216 C CG1 . VAL A 1 297 ? -19.775 91.400  -7.514  1.00 27.50  ? 294 VAL A CG1 1 
ATOM   2217 C CG2 . VAL A 1 297 ? -18.501 91.697  -9.650  1.00 29.18  ? 294 VAL A CG2 1 
ATOM   2218 N N   . PHE A 1 298 ? -21.668 90.811  -11.533 1.00 35.01  ? 295 PHE A N   1 
ATOM   2219 C CA  . PHE A 1 298 ? -21.974 90.945  -12.959 1.00 29.25  ? 295 PHE A CA  1 
ATOM   2220 C C   . PHE A 1 298 ? -22.176 89.579  -13.614 1.00 27.18  ? 295 PHE A C   1 
ATOM   2221 O O   . PHE A 1 298 ? -21.794 89.356  -14.764 1.00 27.27  ? 295 PHE A O   1 
ATOM   2222 C CB  . PHE A 1 298 ? -20.891 91.750  -13.683 1.00 29.34  ? 295 PHE A CB  1 
ATOM   2223 C CG  . PHE A 1 298 ? -21.426 92.690  -14.726 1.00 29.37  ? 295 PHE A CG  1 
ATOM   2224 C CD1 . PHE A 1 298 ? -22.395 92.275  -15.623 1.00 25.57  ? 295 PHE A CD1 1 
ATOM   2225 C CD2 . PHE A 1 298 ? -20.965 93.994  -14.801 1.00 25.82  ? 295 PHE A CD2 1 
ATOM   2226 C CE1 . PHE A 1 298 ? -22.886 93.139  -16.581 1.00 25.69  ? 295 PHE A CE1 1 
ATOM   2227 C CE2 . PHE A 1 298 ? -21.453 94.862  -15.758 1.00 28.77  ? 295 PHE A CE2 1 
ATOM   2228 C CZ  . PHE A 1 298 ? -22.416 94.434  -16.648 1.00 28.01  ? 295 PHE A CZ  1 
ATOM   2229 N N   . ARG A 1 299 ? -22.778 88.653  -12.868 1.00 23.51  ? 296 ARG A N   1 
ATOM   2230 C CA  . ARG A 1 299 ? -23.142 87.336  -13.372 1.00 25.97  ? 296 ARG A CA  1 
ATOM   2231 C C   . ARG A 1 299 ? -24.575 87.032  -12.965 1.00 32.26  ? 296 ARG A C   1 
ATOM   2232 O O   . ARG A 1 299 ? -24.991 87.347  -11.846 1.00 28.44  ? 296 ARG A O   1 
ATOM   2233 C CB  . ARG A 1 299 ? -22.200 86.246  -12.844 1.00 23.92  ? 296 ARG A CB  1 
ATOM   2234 C CG  . ARG A 1 299 ? -20.784 86.329  -13.390 1.00 29.57  ? 296 ARG A CG  1 
ATOM   2235 C CD  . ARG A 1 299 ? -20.765 86.173  -14.903 1.00 28.86  ? 296 ARG A CD  1 
ATOM   2236 N NE  . ARG A 1 299 ? -19.405 86.164  -15.434 1.00 33.88  ? 296 ARG A NE  1 
ATOM   2237 C CZ  . ARG A 1 299 ? -18.759 87.246  -15.856 1.00 32.51  ? 296 ARG A CZ  1 
ATOM   2238 N NH1 . ARG A 1 299 ? -19.348 88.433  -15.811 1.00 26.65  ? 296 ARG A NH1 1 
ATOM   2239 N NH2 . ARG A 1 299 ? -17.523 87.140  -16.324 1.00 31.70  ? 296 ARG A NH2 1 
ATOM   2240 N N   . PHE A 1 300 ? -25.328 86.418  -13.875 1.00 23.47  ? 297 PHE A N   1 
ATOM   2241 C CA  . PHE A 1 300 ? -26.755 86.214  -13.686 1.00 26.99  ? 297 PHE A CA  1 
ATOM   2242 C C   . PHE A 1 300 ? -27.129 84.781  -14.037 1.00 29.28  ? 297 PHE A C   1 
ATOM   2243 O O   . PHE A 1 300 ? -26.504 84.148  -14.892 1.00 36.11  ? 297 PHE A O   1 
ATOM   2244 C CB  . PHE A 1 300 ? -27.556 87.214  -14.527 1.00 18.40  ? 297 PHE A CB  1 
ATOM   2245 C CG  . PHE A 1 300 ? -27.002 88.610  -14.476 1.00 21.99  ? 297 PHE A CG  1 
ATOM   2246 C CD1 . PHE A 1 300 ? -26.296 89.130  -15.548 1.00 24.45  ? 297 PHE A CD1 1 
ATOM   2247 C CD2 . PHE A 1 300 ? -27.154 89.388  -13.340 1.00 22.80  ? 297 PHE A CD2 1 
ATOM   2248 C CE1 . PHE A 1 300 ? -25.772 90.409  -15.497 1.00 18.90  ? 297 PHE A CE1 1 
ATOM   2249 C CE2 . PHE A 1 300 ? -26.633 90.668  -13.282 1.00 17.98  ? 297 PHE A CE2 1 
ATOM   2250 C CZ  . PHE A 1 300 ? -25.941 91.179  -14.363 1.00 26.00  ? 297 PHE A CZ  1 
ATOM   2251 N N   . SER A 1 301 ? -28.166 84.281  -13.362 1.00 23.98  ? 298 SER A N   1 
ATOM   2252 C CA  . SER A 1 301 ? -28.484 82.857  -13.414 1.00 20.38  ? 298 SER A CA  1 
ATOM   2253 C C   . SER A 1 301 ? -29.070 82.460  -14.763 1.00 26.45  ? 298 SER A C   1 
ATOM   2254 O O   . SER A 1 301 ? -28.535 81.585  -15.454 1.00 26.46  ? 298 SER A O   1 
ATOM   2255 C CB  . SER A 1 301 ? -29.448 82.501  -12.281 1.00 27.17  ? 298 SER A CB  1 
ATOM   2256 O OG  . SER A 1 301 ? -28.849 82.719  -11.016 1.00 41.27  ? 298 SER A OG  1 
ATOM   2257 N N   . PHE A 1 302 ? -30.177 83.083  -15.152 1.00 19.95  ? 299 PHE A N   1 
ATOM   2258 C CA  . PHE A 1 302 ? -30.913 82.699  -16.352 1.00 26.51  ? 299 PHE A CA  1 
ATOM   2259 C C   . PHE A 1 302 ? -30.791 83.813  -17.384 1.00 27.71  ? 299 PHE A C   1 
ATOM   2260 O O   . PHE A 1 302 ? -31.426 84.866  -17.255 1.00 21.93  ? 299 PHE A O   1 
ATOM   2261 C CB  . PHE A 1 302 ? -32.369 82.395  -16.010 1.00 22.90  ? 299 PHE A CB  1 
ATOM   2262 C CG  . PHE A 1 302 ? -32.525 81.313  -14.980 1.00 25.19  ? 299 PHE A CG  1 
ATOM   2263 C CD1 . PHE A 1 302 ? -32.842 81.624  -13.668 1.00 24.99  ? 299 PHE A CD1 1 
ATOM   2264 C CD2 . PHE A 1 302 ? -32.323 79.985  -15.319 1.00 19.48  ? 299 PHE A CD2 1 
ATOM   2265 C CE1 . PHE A 1 302 ? -32.974 80.629  -12.717 1.00 26.66  ? 299 PHE A CE1 1 
ATOM   2266 C CE2 . PHE A 1 302 ? -32.452 78.986  -14.373 1.00 27.59  ? 299 PHE A CE2 1 
ATOM   2267 C CZ  . PHE A 1 302 ? -32.778 79.308  -13.071 1.00 23.73  ? 299 PHE A CZ  1 
ATOM   2268 N N   . VAL A 1 303 ? -29.972 83.572  -18.402 1.00 22.07  ? 300 VAL A N   1 
ATOM   2269 C CA  . VAL A 1 303 ? -29.690 84.538  -19.461 1.00 18.66  ? 300 VAL A CA  1 
ATOM   2270 C C   . VAL A 1 303 ? -29.984 83.858  -20.794 1.00 27.01  ? 300 VAL A C   1 
ATOM   2271 O O   . VAL A 1 303 ? -30.249 82.646  -20.811 1.00 16.63  ? 300 VAL A O   1 
ATOM   2272 C CB  . VAL A 1 303 ? -28.238 85.037  -19.376 1.00 28.78  ? 300 VAL A CB  1 
ATOM   2273 C CG1 . VAL A 1 303 ? -27.997 85.751  -18.056 1.00 20.53  ? 300 VAL A CG1 1 
ATOM   2274 C CG2 . VAL A 1 303 ? -27.270 83.877  -19.545 1.00 18.15  ? 300 VAL A CG2 1 
ATOM   2275 N N   . PRO A 1 304 ? -29.982 84.578  -21.919 1.00 21.54  ? 301 PRO A N   1 
ATOM   2276 C CA  . PRO A 1 304 ? -30.157 83.914  -23.216 1.00 21.26  ? 301 PRO A CA  1 
ATOM   2277 C C   . PRO A 1 304 ? -29.172 82.768  -23.409 1.00 30.34  ? 301 PRO A C   1 
ATOM   2278 O O   . PRO A 1 304 ? -28.012 82.841  -22.998 1.00 29.88  ? 301 PRO A O   1 
ATOM   2279 C CB  . PRO A 1 304 ? -29.914 85.043  -24.220 1.00 21.22  ? 301 PRO A CB  1 
ATOM   2280 C CG  . PRO A 1 304 ? -30.384 86.255  -23.507 1.00 24.50  ? 301 PRO A CG  1 
ATOM   2281 C CD  . PRO A 1 304 ? -30.052 86.046  -22.050 1.00 19.13  ? 301 PRO A CD  1 
ATOM   2282 N N   . VAL A 1 305 ? -29.652 81.696  -24.036 1.00 23.81  ? 302 VAL A N   1 
ATOM   2283 C CA  . VAL A 1 305 ? -28.880 80.475  -24.230 1.00 29.33  ? 302 VAL A CA  1 
ATOM   2284 C C   . VAL A 1 305 ? -28.528 80.345  -25.706 1.00 36.40  ? 302 VAL A C   1 
ATOM   2285 O O   . VAL A 1 305 ? -29.323 80.709  -26.581 1.00 31.71  ? 302 VAL A O   1 
ATOM   2286 C CB  . VAL A 1 305 ? -29.655 79.239  -23.725 1.00 25.30  ? 302 VAL A CB  1 
ATOM   2287 C CG1 . VAL A 1 305 ? -30.964 79.068  -24.488 1.00 31.92  ? 302 VAL A CG1 1 
ATOM   2288 C CG2 . VAL A 1 305 ? -28.799 77.982  -23.816 1.00 34.53  ? 302 VAL A CG2 1 
ATOM   2289 N N   . VAL A 1 306 ? -27.325 79.844  -25.980 1.00 35.26  ? 303 VAL A N   1 
ATOM   2290 C CA  . VAL A 1 306 ? -26.873 79.595  -27.351 1.00 42.18  ? 303 VAL A CA  1 
ATOM   2291 C C   . VAL A 1 306 ? -27.375 78.200  -27.714 1.00 40.24  ? 303 VAL A C   1 
ATOM   2292 O O   . VAL A 1 306 ? -26.710 77.191  -27.479 1.00 39.83  ? 303 VAL A O   1 
ATOM   2293 C CB  . VAL A 1 306 ? -25.359 79.728  -27.489 1.00 45.31  ? 303 VAL A CB  1 
ATOM   2294 C CG1 . VAL A 1 306 ? -24.943 79.563  -28.943 1.00 35.11  ? 303 VAL A CG1 1 
ATOM   2295 C CG2 . VAL A 1 306 ? -24.894 81.070  -26.942 1.00 38.49  ? 303 VAL A CG2 1 
ATOM   2296 N N   . ASP A 1 307 ? -28.571 78.147  -28.301 1.00 39.17  ? 304 ASP A N   1 
ATOM   2297 C CA  . ASP A 1 307 ? -29.247 76.888  -28.575 1.00 50.19  ? 304 ASP A CA  1 
ATOM   2298 C C   . ASP A 1 307 ? -29.260 76.500  -30.046 1.00 52.99  ? 304 ASP A C   1 
ATOM   2299 O O   . ASP A 1 307 ? -29.619 75.361  -30.362 1.00 48.18  ? 304 ASP A O   1 
ATOM   2300 C CB  . ASP A 1 307 ? -30.696 76.949  -28.067 1.00 41.61  ? 304 ASP A CB  1 
ATOM   2301 C CG  . ASP A 1 307 ? -31.458 78.141  -28.620 1.00 56.21  ? 304 ASP A CG  1 
ATOM   2302 O OD1 . ASP A 1 307 ? -30.826 79.008  -29.261 1.00 50.98  ? 304 ASP A OD1 1 
ATOM   2303 O OD2 . ASP A 1 307 ? -32.688 78.210  -28.416 1.00 66.09  ? 304 ASP A OD2 1 
ATOM   2304 N N   . GLY A 1 308 ? -28.881 77.402  -30.948 1.00 55.13  ? 305 GLY A N   1 
ATOM   2305 C CA  . GLY A 1 308 ? -29.010 77.154  -32.367 1.00 51.86  ? 305 GLY A CA  1 
ATOM   2306 C C   . GLY A 1 308 ? -30.338 77.568  -32.960 1.00 47.63  ? 305 GLY A C   1 
ATOM   2307 O O   . GLY A 1 308 ? -30.524 77.435  -34.176 1.00 57.80  ? 305 GLY A O   1 
ATOM   2308 N N   . ASP A 1 309 ? -31.267 78.063  -32.141 1.00 52.10  ? 306 ASP A N   1 
ATOM   2309 C CA  . ASP A 1 309 ? -32.572 78.502  -32.617 1.00 45.62  ? 306 ASP A CA  1 
ATOM   2310 C C   . ASP A 1 309 ? -32.587 80.016  -32.791 1.00 49.26  ? 306 ASP A C   1 
ATOM   2311 O O   . ASP A 1 309 ? -32.378 80.523  -33.898 1.00 47.60  ? 306 ASP A O   1 
ATOM   2312 C CB  . ASP A 1 309 ? -33.669 78.069  -31.642 1.00 50.90  ? 306 ASP A CB  1 
ATOM   2313 C CG  . ASP A 1 309 ? -35.040 78.027  -32.287 1.00 57.31  ? 306 ASP A CG  1 
ATOM   2314 O OD1 . ASP A 1 309 ? -35.639 76.932  -32.336 1.00 80.16  ? 306 ASP A OD1 1 
ATOM   2315 O OD2 . ASP A 1 309 ? -35.512 79.083  -32.758 1.00 56.31  ? 306 ASP A OD2 1 
ATOM   2316 N N   . PHE A 1 310 ? -32.841 80.742  -31.698 1.00 41.17  ? 307 PHE A N   1 
ATOM   2317 C CA  . PHE A 1 310 ? -32.801 82.200  -31.746 1.00 35.53  ? 307 PHE A CA  1 
ATOM   2318 C C   . PHE A 1 310 ? -31.412 82.695  -32.126 1.00 34.23  ? 307 PHE A C   1 
ATOM   2319 O O   . PHE A 1 310 ? -31.272 83.691  -32.846 1.00 39.91  ? 307 PHE A O   1 
ATOM   2320 C CB  . PHE A 1 310 ? -33.229 82.777  -30.394 1.00 31.21  ? 307 PHE A CB  1 
ATOM   2321 C CG  . PHE A 1 310 ? -33.537 84.249  -30.424 1.00 28.34  ? 307 PHE A CG  1 
ATOM   2322 C CD1 . PHE A 1 310 ? -32.523 85.189  -30.339 1.00 23.21  ? 307 PHE A CD1 1 
ATOM   2323 C CD2 . PHE A 1 310 ? -34.846 84.692  -30.518 1.00 26.76  ? 307 PHE A CD2 1 
ATOM   2324 C CE1 . PHE A 1 310 ? -32.806 86.542  -30.362 1.00 28.31  ? 307 PHE A CE1 1 
ATOM   2325 C CE2 . PHE A 1 310 ? -35.136 86.044  -30.538 1.00 32.94  ? 307 PHE A CE2 1 
ATOM   2326 C CZ  . PHE A 1 310 ? -34.114 86.970  -30.461 1.00 28.19  ? 307 PHE A CZ  1 
ATOM   2327 N N   . LEU A 1 311 ? -30.374 82.013  -31.650 1.00 47.59  ? 308 LEU A N   1 
ATOM   2328 C CA  . LEU A 1 311 ? -28.985 82.324  -31.978 1.00 44.99  ? 308 LEU A CA  1 
ATOM   2329 C C   . LEU A 1 311 ? -28.375 81.071  -32.598 1.00 47.66  ? 308 LEU A C   1 
ATOM   2330 O O   . LEU A 1 311 ? -28.036 80.123  -31.884 1.00 42.55  ? 308 LEU A O   1 
ATOM   2331 C CB  . LEU A 1 311 ? -28.213 82.768  -30.738 1.00 34.74  ? 308 LEU A CB  1 
ATOM   2332 C CG  . LEU A 1 311 ? -28.701 84.038  -30.038 1.00 42.55  ? 308 LEU A CG  1 
ATOM   2333 C CD1 . LEU A 1 311 ? -28.010 84.206  -28.694 1.00 39.44  ? 308 LEU A CD1 1 
ATOM   2334 C CD2 . LEU A 1 311 ? -28.467 85.257  -30.917 1.00 34.64  ? 308 LEU A CD2 1 
ATOM   2335 N N   . SER A 1 312 ? -28.239 81.068  -33.928 1.00 48.76  ? 309 SER A N   1 
ATOM   2336 C CA  . SER A 1 312 ? -27.695 79.906  -34.623 1.00 48.46  ? 309 SER A CA  1 
ATOM   2337 C C   . SER A 1 312 ? -26.263 79.599  -34.205 1.00 53.17  ? 309 SER A C   1 
ATOM   2338 O O   . SER A 1 312 ? -25.808 78.462  -34.375 1.00 51.88  ? 309 SER A O   1 
ATOM   2339 C CB  . SER A 1 312 ? -27.760 80.121  -36.136 1.00 48.54  ? 309 SER A CB  1 
ATOM   2340 O OG  . SER A 1 312 ? -27.019 81.266  -36.520 1.00 47.33  ? 309 SER A OG  1 
ATOM   2341 N N   . ASP A 1 313 ? -25.546 80.582  -33.668 1.00 55.45  ? 310 ASP A N   1 
ATOM   2342 C CA  . ASP A 1 313 ? -24.200 80.380  -33.157 1.00 49.79  ? 310 ASP A CA  1 
ATOM   2343 C C   . ASP A 1 313 ? -23.988 81.355  -32.005 1.00 45.05  ? 310 ASP A C   1 
ATOM   2344 O O   . ASP A 1 313 ? -24.901 82.087  -31.612 1.00 44.95  ? 310 ASP A O   1 
ATOM   2345 C CB  . ASP A 1 313 ? -23.157 80.567  -34.265 1.00 49.00  ? 310 ASP A CB  1 
ATOM   2346 C CG  . ASP A 1 313 ? -21.864 79.826  -33.983 1.00 54.14  ? 310 ASP A CG  1 
ATOM   2347 O OD1 . ASP A 1 313 ? -21.604 79.503  -32.805 1.00 59.44  ? 310 ASP A OD1 1 
ATOM   2348 O OD2 . ASP A 1 313 ? -21.105 79.568  -34.942 1.00 66.47  ? 310 ASP A OD2 1 
ATOM   2349 N N   . THR A 1 314 ? -22.776 81.357  -31.458 1.00 40.73  ? 311 THR A N   1 
ATOM   2350 C CA  . THR A 1 314 ? -22.448 82.303  -30.406 1.00 39.86  ? 311 THR A CA  1 
ATOM   2351 C C   . THR A 1 314 ? -22.529 83.728  -30.952 1.00 38.41  ? 311 THR A C   1 
ATOM   2352 O O   . THR A 1 314 ? -22.310 83.956  -32.146 1.00 46.73  ? 311 THR A O   1 
ATOM   2353 C CB  . THR A 1 314 ? -21.048 82.038  -29.855 1.00 42.95  ? 311 THR A CB  1 
ATOM   2354 O OG1 . THR A 1 314 ? -20.070 82.401  -30.838 1.00 41.84  ? 311 THR A OG1 1 
ATOM   2355 C CG2 . THR A 1 314 ? -20.885 80.567  -29.505 1.00 43.73  ? 311 THR A CG2 1 
ATOM   2356 N N   . PRO A 1 315 ? -22.862 84.706  -30.106 1.00 38.00  ? 312 PRO A N   1 
ATOM   2357 C CA  . PRO A 1 315 ? -22.870 86.099  -30.578 1.00 37.18  ? 312 PRO A CA  1 
ATOM   2358 C C   . PRO A 1 315 ? -21.537 86.546  -31.147 1.00 35.57  ? 312 PRO A C   1 
ATOM   2359 O O   . PRO A 1 315 ? -21.516 87.344  -32.091 1.00 43.26  ? 312 PRO A O   1 
ATOM   2360 C CB  . PRO A 1 315 ? -23.245 86.891  -29.318 1.00 33.92  ? 312 PRO A CB  1 
ATOM   2361 C CG  . PRO A 1 315 ? -24.011 85.923  -28.488 1.00 35.98  ? 312 PRO A CG  1 
ATOM   2362 C CD  . PRO A 1 315 ? -23.367 84.586  -28.727 1.00 38.93  ? 312 PRO A CD  1 
ATOM   2363 N N   . GLU A 1 316 ? -20.421 86.046  -30.610 1.00 47.34  ? 313 GLU A N   1 
ATOM   2364 C CA  . GLU A 1 316 ? -19.116 86.405  -31.155 1.00 45.56  ? 313 GLU A CA  1 
ATOM   2365 C C   . GLU A 1 316 ? -18.963 85.909  -32.588 1.00 38.86  ? 313 GLU A C   1 
ATOM   2366 O O   . GLU A 1 316 ? -18.441 86.627  -33.449 1.00 40.67  ? 313 GLU A O   1 
ATOM   2367 C CB  . GLU A 1 316 ? -18.005 85.838  -30.271 1.00 38.54  ? 313 GLU A CB  1 
ATOM   2368 C CG  . GLU A 1 316 ? -16.612 86.323  -30.640 1.00 54.02  ? 313 GLU A CG  1 
ATOM   2369 C CD  . GLU A 1 316 ? -15.521 85.594  -29.882 1.00 64.49  ? 313 GLU A CD  1 
ATOM   2370 O OE1 . GLU A 1 316 ? -15.573 84.348  -29.814 1.00 58.75  ? 313 GLU A OE1 1 
ATOM   2371 O OE2 . GLU A 1 316 ? -14.615 86.268  -29.348 1.00 80.97  ? 313 GLU A OE2 1 
ATOM   2372 N N   . ALA A 1 317 ? -19.418 84.684  -32.863 1.00 36.25  ? 314 ALA A N   1 
ATOM   2373 C CA  . ALA A 1 317 ? -19.300 84.138  -34.211 1.00 36.19  ? 314 ALA A CA  1 
ATOM   2374 C C   . ALA A 1 317 ? -20.215 84.867  -35.188 1.00 46.43  ? 314 ALA A C   1 
ATOM   2375 O O   . ALA A 1 317 ? -19.821 85.146  -36.326 1.00 46.91  ? 314 ALA A O   1 
ATOM   2376 C CB  . ALA A 1 317 ? -19.608 82.642  -34.199 1.00 36.92  ? 314 ALA A CB  1 
ATOM   2377 N N   . LEU A 1 318 ? -21.440 85.185  -34.762 1.00 44.69  ? 315 LEU A N   1 
ATOM   2378 C CA  . LEU A 1 318 ? -22.376 85.869  -35.648 1.00 37.72  ? 315 LEU A CA  1 
ATOM   2379 C C   . LEU A 1 318 ? -21.943 87.302  -35.930 1.00 34.96  ? 315 LEU A C   1 
ATOM   2380 O O   . LEU A 1 318 ? -22.230 87.832  -37.009 1.00 38.81  ? 315 LEU A O   1 
ATOM   2381 C CB  . LEU A 1 318 ? -23.781 85.844  -35.046 1.00 35.69  ? 315 LEU A CB  1 
ATOM   2382 C CG  . LEU A 1 318 ? -24.400 84.461  -34.830 1.00 38.86  ? 315 LEU A CG  1 
ATOM   2383 C CD1 . LEU A 1 318 ? -25.747 84.576  -34.133 1.00 35.92  ? 315 LEU A CD1 1 
ATOM   2384 C CD2 . LEU A 1 318 ? -24.540 83.721  -36.152 1.00 34.31  ? 315 LEU A CD2 1 
ATOM   2385 N N   . ILE A 1 319 ? -21.258 87.942  -34.980 1.00 35.69  ? 316 ILE A N   1 
ATOM   2386 C CA  . ILE A 1 319 ? -20.782 89.304  -35.201 1.00 35.33  ? 316 ILE A CA  1 
ATOM   2387 C C   . ILE A 1 319 ? -19.627 89.313  -36.196 1.00 43.53  ? 316 ILE A C   1 
ATOM   2388 O O   . ILE A 1 319 ? -19.546 90.187  -37.067 1.00 50.59  ? 316 ILE A O   1 
ATOM   2389 C CB  . ILE A 1 319 ? -20.387 89.953  -33.860 1.00 37.17  ? 316 ILE A CB  1 
ATOM   2390 C CG1 . ILE A 1 319 ? -21.632 90.272  -33.031 1.00 35.94  ? 316 ILE A CG1 1 
ATOM   2391 C CG2 . ILE A 1 319 ? -19.571 91.216  -34.087 1.00 32.51  ? 316 ILE A CG2 1 
ATOM   2392 C CD1 . ILE A 1 319 ? -21.332 90.591  -31.581 1.00 32.13  ? 316 ILE A CD1 1 
ATOM   2393 N N   . ASN A 1 320 ? -18.723 88.335  -36.092 1.00 38.10  ? 317 ASN A N   1 
ATOM   2394 C CA  . ASN A 1 320 ? -17.567 88.300  -36.984 1.00 39.72  ? 317 ASN A CA  1 
ATOM   2395 C C   . ASN A 1 320 ? -17.975 87.970  -38.415 1.00 41.73  ? 317 ASN A C   1 
ATOM   2396 O O   . ASN A 1 320 ? -17.494 88.600  -39.363 1.00 44.69  ? 317 ASN A O   1 
ATOM   2397 C CB  . ASN A 1 320 ? -16.541 87.288  -36.474 1.00 37.14  ? 317 ASN A CB  1 
ATOM   2398 C CG  . ASN A 1 320 ? -15.990 87.653  -35.110 1.00 34.32  ? 317 ASN A CG  1 
ATOM   2399 O OD1 . ASN A 1 320 ? -15.973 88.823  -34.726 1.00 38.31  ? 317 ASN A OD1 1 
ATOM   2400 N ND2 . ASN A 1 320 ? -15.533 86.649  -34.369 1.00 38.27  ? 317 ASN A ND2 1 
ATOM   2401 N N   . ALA A 1 321 ? -18.859 86.990  -38.592 1.00 40.17  ? 318 ALA A N   1 
ATOM   2402 C CA  . ALA A 1 321 ? -19.284 86.535  -39.914 1.00 38.50  ? 318 ALA A CA  1 
ATOM   2403 C C   . ALA A 1 321 ? -20.616 87.145  -40.330 1.00 49.91  ? 318 ALA A C   1 
ATOM   2404 O O   . ALA A 1 321 ? -21.461 86.466  -40.920 1.00 60.44  ? 318 ALA A O   1 
ATOM   2405 C CB  . ALA A 1 321 ? -19.360 85.012  -39.948 1.00 40.03  ? 318 ALA A CB  1 
ATOM   2406 N N   . GLY A 1 322 ? -20.828 88.421  -40.045 1.00 42.86  ? 319 GLY A N   1 
ATOM   2407 C CA  . GLY A 1 322 ? -22.085 89.087  -40.351 1.00 39.73  ? 319 GLY A CA  1 
ATOM   2408 C C   . GLY A 1 322 ? -21.877 90.295  -41.242 1.00 45.28  ? 319 GLY A C   1 
ATOM   2409 O O   . GLY A 1 322 ? -20.896 91.026  -41.091 1.00 41.69  ? 319 GLY A O   1 
ATOM   2410 N N   . ASP A 1 323 ? -22.807 90.496  -42.173 1.00 45.34  ? 320 ASP A N   1 
ATOM   2411 C CA  . ASP A 1 323 ? -22.812 91.658  -43.051 1.00 40.57  ? 320 ASP A CA  1 
ATOM   2412 C C   . ASP A 1 323 ? -23.832 92.657  -42.519 1.00 40.82  ? 320 ASP A C   1 
ATOM   2413 O O   . ASP A 1 323 ? -25.020 92.336  -42.404 1.00 50.27  ? 320 ASP A O   1 
ATOM   2414 C CB  . ASP A 1 323 ? -23.141 91.254  -44.489 1.00 47.96  ? 320 ASP A CB  1 
ATOM   2415 C CG  . ASP A 1 323 ? -22.971 92.398  -45.476 1.00 57.84  ? 320 ASP A CG  1 
ATOM   2416 O OD1 . ASP A 1 323 ? -23.653 93.434  -45.327 1.00 52.74  ? 320 ASP A OD1 1 
ATOM   2417 O OD2 . ASP A 1 323 ? -22.147 92.261  -46.404 1.00 70.41  ? 320 ASP A OD2 1 
ATOM   2418 N N   . PHE A 1 324 ? -23.368 93.864  -42.197 1.00 42.47  ? 321 PHE A N   1 
ATOM   2419 C CA  . PHE A 1 324 ? -24.205 94.883  -41.575 1.00 44.91  ? 321 PHE A CA  1 
ATOM   2420 C C   . PHE A 1 324 ? -24.351 96.117  -42.460 1.00 47.90  ? 321 PHE A C   1 
ATOM   2421 O O   . PHE A 1 324 ? -24.540 97.227  -41.959 1.00 40.36  ? 321 PHE A O   1 
ATOM   2422 C CB  . PHE A 1 324 ? -23.648 95.269  -40.205 1.00 42.34  ? 321 PHE A CB  1 
ATOM   2423 C CG  . PHE A 1 324 ? -23.425 94.099  -39.290 1.00 41.53  ? 321 PHE A CG  1 
ATOM   2424 C CD1 . PHE A 1 324 ? -24.476 93.557  -38.569 1.00 45.06  ? 321 PHE A CD1 1 
ATOM   2425 C CD2 . PHE A 1 324 ? -22.164 93.543  -39.149 1.00 44.70  ? 321 PHE A CD2 1 
ATOM   2426 C CE1 . PHE A 1 324 ? -24.274 92.480  -37.726 1.00 49.38  ? 321 PHE A CE1 1 
ATOM   2427 C CE2 . PHE A 1 324 ? -21.955 92.467  -38.306 1.00 39.17  ? 321 PHE A CE2 1 
ATOM   2428 C CZ  . PHE A 1 324 ? -23.012 91.935  -37.594 1.00 44.08  ? 321 PHE A CZ  1 
ATOM   2429 N N   . HIS A 1 325 ? -24.268 95.939  -43.776 1.00 55.89  ? 322 HIS A N   1 
ATOM   2430 C CA  . HIS A 1 325 ? -24.446 97.059  -44.690 1.00 54.32  ? 322 HIS A CA  1 
ATOM   2431 C C   . HIS A 1 325 ? -25.880 97.572  -44.632 1.00 47.42  ? 322 HIS A C   1 
ATOM   2432 O O   . HIS A 1 325 ? -26.835 96.794  -44.554 1.00 42.07  ? 322 HIS A O   1 
ATOM   2433 C CB  . HIS A 1 325 ? -24.092 96.648  -46.119 1.00 55.43  ? 322 HIS A CB  1 
ATOM   2434 C CG  . HIS A 1 325 ? -22.620 96.625  -46.394 1.00 57.93  ? 322 HIS A CG  1 
ATOM   2435 N ND1 . HIS A 1 325 ? -21.835 95.516  -46.163 1.00 53.25  ? 322 HIS A ND1 1 
ATOM   2436 C CD2 . HIS A 1 325 ? -21.790 97.579  -46.878 1.00 53.08  ? 322 HIS A CD2 1 
ATOM   2437 C CE1 . HIS A 1 325 ? -20.586 95.786  -46.495 1.00 59.55  ? 322 HIS A CE1 1 
ATOM   2438 N NE2 . HIS A 1 325 ? -20.531 97.032  -46.932 1.00 57.87  ? 322 HIS A NE2 1 
ATOM   2439 N N   . GLY A 1 326 ? -26.025 98.895  -44.670 1.00 42.77  ? 323 GLY A N   1 
ATOM   2440 C CA  . GLY A 1 326 ? -27.327 99.518  -44.566 1.00 50.81  ? 323 GLY A CA  1 
ATOM   2441 C C   . GLY A 1 326 ? -27.862 99.651  -43.160 1.00 57.62  ? 323 GLY A C   1 
ATOM   2442 O O   . GLY A 1 326 ? -29.060 99.903  -42.990 1.00 45.32  ? 323 GLY A O   1 
ATOM   2443 N N   . LEU A 1 327 ? -27.014 99.493  -42.147 1.00 57.25  ? 324 LEU A N   1 
ATOM   2444 C CA  . LEU A 1 327 ? -27.417 99.559  -40.751 1.00 42.40  ? 324 LEU A CA  1 
ATOM   2445 C C   . LEU A 1 327 ? -26.674 100.687 -40.051 1.00 42.71  ? 324 LEU A C   1 
ATOM   2446 O O   . LEU A 1 327 ? -25.469 100.867 -40.252 1.00 49.89  ? 324 LEU A O   1 
ATOM   2447 C CB  . LEU A 1 327 ? -27.141 98.228  -40.040 1.00 46.40  ? 324 LEU A CB  1 
ATOM   2448 C CG  . LEU A 1 327 ? -27.217 98.210  -38.512 1.00 49.79  ? 324 LEU A CG  1 
ATOM   2449 C CD1 . LEU A 1 327 ? -28.636 98.471  -38.029 1.00 46.62  ? 324 LEU A CD1 1 
ATOM   2450 C CD2 . LEU A 1 327 ? -26.691 96.890  -37.971 1.00 38.62  ? 324 LEU A CD2 1 
ATOM   2451 N N   . GLN A 1 328 ? -27.397 101.448 -39.235 1.00 34.12  ? 325 GLN A N   1 
ATOM   2452 C CA  . GLN A 1 328 ? -26.819 102.506 -38.419 1.00 37.16  ? 325 GLN A CA  1 
ATOM   2453 C C   . GLN A 1 328 ? -26.917 102.109 -36.953 1.00 47.25  ? 325 GLN A C   1 
ATOM   2454 O O   . GLN A 1 328 ? -27.999 101.753 -36.473 1.00 39.14  ? 325 GLN A O   1 
ATOM   2455 C CB  . GLN A 1 328 ? -27.527 103.843 -38.656 1.00 36.40  ? 325 GLN A CB  1 
ATOM   2456 C CG  . GLN A 1 328 ? -27.486 104.331 -40.097 1.00 47.13  ? 325 GLN A CG  1 
ATOM   2457 C CD  . GLN A 1 328 ? -28.560 103.697 -40.960 1.00 47.22  ? 325 GLN A CD  1 
ATOM   2458 O OE1 . GLN A 1 328 ? -29.752 103.848 -40.696 1.00 55.43  ? 325 GLN A OE1 1 
ATOM   2459 N NE2 . GLN A 1 328 ? -28.140 102.975 -41.993 1.00 44.65  ? 325 GLN A NE2 1 
ATOM   2460 N N   . VAL A 1 329 ? -25.789 102.161 -36.248 1.00 36.35  ? 326 VAL A N   1 
ATOM   2461 C CA  . VAL A 1 329 ? -25.709 101.753 -34.851 1.00 30.90  ? 326 VAL A CA  1 
ATOM   2462 C C   . VAL A 1 329 ? -25.159 102.911 -34.031 1.00 37.45  ? 326 VAL A C   1 
ATOM   2463 O O   . VAL A 1 329 ? -24.272 103.643 -34.484 1.00 42.07  ? 326 VAL A O   1 
ATOM   2464 C CB  . VAL A 1 329 ? -24.830 100.497 -34.673 1.00 35.91  ? 326 VAL A CB  1 
ATOM   2465 C CG1 . VAL A 1 329 ? -24.943 99.964  -33.252 1.00 38.66  ? 326 VAL A CG1 1 
ATOM   2466 C CG2 . VAL A 1 329 ? -25.218 99.425  -35.678 1.00 39.22  ? 326 VAL A CG2 1 
ATOM   2467 N N   . LEU A 1 330 ? -25.694 103.077 -32.823 1.00 38.48  ? 327 LEU A N   1 
ATOM   2468 C CA  . LEU A 1 330 ? -25.217 104.064 -31.859 1.00 34.28  ? 327 LEU A CA  1 
ATOM   2469 C C   . LEU A 1 330 ? -24.876 103.326 -30.570 1.00 35.87  ? 327 LEU A C   1 
ATOM   2470 O O   . LEU A 1 330 ? -25.773 102.843 -29.872 1.00 40.39  ? 327 LEU A O   1 
ATOM   2471 C CB  . LEU A 1 330 ? -26.267 105.147 -31.617 1.00 27.14  ? 327 LEU A CB  1 
ATOM   2472 C CG  . LEU A 1 330 ? -25.969 106.186 -30.533 1.00 38.69  ? 327 LEU A CG  1 
ATOM   2473 C CD1 . LEU A 1 330 ? -24.688 106.942 -30.841 1.00 40.13  ? 327 LEU A CD1 1 
ATOM   2474 C CD2 . LEU A 1 330 ? -27.136 107.148 -30.381 1.00 32.95  ? 327 LEU A CD2 1 
ATOM   2475 N N   . VAL A 1 331 ? -23.585 103.228 -30.259 1.00 37.66  ? 328 VAL A N   1 
ATOM   2476 C CA  . VAL A 1 331 ? -23.124 102.527 -29.070 1.00 22.89  ? 328 VAL A CA  1 
ATOM   2477 C C   . VAL A 1 331 ? -22.429 103.521 -28.151 1.00 29.01  ? 328 VAL A C   1 
ATOM   2478 O O   . VAL A 1 331 ? -22.058 104.625 -28.552 1.00 32.06  ? 328 VAL A O   1 
ATOM   2479 C CB  . VAL A 1 331 ? -22.183 101.354 -29.413 1.00 30.62  ? 328 VAL A CB  1 
ATOM   2480 C CG1 . VAL A 1 331 ? -22.934 100.281 -30.186 1.00 27.08  ? 328 VAL A CG1 1 
ATOM   2481 C CG2 . VAL A 1 331 ? -20.989 101.854 -30.211 1.00 31.61  ? 328 VAL A CG2 1 
ATOM   2482 N N   . GLY A 1 332 ? -22.259 103.113 -26.900 1.00 27.55  ? 329 GLY A N   1 
ATOM   2483 C CA  . GLY A 1 332 ? -21.591 103.962 -25.931 1.00 29.19  ? 329 GLY A CA  1 
ATOM   2484 C C   . GLY A 1 332 ? -21.620 103.334 -24.556 1.00 28.40  ? 329 GLY A C   1 
ATOM   2485 O O   . GLY A 1 332 ? -22.306 102.336 -24.311 1.00 25.74  ? 329 GLY A O   1 
ATOM   2486 N N   . VAL A 1 333 ? -20.847 103.940 -23.656 1.00 24.93  ? 330 VAL A N   1 
ATOM   2487 C CA  . VAL A 1 333 ? -20.719 103.494 -22.275 1.00 22.30  ? 330 VAL A CA  1 
ATOM   2488 C C   . VAL A 1 333 ? -20.701 104.722 -21.373 1.00 22.55  ? 330 VAL A C   1 
ATOM   2489 O O   . VAL A 1 333 ? -20.628 105.861 -21.836 1.00 28.34  ? 330 VAL A O   1 
ATOM   2490 C CB  . VAL A 1 333 ? -19.448 102.648 -22.045 1.00 28.20  ? 330 VAL A CB  1 
ATOM   2491 C CG1 . VAL A 1 333 ? -19.510 101.350 -22.835 1.00 29.15  ? 330 VAL A CG1 1 
ATOM   2492 C CG2 . VAL A 1 333 ? -18.207 103.448 -22.415 1.00 22.62  ? 330 VAL A CG2 1 
ATOM   2493 N N   . VAL A 1 334 ? -20.766 104.478 -20.070 1.00 24.26  ? 331 VAL A N   1 
ATOM   2494 C CA  . VAL A 1 334 ? -20.613 105.528 -19.083 1.00 16.56  ? 331 VAL A CA  1 
ATOM   2495 C C   . VAL A 1 334 ? -19.165 105.539 -18.607 1.00 19.88  ? 331 VAL A C   1 
ATOM   2496 O O   . VAL A 1 334 ? -18.381 104.644 -18.910 1.00 25.02  ? 331 VAL A O   1 
ATOM   2497 C CB  . VAL A 1 334 ? -21.602 105.367 -17.902 1.00 26.81  ? 331 VAL A CB  1 
ATOM   2498 C CG1 . VAL A 1 334 ? -23.032 105.272 -18.415 1.00 26.53  ? 331 VAL A CG1 1 
ATOM   2499 C CG2 . VAL A 1 334 ? -21.242 104.155 -17.061 1.00 18.80  ? 331 VAL A CG2 1 
ATOM   2500 N N   . LYS A 1 335 ? -18.804 106.570 -17.840 1.00 21.77  ? 332 LYS A N   1 
ATOM   2501 C CA  . LYS A 1 335 ? -17.406 106.757 -17.461 1.00 29.39  ? 332 LYS A CA  1 
ATOM   2502 C C   . LYS A 1 335 ? -16.926 105.683 -16.490 1.00 33.02  ? 332 LYS A C   1 
ATOM   2503 O O   . LYS A 1 335 ? -15.763 105.268 -16.555 1.00 28.49  ? 332 LYS A O   1 
ATOM   2504 C CB  . LYS A 1 335 ? -17.216 108.149 -16.858 1.00 36.13  ? 332 LYS A CB  1 
ATOM   2505 C CG  . LYS A 1 335 ? -15.772 108.522 -16.565 1.00 33.95  ? 332 LYS A CG  1 
ATOM   2506 C CD  . LYS A 1 335 ? -15.663 109.978 -16.138 1.00 36.05  ? 332 LYS A CD  1 
ATOM   2507 C CE  . LYS A 1 335 ? -14.253 110.325 -15.683 1.00 46.56  ? 332 LYS A CE  1 
ATOM   2508 N NZ  . LYS A 1 335 ? -13.245 110.103 -16.754 1.00 55.08  ? 332 LYS A NZ  1 
ATOM   2509 N N   . ASP A 1 336 ? -17.800 105.213 -15.594 1.00 29.45  ? 333 ASP A N   1 
ATOM   2510 C CA  . ASP A 1 336 ? -17.433 104.252 -14.547 1.00 27.31  ? 333 ASP A CA  1 
ATOM   2511 C C   . ASP A 1 336 ? -18.435 103.097 -14.579 1.00 34.95  ? 333 ASP A C   1 
ATOM   2512 O O   . ASP A 1 336 ? -19.406 103.075 -13.818 1.00 33.28  ? 333 ASP A O   1 
ATOM   2513 C CB  . ASP A 1 336 ? -17.388 104.939 -13.183 1.00 33.37  ? 333 ASP A CB  1 
ATOM   2514 C CG  . ASP A 1 336 ? -16.404 106.092 -13.146 1.00 36.88  ? 333 ASP A CG  1 
ATOM   2515 O OD1 . ASP A 1 336 ? -15.202 105.856 -13.392 1.00 41.96  ? 333 ASP A OD1 1 
ATOM   2516 O OD2 . ASP A 1 336 ? -16.834 107.236 -12.891 1.00 33.72  ? 333 ASP A OD2 1 
ATOM   2517 N N   . GLU A 1 337 ? -18.177 102.122 -15.455 1.00 20.84  ? 334 GLU A N   1 
ATOM   2518 C CA  . GLU A 1 337 ? -19.137 101.046 -15.677 1.00 25.57  ? 334 GLU A CA  1 
ATOM   2519 C C   . GLU A 1 337 ? -19.164 100.062 -14.514 1.00 34.17  ? 334 GLU A C   1 
ATOM   2520 O O   . GLU A 1 337 ? -20.233 99.567  -14.140 1.00 28.16  ? 334 GLU A O   1 
ATOM   2521 C CB  . GLU A 1 337 ? -18.811 100.315 -16.980 1.00 22.68  ? 334 GLU A CB  1 
ATOM   2522 C CG  . GLU A 1 337 ? -19.182 101.077 -18.237 1.00 28.85  ? 334 GLU A CG  1 
ATOM   2523 C CD  . GLU A 1 337 ? -20.678 101.087 -18.493 1.00 33.68  ? 334 GLU A CD  1 
ATOM   2524 O OE1 . GLU A 1 337 ? -21.407 100.324 -17.823 1.00 31.90  ? 334 GLU A OE1 1 
ATOM   2525 O OE2 . GLU A 1 337 ? -21.125 101.858 -19.366 1.00 35.11  ? 334 GLU A OE2 1 
ATOM   2526 N N   . GLY A 1 338 ? -18.004 99.763  -13.931 1.00 23.74  ? 335 GLY A N   1 
ATOM   2527 C CA  . GLY A 1 338 ? -17.918 98.699  -12.950 1.00 24.41  ? 335 GLY A CA  1 
ATOM   2528 C C   . GLY A 1 338 ? -18.063 99.098  -11.493 1.00 21.23  ? 335 GLY A C   1 
ATOM   2529 O O   . GLY A 1 338 ? -18.172 98.221  -10.629 1.00 31.81  ? 335 GLY A O   1 
ATOM   2530 N N   . SER A 1 339 ? -18.071 100.399 -11.187 1.00 18.67  ? 336 SER A N   1 
ATOM   2531 C CA  . SER A 1 339 ? -18.090 100.834 -9.790  1.00 25.49  ? 336 SER A CA  1 
ATOM   2532 C C   . SER A 1 339 ? -19.376 100.427 -9.077  1.00 33.12  ? 336 SER A C   1 
ATOM   2533 O O   . SER A 1 339 ? -19.352 100.146 -7.874  1.00 32.79  ? 336 SER A O   1 
ATOM   2534 C CB  . SER A 1 339 ? -17.905 102.349 -9.704  1.00 31.50  ? 336 SER A CB  1 
ATOM   2535 O OG  . SER A 1 339 ? -18.972 103.029 -10.342 1.00 33.07  ? 336 SER A OG  1 
ATOM   2536 N N   . TYR A 1 340 ? -20.499 100.392 -9.797  1.00 34.87  ? 337 TYR A N   1 
ATOM   2537 C CA  . TYR A 1 340 ? -21.778 100.056 -9.177  1.00 26.12  ? 337 TYR A CA  1 
ATOM   2538 C C   . TYR A 1 340 ? -21.830 98.600  -8.730  1.00 29.46  ? 337 TYR A C   1 
ATOM   2539 O O   . TYR A 1 340 ? -22.457 98.289  -7.711  1.00 30.27  ? 337 TYR A O   1 
ATOM   2540 C CB  . TYR A 1 340 ? -22.912 100.365 -10.158 1.00 40.20  ? 337 TYR A CB  1 
ATOM   2541 C CG  . TYR A 1 340 ? -24.245 99.726  -9.843  1.00 34.66  ? 337 TYR A CG  1 
ATOM   2542 C CD1 . TYR A 1 340 ? -25.115 100.303 -8.931  1.00 50.15  ? 337 TYR A CD1 1 
ATOM   2543 C CD2 . TYR A 1 340 ? -24.647 98.562  -10.486 1.00 39.47  ? 337 TYR A CD2 1 
ATOM   2544 C CE1 . TYR A 1 340 ? -26.340 99.729  -8.652  1.00 52.40  ? 337 TYR A CE1 1 
ATOM   2545 C CE2 . TYR A 1 340 ? -25.869 97.980  -10.212 1.00 47.99  ? 337 TYR A CE2 1 
ATOM   2546 C CZ  . TYR A 1 340 ? -26.711 98.569  -9.294  1.00 64.12  ? 337 TYR A CZ  1 
ATOM   2547 O OH  . TYR A 1 340 ? -27.932 97.996  -9.016  1.00 66.52  ? 337 TYR A OH  1 
ATOM   2548 N N   . PHE A 1 341 ? -21.177 97.701  -9.464  1.00 27.89  ? 338 PHE A N   1 
ATOM   2549 C CA  . PHE A 1 341 ? -21.261 96.275  -9.179  1.00 30.17  ? 338 PHE A CA  1 
ATOM   2550 C C   . PHE A 1 341 ? -20.301 95.821  -8.088  1.00 30.62  ? 338 PHE A C   1 
ATOM   2551 O O   . PHE A 1 341 ? -20.376 94.662  -7.667  1.00 27.62  ? 338 PHE A O   1 
ATOM   2552 C CB  . PHE A 1 341 ? -21.002 95.476  -10.459 1.00 25.88  ? 338 PHE A CB  1 
ATOM   2553 C CG  . PHE A 1 341 ? -21.923 95.836  -11.590 1.00 32.17  ? 338 PHE A CG  1 
ATOM   2554 C CD1 . PHE A 1 341 ? -21.592 96.849  -12.476 1.00 29.98  ? 338 PHE A CD1 1 
ATOM   2555 C CD2 . PHE A 1 341 ? -23.122 95.166  -11.764 1.00 39.09  ? 338 PHE A CD2 1 
ATOM   2556 C CE1 . PHE A 1 341 ? -22.440 97.186  -13.513 1.00 35.03  ? 338 PHE A CE1 1 
ATOM   2557 C CE2 . PHE A 1 341 ? -23.974 95.496  -12.802 1.00 37.64  ? 338 PHE A CE2 1 
ATOM   2558 C CZ  . PHE A 1 341 ? -23.632 96.508  -13.677 1.00 33.29  ? 338 PHE A CZ  1 
ATOM   2559 N N   . LEU A 1 342 ? -19.414 96.698  -7.614  1.00 20.61  ? 339 LEU A N   1 
ATOM   2560 C CA  . LEU A 1 342 ? -18.423 96.288  -6.626  1.00 28.74  ? 339 LEU A CA  1 
ATOM   2561 C C   . LEU A 1 342 ? -19.025 96.111  -5.238  1.00 28.84  ? 339 LEU A C   1 
ATOM   2562 O O   . LEU A 1 342 ? -18.523 95.301  -4.451  1.00 23.75  ? 339 LEU A O   1 
ATOM   2563 C CB  . LEU A 1 342 ? -17.277 97.300  -6.583  1.00 24.06  ? 339 LEU A CB  1 
ATOM   2564 C CG  . LEU A 1 342 ? -16.518 97.454  -7.903  1.00 31.06  ? 339 LEU A CG  1 
ATOM   2565 C CD1 . LEU A 1 342 ? -15.343 98.407  -7.757  1.00 21.19  ? 339 LEU A CD1 1 
ATOM   2566 C CD2 . LEU A 1 342 ? -16.055 96.099  -8.415  1.00 27.30  ? 339 LEU A CD2 1 
ATOM   2567 N N   . VAL A 1 343 ? -20.098 96.843  -4.916  1.00 25.90  ? 340 VAL A N   1 
ATOM   2568 C CA  . VAL A 1 343 ? -20.747 96.688  -3.615  1.00 24.92  ? 340 VAL A CA  1 
ATOM   2569 C C   . VAL A 1 343 ? -21.602 95.435  -3.529  1.00 25.82  ? 340 VAL A C   1 
ATOM   2570 O O   . VAL A 1 343 ? -22.255 95.215  -2.501  1.00 25.19  ? 340 VAL A O   1 
ATOM   2571 C CB  . VAL A 1 343 ? -21.625 97.909  -3.272  1.00 30.73  ? 340 VAL A CB  1 
ATOM   2572 C CG1 . VAL A 1 343 ? -20.760 99.142  -3.066  1.00 29.98  ? 340 VAL A CG1 1 
ATOM   2573 C CG2 . VAL A 1 343 ? -22.654 98.146  -4.367  1.00 28.11  ? 340 VAL A CG2 1 
ATOM   2574 N N   . TYR A 1 344 ? -21.614 94.602  -4.571  1.00 21.47  ? 341 TYR A N   1 
ATOM   2575 C CA  . TYR A 1 344 ? -22.423 93.391  -4.602  1.00 28.46  ? 341 TYR A CA  1 
ATOM   2576 C C   . TYR A 1 344 ? -21.589 92.121  -4.461  1.00 29.01  ? 341 TYR A C   1 
ATOM   2577 O O   . TYR A 1 344 ? -22.026 91.049  -4.892  1.00 37.33  ? 341 TYR A O   1 
ATOM   2578 C CB  . TYR A 1 344 ? -23.244 93.336  -5.891  1.00 32.79  ? 341 TYR A CB  1 
ATOM   2579 C CG  . TYR A 1 344 ? -24.472 94.217  -5.883  1.00 27.61  ? 341 TYR A CG  1 
ATOM   2580 C CD1 . TYR A 1 344 ? -25.708 93.713  -5.497  1.00 30.08  ? 341 TYR A CD1 1 
ATOM   2581 C CD2 . TYR A 1 344 ? -24.398 95.550  -6.265  1.00 30.73  ? 341 TYR A CD2 1 
ATOM   2582 C CE1 . TYR A 1 344 ? -26.835 94.513  -5.491  1.00 36.29  ? 341 TYR A CE1 1 
ATOM   2583 C CE2 . TYR A 1 344 ? -25.520 96.358  -6.261  1.00 41.50  ? 341 TYR A CE2 1 
ATOM   2584 C CZ  . TYR A 1 344 ? -26.735 95.834  -5.872  1.00 32.27  ? 341 TYR A CZ  1 
ATOM   2585 O OH  . TYR A 1 344 ? -27.855 96.634  -5.866  1.00 38.65  ? 341 TYR A OH  1 
ATOM   2586 N N   . GLY A 1 345 ? -20.399 92.212  -3.871  1.00 30.96  ? 342 GLY A N   1 
ATOM   2587 C CA  . GLY A 1 345 ? -19.604 91.016  -3.665  1.00 27.89  ? 342 GLY A CA  1 
ATOM   2588 C C   . GLY A 1 345 ? -18.114 91.233  -3.493  1.00 34.75  ? 342 GLY A C   1 
ATOM   2589 O O   . GLY A 1 345 ? -17.427 90.379  -2.926  1.00 35.55  ? 342 GLY A O   1 
ATOM   2590 N N   . ALA A 1 346 ? -17.598 92.355  -3.978  1.00 25.43  ? 343 ALA A N   1 
ATOM   2591 C CA  . ALA A 1 346 ? -16.169 92.617  -3.859  1.00 28.99  ? 343 ALA A CA  1 
ATOM   2592 C C   . ALA A 1 346 ? -15.823 92.946  -2.411  1.00 28.86  ? 343 ALA A C   1 
ATOM   2593 O O   . ALA A 1 346 ? -16.470 93.809  -1.805  1.00 32.64  ? 343 ALA A O   1 
ATOM   2594 C CB  . ALA A 1 346 ? -15.749 93.758  -4.782  1.00 20.47  ? 343 ALA A CB  1 
ATOM   2595 N N   . PRO A 1 347 ? -14.822 92.291  -1.824  1.00 32.54  ? 344 PRO A N   1 
ATOM   2596 C CA  . PRO A 1 347 ? -14.529 92.516  -0.403  1.00 24.81  ? 344 PRO A CA  1 
ATOM   2597 C C   . PRO A 1 347 ? -13.947 93.899  -0.155  1.00 32.27  ? 344 PRO A C   1 
ATOM   2598 O O   . PRO A 1 347 ? -13.173 94.425  -0.959  1.00 28.01  ? 344 PRO A O   1 
ATOM   2599 C CB  . PRO A 1 347 ? -13.514 91.415  -0.073  1.00 28.89  ? 344 PRO A CB  1 
ATOM   2600 C CG  . PRO A 1 347 ? -12.863 91.107  -1.380  1.00 35.66  ? 344 PRO A CG  1 
ATOM   2601 C CD  . PRO A 1 347 ? -13.933 91.280  -2.423  1.00 32.07  ? 344 PRO A CD  1 
ATOM   2602 N N   . GLY A 1 348 ? -14.332 94.485  0.977   1.00 28.65  ? 345 GLY A N   1 
ATOM   2603 C CA  . GLY A 1 348 ? -13.856 95.792  1.373   1.00 24.11  ? 345 GLY A CA  1 
ATOM   2604 C C   . GLY A 1 348 ? -14.630 96.962  0.807   1.00 31.26  ? 345 GLY A C   1 
ATOM   2605 O O   . GLY A 1 348 ? -14.263 98.113  1.077   1.00 25.38  ? 345 GLY A O   1 
ATOM   2606 N N   . PHE A 1 349 ? -15.687 96.714  0.040   1.00 28.04  ? 346 PHE A N   1 
ATOM   2607 C CA  . PHE A 1 349 ? -16.450 97.774  -0.601  1.00 29.13  ? 346 PHE A CA  1 
ATOM   2608 C C   . PHE A 1 349 ? -17.748 98.038  0.150   1.00 28.94  ? 346 PHE A C   1 
ATOM   2609 O O   . PHE A 1 349 ? -18.378 97.115  0.677   1.00 31.41  ? 346 PHE A O   1 
ATOM   2610 C CB  . PHE A 1 349 ? -16.753 97.424  -2.059  1.00 27.52  ? 346 PHE A CB  1 
ATOM   2611 C CG  . PHE A 1 349 ? -15.611 97.695  -2.991  1.00 24.47  ? 346 PHE A CG  1 
ATOM   2612 C CD1 . PHE A 1 349 ? -15.484 98.928  -3.608  1.00 29.45  ? 346 PHE A CD1 1 
ATOM   2613 C CD2 . PHE A 1 349 ? -14.658 96.724  -3.242  1.00 28.60  ? 346 PHE A CD2 1 
ATOM   2614 C CE1 . PHE A 1 349 ? -14.431 99.184  -4.463  1.00 30.46  ? 346 PHE A CE1 1 
ATOM   2615 C CE2 . PHE A 1 349 ? -13.604 96.973  -4.098  1.00 28.43  ? 346 PHE A CE2 1 
ATOM   2616 C CZ  . PHE A 1 349 ? -13.489 98.205  -4.709  1.00 29.13  ? 346 PHE A CZ  1 
ATOM   2617 N N   . SER A 1 350 ? -18.139 99.308  0.190   1.00 35.66  ? 347 SER A N   1 
ATOM   2618 C CA  . SER A 1 350 ? -19.364 99.739  0.846   1.00 27.10  ? 347 SER A CA  1 
ATOM   2619 C C   . SER A 1 350 ? -19.749 101.098 0.285   1.00 26.29  ? 347 SER A C   1 
ATOM   2620 O O   . SER A 1 350 ? -18.892 101.969 0.122   1.00 30.59  ? 347 SER A O   1 
ATOM   2621 C CB  . SER A 1 350 ? -19.186 99.819  2.367   1.00 31.26  ? 347 SER A CB  1 
ATOM   2622 O OG  . SER A 1 350 ? -20.274 100.495 2.972   1.00 36.49  ? 347 SER A OG  1 
ATOM   2623 N N   . LYS A 1 351 ? -21.038 101.271 -0.013  1.00 31.55  ? 348 LYS A N   1 
ATOM   2624 C CA  . LYS A 1 351 ? -21.503 102.551 -0.533  1.00 26.78  ? 348 LYS A CA  1 
ATOM   2625 C C   . LYS A 1 351 ? -21.489 103.650 0.520   1.00 22.26  ? 348 LYS A C   1 
ATOM   2626 O O   . LYS A 1 351 ? -21.631 104.825 0.164   1.00 29.73  ? 348 LYS A O   1 
ATOM   2627 C CB  . LYS A 1 351 ? -22.915 102.412 -1.106  1.00 31.15  ? 348 LYS A CB  1 
ATOM   2628 C CG  . LYS A 1 351 ? -24.024 102.598 -0.081  1.00 27.34  ? 348 LYS A CG  1 
ATOM   2629 C CD  . LYS A 1 351 ? -25.386 102.694 -0.751  1.00 28.59  ? 348 LYS A CD  1 
ATOM   2630 C CE  . LYS A 1 351 ? -26.473 103.048 0.252   1.00 25.68  ? 348 LYS A CE  1 
ATOM   2631 N NZ  . LYS A 1 351 ? -26.233 104.371 0.892   1.00 22.43  ? 348 LYS A NZ  1 
ATOM   2632 N N   . ASP A 1 352 ? -21.314 103.304 1.794   1.00 19.97  ? 349 ASP A N   1 
ATOM   2633 C CA  . ASP A 1 352 ? -21.389 104.263 2.885   1.00 29.86  ? 349 ASP A CA  1 
ATOM   2634 C C   . ASP A 1 352 ? -20.020 104.649 3.436   1.00 31.30  ? 349 ASP A C   1 
ATOM   2635 O O   . ASP A 1 352 ? -19.950 105.359 4.444   1.00 27.07  ? 349 ASP A O   1 
ATOM   2636 C CB  . ASP A 1 352 ? -22.274 103.710 4.003   1.00 23.65  ? 349 ASP A CB  1 
ATOM   2637 C CG  . ASP A 1 352 ? -23.709 103.497 3.555   1.00 30.08  ? 349 ASP A CG  1 
ATOM   2638 O OD1 . ASP A 1 352 ? -24.249 104.378 2.853   1.00 25.99  ? 349 ASP A OD1 1 
ATOM   2639 O OD2 . ASP A 1 352 ? -24.294 102.446 3.894   1.00 31.52  ? 349 ASP A OD2 1 
ATOM   2640 N N   . ASN A 1 353 ? -18.936 104.200 2.807   1.00 26.39  ? 350 ASN A N   1 
ATOM   2641 C CA  . ASN A 1 353 ? -17.596 104.666 3.149   1.00 32.93  ? 350 ASN A CA  1 
ATOM   2642 C C   . ASN A 1 353 ? -16.839 104.918 1.848   1.00 33.23  ? 350 ASN A C   1 
ATOM   2643 O O   . ASN A 1 353 ? -17.411 104.875 0.755   1.00 30.50  ? 350 ASN A O   1 
ATOM   2644 C CB  . ASN A 1 353 ? -16.880 103.676 4.083   1.00 24.34  ? 350 ASN A CB  1 
ATOM   2645 C CG  . ASN A 1 353 ? -16.720 102.286 3.481   1.00 35.13  ? 350 ASN A CG  1 
ATOM   2646 O OD1 . ASN A 1 353 ? -16.667 102.115 2.263   1.00 33.38  ? 350 ASN A OD1 1 
ATOM   2647 N ND2 . ASN A 1 353 ? -16.632 101.283 4.347   1.00 28.67  ? 350 ASN A ND2 1 
ATOM   2648 N N   . GLU A 1 354 ? -15.537 105.181 1.966   1.00 37.18  ? 351 GLU A N   1 
ATOM   2649 C CA  . GLU A 1 354 ? -14.721 105.502 0.802   1.00 33.93  ? 351 GLU A CA  1 
ATOM   2650 C C   . GLU A 1 354 ? -14.246 104.269 0.044   1.00 28.18  ? 351 GLU A C   1 
ATOM   2651 O O   . GLU A 1 354 ? -13.692 104.418 -1.050  1.00 28.17  ? 351 GLU A O   1 
ATOM   2652 C CB  . GLU A 1 354 ? -13.513 106.343 1.221   1.00 35.58  ? 351 GLU A CB  1 
ATOM   2653 C CG  . GLU A 1 354 ? -13.873 107.630 1.949   1.00 44.20  ? 351 GLU A CG  1 
ATOM   2654 C CD  . GLU A 1 354 ? -14.985 108.399 1.260   1.00 59.38  ? 351 GLU A CD  1 
ATOM   2655 O OE1 . GLU A 1 354 ? -16.154 108.266 1.683   1.00 68.03  ? 351 GLU A OE1 1 
ATOM   2656 O OE2 . GLU A 1 354 ? -14.692 109.131 0.291   1.00 74.07  ? 351 GLU A OE2 1 
ATOM   2657 N N   . SER A 1 355 ? -14.451 103.071 0.594   1.00 28.21  ? 352 SER A N   1 
ATOM   2658 C CA  . SER A 1 355 ? -14.060 101.819 -0.059  1.00 25.75  ? 352 SER A CA  1 
ATOM   2659 C C   . SER A 1 355 ? -12.576 101.817 -0.418  1.00 31.35  ? 352 SER A C   1 
ATOM   2660 O O   . SER A 1 355 ? -12.175 101.388 -1.501  1.00 28.02  ? 352 SER A O   1 
ATOM   2661 C CB  . SER A 1 355 ? -14.922 101.550 -1.295  1.00 24.89  ? 352 SER A CB  1 
ATOM   2662 O OG  . SER A 1 355 ? -16.256 101.250 -0.926  1.00 30.92  ? 352 SER A OG  1 
ATOM   2663 N N   . LEU A 1 356 ? -11.751 102.311 0.506   1.00 35.57  ? 353 LEU A N   1 
ATOM   2664 C CA  . LEU A 1 356 ? -10.299 102.320 0.329   1.00 30.09  ? 353 LEU A CA  1 
ATOM   2665 C C   . LEU A 1 356 ? -9.777  100.919 0.637   1.00 26.25  ? 353 LEU A C   1 
ATOM   2666 O O   . LEU A 1 356 ? -9.335  100.606 1.745   1.00 34.47  ? 353 LEU A O   1 
ATOM   2667 C CB  . LEU A 1 356 ? -9.657  103.378 1.217   1.00 29.42  ? 353 LEU A CB  1 
ATOM   2668 C CG  . LEU A 1 356 ? -10.102 104.818 0.951   1.00 35.72  ? 353 LEU A CG  1 
ATOM   2669 C CD1 . LEU A 1 356 ? -9.491  105.766 1.972   1.00 35.62  ? 353 LEU A CD1 1 
ATOM   2670 C CD2 . LEU A 1 356 ? -9.735  105.241 -0.464  1.00 23.74  ? 353 LEU A CD2 1 
ATOM   2671 N N   . ILE A 1 357 ? -9.837  100.057 -0.378  1.00 25.45  ? 354 ILE A N   1 
ATOM   2672 C CA  . ILE A 1 357 ? -9.484  98.655  -0.196  1.00 30.04  ? 354 ILE A CA  1 
ATOM   2673 C C   . ILE A 1 357 ? -7.968  98.498  -0.133  1.00 38.05  ? 354 ILE A C   1 
ATOM   2674 O O   . ILE A 1 357 ? -7.202  99.328  -0.629  1.00 33.56  ? 354 ILE A O   1 
ATOM   2675 C CB  . ILE A 1 357 ? -10.088 97.785  -1.313  1.00 26.85  ? 354 ILE A CB  1 
ATOM   2676 C CG1 . ILE A 1 357 ? -9.568  98.235  -2.680  1.00 25.49  ? 354 ILE A CG1 1 
ATOM   2677 C CG2 . ILE A 1 357 ? -11.607 97.841  -1.266  1.00 32.28  ? 354 ILE A CG2 1 
ATOM   2678 C CD1 . ILE A 1 357 ? -10.031 97.365  -3.827  1.00 28.01  ? 354 ILE A CD1 1 
ATOM   2679 N N   . SER A 1 358 ? -7.535  97.405  0.488   1.00 38.88  ? 355 SER A N   1 
ATOM   2680 C CA  . SER A 1 358 ? -6.123  97.086  0.603   1.00 33.41  ? 355 SER A CA  1 
ATOM   2681 C C   . SER A 1 358 ? -5.659  96.306  -0.626  1.00 40.17  ? 355 SER A C   1 
ATOM   2682 O O   . SER A 1 358 ? -6.430  96.027  -1.548  1.00 37.17  ? 355 SER A O   1 
ATOM   2683 C CB  . SER A 1 358 ? -5.858  96.297  1.885   1.00 22.39  ? 355 SER A CB  1 
ATOM   2684 O OG  . SER A 1 358 ? -6.523  95.046  1.859   1.00 31.86  ? 355 SER A OG  1 
ATOM   2685 N N   . ARG A 1 359 ? -4.372  95.950  -0.640  1.00 38.79  ? 356 ARG A N   1 
ATOM   2686 C CA  . ARG A 1 359 ? -3.837  95.157  -1.742  1.00 24.96  ? 356 ARG A CA  1 
ATOM   2687 C C   . ARG A 1 359 ? -4.431  93.754  -1.749  1.00 30.76  ? 356 ARG A C   1 
ATOM   2688 O O   . ARG A 1 359 ? -4.748  93.214  -2.816  1.00 28.75  ? 356 ARG A O   1 
ATOM   2689 C CB  . ARG A 1 359 ? -2.312  95.095  -1.650  1.00 39.14  ? 356 ARG A CB  1 
ATOM   2690 C CG  . ARG A 1 359 ? -1.646  94.308  -2.770  1.00 33.71  ? 356 ARG A CG  1 
ATOM   2691 C CD  . ARG A 1 359 ? -1.789  95.014  -4.109  1.00 32.45  ? 356 ARG A CD  1 
ATOM   2692 N NE  . ARG A 1 359 ? -1.176  94.253  -5.194  1.00 34.21  ? 356 ARG A NE  1 
ATOM   2693 C CZ  . ARG A 1 359 ? -1.182  94.632  -6.469  1.00 30.22  ? 356 ARG A CZ  1 
ATOM   2694 N NH1 . ARG A 1 359 ? -1.771  95.766  -6.823  1.00 32.13  ? 356 ARG A NH1 1 
ATOM   2695 N NH2 . ARG A 1 359 ? -0.601  93.876  -7.390  1.00 33.48  ? 356 ARG A NH2 1 
ATOM   2696 N N   . ALA A 1 360 ? -4.593  93.152  -0.569  1.00 27.68  ? 357 ALA A N   1 
ATOM   2697 C CA  . ALA A 1 360 ? -5.161  91.809  -0.494  1.00 33.04  ? 357 ALA A CA  1 
ATOM   2698 C C   . ALA A 1 360 ? -6.619  91.799  -0.935  1.00 36.55  ? 357 ALA A C   1 
ATOM   2699 O O   . ALA A 1 360 ? -7.059  90.868  -1.619  1.00 33.69  ? 357 ALA A O   1 
ATOM   2700 C CB  . ALA A 1 360 ? -5.024  91.259  0.925   1.00 26.80  ? 357 ALA A CB  1 
ATOM   2701 N N   . GLU A 1 361 ? -7.383  92.825  -0.550  1.00 33.06  ? 358 GLU A N   1 
ATOM   2702 C CA  . GLU A 1 361 ? -8.777  92.905  -0.975  1.00 39.90  ? 358 GLU A CA  1 
ATOM   2703 C C   . GLU A 1 361 ? -8.892  93.118  -2.479  1.00 28.04  ? 358 GLU A C   1 
ATOM   2704 O O   . GLU A 1 361 ? -9.840  92.626  -3.101  1.00 30.27  ? 358 GLU A O   1 
ATOM   2705 C CB  . GLU A 1 361 ? -9.493  94.021  -0.214  1.00 30.27  ? 358 GLU A CB  1 
ATOM   2706 C CG  . GLU A 1 361 ? -9.692  93.721  1.265   1.00 31.46  ? 358 GLU A CG  1 
ATOM   2707 C CD  . GLU A 1 361 ? -10.238 94.905  2.039   1.00 32.28  ? 358 GLU A CD  1 
ATOM   2708 O OE1 . GLU A 1 361 ? -9.943  96.056  1.655   1.00 36.14  ? 358 GLU A OE1 1 
ATOM   2709 O OE2 . GLU A 1 361 ? -10.963 94.683  3.031   1.00 43.83  ? 358 GLU A OE2 1 
ATOM   2710 N N   . PHE A 1 362 ? -7.941  93.839  -3.079  1.00 25.43  ? 359 PHE A N   1 
ATOM   2711 C CA  . PHE A 1 362 ? -7.940  93.993  -4.530  1.00 28.49  ? 359 PHE A CA  1 
ATOM   2712 C C   . PHE A 1 362 ? -7.657  92.666  -5.223  1.00 30.44  ? 359 PHE A C   1 
ATOM   2713 O O   . PHE A 1 362 ? -8.324  92.318  -6.204  1.00 29.98  ? 359 PHE A O   1 
ATOM   2714 C CB  . PHE A 1 362 ? -6.915  95.047  -4.948  1.00 27.45  ? 359 PHE A CB  1 
ATOM   2715 C CG  . PHE A 1 362 ? -6.681  95.113  -6.433  1.00 32.61  ? 359 PHE A CG  1 
ATOM   2716 C CD1 . PHE A 1 362 ? -7.575  95.774  -7.260  1.00 26.79  ? 359 PHE A CD1 1 
ATOM   2717 C CD2 . PHE A 1 362 ? -5.564  94.519  -7.001  1.00 32.85  ? 359 PHE A CD2 1 
ATOM   2718 C CE1 . PHE A 1 362 ? -7.362  95.836  -8.626  1.00 32.28  ? 359 PHE A CE1 1 
ATOM   2719 C CE2 . PHE A 1 362 ? -5.346  94.579  -8.365  1.00 28.27  ? 359 PHE A CE2 1 
ATOM   2720 C CZ  . PHE A 1 362 ? -6.246  95.238  -9.179  1.00 32.09  ? 359 PHE A CZ  1 
ATOM   2721 N N   . LEU A 1 363 ? -6.672  91.913  -4.726  1.00 35.06  ? 360 LEU A N   1 
ATOM   2722 C CA  . LEU A 1 363 ? -6.345  90.626  -5.333  1.00 40.32  ? 360 LEU A CA  1 
ATOM   2723 C C   . LEU A 1 363 ? -7.514  89.655  -5.229  1.00 32.37  ? 360 LEU A C   1 
ATOM   2724 O O   . LEU A 1 363 ? -7.795  88.905  -6.171  1.00 32.79  ? 360 LEU A O   1 
ATOM   2725 C CB  . LEU A 1 363 ? -5.097  90.039  -4.673  1.00 39.89  ? 360 LEU A CB  1 
ATOM   2726 C CG  . LEU A 1 363 ? -3.797  90.824  -4.867  1.00 38.15  ? 360 LEU A CG  1 
ATOM   2727 C CD1 . LEU A 1 363 ? -2.677  90.238  -4.022  1.00 33.00  ? 360 LEU A CD1 1 
ATOM   2728 C CD2 . LEU A 1 363 ? -3.401  90.852  -6.336  1.00 43.22  ? 360 LEU A CD2 1 
ATOM   2729 N N   . ALA A 1 364 ? -8.209  89.654  -4.090  1.00 28.83  ? 361 ALA A N   1 
ATOM   2730 C CA  . ALA A 1 364 ? -9.375  88.791  -3.941  1.00 35.22  ? 361 ALA A CA  1 
ATOM   2731 C C   . ALA A 1 364 ? -10.535 89.280  -4.795  1.00 27.96  ? 361 ALA A C   1 
ATOM   2732 O O   . ALA A 1 364 ? -11.305 88.471  -5.325  1.00 33.00  ? 361 ALA A O   1 
ATOM   2733 C CB  . ALA A 1 364 ? -9.787  88.705  -2.472  1.00 21.10  ? 361 ALA A CB  1 
ATOM   2734 N N   . GLY A 1 365 ? -10.674 90.601  -4.942  1.00 26.11  ? 362 GLY A N   1 
ATOM   2735 C CA  . GLY A 1 365 ? -11.754 91.145  -5.746  1.00 31.15  ? 362 GLY A CA  1 
ATOM   2736 C C   . GLY A 1 365 ? -11.637 90.808  -7.219  1.00 29.48  ? 362 GLY A C   1 
ATOM   2737 O O   . GLY A 1 365 ? -12.651 90.708  -7.916  1.00 32.71  ? 362 GLY A O   1 
ATOM   2738 N N   . VAL A 1 366 ? -10.409 90.627  -7.712  1.00 29.13  ? 363 VAL A N   1 
ATOM   2739 C CA  . VAL A 1 366 ? -10.216 90.255  -9.111  1.00 26.03  ? 363 VAL A CA  1 
ATOM   2740 C C   . VAL A 1 366 ? -10.838 88.893  -9.390  1.00 27.98  ? 363 VAL A C   1 
ATOM   2741 O O   . VAL A 1 366 ? -11.410 88.662  -10.463 1.00 32.57  ? 363 VAL A O   1 
ATOM   2742 C CB  . VAL A 1 366 ? -8.717  90.283  -9.469  1.00 27.11  ? 363 VAL A CB  1 
ATOM   2743 C CG1 . VAL A 1 366 ? -8.489  89.749  -10.876 1.00 23.65  ? 363 VAL A CG1 1 
ATOM   2744 C CG2 . VAL A 1 366 ? -8.170  91.695  -9.344  1.00 18.27  ? 363 VAL A CG2 1 
ATOM   2745 N N   . ARG A 1 367 ? -10.751 87.973  -8.426  1.00 25.38  ? 364 ARG A N   1 
ATOM   2746 C CA  . ARG A 1 367 ? -11.351 86.657  -8.612  1.00 31.79  ? 364 ARG A CA  1 
ATOM   2747 C C   . ARG A 1 367 ? -12.873 86.729  -8.595  1.00 38.09  ? 364 ARG A C   1 
ATOM   2748 O O   . ARG A 1 367 ? -13.539 85.897  -9.220  1.00 31.77  ? 364 ARG A O   1 
ATOM   2749 C CB  . ARG A 1 367 ? -10.851 85.689  -7.539  1.00 32.70  ? 364 ARG A CB  1 
ATOM   2750 C CG  . ARG A 1 367 ? -9.336  85.647  -7.392  1.00 33.60  ? 364 ARG A CG  1 
ATOM   2751 C CD  . ARG A 1 367 ? -8.642  85.531  -8.741  1.00 33.48  ? 364 ARG A CD  1 
ATOM   2752 N NE  . ARG A 1 367 ? -8.980  84.296  -9.443  1.00 46.71  ? 364 ARG A NE  1 
ATOM   2753 C CZ  . ARG A 1 367 ? -8.204  83.217  -9.473  1.00 51.27  ? 364 ARG A CZ  1 
ATOM   2754 N NH1 . ARG A 1 367 ? -7.039  83.220  -8.840  1.00 51.33  ? 364 ARG A NH1 1 
ATOM   2755 N NH2 . ARG A 1 367 ? -8.591  82.137  -10.137 1.00 46.06  ? 364 ARG A NH2 1 
ATOM   2756 N N   . VAL A 1 368 ? -13.437 87.710  -7.888  1.00 29.41  ? 365 VAL A N   1 
ATOM   2757 C CA  . VAL A 1 368 ? -14.883 87.901  -7.901  1.00 32.64  ? 365 VAL A CA  1 
ATOM   2758 C C   . VAL A 1 368 ? -15.315 88.640  -9.162  1.00 30.33  ? 365 VAL A C   1 
ATOM   2759 O O   . VAL A 1 368 ? -16.331 88.298  -9.777  1.00 39.78  ? 365 VAL A O   1 
ATOM   2760 C CB  . VAL A 1 368 ? -15.329 88.638  -6.625  1.00 35.10  ? 365 VAL A CB  1 
ATOM   2761 C CG1 . VAL A 1 368 ? -16.817 88.952  -6.678  1.00 30.66  ? 365 VAL A CG1 1 
ATOM   2762 C CG2 . VAL A 1 368 ? -15.000 87.809  -5.393  1.00 33.75  ? 365 VAL A CG2 1 
ATOM   2763 N N   . GLY A 1 369 ? -14.552 89.656  -9.570  1.00 30.15  ? 366 GLY A N   1 
ATOM   2764 C CA  . GLY A 1 369 ? -14.886 90.386  -10.781 1.00 22.07  ? 366 GLY A CA  1 
ATOM   2765 C C   . GLY A 1 369 ? -14.644 89.590  -12.047 1.00 30.01  ? 366 GLY A C   1 
ATOM   2766 O O   . GLY A 1 369 ? -15.350 89.773  -13.043 1.00 34.56  ? 366 GLY A O   1 
ATOM   2767 N N   . VAL A 1 370 ? -13.649 88.709  -12.034 1.00 29.17  ? 367 VAL A N   1 
ATOM   2768 C CA  . VAL A 1 370 ? -13.379 87.816  -13.158 1.00 33.26  ? 367 VAL A CA  1 
ATOM   2769 C C   . VAL A 1 370 ? -13.602 86.387  -12.675 1.00 38.35  ? 367 VAL A C   1 
ATOM   2770 O O   . VAL A 1 370 ? -12.636 85.690  -12.333 1.00 40.26  ? 367 VAL A O   1 
ATOM   2771 C CB  . VAL A 1 370 ? -11.957 88.014  -13.708 1.00 36.72  ? 367 VAL A CB  1 
ATOM   2772 C CG1 . VAL A 1 370 ? -11.802 87.309  -15.047 1.00 28.43  ? 367 VAL A CG1 1 
ATOM   2773 C CG2 . VAL A 1 370 ? -11.640 89.496  -13.838 1.00 26.35  ? 367 VAL A CG2 1 
ATOM   2774 N N   . PRO A 1 371 ? -14.846 85.913  -12.631 1.00 39.11  ? 368 PRO A N   1 
ATOM   2775 C CA  . PRO A 1 371 ? -15.121 84.631  -11.974 1.00 36.67  ? 368 PRO A CA  1 
ATOM   2776 C C   . PRO A 1 371 ? -14.638 83.441  -12.789 1.00 37.94  ? 368 PRO A C   1 
ATOM   2777 O O   . PRO A 1 371 ? -14.811 83.382  -14.009 1.00 41.33  ? 368 PRO A O   1 
ATOM   2778 C CB  . PRO A 1 371 ? -16.647 84.626  -11.837 1.00 36.99  ? 368 PRO A CB  1 
ATOM   2779 C CG  . PRO A 1 371 ? -17.118 85.489  -12.955 1.00 38.41  ? 368 PRO A CG  1 
ATOM   2780 C CD  . PRO A 1 371 ? -16.074 86.560  -13.123 1.00 37.58  ? 368 PRO A CD  1 
ATOM   2781 N N   . GLN A 1 372 ? -14.027 82.491  -12.084 1.00 44.49  ? 369 GLN A N   1 
ATOM   2782 C CA  . GLN A 1 372 ? -13.631 81.191  -12.622 1.00 61.94  ? 369 GLN A CA  1 
ATOM   2783 C C   . GLN A 1 372 ? -12.745 81.333  -13.859 1.00 58.08  ? 369 GLN A C   1 
ATOM   2784 O O   . GLN A 1 372 ? -13.102 80.942  -14.972 1.00 52.19  ? 369 GLN A O   1 
ATOM   2785 C CB  . GLN A 1 372 ? -14.858 80.325  -12.918 1.00 66.03  ? 369 GLN A CB  1 
ATOM   2786 C CG  . GLN A 1 372 ? -14.563 78.835  -12.869 1.00 83.57  ? 369 GLN A CG  1 
ATOM   2787 C CD  . GLN A 1 372 ? -13.973 78.406  -11.537 1.00 92.32  ? 369 GLN A CD  1 
ATOM   2788 O OE1 . GLN A 1 372 ? -14.681 78.303  -10.535 1.00 91.09  ? 369 GLN A OE1 1 
ATOM   2789 N NE2 . GLN A 1 372 ? -12.668 78.158  -11.520 1.00 82.49  ? 369 GLN A NE2 1 
ATOM   2790 N N   . VAL A 1 373 ? -11.569 81.913  -13.639 1.00 56.53  ? 370 VAL A N   1 
ATOM   2791 C CA  . VAL A 1 373 ? -10.491 81.893  -14.614 1.00 45.04  ? 370 VAL A CA  1 
ATOM   2792 C C   . VAL A 1 373 ? -9.268  81.296  -13.933 1.00 43.39  ? 370 VAL A C   1 
ATOM   2793 O O   . VAL A 1 373 ? -9.190  81.213  -12.705 1.00 46.46  ? 370 VAL A O   1 
ATOM   2794 C CB  . VAL A 1 373 ? -10.176 83.289  -15.190 1.00 43.61  ? 370 VAL A CB  1 
ATOM   2795 C CG1 . VAL A 1 373 ? -11.349 83.800  -16.013 1.00 42.83  ? 370 VAL A CG1 1 
ATOM   2796 C CG2 . VAL A 1 373 ? -9.835  84.261  -14.072 1.00 40.88  ? 370 VAL A CG2 1 
ATOM   2797 N N   . SER A 1 374 ? -8.311  80.865  -14.750 1.00 45.40  ? 371 SER A N   1 
ATOM   2798 C CA  . SER A 1 374 ? -7.101  80.258  -14.214 1.00 40.66  ? 371 SER A CA  1 
ATOM   2799 C C   . SER A 1 374 ? -6.338  81.258  -13.353 1.00 43.28  ? 371 SER A C   1 
ATOM   2800 O O   . SER A 1 374 ? -6.463  82.476  -13.515 1.00 41.53  ? 371 SER A O   1 
ATOM   2801 C CB  . SER A 1 374 ? -6.210  79.753  -15.349 1.00 40.73  ? 371 SER A CB  1 
ATOM   2802 O OG  . SER A 1 374 ? -5.816  80.815  -16.200 1.00 50.10  ? 371 SER A OG  1 
ATOM   2803 N N   . ASP A 1 375 ? -5.550  80.728  -12.414 1.00 42.81  ? 372 ASP A N   1 
ATOM   2804 C CA  . ASP A 1 375 ? -4.717  81.590  -11.582 1.00 40.48  ? 372 ASP A CA  1 
ATOM   2805 C C   . ASP A 1 375 ? -3.736  82.395  -12.422 1.00 41.85  ? 372 ASP A C   1 
ATOM   2806 O O   . ASP A 1 375 ? -3.416  83.537  -12.077 1.00 47.40  ? 372 ASP A O   1 
ATOM   2807 C CB  . ASP A 1 375 ? -3.971  80.756  -10.540 1.00 55.40  ? 372 ASP A CB  1 
ATOM   2808 C CG  . ASP A 1 375 ? -4.854  80.353  -9.375  1.00 70.78  ? 372 ASP A CG  1 
ATOM   2809 O OD1 . ASP A 1 375 ? -5.946  79.797  -9.617  1.00 68.78  ? 372 ASP A OD1 1 
ATOM   2810 O OD2 . ASP A 1 375 ? -4.452  80.587  -8.215  1.00 74.00  ? 372 ASP A OD2 1 
ATOM   2811 N N   . LEU A 1 376 ? -3.257  81.822  -13.529 1.00 33.80  ? 373 LEU A N   1 
ATOM   2812 C CA  . LEU A 1 376 ? -2.394  82.573  -14.434 1.00 38.66  ? 373 LEU A CA  1 
ATOM   2813 C C   . LEU A 1 376 ? -3.154  83.715  -15.096 1.00 46.08  ? 373 LEU A C   1 
ATOM   2814 O O   . LEU A 1 376 ? -2.597  84.800  -15.306 1.00 44.85  ? 373 LEU A O   1 
ATOM   2815 C CB  . LEU A 1 376 ? -1.800  81.639  -15.488 1.00 38.42  ? 373 LEU A CB  1 
ATOM   2816 C CG  . LEU A 1 376 ? -0.891  82.290  -16.533 1.00 42.66  ? 373 LEU A CG  1 
ATOM   2817 C CD1 . LEU A 1 376 ? 0.330   82.912  -15.871 1.00 42.20  ? 373 LEU A CD1 1 
ATOM   2818 C CD2 . LEU A 1 376 ? -0.479  81.281  -17.594 1.00 47.46  ? 373 LEU A CD2 1 
ATOM   2819 N N   . ALA A 1 377 ? -4.427  83.491  -15.433 1.00 41.00  ? 374 ALA A N   1 
ATOM   2820 C CA  . ALA A 1 377 ? -5.234  84.556  -16.019 1.00 34.61  ? 374 ALA A CA  1 
ATOM   2821 C C   . ALA A 1 377 ? -5.439  85.696  -15.031 1.00 26.31  ? 374 ALA A C   1 
ATOM   2822 O O   . ALA A 1 377 ? -5.406  86.872  -15.413 1.00 32.24  ? 374 ALA A O   1 
ATOM   2823 C CB  . ALA A 1 377 ? -6.579  84.002  -16.488 1.00 37.60  ? 374 ALA A CB  1 
ATOM   2824 N N   . ALA A 1 378 ? -5.650  85.366  -13.755 1.00 24.98  ? 375 ALA A N   1 
ATOM   2825 C CA  . ALA A 1 378 ? -5.793  86.403  -12.739 1.00 30.39  ? 375 ALA A CA  1 
ATOM   2826 C C   . ALA A 1 378 ? -4.507  87.205  -12.588 1.00 43.40  ? 375 ALA A C   1 
ATOM   2827 O O   . ALA A 1 378 ? -4.547  88.420  -12.364 1.00 41.75  ? 375 ALA A O   1 
ATOM   2828 C CB  . ALA A 1 378 ? -6.197  85.777  -11.405 1.00 39.26  ? 375 ALA A CB  1 
ATOM   2829 N N   . GLU A 1 379 ? -3.353  86.541  -12.709 1.00 40.46  ? 376 GLU A N   1 
ATOM   2830 C CA  . GLU A 1 379 ? -2.081  87.254  -12.655 1.00 38.72  ? 376 GLU A CA  1 
ATOM   2831 C C   . GLU A 1 379 ? -1.961  88.249  -13.802 1.00 29.87  ? 376 GLU A C   1 
ATOM   2832 O O   . GLU A 1 379 ? -1.440  89.357  -13.622 1.00 33.12  ? 376 GLU A O   1 
ATOM   2833 C CB  . GLU A 1 379 ? -0.917  86.261  -12.686 1.00 45.91  ? 376 GLU A CB  1 
ATOM   2834 C CG  . GLU A 1 379 ? -0.845  85.320  -11.491 1.00 49.72  ? 376 GLU A CG  1 
ATOM   2835 C CD  . GLU A 1 379 ? -0.208  85.956  -10.268 1.00 65.47  ? 376 GLU A CD  1 
ATOM   2836 O OE1 . GLU A 1 379 ? 0.005   87.187  -10.268 1.00 58.18  ? 376 GLU A OE1 1 
ATOM   2837 O OE2 . GLU A 1 379 ? 0.085   85.218  -9.304  1.00 76.30  ? 376 GLU A OE2 1 
ATOM   2838 N N   . ALA A 1 380 ? -2.440  87.873  -14.990 1.00 31.08  ? 377 ALA A N   1 
ATOM   2839 C CA  . ALA A 1 380 ? -2.401  88.788  -16.126 1.00 31.22  ? 377 ALA A CA  1 
ATOM   2840 C C   . ALA A 1 380 ? -3.307  89.991  -15.896 1.00 35.31  ? 377 ALA A C   1 
ATOM   2841 O O   . ALA A 1 380 ? -2.967  91.114  -16.286 1.00 36.70  ? 377 ALA A O   1 
ATOM   2842 C CB  . ALA A 1 380 ? -2.797  88.052  -17.406 1.00 31.17  ? 377 ALA A CB  1 
ATOM   2843 N N   . VAL A 1 381 ? -4.463  89.776  -15.263 1.00 35.18  ? 378 VAL A N   1 
ATOM   2844 C CA  . VAL A 1 381 ? -5.353  90.889  -14.952 1.00 29.44  ? 378 VAL A CA  1 
ATOM   2845 C C   . VAL A 1 381 ? -4.719  91.804  -13.912 1.00 29.92  ? 378 VAL A C   1 
ATOM   2846 O O   . VAL A 1 381 ? -4.775  93.034  -14.030 1.00 34.47  ? 378 VAL A O   1 
ATOM   2847 C CB  . VAL A 1 381 ? -6.723  90.364  -14.484 1.00 27.16  ? 378 VAL A CB  1 
ATOM   2848 C CG1 . VAL A 1 381 ? -7.636  91.520  -14.109 1.00 21.11  ? 378 VAL A CG1 1 
ATOM   2849 C CG2 . VAL A 1 381 ? -7.361  89.506  -15.566 1.00 25.06  ? 378 VAL A CG2 1 
ATOM   2850 N N   . VAL A 1 382 ? -4.101  91.220  -12.881 1.00 30.58  ? 379 VAL A N   1 
ATOM   2851 C CA  . VAL A 1 382 ? -3.456  92.023  -11.846 1.00 31.21  ? 379 VAL A CA  1 
ATOM   2852 C C   . VAL A 1 382 ? -2.308  92.833  -12.435 1.00 39.55  ? 379 VAL A C   1 
ATOM   2853 O O   . VAL A 1 382 ? -2.104  93.999  -12.077 1.00 37.06  ? 379 VAL A O   1 
ATOM   2854 C CB  . VAL A 1 382 ? -2.984  91.122  -10.689 1.00 29.06  ? 379 VAL A CB  1 
ATOM   2855 C CG1 . VAL A 1 382 ? -2.124  91.909  -9.712  1.00 38.24  ? 379 VAL A CG1 1 
ATOM   2856 C CG2 . VAL A 1 382 ? -4.179  90.515  -9.971  1.00 22.31  ? 379 VAL A CG2 1 
ATOM   2857 N N   . LEU A 1 383 ? -1.549  92.236  -13.357 1.00 33.38  ? 380 LEU A N   1 
ATOM   2858 C CA  . LEU A 1 383 ? -0.437  92.949  -13.980 1.00 34.12  ? 380 LEU A CA  1 
ATOM   2859 C C   . LEU A 1 383 ? -0.922  94.177  -14.740 1.00 40.91  ? 380 LEU A C   1 
ATOM   2860 O O   . LEU A 1 383 ? -0.346  95.264  -14.622 1.00 34.52  ? 380 LEU A O   1 
ATOM   2861 C CB  . LEU A 1 383 ? 0.327   92.015  -14.919 1.00 41.94  ? 380 LEU A CB  1 
ATOM   2862 C CG  . LEU A 1 383 ? 1.228   92.730  -15.931 1.00 45.82  ? 380 LEU A CG  1 
ATOM   2863 C CD1 . LEU A 1 383 ? 2.495   93.254  -15.266 1.00 36.71  ? 380 LEU A CD1 1 
ATOM   2864 C CD2 . LEU A 1 383 ? 1.559   91.832  -17.114 1.00 36.89  ? 380 LEU A CD2 1 
ATOM   2865 N N   . HIS A 1 384 ? -1.989  94.021  -15.526 1.00 37.64  ? 381 HIS A N   1 
ATOM   2866 C CA  . HIS A 1 384 ? -2.407  95.093  -16.422 1.00 35.08  ? 381 HIS A CA  1 
ATOM   2867 C C   . HIS A 1 384 ? -3.048  96.254  -15.672 1.00 31.26  ? 381 HIS A C   1 
ATOM   2868 O O   . HIS A 1 384 ? -2.978  97.398  -16.134 1.00 37.07  ? 381 HIS A O   1 
ATOM   2869 C CB  . HIS A 1 384 ? -3.375  94.551  -17.472 1.00 34.36  ? 381 HIS A CB  1 
ATOM   2870 C CG  . HIS A 1 384 ? -3.703  95.533  -18.552 1.00 44.93  ? 381 HIS A CG  1 
ATOM   2871 N ND1 . HIS A 1 384 ? -3.007  95.593  -19.740 1.00 48.97  ? 381 HIS A ND1 1 
ATOM   2872 C CD2 . HIS A 1 384 ? -4.646  96.503  -18.619 1.00 43.58  ? 381 HIS A CD2 1 
ATOM   2873 C CE1 . HIS A 1 384 ? -3.511  96.553  -20.495 1.00 56.92  ? 381 HIS A CE1 1 
ATOM   2874 N NE2 . HIS A 1 384 ? -4.506  97.121  -19.837 1.00 62.44  ? 381 HIS A NE2 1 
ATOM   2875 N N   . TYR A 1 385 ? -3.670  95.991  -14.524 1.00 28.79  ? 382 TYR A N   1 
ATOM   2876 C CA  . TYR A 1 385 ? -4.434  97.006  -13.811 1.00 35.42  ? 382 TYR A CA  1 
ATOM   2877 C C   . TYR A 1 385 ? -3.754  97.487  -12.537 1.00 38.57  ? 382 TYR A C   1 
ATOM   2878 O O   . TYR A 1 385 ? -4.369  98.226  -11.761 1.00 41.19  ? 382 TYR A O   1 
ATOM   2879 C CB  . TYR A 1 385 ? -5.836  96.482  -13.497 1.00 24.29  ? 382 TYR A CB  1 
ATOM   2880 C CG  . TYR A 1 385 ? -6.729  96.412  -14.713 1.00 31.24  ? 382 TYR A CG  1 
ATOM   2881 C CD1 . TYR A 1 385 ? -7.511  97.498  -15.084 1.00 30.76  ? 382 TYR A CD1 1 
ATOM   2882 C CD2 . TYR A 1 385 ? -6.781  95.267  -15.496 1.00 21.36  ? 382 TYR A CD2 1 
ATOM   2883 C CE1 . TYR A 1 385 ? -8.325  97.443  -16.197 1.00 24.39  ? 382 TYR A CE1 1 
ATOM   2884 C CE2 . TYR A 1 385 ? -7.593  95.204  -16.613 1.00 32.89  ? 382 TYR A CE2 1 
ATOM   2885 C CZ  . TYR A 1 385 ? -8.362  96.295  -16.958 1.00 24.58  ? 382 TYR A CZ  1 
ATOM   2886 O OH  . TYR A 1 385 ? -9.173  96.240  -18.068 1.00 37.28  ? 382 TYR A OH  1 
ATOM   2887 N N   . THR A 1 386 ? -2.504  97.099  -12.303 1.00 35.50  ? 383 THR A N   1 
ATOM   2888 C CA  . THR A 1 386 ? -1.748  97.569  -11.151 1.00 32.68  ? 383 THR A CA  1 
ATOM   2889 C C   . THR A 1 386 ? -0.835  98.711  -11.573 1.00 36.84  ? 383 THR A C   1 
ATOM   2890 O O   . THR A 1 386 ? -0.050  98.570  -12.516 1.00 38.08  ? 383 THR A O   1 
ATOM   2891 C CB  . THR A 1 386 ? -0.918  96.443  -10.531 1.00 35.63  ? 383 THR A CB  1 
ATOM   2892 O OG1 . THR A 1 386 ? -1.790  95.441  -9.994  1.00 33.16  ? 383 THR A OG1 1 
ATOM   2893 C CG2 . THR A 1 386 ? -0.027  96.986  -9.422  1.00 34.87  ? 383 THR A CG2 1 
ATOM   2894 N N   . ASP A 1 387 ? -0.951  99.843  -10.883 1.00 38.00  ? 384 ASP A N   1 
ATOM   2895 C CA  . ASP A 1 387 ? 0.002   100.939 -11.032 1.00 40.11  ? 384 ASP A CA  1 
ATOM   2896 C C   . ASP A 1 387 ? 1.241   100.566 -10.230 1.00 40.97  ? 384 ASP A C   1 
ATOM   2897 O O   . ASP A 1 387 ? 1.280   100.737 -9.011  1.00 34.77  ? 384 ASP A O   1 
ATOM   2898 C CB  . ASP A 1 387 ? -0.601  102.253 -10.550 1.00 47.02  ? 384 ASP A CB  1 
ATOM   2899 C CG  . ASP A 1 387 ? 0.234   103.457 -10.942 1.00 52.80  ? 384 ASP A CG  1 
ATOM   2900 O OD1 . ASP A 1 387 ? -0.222  104.243 -11.798 1.00 60.20  ? 384 ASP A OD1 1 
ATOM   2901 O OD2 . ASP A 1 387 ? 1.351   103.612 -10.404 1.00 51.64  ? 384 ASP A OD2 1 
ATOM   2902 N N   . TRP A 1 388 ? 2.260   100.044 -10.910 1.00 42.20  ? 385 TRP A N   1 
ATOM   2903 C CA  . TRP A 1 388 ? 3.409   99.496  -10.200 1.00 43.58  ? 385 TRP A CA  1 
ATOM   2904 C C   . TRP A 1 388 ? 4.303   100.563 -9.583  1.00 33.25  ? 385 TRP A C   1 
ATOM   2905 O O   . TRP A 1 388 ? 5.290   100.210 -8.928  1.00 39.76  ? 385 TRP A O   1 
ATOM   2906 C CB  . TRP A 1 388 ? 4.208   98.593  -11.138 1.00 35.52  ? 385 TRP A CB  1 
ATOM   2907 C CG  . TRP A 1 388 ? 3.440   97.363  -11.507 1.00 30.80  ? 385 TRP A CG  1 
ATOM   2908 C CD1 . TRP A 1 388 ? 2.766   97.134  -12.671 1.00 35.78  ? 385 TRP A CD1 1 
ATOM   2909 C CD2 . TRP A 1 388 ? 3.236   96.205  -10.689 1.00 27.76  ? 385 TRP A CD2 1 
ATOM   2910 N NE1 . TRP A 1 388 ? 2.170   95.895  -12.636 1.00 28.93  ? 385 TRP A NE1 1 
ATOM   2911 C CE2 . TRP A 1 388 ? 2.442   95.306  -11.429 1.00 29.91  ? 385 TRP A CE2 1 
ATOM   2912 C CE3 . TRP A 1 388 ? 3.654   95.838  -9.407  1.00 27.11  ? 385 TRP A CE3 1 
ATOM   2913 C CZ2 . TRP A 1 388 ? 2.059   94.063  -10.928 1.00 35.61  ? 385 TRP A CZ2 1 
ATOM   2914 C CZ3 . TRP A 1 388 ? 3.272   94.604  -8.912  1.00 27.56  ? 385 TRP A CZ3 1 
ATOM   2915 C CH2 . TRP A 1 388 ? 2.483   93.732  -9.671  1.00 30.52  ? 385 TRP A CH2 1 
ATOM   2916 N N   . LEU A 1 389 ? 3.989   101.845 -9.765  1.00 39.97  ? 386 LEU A N   1 
ATOM   2917 C CA  . LEU A 1 389 ? 4.625   102.895 -8.980  1.00 37.16  ? 386 LEU A CA  1 
ATOM   2918 C C   . LEU A 1 389 ? 3.912   103.130 -7.656  1.00 41.77  ? 386 LEU A C   1 
ATOM   2919 O O   . LEU A 1 389 ? 4.542   103.578 -6.691  1.00 51.54  ? 386 LEU A O   1 
ATOM   2920 C CB  . LEU A 1 389 ? 4.677   104.201 -9.776  1.00 40.34  ? 386 LEU A CB  1 
ATOM   2921 C CG  . LEU A 1 389 ? 6.066   104.653 -10.233 1.00 54.74  ? 386 LEU A CG  1 
ATOM   2922 C CD1 . LEU A 1 389 ? 5.986   105.980 -10.969 1.00 51.64  ? 386 LEU A CD1 1 
ATOM   2923 C CD2 . LEU A 1 389 ? 7.015   104.750 -9.046  1.00 47.31  ? 386 LEU A CD2 1 
ATOM   2924 N N   . HIS A 1 390 ? 2.614   102.836 -7.592  1.00 43.13  ? 387 HIS A N   1 
ATOM   2925 C CA  . HIS A 1 390 ? 1.828   102.921 -6.362  1.00 37.25  ? 387 HIS A CA  1 
ATOM   2926 C C   . HIS A 1 390 ? 0.989   101.654 -6.235  1.00 42.36  ? 387 HIS A C   1 
ATOM   2927 O O   . HIS A 1 390 ? -0.245  101.699 -6.311  1.00 37.05  ? 387 HIS A O   1 
ATOM   2928 C CB  . HIS A 1 390 ? 0.940   104.166 -6.360  1.00 36.01  ? 387 HIS A CB  1 
ATOM   2929 C CG  . HIS A 1 390 ? 1.624   105.399 -6.862  1.00 40.48  ? 387 HIS A CG  1 
ATOM   2930 N ND1 . HIS A 1 390 ? 2.327   106.250 -6.037  1.00 42.82  ? 387 HIS A ND1 1 
ATOM   2931 C CD2 . HIS A 1 390 ? 1.710   105.927 -8.107  1.00 40.77  ? 387 HIS A CD2 1 
ATOM   2932 C CE1 . HIS A 1 390 ? 2.818   107.247 -6.751  1.00 44.91  ? 387 HIS A CE1 1 
ATOM   2933 N NE2 . HIS A 1 390 ? 2.457   107.075 -8.010  1.00 46.60  ? 387 HIS A NE2 1 
ATOM   2934 N N   . PRO A 1 391 ? 1.632   100.497 -6.041  1.00 45.68  ? 388 PRO A N   1 
ATOM   2935 C CA  . PRO A 1 391 ? 0.886   99.228  -6.074  1.00 35.02  ? 388 PRO A CA  1 
ATOM   2936 C C   . PRO A 1 391 ? 0.014   98.990  -4.854  1.00 33.60  ? 388 PRO A C   1 
ATOM   2937 O O   . PRO A 1 391 ? -0.805  98.061  -4.878  1.00 38.35  ? 388 PRO A O   1 
ATOM   2938 C CB  . PRO A 1 391 ? 1.997   98.177  -6.171  1.00 36.74  ? 388 PRO A CB  1 
ATOM   2939 C CG  . PRO A 1 391 ? 3.147   98.807  -5.462  1.00 42.32  ? 388 PRO A CG  1 
ATOM   2940 C CD  . PRO A 1 391 ? 3.062   100.287 -5.747  1.00 39.05  ? 388 PRO A CD  1 
ATOM   2941 N N   . GLU A 1 392 ? 0.156   99.787  -3.796  1.00 39.15  ? 389 GLU A N   1 
ATOM   2942 C CA  . GLU A 1 392 ? -0.615  99.600  -2.576  1.00 44.18  ? 389 GLU A CA  1 
ATOM   2943 C C   . GLU A 1 392 ? -1.548  100.763 -2.271  1.00 34.48  ? 389 GLU A C   1 
ATOM   2944 O O   . GLU A 1 392 ? -2.200  100.751 -1.220  1.00 42.99  ? 389 GLU A O   1 
ATOM   2945 C CB  . GLU A 1 392 ? 0.327   99.379  -1.383  1.00 44.13  ? 389 GLU A CB  1 
ATOM   2946 C CG  . GLU A 1 392 ? 1.348   98.267  -1.582  1.00 51.86  ? 389 GLU A CG  1 
ATOM   2947 C CD  . GLU A 1 392 ? 0.972   96.987  -0.861  1.00 57.94  ? 389 GLU A CD  1 
ATOM   2948 O OE1 . GLU A 1 392 ? 1.237   95.894  -1.405  1.00 64.28  ? 389 GLU A OE1 1 
ATOM   2949 O OE2 . GLU A 1 392 ? 0.412   97.074  0.253   1.00 61.46  ? 389 GLU A OE2 1 
ATOM   2950 N N   . ASP A 1 393 ? -1.631  101.759 -3.145  1.00 35.07  ? 390 ASP A N   1 
ATOM   2951 C CA  . ASP A 1 393 ? -2.489  102.916 -2.908  1.00 36.77  ? 390 ASP A CA  1 
ATOM   2952 C C   . ASP A 1 393 ? -3.951  102.487 -2.904  1.00 39.98  ? 390 ASP A C   1 
ATOM   2953 O O   . ASP A 1 393 ? -4.446  102.003 -3.931  1.00 30.64  ? 390 ASP A O   1 
ATOM   2954 C CB  . ASP A 1 393 ? -2.249  103.979 -3.977  1.00 28.63  ? 390 ASP A CB  1 
ATOM   2955 C CG  . ASP A 1 393 ? -2.962  105.284 -3.676  1.00 41.14  ? 390 ASP A CG  1 
ATOM   2956 O OD1 . ASP A 1 393 ? -3.406  105.474 -2.524  1.00 52.47  ? 390 ASP A OD1 1 
ATOM   2957 O OD2 . ASP A 1 393 ? -3.082  106.122 -4.595  1.00 45.83  ? 390 ASP A OD2 1 
ATOM   2958 N N   . PRO A 1 394 ? -4.673  102.638 -1.789  1.00 42.37  ? 391 PRO A N   1 
ATOM   2959 C CA  . PRO A 1 394 ? -6.066  102.157 -1.753  1.00 33.62  ? 391 PRO A CA  1 
ATOM   2960 C C   . PRO A 1 394 ? -6.971  102.823 -2.776  1.00 28.57  ? 391 PRO A C   1 
ATOM   2961 O O   . PRO A 1 394 ? -7.829  102.151 -3.363  1.00 23.78  ? 391 PRO A O   1 
ATOM   2962 C CB  . PRO A 1 394 ? -6.502  102.474 -0.315  1.00 35.86  ? 391 PRO A CB  1 
ATOM   2963 C CG  . PRO A 1 394 ? -5.228  102.535 0.464   1.00 38.01  ? 391 PRO A CG  1 
ATOM   2964 C CD  . PRO A 1 394 ? -4.222  103.128 -0.476  1.00 37.74  ? 391 PRO A CD  1 
ATOM   2965 N N   . ALA A 1 395 ? -6.806  104.127 -3.008  1.00 29.25  ? 392 ALA A N   1 
ATOM   2966 C CA  . ALA A 1 395 ? -7.662  104.817 -3.967  1.00 29.93  ? 392 ALA A CA  1 
ATOM   2967 C C   . ALA A 1 395 ? -7.435  104.305 -5.384  1.00 42.13  ? 392 ALA A C   1 
ATOM   2968 O O   . ALA A 1 395 ? -8.395  104.102 -6.137  1.00 33.43  ? 392 ALA A O   1 
ATOM   2969 C CB  . ALA A 1 395 ? -7.423  106.325 -3.897  1.00 32.12  ? 392 ALA A CB  1 
ATOM   2970 N N   . ARG A 1 396 ? -6.174  104.087 -5.765  1.00 35.89  ? 393 ARG A N   1 
ATOM   2971 C CA  . ARG A 1 396 ? -5.887  103.584 -7.105  1.00 29.22  ? 393 ARG A CA  1 
ATOM   2972 C C   . ARG A 1 396 ? -6.376  102.152 -7.276  1.00 29.31  ? 393 ARG A C   1 
ATOM   2973 O O   . ARG A 1 396 ? -6.837  101.773 -8.358  1.00 29.79  ? 393 ARG A O   1 
ATOM   2974 C CB  . ARG A 1 396 ? -4.390  103.680 -7.395  1.00 31.80  ? 393 ARG A CB  1 
ATOM   2975 C CG  . ARG A 1 396 ? -3.897  105.094 -7.661  1.00 37.58  ? 393 ARG A CG  1 
ATOM   2976 C CD  . ARG A 1 396 ? -2.417  105.103 -8.012  1.00 43.89  ? 393 ARG A CD  1 
ATOM   2977 N NE  . ARG A 1 396 ? -1.952  106.430 -8.405  1.00 46.14  ? 393 ARG A NE  1 
ATOM   2978 C CZ  . ARG A 1 396 ? -1.454  107.328 -7.561  1.00 40.21  ? 393 ARG A CZ  1 
ATOM   2979 N NH1 . ARG A 1 396 ? -1.356  107.044 -6.270  1.00 36.92  ? 393 ARG A NH1 1 
ATOM   2980 N NH2 . ARG A 1 396 ? -1.053  108.510 -8.008  1.00 39.47  ? 393 ARG A NH2 1 
ATOM   2981 N N   . LEU A 1 397 ? -6.282  101.340 -6.220  1.00 29.36  ? 394 LEU A N   1 
ATOM   2982 C CA  . LEU A 1 397 ? -6.784  99.972  -6.298  1.00 33.21  ? 394 LEU A CA  1 
ATOM   2983 C C   . LEU A 1 397 ? -8.299  99.949  -6.446  1.00 30.54  ? 394 LEU A C   1 
ATOM   2984 O O   . LEU A 1 397 ? -8.849  99.081  -7.135  1.00 31.26  ? 394 LEU A O   1 
ATOM   2985 C CB  . LEU A 1 397 ? -6.356  99.181  -5.064  1.00 26.61  ? 394 LEU A CB  1 
ATOM   2986 C CG  . LEU A 1 397 ? -4.855  98.945  -4.893  1.00 39.12  ? 394 LEU A CG  1 
ATOM   2987 C CD1 . LEU A 1 397 ? -4.566  98.263  -3.564  1.00 34.49  ? 394 LEU A CD1 1 
ATOM   2988 C CD2 . LEU A 1 397 ? -4.307  98.122  -6.048  1.00 28.65  ? 394 LEU A CD2 1 
ATOM   2989 N N   . ARG A 1 398 ? -8.989  100.897 -5.807  1.00 28.76  ? 395 ARG A N   1 
ATOM   2990 C CA  . ARG A 1 398 ? -10.440 100.982 -5.936  1.00 30.76  ? 395 ARG A CA  1 
ATOM   2991 C C   . ARG A 1 398 ? -10.843 101.305 -7.370  1.00 29.24  ? 395 ARG A C   1 
ATOM   2992 O O   . ARG A 1 398 ? -11.735 100.663 -7.938  1.00 28.43  ? 395 ARG A O   1 
ATOM   2993 C CB  . ARG A 1 398 ? -10.982 102.035 -4.970  1.00 26.40  ? 395 ARG A CB  1 
ATOM   2994 C CG  . ARG A 1 398 ? -12.481 102.241 -5.037  1.00 33.24  ? 395 ARG A CG  1 
ATOM   2995 C CD  . ARG A 1 398 ? -12.876 103.480 -4.257  1.00 29.74  ? 395 ARG A CD  1 
ATOM   2996 N NE  . ARG A 1 398 ? -12.258 104.678 -4.817  1.00 26.22  ? 395 ARG A NE  1 
ATOM   2997 C CZ  . ARG A 1 398 ? -12.119 105.826 -4.162  1.00 26.67  ? 395 ARG A CZ  1 
ATOM   2998 N NH1 . ARG A 1 398 ? -12.549 105.937 -2.912  1.00 27.95  ? 395 ARG A NH1 1 
ATOM   2999 N NH2 . ARG A 1 398 ? -11.543 106.862 -4.756  1.00 21.65  ? 395 ARG A NH2 1 
ATOM   3000 N N   . GLU A 1 399 ? -10.189 102.300 -7.976  1.00 29.07  ? 396 GLU A N   1 
ATOM   3001 C CA  . GLU A 1 399 ? -10.475 102.632 -9.367  1.00 30.07  ? 396 GLU A CA  1 
ATOM   3002 C C   . GLU A 1 399 ? -10.013 101.532 -10.315 1.00 25.59  ? 396 GLU A C   1 
ATOM   3003 O O   . GLU A 1 399 ? -10.586 101.370 -11.399 1.00 29.58  ? 396 GLU A O   1 
ATOM   3004 C CB  . GLU A 1 399 ? -9.821  103.963 -9.742  1.00 26.64  ? 396 GLU A CB  1 
ATOM   3005 C CG  . GLU A 1 399 ? -10.746 105.166 -9.633  1.00 47.87  ? 396 GLU A CG  1 
ATOM   3006 C CD  . GLU A 1 399 ? -11.124 105.491 -8.201  1.00 59.74  ? 396 GLU A CD  1 
ATOM   3007 O OE1 . GLU A 1 399 ? -10.226 105.867 -7.418  1.00 57.85  ? 396 GLU A OE1 1 
ATOM   3008 O OE2 . GLU A 1 399 ? -12.319 105.366 -7.858  1.00 57.34  ? 396 GLU A OE2 1 
ATOM   3009 N N   . ALA A 1 400 ? -8.988  100.770 -9.929  1.00 24.28  ? 397 ALA A N   1 
ATOM   3010 C CA  . ALA A 1 400 ? -8.498  99.698  -10.789 1.00 24.41  ? 397 ALA A CA  1 
ATOM   3011 C C   . ALA A 1 400 ? -9.506  98.558  -10.871 1.00 25.99  ? 397 ALA A C   1 
ATOM   3012 O O   . ALA A 1 400 ? -9.830  98.081  -11.965 1.00 27.56  ? 397 ALA A O   1 
ATOM   3013 C CB  . ALA A 1 400 ? -7.148  99.191  -10.282 1.00 27.99  ? 397 ALA A CB  1 
ATOM   3014 N N   . LEU A 1 401 ? -10.013 98.106  -9.720  1.00 21.00  ? 398 LEU A N   1 
ATOM   3015 C CA  . LEU A 1 401 ? -11.008 97.038  -9.726  1.00 27.74  ? 398 LEU A CA  1 
ATOM   3016 C C   . LEU A 1 401 ? -12.294 97.479  -10.414 1.00 22.18  ? 398 LEU A C   1 
ATOM   3017 O O   . LEU A 1 401 ? -12.967 96.660  -11.050 1.00 22.01  ? 398 LEU A O   1 
ATOM   3018 C CB  . LEU A 1 401 ? -11.297 96.575  -8.298  1.00 22.40  ? 398 LEU A CB  1 
ATOM   3019 C CG  . LEU A 1 401 ? -12.133 95.300  -8.171  1.00 19.80  ? 398 LEU A CG  1 
ATOM   3020 C CD1 . LEU A 1 401 ? -11.467 94.149  -8.908  1.00 25.99  ? 398 LEU A CD1 1 
ATOM   3021 C CD2 . LEU A 1 401 ? -12.357 94.944  -6.711  1.00 20.50  ? 398 LEU A CD2 1 
ATOM   3022 N N   . SER A 1 402 ? -12.650 98.761  -10.297 1.00 19.76  ? 399 SER A N   1 
ATOM   3023 C CA  . SER A 1 402 ? -13.782 99.284  -11.056 1.00 26.40  ? 399 SER A CA  1 
ATOM   3024 C C   . SER A 1 402 ? -13.529 99.178  -12.554 1.00 31.30  ? 399 SER A C   1 
ATOM   3025 O O   . SER A 1 402 ? -14.442 98.862  -13.326 1.00 27.41  ? 399 SER A O   1 
ATOM   3026 C CB  . SER A 1 402 ? -14.055 100.734 -10.658 1.00 26.93  ? 399 SER A CB  1 
ATOM   3027 O OG  . SER A 1 402 ? -15.046 101.317 -11.487 1.00 27.15  ? 399 SER A OG  1 
ATOM   3028 N N   . ASP A 1 403 ? -12.291 99.438  -12.984 1.00 26.62  ? 400 ASP A N   1 
ATOM   3029 C CA  . ASP A 1 403 ? -11.953 99.288  -14.395 1.00 25.47  ? 400 ASP A CA  1 
ATOM   3030 C C   . ASP A 1 403 ? -11.962 97.823  -14.812 1.00 27.75  ? 400 ASP A C   1 
ATOM   3031 O O   . ASP A 1 403 ? -12.355 97.497  -15.938 1.00 20.95  ? 400 ASP A O   1 
ATOM   3032 C CB  . ASP A 1 403 ? -10.589 99.916  -14.682 1.00 33.03  ? 400 ASP A CB  1 
ATOM   3033 C CG  . ASP A 1 403 ? -10.593 101.424 -14.520 1.00 38.30  ? 400 ASP A CG  1 
ATOM   3034 O OD1 . ASP A 1 403 ? -11.660 102.043 -14.713 1.00 39.44  ? 400 ASP A OD1 1 
ATOM   3035 O OD2 . ASP A 1 403 ? -9.525  101.990 -14.203 1.00 40.62  ? 400 ASP A OD2 1 
ATOM   3036 N N   . VAL A 1 404 ? -11.535 96.926  -13.919 1.00 23.55  ? 401 VAL A N   1 
ATOM   3037 C CA  . VAL A 1 404 ? -11.496 95.502  -14.249 1.00 26.66  ? 401 VAL A CA  1 
ATOM   3038 C C   . VAL A 1 404 ? -12.895 94.993  -14.573 1.00 25.62  ? 401 VAL A C   1 
ATOM   3039 O O   . VAL A 1 404 ? -13.112 94.321  -15.588 1.00 24.06  ? 401 VAL A O   1 
ATOM   3040 C CB  . VAL A 1 404 ? -10.859 94.700  -13.100 1.00 25.83  ? 401 VAL A CB  1 
ATOM   3041 C CG1 . VAL A 1 404 ? -11.044 93.207  -13.330 1.00 17.49  ? 401 VAL A CG1 1 
ATOM   3042 C CG2 . VAL A 1 404 ? -9.385  95.039  -12.968 1.00 24.20  ? 401 VAL A CG2 1 
ATOM   3043 N N   . VAL A 1 405 ? -13.866 95.313  -13.717 1.00 22.23  ? 402 VAL A N   1 
ATOM   3044 C CA  . VAL A 1 405 ? -15.228 94.834  -13.929 1.00 25.55  ? 402 VAL A CA  1 
ATOM   3045 C C   . VAL A 1 405 ? -15.869 95.543  -15.116 1.00 20.81  ? 402 VAL A C   1 
ATOM   3046 O O   . VAL A 1 405 ? -16.558 94.918  -15.931 1.00 22.87  ? 402 VAL A O   1 
ATOM   3047 C CB  . VAL A 1 405 ? -16.056 95.010  -12.643 1.00 34.95  ? 402 VAL A CB  1 
ATOM   3048 C CG1 . VAL A 1 405 ? -17.505 94.615  -12.881 1.00 26.92  ? 402 VAL A CG1 1 
ATOM   3049 C CG2 . VAL A 1 405 ? -15.454 94.188  -11.514 1.00 25.31  ? 402 VAL A CG2 1 
ATOM   3050 N N   . GLY A 1 406 ? -15.645 96.853  -15.240 1.00 21.86  ? 403 GLY A N   1 
ATOM   3051 C CA  . GLY A 1 406 ? -16.272 97.601  -16.317 1.00 21.58  ? 403 GLY A CA  1 
ATOM   3052 C C   . GLY A 1 406 ? -15.743 97.230  -17.689 1.00 27.41  ? 403 GLY A C   1 
ATOM   3053 O O   . GLY A 1 406 ? -16.514 97.084  -18.642 1.00 31.25  ? 403 GLY A O   1 
ATOM   3054 N N   . ASP A 1 407 ? -14.422 97.075  -17.814 1.00 29.51  ? 404 ASP A N   1 
ATOM   3055 C CA  . ASP A 1 407 ? -13.844 96.723  -19.108 1.00 25.96  ? 404 ASP A CA  1 
ATOM   3056 C C   . ASP A 1 407 ? -14.190 95.292  -19.498 1.00 24.30  ? 404 ASP A C   1 
ATOM   3057 O O   . ASP A 1 407 ? -14.521 95.021  -20.658 1.00 26.01  ? 404 ASP A O   1 
ATOM   3058 C CB  . ASP A 1 407 ? -12.327 96.913  -19.081 1.00 19.58  ? 404 ASP A CB  1 
ATOM   3059 C CG  . ASP A 1 407 ? -11.922 98.340  -18.764 1.00 34.53  ? 404 ASP A CG  1 
ATOM   3060 O OD1 . ASP A 1 407 ? -12.744 99.256  -18.974 1.00 32.99  ? 404 ASP A OD1 1 
ATOM   3061 O OD2 . ASP A 1 407 ? -10.778 98.543  -18.304 1.00 39.52  ? 404 ASP A OD2 1 
ATOM   3062 N N   . HIS A 1 408 ? -14.123 94.363  -18.541 1.00 22.64  ? 405 HIS A N   1 
ATOM   3063 C CA  . HIS A 1 408 ? -14.359 92.956  -18.850 1.00 25.19  ? 405 HIS A CA  1 
ATOM   3064 C C   . HIS A 1 408 ? -15.806 92.693  -19.249 1.00 32.83  ? 405 HIS A C   1 
ATOM   3065 O O   . HIS A 1 408 ? -16.065 91.826  -20.092 1.00 28.29  ? 405 HIS A O   1 
ATOM   3066 C CB  . HIS A 1 408 ? -13.971 92.092  -17.649 1.00 20.42  ? 405 HIS A CB  1 
ATOM   3067 C CG  . HIS A 1 408 ? -14.363 90.653  -17.782 1.00 21.09  ? 405 HIS A CG  1 
ATOM   3068 N ND1 . HIS A 1 408 ? -13.985 89.873  -18.853 1.00 31.63  ? 405 HIS A ND1 1 
ATOM   3069 C CD2 . HIS A 1 408 ? -15.094 89.851  -16.972 1.00 26.91  ? 405 HIS A CD2 1 
ATOM   3070 C CE1 . HIS A 1 408 ? -14.469 88.653  -18.699 1.00 30.67  ? 405 HIS A CE1 1 
ATOM   3071 N NE2 . HIS A 1 408 ? -15.146 88.613  -17.565 1.00 27.45  ? 405 HIS A NE2 1 
ATOM   3072 N N   . ASN A 1 409 ? -16.755 93.426  -18.671 1.00 26.29  ? 406 ASN A N   1 
ATOM   3073 C CA  . ASN A 1 409 ? -18.169 93.141  -18.882 1.00 28.30  ? 406 ASN A CA  1 
ATOM   3074 C C   . ASN A 1 409 ? -18.856 94.094  -19.851 1.00 20.10  ? 406 ASN A C   1 
ATOM   3075 O O   . ASN A 1 409 ? -19.842 93.701  -20.483 1.00 23.99  ? 406 ASN A O   1 
ATOM   3076 C CB  . ASN A 1 409 ? -18.923 93.170  -17.548 1.00 22.80  ? 406 ASN A CB  1 
ATOM   3077 C CG  . ASN A 1 409 ? -18.533 92.029  -16.631 1.00 20.87  ? 406 ASN A CG  1 
ATOM   3078 O OD1 . ASN A 1 409 ? -18.879 90.873  -16.878 1.00 33.04  ? 406 ASN A OD1 1 
ATOM   3079 N ND2 . ASN A 1 409 ? -17.820 92.349  -15.557 1.00 20.63  ? 406 ASN A ND2 1 
ATOM   3080 N N   . VAL A 1 410 ? -18.379 95.331  -19.986 1.00 23.86  ? 407 VAL A N   1 
ATOM   3081 C CA  . VAL A 1 410 ? -19.113 96.327  -20.761 1.00 21.97  ? 407 VAL A CA  1 
ATOM   3082 C C   . VAL A 1 410 ? -18.242 96.954  -21.843 1.00 24.14  ? 407 VAL A C   1 
ATOM   3083 O O   . VAL A 1 410 ? -18.511 96.791  -23.038 1.00 23.92  ? 407 VAL A O   1 
ATOM   3084 C CB  . VAL A 1 410 ? -19.693 97.420  -19.844 1.00 26.84  ? 407 VAL A CB  1 
ATOM   3085 C CG1 . VAL A 1 410 ? -20.472 98.431  -20.668 1.00 23.91  ? 407 VAL A CG1 1 
ATOM   3086 C CG2 . VAL A 1 410 ? -20.579 96.808  -18.769 1.00 21.00  ? 407 VAL A CG2 1 
ATOM   3087 N N   . VAL A 1 411 ? -17.199 97.680  -21.429 1.00 26.89  ? 408 VAL A N   1 
ATOM   3088 C CA  . VAL A 1 411 ? -16.479 98.562  -22.348 1.00 21.75  ? 408 VAL A CA  1 
ATOM   3089 C C   . VAL A 1 411 ? -15.879 97.771  -23.505 1.00 31.13  ? 408 VAL A C   1 
ATOM   3090 O O   . VAL A 1 411 ? -16.054 98.123  -24.678 1.00 29.46  ? 408 VAL A O   1 
ATOM   3091 C CB  . VAL A 1 411 ? -15.398 99.356  -21.593 1.00 26.92  ? 408 VAL A CB  1 
ATOM   3092 C CG1 . VAL A 1 411 ? -14.630 100.251 -22.555 1.00 33.39  ? 408 VAL A CG1 1 
ATOM   3093 C CG2 . VAL A 1 411 ? -16.025 100.177 -20.478 1.00 28.44  ? 408 VAL A CG2 1 
ATOM   3094 N N   . CYS A 1 412 ? -15.168 96.695  -23.196 1.00 22.23  ? 409 CYS A N   1 
ATOM   3095 C CA  . CYS A 1 412 ? -14.466 95.948  -24.233 1.00 27.20  ? 409 CYS A CA  1 
ATOM   3096 C C   . CYS A 1 412 ? -15.407 95.096  -25.083 1.00 32.48  ? 409 CYS A C   1 
ATOM   3097 O O   . CYS A 1 412 ? -15.198 95.001  -26.300 1.00 36.34  ? 409 CYS A O   1 
ATOM   3098 C CB  . CYS A 1 412 ? -13.365 95.092  -23.608 1.00 27.73  ? 409 CYS A CB  1 
ATOM   3099 S SG  . CYS A 1 412 ? -12.158 96.091  -22.714 1.00 31.34  ? 409 CYS A SG  1 
ATOM   3100 N N   . PRO A 1 413 ? -16.436 94.452  -24.513 1.00 34.92  ? 410 PRO A N   1 
ATOM   3101 C CA  . PRO A 1 413 ? -17.447 93.833  -25.389 1.00 37.38  ? 410 PRO A CA  1 
ATOM   3102 C C   . PRO A 1 413 ? -18.121 94.830  -26.315 1.00 30.41  ? 410 PRO A C   1 
ATOM   3103 O O   . PRO A 1 413 ? -18.441 94.486  -27.459 1.00 28.74  ? 410 PRO A O   1 
ATOM   3104 C CB  . PRO A 1 413 ? -18.438 93.214  -24.394 1.00 27.61  ? 410 PRO A CB  1 
ATOM   3105 C CG  . PRO A 1 413 ? -17.613 92.916  -23.202 1.00 30.48  ? 410 PRO A CG  1 
ATOM   3106 C CD  . PRO A 1 413 ? -16.624 94.044  -23.107 1.00 26.98  ? 410 PRO A CD  1 
ATOM   3107 N N   . VAL A 1 414 ? -18.341 96.062  -25.852 1.00 26.25  ? 411 VAL A N   1 
ATOM   3108 C CA  . VAL A 1 414 ? -18.940 97.081  -26.709 1.00 27.44  ? 411 VAL A CA  1 
ATOM   3109 C C   . VAL A 1 414 ? -17.945 97.544  -27.767 1.00 36.89  ? 411 VAL A C   1 
ATOM   3110 O O   . VAL A 1 414 ? -18.298 97.704  -28.942 1.00 33.46  ? 411 VAL A O   1 
ATOM   3111 C CB  . VAL A 1 414 ? -19.456 98.256  -25.858 1.00 21.36  ? 411 VAL A CB  1 
ATOM   3112 C CG1 . VAL A 1 414 ? -19.722 99.473  -26.729 1.00 23.56  ? 411 VAL A CG1 1 
ATOM   3113 C CG2 . VAL A 1 414 ? -20.719 97.852  -25.111 1.00 22.10  ? 411 VAL A CG2 1 
ATOM   3114 N N   . ALA A 1 415 ? -16.687 97.763  -27.371 1.00 31.01  ? 412 ALA A N   1 
ATOM   3115 C CA  . ALA A 1 415 ? -15.676 98.202  -28.329 1.00 31.29  ? 412 ALA A CA  1 
ATOM   3116 C C   . ALA A 1 415 ? -15.430 97.143  -29.396 1.00 28.94  ? 412 ALA A C   1 
ATOM   3117 O O   . ALA A 1 415 ? -15.275 97.467  -30.580 1.00 23.46  ? 412 ALA A O   1 
ATOM   3118 C CB  . ALA A 1 415 ? -14.376 98.546  -27.603 1.00 23.84  ? 412 ALA A CB  1 
ATOM   3119 N N   . GLN A 1 416 ? -15.393 95.870  -28.997 1.00 24.39  ? 413 GLN A N   1 
ATOM   3120 C CA  . GLN A 1 416 ? -15.220 94.796  -29.969 1.00 25.80  ? 413 GLN A CA  1 
ATOM   3121 C C   . GLN A 1 416 ? -16.397 94.737  -30.934 1.00 41.66  ? 413 GLN A C   1 
ATOM   3122 O O   . GLN A 1 416 ? -16.219 94.473  -32.129 1.00 31.86  ? 413 GLN A O   1 
ATOM   3123 C CB  . GLN A 1 416 ? -15.048 93.460  -29.246 1.00 30.09  ? 413 GLN A CB  1 
ATOM   3124 C CG  . GLN A 1 416 ? -14.698 92.296  -30.157 1.00 32.47  ? 413 GLN A CG  1 
ATOM   3125 C CD  . GLN A 1 416 ? -14.539 90.991  -29.401 1.00 55.86  ? 413 GLN A CD  1 
ATOM   3126 O OE1 . GLN A 1 416 ? -15.470 90.523  -28.744 1.00 61.95  ? 413 GLN A OE1 1 
ATOM   3127 N NE2 . GLN A 1 416 ? -13.353 90.399  -29.486 1.00 55.32  ? 413 GLN A NE2 1 
ATOM   3128 N N   . LEU A 1 417 ? -17.608 94.987  -30.432 1.00 38.99  ? 414 LEU A N   1 
ATOM   3129 C CA  . LEU A 1 417 ? -18.784 94.990  -31.295 1.00 32.29  ? 414 LEU A CA  1 
ATOM   3130 C C   . LEU A 1 417 ? -18.767 96.182  -32.245 1.00 27.65  ? 414 LEU A C   1 
ATOM   3131 O O   . LEU A 1 417 ? -19.034 96.036  -33.443 1.00 27.04  ? 414 LEU A O   1 
ATOM   3132 C CB  . LEU A 1 417 ? -20.055 94.996  -30.445 1.00 35.22  ? 414 LEU A CB  1 
ATOM   3133 C CG  . LEU A 1 417 ? -21.376 95.215  -31.187 1.00 32.80  ? 414 LEU A CG  1 
ATOM   3134 C CD1 . LEU A 1 417 ? -21.614 94.115  -32.208 1.00 29.78  ? 414 LEU A CD1 1 
ATOM   3135 C CD2 . LEU A 1 417 ? -22.530 95.294  -30.202 1.00 34.96  ? 414 LEU A CD2 1 
ATOM   3136 N N   . ALA A 1 418 ? -18.452 97.372  -31.726 1.00 24.72  ? 415 ALA A N   1 
ATOM   3137 C CA  . ALA A 1 418 ? -18.466 98.572  -32.557 1.00 31.68  ? 415 ALA A CA  1 
ATOM   3138 C C   . ALA A 1 418 ? -17.420 98.495  -33.662 1.00 37.34  ? 415 ALA A C   1 
ATOM   3139 O O   . ALA A 1 418 ? -17.650 98.973  -34.780 1.00 37.75  ? 415 ALA A O   1 
ATOM   3140 C CB  . ALA A 1 418 ? -18.243 99.811  -31.692 1.00 26.13  ? 415 ALA A CB  1 
ATOM   3141 N N   . GLY A 1 419 ? -16.263 97.898  -33.370 1.00 36.74  ? 416 GLY A N   1 
ATOM   3142 C CA  . GLY A 1 419 ? -15.232 97.776  -34.386 1.00 34.61  ? 416 GLY A CA  1 
ATOM   3143 C C   . GLY A 1 419 ? -15.618 96.820  -35.499 1.00 34.25  ? 416 GLY A C   1 
ATOM   3144 O O   . GLY A 1 419 ? -15.362 97.089  -36.676 1.00 38.97  ? 416 GLY A O   1 
ATOM   3145 N N   . ARG A 1 420 ? -16.239 95.693  -35.145 1.00 25.03  ? 417 ARG A N   1 
ATOM   3146 C CA  . ARG A 1 420 ? -16.658 94.736  -36.163 1.00 30.40  ? 417 ARG A CA  1 
ATOM   3147 C C   . ARG A 1 420 ? -17.835 95.257  -36.978 1.00 42.45  ? 417 ARG A C   1 
ATOM   3148 O O   . ARG A 1 420 ? -17.924 94.978  -38.179 1.00 48.07  ? 417 ARG A O   1 
ATOM   3149 C CB  . ARG A 1 420 ? -17.011 93.396  -35.519 1.00 27.57  ? 417 ARG A CB  1 
ATOM   3150 C CG  . ARG A 1 420 ? -15.807 92.572  -35.090 1.00 41.73  ? 417 ARG A CG  1 
ATOM   3151 C CD  . ARG A 1 420 ? -14.766 92.503  -36.199 1.00 51.82  ? 417 ARG A CD  1 
ATOM   3152 N NE  . ARG A 1 420 ? -13.988 91.268  -36.152 1.00 53.38  ? 417 ARG A NE  1 
ATOM   3153 C CZ  . ARG A 1 420 ? -14.155 90.251  -36.992 1.00 47.66  ? 417 ARG A CZ  1 
ATOM   3154 N NH1 . ARG A 1 420 ? -15.067 90.325  -37.952 1.00 47.73  ? 417 ARG A NH1 1 
ATOM   3155 N NH2 . ARG A 1 420 ? -13.405 89.163  -36.879 1.00 51.96  ? 417 ARG A NH2 1 
ATOM   3156 N N   . LEU A 1 421 ? -18.745 96.008  -36.352 1.00 37.46  ? 418 LEU A N   1 
ATOM   3157 C CA  . LEU A 1 421 ? -19.868 96.574  -37.094 1.00 40.02  ? 418 LEU A CA  1 
ATOM   3158 C C   . LEU A 1 421 ? -19.397 97.616  -38.100 1.00 39.30  ? 418 LEU A C   1 
ATOM   3159 O O   . LEU A 1 421 ? -19.871 97.643  -39.242 1.00 41.45  ? 418 LEU A O   1 
ATOM   3160 C CB  . LEU A 1 421 ? -20.884 97.188  -36.130 1.00 40.85  ? 418 LEU A CB  1 
ATOM   3161 C CG  . LEU A 1 421 ? -21.695 96.249  -35.235 1.00 35.91  ? 418 LEU A CG  1 
ATOM   3162 C CD1 . LEU A 1 421 ? -22.609 97.048  -34.320 1.00 30.39  ? 418 LEU A CD1 1 
ATOM   3163 C CD2 . LEU A 1 421 ? -22.498 95.265  -36.067 1.00 37.59  ? 418 LEU A CD2 1 
ATOM   3164 N N   . ALA A 1 422 ? -18.463 98.480  -37.695 1.00 34.85  ? 419 ALA A N   1 
ATOM   3165 C CA  . ALA A 1 422 ? -18.000 99.542  -38.583 1.00 36.56  ? 419 ALA A CA  1 
ATOM   3166 C C   . ALA A 1 422 ? -17.208 98.982  -39.757 1.00 44.52  ? 419 ALA A C   1 
ATOM   3167 O O   . ALA A 1 422 ? -17.372 99.435  -40.895 1.00 45.71  ? 419 ALA A O   1 
ATOM   3168 C CB  . ALA A 1 422 ? -17.158 100.548 -37.801 1.00 40.50  ? 419 ALA A CB  1 
ATOM   3169 N N   . ALA A 1 423 ? -16.351 97.997  -39.503 1.00 42.57  ? 420 ALA A N   1 
ATOM   3170 C CA  . ALA A 1 423 ? -15.507 97.415  -40.538 1.00 47.89  ? 420 ALA A CA  1 
ATOM   3171 C C   . ALA A 1 423 ? -16.237 96.397  -41.406 1.00 45.98  ? 420 ALA A C   1 
ATOM   3172 O O   . ALA A 1 423 ? -15.590 95.722  -42.214 1.00 59.95  ? 420 ALA A O   1 
ATOM   3173 C CB  . ALA A 1 423 ? -14.275 96.764  -39.905 1.00 38.72  ? 420 ALA A CB  1 
ATOM   3174 N N   . GLN A 1 424 ? -17.559 96.266  -41.266 1.00 46.47  ? 421 GLN A N   1 
ATOM   3175 C CA  . GLN A 1 424 ? -18.304 95.280  -42.040 1.00 43.83  ? 421 GLN A CA  1 
ATOM   3176 C C   . GLN A 1 424 ? -19.612 95.850  -42.579 1.00 37.23  ? 421 GLN A C   1 
ATOM   3177 O O   . GLN A 1 424 ? -20.576 95.105  -42.786 1.00 44.68  ? 421 GLN A O   1 
ATOM   3178 C CB  . GLN A 1 424 ? -18.577 94.021  -41.207 1.00 30.48  ? 421 GLN A CB  1 
ATOM   3179 C CG  . GLN A 1 424 ? -17.318 93.235  -40.863 1.00 37.17  ? 421 GLN A CG  1 
ATOM   3180 C CD  . GLN A 1 424 ? -17.558 92.150  -39.836 1.00 44.74  ? 421 GLN A CD  1 
ATOM   3181 O OE1 . GLN A 1 424 ? -16.657 91.784  -39.082 1.00 46.23  ? 421 GLN A OE1 1 
ATOM   3182 N NE2 . GLN A 1 424 ? -18.773 91.623  -39.806 1.00 41.67  ? 421 GLN A NE2 1 
ATOM   3183 N N   . GLY A 1 425 ? -19.665 97.160  -42.813 1.00 43.58  ? 422 GLY A N   1 
ATOM   3184 C CA  . GLY A 1 425 ? -20.800 97.749  -43.497 1.00 48.94  ? 422 GLY A CA  1 
ATOM   3185 C C   . GLY A 1 425 ? -21.582 98.780  -42.708 1.00 43.40  ? 422 GLY A C   1 
ATOM   3186 O O   . GLY A 1 425 ? -22.029 99.785  -43.269 1.00 42.09  ? 422 GLY A O   1 
ATOM   3187 N N   . ALA A 1 426 ? -21.764 98.545  -41.412 1.00 42.45  ? 423 ALA A N   1 
ATOM   3188 C CA  . ALA A 1 426 ? -22.591 99.424  -40.597 1.00 38.83  ? 423 ALA A CA  1 
ATOM   3189 C C   . ALA A 1 426 ? -21.858 100.717 -40.271 1.00 35.65  ? 423 ALA A C   1 
ATOM   3190 O O   . ALA A 1 426 ? -20.644 100.724 -40.052 1.00 48.56  ? 423 ALA A O   1 
ATOM   3191 C CB  . ALA A 1 426 ? -23.003 98.722  -39.304 1.00 33.93  ? 423 ALA A CB  1 
ATOM   3192 N N   . ARG A 1 427 ? -22.606 101.817 -40.244 1.00 27.47  ? 424 ARG A N   1 
ATOM   3193 C CA  . ARG A 1 427 ? -22.086 103.095 -39.776 1.00 34.87  ? 424 ARG A CA  1 
ATOM   3194 C C   . ARG A 1 427 ? -22.370 103.209 -38.283 1.00 50.30  ? 424 ARG A C   1 
ATOM   3195 O O   . ARG A 1 427 ? -23.526 103.107 -37.857 1.00 38.06  ? 424 ARG A O   1 
ATOM   3196 C CB  . ARG A 1 427 ? -22.709 104.260 -40.542 1.00 35.38  ? 424 ARG A CB  1 
ATOM   3197 C CG  . ARG A 1 427 ? -22.074 105.605 -40.228 1.00 48.02  ? 424 ARG A CG  1 
ATOM   3198 C CD  . ARG A 1 427 ? -22.610 106.700 -41.133 1.00 57.29  ? 424 ARG A CD  1 
ATOM   3199 N NE  . ARG A 1 427 ? -24.046 106.895 -40.963 1.00 77.41  ? 424 ARG A NE  1 
ATOM   3200 C CZ  . ARG A 1 427 ? -24.766 107.773 -41.654 1.00 74.03  ? 424 ARG A CZ  1 
ATOM   3201 N NH1 . ARG A 1 427 ? -26.069 107.885 -41.434 1.00 65.52  ? 424 ARG A NH1 1 
ATOM   3202 N NH2 . ARG A 1 427 ? -24.183 108.540 -42.565 1.00 77.49  ? 424 ARG A NH2 1 
ATOM   3203 N N   . VAL A 1 428 ? -21.319 103.412 -37.494 1.00 41.66  ? 425 VAL A N   1 
ATOM   3204 C CA  . VAL A 1 428 ? -21.399 103.355 -36.041 1.00 31.98  ? 425 VAL A CA  1 
ATOM   3205 C C   . VAL A 1 428 ? -21.016 104.710 -35.465 1.00 38.40  ? 425 VAL A C   1 
ATOM   3206 O O   . VAL A 1 428 ? -20.071 105.352 -35.935 1.00 41.07  ? 425 VAL A O   1 
ATOM   3207 C CB  . VAL A 1 428 ? -20.490 102.243 -35.475 1.00 32.49  ? 425 VAL A CB  1 
ATOM   3208 C CG1 . VAL A 1 428 ? -20.635 102.145 -33.964 1.00 37.03  ? 425 VAL A CG1 1 
ATOM   3209 C CG2 . VAL A 1 428 ? -20.809 100.910 -36.135 1.00 29.88  ? 425 VAL A CG2 1 
ATOM   3210 N N   . TYR A 1 429 ? -21.760 105.142 -34.450 1.00 35.93  ? 426 TYR A N   1 
ATOM   3211 C CA  . TYR A 1 429 ? -21.430 106.321 -33.661 1.00 32.10  ? 426 TYR A CA  1 
ATOM   3212 C C   . TYR A 1 429 ? -21.213 105.887 -32.219 1.00 31.23  ? 426 TYR A C   1 
ATOM   3213 O O   . TYR A 1 429 ? -22.021 105.132 -31.667 1.00 34.35  ? 426 TYR A O   1 
ATOM   3214 C CB  . TYR A 1 429 ? -22.537 107.376 -33.742 1.00 30.08  ? 426 TYR A CB  1 
ATOM   3215 C CG  . TYR A 1 429 ? -22.712 107.984 -35.115 1.00 43.32  ? 426 TYR A CG  1 
ATOM   3216 C CD1 . TYR A 1 429 ? -22.078 109.173 -35.454 1.00 39.87  ? 426 TYR A CD1 1 
ATOM   3217 C CD2 . TYR A 1 429 ? -23.513 107.373 -36.071 1.00 33.70  ? 426 TYR A CD2 1 
ATOM   3218 C CE1 . TYR A 1 429 ? -22.236 109.734 -36.707 1.00 45.18  ? 426 TYR A CE1 1 
ATOM   3219 C CE2 . TYR A 1 429 ? -23.676 107.926 -37.327 1.00 41.45  ? 426 TYR A CE2 1 
ATOM   3220 C CZ  . TYR A 1 429 ? -23.036 109.107 -37.639 1.00 45.29  ? 426 TYR A CZ  1 
ATOM   3221 O OH  . TYR A 1 429 ? -23.196 109.662 -38.888 1.00 41.22  ? 426 TYR A OH  1 
ATOM   3222 N N   . ALA A 1 430 ? -20.125 106.356 -31.614 1.00 40.30  ? 427 ALA A N   1 
ATOM   3223 C CA  . ALA A 1 430 ? -19.749 105.961 -30.266 1.00 21.88  ? 427 ALA A CA  1 
ATOM   3224 C C   . ALA A 1 430 ? -19.689 107.179 -29.355 1.00 29.05  ? 427 ALA A C   1 
ATOM   3225 O O   . ALA A 1 430 ? -19.350 108.284 -29.789 1.00 31.89  ? 427 ALA A O   1 
ATOM   3226 C CB  . ALA A 1 430 ? -18.398 105.235 -30.256 1.00 28.31  ? 427 ALA A CB  1 
ATOM   3227 N N   . TYR A 1 431 ? -20.021 106.965 -28.083 1.00 20.82  ? 428 TYR A N   1 
ATOM   3228 C CA  . TYR A 1 431 ? -19.999 108.026 -27.087 1.00 26.43  ? 428 TYR A CA  1 
ATOM   3229 C C   . TYR A 1 431 ? -19.476 107.474 -25.769 1.00 25.16  ? 428 TYR A C   1 
ATOM   3230 O O   . TYR A 1 431 ? -19.396 106.261 -25.562 1.00 25.91  ? 428 TYR A O   1 
ATOM   3231 C CB  . TYR A 1 431 ? -21.390 108.650 -26.887 1.00 28.46  ? 428 TYR A CB  1 
ATOM   3232 C CG  . TYR A 1 431 ? -22.400 107.735 -26.220 1.00 31.56  ? 428 TYR A CG  1 
ATOM   3233 C CD1 . TYR A 1 431 ? -22.478 107.639 -24.834 1.00 27.20  ? 428 TYR A CD1 1 
ATOM   3234 C CD2 . TYR A 1 431 ? -23.286 106.979 -26.977 1.00 28.61  ? 428 TYR A CD2 1 
ATOM   3235 C CE1 . TYR A 1 431 ? -23.396 106.807 -24.224 1.00 35.38  ? 428 TYR A CE1 1 
ATOM   3236 C CE2 . TYR A 1 431 ? -24.212 106.146 -26.374 1.00 35.24  ? 428 TYR A CE2 1 
ATOM   3237 C CZ  . TYR A 1 431 ? -24.261 106.064 -24.998 1.00 31.57  ? 428 TYR A CZ  1 
ATOM   3238 O OH  . TYR A 1 431 ? -25.177 105.236 -24.393 1.00 31.15  ? 428 TYR A OH  1 
ATOM   3239 N N   . VAL A 1 432 ? -19.124 108.390 -24.868 1.00 30.58  ? 429 VAL A N   1 
ATOM   3240 C CA  . VAL A 1 432 ? -18.798 108.059 -23.485 1.00 28.95  ? 429 VAL A CA  1 
ATOM   3241 C C   . VAL A 1 432 ? -19.480 109.088 -22.596 1.00 34.29  ? 429 VAL A C   1 
ATOM   3242 O O   . VAL A 1 432 ? -19.167 110.282 -22.670 1.00 31.49  ? 429 VAL A O   1 
ATOM   3243 C CB  . VAL A 1 432 ? -17.282 108.038 -23.219 1.00 33.33  ? 429 VAL A CB  1 
ATOM   3244 C CG1 . VAL A 1 432 ? -17.012 107.983 -21.725 1.00 30.06  ? 429 VAL A CG1 1 
ATOM   3245 C CG2 . VAL A 1 432 ? -16.643 106.845 -23.909 1.00 32.80  ? 429 VAL A CG2 1 
ATOM   3246 N N   . PHE A 1 433 ? -20.416 108.633 -21.768 1.00 29.33  ? 430 PHE A N   1 
ATOM   3247 C CA  . PHE A 1 433 ? -21.168 109.522 -20.891 1.00 24.54  ? 430 PHE A CA  1 
ATOM   3248 C C   . PHE A 1 433 ? -20.332 109.837 -19.656 1.00 29.27  ? 430 PHE A C   1 
ATOM   3249 O O   . PHE A 1 433 ? -19.994 108.932 -18.884 1.00 26.83  ? 430 PHE A O   1 
ATOM   3250 C CB  . PHE A 1 433 ? -22.497 108.873 -20.506 1.00 29.75  ? 430 PHE A CB  1 
ATOM   3251 C CG  . PHE A 1 433 ? -23.491 109.827 -19.910 1.00 25.17  ? 430 PHE A CG  1 
ATOM   3252 C CD1 . PHE A 1 433 ? -24.314 110.587 -20.724 1.00 22.15  ? 430 PHE A CD1 1 
ATOM   3253 C CD2 . PHE A 1 433 ? -23.614 109.954 -18.537 1.00 24.57  ? 430 PHE A CD2 1 
ATOM   3254 C CE1 . PHE A 1 433 ? -25.234 111.462 -20.180 1.00 25.53  ? 430 PHE A CE1 1 
ATOM   3255 C CE2 . PHE A 1 433 ? -24.534 110.827 -17.987 1.00 37.26  ? 430 PHE A CE2 1 
ATOM   3256 C CZ  . PHE A 1 433 ? -25.344 111.583 -18.810 1.00 23.66  ? 430 PHE A CZ  1 
ATOM   3257 N N   . GLU A 1 434 ? -19.997 111.115 -19.466 1.00 31.04  ? 431 GLU A N   1 
ATOM   3258 C CA  . GLU A 1 434 ? -19.081 111.523 -18.405 1.00 33.52  ? 431 GLU A CA  1 
ATOM   3259 C C   . GLU A 1 434 ? -19.684 112.533 -17.436 1.00 34.55  ? 431 GLU A C   1 
ATOM   3260 O O   . GLU A 1 434 ? -18.935 113.171 -16.685 1.00 41.96  ? 431 GLU A O   1 
ATOM   3261 C CB  . GLU A 1 434 ? -17.796 112.104 -19.004 1.00 32.25  ? 431 GLU A CB  1 
ATOM   3262 C CG  . GLU A 1 434 ? -17.072 111.170 -19.944 1.00 39.34  ? 431 GLU A CG  1 
ATOM   3263 C CD  . GLU A 1 434 ? -15.652 111.618 -20.219 1.00 45.27  ? 431 GLU A CD  1 
ATOM   3264 O OE1 . GLU A 1 434 ? -14.720 110.828 -19.958 1.00 55.09  ? 431 GLU A OE1 1 
ATOM   3265 O OE2 . GLU A 1 434 ? -15.467 112.763 -20.684 1.00 42.18  ? 431 GLU A OE2 1 
ATOM   3266 N N   . HIS A 1 435 ? -21.001 112.703 -17.422 1.00 31.50  ? 432 HIS A N   1 
ATOM   3267 C CA  . HIS A 1 435 ? -21.646 113.635 -16.505 1.00 29.53  ? 432 HIS A CA  1 
ATOM   3268 C C   . HIS A 1 435 ? -22.254 112.875 -15.335 1.00 33.66  ? 432 HIS A C   1 
ATOM   3269 O O   . HIS A 1 435 ? -23.030 111.935 -15.533 1.00 34.83  ? 432 HIS A O   1 
ATOM   3270 C CB  . HIS A 1 435 ? -22.728 114.455 -17.209 1.00 34.33  ? 432 HIS A CB  1 
ATOM   3271 C CG  . HIS A 1 435 ? -23.470 115.378 -16.292 1.00 33.70  ? 432 HIS A CG  1 
ATOM   3272 N ND1 . HIS A 1 435 ? -22.860 116.428 -15.639 1.00 37.08  ? 432 HIS A ND1 1 
ATOM   3273 C CD2 . HIS A 1 435 ? -24.770 115.404 -15.912 1.00 31.23  ? 432 HIS A CD2 1 
ATOM   3274 C CE1 . HIS A 1 435 ? -23.752 117.063 -14.901 1.00 26.91  ? 432 HIS A CE1 1 
ATOM   3275 N NE2 . HIS A 1 435 ? -24.919 116.462 -15.048 1.00 33.69  ? 432 HIS A NE2 1 
ATOM   3276 N N   . ARG A 1 436 ? -21.899 113.284 -14.121 1.00 28.71  ? 433 ARG A N   1 
ATOM   3277 C CA  . ARG A 1 436 ? -22.501 112.739 -12.912 1.00 30.07  ? 433 ARG A CA  1 
ATOM   3278 C C   . ARG A 1 436 ? -23.663 113.634 -12.500 1.00 33.58  ? 433 ARG A C   1 
ATOM   3279 O O   . ARG A 1 436 ? -23.487 114.844 -12.322 1.00 31.10  ? 433 ARG A O   1 
ATOM   3280 C CB  . ARG A 1 436 ? -21.470 112.636 -11.788 1.00 29.07  ? 433 ARG A CB  1 
ATOM   3281 C CG  . ARG A 1 436 ? -22.057 112.239 -10.443 1.00 29.74  ? 433 ARG A CG  1 
ATOM   3282 C CD  . ARG A 1 436 ? -20.995 112.234 -9.355  1.00 28.18  ? 433 ARG A CD  1 
ATOM   3283 N NE  . ARG A 1 436 ? -21.575 112.041 -8.029  1.00 31.69  ? 433 ARG A NE  1 
ATOM   3284 C CZ  . ARG A 1 436 ? -21.679 110.864 -7.421  1.00 29.53  ? 433 ARG A CZ  1 
ATOM   3285 N NH1 . ARG A 1 436 ? -21.236 109.765 -8.016  1.00 29.65  ? 433 ARG A NH1 1 
ATOM   3286 N NH2 . ARG A 1 436 ? -22.224 110.788 -6.215  1.00 27.66  ? 433 ARG A NH2 1 
ATOM   3287 N N   . ALA A 1 437 ? -24.847 113.041 -12.359 1.00 28.10  ? 434 ALA A N   1 
ATOM   3288 C CA  . ALA A 1 437 ? -26.034 113.816 -12.023 1.00 28.55  ? 434 ALA A CA  1 
ATOM   3289 C C   . ALA A 1 437 ? -25.882 114.471 -10.656 1.00 33.97  ? 434 ALA A C   1 
ATOM   3290 O O   . ALA A 1 437 ? -25.353 113.873 -9.715  1.00 35.92  ? 434 ALA A O   1 
ATOM   3291 C CB  . ALA A 1 437 ? -27.274 112.922 -12.045 1.00 33.08  ? 434 ALA A CB  1 
ATOM   3292 N N   . SER A 1 438 ? -26.350 115.718 -10.553 1.00 26.38  ? 435 SER A N   1 
ATOM   3293 C CA  . SER A 1 438 ? -26.256 116.456 -9.300  1.00 32.84  ? 435 SER A CA  1 
ATOM   3294 C C   . SER A 1 438 ? -27.125 115.855 -8.204  1.00 29.30  ? 435 SER A C   1 
ATOM   3295 O O   . SER A 1 438 ? -26.868 116.102 -7.021  1.00 26.90  ? 435 SER A O   1 
ATOM   3296 C CB  . SER A 1 438 ? -26.643 117.919 -9.522  1.00 31.95  ? 435 SER A CB  1 
ATOM   3297 O OG  . SER A 1 438 ? -27.985 118.029 -9.964  1.00 35.68  ? 435 SER A OG  1 
ATOM   3298 N N   . THR A 1 439 ? -28.143 115.077 -8.567  1.00 28.67  ? 436 THR A N   1 
ATOM   3299 C CA  . THR A 1 439 ? -29.040 114.451 -7.607  1.00 33.29  ? 436 THR A CA  1 
ATOM   3300 C C   . THR A 1 439 ? -28.681 112.997 -7.332  1.00 36.07  ? 436 THR A C   1 
ATOM   3301 O O   . THR A 1 439 ? -29.466 112.285 -6.697  1.00 31.17  ? 436 THR A O   1 
ATOM   3302 C CB  . THR A 1 439 ? -30.486 114.543 -8.101  1.00 36.51  ? 436 THR A CB  1 
ATOM   3303 O OG1 . THR A 1 439 ? -30.586 113.944 -9.400  1.00 31.40  ? 436 THR A OG1 1 
ATOM   3304 C CG2 . THR A 1 439 ? -30.928 115.996 -8.184  1.00 38.40  ? 436 THR A CG2 1 
ATOM   3305 N N   . LEU A 1 440 ? -27.516 112.545 -7.790  1.00 31.78  ? 437 LEU A N   1 
ATOM   3306 C CA  . LEU A 1 440 ? -27.142 111.144 -7.647  1.00 34.70  ? 437 LEU A CA  1 
ATOM   3307 C C   . LEU A 1 440 ? -26.939 110.789 -6.179  1.00 30.02  ? 437 LEU A C   1 
ATOM   3308 O O   . LEU A 1 440 ? -26.206 111.471 -5.456  1.00 26.15  ? 437 LEU A O   1 
ATOM   3309 C CB  . LEU A 1 440 ? -25.873 110.856 -8.445  1.00 31.56  ? 437 LEU A CB  1 
ATOM   3310 C CG  . LEU A 1 440 ? -25.434 109.394 -8.507  1.00 36.73  ? 437 LEU A CG  1 
ATOM   3311 C CD1 . LEU A 1 440 ? -26.575 108.518 -8.989  1.00 28.00  ? 437 LEU A CD1 1 
ATOM   3312 C CD2 . LEU A 1 440 ? -24.229 109.252 -9.415  1.00 44.19  ? 437 LEU A CD2 1 
ATOM   3313 N N   . SER A 1 441 ? -27.593 109.712 -5.741  1.00 24.64  ? 438 SER A N   1 
ATOM   3314 C CA  . SER A 1 441 ? -27.528 109.281 -4.352  1.00 29.08  ? 438 SER A CA  1 
ATOM   3315 C C   . SER A 1 441 ? -26.380 108.321 -4.073  1.00 25.11  ? 438 SER A C   1 
ATOM   3316 O O   . SER A 1 441 ? -26.043 108.107 -2.903  1.00 25.48  ? 438 SER A O   1 
ATOM   3317 C CB  . SER A 1 441 ? -28.850 108.622 -3.943  1.00 22.67  ? 438 SER A CB  1 
ATOM   3318 O OG  . SER A 1 441 ? -29.158 107.531 -4.793  1.00 32.45  ? 438 SER A OG  1 
ATOM   3319 N N   . TRP A 1 442 ? -25.781 107.735 -5.106  1.00 28.38  ? 439 TRP A N   1 
ATOM   3320 C CA  . TRP A 1 442 ? -24.639 106.860 -4.905  1.00 25.52  ? 439 TRP A CA  1 
ATOM   3321 C C   . TRP A 1 442 ? -23.427 107.671 -4.449  1.00 26.68  ? 439 TRP A C   1 
ATOM   3322 O O   . TRP A 1 442 ? -23.340 108.872 -4.717  1.00 24.07  ? 439 TRP A O   1 
ATOM   3323 C CB  . TRP A 1 442 ? -24.318 106.102 -6.191  1.00 22.02  ? 439 TRP A CB  1 
ATOM   3324 C CG  . TRP A 1 442 ? -25.303 105.020 -6.497  1.00 29.59  ? 439 TRP A CG  1 
ATOM   3325 C CD1 . TRP A 1 442 ? -26.291 105.054 -7.436  1.00 24.44  ? 439 TRP A CD1 1 
ATOM   3326 C CD2 . TRP A 1 442 ? -25.402 103.744 -5.854  1.00 29.06  ? 439 TRP A CD2 1 
ATOM   3327 N NE1 . TRP A 1 442 ? -26.996 103.874 -7.422  1.00 29.13  ? 439 TRP A NE1 1 
ATOM   3328 C CE2 . TRP A 1 442 ? -26.470 103.054 -6.459  1.00 29.67  ? 439 TRP A CE2 1 
ATOM   3329 C CE3 . TRP A 1 442 ? -24.690 103.118 -4.826  1.00 25.56  ? 439 TRP A CE3 1 
ATOM   3330 C CZ2 . TRP A 1 442 ? -26.845 101.770 -6.069  1.00 28.86  ? 439 TRP A CZ2 1 
ATOM   3331 C CZ3 . TRP A 1 442 ? -25.061 101.842 -4.443  1.00 17.71  ? 439 TRP A CZ3 1 
ATOM   3332 C CH2 . TRP A 1 442 ? -26.128 101.182 -5.064  1.00 25.90  ? 439 TRP A CH2 1 
ATOM   3333 N N   . PRO A 1 443 ? -22.483 107.042 -3.747  1.00 25.12  ? 440 PRO A N   1 
ATOM   3334 C CA  . PRO A 1 443 ? -21.327 107.787 -3.234  1.00 26.58  ? 440 PRO A CA  1 
ATOM   3335 C C   . PRO A 1 443 ? -20.500 108.401 -4.354  1.00 29.80  ? 440 PRO A C   1 
ATOM   3336 O O   . PRO A 1 443 ? -20.583 108.009 -5.520  1.00 30.97  ? 440 PRO A O   1 
ATOM   3337 C CB  . PRO A 1 443 ? -20.527 106.726 -2.466  1.00 21.82  ? 440 PRO A CB  1 
ATOM   3338 C CG  . PRO A 1 443 ? -20.981 105.422 -3.031  1.00 28.15  ? 440 PRO A CG  1 
ATOM   3339 C CD  . PRO A 1 443 ? -22.430 105.622 -3.358  1.00 24.32  ? 440 PRO A CD  1 
ATOM   3340 N N   . LEU A 1 444 ? -19.681 109.384 -3.972  1.00 36.11  ? 441 LEU A N   1 
ATOM   3341 C CA  . LEU A 1 444 ? -18.920 110.145 -4.957  1.00 33.32  ? 441 LEU A CA  1 
ATOM   3342 C C   . LEU A 1 444 ? -17.849 109.297 -5.635  1.00 32.01  ? 441 LEU A C   1 
ATOM   3343 O O   . LEU A 1 444 ? -17.532 109.532 -6.807  1.00 34.59  ? 441 LEU A O   1 
ATOM   3344 C CB  . LEU A 1 444 ? -18.291 111.372 -4.294  1.00 30.72  ? 441 LEU A CB  1 
ATOM   3345 C CG  . LEU A 1 444 ? -17.572 112.368 -5.206  1.00 43.91  ? 441 LEU A CG  1 
ATOM   3346 C CD1 . LEU A 1 444 ? -18.514 112.895 -6.277  1.00 41.29  ? 441 LEU A CD1 1 
ATOM   3347 C CD2 . LEU A 1 444 ? -16.988 113.512 -4.392  1.00 46.87  ? 441 LEU A CD2 1 
ATOM   3348 N N   . TRP A 1 445 ? -17.288 108.308 -4.930  1.00 28.85  ? 442 TRP A N   1 
ATOM   3349 C CA  . TRP A 1 445 ? -16.203 107.523 -5.510  1.00 31.48  ? 442 TRP A CA  1 
ATOM   3350 C C   . TRP A 1 445 ? -16.670 106.647 -6.665  1.00 34.45  ? 442 TRP A C   1 
ATOM   3351 O O   . TRP A 1 445 ? -15.835 106.193 -7.455  1.00 39.34  ? 442 TRP A O   1 
ATOM   3352 C CB  . TRP A 1 445 ? -15.523 106.665 -4.438  1.00 21.05  ? 442 TRP A CB  1 
ATOM   3353 C CG  . TRP A 1 445 ? -16.391 105.609 -3.811  1.00 30.13  ? 442 TRP A CG  1 
ATOM   3354 C CD1 . TRP A 1 445 ? -17.068 105.702 -2.630  1.00 33.49  ? 442 TRP A CD1 1 
ATOM   3355 C CD2 . TRP A 1 445 ? -16.653 104.293 -4.321  1.00 22.15  ? 442 TRP A CD2 1 
ATOM   3356 N NE1 . TRP A 1 445 ? -17.742 104.531 -2.377  1.00 26.32  ? 442 TRP A NE1 1 
ATOM   3357 C CE2 . TRP A 1 445 ? -17.505 103.651 -3.400  1.00 21.74  ? 442 TRP A CE2 1 
ATOM   3358 C CE3 . TRP A 1 445 ? -16.256 103.599 -5.469  1.00 24.40  ? 442 TRP A CE3 1 
ATOM   3359 C CZ2 . TRP A 1 445 ? -17.967 102.350 -3.590  1.00 21.45  ? 442 TRP A CZ2 1 
ATOM   3360 C CZ3 . TRP A 1 445 ? -16.717 102.307 -5.657  1.00 22.09  ? 442 TRP A CZ3 1 
ATOM   3361 C CH2 . TRP A 1 445 ? -17.563 101.696 -4.722  1.00 23.79  ? 442 TRP A CH2 1 
ATOM   3362 N N   . MET A 1 446 ? -17.978 106.401 -6.786  1.00 33.47  ? 443 MET A N   1 
ATOM   3363 C CA  . MET A 1 446 ? -18.490 105.653 -7.930  1.00 28.01  ? 443 MET A CA  1 
ATOM   3364 C C   . MET A 1 446 ? -18.490 106.466 -9.215  1.00 22.81  ? 443 MET A C   1 
ATOM   3365 O O   . MET A 1 446 ? -18.596 105.879 -10.298 1.00 32.42  ? 443 MET A O   1 
ATOM   3366 C CB  . MET A 1 446 ? -19.903 105.137 -7.646  1.00 24.46  ? 443 MET A CB  1 
ATOM   3367 C CG  . MET A 1 446 ? -19.961 103.989 -6.656  1.00 24.54  ? 443 MET A CG  1 
ATOM   3368 S SD  . MET A 1 446 ? -21.614 103.280 -6.527  1.00 35.35  ? 443 MET A SD  1 
ATOM   3369 C CE  . MET A 1 446 ? -21.333 101.956 -5.354  1.00 29.84  ? 443 MET A CE  1 
ATOM   3370 N N   . GLY A 1 447 ? -18.369 107.781 -9.131  1.00 25.19  ? 444 GLY A N   1 
ATOM   3371 C CA  . GLY A 1 447 ? -18.231 108.571 -10.345 1.00 26.30  ? 444 GLY A CA  1 
ATOM   3372 C C   . GLY A 1 447 ? -19.535 108.598 -11.110 1.00 29.08  ? 444 GLY A C   1 
ATOM   3373 O O   . GLY A 1 447 ? -20.578 109.013 -10.589 1.00 27.82  ? 444 GLY A O   1 
ATOM   3374 N N   . VAL A 1 448 ? -19.479 108.152 -12.363 1.00 25.96  ? 445 VAL A N   1 
ATOM   3375 C CA  . VAL A 1 448 ? -20.655 108.040 -13.219 1.00 20.47  ? 445 VAL A CA  1 
ATOM   3376 C C   . VAL A 1 448 ? -21.016 106.563 -13.326 1.00 22.01  ? 445 VAL A C   1 
ATOM   3377 O O   . VAL A 1 448 ? -20.518 105.865 -14.221 1.00 22.84  ? 445 VAL A O   1 
ATOM   3378 C CB  . VAL A 1 448 ? -20.402 108.659 -14.604 1.00 31.36  ? 445 VAL A CB  1 
ATOM   3379 C CG1 . VAL A 1 448 ? -21.689 108.693 -15.426 1.00 25.40  ? 445 VAL A CG1 1 
ATOM   3380 C CG2 . VAL A 1 448 ? -19.814 110.053 -14.459 1.00 24.59  ? 445 VAL A CG2 1 
ATOM   3381 N N   . PRO A 1 449 ? -21.873 106.047 -12.449 1.00 25.29  ? 446 PRO A N   1 
ATOM   3382 C CA  . PRO A 1 449 ? -22.089 104.598 -12.388 1.00 21.73  ? 446 PRO A CA  1 
ATOM   3383 C C   . PRO A 1 449 ? -22.869 104.092 -13.590 1.00 23.00  ? 446 PRO A C   1 
ATOM   3384 O O   . PRO A 1 449 ? -23.427 104.849 -14.387 1.00 21.65  ? 446 PRO A O   1 
ATOM   3385 C CB  . PRO A 1 449 ? -22.882 104.403 -11.090 1.00 22.50  ? 446 PRO A CB  1 
ATOM   3386 C CG  . PRO A 1 449 ? -22.758 105.710 -10.344 1.00 27.58  ? 446 PRO A CG  1 
ATOM   3387 C CD  . PRO A 1 449 ? -22.620 106.756 -11.401 1.00 26.53  ? 446 PRO A CD  1 
ATOM   3388 N N   . HIS A 1 450 ? -22.901 102.768 -13.700 1.00 25.85  ? 447 HIS A N   1 
ATOM   3389 C CA  . HIS A 1 450 ? -23.619 102.103 -14.777 1.00 24.69  ? 447 HIS A CA  1 
ATOM   3390 C C   . HIS A 1 450 ? -25.118 102.343 -14.649 1.00 34.23  ? 447 HIS A C   1 
ATOM   3391 O O   . HIS A 1 450 ? -25.712 102.086 -13.597 1.00 28.13  ? 447 HIS A O   1 
ATOM   3392 C CB  . HIS A 1 450 ? -23.312 100.607 -14.746 1.00 27.87  ? 447 HIS A CB  1 
ATOM   3393 C CG  . HIS A 1 450 ? -24.167 99.790  -15.661 1.00 26.99  ? 447 HIS A CG  1 
ATOM   3394 N ND1 . HIS A 1 450 ? -23.830 99.546  -16.975 1.00 32.52  ? 447 HIS A ND1 1 
ATOM   3395 C CD2 . HIS A 1 450 ? -25.342 99.151  -15.449 1.00 34.01  ? 447 HIS A CD2 1 
ATOM   3396 C CE1 . HIS A 1 450 ? -24.762 98.796  -17.534 1.00 29.65  ? 447 HIS A CE1 1 
ATOM   3397 N NE2 . HIS A 1 450 ? -25.691 98.543  -16.630 1.00 40.71  ? 447 HIS A NE2 1 
ATOM   3398 N N   . GLY A 1 451 ? -25.729 102.845 -15.721 1.00 31.49  ? 448 GLY A N   1 
ATOM   3399 C CA  . GLY A 1 451 ? -27.166 103.005 -15.787 1.00 29.66  ? 448 GLY A CA  1 
ATOM   3400 C C   . GLY A 1 451 ? -27.691 104.397 -15.512 1.00 30.82  ? 448 GLY A C   1 
ATOM   3401 O O   . GLY A 1 451 ? -28.908 104.603 -15.592 1.00 33.97  ? 448 GLY A O   1 
ATOM   3402 N N   . TYR A 1 452 ? -26.824 105.361 -15.199 1.00 22.66  ? 449 TYR A N   1 
ATOM   3403 C CA  . TYR A 1 452 ? -27.265 106.696 -14.815 1.00 21.49  ? 449 TYR A CA  1 
ATOM   3404 C C   . TYR A 1 452 ? -27.065 107.723 -15.924 1.00 24.18  ? 449 TYR A C   1 
ATOM   3405 O O   . TYR A 1 452 ? -26.912 108.918 -15.650 1.00 23.77  ? 449 TYR A O   1 
ATOM   3406 C CB  . TYR A 1 452 ? -26.572 107.125 -13.523 1.00 19.24  ? 449 TYR A CB  1 
ATOM   3407 C CG  . TYR A 1 452 ? -27.125 106.373 -12.339 1.00 26.83  ? 449 TYR A CG  1 
ATOM   3408 C CD1 . TYR A 1 452 ? -28.227 106.851 -11.645 1.00 26.13  ? 449 TYR A CD1 1 
ATOM   3409 C CD2 . TYR A 1 452 ? -26.577 105.160 -11.945 1.00 23.99  ? 449 TYR A CD2 1 
ATOM   3410 C CE1 . TYR A 1 452 ? -28.751 106.158 -10.574 1.00 29.03  ? 449 TYR A CE1 1 
ATOM   3411 C CE2 . TYR A 1 452 ? -27.094 104.459 -10.874 1.00 24.55  ? 449 TYR A CE2 1 
ATOM   3412 C CZ  . TYR A 1 452 ? -28.182 104.962 -10.192 1.00 24.38  ? 449 TYR A CZ  1 
ATOM   3413 O OH  . TYR A 1 452 ? -28.703 104.269 -9.124  1.00 37.28  ? 449 TYR A OH  1 
ATOM   3414 N N   . GLU A 1 453 ? -27.066 107.271 -17.176 1.00 25.59  ? 450 GLU A N   1 
ATOM   3415 C CA  . GLU A 1 453 ? -27.295 108.138 -18.320 1.00 27.16  ? 450 GLU A CA  1 
ATOM   3416 C C   . GLU A 1 453 ? -28.732 108.061 -18.812 1.00 36.32  ? 450 GLU A C   1 
ATOM   3417 O O   . GLU A 1 453 ? -29.142 108.899 -19.622 1.00 30.49  ? 450 GLU A O   1 
ATOM   3418 C CB  . GLU A 1 453 ? -26.342 107.776 -19.468 1.00 20.34  ? 450 GLU A CB  1 
ATOM   3419 C CG  . GLU A 1 453 ? -26.866 106.702 -20.422 1.00 28.20  ? 450 GLU A CG  1 
ATOM   3420 C CD  . GLU A 1 453 ? -26.852 105.301 -19.828 1.00 33.15  ? 450 GLU A CD  1 
ATOM   3421 O OE1 . GLU A 1 453 ? -26.535 105.149 -18.629 1.00 32.93  ? 450 GLU A OE1 1 
ATOM   3422 O OE2 . GLU A 1 453 ? -27.157 104.343 -20.570 1.00 31.52  ? 450 GLU A OE2 1 
ATOM   3423 N N   . ILE A 1 454 ? -29.501 107.083 -18.324 1.00 28.86  ? 451 ILE A N   1 
ATOM   3424 C CA  . ILE A 1 454 ? -30.860 106.862 -18.809 1.00 30.43  ? 451 ILE A CA  1 
ATOM   3425 C C   . ILE A 1 454 ? -31.754 108.047 -18.469 1.00 27.75  ? 451 ILE A C   1 
ATOM   3426 O O   . ILE A 1 454 ? -32.573 108.479 -19.290 1.00 28.40  ? 451 ILE A O   1 
ATOM   3427 C CB  . ILE A 1 454 ? -31.418 105.549 -18.228 1.00 30.48  ? 451 ILE A CB  1 
ATOM   3428 C CG1 . ILE A 1 454 ? -30.508 104.374 -18.594 1.00 25.87  ? 451 ILE A CG1 1 
ATOM   3429 C CG2 . ILE A 1 454 ? -32.837 105.305 -18.716 1.00 29.36  ? 451 ILE A CG2 1 
ATOM   3430 C CD1 . ILE A 1 454 ? -30.936 103.056 -17.984 1.00 30.94  ? 451 ILE A CD1 1 
ATOM   3431 N N   . GLU A 1 455 ? -31.614 108.592 -17.257 1.00 22.08  ? 452 GLU A N   1 
ATOM   3432 C CA  . GLU A 1 455 ? -32.471 109.699 -16.842 1.00 30.43  ? 452 GLU A CA  1 
ATOM   3433 C C   . GLU A 1 455 ? -32.274 110.928 -17.720 1.00 32.98  ? 452 GLU A C   1 
ATOM   3434 O O   . GLU A 1 455 ? -33.188 111.748 -17.852 1.00 35.12  ? 452 GLU A O   1 
ATOM   3435 C CB  . GLU A 1 455 ? -32.215 110.043 -15.374 1.00 26.82  ? 452 GLU A CB  1 
ATOM   3436 C CG  . GLU A 1 455 ? -30.749 110.240 -15.021 1.00 33.50  ? 452 GLU A CG  1 
ATOM   3437 C CD  . GLU A 1 455 ? -30.499 110.198 -13.524 1.00 38.02  ? 452 GLU A CD  1 
ATOM   3438 O OE1 . GLU A 1 455 ? -30.698 111.231 -12.851 1.00 37.66  ? 452 GLU A OE1 1 
ATOM   3439 O OE2 . GLU A 1 455 ? -30.111 109.124 -13.018 1.00 34.27  ? 452 GLU A OE2 1 
ATOM   3440 N N   . PHE A 1 456 ? -31.099 111.073 -18.330 1.00 31.32  ? 453 PHE A N   1 
ATOM   3441 C CA  . PHE A 1 456 ? -30.876 112.202 -19.224 1.00 31.71  ? 453 PHE A CA  1 
ATOM   3442 C C   . PHE A 1 456 ? -31.359 111.915 -20.638 1.00 24.49  ? 453 PHE A C   1 
ATOM   3443 O O   . PHE A 1 456 ? -31.761 112.842 -21.349 1.00 37.32  ? 453 PHE A O   1 
ATOM   3444 C CB  . PHE A 1 456 ? -29.396 112.579 -19.233 1.00 28.16  ? 453 PHE A CB  1 
ATOM   3445 C CG  . PHE A 1 456 ? -28.915 113.161 -17.935 1.00 23.25  ? 453 PHE A CG  1 
ATOM   3446 C CD1 . PHE A 1 456 ? -28.380 112.348 -16.949 1.00 24.74  ? 453 PHE A CD1 1 
ATOM   3447 C CD2 . PHE A 1 456 ? -29.000 114.524 -17.701 1.00 21.78  ? 453 PHE A CD2 1 
ATOM   3448 C CE1 . PHE A 1 456 ? -27.936 112.885 -15.753 1.00 32.96  ? 453 PHE A CE1 1 
ATOM   3449 C CE2 . PHE A 1 456 ? -28.558 115.066 -16.508 1.00 27.36  ? 453 PHE A CE2 1 
ATOM   3450 C CZ  . PHE A 1 456 ? -28.026 114.245 -15.533 1.00 29.46  ? 453 PHE A CZ  1 
ATOM   3451 N N   . ILE A 1 457 ? -31.335 110.650 -21.058 1.00 25.09  ? 454 ILE A N   1 
ATOM   3452 C CA  . ILE A 1 457 ? -31.843 110.300 -22.379 1.00 25.54  ? 454 ILE A CA  1 
ATOM   3453 C C   . ILE A 1 457 ? -33.355 110.482 -22.433 1.00 32.48  ? 454 ILE A C   1 
ATOM   3454 O O   . ILE A 1 457 ? -33.909 110.896 -23.459 1.00 38.08  ? 454 ILE A O   1 
ATOM   3455 C CB  . ILE A 1 457 ? -31.430 108.863 -22.746 1.00 32.18  ? 454 ILE A CB  1 
ATOM   3456 C CG1 . ILE A 1 457 ? -29.906 108.721 -22.721 1.00 34.56  ? 454 ILE A CG1 1 
ATOM   3457 C CG2 . ILE A 1 457 ? -31.972 108.482 -24.112 1.00 21.76  ? 454 ILE A CG2 1 
ATOM   3458 C CD1 . ILE A 1 457 ? -29.190 109.619 -23.705 1.00 34.61  ? 454 ILE A CD1 1 
ATOM   3459 N N   . PHE A 1 458 ? -34.044 110.190 -21.332 1.00 29.49  ? 455 PHE A N   1 
ATOM   3460 C CA  . PHE A 1 458 ? -35.495 110.304 -21.263 1.00 33.26  ? 455 PHE A CA  1 
ATOM   3461 C C   . PHE A 1 458 ? -35.965 111.675 -20.790 1.00 30.38  ? 455 PHE A C   1 
ATOM   3462 O O   . PHE A 1 458 ? -37.162 111.851 -20.543 1.00 38.50  ? 455 PHE A O   1 
ATOM   3463 C CB  . PHE A 1 458 ? -36.064 109.215 -20.349 1.00 23.64  ? 455 PHE A CB  1 
ATOM   3464 C CG  . PHE A 1 458 ? -36.124 107.857 -20.989 1.00 31.26  ? 455 PHE A CG  1 
ATOM   3465 C CD1 . PHE A 1 458 ? -35.038 106.999 -20.935 1.00 25.01  ? 455 PHE A CD1 1 
ATOM   3466 C CD2 . PHE A 1 458 ? -37.269 107.438 -21.647 1.00 25.27  ? 455 PHE A CD2 1 
ATOM   3467 C CE1 . PHE A 1 458 ? -35.094 105.747 -21.525 1.00 22.93  ? 455 PHE A CE1 1 
ATOM   3468 C CE2 . PHE A 1 458 ? -37.332 106.190 -22.238 1.00 27.96  ? 455 PHE A CE2 1 
ATOM   3469 C CZ  . PHE A 1 458 ? -36.243 105.343 -22.177 1.00 30.75  ? 455 PHE A CZ  1 
ATOM   3470 N N   . GLY A 1 459 ? -35.061 112.641 -20.658 1.00 30.64  ? 456 GLY A N   1 
ATOM   3471 C CA  . GLY A 1 459 ? -35.456 113.985 -20.276 1.00 26.85  ? 456 GLY A CA  1 
ATOM   3472 C C   . GLY A 1 459 ? -36.037 114.108 -18.886 1.00 30.91  ? 456 GLY A C   1 
ATOM   3473 O O   . GLY A 1 459 ? -36.849 115.005 -18.640 1.00 41.71  ? 456 GLY A O   1 
ATOM   3474 N N   . ILE A 1 460 ? -35.644 113.221 -17.968 1.00 30.63  ? 457 ILE A N   1 
ATOM   3475 C CA  . ILE A 1 460 ? -36.147 113.305 -16.593 1.00 22.27  ? 457 ILE A CA  1 
ATOM   3476 C C   . ILE A 1 460 ? -35.821 114.638 -15.933 1.00 33.02  ? 457 ILE A C   1 
ATOM   3477 O O   . ILE A 1 460 ? -36.650 115.132 -15.154 1.00 37.21  ? 457 ILE A O   1 
ATOM   3478 C CB  . ILE A 1 460 ? -35.663 112.095 -15.781 1.00 24.73  ? 457 ILE A CB  1 
ATOM   3479 C CG1 . ILE A 1 460 ? -36.082 110.796 -16.471 1.00 25.49  ? 457 ILE A CG1 1 
ATOM   3480 C CG2 . ILE A 1 460 ? -36.219 112.131 -14.367 1.00 29.64  ? 457 ILE A CG2 1 
ATOM   3481 C CD1 . ILE A 1 460 ? -37.577 110.667 -16.673 1.00 28.86  ? 457 ILE A CD1 1 
ATOM   3482 N N   . PRO A 1 461 ? -34.649 115.283 -16.174 1.00 28.90  ? 458 PRO A N   1 
ATOM   3483 C CA  . PRO A 1 461 ? -34.413 116.610 -15.581 1.00 31.41  ? 458 PRO A CA  1 
ATOM   3484 C C   . PRO A 1 461 ? -35.492 117.642 -15.878 1.00 39.46  ? 458 PRO A C   1 
ATOM   3485 O O   . PRO A 1 461 ? -35.600 118.645 -15.167 1.00 39.30  ? 458 PRO A O   1 
ATOM   3486 C CB  . PRO A 1 461 ? -33.071 117.025 -16.195 1.00 29.05  ? 458 PRO A CB  1 
ATOM   3487 C CG  . PRO A 1 461 ? -32.359 115.748 -16.376 1.00 32.91  ? 458 PRO A CG  1 
ATOM   3488 C CD  . PRO A 1 461 ? -33.408 114.739 -16.761 1.00 28.00  ? 458 PRO A CD  1 
ATOM   3489 N N   . LEU A 1 462 ? -36.296 117.415 -16.918 1.00 32.45  ? 459 LEU A N   1 
ATOM   3490 C CA  . LEU A 1 462 ? -37.387 118.328 -17.235 1.00 32.45  ? 459 LEU A CA  1 
ATOM   3491 C C   . LEU A 1 462 ? -38.578 118.181 -16.297 1.00 41.21  ? 459 LEU A C   1 
ATOM   3492 O O   . LEU A 1 462 ? -39.510 118.990 -16.378 1.00 43.60  ? 459 LEU A O   1 
ATOM   3493 C CB  . LEU A 1 462 ? -37.840 118.123 -18.682 1.00 32.03  ? 459 LEU A CB  1 
ATOM   3494 C CG  . LEU A 1 462 ? -36.777 118.413 -19.743 1.00 36.38  ? 459 LEU A CG  1 
ATOM   3495 C CD1 . LEU A 1 462 ? -37.341 118.214 -21.138 1.00 40.71  ? 459 LEU A CD1 1 
ATOM   3496 C CD2 . LEU A 1 462 ? -36.228 119.822 -19.580 1.00 35.06  ? 459 LEU A CD2 1 
ATOM   3497 N N   . ASP A 1 463 ? -38.575 117.184 -15.422 1.00 39.77  ? 460 ASP A N   1 
ATOM   3498 C CA  . ASP A 1 463 ? -39.647 117.023 -14.445 1.00 38.63  ? 460 ASP A CA  1 
ATOM   3499 C C   . ASP A 1 463 ? -39.584 118.162 -13.435 1.00 38.45  ? 460 ASP A C   1 
ATOM   3500 O O   . ASP A 1 463 ? -38.583 118.284 -12.717 1.00 36.81  ? 460 ASP A O   1 
ATOM   3501 C CB  . ASP A 1 463 ? -39.522 115.671 -13.744 1.00 42.34  ? 460 ASP A CB  1 
ATOM   3502 C CG  . ASP A 1 463 ? -40.789 115.268 -13.005 1.00 42.07  ? 460 ASP A CG  1 
ATOM   3503 O OD1 . ASP A 1 463 ? -41.495 116.154 -12.480 1.00 41.55  ? 460 ASP A OD1 1 
ATOM   3504 O OD2 . ASP A 1 463 ? -41.077 114.054 -12.949 1.00 49.78  ? 460 ASP A OD2 1 
ATOM   3505 N N   . PRO A 1 464 ? -40.612 119.010 -13.340 1.00 44.70  ? 461 PRO A N   1 
ATOM   3506 C CA  . PRO A 1 464 ? -40.535 120.154 -12.417 1.00 40.25  ? 461 PRO A CA  1 
ATOM   3507 C C   . PRO A 1 464 ? -40.528 119.760 -10.951 1.00 45.65  ? 461 PRO A C   1 
ATOM   3508 O O   . PRO A 1 464 ? -40.175 120.595 -10.108 1.00 42.34  ? 461 PRO A O   1 
ATOM   3509 C CB  . PRO A 1 464 ? -41.784 120.973 -12.768 1.00 34.86  ? 461 PRO A CB  1 
ATOM   3510 C CG  . PRO A 1 464 ? -42.737 119.970 -13.329 1.00 38.91  ? 461 PRO A CG  1 
ATOM   3511 C CD  . PRO A 1 464 ? -41.891 118.971 -14.070 1.00 47.74  ? 461 PRO A CD  1 
ATOM   3512 N N   . SER A 1 465 ? -40.901 118.527 -10.615 1.00 39.49  ? 462 SER A N   1 
ATOM   3513 C CA  . SER A 1 465 ? -40.905 118.065 -9.234  1.00 45.11  ? 462 SER A CA  1 
ATOM   3514 C C   . SER A 1 465 ? -39.560 117.495 -8.798  1.00 42.06  ? 462 SER A C   1 
ATOM   3515 O O   . SER A 1 465 ? -39.486 116.856 -7.743  1.00 50.45  ? 462 SER A O   1 
ATOM   3516 C CB  . SER A 1 465 ? -42.003 117.017 -9.031  1.00 35.88  ? 462 SER A CB  1 
ATOM   3517 O OG  . SER A 1 465 ? -41.762 115.864 -9.819  1.00 55.21  ? 462 SER A OG  1 
ATOM   3518 N N   . ARG A 1 466 ? -38.504 117.708 -9.578  1.00 44.95  ? 463 ARG A N   1 
ATOM   3519 C CA  . ARG A 1 466 ? -37.172 117.227 -9.252  1.00 42.07  ? 463 ARG A CA  1 
ATOM   3520 C C   . ARG A 1 466 ? -36.199 118.398 -9.203  1.00 42.90  ? 463 ARG A C   1 
ATOM   3521 O O   . ARG A 1 466 ? -36.471 119.483 -9.725  1.00 47.61  ? 463 ARG A O   1 
ATOM   3522 C CB  . ARG A 1 466 ? -36.700 116.175 -10.264 1.00 42.71  ? 463 ARG A CB  1 
ATOM   3523 C CG  . ARG A 1 466 ? -37.606 114.954 -10.336 1.00 38.46  ? 463 ARG A CG  1 
ATOM   3524 C CD  . ARG A 1 466 ? -37.122 113.954 -11.370 1.00 49.42  ? 463 ARG A CD  1 
ATOM   3525 N NE  . ARG A 1 466 ? -38.069 112.857 -11.553 1.00 58.08  ? 463 ARG A NE  1 
ATOM   3526 C CZ  . ARG A 1 466 ? -37.990 111.687 -10.927 1.00 56.36  ? 463 ARG A CZ  1 
ATOM   3527 N NH1 . ARG A 1 466 ? -37.002 111.452 -10.074 1.00 50.76  ? 463 ARG A NH1 1 
ATOM   3528 N NH2 . ARG A 1 466 ? -38.899 110.748 -11.157 1.00 53.97  ? 463 ARG A NH2 1 
ATOM   3529 N N   . ASN A 1 467 ? -35.052 118.165 -8.566  1.00 37.13  ? 464 ASN A N   1 
ATOM   3530 C CA  . ASN A 1 467 ? -34.112 119.244 -8.285  1.00 45.07  ? 464 ASN A CA  1 
ATOM   3531 C C   . ASN A 1 467 ? -32.879 119.176 -9.179  1.00 35.08  ? 464 ASN A C   1 
ATOM   3532 O O   . ASN A 1 467 ? -31.747 119.274 -8.694  1.00 40.80  ? 464 ASN A O   1 
ATOM   3533 C CB  . ASN A 1 467 ? -33.703 119.212 -6.809  1.00 46.09  ? 464 ASN A CB  1 
ATOM   3534 C CG  . ASN A 1 467 ? -33.059 120.507 -6.353  1.00 54.22  ? 464 ASN A CG  1 
ATOM   3535 O OD1 . ASN A 1 467 ? -33.170 121.536 -7.019  1.00 61.61  ? 464 ASN A OD1 1 
ATOM   3536 N ND2 . ASN A 1 467 ? -32.382 120.461 -5.211  1.00 45.50  ? 464 ASN A ND2 1 
ATOM   3537 N N   . TYR A 1 468 ? -33.081 119.009 -10.483 1.00 31.82  ? 465 TYR A N   1 
ATOM   3538 C CA  . TYR A 1 468 ? -31.976 119.081 -11.426 1.00 34.92  ? 465 TYR A CA  1 
ATOM   3539 C C   . TYR A 1 468 ? -31.599 120.535 -11.687 1.00 42.44  ? 465 TYR A C   1 
ATOM   3540 O O   . TYR A 1 468 ? -32.425 121.444 -11.567 1.00 41.57  ? 465 TYR A O   1 
ATOM   3541 C CB  . TYR A 1 468 ? -32.339 118.392 -12.742 1.00 35.24  ? 465 TYR A CB  1 
ATOM   3542 C CG  . TYR A 1 468 ? -32.352 116.881 -12.675 1.00 38.93  ? 465 TYR A CG  1 
ATOM   3543 C CD1 . TYR A 1 468 ? -33.488 116.193 -12.266 1.00 35.18  ? 465 TYR A CD1 1 
ATOM   3544 C CD2 . TYR A 1 468 ? -31.231 116.141 -13.030 1.00 37.64  ? 465 TYR A CD2 1 
ATOM   3545 C CE1 . TYR A 1 468 ? -33.505 114.811 -12.211 1.00 36.14  ? 465 TYR A CE1 1 
ATOM   3546 C CE2 . TYR A 1 468 ? -31.239 114.759 -12.976 1.00 33.43  ? 465 TYR A CE2 1 
ATOM   3547 C CZ  . TYR A 1 468 ? -32.378 114.100 -12.566 1.00 37.28  ? 465 TYR A CZ  1 
ATOM   3548 O OH  . TYR A 1 468 ? -32.392 112.725 -12.510 1.00 29.35  ? 465 TYR A OH  1 
ATOM   3549 N N   . THR A 1 469 ? -30.337 120.748 -12.047 1.00 39.28  ? 466 THR A N   1 
ATOM   3550 C CA  . THR A 1 469 ? -29.849 122.095 -12.297 1.00 39.46  ? 466 THR A CA  1 
ATOM   3551 C C   . THR A 1 469 ? -30.318 122.593 -13.663 1.00 36.00  ? 466 THR A C   1 
ATOM   3552 O O   . THR A 1 469 ? -30.823 121.836 -14.497 1.00 35.25  ? 466 THR A O   1 
ATOM   3553 C CB  . THR A 1 469 ? -28.323 122.142 -12.219 1.00 43.58  ? 466 THR A CB  1 
ATOM   3554 O OG1 . THR A 1 469 ? -27.764 121.422 -13.325 1.00 44.88  ? 466 THR A OG1 1 
ATOM   3555 C CG2 . THR A 1 469 ? -27.837 121.521 -10.919 1.00 37.93  ? 466 THR A CG2 1 
ATOM   3556 N N   . ALA A 1 470 ? -30.143 123.898 -13.885 1.00 44.45  ? 467 ALA A N   1 
ATOM   3557 C CA  . ALA A 1 470 ? -30.523 124.489 -15.163 1.00 44.35  ? 467 ALA A CA  1 
ATOM   3558 C C   . ALA A 1 470 ? -29.645 123.984 -16.300 1.00 37.14  ? 467 ALA A C   1 
ATOM   3559 O O   . ALA A 1 470 ? -30.122 123.841 -17.432 1.00 36.76  ? 467 ALA A O   1 
ATOM   3560 C CB  . ALA A 1 470 ? -30.458 126.014 -15.079 1.00 33.59  ? 467 ALA A CB  1 
ATOM   3561 N N   . GLU A 1 471 ? -28.368 123.709 -16.023 1.00 39.87  ? 468 GLU A N   1 
ATOM   3562 C CA  . GLU A 1 471 ? -27.483 123.199 -17.065 1.00 35.53  ? 468 GLU A CA  1 
ATOM   3563 C C   . GLU A 1 471 ? -27.815 121.757 -17.424 1.00 34.65  ? 468 GLU A C   1 
ATOM   3564 O O   . GLU A 1 471 ? -27.628 121.348 -18.575 1.00 36.50  ? 468 GLU A O   1 
ATOM   3565 C CB  . GLU A 1 471 ? -26.024 123.313 -16.624 1.00 48.87  ? 468 GLU A CB  1 
ATOM   3566 C CG  . GLU A 1 471 ? -25.653 124.665 -16.033 1.00 55.89  ? 468 GLU A CG  1 
ATOM   3567 C CD  . GLU A 1 471 ? -25.832 124.712 -14.527 1.00 77.74  ? 468 GLU A CD  1 
ATOM   3568 O OE1 . GLU A 1 471 ? -25.143 123.944 -13.822 1.00 81.45  ? 468 GLU A OE1 1 
ATOM   3569 O OE2 . GLU A 1 471 ? -26.668 125.508 -14.050 1.00 64.56  ? 468 GLU A OE2 1 
ATOM   3570 N N   . GLU A 1 472 ? -28.306 120.976 -16.458 1.00 36.62  ? 469 GLU A N   1 
ATOM   3571 C CA  . GLU A 1 472 ? -28.673 119.594 -16.743 1.00 36.89  ? 469 GLU A CA  1 
ATOM   3572 C C   . GLU A 1 472 ? -29.933 119.510 -17.594 1.00 34.75  ? 469 GLU A C   1 
ATOM   3573 O O   . GLU A 1 472 ? -30.100 118.551 -18.357 1.00 32.36  ? 469 GLU A O   1 
ATOM   3574 C CB  . GLU A 1 472 ? -28.851 118.820 -15.437 1.00 34.04  ? 469 GLU A CB  1 
ATOM   3575 C CG  . GLU A 1 472 ? -27.542 118.522 -14.720 1.00 41.03  ? 469 GLU A CG  1 
ATOM   3576 C CD  . GLU A 1 472 ? -27.748 117.951 -13.330 1.00 41.05  ? 469 GLU A CD  1 
ATOM   3577 O OE1 . GLU A 1 472 ? -28.732 118.339 -12.665 1.00 35.25  ? 469 GLU A OE1 1 
ATOM   3578 O OE2 . GLU A 1 472 ? -26.926 117.113 -12.903 1.00 40.23  ? 469 GLU A OE2 1 
ATOM   3579 N N   . LYS A 1 473 ? -30.826 120.496 -17.482 1.00 38.56  ? 470 LYS A N   1 
ATOM   3580 C CA  . LYS A 1 473 ? -32.002 120.523 -18.346 1.00 34.02  ? 470 LYS A CA  1 
ATOM   3581 C C   . LYS A 1 473 ? -31.611 120.780 -19.796 1.00 36.28  ? 470 LYS A C   1 
ATOM   3582 O O   . LYS A 1 473 ? -32.139 120.137 -20.711 1.00 40.94  ? 470 LYS A O   1 
ATOM   3583 C CB  . LYS A 1 473 ? -32.991 121.581 -17.858 1.00 38.87  ? 470 LYS A CB  1 
ATOM   3584 C CG  . LYS A 1 473 ? -33.584 121.291 -16.488 1.00 44.66  ? 470 LYS A CG  1 
ATOM   3585 C CD  . LYS A 1 473 ? -34.521 122.401 -16.042 1.00 44.89  ? 470 LYS A CD  1 
ATOM   3586 C CE  . LYS A 1 473 ? -35.097 122.115 -14.664 1.00 40.97  ? 470 LYS A CE  1 
ATOM   3587 N NZ  . LYS A 1 473 ? -35.942 123.237 -14.170 1.00 54.99  ? 470 LYS A NZ  1 
ATOM   3588 N N   . ILE A 1 474 ? -30.687 121.716 -20.024 1.00 36.40  ? 471 ILE A N   1 
ATOM   3589 C CA  . ILE A 1 474 ? -30.182 121.947 -21.374 1.00 32.97  ? 471 ILE A CA  1 
ATOM   3590 C C   . ILE A 1 474 ? -29.406 120.732 -21.864 1.00 37.83  ? 471 ILE A C   1 
ATOM   3591 O O   . ILE A 1 474 ? -29.503 120.345 -23.036 1.00 33.83  ? 471 ILE A O   1 
ATOM   3592 C CB  . ILE A 1 474 ? -29.321 123.223 -21.407 1.00 39.34  ? 471 ILE A CB  1 
ATOM   3593 C CG1 . ILE A 1 474 ? -30.132 124.428 -20.926 1.00 37.72  ? 471 ILE A CG1 1 
ATOM   3594 C CG2 . ILE A 1 474 ? -28.774 123.467 -22.807 1.00 38.88  ? 471 ILE A CG2 1 
ATOM   3595 C CD1 . ILE A 1 474 ? -29.343 125.720 -20.884 1.00 43.56  ? 471 ILE A CD1 1 
ATOM   3596 N N   . PHE A 1 475 ? -28.630 120.107 -20.975 1.00 38.72  ? 472 PHE A N   1 
ATOM   3597 C CA  . PHE A 1 475 ? -27.861 118.926 -21.354 1.00 27.44  ? 472 PHE A CA  1 
ATOM   3598 C C   . PHE A 1 475 ? -28.776 117.764 -21.719 1.00 29.28  ? 472 PHE A C   1 
ATOM   3599 O O   . PHE A 1 475 ? -28.482 117.001 -22.647 1.00 31.40  ? 472 PHE A O   1 
ATOM   3600 C CB  . PHE A 1 475 ? -26.916 118.539 -20.216 1.00 42.02  ? 472 PHE A CB  1 
ATOM   3601 C CG  . PHE A 1 475 ? -26.171 117.255 -20.448 1.00 40.33  ? 472 PHE A CG  1 
ATOM   3602 C CD1 . PHE A 1 475 ? -25.391 117.085 -21.579 1.00 32.41  ? 472 PHE A CD1 1 
ATOM   3603 C CD2 . PHE A 1 475 ? -26.233 116.228 -19.522 1.00 36.29  ? 472 PHE A CD2 1 
ATOM   3604 C CE1 . PHE A 1 475 ? -24.699 115.906 -21.789 1.00 37.61  ? 472 PHE A CE1 1 
ATOM   3605 C CE2 . PHE A 1 475 ? -25.543 115.048 -19.725 1.00 32.98  ? 472 PHE A CE2 1 
ATOM   3606 C CZ  . PHE A 1 475 ? -24.773 114.889 -20.859 1.00 39.45  ? 472 PHE A CZ  1 
ATOM   3607 N N   . ALA A 1 476 ? -29.894 117.616 -21.005 1.00 30.92  ? 473 ALA A N   1 
ATOM   3608 C CA  . ALA A 1 476 ? -30.835 116.547 -21.322 1.00 27.19  ? 473 ALA A CA  1 
ATOM   3609 C C   . ALA A 1 476 ? -31.531 116.801 -22.654 1.00 30.96  ? 473 ALA A C   1 
ATOM   3610 O O   . ALA A 1 476 ? -31.785 115.862 -23.417 1.00 30.14  ? 473 ALA A O   1 
ATOM   3611 C CB  . ALA A 1 476 ? -31.860 116.399 -20.199 1.00 34.83  ? 473 ALA A CB  1 
ATOM   3612 N N   . GLN A 1 477 ? -31.844 118.065 -22.951 1.00 29.48  ? 474 GLN A N   1 
ATOM   3613 C CA  . GLN A 1 477 ? -32.489 118.388 -24.220 1.00 34.98  ? 474 GLN A CA  1 
ATOM   3614 C C   . GLN A 1 477 ? -31.555 118.134 -25.396 1.00 41.36  ? 474 GLN A C   1 
ATOM   3615 O O   . GLN A 1 477 ? -31.996 117.685 -26.461 1.00 37.02  ? 474 GLN A O   1 
ATOM   3616 C CB  . GLN A 1 477 ? -32.963 119.841 -24.211 1.00 31.58  ? 474 GLN A CB  1 
ATOM   3617 C CG  . GLN A 1 477 ? -34.136 120.103 -23.281 1.00 34.39  ? 474 GLN A CG  1 
ATOM   3618 C CD  . GLN A 1 477 ? -34.416 121.580 -23.098 1.00 45.34  ? 474 GLN A CD  1 
ATOM   3619 O OE1 . GLN A 1 477 ? -33.501 122.404 -23.116 1.00 48.78  ? 474 GLN A OE1 1 
ATOM   3620 N NE2 . GLN A 1 477 ? -35.686 121.925 -22.923 1.00 50.84  ? 474 GLN A NE2 1 
ATOM   3621 N N   . ARG A 1 478 ? -30.260 118.412 -25.224 1.00 38.88  ? 475 ARG A N   1 
ATOM   3622 C CA  . ARG A 1 478 ? -29.304 118.148 -26.293 1.00 29.83  ? 475 ARG A CA  1 
ATOM   3623 C C   . ARG A 1 478 ? -29.122 116.653 -26.523 1.00 38.42  ? 475 ARG A C   1 
ATOM   3624 O O   . ARG A 1 478 ? -28.926 116.222 -27.665 1.00 42.52  ? 475 ARG A O   1 
ATOM   3625 C CB  . ARG A 1 478 ? -27.964 118.814 -25.976 1.00 37.47  ? 475 ARG A CB  1 
ATOM   3626 C CG  . ARG A 1 478 ? -26.911 118.651 -27.063 1.00 50.80  ? 475 ARG A CG  1 
ATOM   3627 C CD  . ARG A 1 478 ? -25.805 119.688 -26.929 1.00 52.20  ? 475 ARG A CD  1 
ATOM   3628 N NE  . ARG A 1 478 ? -25.143 119.634 -25.628 1.00 35.76  ? 475 ARG A NE  1 
ATOM   3629 C CZ  . ARG A 1 478 ? -24.073 118.891 -25.364 1.00 43.11  ? 475 ARG A CZ  1 
ATOM   3630 N NH1 . ARG A 1 478 ? -23.539 118.132 -26.312 1.00 37.65  ? 475 ARG A NH1 1 
ATOM   3631 N NH2 . ARG A 1 478 ? -23.537 118.905 -24.151 1.00 33.29  ? 475 ARG A NH2 1 
ATOM   3632 N N   . LEU A 1 479 ? -29.194 115.848 -25.459 1.00 30.37  ? 476 LEU A N   1 
ATOM   3633 C CA  . LEU A 1 479 ? -29.086 114.402 -25.621 1.00 39.20  ? 476 LEU A CA  1 
ATOM   3634 C C   . LEU A 1 479 ? -30.319 113.827 -26.305 1.00 30.73  ? 476 LEU A C   1 
ATOM   3635 O O   . LEU A 1 479 ? -30.203 112.946 -27.164 1.00 34.25  ? 476 LEU A O   1 
ATOM   3636 C CB  . LEU A 1 479 ? -28.868 113.733 -24.266 1.00 39.46  ? 476 LEU A CB  1 
ATOM   3637 C CG  . LEU A 1 479 ? -27.514 113.962 -23.598 1.00 35.10  ? 476 LEU A CG  1 
ATOM   3638 C CD1 . LEU A 1 479 ? -27.446 113.189 -22.296 1.00 37.80  ? 476 LEU A CD1 1 
ATOM   3639 C CD2 . LEU A 1 479 ? -26.381 113.557 -24.529 1.00 40.12  ? 476 LEU A CD2 1 
ATOM   3640 N N   . MET A 1 480 ? -31.510 114.305 -25.930 1.00 34.96  ? 477 MET A N   1 
ATOM   3641 C CA  . MET A 1 480 ? -32.728 113.846 -26.589 1.00 32.08  ? 477 MET A CA  1 
ATOM   3642 C C   . MET A 1 480 ? -32.713 114.174 -28.076 1.00 30.34  ? 477 MET A C   1 
ATOM   3643 O O   . MET A 1 480 ? -33.262 113.417 -28.884 1.00 30.81  ? 477 MET A O   1 
ATOM   3644 C CB  . MET A 1 480 ? -33.957 114.460 -25.919 1.00 35.97  ? 477 MET A CB  1 
ATOM   3645 C CG  . MET A 1 480 ? -34.220 113.943 -24.513 1.00 38.62  ? 477 MET A CG  1 
ATOM   3646 S SD  . MET A 1 480 ? -35.791 114.503 -23.826 1.00 35.19  ? 477 MET A SD  1 
ATOM   3647 C CE  . MET A 1 480 ? -35.496 116.264 -23.682 1.00 30.96  ? 477 MET A CE  1 
ATOM   3648 N N   . ARG A 1 481 ? -32.084 115.288 -28.456 1.00 35.50  ? 478 ARG A N   1 
ATOM   3649 C CA  . ARG A 1 481 ? -31.957 115.617 -29.871 1.00 34.03  ? 478 ARG A CA  1 
ATOM   3650 C C   . ARG A 1 481 ? -31.011 114.654 -30.578 1.00 42.37  ? 478 ARG A C   1 
ATOM   3651 O O   . ARG A 1 481 ? -31.260 114.263 -31.724 1.00 33.97  ? 478 ARG A O   1 
ATOM   3652 C CB  . ARG A 1 481 ? -31.483 117.061 -30.032 1.00 36.99  ? 478 ARG A CB  1 
ATOM   3653 C CG  . ARG A 1 481 ? -31.288 117.497 -31.474 1.00 49.55  ? 478 ARG A CG  1 
ATOM   3654 C CD  . ARG A 1 481 ? -31.851 118.888 -31.698 1.00 59.11  ? 478 ARG A CD  1 
ATOM   3655 N NE  . ARG A 1 481 ? -33.302 118.912 -31.540 1.00 49.47  ? 478 ARG A NE  1 
ATOM   3656 C CZ  . ARG A 1 481 ? -34.026 120.022 -31.454 1.00 56.97  ? 478 ARG A CZ  1 
ATOM   3657 N NH1 . ARG A 1 481 ? -33.435 121.208 -31.504 1.00 57.88  ? 478 ARG A NH1 1 
ATOM   3658 N NH2 . ARG A 1 481 ? -35.343 119.947 -31.312 1.00 66.31  ? 478 ARG A NH2 1 
ATOM   3659 N N   . TYR A 1 482 ? -29.923 114.260 -29.910 1.00 36.54  ? 479 TYR A N   1 
ATOM   3660 C CA  . TYR A 1 482 ? -29.007 113.282 -30.489 1.00 33.27  ? 479 TYR A CA  1 
ATOM   3661 C C   . TYR A 1 482 ? -29.720 111.965 -30.772 1.00 30.66  ? 479 TYR A C   1 
ATOM   3662 O O   . TYR A 1 482 ? -29.614 111.409 -31.872 1.00 31.97  ? 479 TYR A O   1 
ATOM   3663 C CB  . TYR A 1 482 ? -27.820 113.051 -29.552 1.00 39.35  ? 479 TYR A CB  1 
ATOM   3664 C CG  . TYR A 1 482 ? -26.856 114.211 -29.445 1.00 39.87  ? 479 TYR A CG  1 
ATOM   3665 C CD1 . TYR A 1 482 ? -26.570 115.010 -30.545 1.00 37.90  ? 479 TYR A CD1 1 
ATOM   3666 C CD2 . TYR A 1 482 ? -26.226 114.502 -28.243 1.00 37.48  ? 479 TYR A CD2 1 
ATOM   3667 C CE1 . TYR A 1 482 ? -25.684 116.069 -30.447 1.00 40.84  ? 479 TYR A CE1 1 
ATOM   3668 C CE2 . TYR A 1 482 ? -25.340 115.557 -28.135 1.00 39.84  ? 479 TYR A CE2 1 
ATOM   3669 C CZ  . TYR A 1 482 ? -25.073 116.337 -29.239 1.00 42.85  ? 479 TYR A CZ  1 
ATOM   3670 O OH  . TYR A 1 482 ? -24.192 117.387 -29.133 1.00 38.78  ? 479 TYR A OH  1 
ATOM   3671 N N   . TRP A 1 483 ? -30.455 111.450 -29.783 1.00 28.43  ? 480 TRP A N   1 
ATOM   3672 C CA  . TRP A 1 483 ? -31.143 110.174 -29.954 1.00 27.52  ? 480 TRP A CA  1 
ATOM   3673 C C   . TRP A 1 483 ? -32.260 110.276 -30.985 1.00 26.69  ? 480 TRP A C   1 
ATOM   3674 O O   . TRP A 1 483 ? -32.492 109.333 -31.751 1.00 25.22  ? 480 TRP A O   1 
ATOM   3675 C CB  . TRP A 1 483 ? -31.689 109.693 -28.609 1.00 25.50  ? 480 TRP A CB  1 
ATOM   3676 C CG  . TRP A 1 483 ? -30.819 108.673 -27.933 1.00 29.26  ? 480 TRP A CG  1 
ATOM   3677 C CD1 . TRP A 1 483 ? -31.144 107.378 -27.654 1.00 25.00  ? 480 TRP A CD1 1 
ATOM   3678 C CD2 . TRP A 1 483 ? -29.477 108.859 -27.463 1.00 24.73  ? 480 TRP A CD2 1 
ATOM   3679 N NE1 . TRP A 1 483 ? -30.093 106.748 -27.033 1.00 31.90  ? 480 TRP A NE1 1 
ATOM   3680 C CE2 . TRP A 1 483 ? -29.057 107.636 -26.905 1.00 28.04  ? 480 TRP A CE2 1 
ATOM   3681 C CE3 . TRP A 1 483 ? -28.592 109.942 -27.458 1.00 33.00  ? 480 TRP A CE3 1 
ATOM   3682 C CZ2 . TRP A 1 483 ? -27.791 107.465 -26.349 1.00 27.40  ? 480 TRP A CZ2 1 
ATOM   3683 C CZ3 . TRP A 1 483 ? -27.336 109.770 -26.904 1.00 33.57  ? 480 TRP A CZ3 1 
ATOM   3684 C CH2 . TRP A 1 483 ? -26.947 108.541 -26.358 1.00 27.53  ? 480 TRP A CH2 1 
ATOM   3685 N N   . ALA A 1 484 ? -32.962 111.411 -31.024 1.00 27.46  ? 481 ALA A N   1 
ATOM   3686 C CA  . ALA A 1 484 ? -34.049 111.567 -31.986 1.00 32.17  ? 481 ALA A CA  1 
ATOM   3687 C C   . ALA A 1 484 ? -33.517 111.730 -33.403 1.00 37.51  ? 481 ALA A C   1 
ATOM   3688 O O   . ALA A 1 484 ? -34.064 111.148 -34.347 1.00 34.00  ? 481 ALA A O   1 
ATOM   3689 C CB  . ALA A 1 484 ? -34.926 112.756 -31.603 1.00 30.44  ? 481 ALA A CB  1 
ATOM   3690 N N   . ASN A 1 485 ? -32.457 112.526 -33.576 1.00 37.83  ? 482 ASN A N   1 
ATOM   3691 C CA  . ASN A 1 485 ? -31.867 112.689 -34.901 1.00 32.22  ? 482 ASN A CA  1 
ATOM   3692 C C   . ASN A 1 485 ? -31.363 111.359 -35.444 1.00 33.72  ? 482 ASN A C   1 
ATOM   3693 O O   . ASN A 1 485 ? -31.502 111.075 -36.640 1.00 41.53  ? 482 ASN A O   1 
ATOM   3694 C CB  . ASN A 1 485 ? -30.732 113.713 -34.858 1.00 31.40  ? 482 ASN A CB  1 
ATOM   3695 C CG  . ASN A 1 485 ? -31.230 115.128 -34.636 1.00 40.78  ? 482 ASN A CG  1 
ATOM   3696 O OD1 . ASN A 1 485 ? -32.416 115.414 -34.798 1.00 45.20  ? 482 ASN A OD1 1 
ATOM   3697 N ND2 . ASN A 1 485 ? -30.319 116.023 -34.272 1.00 42.59  ? 482 ASN A ND2 1 
ATOM   3698 N N   . PHE A 1 486 ? -30.777 110.527 -34.580 1.00 31.44  ? 483 PHE A N   1 
ATOM   3699 C CA  . PHE A 1 486 ? -30.356 109.200 -35.015 1.00 33.16  ? 483 PHE A CA  1 
ATOM   3700 C C   . PHE A 1 486 ? -31.556 108.338 -35.383 1.00 33.04  ? 483 PHE A C   1 
ATOM   3701 O O   . PHE A 1 486 ? -31.493 107.550 -36.332 1.00 33.84  ? 483 PHE A O   1 
ATOM   3702 C CB  . PHE A 1 486 ? -29.523 108.521 -33.928 1.00 27.51  ? 483 PHE A CB  1 
ATOM   3703 C CG  . PHE A 1 486 ? -29.101 107.121 -34.279 1.00 31.70  ? 483 PHE A CG  1 
ATOM   3704 C CD1 . PHE A 1 486 ? -27.992 106.899 -35.079 1.00 23.25  ? 483 PHE A CD1 1 
ATOM   3705 C CD2 . PHE A 1 486 ? -29.817 106.028 -33.816 1.00 17.56  ? 483 PHE A CD2 1 
ATOM   3706 C CE1 . PHE A 1 486 ? -27.603 105.614 -35.408 1.00 30.59  ? 483 PHE A CE1 1 
ATOM   3707 C CE2 . PHE A 1 486 ? -29.433 104.740 -34.144 1.00 34.05  ? 483 PHE A CE2 1 
ATOM   3708 C CZ  . PHE A 1 486 ? -28.324 104.533 -34.940 1.00 31.22  ? 483 PHE A CZ  1 
ATOM   3709 N N   . ALA A 1 487 ? -32.658 108.468 -34.641 1.00 34.65  ? 484 ALA A N   1 
ATOM   3710 C CA  . ALA A 1 487 ? -33.852 107.694 -34.962 1.00 36.44  ? 484 ALA A CA  1 
ATOM   3711 C C   . ALA A 1 487 ? -34.471 108.156 -36.275 1.00 34.74  ? 484 ALA A C   1 
ATOM   3712 O O   . ALA A 1 487 ? -34.969 107.337 -37.056 1.00 35.50  ? 484 ALA A O   1 
ATOM   3713 C CB  . ALA A 1 487 ? -34.866 107.797 -33.824 1.00 36.23  ? 484 ALA A CB  1 
ATOM   3714 N N   . ARG A 1 488 ? -34.444 109.463 -36.537 1.00 27.73  ? 485 ARG A N   1 
ATOM   3715 C CA  . ARG A 1 488 ? -35.057 109.995 -37.750 1.00 41.17  ? 485 ARG A CA  1 
ATOM   3716 C C   . ARG A 1 488 ? -34.183 109.752 -38.976 1.00 44.67  ? 485 ARG A C   1 
ATOM   3717 O O   . ARG A 1 488 ? -34.649 109.203 -39.980 1.00 36.78  ? 485 ARG A O   1 
ATOM   3718 C CB  . ARG A 1 488 ? -35.338 111.491 -37.585 1.00 34.82  ? 485 ARG A CB  1 
ATOM   3719 C CG  . ARG A 1 488 ? -36.457 111.819 -36.608 1.00 30.61  ? 485 ARG A CG  1 
ATOM   3720 C CD  . ARG A 1 488 ? -36.763 113.311 -36.600 1.00 28.87  ? 485 ARG A CD  1 
ATOM   3721 N NE  . ARG A 1 488 ? -35.717 114.089 -35.942 1.00 40.94  ? 485 ARG A NE  1 
ATOM   3722 C CZ  . ARG A 1 488 ? -35.797 114.542 -34.694 1.00 35.56  ? 485 ARG A CZ  1 
ATOM   3723 N NH1 . ARG A 1 488 ? -36.878 114.298 -33.966 1.00 38.35  ? 485 ARG A NH1 1 
ATOM   3724 N NH2 . ARG A 1 488 ? -34.797 115.242 -34.175 1.00 33.55  ? 485 ARG A NH2 1 
ATOM   3725 N N   . THR A 1 489 ? -32.910 110.147 -38.911 1.00 43.32  ? 486 THR A N   1 
ATOM   3726 C CA  . THR A 1 489 ? -32.045 110.162 -40.082 1.00 38.21  ? 486 THR A CA  1 
ATOM   3727 C C   . THR A 1 489 ? -30.907 109.152 -40.031 1.00 41.93  ? 486 THR A C   1 
ATOM   3728 O O   . THR A 1 489 ? -30.194 109.005 -41.030 1.00 45.72  ? 486 THR A O   1 
ATOM   3729 C CB  . THR A 1 489 ? -31.448 111.563 -40.278 1.00 45.39  ? 486 THR A CB  1 
ATOM   3730 O OG1 . THR A 1 489 ? -30.532 111.846 -39.213 1.00 38.03  ? 486 THR A OG1 1 
ATOM   3731 C CG2 . THR A 1 489 ? -32.548 112.615 -40.281 1.00 41.22  ? 486 THR A CG2 1 
ATOM   3732 N N   . GLY A 1 490 ? -30.713 108.457 -38.913 1.00 41.67  ? 487 GLY A N   1 
ATOM   3733 C CA  . GLY A 1 490 ? -29.559 107.595 -38.771 1.00 25.76  ? 487 GLY A CA  1 
ATOM   3734 C C   . GLY A 1 490 ? -28.275 108.315 -38.434 1.00 36.92  ? 487 GLY A C   1 
ATOM   3735 O O   . GLY A 1 490 ? -27.209 107.689 -38.443 1.00 40.85  ? 487 GLY A O   1 
ATOM   3736 N N   . ASP A 1 491 ? -28.345 109.609 -38.135 1.00 35.30  ? 488 ASP A N   1 
ATOM   3737 C CA  . ASP A 1 491 ? -27.180 110.430 -37.841 1.00 43.24  ? 488 ASP A CA  1 
ATOM   3738 C C   . ASP A 1 491 ? -27.485 111.307 -36.633 1.00 40.91  ? 488 ASP A C   1 
ATOM   3739 O O   . ASP A 1 491 ? -28.412 112.127 -36.680 1.00 49.32  ? 488 ASP A O   1 
ATOM   3740 C CB  . ASP A 1 491 ? -26.809 111.282 -39.059 1.00 49.58  ? 488 ASP A CB  1 
ATOM   3741 C CG  . ASP A 1 491 ? -25.424 111.895 -38.953 1.00 48.43  ? 488 ASP A CG  1 
ATOM   3742 O OD1 . ASP A 1 491 ? -25.022 112.302 -37.843 1.00 47.76  ? 488 ASP A OD1 1 
ATOM   3743 O OD2 . ASP A 1 491 ? -24.733 111.973 -39.991 1.00 66.42  ? 488 ASP A OD2 1 
ATOM   3744 N N   . PRO A 1 492 ? -26.737 111.167 -35.535 1.00 46.83  ? 489 PRO A N   1 
ATOM   3745 C CA  . PRO A 1 492 ? -27.022 111.989 -34.348 1.00 36.69  ? 489 PRO A CA  1 
ATOM   3746 C C   . PRO A 1 492 ? -26.743 113.467 -34.551 1.00 46.41  ? 489 PRO A C   1 
ATOM   3747 O O   . PRO A 1 492 ? -27.267 114.287 -33.786 1.00 45.77  ? 489 PRO A O   1 
ATOM   3748 C CB  . PRO A 1 492 ? -26.101 111.391 -33.277 1.00 41.89  ? 489 PRO A CB  1 
ATOM   3749 C CG  . PRO A 1 492 ? -24.981 110.778 -34.051 1.00 40.36  ? 489 PRO A CG  1 
ATOM   3750 C CD  . PRO A 1 492 ? -25.599 110.257 -35.320 1.00 38.90  ? 489 PRO A CD  1 
ATOM   3751 N N   . ASN A 1 493 ? -25.943 113.835 -35.548 1.00 50.50  ? 490 ASN A N   1 
ATOM   3752 C CA  . ASN A 1 493 ? -25.641 115.235 -35.790 1.00 55.16  ? 490 ASN A CA  1 
ATOM   3753 C C   . ASN A 1 493 ? -26.868 115.968 -36.325 1.00 55.00  ? 490 ASN A C   1 
ATOM   3754 O O   . ASN A 1 493 ? -27.790 115.371 -36.889 1.00 54.21  ? 490 ASN A O   1 
ATOM   3755 C CB  . ASN A 1 493 ? -24.482 115.375 -36.776 1.00 50.18  ? 490 ASN A CB  1 
ATOM   3756 C CG  . ASN A 1 493 ? -23.172 114.868 -36.211 1.00 40.82  ? 490 ASN A CG  1 
ATOM   3757 O OD1 . ASN A 1 493 ? -22.469 115.590 -35.506 1.00 51.65  ? 490 ASN A OD1 1 
ATOM   3758 N ND2 . ASN A 1 493 ? -22.835 113.622 -36.522 1.00 37.07  ? 490 ASN A ND2 1 
ATOM   3759 N N   . GLU A 1 494 ? -26.867 117.282 -36.137 1.00 56.52  ? 491 GLU A N   1 
ATOM   3760 C CA  . GLU A 1 494 ? -27.942 118.110 -36.661 1.00 81.76  ? 491 GLU A CA  1 
ATOM   3761 C C   . GLU A 1 494 ? -27.927 118.058 -38.186 1.00 89.73  ? 491 GLU A C   1 
ATOM   3762 O O   . GLU A 1 494 ? -26.872 118.278 -38.798 1.00 93.50  ? 491 GLU A O   1 
ATOM   3763 C CB  . GLU A 1 494 ? -27.792 119.551 -36.177 1.00 80.23  ? 491 GLU A CB  1 
ATOM   3764 C CG  . GLU A 1 494 ? -27.605 119.694 -34.671 1.00 77.24  ? 491 GLU A CG  1 
ATOM   3765 C CD  . GLU A 1 494 ? -28.912 119.650 -33.899 1.00 82.83  ? 491 GLU A CD  1 
ATOM   3766 O OE1 . GLU A 1 494 ? -28.914 120.054 -32.717 1.00 77.41  ? 491 GLU A OE1 1 
ATOM   3767 O OE2 . GLU A 1 494 ? -29.937 119.219 -34.470 1.00 66.46  ? 491 GLU A OE2 1 
ATOM   3768 N N   . PRO A 1 495 ? -29.058 117.766 -38.833 1.00 80.30  ? 492 PRO A N   1 
ATOM   3769 C CA  . PRO A 1 495 ? -29.051 117.624 -40.299 1.00 92.09  ? 492 PRO A CA  1 
ATOM   3770 C C   . PRO A 1 495 ? -28.657 118.889 -41.040 1.00 105.82 ? 492 PRO A C   1 
ATOM   3771 O O   . PRO A 1 495 ? -28.270 118.804 -42.212 1.00 106.82 ? 492 PRO A O   1 
ATOM   3772 C CB  . PRO A 1 495 ? -30.497 117.217 -40.619 1.00 89.95  ? 492 PRO A CB  1 
ATOM   3773 C CG  . PRO A 1 495 ? -31.026 116.647 -39.339 1.00 70.02  ? 492 PRO A CG  1 
ATOM   3774 C CD  . PRO A 1 495 ? -30.369 117.437 -38.250 1.00 65.02  ? 492 PRO A CD  1 
ATOM   3775 N N   . ARG A 1 496 ? -28.740 120.058 -40.404 1.00 105.67 ? 493 ARG A N   1 
ATOM   3776 C CA  . ARG A 1 496 ? -28.381 121.308 -41.070 1.00 111.73 ? 493 ARG A CA  1 
ATOM   3777 C C   . ARG A 1 496 ? -27.548 122.262 -40.227 1.00 109.56 ? 493 ARG A C   1 
ATOM   3778 O O   . ARG A 1 496 ? -26.833 123.086 -40.806 1.00 108.23 ? 493 ARG A O   1 
ATOM   3779 C CB  . ARG A 1 496 ? -29.642 122.043 -41.542 1.00 107.92 ? 493 ARG A CB  1 
ATOM   3780 C CG  . ARG A 1 496 ? -30.276 121.447 -42.787 1.00 102.88 ? 493 ARG A CG  1 
ATOM   3781 C CD  . ARG A 1 496 ? -31.717 121.041 -42.537 1.00 102.55 ? 493 ARG A CD  1 
ATOM   3782 N NE  . ARG A 1 496 ? -32.336 120.483 -43.735 1.00 102.30 ? 493 ARG A NE  1 
ATOM   3783 C CZ  . ARG A 1 496 ? -32.981 121.203 -44.647 1.00 111.82 ? 493 ARG A CZ  1 
ATOM   3784 N NH1 . ARG A 1 496 ? -33.095 122.515 -44.498 1.00 116.20 ? 493 ARG A NH1 1 
ATOM   3785 N NH2 . ARG A 1 496 ? -33.513 120.611 -45.708 1.00 108.19 ? 493 ARG A NH2 1 
ATOM   3786 N N   . ASP A 1 497 ? -27.601 122.194 -38.903 1.00 99.92  ? 494 ASP A N   1 
ATOM   3787 C CA  . ASP A 1 497 ? -26.876 123.144 -38.061 1.00 111.59 ? 494 ASP A CA  1 
ATOM   3788 C C   . ASP A 1 497 ? -25.376 122.880 -38.124 1.00 115.40 ? 494 ASP A C   1 
ATOM   3789 O O   . ASP A 1 497 ? -24.930 121.796 -37.725 1.00 107.54 ? 494 ASP A O   1 
ATOM   3790 C CB  . ASP A 1 497 ? -27.372 123.047 -36.619 1.00 106.76 ? 494 ASP A CB  1 
ATOM   3791 C CG  . ASP A 1 497 ? -26.683 124.031 -35.691 1.00 106.50 ? 494 ASP A CG  1 
ATOM   3792 O OD1 . ASP A 1 497 ? -26.077 125.005 -36.186 1.00 108.55 ? 494 ASP A OD1 1 
ATOM   3793 O OD2 . ASP A 1 497 ? -26.745 123.825 -34.460 1.00 90.75  ? 494 ASP A OD2 1 
ATOM   3794 N N   . PRO A 1 498 ? -24.569 123.823 -38.610 1.00 121.17 ? 495 PRO A N   1 
ATOM   3795 C CA  . PRO A 1 498 ? -23.107 123.652 -38.605 1.00 116.16 ? 495 PRO A CA  1 
ATOM   3796 C C   . PRO A 1 498 ? -22.391 124.292 -37.422 1.00 111.83 ? 495 PRO A C   1 
ATOM   3797 O O   . PRO A 1 498 ? -21.171 124.131 -37.314 1.00 103.68 ? 495 PRO A O   1 
ATOM   3798 C CB  . PRO A 1 498 ? -22.710 124.355 -39.906 1.00 104.66 ? 495 PRO A CB  1 
ATOM   3799 C CG  . PRO A 1 498 ? -23.675 125.507 -39.982 1.00 105.65 ? 495 PRO A CG  1 
ATOM   3800 C CD  . PRO A 1 498 ? -24.967 125.048 -39.326 1.00 107.00 ? 495 PRO A CD  1 
ATOM   3801 N N   . LYS A 1 499 ? -23.111 125.004 -36.552 1.00 114.50 ? 496 LYS A N   1 
ATOM   3802 C CA  . LYS A 1 499 ? -22.468 125.707 -35.446 1.00 116.02 ? 496 LYS A CA  1 
ATOM   3803 C C   . LYS A 1 499 ? -21.915 124.729 -34.417 1.00 111.70 ? 496 LYS A C   1 
ATOM   3804 O O   . LYS A 1 499 ? -20.735 124.796 -34.052 1.00 108.55 ? 496 LYS A O   1 
ATOM   3805 C CB  . LYS A 1 499 ? -23.460 126.669 -34.792 1.00 112.36 ? 496 LYS A CB  1 
ATOM   3806 C CG  . LYS A 1 499 ? -24.144 127.617 -35.763 1.00 101.00 ? 496 LYS A CG  1 
ATOM   3807 C CD  . LYS A 1 499 ? -25.220 128.432 -35.062 1.00 90.08  ? 496 LYS A CD  1 
ATOM   3808 C CE  . LYS A 1 499 ? -25.976 129.313 -36.044 1.00 94.03  ? 496 LYS A CE  1 
ATOM   3809 N NZ  . LYS A 1 499 ? -27.056 130.088 -35.373 1.00 99.05  ? 496 LYS A NZ  1 
ATOM   3810 N N   . ALA A 1 500 ? -22.755 123.817 -33.934 1.00 112.02 ? 497 ALA A N   1 
ATOM   3811 C CA  . ALA A 1 500 ? -22.324 122.864 -32.927 1.00 100.34 ? 497 ALA A CA  1 
ATOM   3812 C C   . ALA A 1 500 ? -21.265 121.923 -33.500 1.00 93.56  ? 497 ALA A C   1 
ATOM   3813 O O   . ALA A 1 500 ? -21.301 121.585 -34.686 1.00 88.50  ? 497 ALA A O   1 
ATOM   3814 C CB  . ALA A 1 500 ? -23.512 122.057 -32.411 1.00 83.22  ? 497 ALA A CB  1 
ATOM   3815 N N   . PRO A 1 501 ? -20.303 121.500 -32.678 1.00 90.05  ? 498 PRO A N   1 
ATOM   3816 C CA  . PRO A 1 501 ? -19.284 120.559 -33.158 1.00 80.01  ? 498 PRO A CA  1 
ATOM   3817 C C   . PRO A 1 501 ? -19.913 119.262 -33.645 1.00 62.67  ? 498 PRO A C   1 
ATOM   3818 O O   . PRO A 1 501 ? -20.994 118.863 -33.206 1.00 63.28  ? 498 PRO A O   1 
ATOM   3819 C CB  . PRO A 1 501 ? -18.403 120.328 -31.925 1.00 77.45  ? 498 PRO A CB  1 
ATOM   3820 C CG  . PRO A 1 501 ? -18.604 121.551 -31.090 1.00 74.64  ? 498 PRO A CG  1 
ATOM   3821 C CD  . PRO A 1 501 ? -20.035 121.950 -31.302 1.00 71.33  ? 498 PRO A CD  1 
ATOM   3822 N N   . GLN A 1 502 ? -19.219 118.605 -34.567 1.00 56.48  ? 499 GLN A N   1 
ATOM   3823 C CA  . GLN A 1 502 ? -19.754 117.432 -35.238 1.00 49.92  ? 499 GLN A CA  1 
ATOM   3824 C C   . GLN A 1 502 ? -19.390 116.150 -34.498 1.00 53.65  ? 499 GLN A C   1 
ATOM   3825 O O   . GLN A 1 502 ? -18.395 116.080 -33.771 1.00 43.81  ? 499 GLN A O   1 
ATOM   3826 C CB  . GLN A 1 502 ? -19.250 117.362 -36.679 1.00 53.44  ? 499 GLN A CB  1 
ATOM   3827 C CG  . GLN A 1 502 ? -19.799 118.462 -37.571 1.00 63.40  ? 499 GLN A CG  1 
ATOM   3828 C CD  . GLN A 1 502 ? -21.312 118.441 -37.650 1.00 64.82  ? 499 GLN A CD  1 
ATOM   3829 O OE1 . GLN A 1 502 ? -21.910 117.447 -38.063 1.00 53.87  ? 499 GLN A OE1 1 
ATOM   3830 N NE2 . GLN A 1 502 ? -21.940 119.538 -37.244 1.00 58.75  ? 499 GLN A NE2 1 
ATOM   3831 N N   . TRP A 1 503 ? -20.224 115.130 -34.693 1.00 45.56  ? 500 TRP A N   1 
ATOM   3832 C CA  . TRP A 1 503 ? -20.022 113.802 -34.122 1.00 43.04  ? 500 TRP A CA  1 
ATOM   3833 C C   . TRP A 1 503 ? -19.543 112.870 -35.226 1.00 40.80  ? 500 TRP A C   1 
ATOM   3834 O O   . TRP A 1 503 ? -20.363 112.354 -36.002 1.00 40.20  ? 500 TRP A O   1 
ATOM   3835 C CB  . TRP A 1 503 ? -21.326 113.289 -33.501 1.00 40.23  ? 500 TRP A CB  1 
ATOM   3836 C CG  . TRP A 1 503 ? -21.218 112.013 -32.708 1.00 44.81  ? 500 TRP A CG  1 
ATOM   3837 C CD1 . TRP A 1 503 ? -20.250 111.054 -32.806 1.00 42.92  ? 500 TRP A CD1 1 
ATOM   3838 C CD2 . TRP A 1 503 ? -22.121 111.565 -31.690 1.00 45.92  ? 500 TRP A CD2 1 
ATOM   3839 N NE1 . TRP A 1 503 ? -20.498 110.037 -31.916 1.00 43.21  ? 500 TRP A NE1 1 
ATOM   3840 C CE2 . TRP A 1 503 ? -21.641 110.327 -31.219 1.00 40.17  ? 500 TRP A CE2 1 
ATOM   3841 C CE3 . TRP A 1 503 ? -23.291 112.091 -31.132 1.00 40.95  ? 500 TRP A CE3 1 
ATOM   3842 C CZ2 . TRP A 1 503 ? -22.288 109.609 -30.216 1.00 47.87  ? 500 TRP A CZ2 1 
ATOM   3843 C CZ3 . TRP A 1 503 ? -23.932 111.377 -30.138 1.00 37.12  ? 500 TRP A CZ3 1 
ATOM   3844 C CH2 . TRP A 1 503 ? -23.429 110.149 -29.689 1.00 38.48  ? 500 TRP A CH2 1 
ATOM   3845 N N   . PRO A 1 504 ? -18.236 112.624 -35.348 1.00 34.17  ? 501 PRO A N   1 
ATOM   3846 C CA  . PRO A 1 504 ? -17.755 111.792 -36.447 1.00 35.40  ? 501 PRO A CA  1 
ATOM   3847 C C   . PRO A 1 504 ? -18.109 110.336 -36.217 1.00 34.72  ? 501 PRO A C   1 
ATOM   3848 O O   . PRO A 1 504 ? -18.223 109.883 -35.065 1.00 42.51  ? 501 PRO A O   1 
ATOM   3849 C CB  . PRO A 1 504 ? -16.232 112.012 -36.415 1.00 37.50  ? 501 PRO A CB  1 
ATOM   3850 C CG  . PRO A 1 504 ? -15.944 112.340 -34.990 1.00 40.03  ? 501 PRO A CG  1 
ATOM   3851 C CD  . PRO A 1 504 ? -17.139 113.115 -34.496 1.00 40.29  ? 501 PRO A CD  1 
ATOM   3852 N N   . PRO A 1 505 ? -18.306 109.561 -37.283 1.00 33.37  ? 502 PRO A N   1 
ATOM   3853 C CA  . PRO A 1 505 ? -18.618 108.139 -37.114 1.00 36.46  ? 502 PRO A CA  1 
ATOM   3854 C C   . PRO A 1 505 ? -17.459 107.379 -36.486 1.00 41.67  ? 502 PRO A C   1 
ATOM   3855 O O   . PRO A 1 505 ? -16.309 107.825 -36.481 1.00 46.91  ? 502 PRO A O   1 
ATOM   3856 C CB  . PRO A 1 505 ? -18.884 107.657 -38.546 1.00 26.76  ? 502 PRO A CB  1 
ATOM   3857 C CG  . PRO A 1 505 ? -19.218 108.899 -39.314 1.00 39.40  ? 502 PRO A CG  1 
ATOM   3858 C CD  . PRO A 1 505 ? -18.393 109.985 -38.690 1.00 37.83  ? 502 PRO A CD  1 
ATOM   3859 N N   . TYR A 1 506 ? -17.784 106.208 -35.944 1.00 43.14  ? 503 TYR A N   1 
ATOM   3860 C CA  . TYR A 1 506 ? -16.792 105.322 -35.352 1.00 38.38  ? 503 TYR A CA  1 
ATOM   3861 C C   . TYR A 1 506 ? -16.322 104.323 -36.401 1.00 44.62  ? 503 TYR A C   1 
ATOM   3862 O O   . TYR A 1 506 ? -17.141 103.672 -37.058 1.00 41.14  ? 503 TYR A O   1 
ATOM   3863 C CB  . TYR A 1 506 ? -17.377 104.595 -34.139 1.00 40.02  ? 503 TYR A CB  1 
ATOM   3864 C CG  . TYR A 1 506 ? -16.411 103.664 -33.436 1.00 30.53  ? 503 TYR A CG  1 
ATOM   3865 C CD1 . TYR A 1 506 ? -16.290 102.335 -33.821 1.00 29.65  ? 503 TYR A CD1 1 
ATOM   3866 C CD2 . TYR A 1 506 ? -15.632 104.112 -32.377 1.00 27.13  ? 503 TYR A CD2 1 
ATOM   3867 C CE1 . TYR A 1 506 ? -15.413 101.482 -33.181 1.00 26.36  ? 503 TYR A CE1 1 
ATOM   3868 C CE2 . TYR A 1 506 ? -14.754 103.265 -31.729 1.00 24.46  ? 503 TYR A CE2 1 
ATOM   3869 C CZ  . TYR A 1 506 ? -14.648 101.952 -32.135 1.00 28.91  ? 503 TYR A CZ  1 
ATOM   3870 O OH  . TYR A 1 506 ? -13.774 101.105 -31.493 1.00 38.40  ? 503 TYR A OH  1 
ATOM   3871 N N   . THR A 1 507 ? -15.006 104.211 -36.560 1.00 39.69  ? 504 THR A N   1 
ATOM   3872 C CA  . THR A 1 507 ? -14.409 103.281 -37.506 1.00 42.98  ? 504 THR A CA  1 
ATOM   3873 C C   . THR A 1 507 ? -13.412 102.388 -36.779 1.00 37.46  ? 504 THR A C   1 
ATOM   3874 O O   . THR A 1 507 ? -12.893 102.737 -35.717 1.00 44.03  ? 504 THR A O   1 
ATOM   3875 C CB  . THR A 1 507 ? -13.712 104.013 -38.663 1.00 44.31  ? 504 THR A CB  1 
ATOM   3876 O OG1 . THR A 1 507 ? -12.736 104.921 -38.139 1.00 42.06  ? 504 THR A OG1 1 
ATOM   3877 C CG2 . THR A 1 507 ? -14.725 104.786 -39.499 1.00 40.53  ? 504 THR A CG2 1 
ATOM   3878 N N   . ALA A 1 508 ? -13.147 101.221 -37.371 1.00 30.62  ? 505 ALA A N   1 
ATOM   3879 C CA  . ALA A 1 508 ? -12.217 100.277 -36.764 1.00 39.45  ? 505 ALA A CA  1 
ATOM   3880 C C   . ALA A 1 508 ? -10.790 100.808 -36.723 1.00 55.74  ? 505 ALA A C   1 
ATOM   3881 O O   . ALA A 1 508 ? -9.983  100.317 -35.926 1.00 55.02  ? 505 ALA A O   1 
ATOM   3882 C CB  . ALA A 1 508 ? -12.255 98.944  -37.514 1.00 36.66  ? 505 ALA A CB  1 
ATOM   3883 N N   . GLY A 1 509 ? -10.462 101.794 -37.554 1.00 42.29  ? 506 GLY A N   1 
ATOM   3884 C CA  . GLY A 1 509 ? -9.125  102.351 -37.574 1.00 36.72  ? 506 GLY A CA  1 
ATOM   3885 C C   . GLY A 1 509 ? -8.970  103.585 -36.709 1.00 38.92  ? 506 GLY A C   1 
ATOM   3886 O O   . GLY A 1 509 ? -8.135  103.612 -35.799 1.00 47.35  ? 506 GLY A O   1 
ATOM   3887 N N   . ALA A 1 510 ? -9.772  104.616 -36.982 1.00 36.75  ? 507 ALA A N   1 
ATOM   3888 C CA  . ALA A 1 510 ? -9.659  105.858 -36.223 1.00 36.77  ? 507 ALA A CA  1 
ATOM   3889 C C   . ALA A 1 510 ? -10.223 105.703 -34.816 1.00 39.86  ? 507 ALA A C   1 
ATOM   3890 O O   . ALA A 1 510 ? -9.673  106.261 -33.859 1.00 39.51  ? 507 ALA A O   1 
ATOM   3891 C CB  . ALA A 1 510 ? -10.365 106.992 -36.965 1.00 38.90  ? 507 ALA A CB  1 
ATOM   3892 N N   . GLN A 1 511 ? -11.319 104.955 -34.675 1.00 44.03  ? 508 GLN A N   1 
ATOM   3893 C CA  . GLN A 1 511 ? -11.944 104.685 -33.378 1.00 38.09  ? 508 GLN A CA  1 
ATOM   3894 C C   . GLN A 1 511 ? -12.319 105.982 -32.661 1.00 33.36  ? 508 GLN A C   1 
ATOM   3895 O O   . GLN A 1 511 ? -12.038 106.170 -31.476 1.00 37.70  ? 508 GLN A O   1 
ATOM   3896 C CB  . GLN A 1 511 ? -11.038 103.814 -32.503 1.00 36.58  ? 508 GLN A CB  1 
ATOM   3897 C CG  . GLN A 1 511 ? -10.580 102.530 -33.174 1.00 40.83  ? 508 GLN A CG  1 
ATOM   3898 C CD  . GLN A 1 511 ? -9.664  101.708 -32.290 1.00 44.46  ? 508 GLN A CD  1 
ATOM   3899 O OE1 . GLN A 1 511 ? -9.682  101.838 -31.066 1.00 45.34  ? 508 GLN A OE1 1 
ATOM   3900 N NE2 . GLN A 1 511 ? -8.852  100.857 -32.908 1.00 51.42  ? 508 GLN A NE2 1 
ATOM   3901 N N   . GLN A 1 512 ? -12.965 106.882 -33.395 1.00 33.77  ? 509 GLN A N   1 
ATOM   3902 C CA  . GLN A 1 512 ? -13.355 108.170 -32.840 1.00 37.58  ? 509 GLN A CA  1 
ATOM   3903 C C   . GLN A 1 512 ? -14.667 108.055 -32.075 1.00 37.58  ? 509 GLN A C   1 
ATOM   3904 O O   . GLN A 1 512 ? -15.585 107.339 -32.484 1.00 34.96  ? 509 GLN A O   1 
ATOM   3905 C CB  . GLN A 1 512 ? -13.493 109.214 -33.948 1.00 39.97  ? 509 GLN A CB  1 
ATOM   3906 C CG  . GLN A 1 512 ? -12.212 109.482 -34.717 1.00 41.47  ? 509 GLN A CG  1 
ATOM   3907 C CD  . GLN A 1 512 ? -12.441 110.361 -35.930 1.00 36.92  ? 509 GLN A CD  1 
ATOM   3908 O OE1 . GLN A 1 512 ? -12.577 109.868 -37.050 1.00 45.18  ? 509 GLN A OE1 1 
ATOM   3909 N NE2 . GLN A 1 512 ? -12.487 111.670 -35.713 1.00 34.87  ? 509 GLN A NE2 1 
ATOM   3910 N N   . TYR A 1 513 ? -14.746 108.770 -30.955 1.00 30.89  ? 510 TYR A N   1 
ATOM   3911 C CA  . TYR A 1 513 ? -15.968 108.857 -30.173 1.00 28.47  ? 510 TYR A CA  1 
ATOM   3912 C C   . TYR A 1 513 ? -16.032 110.244 -29.552 1.00 31.78  ? 510 TYR A C   1 
ATOM   3913 O O   . TYR A 1 513 ? -15.067 111.012 -29.598 1.00 34.16  ? 510 TYR A O   1 
ATOM   3914 C CB  . TYR A 1 513 ? -16.035 107.762 -29.100 1.00 31.66  ? 510 TYR A CB  1 
ATOM   3915 C CG  . TYR A 1 513 ? -15.003 107.898 -28.002 1.00 31.36  ? 510 TYR A CG  1 
ATOM   3916 C CD1 . TYR A 1 513 ? -13.733 107.356 -28.144 1.00 34.49  ? 510 TYR A CD1 1 
ATOM   3917 C CD2 . TYR A 1 513 ? -15.303 108.561 -26.819 1.00 29.40  ? 510 TYR A CD2 1 
ATOM   3918 C CE1 . TYR A 1 513 ? -12.788 107.476 -27.141 1.00 29.95  ? 510 TYR A CE1 1 
ATOM   3919 C CE2 . TYR A 1 513 ? -14.365 108.688 -25.812 1.00 29.08  ? 510 TYR A CE2 1 
ATOM   3920 C CZ  . TYR A 1 513 ? -13.111 108.142 -25.977 1.00 31.66  ? 510 TYR A CZ  1 
ATOM   3921 O OH  . TYR A 1 513 ? -12.177 108.266 -24.975 1.00 40.31  ? 510 TYR A OH  1 
ATOM   3922 N N   . VAL A 1 514 ? -17.183 110.565 -28.969 1.00 29.73  ? 511 VAL A N   1 
ATOM   3923 C CA  . VAL A 1 514 ? -17.391 111.863 -28.343 1.00 32.69  ? 511 VAL A CA  1 
ATOM   3924 C C   . VAL A 1 514 ? -17.719 111.659 -26.871 1.00 28.56  ? 511 VAL A C   1 
ATOM   3925 O O   . VAL A 1 514 ? -18.218 110.606 -26.461 1.00 23.64  ? 511 VAL A O   1 
ATOM   3926 C CB  . VAL A 1 514 ? -18.505 112.676 -29.041 1.00 40.14  ? 511 VAL A CB  1 
ATOM   3927 C CG1 . VAL A 1 514 ? -18.196 112.840 -30.522 1.00 32.19  ? 511 VAL A CG1 1 
ATOM   3928 C CG2 . VAL A 1 514 ? -19.858 112.015 -28.836 1.00 38.35  ? 511 VAL A CG2 1 
ATOM   3929 N N   . SER A 1 515 ? -17.425 112.680 -26.074 1.00 28.52  ? 512 SER A N   1 
ATOM   3930 C CA  . SER A 1 515 ? -17.747 112.688 -24.655 1.00 31.64  ? 512 SER A CA  1 
ATOM   3931 C C   . SER A 1 515 ? -19.024 113.489 -24.440 1.00 37.80  ? 512 SER A C   1 
ATOM   3932 O O   . SER A 1 515 ? -19.145 114.616 -24.931 1.00 29.79  ? 512 SER A O   1 
ATOM   3933 C CB  . SER A 1 515 ? -16.601 113.282 -23.835 1.00 38.56  ? 512 SER A CB  1 
ATOM   3934 O OG  . SER A 1 515 ? -16.325 114.613 -24.236 1.00 44.93  ? 512 SER A OG  1 
ATOM   3935 N N   . LEU A 1 516 ? -19.972 112.904 -23.713 1.00 34.11  ? 513 LEU A N   1 
ATOM   3936 C CA  . LEU A 1 516 ? -21.260 113.533 -23.445 1.00 29.70  ? 513 LEU A CA  1 
ATOM   3937 C C   . LEU A 1 516 ? -21.250 114.081 -22.022 1.00 25.31  ? 513 LEU A C   1 
ATOM   3938 O O   . LEU A 1 516 ? -21.279 113.315 -21.054 1.00 34.64  ? 513 LEU A O   1 
ATOM   3939 C CB  . LEU A 1 516 ? -22.402 112.540 -23.647 1.00 26.10  ? 513 LEU A CB  1 
ATOM   3940 C CG  . LEU A 1 516 ? -22.547 111.958 -25.054 1.00 30.20  ? 513 LEU A CG  1 
ATOM   3941 C CD1 . LEU A 1 516 ? -23.719 110.990 -25.120 1.00 22.43  ? 513 LEU A CD1 1 
ATOM   3942 C CD2 . LEU A 1 516 ? -22.708 113.068 -26.081 1.00 30.79  ? 513 LEU A CD2 1 
ATOM   3943 N N   . ASP A 1 517 ? -21.208 115.404 -21.901 1.00 28.79  ? 514 ASP A N   1 
ATOM   3944 C CA  . ASP A 1 517 ? -21.268 116.078 -20.610 1.00 30.66  ? 514 ASP A CA  1 
ATOM   3945 C C   . ASP A 1 517 ? -21.763 117.502 -20.845 1.00 36.25  ? 514 ASP A C   1 
ATOM   3946 O O   . ASP A 1 517 ? -22.248 117.835 -21.932 1.00 28.46  ? 514 ASP A O   1 
ATOM   3947 C CB  . ASP A 1 517 ? -19.909 116.035 -19.901 1.00 40.12  ? 514 ASP A CB  1 
ATOM   3948 C CG  . ASP A 1 517 ? -18.766 116.494 -20.791 1.00 47.51  ? 514 ASP A CG  1 
ATOM   3949 O OD1 . ASP A 1 517 ? -19.028 116.950 -21.923 1.00 56.70  ? 514 ASP A OD1 1 
ATOM   3950 O OD2 . ASP A 1 517 ? -17.600 116.392 -20.355 1.00 50.14  ? 514 ASP A OD2 1 
ATOM   3951 N N   . LEU A 1 518 ? -21.639 118.349 -19.820 1.00 28.24  ? 515 LEU A N   1 
ATOM   3952 C CA  . LEU A 1 518 ? -22.119 119.722 -19.937 1.00 32.86  ? 515 LEU A CA  1 
ATOM   3953 C C   . LEU A 1 518 ? -21.324 120.513 -20.967 1.00 46.09  ? 515 LEU A C   1 
ATOM   3954 O O   . LEU A 1 518 ? -21.863 121.434 -21.590 1.00 45.19  ? 515 LEU A O   1 
ATOM   3955 C CB  . LEU A 1 518 ? -22.066 120.417 -18.576 1.00 30.45  ? 515 LEU A CB  1 
ATOM   3956 C CG  . LEU A 1 518 ? -22.828 119.736 -17.437 1.00 41.55  ? 515 LEU A CG  1 
ATOM   3957 C CD1 . LEU A 1 518 ? -22.860 120.626 -16.203 1.00 32.41  ? 515 LEU A CD1 1 
ATOM   3958 C CD2 . LEU A 1 518 ? -24.236 119.364 -17.873 1.00 34.86  ? 515 LEU A CD2 1 
ATOM   3959 N N   . ARG A 1 519 ? -20.051 120.173 -21.159 1.00 46.70  ? 516 ARG A N   1 
ATOM   3960 C CA  . ARG A 1 519 ? -19.238 120.835 -22.162 1.00 45.02  ? 516 ARG A CA  1 
ATOM   3961 C C   . ARG A 1 519 ? -19.682 120.411 -23.561 1.00 41.94  ? 516 ARG A C   1 
ATOM   3962 O O   . ARG A 1 519 ? -20.326 119.373 -23.731 1.00 43.87  ? 516 ARG A O   1 
ATOM   3963 C CB  . ARG A 1 519 ? -17.763 120.500 -21.949 1.00 41.86  ? 516 ARG A CB  1 
ATOM   3964 C CG  . ARG A 1 519 ? -17.247 120.836 -20.559 1.00 42.43  ? 516 ARG A CG  1 
ATOM   3965 C CD  . ARG A 1 519 ? -15.792 120.423 -20.380 1.00 53.54  ? 516 ARG A CD  1 
ATOM   3966 N NE  . ARG A 1 519 ? -15.580 119.004 -20.652 1.00 64.62  ? 516 ARG A NE  1 
ATOM   3967 C CZ  . ARG A 1 519 ? -14.938 118.533 -21.717 1.00 69.05  ? 516 ARG A CZ  1 
ATOM   3968 N NH1 . ARG A 1 519 ? -14.433 119.371 -22.613 1.00 64.21  ? 516 ARG A NH1 1 
ATOM   3969 N NH2 . ARG A 1 519 ? -14.794 117.225 -21.883 1.00 59.65  ? 516 ARG A NH2 1 
ATOM   3970 N N   . PRO A 1 520 ? -19.361 121.209 -24.580 1.00 43.62  ? 517 PRO A N   1 
ATOM   3971 C CA  . PRO A 1 520 ? -19.668 120.805 -25.959 1.00 37.35  ? 517 PRO A CA  1 
ATOM   3972 C C   . PRO A 1 520 ? -18.963 119.509 -26.330 1.00 35.56  ? 517 PRO A C   1 
ATOM   3973 O O   . PRO A 1 520 ? -18.095 119.003 -25.615 1.00 44.99  ? 517 PRO A O   1 
ATOM   3974 C CB  . PRO A 1 520 ? -19.160 121.983 -26.797 1.00 47.63  ? 517 PRO A CB  1 
ATOM   3975 C CG  . PRO A 1 520 ? -19.202 123.146 -25.866 1.00 48.46  ? 517 PRO A CG  1 
ATOM   3976 C CD  . PRO A 1 520 ? -18.860 122.593 -24.512 1.00 46.32  ? 517 PRO A CD  1 
ATOM   3977 N N   . LEU A 1 521 ? -19.354 118.968 -27.483 1.00 36.77  ? 518 LEU A N   1 
ATOM   3978 C CA  . LEU A 1 521 ? -18.807 117.696 -27.938 1.00 40.85  ? 518 LEU A CA  1 
ATOM   3979 C C   . LEU A 1 521 ? -17.295 117.778 -28.100 1.00 48.33  ? 518 LEU A C   1 
ATOM   3980 O O   . LEU A 1 521 ? -16.760 118.743 -28.653 1.00 46.13  ? 518 LEU A O   1 
ATOM   3981 C CB  . LEU A 1 521 ? -19.452 117.279 -29.260 1.00 41.16  ? 518 LEU A CB  1 
ATOM   3982 C CG  . LEU A 1 521 ? -20.865 116.699 -29.191 1.00 45.83  ? 518 LEU A CG  1 
ATOM   3983 C CD1 . LEU A 1 521 ? -21.302 116.199 -30.560 1.00 41.90  ? 518 LEU A CD1 1 
ATOM   3984 C CD2 . LEU A 1 521 ? -20.934 115.582 -28.162 1.00 45.07  ? 518 LEU A CD2 1 
ATOM   3985 N N   . GLU A 1 522 ? -16.607 116.753 -27.603 1.00 50.31  ? 519 GLU A N   1 
ATOM   3986 C CA  . GLU A 1 522 ? -15.157 116.644 -27.698 1.00 49.85  ? 519 GLU A CA  1 
ATOM   3987 C C   . GLU A 1 522 ? -14.822 115.281 -28.282 1.00 39.56  ? 519 GLU A C   1 
ATOM   3988 O O   . GLU A 1 522 ? -15.234 114.253 -27.736 1.00 47.61  ? 519 GLU A O   1 
ATOM   3989 C CB  . GLU A 1 522 ? -14.498 116.826 -26.328 1.00 51.09  ? 519 GLU A CB  1 
ATOM   3990 C CG  . GLU A 1 522 ? -12.997 116.603 -26.319 1.00 53.88  ? 519 GLU A CG  1 
ATOM   3991 C CD  . GLU A 1 522 ? -12.395 116.784 -24.939 1.00 70.62  ? 519 GLU A CD  1 
ATOM   3992 O OE1 . GLU A 1 522 ? -13.082 117.347 -24.060 1.00 69.53  ? 519 GLU A OE1 1 
ATOM   3993 O OE2 . GLU A 1 522 ? -11.239 116.362 -24.732 1.00 64.45  ? 519 GLU A OE2 1 
ATOM   3994 N N   . VAL A 1 523 ? -14.084 115.273 -29.386 1.00 39.16  ? 520 VAL A N   1 
ATOM   3995 C CA  . VAL A 1 523 ? -13.768 114.042 -30.100 1.00 40.25  ? 520 VAL A CA  1 
ATOM   3996 C C   . VAL A 1 523 ? -12.512 113.425 -29.503 1.00 33.88  ? 520 VAL A C   1 
ATOM   3997 O O   . VAL A 1 523 ? -11.486 114.098 -29.352 1.00 48.06  ? 520 VAL A O   1 
ATOM   3998 C CB  . VAL A 1 523 ? -13.590 114.308 -31.604 1.00 32.94  ? 520 VAL A CB  1 
ATOM   3999 C CG1 . VAL A 1 523 ? -13.315 113.007 -32.343 1.00 32.63  ? 520 VAL A CG1 1 
ATOM   4000 C CG2 . VAL A 1 523 ? -14.821 114.998 -32.168 1.00 31.23  ? 520 VAL A CG2 1 
ATOM   4001 N N   . ARG A 1 524 ? -12.594 112.142 -29.160 1.00 35.74  ? 521 ARG A N   1 
ATOM   4002 C CA  . ARG A 1 524 ? -11.465 111.374 -28.661 1.00 31.74  ? 521 ARG A CA  1 
ATOM   4003 C C   . ARG A 1 524 ? -11.332 110.104 -29.489 1.00 35.05  ? 521 ARG A C   1 
ATOM   4004 O O   . ARG A 1 524 ? -12.195 109.777 -30.307 1.00 33.70  ? 521 ARG A O   1 
ATOM   4005 C CB  . ARG A 1 524 ? -11.628 111.039 -27.172 1.00 35.69  ? 521 ARG A CB  1 
ATOM   4006 C CG  . ARG A 1 524 ? -11.796 112.261 -26.287 1.00 37.05  ? 521 ARG A CG  1 
ATOM   4007 C CD  . ARG A 1 524 ? -12.158 111.873 -24.866 1.00 40.00  ? 521 ARG A CD  1 
ATOM   4008 N NE  . ARG A 1 524 ? -12.495 113.041 -24.059 1.00 48.05  ? 521 ARG A NE  1 
ATOM   4009 C CZ  . ARG A 1 524 ? -12.991 112.979 -22.828 1.00 40.89  ? 521 ARG A CZ  1 
ATOM   4010 N NH1 . ARG A 1 524 ? -13.209 111.802 -22.258 1.00 40.95  ? 521 ARG A NH1 1 
ATOM   4011 N NH2 . ARG A 1 524 ? -13.270 114.094 -22.166 1.00 47.37  ? 521 ARG A NH2 1 
ATOM   4012 N N   . ARG A 1 525 ? -10.237 109.380 -29.269 1.00 36.12  ? 522 ARG A N   1 
ATOM   4013 C CA  . ARG A 1 525 ? -9.915  108.199 -30.059 1.00 38.38  ? 522 ARG A CA  1 
ATOM   4014 C C   . ARG A 1 525 ? -9.613  107.027 -29.140 1.00 35.31  ? 522 ARG A C   1 
ATOM   4015 O O   . ARG A 1 525 ? -8.812  107.154 -28.208 1.00 40.85  ? 522 ARG A O   1 
ATOM   4016 C CB  . ARG A 1 525 ? -8.722  108.466 -30.982 1.00 47.76  ? 522 ARG A CB  1 
ATOM   4017 C CG  . ARG A 1 525 ? -8.987  109.501 -32.061 1.00 49.26  ? 522 ARG A CG  1 
ATOM   4018 C CD  . ARG A 1 525 ? -7.702  109.872 -32.780 1.00 62.82  ? 522 ARG A CD  1 
ATOM   4019 N NE  . ARG A 1 525 ? -6.936  108.688 -33.158 1.00 70.03  ? 522 ARG A NE  1 
ATOM   4020 C CZ  . ARG A 1 525 ? -7.034  108.078 -34.334 1.00 67.55  ? 522 ARG A CZ  1 
ATOM   4021 N NH1 . ARG A 1 525 ? -7.866  108.542 -35.257 1.00 71.87  ? 522 ARG A NH1 1 
ATOM   4022 N NH2 . ARG A 1 525 ? -6.298  107.005 -34.589 1.00 61.74  ? 522 ARG A NH2 1 
ATOM   4023 N N   . GLY A 1 526 ? -10.250 105.889 -29.407 1.00 38.99  ? 523 GLY A N   1 
ATOM   4024 C CA  . GLY A 1 526 ? -9.970  104.670 -28.675 1.00 37.30  ? 523 GLY A CA  1 
ATOM   4025 C C   . GLY A 1 526 ? -10.812 104.473 -27.431 1.00 40.19  ? 523 GLY A C   1 
ATOM   4026 O O   . GLY A 1 526 ? -10.669 105.211 -26.451 1.00 42.16  ? 523 GLY A O   1 
ATOM   4027 N N   . LEU A 1 527 ? -11.697 103.475 -27.460 1.00 41.67  ? 524 LEU A N   1 
ATOM   4028 C CA  . LEU A 1 527 ? -12.497 103.100 -26.293 1.00 43.53  ? 524 LEU A CA  1 
ATOM   4029 C C   . LEU A 1 527 ? -11.672 102.168 -25.405 1.00 37.02  ? 524 LEU A C   1 
ATOM   4030 O O   . LEU A 1 527 ? -11.901 100.959 -25.324 1.00 40.84  ? 524 LEU A O   1 
ATOM   4031 C CB  . LEU A 1 527 ? -13.804 102.449 -26.723 1.00 34.19  ? 524 LEU A CB  1 
ATOM   4032 C CG  . LEU A 1 527 ? -14.861 103.344 -27.369 1.00 41.00  ? 524 LEU A CG  1 
ATOM   4033 C CD1 . LEU A 1 527 ? -15.988 102.499 -27.940 1.00 46.56  ? 524 LEU A CD1 1 
ATOM   4034 C CD2 . LEU A 1 527 ? -15.400 104.341 -26.358 1.00 30.31  ? 524 LEU A CD2 1 
ATOM   4035 N N   . ARG A 1 528 ? -10.692 102.765 -24.727 1.00 37.33  ? 525 ARG A N   1 
ATOM   4036 C CA  . ARG A 1 528 ? -9.729  102.036 -23.904 1.00 40.27  ? 525 ARG A CA  1 
ATOM   4037 C C   . ARG A 1 528 ? -9.063  100.928 -24.719 1.00 28.28  ? 525 ARG A C   1 
ATOM   4038 O O   . ARG A 1 528 ? -9.177  99.736  -24.426 1.00 34.43  ? 525 ARG A O   1 
ATOM   4039 C CB  . ARG A 1 528 ? -10.394 101.482 -22.640 1.00 37.44  ? 525 ARG A CB  1 
ATOM   4040 C CG  . ARG A 1 528 ? -11.127 102.536 -21.824 1.00 37.15  ? 525 ARG A CG  1 
ATOM   4041 C CD  . ARG A 1 528 ? -11.512 102.020 -20.448 1.00 44.39  ? 525 ARG A CD  1 
ATOM   4042 N NE  . ARG A 1 528 ? -12.178 103.049 -19.652 1.00 56.37  ? 525 ARG A NE  1 
ATOM   4043 C CZ  . ARG A 1 528 ? -12.471 102.926 -18.362 1.00 60.31  ? 525 ARG A CZ  1 
ATOM   4044 N NH1 . ARG A 1 528 ? -12.154 101.816 -17.709 1.00 53.58  ? 525 ARG A NH1 1 
ATOM   4045 N NH2 . ARG A 1 528 ? -13.078 103.917 -17.721 1.00 47.53  ? 525 ARG A NH2 1 
ATOM   4046 N N   . ALA A 1 529 ? -8.356  101.356 -25.769 1.00 32.10  ? 526 ALA A N   1 
ATOM   4047 C CA  . ALA A 1 529 ? -7.803  100.412 -26.735 1.00 34.46  ? 526 ALA A CA  1 
ATOM   4048 C C   . ALA A 1 529 ? -6.747  99.514  -26.103 1.00 29.38  ? 526 ALA A C   1 
ATOM   4049 O O   . ALA A 1 529 ? -6.671  98.320  -26.417 1.00 36.01  ? 526 ALA A O   1 
ATOM   4050 C CB  . ALA A 1 529 ? -7.220  101.168 -27.929 1.00 33.79  ? 526 ALA A CB  1 
ATOM   4051 N N   . GLN A 1 530 ? -5.922  100.068 -25.213 1.00 34.18  ? 527 GLN A N   1 
ATOM   4052 C CA  . GLN A 1 530 ? -4.876  99.269  -24.581 1.00 32.91  ? 527 GLN A CA  1 
ATOM   4053 C C   . GLN A 1 530 ? -5.472  98.227  -23.642 1.00 38.00  ? 527 GLN A C   1 
ATOM   4054 O O   . GLN A 1 530 ? -5.072  97.057  -23.664 1.00 40.32  ? 527 GLN A O   1 
ATOM   4055 C CB  . GLN A 1 530 ? -3.899  100.177 -23.834 1.00 37.88  ? 527 GLN A CB  1 
ATOM   4056 C CG  . GLN A 1 530 ? -3.050  101.046 -24.746 1.00 48.77  ? 527 GLN A CG  1 
ATOM   4057 C CD  . GLN A 1 530 ? -2.221  100.228 -25.716 1.00 42.75  ? 527 GLN A CD  1 
ATOM   4058 O OE1 . GLN A 1 530 ? -2.371  100.346 -26.932 1.00 47.46  ? 527 GLN A OE1 1 
ATOM   4059 N NE2 . GLN A 1 530 ? -1.338  99.392  -25.182 1.00 46.11  ? 527 GLN A NE2 1 
ATOM   4060 N N   . ALA A 1 531 ? -6.434  98.634  -22.811 1.00 37.33  ? 528 ALA A N   1 
ATOM   4061 C CA  . ALA A 1 531 ? -7.041  97.697  -21.872 1.00 34.47  ? 528 ALA A CA  1 
ATOM   4062 C C   . ALA A 1 531 ? -7.858  96.635  -22.596 1.00 31.74  ? 528 ALA A C   1 
ATOM   4063 O O   . ALA A 1 531 ? -7.840  95.461  -22.209 1.00 39.70  ? 528 ALA A O   1 
ATOM   4064 C CB  . ALA A 1 531 ? -7.911  98.451  -20.866 1.00 30.83  ? 528 ALA A CB  1 
ATOM   4065 N N   . CYS A 1 532 ? -8.572  97.023  -23.653 1.00 28.01  ? 529 CYS A N   1 
ATOM   4066 C CA  . CYS A 1 532 ? -9.441  96.083  -24.348 1.00 29.07  ? 529 CYS A CA  1 
ATOM   4067 C C   . CYS A 1 532 ? -8.683  95.154  -25.284 1.00 33.63  ? 529 CYS A C   1 
ATOM   4068 O O   . CYS A 1 532 ? -9.223  94.109  -25.664 1.00 29.98  ? 529 CYS A O   1 
ATOM   4069 C CB  . CYS A 1 532 ? -10.522 96.840  -25.118 1.00 36.99  ? 529 CYS A CB  1 
ATOM   4070 S SG  . CYS A 1 532 ? -11.734 97.591  -24.018 1.00 42.99  ? 529 CYS A SG  1 
ATOM   4071 N N   . ALA A 1 533 ? -7.454  95.502  -25.666 1.00 32.48  ? 530 ALA A N   1 
ATOM   4072 C CA  . ALA A 1 533 ? -6.626  94.545  -26.390 1.00 34.26  ? 530 ALA A CA  1 
ATOM   4073 C C   . ALA A 1 533 ? -6.232  93.377  -25.498 1.00 26.40  ? 530 ALA A C   1 
ATOM   4074 O O   . ALA A 1 533 ? -6.031  92.260  -25.989 1.00 30.23  ? 530 ALA A O   1 
ATOM   4075 C CB  . ALA A 1 533 ? -5.384  95.234  -26.949 1.00 27.37  ? 530 ALA A CB  1 
ATOM   4076 N N   . PHE A 1 534 ? -6.120  93.614  -24.190 1.00 26.66  ? 531 PHE A N   1 
ATOM   4077 C CA  . PHE A 1 534 ? -5.840  92.525  -23.261 1.00 29.01  ? 531 PHE A CA  1 
ATOM   4078 C C   . PHE A 1 534 ? -7.022  91.569  -23.160 1.00 35.20  ? 531 PHE A C   1 
ATOM   4079 O O   . PHE A 1 534 ? -6.839  90.346  -23.158 1.00 34.25  ? 531 PHE A O   1 
ATOM   4080 C CB  . PHE A 1 534 ? -5.483  93.094  -21.887 1.00 29.24  ? 531 PHE A CB  1 
ATOM   4081 C CG  . PHE A 1 534 ? -5.562  92.089  -20.773 1.00 38.04  ? 531 PHE A CG  1 
ATOM   4082 C CD1 . PHE A 1 534 ? -4.554  91.157  -20.590 1.00 40.72  ? 531 PHE A CD1 1 
ATOM   4083 C CD2 . PHE A 1 534 ? -6.640  92.083  -19.902 1.00 32.76  ? 531 PHE A CD2 1 
ATOM   4084 C CE1 . PHE A 1 534 ? -4.624  90.233  -19.564 1.00 41.62  ? 531 PHE A CE1 1 
ATOM   4085 C CE2 . PHE A 1 534 ? -6.715  91.161  -18.874 1.00 35.65  ? 531 PHE A CE2 1 
ATOM   4086 C CZ  . PHE A 1 534 ? -5.705  90.235  -18.705 1.00 40.14  ? 531 PHE A CZ  1 
ATOM   4087 N N   . TRP A 1 535 ? -8.241  92.106  -23.082 1.00 29.45  ? 532 TRP A N   1 
ATOM   4088 C CA  . TRP A 1 535 ? -9.418  91.258  -22.930 1.00 35.77  ? 532 TRP A CA  1 
ATOM   4089 C C   . TRP A 1 535 ? -9.807  90.584  -24.241 1.00 27.25  ? 532 TRP A C   1 
ATOM   4090 O O   . TRP A 1 535 ? -10.189 89.409  -24.246 1.00 35.08  ? 532 TRP A O   1 
ATOM   4091 C CB  . TRP A 1 535 ? -10.595 92.075  -22.393 1.00 23.80  ? 532 TRP A CB  1 
ATOM   4092 C CG  . TRP A 1 535 ? -10.389 92.607  -21.009 1.00 16.93  ? 532 TRP A CG  1 
ATOM   4093 C CD1 . TRP A 1 535 ? -10.084 93.890  -20.660 1.00 23.45  ? 532 TRP A CD1 1 
ATOM   4094 C CD2 . TRP A 1 535 ? -10.474 91.869  -19.784 1.00 16.49  ? 532 TRP A CD2 1 
ATOM   4095 N NE1 . TRP A 1 535 ? -9.974  93.997  -19.295 1.00 23.79  ? 532 TRP A NE1 1 
ATOM   4096 C CE2 . TRP A 1 535 ? -10.209 92.769  -18.734 1.00 22.00  ? 532 TRP A CE2 1 
ATOM   4097 C CE3 . TRP A 1 535 ? -10.750 90.534  -19.474 1.00 18.60  ? 532 TRP A CE3 1 
ATOM   4098 C CZ2 . TRP A 1 535 ? -10.211 92.378  -17.397 1.00 24.53  ? 532 TRP A CZ2 1 
ATOM   4099 C CZ3 . TRP A 1 535 ? -10.751 90.147  -18.146 1.00 19.42  ? 532 TRP A CZ3 1 
ATOM   4100 C CH2 . TRP A 1 535 ? -10.483 91.066  -17.124 1.00 21.44  ? 532 TRP A CH2 1 
ATOM   4101 N N   . ASN A 1 536 ? -9.718  91.304  -25.359 1.00 26.62  ? 533 ASN A N   1 
ATOM   4102 C CA  . ASN A 1 536 ? -10.231 90.796  -26.625 1.00 31.40  ? 533 ASN A CA  1 
ATOM   4103 C C   . ASN A 1 536 ? -9.210  89.989  -27.415 1.00 38.24  ? 533 ASN A C   1 
ATOM   4104 O O   . ASN A 1 536 ? -9.602  89.113  -28.195 1.00 41.50  ? 533 ASN A O   1 
ATOM   4105 C CB  . ASN A 1 536 ? -10.739 91.953  -27.491 1.00 30.17  ? 533 ASN A CB  1 
ATOM   4106 C CG  . ASN A 1 536 ? -11.911 92.681  -26.863 1.00 33.05  ? 533 ASN A CG  1 
ATOM   4107 O OD1 . ASN A 1 536 ? -12.665 92.106  -26.077 1.00 38.59  ? 533 ASN A OD1 1 
ATOM   4108 N ND2 . ASN A 1 536 ? -12.072 93.954  -27.208 1.00 38.30  ? 533 ASN A ND2 1 
ATOM   4109 N N   . ARG A 1 537 ? -7.917  90.254  -27.241 1.00 32.46  ? 534 ARG A N   1 
ATOM   4110 C CA  . ARG A 1 537 ? -6.884  89.606  -28.041 1.00 39.56  ? 534 ARG A CA  1 
ATOM   4111 C C   . ARG A 1 537 ? -6.023  88.636  -27.247 1.00 38.95  ? 534 ARG A C   1 
ATOM   4112 O O   . ARG A 1 537 ? -5.868  87.479  -27.650 1.00 43.12  ? 534 ARG A O   1 
ATOM   4113 C CB  . ARG A 1 537 ? -5.989  90.666  -28.701 1.00 36.84  ? 534 ARG A CB  1 
ATOM   4114 C CG  . ARG A 1 537 ? -6.729  91.636  -29.607 1.00 33.72  ? 534 ARG A CG  1 
ATOM   4115 C CD  . ARG A 1 537 ? -5.793  92.712  -30.134 1.00 39.31  ? 534 ARG A CD  1 
ATOM   4116 N NE  . ARG A 1 537 ? -6.484  93.682  -30.979 1.00 48.18  ? 534 ARG A NE  1 
ATOM   4117 C CZ  . ARG A 1 537 ? -6.561  93.599  -32.303 1.00 45.16  ? 534 ARG A CZ  1 
ATOM   4118 N NH1 . ARG A 1 537 ? -5.986  92.588  -32.942 1.00 38.31  ? 534 ARG A NH1 1 
ATOM   4119 N NH2 . ARG A 1 537 ? -7.210  94.529  -32.991 1.00 37.44  ? 534 ARG A NH2 1 
ATOM   4120 N N   . PHE A 1 538 ? -5.453  89.072  -26.123 1.00 36.78  ? 535 PHE A N   1 
ATOM   4121 C CA  . PHE A 1 538 ? -4.452  88.256  -25.446 1.00 40.41  ? 535 PHE A CA  1 
ATOM   4122 C C   . PHE A 1 538 ? -5.082  87.226  -24.515 1.00 40.58  ? 535 PHE A C   1 
ATOM   4123 O O   . PHE A 1 538 ? -4.706  86.049  -24.540 1.00 42.75  ? 535 PHE A O   1 
ATOM   4124 C CB  . PHE A 1 538 ? -3.480  89.145  -24.670 1.00 32.29  ? 535 PHE A CB  1 
ATOM   4125 C CG  . PHE A 1 538 ? -2.479  88.376  -23.859 1.00 43.15  ? 535 PHE A CG  1 
ATOM   4126 C CD1 . PHE A 1 538 ? -1.501  87.618  -24.482 1.00 39.99  ? 535 PHE A CD1 1 
ATOM   4127 C CD2 . PHE A 1 538 ? -2.516  88.407  -22.475 1.00 38.82  ? 535 PHE A CD2 1 
ATOM   4128 C CE1 . PHE A 1 538 ? -0.579  86.904  -23.740 1.00 39.48  ? 535 PHE A CE1 1 
ATOM   4129 C CE2 . PHE A 1 538 ? -1.594  87.697  -21.727 1.00 41.51  ? 535 PHE A CE2 1 
ATOM   4130 C CZ  . PHE A 1 538 ? -0.625  86.945  -22.361 1.00 42.82  ? 535 PHE A CZ  1 
ATOM   4131 N N   . LEU A 1 539 ? -6.032  87.651  -23.681 1.00 36.70  ? 536 LEU A N   1 
ATOM   4132 C CA  . LEU A 1 539 ? -6.581  86.747  -22.674 1.00 41.53  ? 536 LEU A CA  1 
ATOM   4133 C C   . LEU A 1 539 ? -7.228  85.494  -23.258 1.00 43.69  ? 536 LEU A C   1 
ATOM   4134 O O   . LEU A 1 539 ? -7.038  84.413  -22.672 1.00 43.49  ? 536 LEU A O   1 
ATOM   4135 C CB  . LEU A 1 539 ? -7.574  87.500  -21.780 1.00 38.30  ? 536 LEU A CB  1 
ATOM   4136 C CG  . LEU A 1 539 ? -7.983  86.733  -20.520 1.00 46.74  ? 536 LEU A CG  1 
ATOM   4137 C CD1 . LEU A 1 539 ? -6.774  86.485  -19.629 1.00 49.99  ? 536 LEU A CD1 1 
ATOM   4138 C CD2 . LEU A 1 539 ? -9.073  87.464  -19.757 1.00 33.22  ? 536 LEU A CD2 1 
ATOM   4139 N N   . PRO A 1 540 ? -7.989  85.544  -24.362 1.00 42.88  ? 537 PRO A N   1 
ATOM   4140 C CA  . PRO A 1 540 ? -8.484  84.282  -24.941 1.00 45.92  ? 537 PRO A CA  1 
ATOM   4141 C C   . PRO A 1 540 ? -7.374  83.315  -25.312 1.00 54.23  ? 537 PRO A C   1 
ATOM   4142 O O   . PRO A 1 540 ? -7.543  82.098  -25.163 1.00 57.55  ? 537 PRO A O   1 
ATOM   4143 C CB  . PRO A 1 540 ? -9.270  84.751  -26.173 1.00 36.32  ? 537 PRO A CB  1 
ATOM   4144 C CG  . PRO A 1 540 ? -9.714  86.120  -25.825 1.00 34.34  ? 537 PRO A CG  1 
ATOM   4145 C CD  . PRO A 1 540 ? -8.585  86.715  -25.033 1.00 35.75  ? 537 PRO A CD  1 
ATOM   4146 N N   . LYS A 1 541 ? -6.236  83.822  -25.792 1.00 56.40  ? 538 LYS A N   1 
ATOM   4147 C CA  . LYS A 1 541 ? -5.106  82.946  -26.078 1.00 59.32  ? 538 LYS A CA  1 
ATOM   4148 C C   . LYS A 1 541 ? -4.498  82.382  -24.801 1.00 57.36  ? 538 LYS A C   1 
ATOM   4149 O O   . LYS A 1 541 ? -3.999  81.251  -24.800 1.00 60.00  ? 538 LYS A O   1 
ATOM   4150 C CB  . LYS A 1 541 ? -4.046  83.695  -26.885 1.00 49.83  ? 538 LYS A CB  1 
ATOM   4151 C CG  . LYS A 1 541 ? -4.507  84.118  -28.269 1.00 59.95  ? 538 LYS A CG  1 
ATOM   4152 C CD  . LYS A 1 541 ? -3.364  84.721  -29.065 1.00 67.65  ? 538 LYS A CD  1 
ATOM   4153 C CE  . LYS A 1 541 ? -2.193  83.756  -29.157 1.00 79.40  ? 538 LYS A CE  1 
ATOM   4154 N NZ  . LYS A 1 541 ? -2.569  82.475  -29.815 1.00 74.16  ? 538 LYS A NZ  1 
ATOM   4155 N N   . LEU A 1 542 ? -4.529  83.150  -23.710 1.00 51.87  ? 539 LEU A N   1 
ATOM   4156 C CA  . LEU A 1 542 ? -4.044  82.638  -22.433 1.00 52.67  ? 539 LEU A CA  1 
ATOM   4157 C C   . LEU A 1 542 ? -4.971  81.562  -21.881 1.00 63.13  ? 539 LEU A C   1 
ATOM   4158 O O   . LEU A 1 542 ? -4.517  80.659  -21.170 1.00 73.77  ? 539 LEU A O   1 
ATOM   4159 C CB  . LEU A 1 542 ? -3.889  83.788  -21.435 1.00 51.37  ? 539 LEU A CB  1 
ATOM   4160 C CG  . LEU A 1 542 ? -3.060  83.570  -20.164 1.00 55.10  ? 539 LEU A CG  1 
ATOM   4161 C CD1 . LEU A 1 542 ? -2.443  84.882  -19.709 1.00 45.47  ? 539 LEU A CD1 1 
ATOM   4162 C CD2 . LEU A 1 542 ? -3.897  82.974  -19.043 1.00 59.33  ? 539 LEU A CD2 1 
ATOM   4163 N N   . LEU A 1 543 ? -6.266  81.637  -22.199 1.00 63.39  ? 540 LEU A N   1 
ATOM   4164 C CA  . LEU A 1 543 ? -7.204  80.620  -21.742 1.00 68.25  ? 540 LEU A CA  1 
ATOM   4165 C C   . LEU A 1 543 ? -7.143  79.362  -22.599 1.00 69.66  ? 540 LEU A C   1 
ATOM   4166 O O   . LEU A 1 543 ? -7.413  78.265  -22.097 1.00 74.80  ? 540 LEU A O   1 
ATOM   4167 C CB  . LEU A 1 543 ? -8.627  81.180  -21.732 1.00 65.73  ? 540 LEU A CB  1 
ATOM   4168 C CG  . LEU A 1 543 ? -8.859  82.433  -20.884 1.00 63.03  ? 540 LEU A CG  1 
ATOM   4169 C CD1 . LEU A 1 543 ? -10.339 82.784  -20.832 1.00 50.20  ? 540 LEU A CD1 1 
ATOM   4170 C CD2 . LEU A 1 543 ? -8.293  82.257  -19.484 1.00 59.69  ? 540 LEU A CD2 1 
ATOM   4171 N N   . SER A 1 544 ? -6.799  79.497  -23.881 1.00 69.37  ? 541 SER A N   1 
ATOM   4172 C CA  . SER A 1 544 ? -6.633  78.343  -24.757 1.00 72.14  ? 541 SER A CA  1 
ATOM   4173 C C   . SER A 1 544 ? -5.506  77.460  -24.241 1.00 82.56  ? 541 SER A C   1 
ATOM   4174 O O   . SER A 1 544 ? -5.741  76.321  -23.822 1.00 88.90  ? 541 SER A O   1 
ATOM   4175 C CB  . SER A 1 544 ? -6.354  78.791  -26.193 1.00 72.00  ? 541 SER A CB  1 
ATOM   4176 O OG  . SER A 1 544 ? -7.407  79.600  -26.687 1.00 70.51  ? 541 SER A OG  1 
ATOM   4177 N N   . ALA A 1 545 ? -4.278  77.976  -24.269 1.00 79.20  ? 542 ALA A N   1 
ATOM   4178 C CA  . ALA A 1 545 ? -3.165  77.306  -23.611 1.00 71.50  ? 542 ALA A CA  1 
ATOM   4179 C C   . ALA A 1 545 ? -3.309  77.468  -22.104 1.00 78.44  ? 542 ALA A C   1 
ATOM   4180 O O   . ALA A 1 545 ? -2.801  78.434  -21.527 1.00 78.49  ? 542 ALA A O   1 
ATOM   4181 C CB  . ALA A 1 545 ? -1.827  77.868  -24.096 1.00 60.96  ? 542 ALA A CB  1 
ATOM   4182 N N   . THR A 1 546 ? -4.006  76.530  -21.468 1.00 93.45  ? 543 THR A N   1 
ATOM   4183 C CA  . THR A 1 546 ? -4.372  76.635  -20.056 1.00 94.23  ? 543 THR A CA  1 
ATOM   4184 C C   . THR A 1 546 ? -3.167  76.827  -19.137 1.00 92.99  ? 543 THR A C   1 
ATOM   4185 O O   . THR A 1 546 ? -2.034  76.518  -19.503 1.00 101.16 ? 543 THR A O   1 
ATOM   4186 C CB  . THR A 1 546 ? -5.145  75.385  -19.591 1.00 86.52  ? 543 THR A CB  1 
ATOM   4187 O OG1 . THR A 1 546 ? -6.193  75.093  -20.524 1.00 78.96  ? 543 THR A OG1 1 
ATOM   4188 C CG2 . THR A 1 546 ? -5.750  75.617  -18.216 1.00 81.75  ? 543 THR A CG2 1 
ATOM   4189 N N   . GLU B 1 7   ? -67.897 100.061 31.471  1.00 79.04  ? 4   GLU B N   1 
ATOM   4190 C CA  . GLU B 1 7   ? -68.165 100.404 30.079  1.00 88.81  ? 4   GLU B CA  1 
ATOM   4191 C C   . GLU B 1 7   ? -67.001 101.174 29.461  1.00 88.83  ? 4   GLU B C   1 
ATOM   4192 O O   . GLU B 1 7   ? -65.835 100.844 29.683  1.00 73.30  ? 4   GLU B O   1 
ATOM   4193 C CB  . GLU B 1 7   ? -69.459 101.218 29.965  1.00 93.79  ? 4   GLU B CB  1 
ATOM   4194 C CG  . GLU B 1 7   ? -69.543 102.441 30.878  1.00 91.15  ? 4   GLU B CG  1 
ATOM   4195 C CD  . GLU B 1 7   ? -70.228 102.149 32.197  1.00 96.55  ? 4   GLU B CD  1 
ATOM   4196 O OE1 . GLU B 1 7   ? -69.672 101.376 33.005  1.00 101.35 ? 4   GLU B OE1 1 
ATOM   4197 O OE2 . GLU B 1 7   ? -71.332 102.690 32.421  1.00 96.42  ? 4   GLU B OE2 1 
ATOM   4198 N N   . ASP B 1 8   ? -67.331 102.201 28.673  1.00 82.78  ? 5   ASP B N   1 
ATOM   4199 C CA  . ASP B 1 8   ? -66.313 103.051 28.070  1.00 69.21  ? 5   ASP B CA  1 
ATOM   4200 C C   . ASP B 1 8   ? -65.493 103.801 29.110  1.00 64.39  ? 5   ASP B C   1 
ATOM   4201 O O   . ASP B 1 8   ? -64.427 104.327 28.777  1.00 53.27  ? 5   ASP B O   1 
ATOM   4202 C CB  . ASP B 1 8   ? -66.971 104.045 27.113  1.00 78.00  ? 5   ASP B CB  1 
ATOM   4203 C CG  . ASP B 1 8   ? -67.838 103.362 26.072  1.00 83.09  ? 5   ASP B CG  1 
ATOM   4204 O OD1 . ASP B 1 8   ? -67.282 102.751 25.134  1.00 74.95  ? 5   ASP B OD1 1 
ATOM   4205 O OD2 . ASP B 1 8   ? -69.079 103.422 26.202  1.00 92.97  ? 5   ASP B OD2 1 
ATOM   4206 N N   . ALA B 1 9   ? -65.964 103.859 30.359  1.00 74.08  ? 6   ALA B N   1 
ATOM   4207 C CA  . ALA B 1 9   ? -65.199 104.520 31.409  1.00 72.74  ? 6   ALA B CA  1 
ATOM   4208 C C   . ALA B 1 9   ? -63.961 103.719 31.788  1.00 71.92  ? 6   ALA B C   1 
ATOM   4209 O O   . ALA B 1 9   ? -62.972 104.294 32.258  1.00 60.28  ? 6   ALA B O   1 
ATOM   4210 C CB  . ALA B 1 9   ? -66.081 104.750 32.635  1.00 71.26  ? 6   ALA B CB  1 
ATOM   4211 N N   . GLU B 1 10  ? -63.991 102.399 31.591  1.00 64.82  ? 7   GLU B N   1 
ATOM   4212 C CA  . GLU B 1 10  ? -62.830 101.572 31.890  1.00 58.71  ? 7   GLU B CA  1 
ATOM   4213 C C   . GLU B 1 10  ? -61.720 101.728 30.860  1.00 54.54  ? 7   GLU B C   1 
ATOM   4214 O O   . GLU B 1 10  ? -60.623 101.199 31.072  1.00 48.51  ? 7   GLU B O   1 
ATOM   4215 C CB  . GLU B 1 10  ? -63.245 100.104 31.999  1.00 61.21  ? 7   GLU B CB  1 
ATOM   4216 C CG  . GLU B 1 10  ? -64.353 99.866  33.012  1.00 65.40  ? 7   GLU B CG  1 
ATOM   4217 C CD  . GLU B 1 10  ? -64.217 98.540  33.733  1.00 63.13  ? 7   GLU B CD  1 
ATOM   4218 O OE1 . GLU B 1 10  ? -63.824 97.545  33.090  1.00 58.30  ? 7   GLU B OE1 1 
ATOM   4219 O OE2 . GLU B 1 10  ? -64.495 98.498  34.950  1.00 67.95  ? 7   GLU B OE2 1 
ATOM   4220 N N   . LEU B 1 11  ? -61.973 102.434 29.761  1.00 50.09  ? 8   LEU B N   1 
ATOM   4221 C CA  . LEU B 1 11  ? -60.947 102.738 28.775  1.00 40.42  ? 8   LEU B CA  1 
ATOM   4222 C C   . LEU B 1 11  ? -60.156 103.993 29.120  1.00 36.82  ? 8   LEU B C   1 
ATOM   4223 O O   . LEU B 1 11  ? -59.221 104.338 28.392  1.00 43.56  ? 8   LEU B O   1 
ATOM   4224 C CB  . LEU B 1 11  ? -61.576 102.887 27.386  1.00 34.93  ? 8   LEU B CB  1 
ATOM   4225 C CG  . LEU B 1 11  ? -62.351 101.673 26.867  1.00 41.83  ? 8   LEU B CG  1 
ATOM   4226 C CD1 . LEU B 1 11  ? -62.842 101.911 25.446  1.00 31.51  ? 8   LEU B CD1 1 
ATOM   4227 C CD2 . LEU B 1 11  ? -61.499 100.414 26.940  1.00 39.36  ? 8   LEU B CD2 1 
ATOM   4228 N N   . LEU B 1 12  ? -60.509 104.681 30.204  1.00 46.63  ? 9   LEU B N   1 
ATOM   4229 C CA  . LEU B 1 12  ? -59.769 105.840 30.690  1.00 41.19  ? 9   LEU B CA  1 
ATOM   4230 C C   . LEU B 1 12  ? -58.994 105.430 31.934  1.00 42.15  ? 9   LEU B C   1 
ATOM   4231 O O   . LEU B 1 12  ? -59.583 104.934 32.901  1.00 50.21  ? 9   LEU B O   1 
ATOM   4232 C CB  . LEU B 1 12  ? -60.704 107.010 31.004  1.00 41.05  ? 9   LEU B CB  1 
ATOM   4233 C CG  . LEU B 1 12  ? -61.435 107.701 29.849  1.00 49.71  ? 9   LEU B CG  1 
ATOM   4234 C CD1 . LEU B 1 12  ? -60.532 107.838 28.629  1.00 39.36  ? 9   LEU B CD1 1 
ATOM   4235 C CD2 . LEU B 1 12  ? -62.731 106.984 29.497  1.00 53.18  ? 9   LEU B CD2 1 
ATOM   4236 N N   . VAL B 1 13  ? -57.679 105.636 31.908  1.00 35.54  ? 10  VAL B N   1 
ATOM   4237 C CA  . VAL B 1 13  ? -56.801 105.271 33.013  1.00 39.31  ? 10  VAL B CA  1 
ATOM   4238 C C   . VAL B 1 13  ? -55.773 106.376 33.202  1.00 34.80  ? 10  VAL B C   1 
ATOM   4239 O O   . VAL B 1 13  ? -55.204 106.884 32.230  1.00 39.81  ? 10  VAL B O   1 
ATOM   4240 C CB  . VAL B 1 13  ? -56.110 103.911 32.767  1.00 40.23  ? 10  VAL B CB  1 
ATOM   4241 C CG1 . VAL B 1 13  ? -54.900 103.744 33.674  1.00 36.48  ? 10  VAL B CG1 1 
ATOM   4242 C CG2 . VAL B 1 13  ? -57.089 102.774 32.990  1.00 39.41  ? 10  VAL B CG2 1 
ATOM   4243 N N   . THR B 1 14  ? -55.543 106.754 34.457  1.00 30.50  ? 11  THR B N   1 
ATOM   4244 C CA  . THR B 1 14  ? -54.527 107.735 34.811  1.00 37.90  ? 11  THR B CA  1 
ATOM   4245 C C   . THR B 1 14  ? -53.327 107.022 35.420  1.00 37.77  ? 11  THR B C   1 
ATOM   4246 O O   . THR B 1 14  ? -53.481 106.215 36.343  1.00 36.08  ? 11  THR B O   1 
ATOM   4247 C CB  . THR B 1 14  ? -55.080 108.769 35.793  1.00 40.91  ? 11  THR B CB  1 
ATOM   4248 O OG1 . THR B 1 14  ? -56.165 109.478 35.182  1.00 48.06  ? 11  THR B OG1 1 
ATOM   4249 C CG2 . THR B 1 14  ? -53.995 109.758 36.195  1.00 29.71  ? 11  THR B CG2 1 
ATOM   4250 N N   . VAL B 1 15  ? -52.139 107.312 34.893  1.00 29.66  ? 12  VAL B N   1 
ATOM   4251 C CA  . VAL B 1 15  ? -50.897 106.779 35.440  1.00 36.44  ? 12  VAL B CA  1 
ATOM   4252 C C   . VAL B 1 15  ? -50.081 107.938 35.995  1.00 31.50  ? 12  VAL B C   1 
ATOM   4253 O O   . VAL B 1 15  ? -50.547 109.083 36.012  1.00 50.41  ? 12  VAL B O   1 
ATOM   4254 C CB  . VAL B 1 15  ? -50.107 105.988 34.382  1.00 39.67  ? 12  VAL B CB  1 
ATOM   4255 C CG1 . VAL B 1 15  ? -50.889 104.756 33.949  1.00 24.71  ? 12  VAL B CG1 1 
ATOM   4256 C CG2 . VAL B 1 15  ? -49.794 106.870 33.185  1.00 32.08  ? 12  VAL B CG2 1 
ATOM   4257 N N   . ARG B 1 16  ? -48.860 107.654 36.453  1.00 31.78  ? 13  ARG B N   1 
ATOM   4258 C CA  . ARG B 1 16  ? -48.032 108.700 37.044  1.00 39.68  ? 13  ARG B CA  1 
ATOM   4259 C C   . ARG B 1 16  ? -47.636 109.770 36.036  1.00 39.05  ? 13  ARG B C   1 
ATOM   4260 O O   . ARG B 1 16  ? -47.341 110.901 36.436  1.00 45.76  ? 13  ARG B O   1 
ATOM   4261 C CB  . ARG B 1 16  ? -46.775 108.096 37.673  1.00 38.53  ? 13  ARG B CB  1 
ATOM   4262 C CG  . ARG B 1 16  ? -47.029 107.287 38.934  1.00 51.31  ? 13  ARG B CG  1 
ATOM   4263 C CD  . ARG B 1 16  ? -45.735 107.057 39.699  1.00 54.59  ? 13  ARG B CD  1 
ATOM   4264 N NE  . ARG B 1 16  ? -45.939 106.246 40.896  1.00 72.48  ? 13  ARG B NE  1 
ATOM   4265 C CZ  . ARG B 1 16  ? -44.991 105.982 41.790  1.00 64.05  ? 13  ARG B CZ  1 
ATOM   4266 N NH1 . ARG B 1 16  ? -43.768 106.468 41.626  1.00 53.56  ? 13  ARG B NH1 1 
ATOM   4267 N NH2 . ARG B 1 16  ? -45.267 105.233 42.849  1.00 59.07  ? 13  ARG B NH2 1 
ATOM   4268 N N   . GLY B 1 17  ? -47.625 109.445 34.746  1.00 41.76  ? 14  GLY B N   1 
ATOM   4269 C CA  . GLY B 1 17  ? -47.230 110.401 33.731  1.00 36.93  ? 14  GLY B CA  1 
ATOM   4270 C C   . GLY B 1 17  ? -48.382 111.224 33.191  1.00 35.67  ? 14  GLY B C   1 
ATOM   4271 O O   . GLY B 1 17  ? -48.177 112.332 32.688  1.00 33.37  ? 14  GLY B O   1 
ATOM   4272 N N   . GLY B 1 18  ? -49.595 110.695 33.285  1.00 26.79  ? 15  GLY B N   1 
ATOM   4273 C CA  . GLY B 1 18  ? -50.756 111.400 32.777  1.00 25.04  ? 15  GLY B CA  1 
ATOM   4274 C C   . GLY B 1 18  ? -51.908 110.435 32.553  1.00 33.37  ? 15  GLY B C   1 
ATOM   4275 O O   . GLY B 1 18  ? -51.956 109.358 33.144  1.00 35.42  ? 15  GLY B O   1 
ATOM   4276 N N   . ARG B 1 19  ? -52.823 110.851 31.684  1.00 30.80  ? 16  ARG B N   1 
ATOM   4277 C CA  . ARG B 1 19  ? -54.023 110.087 31.381  1.00 38.84  ? 16  ARG B CA  1 
ATOM   4278 C C   . ARG B 1 19  ? -53.863 109.329 30.070  1.00 35.92  ? 16  ARG B C   1 
ATOM   4279 O O   . ARG B 1 19  ? -53.102 109.730 29.185  1.00 34.37  ? 16  ARG B O   1 
ATOM   4280 C CB  . ARG B 1 19  ? -55.245 111.005 31.306  1.00 47.89  ? 16  ARG B CB  1 
ATOM   4281 C CG  . ARG B 1 19  ? -55.599 111.677 32.622  1.00 55.75  ? 16  ARG B CG  1 
ATOM   4282 C CD  . ARG B 1 19  ? -56.743 112.657 32.438  1.00 60.70  ? 16  ARG B CD  1 
ATOM   4283 N NE  . ARG B 1 19  ? -56.347 113.808 31.633  1.00 63.61  ? 16  ARG B NE  1 
ATOM   4284 C CZ  . ARG B 1 19  ? -57.201 114.641 31.049  1.00 55.42  ? 16  ARG B CZ  1 
ATOM   4285 N NH1 . ARG B 1 19  ? -58.507 114.448 31.170  1.00 55.19  ? 16  ARG B NH1 1 
ATOM   4286 N NH2 . ARG B 1 19  ? -56.750 115.664 30.336  1.00 52.14  ? 16  ARG B NH2 1 
ATOM   4287 N N   . LEU B 1 20  ? -54.598 108.224 29.953  1.00 32.63  ? 17  LEU B N   1 
ATOM   4288 C CA  . LEU B 1 20  ? -54.534 107.360 28.785  1.00 40.07  ? 17  LEU B CA  1 
ATOM   4289 C C   . LEU B 1 20  ? -55.943 106.970 28.367  1.00 36.13  ? 17  LEU B C   1 
ATOM   4290 O O   . LEU B 1 20  ? -56.856 106.901 29.193  1.00 42.17  ? 17  LEU B O   1 
ATOM   4291 C CB  . LEU B 1 20  ? -53.712 106.092 29.064  1.00 31.38  ? 17  LEU B CB  1 
ATOM   4292 C CG  . LEU B 1 20  ? -52.263 106.276 29.518  1.00 35.93  ? 17  LEU B CG  1 
ATOM   4293 C CD1 . LEU B 1 20  ? -51.710 104.970 30.060  1.00 38.40  ? 17  LEU B CD1 1 
ATOM   4294 C CD2 . LEU B 1 20  ? -51.406 106.788 28.373  1.00 28.60  ? 17  LEU B CD2 1 
ATOM   4295 N N   . ARG B 1 21  ? -56.110 106.711 27.071  1.00 25.68  ? 18  ARG B N   1 
ATOM   4296 C CA  . ARG B 1 21  ? -57.360 106.199 26.523  1.00 37.58  ? 18  ARG B CA  1 
ATOM   4297 C C   . ARG B 1 21  ? -57.074 104.891 25.802  1.00 34.47  ? 18  ARG B C   1 
ATOM   4298 O O   . ARG B 1 21  ? -56.328 104.872 24.818  1.00 29.52  ? 18  ARG B O   1 
ATOM   4299 C CB  . ARG B 1 21  ? -58.009 107.201 25.569  1.00 29.30  ? 18  ARG B CB  1 
ATOM   4300 C CG  . ARG B 1 21  ? -59.306 106.690 24.962  1.00 34.83  ? 18  ARG B CG  1 
ATOM   4301 C CD  . ARG B 1 21  ? -59.840 107.638 23.909  1.00 45.11  ? 18  ARG B CD  1 
ATOM   4302 N NE  . ARG B 1 21  ? -60.051 108.981 24.440  1.00 52.72  ? 18  ARG B NE  1 
ATOM   4303 C CZ  . ARG B 1 21  ? -61.163 109.376 25.051  1.00 51.64  ? 18  ARG B CZ  1 
ATOM   4304 N NH1 . ARG B 1 21  ? -62.171 108.529 25.213  1.00 55.06  ? 18  ARG B NH1 1 
ATOM   4305 N NH2 . ARG B 1 21  ? -61.267 110.618 25.502  1.00 50.35  ? 18  ARG B NH2 1 
ATOM   4306 N N   . GLY B 1 22  ? -57.673 103.805 26.286  1.00 32.56  ? 19  GLY B N   1 
ATOM   4307 C CA  . GLY B 1 22  ? -57.469 102.492 25.715  1.00 32.72  ? 19  GLY B CA  1 
ATOM   4308 C C   . GLY B 1 22  ? -58.512 102.142 24.673  1.00 34.00  ? 19  GLY B C   1 
ATOM   4309 O O   . GLY B 1 22  ? -59.256 102.989 24.175  1.00 40.14  ? 19  GLY B O   1 
ATOM   4310 N N   . ILE B 1 23  ? -58.562 100.853 24.345  1.00 31.53  ? 20  ILE B N   1 
ATOM   4311 C CA  . ILE B 1 23  ? -59.476 100.331 23.338  1.00 36.15  ? 20  ILE B CA  1 
ATOM   4312 C C   . ILE B 1 23  ? -59.968 98.963  23.791  1.00 36.29  ? 20  ILE B C   1 
ATOM   4313 O O   . ILE B 1 23  ? -59.240 98.200  24.434  1.00 38.50  ? 20  ILE B O   1 
ATOM   4314 C CB  . ILE B 1 23  ? -58.803 100.254 21.945  1.00 31.91  ? 20  ILE B CB  1 
ATOM   4315 C CG1 . ILE B 1 23  ? -59.806 99.821  20.873  1.00 30.86  ? 20  ILE B CG1 1 
ATOM   4316 C CG2 . ILE B 1 23  ? -57.599 99.318  21.976  1.00 24.14  ? 20  ILE B CG2 1 
ATOM   4317 C CD1 . ILE B 1 23  ? -59.231 99.800  19.472  1.00 32.17  ? 20  ILE B CD1 1 
ATOM   4318 N N   . ARG B 1 24  ? -61.224 98.662  23.469  1.00 31.22  ? 21  ARG B N   1 
ATOM   4319 C CA  . ARG B 1 24  ? -61.809 97.363  23.774  1.00 37.94  ? 21  ARG B CA  1 
ATOM   4320 C C   . ARG B 1 24  ? -61.545 96.396  22.627  1.00 38.11  ? 21  ARG B C   1 
ATOM   4321 O O   . ARG B 1 24  ? -61.827 96.707  21.466  1.00 39.21  ? 21  ARG B O   1 
ATOM   4322 C CB  . ARG B 1 24  ? -63.314 97.481  24.021  1.00 37.46  ? 21  ARG B CB  1 
ATOM   4323 C CG  . ARG B 1 24  ? -64.018 96.133  24.044  1.00 44.97  ? 21  ARG B CG  1 
ATOM   4324 C CD  . ARG B 1 24  ? -65.532 96.260  24.040  1.00 47.24  ? 21  ARG B CD  1 
ATOM   4325 N NE  . ARG B 1 24  ? -66.082 96.417  25.383  1.00 75.66  ? 21  ARG B NE  1 
ATOM   4326 C CZ  . ARG B 1 24  ? -67.339 96.132  25.708  1.00 71.45  ? 21  ARG B CZ  1 
ATOM   4327 N NH1 . ARG B 1 24  ? -68.174 95.667  24.788  1.00 67.25  ? 21  ARG B NH1 1 
ATOM   4328 N NH2 . ARG B 1 24  ? -67.760 96.303  26.954  1.00 69.38  ? 21  ARG B NH2 1 
ATOM   4329 N N   . LEU B 1 25  ? -61.009 95.224  22.958  1.00 38.95  ? 22  LEU B N   1 
ATOM   4330 C CA  . LEU B 1 25  ? -60.737 94.177  21.985  1.00 33.69  ? 22  LEU B CA  1 
ATOM   4331 C C   . LEU B 1 25  ? -61.728 93.036  22.172  1.00 28.87  ? 22  LEU B C   1 
ATOM   4332 O O   . LEU B 1 25  ? -62.041 92.654  23.304  1.00 39.18  ? 22  LEU B O   1 
ATOM   4333 C CB  . LEU B 1 25  ? -59.305 93.655  22.124  1.00 35.62  ? 22  LEU B CB  1 
ATOM   4334 C CG  . LEU B 1 25  ? -58.192 94.700  22.027  1.00 38.61  ? 22  LEU B CG  1 
ATOM   4335 C CD1 . LEU B 1 25  ? -56.830 94.028  22.080  1.00 39.40  ? 22  LEU B CD1 1 
ATOM   4336 C CD2 . LEU B 1 25  ? -58.337 95.531  20.761  1.00 28.08  ? 22  LEU B CD2 1 
ATOM   4337 N N   . LYS B 1 26  ? -62.214 92.493  21.060  1.00 25.03  ? 23  LYS B N   1 
ATOM   4338 C CA  . LYS B 1 26  ? -63.213 91.436  21.094  1.00 39.25  ? 23  LYS B CA  1 
ATOM   4339 C C   . LYS B 1 26  ? -62.554 90.064  21.034  1.00 42.48  ? 23  LYS B C   1 
ATOM   4340 O O   . LYS B 1 26  ? -61.612 89.843  20.267  1.00 41.79  ? 23  LYS B O   1 
ATOM   4341 C CB  . LYS B 1 26  ? -64.200 91.582  19.934  1.00 36.13  ? 23  LYS B CB  1 
ATOM   4342 C CG  . LYS B 1 26  ? -64.927 92.916  19.885  1.00 45.41  ? 23  LYS B CG  1 
ATOM   4343 C CD  . LYS B 1 26  ? -66.029 92.893  18.837  1.00 54.22  ? 23  LYS B CD  1 
ATOM   4344 C CE  . LYS B 1 26  ? -66.636 94.271  18.634  1.00 55.47  ? 23  LYS B CE  1 
ATOM   4345 N NZ  . LYS B 1 26  ? -65.657 95.221  18.038  1.00 65.89  ? 23  LYS B NZ  1 
ATOM   4346 N N   . THR B 1 27  ? -63.054 89.150  21.854  1.00 38.46  ? 24  THR B N   1 
ATOM   4347 C CA  . THR B 1 27  ? -62.688 87.744  21.845  1.00 44.21  ? 24  THR B CA  1 
ATOM   4348 C C   . THR B 1 27  ? -63.966 86.923  21.805  1.00 48.25  ? 24  THR B C   1 
ATOM   4349 O O   . THR B 1 27  ? -65.041 87.419  22.160  1.00 44.84  ? 24  THR B O   1 
ATOM   4350 C CB  . THR B 1 27  ? -61.861 87.357  23.082  1.00 33.12  ? 24  THR B CB  1 
ATOM   4351 O OG1 . THR B 1 27  ? -62.703 87.361  24.242  1.00 46.86  ? 24  THR B OG1 1 
ATOM   4352 C CG2 . THR B 1 27  ? -60.708 88.330  23.292  1.00 25.85  ? 24  THR B CG2 1 
ATOM   4353 N N   . PRO B 1 28  ? -63.890 85.662  21.367  1.00 45.83  ? 25  PRO B N   1 
ATOM   4354 C CA  . PRO B 1 28  ? -65.090 84.808  21.387  1.00 44.33  ? 25  PRO B CA  1 
ATOM   4355 C C   . PRO B 1 28  ? -65.675 84.596  22.776  1.00 49.11  ? 25  PRO B C   1 
ATOM   4356 O O   . PRO B 1 28  ? -66.811 84.114  22.877  1.00 50.14  ? 25  PRO B O   1 
ATOM   4357 C CB  . PRO B 1 28  ? -64.590 83.485  20.791  1.00 47.42  ? 25  PRO B CB  1 
ATOM   4358 C CG  . PRO B 1 28  ? -63.424 83.869  19.954  1.00 46.90  ? 25  PRO B CG  1 
ATOM   4359 C CD  . PRO B 1 28  ? -62.766 85.014  20.668  1.00 44.54  ? 25  PRO B CD  1 
ATOM   4360 N N   . GLY B 1 29  ? -64.951 84.940  23.839  1.00 45.00  ? 26  GLY B N   1 
ATOM   4361 C CA  . GLY B 1 29  ? -65.437 84.715  25.186  1.00 47.43  ? 26  GLY B CA  1 
ATOM   4362 C C   . GLY B 1 29  ? -65.688 85.977  25.987  1.00 47.59  ? 26  GLY B C   1 
ATOM   4363 O O   . GLY B 1 29  ? -66.044 85.902  27.167  1.00 53.86  ? 26  GLY B O   1 
ATOM   4364 N N   . GLY B 1 30  ? -65.504 87.141  25.369  1.00 47.48  ? 27  GLY B N   1 
ATOM   4365 C CA  . GLY B 1 30  ? -65.748 88.396  26.041  1.00 39.26  ? 27  GLY B CA  1 
ATOM   4366 C C   . GLY B 1 30  ? -64.745 89.471  25.679  1.00 43.08  ? 27  GLY B C   1 
ATOM   4367 O O   . GLY B 1 30  ? -63.667 89.197  25.143  1.00 41.74  ? 27  GLY B O   1 
ATOM   4368 N N   . PRO B 1 31  ? -65.084 90.723  25.970  1.00 43.79  ? 28  PRO B N   1 
ATOM   4369 C CA  . PRO B 1 31  ? -64.191 91.834  25.631  1.00 39.91  ? 28  PRO B CA  1 
ATOM   4370 C C   . PRO B 1 31  ? -63.019 91.947  26.596  1.00 43.76  ? 28  PRO B C   1 
ATOM   4371 O O   . PRO B 1 31  ? -63.031 91.419  27.709  1.00 46.29  ? 28  PRO B O   1 
ATOM   4372 C CB  . PRO B 1 31  ? -65.104 93.060  25.734  1.00 43.77  ? 28  PRO B CB  1 
ATOM   4373 C CG  . PRO B 1 31  ? -66.125 92.667  26.745  1.00 47.74  ? 28  PRO B CG  1 
ATOM   4374 C CD  . PRO B 1 31  ? -66.355 91.190  26.550  1.00 51.73  ? 28  PRO B CD  1 
ATOM   4375 N N   . VAL B 1 32  ? -61.992 92.660  26.137  1.00 38.05  ? 29  VAL B N   1 
ATOM   4376 C CA  . VAL B 1 32  ? -60.780 92.910  26.908  1.00 35.48  ? 29  VAL B CA  1 
ATOM   4377 C C   . VAL B 1 32  ? -60.362 94.357  26.687  1.00 26.99  ? 29  VAL B C   1 
ATOM   4378 O O   . VAL B 1 32  ? -60.393 94.857  25.558  1.00 45.33  ? 29  VAL B O   1 
ATOM   4379 C CB  . VAL B 1 32  ? -59.639 91.945  26.512  1.00 41.28  ? 29  VAL B CB  1 
ATOM   4380 C CG1 . VAL B 1 32  ? -58.322 92.373  27.144  1.00 37.89  ? 29  VAL B CG1 1 
ATOM   4381 C CG2 . VAL B 1 32  ? -59.977 90.518  26.916  1.00 29.48  ? 29  VAL B CG2 1 
ATOM   4382 N N   . SER B 1 33  ? -59.981 95.034  27.768  1.00 26.55  ? 30  SER B N   1 
ATOM   4383 C CA  . SER B 1 33  ? -59.487 96.401  27.688  1.00 28.33  ? 30  SER B CA  1 
ATOM   4384 C C   . SER B 1 33  ? -57.986 96.386  27.429  1.00 37.18  ? 30  SER B C   1 
ATOM   4385 O O   . SER B 1 33  ? -57.230 95.736  28.158  1.00 32.44  ? 30  SER B O   1 
ATOM   4386 C CB  . SER B 1 33  ? -59.796 97.168  28.975  1.00 27.21  ? 30  SER B CB  1 
ATOM   4387 O OG  . SER B 1 33  ? -61.189 97.190  29.232  1.00 38.03  ? 30  SER B OG  1 
ATOM   4388 N N   . ALA B 1 34  ? -57.560 97.102  26.390  1.00 30.70  ? 31  ALA B N   1 
ATOM   4389 C CA  . ALA B 1 34  ? -56.162 97.144  25.990  1.00 32.28  ? 31  ALA B CA  1 
ATOM   4390 C C   . ALA B 1 34  ? -55.686 98.586  25.918  1.00 30.74  ? 31  ALA B C   1 
ATOM   4391 O O   . ALA B 1 34  ? -56.415 99.468  25.452  1.00 36.92  ? 31  ALA B O   1 
ATOM   4392 C CB  . ALA B 1 34  ? -55.947 96.458  24.636  1.00 25.73  ? 31  ALA B CB  1 
ATOM   4393 N N   . PHE B 1 35  ? -54.460 98.817  26.377  1.00 24.20  ? 32  PHE B N   1 
ATOM   4394 C CA  . PHE B 1 35  ? -53.823 100.131 26.365  1.00 19.99  ? 32  PHE B CA  1 
ATOM   4395 C C   . PHE B 1 35  ? -52.495 99.968  25.630  1.00 31.54  ? 32  PHE B C   1 
ATOM   4396 O O   . PHE B 1 35  ? -51.475 99.623  26.231  1.00 29.73  ? 32  PHE B O   1 
ATOM   4397 C CB  . PHE B 1 35  ? -53.640 100.668 27.786  1.00 26.12  ? 32  PHE B CB  1 
ATOM   4398 C CG  . PHE B 1 35  ? -54.931 100.837 28.537  1.00 34.73  ? 32  PHE B CG  1 
ATOM   4399 C CD1 . PHE B 1 35  ? -55.542 99.753  29.148  1.00 31.76  ? 32  PHE B CD1 1 
ATOM   4400 C CD2 . PHE B 1 35  ? -55.537 102.079 28.629  1.00 37.90  ? 32  PHE B CD2 1 
ATOM   4401 C CE1 . PHE B 1 35  ? -56.731 99.903  29.834  1.00 35.54  ? 32  PHE B CE1 1 
ATOM   4402 C CE2 . PHE B 1 35  ? -56.728 102.236 29.315  1.00 39.28  ? 32  PHE B CE2 1 
ATOM   4403 C CZ  . PHE B 1 35  ? -57.325 101.146 29.917  1.00 39.53  ? 32  PHE B CZ  1 
ATOM   4404 N N   . LEU B 1 36  ? -52.518 100.217 24.323  1.00 29.31  ? 33  LEU B N   1 
ATOM   4405 C CA  . LEU B 1 36  ? -51.394 99.929  23.442  1.00 25.84  ? 33  LEU B CA  1 
ATOM   4406 C C   . LEU B 1 36  ? -50.647 101.213 23.106  1.00 28.52  ? 33  LEU B C   1 
ATOM   4407 O O   . LEU B 1 36  ? -51.256 102.196 22.674  1.00 36.48  ? 33  LEU B O   1 
ATOM   4408 C CB  . LEU B 1 36  ? -51.882 99.256  22.159  1.00 22.22  ? 33  LEU B CB  1 
ATOM   4409 C CG  . LEU B 1 36  ? -52.907 98.135  22.344  1.00 25.17  ? 33  LEU B CG  1 
ATOM   4410 C CD1 . LEU B 1 36  ? -53.398 97.626  20.997  1.00 22.57  ? 33  LEU B CD1 1 
ATOM   4411 C CD2 . LEU B 1 36  ? -52.319 97.000  23.168  1.00 25.02  ? 33  LEU B CD2 1 
ATOM   4412 N N   . GLY B 1 37  ? -49.331 101.196 23.295  1.00 29.94  ? 34  GLY B N   1 
ATOM   4413 C CA  . GLY B 1 37  ? -48.508 102.332 22.938  1.00 25.14  ? 34  GLY B CA  1 
ATOM   4414 C C   . GLY B 1 37  ? -48.261 103.327 24.046  1.00 28.54  ? 34  GLY B C   1 
ATOM   4415 O O   . GLY B 1 37  ? -48.138 104.526 23.771  1.00 31.41  ? 34  GLY B O   1 
ATOM   4416 N N   . ILE B 1 38  ? -48.181 102.872 25.292  1.00 30.15  ? 35  ILE B N   1 
ATOM   4417 C CA  . ILE B 1 38  ? -47.925 103.757 26.426  1.00 22.65  ? 35  ILE B CA  1 
ATOM   4418 C C   . ILE B 1 38  ? -46.444 104.117 26.444  1.00 24.47  ? 35  ILE B C   1 
ATOM   4419 O O   . ILE B 1 38  ? -45.592 103.220 26.515  1.00 32.38  ? 35  ILE B O   1 
ATOM   4420 C CB  . ILE B 1 38  ? -48.350 103.105 27.750  1.00 19.69  ? 35  ILE B CB  1 
ATOM   4421 C CG1 . ILE B 1 38  ? -49.802 102.632 27.671  1.00 23.48  ? 35  ILE B CG1 1 
ATOM   4422 C CG2 . ILE B 1 38  ? -48.163 104.077 28.906  1.00 25.40  ? 35  ILE B CG2 1 
ATOM   4423 C CD1 . ILE B 1 38  ? -50.247 101.832 28.876  1.00 21.76  ? 35  ILE B CD1 1 
ATOM   4424 N N   . PRO B 1 39  ? -46.088 105.400 26.377  1.00 29.55  ? 36  PRO B N   1 
ATOM   4425 C CA  . PRO B 1 39  ? -44.669 105.781 26.439  1.00 22.86  ? 36  PRO B CA  1 
ATOM   4426 C C   . PRO B 1 39  ? -44.133 105.644 27.856  1.00 36.38  ? 36  PRO B C   1 
ATOM   4427 O O   . PRO B 1 39  ? -44.678 106.224 28.798  1.00 35.78  ? 36  PRO B O   1 
ATOM   4428 C CB  . PRO B 1 39  ? -44.674 107.242 25.972  1.00 23.64  ? 36  PRO B CB  1 
ATOM   4429 C CG  . PRO B 1 39  ? -46.040 107.737 26.323  1.00 22.10  ? 36  PRO B CG  1 
ATOM   4430 C CD  . PRO B 1 39  ? -46.969 106.561 26.158  1.00 29.75  ? 36  PRO B CD  1 
ATOM   4431 N N   . PHE B 1 40  ? -43.063 104.865 28.006  1.00 23.77  ? 37  PHE B N   1 
ATOM   4432 C CA  . PHE B 1 40  ? -42.408 104.692 29.295  1.00 24.60  ? 37  PHE B CA  1 
ATOM   4433 C C   . PHE B 1 40  ? -41.016 105.302 29.337  1.00 22.29  ? 37  PHE B C   1 
ATOM   4434 O O   . PHE B 1 40  ? -40.337 105.191 30.363  1.00 35.21  ? 37  PHE B O   1 
ATOM   4435 C CB  . PHE B 1 40  ? -42.336 103.203 29.665  1.00 29.06  ? 37  PHE B CB  1 
ATOM   4436 C CG  . PHE B 1 40  ? -41.403 102.396 28.799  1.00 24.96  ? 37  PHE B CG  1 
ATOM   4437 C CD1 . PHE B 1 40  ? -40.082 102.200 29.173  1.00 24.31  ? 37  PHE B CD1 1 
ATOM   4438 C CD2 . PHE B 1 40  ? -41.853 101.816 27.624  1.00 25.95  ? 37  PHE B CD2 1 
ATOM   4439 C CE1 . PHE B 1 40  ? -39.225 101.456 28.384  1.00 32.14  ? 37  PHE B CE1 1 
ATOM   4440 C CE2 . PHE B 1 40  ? -41.000 101.068 26.832  1.00 26.00  ? 37  PHE B CE2 1 
ATOM   4441 C CZ  . PHE B 1 40  ? -39.685 100.888 27.213  1.00 33.00  ? 37  PHE B CZ  1 
ATOM   4442 N N   . ALA B 1 41  ? -40.574 105.944 28.259  1.00 27.39  ? 38  ALA B N   1 
ATOM   4443 C CA  . ALA B 1 41  ? -39.248 106.541 28.226  1.00 32.00  ? 38  ALA B CA  1 
ATOM   4444 C C   . ALA B 1 41  ? -39.233 107.664 27.201  1.00 33.69  ? 38  ALA B C   1 
ATOM   4445 O O   . ALA B 1 41  ? -40.053 107.702 26.280  1.00 28.89  ? 38  ALA B O   1 
ATOM   4446 C CB  . ALA B 1 41  ? -38.171 105.501 27.896  1.00 29.34  ? 38  ALA B CB  1 
ATOM   4447 N N   . GLU B 1 42  ? -38.289 108.581 27.381  1.00 23.52  ? 39  GLU B N   1 
ATOM   4448 C CA  . GLU B 1 42  ? -38.058 109.603 26.374  1.00 35.86  ? 39  GLU B CA  1 
ATOM   4449 C C   . GLU B 1 42  ? -37.518 108.956 25.101  1.00 40.94  ? 39  GLU B C   1 
ATOM   4450 O O   . GLU B 1 42  ? -36.774 107.973 25.174  1.00 38.28  ? 39  GLU B O   1 
ATOM   4451 C CB  . GLU B 1 42  ? -37.075 110.654 26.888  1.00 34.56  ? 39  GLU B CB  1 
ATOM   4452 C CG  . GLU B 1 42  ? -37.649 111.561 27.962  1.00 49.83  ? 39  GLU B CG  1 
ATOM   4453 C CD  . GLU B 1 42  ? -38.750 112.459 27.432  1.00 49.12  ? 39  GLU B CD  1 
ATOM   4454 O OE1 . GLU B 1 42  ? -38.567 113.046 26.344  1.00 52.71  ? 39  GLU B OE1 1 
ATOM   4455 O OE2 . GLU B 1 42  ? -39.801 112.571 28.097  1.00 47.41  ? 39  GLU B OE2 1 
ATOM   4456 N N   . PRO B 1 43  ? -37.886 109.466 23.929  1.00 45.95  ? 40  PRO B N   1 
ATOM   4457 C CA  . PRO B 1 43  ? -37.390 108.889 22.674  1.00 36.44  ? 40  PRO B CA  1 
ATOM   4458 C C   . PRO B 1 43  ? -35.874 108.944 22.609  1.00 36.86  ? 40  PRO B C   1 
ATOM   4459 O O   . PRO B 1 43  ? -35.280 110.032 22.620  1.00 35.57  ? 40  PRO B O   1 
ATOM   4460 C CB  . PRO B 1 43  ? -38.029 109.781 21.599  1.00 33.82  ? 40  PRO B CB  1 
ATOM   4461 C CG  . PRO B 1 43  ? -39.254 110.329 22.254  1.00 45.35  ? 40  PRO B CG  1 
ATOM   4462 C CD  . PRO B 1 43  ? -38.882 110.525 23.697  1.00 36.00  ? 40  PRO B CD  1 
ATOM   4463 N N   . PRO B 1 44  ? -35.210 107.786 22.545  1.00 38.80  ? 41  PRO B N   1 
ATOM   4464 C CA  . PRO B 1 44  ? -33.732 107.746 22.521  1.00 34.12  ? 41  PRO B CA  1 
ATOM   4465 C C   . PRO B 1 44  ? -33.167 108.111 21.154  1.00 37.16  ? 41  PRO B C   1 
ATOM   4466 O O   . PRO B 1 44  ? -32.574 107.298 20.436  1.00 34.50  ? 41  PRO B O   1 
ATOM   4467 C CB  . PRO B 1 44  ? -33.441 106.294 22.914  1.00 30.18  ? 41  PRO B CB  1 
ATOM   4468 C CG  . PRO B 1 44  ? -34.601 105.535 22.360  1.00 33.61  ? 41  PRO B CG  1 
ATOM   4469 C CD  . PRO B 1 44  ? -35.801 106.436 22.508  1.00 29.22  ? 41  PRO B CD  1 
ATOM   4470 N N   . MET B 1 45  ? -33.347 109.372 20.774  1.00 41.33  ? 42  MET B N   1 
ATOM   4471 C CA  . MET B 1 45  ? -32.923 109.873 19.477  1.00 37.54  ? 42  MET B CA  1 
ATOM   4472 C C   . MET B 1 45  ? -31.869 110.957 19.655  1.00 38.25  ? 42  MET B C   1 
ATOM   4473 O O   . MET B 1 45  ? -31.664 111.489 20.750  1.00 35.60  ? 42  MET B O   1 
ATOM   4474 C CB  . MET B 1 45  ? -34.116 110.419 18.682  1.00 39.11  ? 42  MET B CB  1 
ATOM   4475 C CG  . MET B 1 45  ? -35.267 109.440 18.538  1.00 34.35  ? 42  MET B CG  1 
ATOM   4476 S SD  . MET B 1 45  ? -36.612 110.118 17.551  1.00 61.22  ? 42  MET B SD  1 
ATOM   4477 C CE  . MET B 1 45  ? -35.760 110.447 16.010  1.00 57.38  ? 42  MET B CE  1 
ATOM   4478 N N   . GLY B 1 46  ? -31.200 111.283 18.550  1.00 32.47  ? 43  GLY B N   1 
ATOM   4479 C CA  . GLY B 1 46  ? -30.180 112.304 18.542  1.00 32.77  ? 43  GLY B CA  1 
ATOM   4480 C C   . GLY B 1 46  ? -29.022 111.970 19.458  1.00 36.48  ? 43  GLY B C   1 
ATOM   4481 O O   . GLY B 1 46  ? -28.377 110.925 19.329  1.00 33.49  ? 43  GLY B O   1 
ATOM   4482 N N   . PRO B 1 47  ? -28.737 112.861 20.413  1.00 37.67  ? 44  PRO B N   1 
ATOM   4483 C CA  . PRO B 1 47  ? -27.653 112.593 21.371  1.00 36.68  ? 44  PRO B CA  1 
ATOM   4484 C C   . PRO B 1 47  ? -27.947 111.447 22.324  1.00 35.44  ? 44  PRO B C   1 
ATOM   4485 O O   . PRO B 1 47  ? -27.019 110.975 22.994  1.00 42.42  ? 44  PRO B O   1 
ATOM   4486 C CB  . PRO B 1 47  ? -27.518 113.921 22.127  1.00 39.90  ? 44  PRO B CB  1 
ATOM   4487 C CG  . PRO B 1 47  ? -28.863 114.559 22.004  1.00 38.07  ? 44  PRO B CG  1 
ATOM   4488 C CD  . PRO B 1 47  ? -29.378 114.166 20.648  1.00 34.40  ? 44  PRO B CD  1 
ATOM   4489 N N   . ARG B 1 48  ? -29.193 110.985 22.408  1.00 34.97  ? 45  ARG B N   1 
ATOM   4490 C CA  . ARG B 1 48  ? -29.553 109.879 23.285  1.00 44.48  ? 45  ARG B CA  1 
ATOM   4491 C C   . ARG B 1 48  ? -29.334 108.513 22.646  1.00 40.57  ? 45  ARG B C   1 
ATOM   4492 O O   . ARG B 1 48  ? -29.576 107.496 23.304  1.00 36.37  ? 45  ARG B O   1 
ATOM   4493 C CB  . ARG B 1 48  ? -31.013 110.002 23.729  1.00 46.38  ? 45  ARG B CB  1 
ATOM   4494 C CG  . ARG B 1 48  ? -31.292 111.180 24.644  1.00 46.61  ? 45  ARG B CG  1 
ATOM   4495 C CD  . ARG B 1 48  ? -32.600 110.983 25.392  1.00 58.85  ? 45  ARG B CD  1 
ATOM   4496 N NE  . ARG B 1 48  ? -32.944 112.140 26.213  1.00 70.42  ? 45  ARG B NE  1 
ATOM   4497 C CZ  . ARG B 1 48  ? -33.783 113.098 25.837  1.00 82.06  ? 45  ARG B CZ  1 
ATOM   4498 N NH1 . ARG B 1 48  ? -34.371 113.038 24.650  1.00 81.70  ? 45  ARG B NH1 1 
ATOM   4499 N NH2 . ARG B 1 48  ? -34.039 114.116 26.648  1.00 76.73  ? 45  ARG B NH2 1 
ATOM   4500 N N   . ARG B 1 49  ? -28.896 108.463 21.390  1.00 39.09  ? 46  ARG B N   1 
ATOM   4501 C CA  . ARG B 1 49  ? -28.612 107.183 20.755  1.00 40.41  ? 46  ARG B CA  1 
ATOM   4502 C C   . ARG B 1 49  ? -27.459 106.493 21.471  1.00 31.56  ? 46  ARG B C   1 
ATOM   4503 O O   . ARG B 1 49  ? -26.452 107.126 21.803  1.00 33.57  ? 46  ARG B O   1 
ATOM   4504 C CB  . ARG B 1 49  ? -28.284 107.386 19.274  1.00 32.11  ? 46  ARG B CB  1 
ATOM   4505 C CG  . ARG B 1 49  ? -28.040 106.094 18.507  1.00 27.68  ? 46  ARG B CG  1 
ATOM   4506 C CD  . ARG B 1 49  ? -27.644 106.361 17.061  1.00 29.65  ? 46  ARG B CD  1 
ATOM   4507 N NE  . ARG B 1 49  ? -28.787 106.694 16.215  1.00 28.85  ? 46  ARG B NE  1 
ATOM   4508 C CZ  . ARG B 1 49  ? -28.693 107.005 14.926  1.00 27.23  ? 46  ARG B CZ  1 
ATOM   4509 N NH1 . ARG B 1 49  ? -27.507 107.031 14.333  1.00 30.47  ? 46  ARG B NH1 1 
ATOM   4510 N NH2 . ARG B 1 49  ? -29.783 107.293 14.228  1.00 28.25  ? 46  ARG B NH2 1 
ATOM   4511 N N   . PHE B 1 50  ? -27.624 105.193 21.725  1.00 26.82  ? 47  PHE B N   1 
ATOM   4512 C CA  . PHE B 1 50  ? -26.693 104.328 22.450  1.00 32.97  ? 47  PHE B CA  1 
ATOM   4513 C C   . PHE B 1 50  ? -26.629 104.633 23.942  1.00 38.50  ? 47  PHE B C   1 
ATOM   4514 O O   . PHE B 1 50  ? -25.807 104.038 24.649  1.00 38.00  ? 47  PHE B O   1 
ATOM   4515 C CB  . PHE B 1 50  ? -25.271 104.383 21.874  1.00 22.62  ? 47  PHE B CB  1 
ATOM   4516 C CG  . PHE B 1 50  ? -25.209 104.234 20.382  1.00 24.80  ? 47  PHE B CG  1 
ATOM   4517 C CD1 . PHE B 1 50  ? -25.663 103.079 19.766  1.00 29.14  ? 47  PHE B CD1 1 
ATOM   4518 C CD2 . PHE B 1 50  ? -24.678 105.243 19.596  1.00 26.43  ? 47  PHE B CD2 1 
ATOM   4519 C CE1 . PHE B 1 50  ? -25.600 102.939 18.391  1.00 26.26  ? 47  PHE B CE1 1 
ATOM   4520 C CE2 . PHE B 1 50  ? -24.609 105.108 18.222  1.00 34.11  ? 47  PHE B CE2 1 
ATOM   4521 C CZ  . PHE B 1 50  ? -25.073 103.955 17.618  1.00 23.72  ? 47  PHE B CZ  1 
ATOM   4522 N N   . LEU B 1 51  ? -27.466 105.533 24.445  1.00 42.81  ? 48  LEU B N   1 
ATOM   4523 C CA  . LEU B 1 51  ? -27.450 105.894 25.853  1.00 34.68  ? 48  LEU B CA  1 
ATOM   4524 C C   . LEU B 1 51  ? -28.546 105.162 26.613  1.00 34.14  ? 48  LEU B C   1 
ATOM   4525 O O   . LEU B 1 51  ? -29.542 104.727 26.027  1.00 32.06  ? 48  LEU B O   1 
ATOM   4526 C CB  . LEU B 1 51  ? -27.625 107.408 26.019  1.00 33.36  ? 48  LEU B CB  1 
ATOM   4527 C CG  . LEU B 1 51  ? -26.450 108.281 25.577  1.00 37.43  ? 48  LEU B CG  1 
ATOM   4528 C CD1 . LEU B 1 51  ? -26.671 109.726 25.998  1.00 36.68  ? 48  LEU B CD1 1 
ATOM   4529 C CD2 . LEU B 1 51  ? -25.140 107.749 26.137  1.00 35.44  ? 48  LEU B CD2 1 
ATOM   4530 N N   . PRO B 1 52  ? -28.385 104.994 27.925  1.00 34.31  ? 49  PRO B N   1 
ATOM   4531 C CA  . PRO B 1 52  ? -29.440 104.362 28.711  1.00 36.18  ? 49  PRO B CA  1 
ATOM   4532 C C   . PRO B 1 52  ? -30.717 105.170 28.640  1.00 33.83  ? 49  PRO B C   1 
ATOM   4533 O O   . PRO B 1 52  ? -30.687 106.399 28.439  1.00 28.76  ? 49  PRO B O   1 
ATOM   4534 C CB  . PRO B 1 52  ? -28.859 104.347 30.132  1.00 25.06  ? 49  PRO B CB  1 
ATOM   4535 C CG  . PRO B 1 52  ? -27.387 104.374 29.935  1.00 33.77  ? 49  PRO B CG  1 
ATOM   4536 C CD  . PRO B 1 52  ? -27.167 105.227 28.721  1.00 36.22  ? 49  PRO B CD  1 
ATOM   4537 N N   . PRO B 1 53  ? -31.870 104.525 28.802  1.00 20.40  ? 50  PRO B N   1 
ATOM   4538 C CA  . PRO B 1 53  ? -33.139 105.244 28.665  1.00 24.11  ? 50  PRO B CA  1 
ATOM   4539 C C   . PRO B 1 53  ? -33.401 106.160 29.848  1.00 39.36  ? 50  PRO B C   1 
ATOM   4540 O O   . PRO B 1 53  ? -33.040 105.866 30.991  1.00 33.23  ? 50  PRO B O   1 
ATOM   4541 C CB  . PRO B 1 53  ? -34.175 104.117 28.603  1.00 18.19  ? 50  PRO B CB  1 
ATOM   4542 C CG  . PRO B 1 53  ? -33.556 103.023 29.411  1.00 16.82  ? 50  PRO B CG  1 
ATOM   4543 C CD  . PRO B 1 53  ? -32.076 103.101 29.121  1.00 19.98  ? 50  PRO B CD  1 
ATOM   4544 N N   . GLU B 1 54  ? -34.038 107.289 29.554  1.00 42.66  ? 51  GLU B N   1 
ATOM   4545 C CA  . GLU B 1 54  ? -34.519 108.210 30.572  1.00 40.84  ? 51  GLU B CA  1 
ATOM   4546 C C   . GLU B 1 54  ? -36.026 108.063 30.732  1.00 37.76  ? 51  GLU B C   1 
ATOM   4547 O O   . GLU B 1 54  ? -36.731 107.824 29.746  1.00 39.56  ? 51  GLU B O   1 
ATOM   4548 C CB  . GLU B 1 54  ? -34.186 109.656 30.204  1.00 41.39  ? 51  GLU B CB  1 
ATOM   4549 C CG  . GLU B 1 54  ? -32.721 109.895 29.886  1.00 51.93  ? 51  GLU B CG  1 
ATOM   4550 C CD  . GLU B 1 54  ? -32.427 111.346 29.560  1.00 75.92  ? 51  GLU B CD  1 
ATOM   4551 O OE1 . GLU B 1 54  ? -31.642 111.977 30.299  1.00 78.46  ? 51  GLU B OE1 1 
ATOM   4552 O OE2 . GLU B 1 54  ? -32.989 111.859 28.569  1.00 65.43  ? 51  GLU B OE2 1 
ATOM   4553 N N   . PRO B 1 55  ? -36.544 108.187 31.954  1.00 39.11  ? 52  PRO B N   1 
ATOM   4554 C CA  . PRO B 1 55  ? -37.986 108.009 32.160  1.00 37.72  ? 52  PRO B CA  1 
ATOM   4555 C C   . PRO B 1 55  ? -38.798 109.037 31.386  1.00 40.49  ? 52  PRO B C   1 
ATOM   4556 O O   . PRO B 1 55  ? -38.375 110.179 31.188  1.00 38.01  ? 52  PRO B O   1 
ATOM   4557 C CB  . PRO B 1 55  ? -38.155 108.189 33.674  1.00 33.04  ? 52  PRO B CB  1 
ATOM   4558 C CG  . PRO B 1 55  ? -36.802 107.906 34.244  1.00 35.44  ? 52  PRO B CG  1 
ATOM   4559 C CD  . PRO B 1 55  ? -35.826 108.402 33.221  1.00 38.84  ? 52  PRO B CD  1 
ATOM   4560 N N   . LYS B 1 56  ? -39.978 108.611 30.941  1.00 34.28  ? 53  LYS B N   1 
ATOM   4561 C CA  . LYS B 1 56  ? -40.875 109.492 30.203  1.00 35.47  ? 53  LYS B CA  1 
ATOM   4562 C C   . LYS B 1 56  ? -41.400 110.585 31.125  1.00 37.15  ? 53  LYS B C   1 
ATOM   4563 O O   . LYS B 1 56  ? -42.049 110.296 32.136  1.00 36.38  ? 53  LYS B O   1 
ATOM   4564 C CB  . LYS B 1 56  ? -42.029 108.690 29.608  1.00 27.75  ? 53  LYS B CB  1 
ATOM   4565 C CG  . LYS B 1 56  ? -43.092 109.532 28.918  1.00 32.31  ? 53  LYS B CG  1 
ATOM   4566 C CD  . LYS B 1 56  ? -42.536 110.249 27.698  1.00 37.75  ? 53  LYS B CD  1 
ATOM   4567 C CE  . LYS B 1 56  ? -43.635 110.984 26.947  1.00 29.07  ? 53  LYS B CE  1 
ATOM   4568 N NZ  . LYS B 1 56  ? -43.115 111.675 25.734  1.00 37.94  ? 53  LYS B NZ  1 
ATOM   4569 N N   . GLN B 1 57  ? -41.113 111.836 30.781  1.00 44.40  ? 54  GLN B N   1 
ATOM   4570 C CA  . GLN B 1 57  ? -41.587 112.955 31.576  1.00 42.37  ? 54  GLN B CA  1 
ATOM   4571 C C   . GLN B 1 57  ? -43.106 113.077 31.460  1.00 33.61  ? 54  GLN B C   1 
ATOM   4572 O O   . GLN B 1 57  ? -43.686 112.736 30.425  1.00 36.02  ? 54  GLN B O   1 
ATOM   4573 C CB  . GLN B 1 57  ? -40.910 114.246 31.124  1.00 38.97  ? 54  GLN B CB  1 
ATOM   4574 C CG  . GLN B 1 57  ? -39.404 114.241 31.342  1.00 50.88  ? 54  GLN B CG  1 
ATOM   4575 C CD  . GLN B 1 57  ? -38.678 115.255 30.480  1.00 74.13  ? 54  GLN B CD  1 
ATOM   4576 O OE1 . GLN B 1 57  ? -39.302 116.061 29.790  1.00 76.00  ? 54  GLN B OE1 1 
ATOM   4577 N NE2 . GLN B 1 57  ? -37.351 115.213 30.510  1.00 70.10  ? 54  GLN B NE2 1 
ATOM   4578 N N   . PRO B 1 58  ? -43.774 113.546 32.516  1.00 44.14  ? 55  PRO B N   1 
ATOM   4579 C CA  . PRO B 1 58  ? -45.242 113.594 32.499  1.00 35.96  ? 55  PRO B CA  1 
ATOM   4580 C C   . PRO B 1 58  ? -45.772 114.468 31.372  1.00 36.90  ? 55  PRO B C   1 
ATOM   4581 O O   . PRO B 1 58  ? -45.143 115.445 30.960  1.00 33.39  ? 55  PRO B O   1 
ATOM   4582 C CB  . PRO B 1 58  ? -45.594 114.179 33.872  1.00 40.31  ? 55  PRO B CB  1 
ATOM   4583 C CG  . PRO B 1 58  ? -44.413 113.862 34.730  1.00 36.65  ? 55  PRO B CG  1 
ATOM   4584 C CD  . PRO B 1 58  ? -43.224 113.956 33.819  1.00 39.70  ? 55  PRO B CD  1 
ATOM   4585 N N   . TRP B 1 59  ? -46.950 114.100 30.875  1.00 34.35  ? 56  TRP B N   1 
ATOM   4586 C CA  . TRP B 1 59  ? -47.563 114.755 29.732  1.00 38.17  ? 56  TRP B CA  1 
ATOM   4587 C C   . TRP B 1 59  ? -48.903 115.363 30.122  1.00 45.97  ? 56  TRP B C   1 
ATOM   4588 O O   . TRP B 1 59  ? -49.546 114.944 31.090  1.00 40.26  ? 56  TRP B O   1 
ATOM   4589 C CB  . TRP B 1 59  ? -47.762 113.770 28.572  1.00 33.04  ? 56  TRP B CB  1 
ATOM   4590 C CG  . TRP B 1 59  ? -48.662 112.621 28.916  1.00 33.19  ? 56  TRP B CG  1 
ATOM   4591 C CD1 . TRP B 1 59  ? -50.022 112.583 28.807  1.00 33.72  ? 56  TRP B CD1 1 
ATOM   4592 C CD2 . TRP B 1 59  ? -48.266 111.342 29.428  1.00 32.80  ? 56  TRP B CD2 1 
ATOM   4593 N NE1 . TRP B 1 59  ? -50.497 111.360 29.217  1.00 32.05  ? 56  TRP B NE1 1 
ATOM   4594 C CE2 . TRP B 1 59  ? -49.439 110.580 29.603  1.00 33.80  ? 56  TRP B CE2 1 
ATOM   4595 C CE3 . TRP B 1 59  ? -47.033 110.768 29.754  1.00 33.65  ? 56  TRP B CE3 1 
ATOM   4596 C CZ2 . TRP B 1 59  ? -49.415 109.275 30.091  1.00 27.91  ? 56  TRP B CZ2 1 
ATOM   4597 C CZ3 . TRP B 1 59  ? -47.012 109.471 30.238  1.00 29.44  ? 56  TRP B CZ3 1 
ATOM   4598 C CH2 . TRP B 1 59  ? -48.196 108.740 30.401  1.00 29.98  ? 56  TRP B CH2 1 
ATOM   4599 N N   . SER B 1 60  ? -49.321 116.356 29.345  1.00 49.78  ? 57  SER B N   1 
ATOM   4600 C CA  . SER B 1 60  ? -50.617 116.995 29.507  1.00 40.02  ? 57  SER B CA  1 
ATOM   4601 C C   . SER B 1 60  ? -51.620 116.389 28.534  1.00 41.34  ? 57  SER B C   1 
ATOM   4602 O O   . SER B 1 60  ? -51.267 115.973 27.428  1.00 50.87  ? 57  SER B O   1 
ATOM   4603 C CB  . SER B 1 60  ? -50.515 118.505 29.277  1.00 47.96  ? 57  SER B CB  1 
ATOM   4604 O OG  . SER B 1 60  ? -49.498 119.077 30.080  1.00 59.14  ? 57  SER B OG  1 
ATOM   4605 N N   . GLY B 1 61  ? -52.876 116.339 28.959  1.00 38.38  ? 58  GLY B N   1 
ATOM   4606 C CA  . GLY B 1 61  ? -53.928 115.797 28.124  1.00 47.82  ? 58  GLY B CA  1 
ATOM   4607 C C   . GLY B 1 61  ? -54.049 114.290 28.243  1.00 53.55  ? 58  GLY B C   1 
ATOM   4608 O O   . GLY B 1 61  ? -53.625 113.666 29.220  1.00 52.07  ? 58  GLY B O   1 
ATOM   4609 N N   . VAL B 1 62  ? -54.644 113.698 27.211  1.00 44.33  ? 59  VAL B N   1 
ATOM   4610 C CA  . VAL B 1 62  ? -54.908 112.264 27.160  1.00 44.17  ? 59  VAL B CA  1 
ATOM   4611 C C   . VAL B 1 62  ? -54.115 111.683 25.998  1.00 46.48  ? 59  VAL B C   1 
ATOM   4612 O O   . VAL B 1 62  ? -54.388 111.997 24.832  1.00 45.20  ? 59  VAL B O   1 
ATOM   4613 C CB  . VAL B 1 62  ? -56.404 111.959 27.011  1.00 37.41  ? 59  VAL B CB  1 
ATOM   4614 C CG1 . VAL B 1 62  ? -56.632 110.458 26.918  1.00 34.89  ? 59  VAL B CG1 1 
ATOM   4615 C CG2 . VAL B 1 62  ? -57.184 112.551 28.173  1.00 43.27  ? 59  VAL B CG2 1 
ATOM   4616 N N   . VAL B 1 63  ? -53.134 110.838 26.312  1.00 35.11  ? 60  VAL B N   1 
ATOM   4617 C CA  . VAL B 1 63  ? -52.391 110.131 25.277  1.00 34.63  ? 60  VAL B CA  1 
ATOM   4618 C C   . VAL B 1 63  ? -53.259 109.015 24.713  1.00 35.32  ? 60  VAL B C   1 
ATOM   4619 O O   . VAL B 1 63  ? -53.844 108.222 25.462  1.00 31.03  ? 60  VAL B O   1 
ATOM   4620 C CB  . VAL B 1 63  ? -51.070 109.584 25.838  1.00 35.47  ? 60  VAL B CB  1 
ATOM   4621 C CG1 . VAL B 1 63  ? -50.533 108.470 24.952  1.00 28.10  ? 60  VAL B CG1 1 
ATOM   4622 C CG2 . VAL B 1 63  ? -50.047 110.699 25.958  1.00 30.26  ? 60  VAL B CG2 1 
ATOM   4623 N N   . ASP B 1 64  ? -53.357 108.955 23.387  1.00 36.89  ? 61  ASP B N   1 
ATOM   4624 C CA  . ASP B 1 64  ? -54.133 107.905 22.741  1.00 38.94  ? 61  ASP B CA  1 
ATOM   4625 C C   . ASP B 1 64  ? -53.383 106.582 22.833  1.00 37.64  ? 61  ASP B C   1 
ATOM   4626 O O   . ASP B 1 64  ? -52.261 106.460 22.330  1.00 29.67  ? 61  ASP B O   1 
ATOM   4627 C CB  . ASP B 1 64  ? -54.409 108.264 21.284  1.00 40.79  ? 61  ASP B CB  1 
ATOM   4628 C CG  . ASP B 1 64  ? -55.359 107.288 20.616  1.00 45.29  ? 61  ASP B CG  1 
ATOM   4629 O OD1 . ASP B 1 64  ? -56.585 107.520 20.667  1.00 48.90  ? 61  ASP B OD1 1 
ATOM   4630 O OD2 . ASP B 1 64  ? -54.880 106.283 20.051  1.00 44.19  ? 61  ASP B OD2 1 
ATOM   4631 N N   . ALA B 1 65  ? -54.000 105.595 23.478  1.00 36.38  ? 62  ALA B N   1 
ATOM   4632 C CA  . ALA B 1 65  ? -53.392 104.278 23.612  1.00 30.57  ? 62  ALA B CA  1 
ATOM   4633 C C   . ALA B 1 65  ? -54.270 103.217 22.962  1.00 27.85  ? 62  ALA B C   1 
ATOM   4634 O O   . ALA B 1 65  ? -54.556 102.180 23.569  1.00 31.09  ? 62  ALA B O   1 
ATOM   4635 C CB  . ALA B 1 65  ? -53.149 103.944 25.085  1.00 30.64  ? 62  ALA B CB  1 
ATOM   4636 N N   . THR B 1 66  ? -54.698 103.467 21.724  1.00 28.94  ? 63  THR B N   1 
ATOM   4637 C CA  . THR B 1 66  ? -55.602 102.574 21.016  1.00 35.02  ? 63  THR B CA  1 
ATOM   4638 C C   . THR B 1 66  ? -54.924 101.752 19.929  1.00 28.87  ? 63  THR B C   1 
ATOM   4639 O O   . THR B 1 66  ? -55.575 100.881 19.342  1.00 26.94  ? 63  THR B O   1 
ATOM   4640 C CB  . THR B 1 66  ? -56.756 103.372 20.389  1.00 34.63  ? 63  THR B CB  1 
ATOM   4641 O OG1 . THR B 1 66  ? -56.229 104.327 19.459  1.00 28.89  ? 63  THR B OG1 1 
ATOM   4642 C CG2 . THR B 1 66  ? -57.542 104.104 21.465  1.00 25.33  ? 63  THR B CG2 1 
ATOM   4643 N N   . THR B 1 67  ? -53.648 102.000 19.643  1.00 24.04  ? 64  THR B N   1 
ATOM   4644 C CA  . THR B 1 67  ? -52.946 101.264 18.602  1.00 28.44  ? 64  THR B CA  1 
ATOM   4645 C C   . THR B 1 67  ? -51.489 101.097 19.004  1.00 22.80  ? 64  THR B C   1 
ATOM   4646 O O   . THR B 1 67  ? -50.958 101.851 19.823  1.00 25.43  ? 64  THR B O   1 
ATOM   4647 C CB  . THR B 1 67  ? -53.046 101.970 17.243  1.00 31.50  ? 64  THR B CB  1 
ATOM   4648 O OG1 . THR B 1 67  ? -52.358 101.199 16.250  1.00 46.53  ? 64  THR B OG1 1 
ATOM   4649 C CG2 . THR B 1 67  ? -52.429 103.359 17.316  1.00 20.15  ? 64  THR B CG2 1 
ATOM   4650 N N   . PHE B 1 68  ? -50.848 100.090 18.417  1.00 27.40  ? 65  PHE B N   1 
ATOM   4651 C CA  . PHE B 1 68  ? -49.436 99.853  18.674  1.00 26.55  ? 65  PHE B CA  1 
ATOM   4652 C C   . PHE B 1 68  ? -48.589 100.987 18.108  1.00 21.81  ? 65  PHE B C   1 
ATOM   4653 O O   . PHE B 1 68  ? -48.916 101.587 17.081  1.00 23.23  ? 65  PHE B O   1 
ATOM   4654 C CB  . PHE B 1 68  ? -48.993 98.524  18.064  1.00 23.71  ? 65  PHE B CB  1 
ATOM   4655 C CG  . PHE B 1 68  ? -49.550 97.317  18.762  1.00 19.26  ? 65  PHE B CG  1 
ATOM   4656 C CD1 . PHE B 1 68  ? -49.085 96.950  20.015  1.00 21.68  ? 65  PHE B CD1 1 
ATOM   4657 C CD2 . PHE B 1 68  ? -50.523 96.537  18.159  1.00 23.76  ? 65  PHE B CD2 1 
ATOM   4658 C CE1 . PHE B 1 68  ? -49.590 95.836  20.659  1.00 26.60  ? 65  PHE B CE1 1 
ATOM   4659 C CE2 . PHE B 1 68  ? -51.032 95.421  18.797  1.00 24.45  ? 65  PHE B CE2 1 
ATOM   4660 C CZ  . PHE B 1 68  ? -50.564 95.070  20.049  1.00 28.45  ? 65  PHE B CZ  1 
ATOM   4661 N N   . GLN B 1 69  ? -47.486 101.274 18.791  1.00 19.77  ? 66  GLN B N   1 
ATOM   4662 C CA  . GLN B 1 69  ? -46.582 102.333 18.376  1.00 25.26  ? 66  GLN B CA  1 
ATOM   4663 C C   . GLN B 1 69  ? -45.551 101.781 17.392  1.00 28.94  ? 66  GLN B C   1 
ATOM   4664 O O   . GLN B 1 69  ? -45.676 100.665 16.882  1.00 24.79  ? 66  GLN B O   1 
ATOM   4665 C CB  . GLN B 1 69  ? -45.925 102.974 19.596  1.00 27.09  ? 66  GLN B CB  1 
ATOM   4666 C CG  . GLN B 1 69  ? -46.617 104.239 20.079  1.00 26.87  ? 66  GLN B CG  1 
ATOM   4667 C CD  . GLN B 1 69  ? -46.379 105.425 19.160  1.00 35.90  ? 66  GLN B CD  1 
ATOM   4668 O OE1 . GLN B 1 69  ? -45.588 105.350 18.218  1.00 33.41  ? 66  GLN B OE1 1 
ATOM   4669 N NE2 . GLN B 1 69  ? -47.062 106.530 19.433  1.00 28.86  ? 66  GLN B NE2 1 
ATOM   4670 N N   . SER B 1 70  ? -44.513 102.567 17.121  1.00 25.81  ? 67  SER B N   1 
ATOM   4671 C CA  . SER B 1 70  ? -43.540 102.207 16.101  1.00 26.20  ? 67  SER B CA  1 
ATOM   4672 C C   . SER B 1 70  ? -42.621 101.089 16.582  1.00 34.87  ? 67  SER B C   1 
ATOM   4673 O O   . SER B 1 70  ? -42.394 100.906 17.781  1.00 27.69  ? 67  SER B O   1 
ATOM   4674 C CB  . SER B 1 70  ? -42.708 103.427 15.706  1.00 20.45  ? 67  SER B CB  1 
ATOM   4675 O OG  . SER B 1 70  ? -43.527 104.454 15.178  1.00 29.95  ? 67  SER B OG  1 
ATOM   4676 N N   . VAL B 1 71  ? -42.091 100.341 15.622  1.00 28.13  ? 68  VAL B N   1 
ATOM   4677 C CA  . VAL B 1 71  ? -41.120 99.284  15.878  1.00 19.86  ? 68  VAL B CA  1 
ATOM   4678 C C   . VAL B 1 71  ? -39.727 99.894  15.872  1.00 21.73  ? 68  VAL B C   1 
ATOM   4679 O O   . VAL B 1 71  ? -39.431 100.786 15.067  1.00 21.97  ? 68  VAL B O   1 
ATOM   4680 C CB  . VAL B 1 71  ? -41.247 98.165  14.824  1.00 29.81  ? 68  VAL B CB  1 
ATOM   4681 C CG1 . VAL B 1 71  ? -40.245 97.053  15.090  1.00 24.98  ? 68  VAL B CG1 1 
ATOM   4682 C CG2 . VAL B 1 71  ? -42.666 97.618  14.799  1.00 21.20  ? 68  VAL B CG2 1 
ATOM   4683 N N   . CYS B 1 72  ? -38.870 99.429  16.778  1.00 16.40  ? 69  CYS B N   1 
ATOM   4684 C CA  . CYS B 1 72  ? -37.492 99.900  16.800  1.00 22.85  ? 69  CYS B CA  1 
ATOM   4685 C C   . CYS B 1 72  ? -36.778 99.500  15.514  1.00 23.64  ? 69  CYS B C   1 
ATOM   4686 O O   . CYS B 1 72  ? -37.058 98.455  14.921  1.00 21.65  ? 69  CYS B O   1 
ATOM   4687 C CB  . CYS B 1 72  ? -36.749 99.336  18.012  1.00 30.26  ? 69  CYS B CB  1 
ATOM   4688 S SG  . CYS B 1 72  ? -37.516 99.699  19.608  1.00 31.98  ? 69  CYS B SG  1 
ATOM   4689 N N   . TYR B 1 73  ? -35.852 100.356 15.079  1.00 24.19  ? 70  TYR B N   1 
ATOM   4690 C CA  . TYR B 1 73  ? -35.113 100.103 13.848  1.00 30.65  ? 70  TYR B CA  1 
ATOM   4691 C C   . TYR B 1 73  ? -34.387 98.767  13.925  1.00 25.72  ? 70  TYR B C   1 
ATOM   4692 O O   . TYR B 1 73  ? -33.636 98.506  14.869  1.00 24.86  ? 70  TYR B O   1 
ATOM   4693 C CB  . TYR B 1 73  ? -34.117 101.231 13.586  1.00 22.31  ? 70  TYR B CB  1 
ATOM   4694 C CG  . TYR B 1 73  ? -34.601 102.255 12.586  1.00 31.70  ? 70  TYR B CG  1 
ATOM   4695 C CD1 . TYR B 1 73  ? -35.133 103.467 13.004  1.00 32.75  ? 70  TYR B CD1 1 
ATOM   4696 C CD2 . TYR B 1 73  ? -34.528 102.007 11.221  1.00 27.81  ? 70  TYR B CD2 1 
ATOM   4697 C CE1 . TYR B 1 73  ? -35.574 104.406 12.090  1.00 32.35  ? 70  TYR B CE1 1 
ATOM   4698 C CE2 . TYR B 1 73  ? -34.968 102.938 10.301  1.00 24.21  ? 70  TYR B CE2 1 
ATOM   4699 C CZ  . TYR B 1 73  ? -35.491 104.136 10.741  1.00 31.45  ? 70  TYR B CZ  1 
ATOM   4700 O OH  . TYR B 1 73  ? -35.930 105.068 9.829   1.00 42.72  ? 70  TYR B OH  1 
ATOM   4701 N N   . GLN B 1 74  ? -34.616 97.919  12.926  1.00 24.45  ? 71  GLN B N   1 
ATOM   4702 C CA  . GLN B 1 74  ? -34.083 96.567  12.954  1.00 23.92  ? 71  GLN B CA  1 
ATOM   4703 C C   . GLN B 1 74  ? -33.981 96.035  11.534  1.00 25.36  ? 71  GLN B C   1 
ATOM   4704 O O   . GLN B 1 74  ? -34.607 96.555  10.605  1.00 20.36  ? 71  GLN B O   1 
ATOM   4705 C CB  . GLN B 1 74  ? -34.958 95.644  13.809  1.00 19.37  ? 71  GLN B CB  1 
ATOM   4706 C CG  . GLN B 1 74  ? -36.368 95.461  13.271  1.00 13.68  ? 71  GLN B CG  1 
ATOM   4707 C CD  . GLN B 1 74  ? -37.271 94.730  14.243  1.00 15.68  ? 71  GLN B CD  1 
ATOM   4708 O OE1 . GLN B 1 74  ? -37.810 93.668  13.931  1.00 20.71  ? 71  GLN B OE1 1 
ATOM   4709 N NE2 . GLN B 1 74  ? -37.444 95.298  15.430  1.00 16.99  ? 71  GLN B NE2 1 
ATOM   4710 N N   . TYR B 1 75  ? -33.176 94.987  11.383  1.00 25.21  ? 72  TYR B N   1 
ATOM   4711 C CA  . TYR B 1 75  ? -33.071 94.291  10.110  1.00 17.14  ? 72  TYR B CA  1 
ATOM   4712 C C   . TYR B 1 75  ? -34.379 93.576  9.793   1.00 27.03  ? 72  TYR B C   1 
ATOM   4713 O O   . TYR B 1 75  ? -35.027 93.009  10.677  1.00 28.35  ? 72  TYR B O   1 
ATOM   4714 C CB  . TYR B 1 75  ? -31.913 93.293  10.156  1.00 18.31  ? 72  TYR B CB  1 
ATOM   4715 C CG  . TYR B 1 75  ? -31.832 92.363  8.966   1.00 23.01  ? 72  TYR B CG  1 
ATOM   4716 C CD1 . TYR B 1 75  ? -31.189 92.751  7.799   1.00 22.54  ? 72  TYR B CD1 1 
ATOM   4717 C CD2 . TYR B 1 75  ? -32.387 91.089  9.017   1.00 28.87  ? 72  TYR B CD2 1 
ATOM   4718 C CE1 . TYR B 1 75  ? -31.109 91.901  6.711   1.00 31.00  ? 72  TYR B CE1 1 
ATOM   4719 C CE2 . TYR B 1 75  ? -32.313 90.234  7.935   1.00 30.24  ? 72  TYR B CE2 1 
ATOM   4720 C CZ  . TYR B 1 75  ? -31.673 90.644  6.785   1.00 30.46  ? 72  TYR B CZ  1 
ATOM   4721 O OH  . TYR B 1 75  ? -31.596 89.794  5.706   1.00 43.34  ? 72  TYR B OH  1 
ATOM   4722 N N   . VAL B 1 76  ? -34.769 93.611  8.521   1.00 21.14  ? 73  VAL B N   1 
ATOM   4723 C CA  . VAL B 1 76  ? -35.982 92.958  8.042   1.00 19.64  ? 73  VAL B CA  1 
ATOM   4724 C C   . VAL B 1 76  ? -35.577 91.719  7.258   1.00 27.45  ? 73  VAL B C   1 
ATOM   4725 O O   . VAL B 1 76  ? -34.754 91.800  6.338   1.00 24.15  ? 73  VAL B O   1 
ATOM   4726 C CB  . VAL B 1 76  ? -36.832 93.907  7.180   1.00 28.57  ? 73  VAL B CB  1 
ATOM   4727 C CG1 . VAL B 1 76  ? -38.031 93.171  6.604   1.00 22.11  ? 73  VAL B CG1 1 
ATOM   4728 C CG2 . VAL B 1 76  ? -37.283 95.106  8.001   1.00 26.50  ? 73  VAL B CG2 1 
ATOM   4729 N N   . ASP B 1 77  ? -36.156 90.576  7.621   1.00 26.11  ? 74  ASP B N   1 
ATOM   4730 C CA  . ASP B 1 77  ? -35.796 89.314  6.988   1.00 25.07  ? 74  ASP B CA  1 
ATOM   4731 C C   . ASP B 1 77  ? -36.284 89.283  5.545   1.00 30.25  ? 74  ASP B C   1 
ATOM   4732 O O   . ASP B 1 77  ? -37.445 89.597  5.263   1.00 30.12  ? 74  ASP B O   1 
ATOM   4733 C CB  . ASP B 1 77  ? -36.387 88.143  7.771   1.00 28.63  ? 74  ASP B CB  1 
ATOM   4734 C CG  . ASP B 1 77  ? -35.911 86.799  7.256   1.00 38.57  ? 74  ASP B CG  1 
ATOM   4735 O OD1 . ASP B 1 77  ? -34.858 86.322  7.730   1.00 31.76  ? 74  ASP B OD1 1 
ATOM   4736 O OD2 . ASP B 1 77  ? -36.583 86.225  6.373   1.00 34.63  ? 74  ASP B OD2 1 
ATOM   4737 N N   . THR B 1 78  ? -35.391 88.901  4.627   1.00 27.96  ? 75  THR B N   1 
ATOM   4738 C CA  . THR B 1 78  ? -35.720 88.818  3.208   1.00 36.59  ? 75  THR B CA  1 
ATOM   4739 C C   . THR B 1 78  ? -35.315 87.476  2.604   1.00 39.94  ? 75  THR B C   1 
ATOM   4740 O O   . THR B 1 78  ? -35.132 87.383  1.386   1.00 40.37  ? 75  THR B O   1 
ATOM   4741 C CB  . THR B 1 78  ? -35.060 89.958  2.426   1.00 37.69  ? 75  THR B CB  1 
ATOM   4742 O OG1 . THR B 1 78  ? -33.640 89.916  2.620   1.00 34.70  ? 75  THR B OG1 1 
ATOM   4743 C CG2 . THR B 1 78  ? -35.594 91.308  2.888   1.00 32.22  ? 75  THR B CG2 1 
ATOM   4744 N N   . LEU B 1 79  ? -35.172 86.434  3.427   1.00 33.44  ? 76  LEU B N   1 
ATOM   4745 C CA  . LEU B 1 79  ? -34.761 85.135  2.904   1.00 35.82  ? 76  LEU B CA  1 
ATOM   4746 C C   . LEU B 1 79  ? -35.850 84.516  2.035   1.00 39.80  ? 76  LEU B C   1 
ATOM   4747 O O   . LEU B 1 79  ? -35.558 83.952  0.974   1.00 37.31  ? 76  LEU B O   1 
ATOM   4748 C CB  . LEU B 1 79  ? -34.393 84.195  4.052   1.00 35.61  ? 76  LEU B CB  1 
ATOM   4749 C CG  . LEU B 1 79  ? -33.895 82.808  3.636   1.00 43.90  ? 76  LEU B CG  1 
ATOM   4750 C CD1 . LEU B 1 79  ? -32.642 82.921  2.780   1.00 33.55  ? 76  LEU B CD1 1 
ATOM   4751 C CD2 . LEU B 1 79  ? -33.639 81.929  4.850   1.00 26.76  ? 76  LEU B CD2 1 
ATOM   4752 N N   . TYR B 1 80  ? -37.107 84.610  2.465   1.00 35.82  ? 77  TYR B N   1 
ATOM   4753 C CA  . TYR B 1 80  ? -38.243 84.075  1.716   1.00 34.44  ? 77  TYR B CA  1 
ATOM   4754 C C   . TYR B 1 80  ? -39.320 85.147  1.630   1.00 27.90  ? 77  TYR B C   1 
ATOM   4755 O O   . TYR B 1 80  ? -40.238 85.190  2.462   1.00 34.25  ? 77  TYR B O   1 
ATOM   4756 C CB  . TYR B 1 80  ? -38.783 82.802  2.363   1.00 25.44  ? 77  TYR B CB  1 
ATOM   4757 C CG  . TYR B 1 80  ? -37.807 81.647  2.363   1.00 33.37  ? 77  TYR B CG  1 
ATOM   4758 C CD1 . TYR B 1 80  ? -37.459 81.008  1.181   1.00 33.87  ? 77  TYR B CD1 1 
ATOM   4759 C CD2 . TYR B 1 80  ? -37.244 81.189  3.546   1.00 31.91  ? 77  TYR B CD2 1 
ATOM   4760 C CE1 . TYR B 1 80  ? -36.570 79.949  1.176   1.00 41.96  ? 77  TYR B CE1 1 
ATOM   4761 C CE2 . TYR B 1 80  ? -36.356 80.129  3.551   1.00 41.26  ? 77  TYR B CE2 1 
ATOM   4762 C CZ  . TYR B 1 80  ? -36.021 79.514  2.364   1.00 40.66  ? 77  TYR B CZ  1 
ATOM   4763 O OH  . TYR B 1 80  ? -35.136 78.460  2.365   1.00 40.47  ? 77  TYR B OH  1 
ATOM   4764 N N   . PRO B 1 81  ? -39.237 86.036  0.641   1.00 32.07  ? 78  PRO B N   1 
ATOM   4765 C CA  . PRO B 1 81  ? -40.258 87.083  0.501   1.00 31.97  ? 78  PRO B CA  1 
ATOM   4766 C C   . PRO B 1 81  ? -41.642 86.491  0.272   1.00 32.65  ? 78  PRO B C   1 
ATOM   4767 O O   . PRO B 1 81  ? -41.818 85.552  -0.507  1.00 39.63  ? 78  PRO B O   1 
ATOM   4768 C CB  . PRO B 1 81  ? -39.780 87.882  -0.717  1.00 28.44  ? 78  PRO B CB  1 
ATOM   4769 C CG  . PRO B 1 81  ? -38.311 87.624  -0.785  1.00 38.80  ? 78  PRO B CG  1 
ATOM   4770 C CD  . PRO B 1 81  ? -38.128 86.211  -0.311  1.00 32.24  ? 78  PRO B CD  1 
ATOM   4771 N N   . GLY B 1 82  ? -42.629 87.055  0.967   1.00 29.12  ? 79  GLY B N   1 
ATOM   4772 C CA  . GLY B 1 82  ? -44.002 86.609  0.861   1.00 27.98  ? 79  GLY B CA  1 
ATOM   4773 C C   . GLY B 1 82  ? -44.338 85.350  1.630   1.00 35.05  ? 79  GLY B C   1 
ATOM   4774 O O   . GLY B 1 82  ? -45.492 84.906  1.580   1.00 36.58  ? 79  GLY B O   1 
ATOM   4775 N N   . PHE B 1 83  ? -43.378 84.764  2.340   1.00 32.40  ? 80  PHE B N   1 
ATOM   4776 C CA  . PHE B 1 83  ? -43.591 83.517  3.064   1.00 30.20  ? 80  PHE B CA  1 
ATOM   4777 C C   . PHE B 1 83  ? -44.058 83.810  4.484   1.00 28.54  ? 80  PHE B C   1 
ATOM   4778 O O   . PHE B 1 83  ? -43.398 84.549  5.221   1.00 25.58  ? 80  PHE B O   1 
ATOM   4779 C CB  . PHE B 1 83  ? -42.304 82.691  3.080   1.00 23.54  ? 80  PHE B CB  1 
ATOM   4780 C CG  . PHE B 1 83  ? -42.396 81.435  3.896   1.00 25.86  ? 80  PHE B CG  1 
ATOM   4781 C CD1 . PHE B 1 83  ? -43.369 80.487  3.627   1.00 24.05  ? 80  PHE B CD1 1 
ATOM   4782 C CD2 . PHE B 1 83  ? -41.493 81.191  4.918   1.00 20.96  ? 80  PHE B CD2 1 
ATOM   4783 C CE1 . PHE B 1 83  ? -43.449 79.325  4.372   1.00 30.54  ? 80  PHE B CE1 1 
ATOM   4784 C CE2 . PHE B 1 83  ? -41.565 80.030  5.664   1.00 24.79  ? 80  PHE B CE2 1 
ATOM   4785 C CZ  . PHE B 1 83  ? -42.546 79.097  5.393   1.00 26.20  ? 80  PHE B CZ  1 
ATOM   4786 N N   . GLU B 1 84  ? -45.192 83.215  4.867   1.00 25.47  ? 81  GLU B N   1 
ATOM   4787 C CA  . GLU B 1 84  ? -45.780 83.493  6.174   1.00 31.89  ? 81  GLU B CA  1 
ATOM   4788 C C   . GLU B 1 84  ? -44.838 83.133  7.315   1.00 31.27  ? 81  GLU B C   1 
ATOM   4789 O O   . GLU B 1 84  ? -44.829 83.813  8.348   1.00 31.90  ? 81  GLU B O   1 
ATOM   4790 C CB  . GLU B 1 84  ? -47.100 82.735  6.328   1.00 27.03  ? 81  GLU B CB  1 
ATOM   4791 C CG  . GLU B 1 84  ? -47.856 83.056  7.609   1.00 42.26  ? 81  GLU B CG  1 
ATOM   4792 C CD  . GLU B 1 84  ? -49.010 82.105  7.862   1.00 53.97  ? 81  GLU B CD  1 
ATOM   4793 O OE1 . GLU B 1 84  ? -48.813 80.878  7.732   1.00 47.88  ? 81  GLU B OE1 1 
ATOM   4794 O OE2 . GLU B 1 84  ? -50.116 82.585  8.188   1.00 72.17  ? 81  GLU B OE2 1 
ATOM   4795 N N   . GLY B 1 85  ? -44.038 82.077  7.150   1.00 24.39  ? 82  GLY B N   1 
ATOM   4796 C CA  . GLY B 1 85  ? -43.192 81.619  8.240   1.00 26.07  ? 82  GLY B CA  1 
ATOM   4797 C C   . GLY B 1 85  ? -42.147 82.631  8.668   1.00 23.86  ? 82  GLY B C   1 
ATOM   4798 O O   . GLY B 1 85  ? -41.719 82.633  9.825   1.00 26.09  ? 82  GLY B O   1 
ATOM   4799 N N   . THR B 1 86  ? -41.720 83.499  7.752   1.00 24.19  ? 83  THR B N   1 
ATOM   4800 C CA  . THR B 1 86  ? -40.749 84.541  8.064   1.00 24.57  ? 83  THR B CA  1 
ATOM   4801 C C   . THR B 1 86  ? -41.383 85.914  8.234   1.00 23.60  ? 83  THR B C   1 
ATOM   4802 O O   . THR B 1 86  ? -40.938 86.693  9.083   1.00 23.90  ? 83  THR B O   1 
ATOM   4803 C CB  . THR B 1 86  ? -39.674 84.616  6.974   1.00 29.85  ? 83  THR B CB  1 
ATOM   4804 O OG1 . THR B 1 86  ? -40.296 84.762  5.692   1.00 23.87  ? 83  THR B OG1 1 
ATOM   4805 C CG2 . THR B 1 86  ? -38.816 83.359  6.979   1.00 23.43  ? 83  THR B CG2 1 
ATOM   4806 N N   . GLU B 1 87  ? -42.417 86.229  7.447   1.00 24.84  ? 84  GLU B N   1 
ATOM   4807 C CA  . GLU B 1 87  ? -43.033 87.551  7.522   1.00 26.64  ? 84  GLU B CA  1 
ATOM   4808 C C   . GLU B 1 87  ? -43.717 87.787  8.863   1.00 23.11  ? 84  GLU B C   1 
ATOM   4809 O O   . GLU B 1 87  ? -43.856 88.939  9.289   1.00 25.64  ? 84  GLU B O   1 
ATOM   4810 C CB  . GLU B 1 87  ? -44.040 87.731  6.383   1.00 25.24  ? 84  GLU B CB  1 
ATOM   4811 C CG  . GLU B 1 87  ? -43.453 87.601  4.982   1.00 40.31  ? 84  GLU B CG  1 
ATOM   4812 C CD  . GLU B 1 87  ? -42.855 88.892  4.461   1.00 52.13  ? 84  GLU B CD  1 
ATOM   4813 O OE1 . GLU B 1 87  ? -42.568 88.961  3.247   1.00 44.94  ? 84  GLU B OE1 1 
ATOM   4814 O OE2 . GLU B 1 87  ? -42.676 89.838  5.257   1.00 65.61  ? 84  GLU B OE2 1 
ATOM   4815 N N   . MET B 1 88  ? -44.146 86.718  9.541   1.00 18.44  ? 85  MET B N   1 
ATOM   4816 C CA  . MET B 1 88  ? -44.856 86.874  10.806  1.00 26.33  ? 85  MET B CA  1 
ATOM   4817 C C   . MET B 1 88  ? -43.981 87.477  11.896  1.00 19.73  ? 85  MET B C   1 
ATOM   4818 O O   . MET B 1 88  ? -44.510 87.964  12.901  1.00 26.76  ? 85  MET B O   1 
ATOM   4819 C CB  . MET B 1 88  ? -45.405 85.525  11.272  1.00 25.19  ? 85  MET B CB  1 
ATOM   4820 C CG  . MET B 1 88  ? -44.333 84.474  11.508  1.00 24.73  ? 85  MET B CG  1 
ATOM   4821 S SD  . MET B 1 88  ? -45.001 82.910  12.106  1.00 26.67  ? 85  MET B SD  1 
ATOM   4822 C CE  . MET B 1 88  ? -45.635 83.399  13.710  1.00 23.78  ? 85  MET B CE  1 
ATOM   4823 N N   . TRP B 1 89  ? -42.660 87.457  11.724  1.00 17.43  ? 86  TRP B N   1 
ATOM   4824 C CA  . TRP B 1 89  ? -41.745 88.049  12.688  1.00 23.94  ? 86  TRP B CA  1 
ATOM   4825 C C   . TRP B 1 89  ? -41.236 89.420  12.261  1.00 25.20  ? 86  TRP B C   1 
ATOM   4826 O O   . TRP B 1 89  ? -40.628 90.119  13.079  1.00 18.60  ? 86  TRP B O   1 
ATOM   4827 C CB  . TRP B 1 89  ? -40.553 87.112  12.928  1.00 17.74  ? 86  TRP B CB  1 
ATOM   4828 C CG  . TRP B 1 89  ? -40.949 85.681  13.148  1.00 22.99  ? 86  TRP B CG  1 
ATOM   4829 C CD1 . TRP B 1 89  ? -40.853 84.657  12.251  1.00 24.96  ? 86  TRP B CD1 1 
ATOM   4830 C CD2 . TRP B 1 89  ? -41.510 85.116  14.341  1.00 23.36  ? 86  TRP B CD2 1 
ATOM   4831 N NE1 . TRP B 1 89  ? -41.315 83.490  12.811  1.00 23.72  ? 86  TRP B NE1 1 
ATOM   4832 C CE2 . TRP B 1 89  ? -41.725 83.745  14.094  1.00 27.07  ? 86  TRP B CE2 1 
ATOM   4833 C CE3 . TRP B 1 89  ? -41.850 85.637  15.594  1.00 25.11  ? 86  TRP B CE3 1 
ATOM   4834 C CZ2 . TRP B 1 89  ? -42.264 82.888  15.052  1.00 25.73  ? 86  TRP B CZ2 1 
ATOM   4835 C CZ3 . TRP B 1 89  ? -42.385 84.784  16.544  1.00 29.46  ? 86  TRP B CZ3 1 
ATOM   4836 C CH2 . TRP B 1 89  ? -42.586 83.425  16.268  1.00 24.11  ? 86  TRP B CH2 1 
ATOM   4837 N N   . ASN B 1 90  ? -41.470 89.818  11.012  1.00 18.03  ? 87  ASN B N   1 
ATOM   4838 C CA  . ASN B 1 90  ? -41.026 91.114  10.530  1.00 22.38  ? 87  ASN B CA  1 
ATOM   4839 C C   . ASN B 1 90  ? -41.881 92.230  11.129  1.00 22.37  ? 87  ASN B C   1 
ATOM   4840 O O   . ASN B 1 90  ? -43.006 91.992  11.573  1.00 22.04  ? 87  ASN B O   1 
ATOM   4841 C CB  . ASN B 1 90  ? -41.085 91.154  9.004   1.00 23.20  ? 87  ASN B CB  1 
ATOM   4842 C CG  . ASN B 1 90  ? -39.972 90.353  8.358   1.00 28.66  ? 87  ASN B CG  1 
ATOM   4843 O OD1 . ASN B 1 90  ? -38.903 90.174  8.942   1.00 26.36  ? 87  ASN B OD1 1 
ATOM   4844 N ND2 . ASN B 1 90  ? -40.216 89.871  7.146   1.00 33.82  ? 87  ASN B ND2 1 
ATOM   4845 N N   . PRO B 1 91  ? -41.361 93.459  11.161  1.00 20.35  ? 88  PRO B N   1 
ATOM   4846 C CA  . PRO B 1 91  ? -42.123 94.566  11.755  1.00 26.91  ? 88  PRO B CA  1 
ATOM   4847 C C   . PRO B 1 91  ? -43.439 94.804  11.027  1.00 27.07  ? 88  PRO B C   1 
ATOM   4848 O O   . PRO B 1 91  ? -43.490 94.856  9.796   1.00 22.41  ? 88  PRO B O   1 
ATOM   4849 C CB  . PRO B 1 91  ? -41.176 95.764  11.611  1.00 21.41  ? 88  PRO B CB  1 
ATOM   4850 C CG  . PRO B 1 91  ? -39.817 95.163  11.522  1.00 29.51  ? 88  PRO B CG  1 
ATOM   4851 C CD  . PRO B 1 91  ? -39.998 93.872  10.783  1.00 23.22  ? 88  PRO B CD  1 
ATOM   4852 N N   . ASN B 1 92  ? -44.512 94.945  11.806  1.00 27.89  ? 89  ASN B N   1 
ATOM   4853 C CA  . ASN B 1 92  ? -45.833 95.260  11.281  1.00 23.79  ? 89  ASN B CA  1 
ATOM   4854 C C   . ASN B 1 92  ? -46.217 96.715  11.516  1.00 22.20  ? 89  ASN B C   1 
ATOM   4855 O O   . ASN B 1 92  ? -47.365 97.094  11.264  1.00 27.21  ? 89  ASN B O   1 
ATOM   4856 C CB  . ASN B 1 92  ? -46.882 94.327  11.892  1.00 27.83  ? 89  ASN B CB  1 
ATOM   4857 C CG  . ASN B 1 92  ? -46.936 94.416  13.403  1.00 28.16  ? 89  ASN B CG  1 
ATOM   4858 O OD1 . ASN B 1 92  ? -45.988 94.869  14.046  1.00 26.74  ? 89  ASN B OD1 1 
ATOM   4859 N ND2 . ASN B 1 92  ? -48.048 93.977  13.981  1.00 25.66  ? 89  ASN B ND2 1 
ATOM   4860 N N   . ARG B 1 93  ? -45.287 97.530  12.005  1.00 22.99  ? 90  ARG B N   1 
ATOM   4861 C CA  . ARG B 1 93  ? -45.449 98.971  12.108  1.00 19.23  ? 90  ARG B CA  1 
ATOM   4862 C C   . ARG B 1 93  ? -44.209 99.634  11.524  1.00 26.53  ? 90  ARG B C   1 
ATOM   4863 O O   . ARG B 1 93  ? -43.189 98.984  11.278  1.00 31.04  ? 90  ARG B O   1 
ATOM   4864 C CB  . ARG B 1 93  ? -45.666 99.418  13.561  1.00 25.72  ? 90  ARG B CB  1 
ATOM   4865 C CG  . ARG B 1 93  ? -46.952 98.907  14.197  1.00 31.54  ? 90  ARG B CG  1 
ATOM   4866 C CD  . ARG B 1 93  ? -48.183 99.425  13.469  1.00 28.20  ? 90  ARG B CD  1 
ATOM   4867 N NE  . ARG B 1 93  ? -49.414 99.119  14.194  1.00 27.67  ? 90  ARG B NE  1 
ATOM   4868 C CZ  . ARG B 1 93  ? -50.083 97.976  14.084  1.00 27.43  ? 90  ARG B CZ  1 
ATOM   4869 N NH1 . ARG B 1 93  ? -49.640 97.021  13.277  1.00 33.12  ? 90  ARG B NH1 1 
ATOM   4870 N NH2 . ARG B 1 93  ? -51.193 97.785  14.782  1.00 37.16  ? 90  ARG B NH2 1 
ATOM   4871 N N   . GLU B 1 94  ? -44.300 100.942 11.298  1.00 25.04  ? 91  GLU B N   1 
ATOM   4872 C CA  . GLU B 1 94  ? -43.175 101.677 10.739  1.00 23.02  ? 91  GLU B CA  1 
ATOM   4873 C C   . GLU B 1 94  ? -41.996 101.679 11.705  1.00 30.57  ? 91  GLU B C   1 
ATOM   4874 O O   . GLU B 1 94  ? -42.162 101.652 12.928  1.00 27.45  ? 91  GLU B O   1 
ATOM   4875 C CB  . GLU B 1 94  ? -43.580 103.113 10.407  1.00 27.10  ? 91  GLU B CB  1 
ATOM   4876 C CG  . GLU B 1 94  ? -44.469 103.252 9.178   1.00 57.82  ? 91  GLU B CG  1 
ATOM   4877 C CD  . GLU B 1 94  ? -43.777 102.814 7.898   1.00 71.63  ? 91  GLU B CD  1 
ATOM   4878 O OE1 . GLU B 1 94  ? -43.806 101.605 7.582   1.00 72.33  ? 91  GLU B OE1 1 
ATOM   4879 O OE2 . GLU B 1 94  ? -43.199 103.681 7.209   1.00 77.75  ? 91  GLU B OE2 1 
ATOM   4880 N N   . LEU B 1 95  ? -40.793 101.709 11.139  1.00 20.16  ? 92  LEU B N   1 
ATOM   4881 C CA  . LEU B 1 95  ? -39.576 101.722 11.938  1.00 22.12  ? 92  LEU B CA  1 
ATOM   4882 C C   . LEU B 1 95  ? -39.265 103.134 12.411  1.00 25.64  ? 92  LEU B C   1 
ATOM   4883 O O   . LEU B 1 95  ? -39.464 104.110 11.681  1.00 31.08  ? 92  LEU B O   1 
ATOM   4884 C CB  . LEU B 1 95  ? -38.401 101.170 11.130  1.00 27.87  ? 92  LEU B CB  1 
ATOM   4885 C CG  . LEU B 1 95  ? -38.508 99.716  10.666  1.00 21.06  ? 92  LEU B CG  1 
ATOM   4886 C CD1 . LEU B 1 95  ? -37.274 99.320  9.870   1.00 20.95  ? 92  LEU B CD1 1 
ATOM   4887 C CD2 . LEU B 1 95  ? -38.707 98.786  11.853  1.00 24.31  ? 92  LEU B CD2 1 
ATOM   4888 N N   . SER B 1 96  ? -38.769 103.238 13.641  1.00 22.34  ? 93  SER B N   1 
ATOM   4889 C CA  . SER B 1 96  ? -38.419 104.527 14.220  1.00 27.09  ? 93  SER B CA  1 
ATOM   4890 C C   . SER B 1 96  ? -37.556 104.294 15.450  1.00 27.29  ? 93  SER B C   1 
ATOM   4891 O O   . SER B 1 96  ? -37.723 103.298 16.159  1.00 26.03  ? 93  SER B O   1 
ATOM   4892 C CB  . SER B 1 96  ? -39.668 105.334 14.598  1.00 20.36  ? 93  SER B CB  1 
ATOM   4893 O OG  . SER B 1 96  ? -39.315 106.544 15.247  1.00 23.07  ? 93  SER B OG  1 
ATOM   4894 N N   . GLU B 1 97  ? -36.627 105.223 15.688  1.00 22.14  ? 94  GLU B N   1 
ATOM   4895 C CA  . GLU B 1 97  ? -35.903 105.226 16.952  1.00 19.17  ? 94  GLU B CA  1 
ATOM   4896 C C   . GLU B 1 97  ? -36.801 105.633 18.112  1.00 30.02  ? 94  GLU B C   1 
ATOM   4897 O O   . GLU B 1 97  ? -36.486 105.324 19.266  1.00 30.25  ? 94  GLU B O   1 
ATOM   4898 C CB  . GLU B 1 97  ? -34.689 106.153 16.867  1.00 24.36  ? 94  GLU B CB  1 
ATOM   4899 C CG  . GLU B 1 97  ? -33.517 105.559 16.101  1.00 22.83  ? 94  GLU B CG  1 
ATOM   4900 C CD  . GLU B 1 97  ? -32.299 106.462 16.101  1.00 33.09  ? 94  GLU B CD  1 
ATOM   4901 O OE1 . GLU B 1 97  ? -32.345 107.529 15.453  1.00 31.03  ? 94  GLU B OE1 1 
ATOM   4902 O OE2 . GLU B 1 97  ? -31.296 106.107 16.758  1.00 27.75  ? 94  GLU B OE2 1 
ATOM   4903 N N   . ASP B 1 98  ? -37.910 106.318 17.826  1.00 29.45  ? 95  ASP B N   1 
ATOM   4904 C CA  . ASP B 1 98  ? -38.946 106.608 18.816  1.00 29.45  ? 95  ASP B CA  1 
ATOM   4905 C C   . ASP B 1 98  ? -39.830 105.370 18.928  1.00 27.94  ? 95  ASP B C   1 
ATOM   4906 O O   . ASP B 1 98  ? -40.886 105.255 18.301  1.00 26.13  ? 95  ASP B O   1 
ATOM   4907 C CB  . ASP B 1 98  ? -39.748 107.838 18.407  1.00 27.52  ? 95  ASP B CB  1 
ATOM   4908 C CG  . ASP B 1 98  ? -40.668 108.336 19.509  1.00 34.81  ? 95  ASP B CG  1 
ATOM   4909 O OD1 . ASP B 1 98  ? -41.132 109.492 19.413  1.00 39.10  ? 95  ASP B OD1 1 
ATOM   4910 O OD2 . ASP B 1 98  ? -40.916 107.589 20.478  1.00 27.69  ? 95  ASP B OD2 1 
ATOM   4911 N N   . CYS B 1 99  ? -39.383 104.419 19.750  1.00 25.23  ? 96  CYS B N   1 
ATOM   4912 C CA  . CYS B 1 99  ? -40.066 103.137 19.845  1.00 27.95  ? 96  CYS B CA  1 
ATOM   4913 C C   . CYS B 1 99  ? -40.256 102.626 21.265  1.00 17.78  ? 96  CYS B C   1 
ATOM   4914 O O   . CYS B 1 99  ? -40.830 101.546 21.433  1.00 24.87  ? 96  CYS B O   1 
ATOM   4915 C CB  . CYS B 1 99  ? -39.308 102.071 19.039  1.00 19.71  ? 96  CYS B CB  1 
ATOM   4916 S SG  . CYS B 1 99  ? -37.642 101.727 19.659  1.00 27.11  ? 96  CYS B SG  1 
ATOM   4917 N N   . LEU B 1 100 ? -39.804 103.351 22.288  1.00 22.74  ? 97  LEU B N   1 
ATOM   4918 C CA  . LEU B 1 100 ? -39.882 102.864 23.664  1.00 19.26  ? 97  LEU B CA  1 
ATOM   4919 C C   . LEU B 1 100 ? -41.305 103.063 24.182  1.00 19.90  ? 97  LEU B C   1 
ATOM   4920 O O   . LEU B 1 100 ? -41.629 104.029 24.877  1.00 28.18  ? 97  LEU B O   1 
ATOM   4921 C CB  . LEU B 1 100 ? -38.848 103.559 24.540  1.00 18.53  ? 97  LEU B CB  1 
ATOM   4922 C CG  . LEU B 1 100 ? -37.403 103.244 24.143  1.00 26.10  ? 97  LEU B CG  1 
ATOM   4923 C CD1 . LEU B 1 100 ? -36.415 103.807 25.152  1.00 24.88  ? 97  LEU B CD1 1 
ATOM   4924 C CD2 . LEU B 1 100 ? -37.209 101.741 23.976  1.00 19.11  ? 97  LEU B CD2 1 
ATOM   4925 N N   . TYR B 1 101 ? -42.167 102.110 23.833  1.00 18.55  ? 98  TYR B N   1 
ATOM   4926 C CA  . TYR B 1 101 ? -43.557 102.097 24.260  1.00 19.92  ? 98  TYR B CA  1 
ATOM   4927 C C   . TYR B 1 101 ? -43.923 100.696 24.728  1.00 26.03  ? 98  TYR B C   1 
ATOM   4928 O O   . TYR B 1 101 ? -43.379 99.702  24.240  1.00 29.83  ? 98  TYR B O   1 
ATOM   4929 C CB  . TYR B 1 101 ? -44.502 102.532 23.127  1.00 19.71  ? 98  TYR B CB  1 
ATOM   4930 C CG  . TYR B 1 101 ? -44.217 103.912 22.578  1.00 30.75  ? 98  TYR B CG  1 
ATOM   4931 C CD1 . TYR B 1 101 ? -44.908 105.023 23.043  1.00 33.16  ? 98  TYR B CD1 1 
ATOM   4932 C CD2 . TYR B 1 101 ? -43.260 104.104 21.590  1.00 24.98  ? 98  TYR B CD2 1 
ATOM   4933 C CE1 . TYR B 1 101 ? -44.653 106.286 22.543  1.00 22.21  ? 98  TYR B CE1 1 
ATOM   4934 C CE2 . TYR B 1 101 ? -42.998 105.362 21.084  1.00 32.76  ? 98  TYR B CE2 1 
ATOM   4935 C CZ  . TYR B 1 101 ? -43.696 106.450 21.564  1.00 33.85  ? 98  TYR B CZ  1 
ATOM   4936 O OH  . TYR B 1 101 ? -43.438 107.705 21.064  1.00 27.45  ? 98  TYR B OH  1 
ATOM   4937 N N   . LEU B 1 102 ? -44.847 100.623 25.681  1.00 20.15  ? 99  LEU B N   1 
ATOM   4938 C CA  . LEU B 1 102 ? -45.315 99.352  26.212  1.00 22.84  ? 99  LEU B CA  1 
ATOM   4939 C C   . LEU B 1 102 ? -46.829 99.252  26.073  1.00 22.49  ? 99  LEU B C   1 
ATOM   4940 O O   . LEU B 1 102 ? -47.521 100.233 25.788  1.00 29.40  ? 99  LEU B O   1 
ATOM   4941 C CB  . LEU B 1 102 ? -44.888 99.167  27.678  1.00 20.23  ? 99  LEU B CB  1 
ATOM   4942 C CG  . LEU B 1 102 ? -45.276 100.187 28.754  1.00 23.38  ? 99  LEU B CG  1 
ATOM   4943 C CD1 . LEU B 1 102 ? -46.682 99.948  29.292  1.00 19.59  ? 99  LEU B CD1 1 
ATOM   4944 C CD2 . LEU B 1 102 ? -44.264 100.152 29.887  1.00 19.51  ? 99  LEU B CD2 1 
ATOM   4945 N N   . ASN B 1 103 ? -47.339 98.042  26.287  1.00 18.23  ? 100 ASN B N   1 
ATOM   4946 C CA  . ASN B 1 103 ? -48.754 97.745  26.132  1.00 20.92  ? 100 ASN B CA  1 
ATOM   4947 C C   . ASN B 1 103 ? -49.257 97.004  27.362  1.00 27.82  ? 100 ASN B C   1 
ATOM   4948 O O   . ASN B 1 103 ? -48.516 96.249  27.997  1.00 29.74  ? 100 ASN B O   1 
ATOM   4949 C CB  . ASN B 1 103 ? -49.009 96.907  24.874  1.00 29.11  ? 100 ASN B CB  1 
ATOM   4950 C CG  . ASN B 1 103 ? -48.114 97.311  23.718  1.00 32.62  ? 100 ASN B CG  1 
ATOM   4951 O OD1 . ASN B 1 103 ? -48.394 98.277  23.008  1.00 29.89  ? 100 ASN B OD1 1 
ATOM   4952 N ND2 . ASN B 1 103 ? -47.026 96.573  23.528  1.00 24.70  ? 100 ASN B ND2 1 
ATOM   4953 N N   . VAL B 1 104 ? -50.526 97.231  27.697  1.00 27.34  ? 101 VAL B N   1 
ATOM   4954 C CA  . VAL B 1 104 ? -51.151 96.636  28.873  1.00 20.10  ? 101 VAL B CA  1 
ATOM   4955 C C   . VAL B 1 104 ? -52.510 96.081  28.470  1.00 21.59  ? 101 VAL B C   1 
ATOM   4956 O O   . VAL B 1 104 ? -53.367 96.825  27.976  1.00 34.38  ? 101 VAL B O   1 
ATOM   4957 C CB  . VAL B 1 104 ? -51.307 97.649  30.022  1.00 24.54  ? 101 VAL B CB  1 
ATOM   4958 C CG1 . VAL B 1 104 ? -52.052 97.016  31.188  1.00 28.07  ? 101 VAL B CG1 1 
ATOM   4959 C CG2 . VAL B 1 104 ? -49.949 98.166  30.473  1.00 18.03  ? 101 VAL B CG2 1 
ATOM   4960 N N   . TRP B 1 105 ? -52.703 94.781  28.674  1.00 27.07  ? 102 TRP B N   1 
ATOM   4961 C CA  . TRP B 1 105 ? -54.001 94.139  28.521  1.00 24.94  ? 102 TRP B CA  1 
ATOM   4962 C C   . TRP B 1 105 ? -54.572 93.854  29.904  1.00 37.53  ? 102 TRP B C   1 
ATOM   4963 O O   . TRP B 1 105 ? -53.868 93.331  30.774  1.00 37.64  ? 102 TRP B O   1 
ATOM   4964 C CB  . TRP B 1 105 ? -53.890 92.837  27.724  1.00 31.21  ? 102 TRP B CB  1 
ATOM   4965 C CG  . TRP B 1 105 ? -53.520 93.007  26.281  1.00 29.48  ? 102 TRP B CG  1 
ATOM   4966 C CD1 . TRP B 1 105 ? -54.374 93.081  25.218  1.00 25.31  ? 102 TRP B CD1 1 
ATOM   4967 C CD2 . TRP B 1 105 ? -52.197 93.106  25.739  1.00 25.79  ? 102 TRP B CD2 1 
ATOM   4968 N NE1 . TRP B 1 105 ? -53.665 93.226  24.050  1.00 28.72  ? 102 TRP B NE1 1 
ATOM   4969 C CE2 . TRP B 1 105 ? -52.327 93.244  24.343  1.00 27.91  ? 102 TRP B CE2 1 
ATOM   4970 C CE3 . TRP B 1 105 ? -50.917 93.094  26.300  1.00 29.28  ? 102 TRP B CE3 1 
ATOM   4971 C CZ2 . TRP B 1 105 ? -51.224 93.371  23.500  1.00 23.68  ? 102 TRP B CZ2 1 
ATOM   4972 C CZ3 . TRP B 1 105 ? -49.824 93.219  25.462  1.00 32.11  ? 102 TRP B CZ3 1 
ATOM   4973 C CH2 . TRP B 1 105 ? -49.984 93.356  24.077  1.00 24.36  ? 102 TRP B CH2 1 
ATOM   4974 N N   . THR B 1 106 ? -55.843 94.202  30.107  1.00 36.05  ? 103 THR B N   1 
ATOM   4975 C CA  . THR B 1 106 ? -56.514 93.970  31.377  1.00 33.58  ? 103 THR B CA  1 
ATOM   4976 C C   . THR B 1 106 ? -57.914 93.434  31.106  1.00 33.55  ? 103 THR B C   1 
ATOM   4977 O O   . THR B 1 106 ? -58.550 93.831  30.117  1.00 31.30  ? 103 THR B O   1 
ATOM   4978 C CB  . THR B 1 106 ? -56.587 95.249  32.228  1.00 38.86  ? 103 THR B CB  1 
ATOM   4979 O OG1 . THR B 1 106 ? -57.294 94.984  33.447  1.00 48.02  ? 103 THR B OG1 1 
ATOM   4980 C CG2 . THR B 1 106 ? -57.284 96.370  31.471  1.00 29.32  ? 103 THR B CG2 1 
ATOM   4981 N N   . PRO B 1 107 ? -58.408 92.523  31.941  1.00 33.86  ? 104 PRO B N   1 
ATOM   4982 C CA  . PRO B 1 107 ? -59.718 91.918  31.681  1.00 36.30  ? 104 PRO B CA  1 
ATOM   4983 C C   . PRO B 1 107 ? -60.850 92.922  31.831  1.00 37.72  ? 104 PRO B C   1 
ATOM   4984 O O   . PRO B 1 107 ? -60.717 93.970  32.467  1.00 30.16  ? 104 PRO B O   1 
ATOM   4985 C CB  . PRO B 1 107 ? -59.822 90.814  32.741  1.00 38.34  ? 104 PRO B CB  1 
ATOM   4986 C CG  . PRO B 1 107 ? -58.422 90.585  33.212  1.00 43.04  ? 104 PRO B CG  1 
ATOM   4987 C CD  . PRO B 1 107 ? -57.735 91.907  33.096  1.00 29.72  ? 104 PRO B CD  1 
ATOM   4988 N N   . TYR B 1 108 ? -61.984 92.582  31.221  1.00 40.53  ? 105 TYR B N   1 
ATOM   4989 C CA  . TYR B 1 108 ? -63.218 93.323  31.400  1.00 48.42  ? 105 TYR B CA  1 
ATOM   4990 C C   . TYR B 1 108 ? -64.260 92.423  32.051  1.00 47.47  ? 105 TYR B C   1 
ATOM   4991 O O   . TYR B 1 108 ? -64.514 91.319  31.550  1.00 51.30  ? 105 TYR B O   1 
ATOM   4992 C CB  . TYR B 1 108 ? -63.759 93.864  30.067  1.00 51.78  ? 105 TYR B CB  1 
ATOM   4993 C CG  . TYR B 1 108 ? -65.039 94.655  30.232  1.00 55.40  ? 105 TYR B CG  1 
ATOM   4994 C CD1 . TYR B 1 108 ? -65.007 95.997  30.588  1.00 51.30  ? 105 TYR B CD1 1 
ATOM   4995 C CD2 . TYR B 1 108 ? -66.279 94.057  30.045  1.00 60.94  ? 105 TYR B CD2 1 
ATOM   4996 C CE1 . TYR B 1 108 ? -66.173 96.723  30.747  1.00 65.97  ? 105 TYR B CE1 1 
ATOM   4997 C CE2 . TYR B 1 108 ? -67.450 94.775  30.202  1.00 67.27  ? 105 TYR B CE2 1 
ATOM   4998 C CZ  . TYR B 1 108 ? -67.391 96.107  30.553  1.00 77.08  ? 105 TYR B CZ  1 
ATOM   4999 O OH  . TYR B 1 108 ? -68.555 96.825  30.709  1.00 77.00  ? 105 TYR B OH  1 
ATOM   5000 N N   . PRO B 1 109 ? -64.886 92.847  33.162  1.00 54.27  ? 106 PRO B N   1 
ATOM   5001 C CA  . PRO B 1 109 ? -64.634 94.116  33.857  1.00 51.14  ? 106 PRO B CA  1 
ATOM   5002 C C   . PRO B 1 109 ? -63.254 94.168  34.506  1.00 39.63  ? 106 PRO B C   1 
ATOM   5003 O O   . PRO B 1 109 ? -62.662 93.117  34.756  1.00 42.97  ? 106 PRO B O   1 
ATOM   5004 C CB  . PRO B 1 109 ? -65.735 94.160  34.925  1.00 45.07  ? 106 PRO B CB  1 
ATOM   5005 C CG  . PRO B 1 109 ? -66.776 93.194  34.454  1.00 58.82  ? 106 PRO B CG  1 
ATOM   5006 C CD  . PRO B 1 109 ? -66.014 92.114  33.760  1.00 53.72  ? 106 PRO B CD  1 
ATOM   5007 N N   . ARG B 1 110 ? -62.752 95.373  34.752  1.00 34.11  ? 107 ARG B N   1 
ATOM   5008 C CA  . ARG B 1 110 ? -61.430 95.519  35.338  1.00 35.96  ? 107 ARG B CA  1 
ATOM   5009 C C   . ARG B 1 110 ? -61.387 94.831  36.700  1.00 43.32  ? 107 ARG B C   1 
ATOM   5010 O O   . ARG B 1 110 ? -62.333 94.954  37.488  1.00 52.37  ? 107 ARG B O   1 
ATOM   5011 C CB  . ARG B 1 110 ? -61.065 96.997  35.483  1.00 37.95  ? 107 ARG B CB  1 
ATOM   5012 C CG  . ARG B 1 110 ? -59.643 97.243  35.962  1.00 41.10  ? 107 ARG B CG  1 
ATOM   5013 C CD  . ARG B 1 110 ? -59.385 98.721  36.177  1.00 41.34  ? 107 ARG B CD  1 
ATOM   5014 N NE  . ARG B 1 110 ? -59.745 99.509  35.003  1.00 50.38  ? 107 ARG B NE  1 
ATOM   5015 C CZ  . ARG B 1 110 ? -59.659 100.833 34.938  1.00 54.62  ? 107 ARG B CZ  1 
ATOM   5016 N NH1 . ARG B 1 110 ? -59.223 101.523 35.982  1.00 61.86  ? 107 ARG B NH1 1 
ATOM   5017 N NH2 . ARG B 1 110 ? -60.011 101.467 33.828  1.00 58.14  ? 107 ARG B NH2 1 
ATOM   5018 N N   . PRO B 1 111 ? -60.324 94.088  37.002  1.00 56.57  ? 108 PRO B N   1 
ATOM   5019 C CA  . PRO B 1 111 ? -60.240 93.418  38.306  1.00 54.11  ? 108 PRO B CA  1 
ATOM   5020 C C   . PRO B 1 111 ? -60.238 94.425  39.447  1.00 61.49  ? 108 PRO B C   1 
ATOM   5021 O O   . PRO B 1 111 ? -59.450 95.373  39.463  1.00 49.57  ? 108 PRO B O   1 
ATOM   5022 C CB  . PRO B 1 111 ? -58.916 92.651  38.225  1.00 46.32  ? 108 PRO B CB  1 
ATOM   5023 C CG  . PRO B 1 111 ? -58.667 92.475  36.764  1.00 47.94  ? 108 PRO B CG  1 
ATOM   5024 C CD  . PRO B 1 111 ? -59.213 93.709  36.113  1.00 43.96  ? 108 PRO B CD  1 
ATOM   5025 N N   . THR B 1 112 ? -61.144 94.214  40.405  1.00 56.15  ? 109 THR B N   1 
ATOM   5026 C CA  . THR B 1 112 ? -61.188 95.063  41.589  1.00 61.32  ? 109 THR B CA  1 
ATOM   5027 C C   . THR B 1 112 ? -60.149 94.648  42.620  1.00 55.46  ? 109 THR B C   1 
ATOM   5028 O O   . THR B 1 112 ? -59.706 95.480  43.420  1.00 55.07  ? 109 THR B O   1 
ATOM   5029 C CB  . THR B 1 112 ? -62.586 95.030  42.209  1.00 61.41  ? 109 THR B CB  1 
ATOM   5030 O OG1 . THR B 1 112 ? -62.946 93.675  42.506  1.00 58.93  ? 109 THR B OG1 1 
ATOM   5031 C CG2 . THR B 1 112 ? -63.606 95.623  41.249  1.00 46.29  ? 109 THR B CG2 1 
ATOM   5032 N N   . SER B 1 113 ? -59.752 93.379  42.616  1.00 55.42  ? 110 SER B N   1 
ATOM   5033 C CA  . SER B 1 113 ? -58.715 92.824  43.465  1.00 58.70  ? 110 SER B CA  1 
ATOM   5034 C C   . SER B 1 113 ? -57.384 92.791  42.723  1.00 58.09  ? 110 SER B C   1 
ATOM   5035 O O   . SER B 1 113 ? -57.353 92.603  41.502  1.00 57.86  ? 110 SER B O   1 
ATOM   5036 C CB  . SER B 1 113 ? -59.084 91.406  43.912  1.00 53.57  ? 110 SER B CB  1 
ATOM   5037 O OG  . SER B 1 113 ? -60.346 91.384  44.555  1.00 73.71  ? 110 SER B OG  1 
ATOM   5038 N N   . PRO B 1 114 ? -56.272 92.991  43.429  1.00 59.22  ? 111 PRO B N   1 
ATOM   5039 C CA  . PRO B 1 114 ? -54.958 92.918  42.775  1.00 50.80  ? 111 PRO B CA  1 
ATOM   5040 C C   . PRO B 1 114 ? -54.745 91.566  42.107  1.00 48.04  ? 111 PRO B C   1 
ATOM   5041 O O   . PRO B 1 114 ? -54.864 90.513  42.738  1.00 49.27  ? 111 PRO B O   1 
ATOM   5042 C CB  . PRO B 1 114 ? -53.977 93.145  43.930  1.00 54.97  ? 111 PRO B CB  1 
ATOM   5043 C CG  . PRO B 1 114 ? -54.754 93.949  44.919  1.00 48.21  ? 111 PRO B CG  1 
ATOM   5044 C CD  . PRO B 1 114 ? -56.170 93.446  44.827  1.00 55.15  ? 111 PRO B CD  1 
ATOM   5045 N N   . THR B 1 115 ? -54.428 91.607  40.812  1.00 43.90  ? 112 THR B N   1 
ATOM   5046 C CA  . THR B 1 115 ? -54.296 90.445  39.950  1.00 47.83  ? 112 THR B CA  1 
ATOM   5047 C C   . THR B 1 115 ? -52.843 90.245  39.528  1.00 41.49  ? 112 THR B C   1 
ATOM   5048 O O   . THR B 1 115 ? -52.156 91.221  39.203  1.00 38.13  ? 112 THR B O   1 
ATOM   5049 C CB  . THR B 1 115 ? -55.177 90.606  38.702  1.00 48.14  ? 112 THR B CB  1 
ATOM   5050 O OG1 . THR B 1 115 ? -56.548 90.721  39.102  1.00 51.88  ? 112 THR B OG1 1 
ATOM   5051 C CG2 . THR B 1 115 ? -55.033 89.421  37.763  1.00 51.04  ? 112 THR B CG2 1 
ATOM   5052 N N   . PRO B 1 116 ? -52.344 89.007  39.543  1.00 52.93  ? 113 PRO B N   1 
ATOM   5053 C CA  . PRO B 1 116 ? -50.970 88.759  39.091  1.00 51.11  ? 113 PRO B CA  1 
ATOM   5054 C C   . PRO B 1 116 ? -50.752 89.222  37.657  1.00 47.43  ? 113 PRO B C   1 
ATOM   5055 O O   . PRO B 1 116 ? -51.661 89.198  36.824  1.00 29.57  ? 113 PRO B O   1 
ATOM   5056 C CB  . PRO B 1 116 ? -50.821 87.236  39.217  1.00 47.61  ? 113 PRO B CB  1 
ATOM   5057 C CG  . PRO B 1 116 ? -52.222 86.712  39.341  1.00 45.90  ? 113 PRO B CG  1 
ATOM   5058 C CD  . PRO B 1 116 ? -52.982 87.781  40.048  1.00 49.95  ? 113 PRO B CD  1 
ATOM   5059 N N   . VAL B 1 117 ? -49.522 89.645  37.378  1.00 36.80  ? 114 VAL B N   1 
ATOM   5060 C CA  . VAL B 1 117 ? -49.170 90.299  36.124  1.00 41.64  ? 114 VAL B CA  1 
ATOM   5061 C C   . VAL B 1 117 ? -48.173 89.430  35.371  1.00 39.06  ? 114 VAL B C   1 
ATOM   5062 O O   . VAL B 1 117 ? -47.195 88.948  35.955  1.00 37.88  ? 114 VAL B O   1 
ATOM   5063 C CB  . VAL B 1 117 ? -48.589 91.704  36.368  1.00 42.21  ? 114 VAL B CB  1 
ATOM   5064 C CG1 . VAL B 1 117 ? -48.259 92.383  35.047  1.00 36.61  ? 114 VAL B CG1 1 
ATOM   5065 C CG2 . VAL B 1 117 ? -49.562 92.545  37.180  1.00 33.61  ? 114 VAL B CG2 1 
ATOM   5066 N N   . LEU B 1 118 ? -48.423 89.234  34.080  1.00 39.06  ? 115 LEU B N   1 
ATOM   5067 C CA  . LEU B 1 118 ? -47.481 88.590  33.176  1.00 33.51  ? 115 LEU B CA  1 
ATOM   5068 C C   . LEU B 1 118 ? -46.821 89.655  32.311  1.00 34.65  ? 115 LEU B C   1 
ATOM   5069 O O   . LEU B 1 118 ? -47.501 90.543  31.788  1.00 32.14  ? 115 LEU B O   1 
ATOM   5070 C CB  . LEU B 1 118 ? -48.184 87.554  32.296  1.00 30.04  ? 115 LEU B CB  1 
ATOM   5071 C CG  . LEU B 1 118 ? -48.523 86.209  32.938  1.00 28.35  ? 115 LEU B CG  1 
ATOM   5072 C CD1 . LEU B 1 118 ? -49.493 85.432  32.065  1.00 37.46  ? 115 LEU B CD1 1 
ATOM   5073 C CD2 . LEU B 1 118 ? -47.254 85.407  33.171  1.00 33.28  ? 115 LEU B CD2 1 
ATOM   5074 N N   . VAL B 1 119 ? -45.501 89.574  32.170  1.00 22.06  ? 116 VAL B N   1 
ATOM   5075 C CA  . VAL B 1 119 ? -44.735 90.540  31.390  1.00 28.06  ? 116 VAL B CA  1 
ATOM   5076 C C   . VAL B 1 119 ? -44.000 89.788  30.290  1.00 33.19  ? 116 VAL B C   1 
ATOM   5077 O O   . VAL B 1 119 ? -43.147 88.939  30.574  1.00 29.06  ? 116 VAL B O   1 
ATOM   5078 C CB  . VAL B 1 119 ? -43.754 91.335  32.264  1.00 30.21  ? 116 VAL B CB  1 
ATOM   5079 C CG1 . VAL B 1 119 ? -42.946 92.295  31.407  1.00 16.32  ? 116 VAL B CG1 1 
ATOM   5080 C CG2 . VAL B 1 119 ? -44.503 92.089  33.349  1.00 24.19  ? 116 VAL B CG2 1 
ATOM   5081 N N   . TRP B 1 120 ? -44.324 90.108  29.039  1.00 26.14  ? 117 TRP B N   1 
ATOM   5082 C CA  . TRP B 1 120 ? -43.750 89.429  27.885  1.00 20.89  ? 117 TRP B CA  1 
ATOM   5083 C C   . TRP B 1 120 ? -42.550 90.204  27.358  1.00 25.34  ? 117 TRP B C   1 
ATOM   5084 O O   . TRP B 1 120 ? -42.604 91.431  27.225  1.00 28.11  ? 117 TRP B O   1 
ATOM   5085 C CB  . TRP B 1 120 ? -44.799 89.265  26.782  1.00 21.01  ? 117 TRP B CB  1 
ATOM   5086 C CG  . TRP B 1 120 ? -44.243 88.751  25.491  1.00 31.07  ? 117 TRP B CG  1 
ATOM   5087 C CD1 . TRP B 1 120 ? -44.060 89.459  24.341  1.00 31.76  ? 117 TRP B CD1 1 
ATOM   5088 C CD2 . TRP B 1 120 ? -43.797 87.417  25.216  1.00 36.55  ? 117 TRP B CD2 1 
ATOM   5089 N NE1 . TRP B 1 120 ? -43.530 88.650  23.365  1.00 34.48  ? 117 TRP B NE1 1 
ATOM   5090 C CE2 . TRP B 1 120 ? -43.359 87.391  23.877  1.00 31.77  ? 117 TRP B CE2 1 
ATOM   5091 C CE3 . TRP B 1 120 ? -43.727 86.242  25.970  1.00 29.11  ? 117 TRP B CE3 1 
ATOM   5092 C CZ2 . TRP B 1 120 ? -42.857 86.239  23.278  1.00 31.47  ? 117 TRP B CZ2 1 
ATOM   5093 C CZ3 . TRP B 1 120 ? -43.229 85.098  25.374  1.00 31.53  ? 117 TRP B CZ3 1 
ATOM   5094 C CH2 . TRP B 1 120 ? -42.801 85.105  24.041  1.00 28.33  ? 117 TRP B CH2 1 
ATOM   5095 N N   . ILE B 1 121 ? -41.471 89.484  27.066  1.00 19.05  ? 118 ILE B N   1 
ATOM   5096 C CA  . ILE B 1 121 ? -40.274 90.044  26.448  1.00 22.01  ? 118 ILE B CA  1 
ATOM   5097 C C   . ILE B 1 121 ? -40.026 89.256  25.171  1.00 25.45  ? 118 ILE B C   1 
ATOM   5098 O O   . ILE B 1 121 ? -39.661 88.074  25.225  1.00 28.00  ? 118 ILE B O   1 
ATOM   5099 C CB  . ILE B 1 121 ? -39.056 89.986  27.379  1.00 23.02  ? 118 ILE B CB  1 
ATOM   5100 C CG1 . ILE B 1 121 ? -39.369 90.670  28.712  1.00 23.62  ? 118 ILE B CG1 1 
ATOM   5101 C CG2 . ILE B 1 121 ? -37.851 90.639  26.717  1.00 16.71  ? 118 ILE B CG2 1 
ATOM   5102 C CD1 . ILE B 1 121 ? -38.225 90.622  29.704  1.00 21.84  ? 118 ILE B CD1 1 
ATOM   5103 N N   . TYR B 1 122 ? -40.226 89.900  24.024  1.00 25.28  ? 119 TYR B N   1 
ATOM   5104 C CA  . TYR B 1 122 ? -40.108 89.199  22.756  1.00 27.68  ? 119 TYR B CA  1 
ATOM   5105 C C   . TYR B 1 122 ? -38.654 88.839  22.465  1.00 29.01  ? 119 TYR B C   1 
ATOM   5106 O O   . TYR B 1 122 ? -37.713 89.455  22.972  1.00 18.58  ? 119 TYR B O   1 
ATOM   5107 C CB  . TYR B 1 122 ? -40.681 90.040  21.612  1.00 27.05  ? 119 TYR B CB  1 
ATOM   5108 C CG  . TYR B 1 122 ? -40.059 91.413  21.445  1.00 21.35  ? 119 TYR B CG  1 
ATOM   5109 C CD1 . TYR B 1 122 ? -38.844 91.576  20.789  1.00 25.16  ? 119 TYR B CD1 1 
ATOM   5110 C CD2 . TYR B 1 122 ? -40.702 92.548  21.921  1.00 20.92  ? 119 TYR B CD2 1 
ATOM   5111 C CE1 . TYR B 1 122 ? -38.278 92.828  20.630  1.00 25.19  ? 119 TYR B CE1 1 
ATOM   5112 C CE2 . TYR B 1 122 ? -40.145 93.805  21.764  1.00 19.25  ? 119 TYR B CE2 1 
ATOM   5113 C CZ  . TYR B 1 122 ? -38.934 93.939  21.118  1.00 22.36  ? 119 TYR B CZ  1 
ATOM   5114 O OH  . TYR B 1 122 ? -38.378 95.187  20.961  1.00 22.88  ? 119 TYR B OH  1 
ATOM   5115 N N   . GLY B 1 123 ? -38.483 87.813  21.633  1.00 22.17  ? 120 GLY B N   1 
ATOM   5116 C CA  . GLY B 1 123 ? -37.178 87.410  21.162  1.00 24.33  ? 120 GLY B CA  1 
ATOM   5117 C C   . GLY B 1 123 ? -36.855 88.016  19.811  1.00 31.11  ? 120 GLY B C   1 
ATOM   5118 O O   . GLY B 1 123 ? -37.525 88.927  19.321  1.00 25.71  ? 120 GLY B O   1 
ATOM   5119 N N   . GLY B 1 124 ? -35.801 87.487  19.199  1.00 25.52  ? 121 GLY B N   1 
ATOM   5120 C CA  . GLY B 1 124 ? -35.368 87.977  17.908  1.00 20.07  ? 121 GLY B CA  1 
ATOM   5121 C C   . GLY B 1 124 ? -33.869 88.163  17.822  1.00 22.99  ? 121 GLY B C   1 
ATOM   5122 O O   . GLY B 1 124 ? -33.389 89.035  17.092  1.00 21.07  ? 121 GLY B O   1 
ATOM   5123 N N   . GLY B 1 125 ? -33.122 87.355  18.573  1.00 25.38  ? 122 GLY B N   1 
ATOM   5124 C CA  . GLY B 1 125 ? -31.671 87.393  18.525  1.00 19.61  ? 122 GLY B CA  1 
ATOM   5125 C C   . GLY B 1 125 ? -31.051 88.722  18.889  1.00 18.97  ? 122 GLY B C   1 
ATOM   5126 O O   . GLY B 1 125 ? -29.921 88.999  18.477  1.00 23.00  ? 122 GLY B O   1 
ATOM   5127 N N   . PHE B 1 126 ? -31.762 89.556  19.647  1.00 26.94  ? 123 PHE B N   1 
ATOM   5128 C CA  . PHE B 1 126 ? -31.336 90.898  20.038  1.00 23.06  ? 123 PHE B CA  1 
ATOM   5129 C C   . PHE B 1 126 ? -31.111 91.822  18.846  1.00 22.10  ? 123 PHE B C   1 
ATOM   5130 O O   . PHE B 1 126 ? -30.536 92.905  19.009  1.00 20.22  ? 123 PHE B O   1 
ATOM   5131 C CB  . PHE B 1 126 ? -30.075 90.861  20.914  1.00 18.40  ? 123 PHE B CB  1 
ATOM   5132 C CG  . PHE B 1 126 ? -30.265 90.149  22.222  1.00 25.27  ? 123 PHE B CG  1 
ATOM   5133 C CD1 . PHE B 1 126 ? -30.948 90.756  23.264  1.00 19.58  ? 123 PHE B CD1 1 
ATOM   5134 C CD2 . PHE B 1 126 ? -29.758 88.874  22.412  1.00 29.88  ? 123 PHE B CD2 1 
ATOM   5135 C CE1 . PHE B 1 126 ? -31.124 90.103  24.470  1.00 31.35  ? 123 PHE B CE1 1 
ATOM   5136 C CE2 . PHE B 1 126 ? -29.931 88.216  23.617  1.00 28.49  ? 123 PHE B CE2 1 
ATOM   5137 C CZ  . PHE B 1 126 ? -30.614 88.832  24.647  1.00 28.76  ? 123 PHE B CZ  1 
ATOM   5138 N N   . TYR B 1 127 ? -31.552 91.428  17.649  1.00 21.14  ? 124 TYR B N   1 
ATOM   5139 C CA  . TYR B 1 127 ? -31.446 92.271  16.469  1.00 20.88  ? 124 TYR B CA  1 
ATOM   5140 C C   . TYR B 1 127 ? -32.791 92.624  15.852  1.00 22.02  ? 124 TYR B C   1 
ATOM   5141 O O   . TYR B 1 127 ? -32.830 93.467  14.948  1.00 25.69  ? 124 TYR B O   1 
ATOM   5142 C CB  . TYR B 1 127 ? -30.565 91.600  15.399  1.00 22.93  ? 124 TYR B CB  1 
ATOM   5143 C CG  . TYR B 1 127 ? -31.221 90.443  14.671  1.00 22.43  ? 124 TYR B CG  1 
ATOM   5144 C CD1 . TYR B 1 127 ? -31.960 90.653  13.511  1.00 23.11  ? 124 TYR B CD1 1 
ATOM   5145 C CD2 . TYR B 1 127 ? -31.089 89.141  15.135  1.00 23.07  ? 124 TYR B CD2 1 
ATOM   5146 C CE1 . TYR B 1 127 ? -32.561 89.603  12.846  1.00 24.62  ? 124 TYR B CE1 1 
ATOM   5147 C CE2 . TYR B 1 127 ? -31.687 88.083  14.473  1.00 24.51  ? 124 TYR B CE2 1 
ATOM   5148 C CZ  . TYR B 1 127 ? -32.420 88.321  13.328  1.00 20.02  ? 124 TYR B CZ  1 
ATOM   5149 O OH  . TYR B 1 127 ? -33.017 87.275  12.664  1.00 23.91  ? 124 TYR B OH  1 
ATOM   5150 N N   . SER B 1 128 ? -33.883 92.010  16.299  1.00 20.87  ? 125 SER B N   1 
ATOM   5151 C CA  . SER B 1 128 ? -35.195 92.240  15.712  1.00 19.11  ? 125 SER B CA  1 
ATOM   5152 C C   . SER B 1 128 ? -36.262 91.940  16.756  1.00 21.44  ? 125 SER B C   1 
ATOM   5153 O O   . SER B 1 128 ? -35.962 91.560  17.892  1.00 18.72  ? 125 SER B O   1 
ATOM   5154 C CB  . SER B 1 128 ? -35.393 91.385  14.457  1.00 23.70  ? 125 SER B CB  1 
ATOM   5155 O OG  . SER B 1 128 ? -35.364 90.004  14.774  1.00 22.74  ? 125 SER B OG  1 
ATOM   5156 N N   . GLY B 1 129 ? -37.520 92.111  16.358  1.00 19.29  ? 126 GLY B N   1 
ATOM   5157 C CA  . GLY B 1 129 ? -38.638 91.826  17.235  1.00 21.90  ? 126 GLY B CA  1 
ATOM   5158 C C   . GLY B 1 129 ? -39.476 93.047  17.555  1.00 24.91  ? 126 GLY B C   1 
ATOM   5159 O O   . GLY B 1 129 ? -39.009 94.183  17.423  1.00 17.75  ? 126 GLY B O   1 
ATOM   5160 N N   . ALA B 1 130 ? -40.716 92.821  17.981  1.00 20.42  ? 127 ALA B N   1 
ATOM   5161 C CA  . ALA B 1 130 ? -41.640 93.894  18.320  1.00 26.06  ? 127 ALA B CA  1 
ATOM   5162 C C   . ALA B 1 130 ? -42.800 93.304  19.106  1.00 19.12  ? 127 ALA B C   1 
ATOM   5163 O O   . ALA B 1 130 ? -43.204 92.162  18.871  1.00 18.27  ? 127 ALA B O   1 
ATOM   5164 C CB  . ALA B 1 130 ? -42.159 94.614  17.068  1.00 20.15  ? 127 ALA B CB  1 
ATOM   5165 N N   . SER B 1 131 ? -43.330 94.094  20.039  1.00 22.60  ? 128 SER B N   1 
ATOM   5166 C CA  . SER B 1 131 ? -44.477 93.672  20.832  1.00 20.81  ? 128 SER B CA  1 
ATOM   5167 C C   . SER B 1 131 ? -45.796 93.800  20.081  1.00 24.51  ? 128 SER B C   1 
ATOM   5168 O O   . SER B 1 131 ? -46.838 93.411  20.622  1.00 29.45  ? 128 SER B O   1 
ATOM   5169 C CB  . SER B 1 131 ? -44.545 94.479  22.133  1.00 24.75  ? 128 SER B CB  1 
ATOM   5170 O OG  . SER B 1 131 ? -44.638 95.868  21.870  1.00 26.84  ? 128 SER B OG  1 
ATOM   5171 N N   . SER B 1 132 ? -45.779 94.324  18.858  1.00 20.72  ? 129 SER B N   1 
ATOM   5172 C CA  . SER B 1 132 ? -46.986 94.528  18.071  1.00 25.29  ? 129 SER B CA  1 
ATOM   5173 C C   . SER B 1 132 ? -47.309 93.357  17.153  1.00 23.94  ? 129 SER B C   1 
ATOM   5174 O O   . SER B 1 132 ? -48.326 93.404  16.453  1.00 24.90  ? 129 SER B O   1 
ATOM   5175 C CB  . SER B 1 132 ? -46.858 95.807  17.238  1.00 25.16  ? 129 SER B CB  1 
ATOM   5176 O OG  . SER B 1 132 ? -45.708 95.765  16.411  1.00 24.82  ? 129 SER B OG  1 
ATOM   5177 N N   . LEU B 1 133 ? -46.476 92.319  17.135  1.00 19.63  ? 130 LEU B N   1 
ATOM   5178 C CA  . LEU B 1 133 ? -46.708 91.189  16.246  1.00 25.80  ? 130 LEU B CA  1 
ATOM   5179 C C   . LEU B 1 133 ? -48.013 90.484  16.601  1.00 25.09  ? 130 LEU B C   1 
ATOM   5180 O O   . LEU B 1 133 ? -48.404 90.402  17.769  1.00 28.49  ? 130 LEU B O   1 
ATOM   5181 C CB  . LEU B 1 133 ? -45.538 90.206  16.318  1.00 20.01  ? 130 LEU B CB  1 
ATOM   5182 C CG  . LEU B 1 133 ? -44.160 90.771  15.966  1.00 25.76  ? 130 LEU B CG  1 
ATOM   5183 C CD1 . LEU B 1 133 ? -43.100 89.680  16.015  1.00 17.94  ? 130 LEU B CD1 1 
ATOM   5184 C CD2 . LEU B 1 133 ? -44.182 91.439  14.600  1.00 24.54  ? 130 LEU B CD2 1 
ATOM   5185 N N   . ASP B 1 134 ? -48.690 89.973  15.568  1.00 20.52  ? 131 ASP B N   1 
ATOM   5186 C CA  . ASP B 1 134 ? -49.986 89.329  15.767  1.00 26.28  ? 131 ASP B CA  1 
ATOM   5187 C C   . ASP B 1 134 ? -49.884 88.117  16.683  1.00 33.24  ? 131 ASP B C   1 
ATOM   5188 O O   . ASP B 1 134 ? -50.829 87.818  17.423  1.00 29.29  ? 131 ASP B O   1 
ATOM   5189 C CB  . ASP B 1 134 ? -50.581 88.919  14.420  1.00 22.53  ? 131 ASP B CB  1 
ATOM   5190 C CG  . ASP B 1 134 ? -50.885 90.107  13.530  1.00 26.07  ? 131 ASP B CG  1 
ATOM   5191 O OD1 . ASP B 1 134 ? -50.740 91.256  13.998  1.00 27.57  ? 131 ASP B OD1 1 
ATOM   5192 O OD2 . ASP B 1 134 ? -51.267 89.891  12.360  1.00 29.09  ? 131 ASP B OD2 1 
ATOM   5193 N N   . VAL B 1 135 ? -48.752 87.409  16.651  1.00 30.50  ? 132 VAL B N   1 
ATOM   5194 C CA  . VAL B 1 135 ? -48.586 86.216  17.473  1.00 31.41  ? 132 VAL B CA  1 
ATOM   5195 C C   . VAL B 1 135 ? -48.426 86.542  18.951  1.00 30.21  ? 132 VAL B C   1 
ATOM   5196 O O   . VAL B 1 135 ? -48.531 85.641  19.791  1.00 24.25  ? 132 VAL B O   1 
ATOM   5197 C CB  . VAL B 1 135 ? -47.389 85.395  16.946  1.00 25.93  ? 132 VAL B CB  1 
ATOM   5198 C CG1 . VAL B 1 135 ? -46.072 86.057  17.319  1.00 26.16  ? 132 VAL B CG1 1 
ATOM   5199 C CG2 . VAL B 1 135 ? -47.450 83.953  17.439  1.00 27.24  ? 132 VAL B CG2 1 
ATOM   5200 N N   . TYR B 1 136 ? -48.193 87.810  19.296  1.00 25.91  ? 133 TYR B N   1 
ATOM   5201 C CA  . TYR B 1 136 ? -48.092 88.241  20.684  1.00 25.06  ? 133 TYR B CA  1 
ATOM   5202 C C   . TYR B 1 136 ? -49.380 88.888  21.188  1.00 28.10  ? 133 TYR B C   1 
ATOM   5203 O O   . TYR B 1 136 ? -49.361 89.567  22.221  1.00 32.19  ? 133 TYR B O   1 
ATOM   5204 C CB  . TYR B 1 136 ? -46.922 89.211  20.858  1.00 18.89  ? 133 TYR B CB  1 
ATOM   5205 C CG  . TYR B 1 136 ? -45.579 88.666  20.420  1.00 32.63  ? 133 TYR B CG  1 
ATOM   5206 C CD1 . TYR B 1 136 ? -45.291 87.310  20.508  1.00 27.98  ? 133 TYR B CD1 1 
ATOM   5207 C CD2 . TYR B 1 136 ? -44.599 89.512  19.919  1.00 23.62  ? 133 TYR B CD2 1 
ATOM   5208 C CE1 . TYR B 1 136 ? -44.064 86.813  20.106  1.00 22.52  ? 133 TYR B CE1 1 
ATOM   5209 C CE2 . TYR B 1 136 ? -43.371 89.025  19.517  1.00 30.34  ? 133 TYR B CE2 1 
ATOM   5210 C CZ  . TYR B 1 136 ? -43.108 87.676  19.611  1.00 24.98  ? 133 TYR B CZ  1 
ATOM   5211 O OH  . TYR B 1 136 ? -41.886 87.189  19.210  1.00 20.03  ? 133 TYR B OH  1 
ATOM   5212 N N   . ASP B 1 137 ? -50.491 88.699  20.479  1.00 29.73  ? 134 ASP B N   1 
ATOM   5213 C CA  . ASP B 1 137 ? -51.759 89.302  20.873  1.00 31.89  ? 134 ASP B CA  1 
ATOM   5214 C C   . ASP B 1 137 ? -52.223 88.710  22.199  1.00 30.63  ? 134 ASP B C   1 
ATOM   5215 O O   . ASP B 1 137 ? -52.497 87.509  22.289  1.00 34.17  ? 134 ASP B O   1 
ATOM   5216 C CB  . ASP B 1 137 ? -52.807 89.079  19.784  1.00 31.41  ? 134 ASP B CB  1 
ATOM   5217 C CG  . ASP B 1 137 ? -54.061 89.907  19.998  1.00 38.14  ? 134 ASP B CG  1 
ATOM   5218 O OD1 . ASP B 1 137 ? -54.113 90.677  20.980  1.00 40.36  ? 134 ASP B OD1 1 
ATOM   5219 O OD2 . ASP B 1 137 ? -54.995 89.790  19.178  1.00 39.86  ? 134 ASP B OD2 1 
ATOM   5220 N N   . GLY B 1 138 ? -52.318 89.553  23.224  1.00 34.47  ? 135 GLY B N   1 
ATOM   5221 C CA  . GLY B 1 138 ? -52.615 89.078  24.560  1.00 38.66  ? 135 GLY B CA  1 
ATOM   5222 C C   . GLY B 1 138 ? -54.076 89.134  24.956  1.00 39.76  ? 135 GLY B C   1 
ATOM   5223 O O   . GLY B 1 138 ? -54.401 89.063  26.144  1.00 36.51  ? 135 GLY B O   1 
ATOM   5224 N N   . ARG B 1 139 ? -54.973 89.252  23.975  1.00 30.60  ? 136 ARG B N   1 
ATOM   5225 C CA  . ARG B 1 139 ? -56.391 89.358  24.302  1.00 37.02  ? 136 ARG B CA  1 
ATOM   5226 C C   . ARG B 1 139 ? -56.976 88.017  24.726  1.00 38.26  ? 136 ARG B C   1 
ATOM   5227 O O   . ARG B 1 139 ? -57.922 87.982  25.522  1.00 35.05  ? 136 ARG B O   1 
ATOM   5228 C CB  . ARG B 1 139 ? -57.168 89.928  23.116  1.00 28.32  ? 136 ARG B CB  1 
ATOM   5229 C CG  . ARG B 1 139 ? -57.277 88.988  21.928  1.00 30.19  ? 136 ARG B CG  1 
ATOM   5230 C CD  . ARG B 1 139 ? -58.043 89.630  20.784  1.00 29.16  ? 136 ARG B CD  1 
ATOM   5231 N NE  . ARG B 1 139 ? -57.336 90.786  20.243  1.00 32.78  ? 136 ARG B NE  1 
ATOM   5232 C CZ  . ARG B 1 139 ? -57.818 91.578  19.291  1.00 36.14  ? 136 ARG B CZ  1 
ATOM   5233 N NH1 . ARG B 1 139 ? -59.016 91.344  18.772  1.00 32.09  ? 136 ARG B NH1 1 
ATOM   5234 N NH2 . ARG B 1 139 ? -57.103 92.608  18.859  1.00 37.65  ? 136 ARG B NH2 1 
ATOM   5235 N N   . PHE B 1 140 ? -56.430 86.910  24.221  1.00 36.17  ? 137 PHE B N   1 
ATOM   5236 C CA  . PHE B 1 140 ? -56.978 85.600  24.552  1.00 31.93  ? 137 PHE B CA  1 
ATOM   5237 C C   . PHE B 1 140 ? -56.452 85.094  25.889  1.00 38.64  ? 137 PHE B C   1 
ATOM   5238 O O   . PHE B 1 140 ? -57.192 84.459  26.649  1.00 30.78  ? 137 PHE B O   1 
ATOM   5239 C CB  . PHE B 1 140 ? -56.661 84.604  23.438  1.00 36.00  ? 137 PHE B CB  1 
ATOM   5240 C CG  . PHE B 1 140 ? -57.129 85.047  22.081  1.00 36.91  ? 137 PHE B CG  1 
ATOM   5241 C CD1 . PHE B 1 140 ? -56.250 85.638  21.189  1.00 34.80  ? 137 PHE B CD1 1 
ATOM   5242 C CD2 . PHE B 1 140 ? -58.450 84.879  21.700  1.00 31.85  ? 137 PHE B CD2 1 
ATOM   5243 C CE1 . PHE B 1 140 ? -56.677 86.048  19.940  1.00 32.45  ? 137 PHE B CE1 1 
ATOM   5244 C CE2 . PHE B 1 140 ? -58.884 85.287  20.452  1.00 36.64  ? 137 PHE B CE2 1 
ATOM   5245 C CZ  . PHE B 1 140 ? -57.996 85.873  19.572  1.00 26.88  ? 137 PHE B CZ  1 
ATOM   5246 N N   . LEU B 1 141 ? -55.180 85.363  26.192  1.00 38.82  ? 138 LEU B N   1 
ATOM   5247 C CA  . LEU B 1 141 ? -54.624 84.955  27.477  1.00 36.20  ? 138 LEU B CA  1 
ATOM   5248 C C   . LEU B 1 141 ? -55.251 85.738  28.623  1.00 40.46  ? 138 LEU B C   1 
ATOM   5249 O O   . LEU B 1 141 ? -55.454 85.198  29.717  1.00 46.26  ? 138 LEU B O   1 
ATOM   5250 C CB  . LEU B 1 141 ? -53.106 85.135  27.469  1.00 28.91  ? 138 LEU B CB  1 
ATOM   5251 C CG  . LEU B 1 141 ? -52.349 84.787  28.751  1.00 43.58  ? 138 LEU B CG  1 
ATOM   5252 C CD1 . LEU B 1 141 ? -52.519 83.316  29.093  1.00 38.72  ? 138 LEU B CD1 1 
ATOM   5253 C CD2 . LEU B 1 141 ? -50.877 85.144  28.612  1.00 38.48  ? 138 LEU B CD2 1 
ATOM   5254 N N   . VAL B 1 142 ? -55.571 87.011  28.389  1.00 39.09  ? 139 VAL B N   1 
ATOM   5255 C CA  . VAL B 1 142 ? -56.156 87.841  29.435  1.00 37.61  ? 139 VAL B CA  1 
ATOM   5256 C C   . VAL B 1 142 ? -57.629 87.502  29.640  1.00 35.33  ? 139 VAL B C   1 
ATOM   5257 O O   . VAL B 1 142 ? -58.119 87.480  30.773  1.00 34.67  ? 139 VAL B O   1 
ATOM   5258 C CB  . VAL B 1 142 ? -55.947 89.328  29.099  1.00 35.05  ? 139 VAL B CB  1 
ATOM   5259 C CG1 . VAL B 1 142 ? -56.858 90.208  29.939  1.00 34.95  ? 139 VAL B CG1 1 
ATOM   5260 C CG2 . VAL B 1 142 ? -54.495 89.710  29.320  1.00 27.23  ? 139 VAL B CG2 1 
ATOM   5261 N N   . GLN B 1 143 ? -58.356 87.224  28.557  1.00 35.94  ? 140 GLN B N   1 
ATOM   5262 C CA  . GLN B 1 143 ? -59.771 86.896  28.697  1.00 37.65  ? 140 GLN B CA  1 
ATOM   5263 C C   . GLN B 1 143 ? -59.963 85.537  29.360  1.00 40.97  ? 140 GLN B C   1 
ATOM   5264 O O   . GLN B 1 143 ? -60.813 85.387  30.245  1.00 52.85  ? 140 GLN B O   1 
ATOM   5265 C CB  . GLN B 1 143 ? -60.458 86.931  27.330  1.00 35.00  ? 140 GLN B CB  1 
ATOM   5266 C CG  . GLN B 1 143 ? -61.985 86.961  27.384  1.00 38.64  ? 140 GLN B CG  1 
ATOM   5267 C CD  . GLN B 1 143 ? -62.598 85.606  27.692  1.00 46.26  ? 140 GLN B CD  1 
ATOM   5268 O OE1 . GLN B 1 143 ? -62.058 84.566  27.314  1.00 50.05  ? 140 GLN B OE1 1 
ATOM   5269 N NE2 . GLN B 1 143 ? -63.726 85.613  28.392  1.00 51.01  ? 140 GLN B NE2 1 
ATOM   5270 N N   . ALA B 1 144 ? -59.179 84.537  28.951  1.00 38.99  ? 141 ALA B N   1 
ATOM   5271 C CA  . ALA B 1 144 ? -59.408 83.178  29.432  1.00 43.53  ? 141 ALA B CA  1 
ATOM   5272 C C   . ALA B 1 144 ? -58.963 82.996  30.878  1.00 38.26  ? 141 ALA B C   1 
ATOM   5273 O O   . ALA B 1 144 ? -59.592 82.237  31.624  1.00 39.30  ? 141 ALA B O   1 
ATOM   5274 C CB  . ALA B 1 144 ? -58.689 82.176  28.530  1.00 34.90  ? 141 ALA B CB  1 
ATOM   5275 N N   . GLU B 1 145 ? -57.895 83.673  31.293  1.00 34.65  ? 142 GLU B N   1 
ATOM   5276 C CA  . GLU B 1 145 ? -57.308 83.462  32.608  1.00 35.30  ? 142 GLU B CA  1 
ATOM   5277 C C   . GLU B 1 145 ? -57.423 84.669  33.528  1.00 40.27  ? 142 GLU B C   1 
ATOM   5278 O O   . GLU B 1 145 ? -57.043 84.570  34.700  1.00 40.63  ? 142 GLU B O   1 
ATOM   5279 C CB  . GLU B 1 145 ? -55.839 83.053  32.465  1.00 35.36  ? 142 GLU B CB  1 
ATOM   5280 C CG  . GLU B 1 145 ? -55.648 81.728  31.736  1.00 40.54  ? 142 GLU B CG  1 
ATOM   5281 C CD  . GLU B 1 145 ? -56.259 80.558  32.486  1.00 42.19  ? 142 GLU B CD  1 
ATOM   5282 O OE1 . GLU B 1 145 ? -56.207 80.557  33.734  1.00 43.06  ? 142 GLU B OE1 1 
ATOM   5283 O OE2 . GLU B 1 145 ? -56.799 79.642  31.829  1.00 39.23  ? 142 GLU B OE2 1 
ATOM   5284 N N   . ARG B 1 146 ? -57.931 85.798  33.029  1.00 47.84  ? 143 ARG B N   1 
ATOM   5285 C CA  . ARG B 1 146 ? -58.202 86.986  33.841  1.00 44.64  ? 143 ARG B CA  1 
ATOM   5286 C C   . ARG B 1 146 ? -56.953 87.459  34.584  1.00 37.17  ? 143 ARG B C   1 
ATOM   5287 O O   . ARG B 1 146 ? -56.976 87.712  35.790  1.00 47.10  ? 143 ARG B O   1 
ATOM   5288 C CB  . ARG B 1 146 ? -59.359 86.735  34.811  1.00 42.58  ? 143 ARG B CB  1 
ATOM   5289 C CG  . ARG B 1 146 ? -60.654 86.336  34.123  1.00 51.32  ? 143 ARG B CG  1 
ATOM   5290 C CD  . ARG B 1 146 ? -61.860 86.649  34.990  1.00 59.62  ? 143 ARG B CD  1 
ATOM   5291 N NE  . ARG B 1 146 ? -61.967 88.078  35.272  1.00 48.96  ? 143 ARG B NE  1 
ATOM   5292 C CZ  . ARG B 1 146 ? -62.546 88.959  34.462  1.00 60.45  ? 143 ARG B CZ  1 
ATOM   5293 N NH1 . ARG B 1 146 ? -63.071 88.560  33.311  1.00 53.14  ? 143 ARG B NH1 1 
ATOM   5294 N NH2 . ARG B 1 146 ? -62.599 90.240  34.802  1.00 51.67  ? 143 ARG B NH2 1 
ATOM   5295 N N   . THR B 1 147 ? -55.853 87.573  33.848  1.00 35.84  ? 144 THR B N   1 
ATOM   5296 C CA  . THR B 1 147 ? -54.617 88.142  34.362  1.00 43.27  ? 144 THR B CA  1 
ATOM   5297 C C   . THR B 1 147 ? -54.297 89.420  33.597  1.00 35.29  ? 144 THR B C   1 
ATOM   5298 O O   . THR B 1 147 ? -54.912 89.734  32.576  1.00 41.84  ? 144 THR B O   1 
ATOM   5299 C CB  . THR B 1 147 ? -53.451 87.150  34.249  1.00 43.24  ? 144 THR B CB  1 
ATOM   5300 O OG1 . THR B 1 147 ? -53.096 86.979  32.871  1.00 42.48  ? 144 THR B OG1 1 
ATOM   5301 C CG2 . THR B 1 147 ? -53.837 85.800  34.837  1.00 41.84  ? 144 THR B CG2 1 
ATOM   5302 N N   . VAL B 1 148 ? -53.321 90.165  34.107  1.00 30.47  ? 145 VAL B N   1 
ATOM   5303 C CA  . VAL B 1 148 ? -52.847 91.387  33.467  1.00 37.73  ? 145 VAL B CA  1 
ATOM   5304 C C   . VAL B 1 148 ? -51.579 91.061  32.695  1.00 41.11  ? 145 VAL B C   1 
ATOM   5305 O O   . VAL B 1 148 ? -50.619 90.522  33.261  1.00 43.34  ? 145 VAL B O   1 
ATOM   5306 C CB  . VAL B 1 148 ? -52.596 92.500  34.498  1.00 31.29  ? 145 VAL B CB  1 
ATOM   5307 C CG1 . VAL B 1 148 ? -51.968 93.713  33.825  1.00 40.77  ? 145 VAL B CG1 1 
ATOM   5308 C CG2 . VAL B 1 148 ? -53.894 92.884  35.188  1.00 34.31  ? 145 VAL B CG2 1 
ATOM   5309 N N   . LEU B 1 149 ? -51.572 91.377  31.403  1.00 38.31  ? 146 LEU B N   1 
ATOM   5310 C CA  . LEU B 1 149 ? -50.435 91.108  30.534  1.00 29.98  ? 146 LEU B CA  1 
ATOM   5311 C C   . LEU B 1 149 ? -49.810 92.421  30.087  1.00 29.36  ? 146 LEU B C   1 
ATOM   5312 O O   . LEU B 1 149 ? -50.513 93.323  29.619  1.00 29.33  ? 146 LEU B O   1 
ATOM   5313 C CB  . LEU B 1 149 ? -50.855 90.278  29.319  1.00 31.53  ? 146 LEU B CB  1 
ATOM   5314 C CG  . LEU B 1 149 ? -49.745 89.933  28.323  1.00 36.27  ? 146 LEU B CG  1 
ATOM   5315 C CD1 . LEU B 1 149 ? -48.570 89.274  29.024  1.00 30.71  ? 146 LEU B CD1 1 
ATOM   5316 C CD2 . LEU B 1 149 ? -50.276 89.030  27.227  1.00 39.21  ? 146 LEU B CD2 1 
ATOM   5317 N N   . VAL B 1 150 ? -48.492 92.524  30.237  1.00 28.62  ? 147 VAL B N   1 
ATOM   5318 C CA  . VAL B 1 150 ? -47.728 93.696  29.832  1.00 29.77  ? 147 VAL B CA  1 
ATOM   5319 C C   . VAL B 1 150 ? -46.636 93.247  28.872  1.00 35.38  ? 147 VAL B C   1 
ATOM   5320 O O   . VAL B 1 150 ? -46.017 92.196  29.071  1.00 33.48  ? 147 VAL B O   1 
ATOM   5321 C CB  . VAL B 1 150 ? -47.119 94.429  31.048  1.00 27.48  ? 147 VAL B CB  1 
ATOM   5322 C CG1 . VAL B 1 150 ? -46.453 95.727  30.615  1.00 23.29  ? 147 VAL B CG1 1 
ATOM   5323 C CG2 . VAL B 1 150 ? -48.185 94.694  32.102  1.00 27.04  ? 147 VAL B CG2 1 
ATOM   5324 N N   . SER B 1 151 ? -46.410 94.034  27.824  1.00 26.74  ? 148 SER B N   1 
ATOM   5325 C CA  . SER B 1 151 ? -45.331 93.776  26.883  1.00 31.70  ? 148 SER B CA  1 
ATOM   5326 C C   . SER B 1 151 ? -44.757 95.104  26.422  1.00 27.75  ? 148 SER B C   1 
ATOM   5327 O O   . SER B 1 151 ? -45.502 96.055  26.170  1.00 30.91  ? 148 SER B O   1 
ATOM   5328 C CB  . SER B 1 151 ? -45.810 92.960  25.676  1.00 28.61  ? 148 SER B CB  1 
ATOM   5329 O OG  . SER B 1 151 ? -46.720 93.701  24.883  1.00 29.39  ? 148 SER B OG  1 
ATOM   5330 N N   . MET B 1 152 ? -43.433 95.166  26.318  1.00 25.46  ? 149 MET B N   1 
ATOM   5331 C CA  . MET B 1 152 ? -42.743 96.398  25.975  1.00 26.23  ? 149 MET B CA  1 
ATOM   5332 C C   . MET B 1 152 ? -41.866 96.196  24.748  1.00 37.39  ? 149 MET B C   1 
ATOM   5333 O O   . MET B 1 152 ? -41.528 95.070  24.371  1.00 26.26  ? 149 MET B O   1 
ATOM   5334 C CB  . MET B 1 152 ? -41.880 96.899  27.142  1.00 23.64  ? 149 MET B CB  1 
ATOM   5335 C CG  . MET B 1 152 ? -40.479 96.300  27.184  1.00 27.54  ? 149 MET B CG  1 
ATOM   5336 S SD  . MET B 1 152 ? -40.459 94.526  27.511  1.00 30.35  ? 149 MET B SD  1 
ATOM   5337 C CE  . MET B 1 152 ? -40.975 94.496  29.225  1.00 27.93  ? 149 MET B CE  1 
ATOM   5338 N N   . ASN B 1 153 ? -41.509 97.313  24.123  1.00 32.83  ? 150 ASN B N   1 
ATOM   5339 C CA  . ASN B 1 153 ? -40.495 97.346  23.082  1.00 25.51  ? 150 ASN B CA  1 
ATOM   5340 C C   . ASN B 1 153 ? -39.160 97.738  23.699  1.00 27.61  ? 150 ASN B C   1 
ATOM   5341 O O   . ASN B 1 153 ? -39.108 98.562  24.617  1.00 27.31  ? 150 ASN B O   1 
ATOM   5342 C CB  . ASN B 1 153 ? -40.865 98.335  21.975  1.00 18.57  ? 150 ASN B CB  1 
ATOM   5343 C CG  . ASN B 1 153 ? -41.843 97.755  20.975  1.00 24.61  ? 150 ASN B CG  1 
ATOM   5344 O OD1 . ASN B 1 153 ? -42.440 96.705  21.208  1.00 31.02  ? 150 ASN B OD1 1 
ATOM   5345 N ND2 . ASN B 1 153 ? -42.012 98.441  19.850  1.00 27.07  ? 150 ASN B ND2 1 
ATOM   5346 N N   . TYR B 1 154 ? -38.085 97.139  23.198  1.00 19.55  ? 151 TYR B N   1 
ATOM   5347 C CA  . TYR B 1 154 ? -36.743 97.494  23.629  1.00 22.87  ? 151 TYR B CA  1 
ATOM   5348 C C   . TYR B 1 154 ? -35.844 97.588  22.407  1.00 16.62  ? 151 TYR B C   1 
ATOM   5349 O O   . TYR B 1 154 ? -36.047 96.887  21.412  1.00 21.97  ? 151 TYR B O   1 
ATOM   5350 C CB  . TYR B 1 154 ? -36.177 96.486  24.644  1.00 22.35  ? 151 TYR B CB  1 
ATOM   5351 C CG  . TYR B 1 154 ? -36.093 95.060  24.146  1.00 21.65  ? 151 TYR B CG  1 
ATOM   5352 C CD1 . TYR B 1 154 ? -37.172 94.195  24.274  1.00 23.27  ? 151 TYR B CD1 1 
ATOM   5353 C CD2 . TYR B 1 154 ? -34.930 94.575  23.563  1.00 23.09  ? 151 TYR B CD2 1 
ATOM   5354 C CE1 . TYR B 1 154 ? -37.097 92.890  23.827  1.00 22.41  ? 151 TYR B CE1 1 
ATOM   5355 C CE2 . TYR B 1 154 ? -34.846 93.272  23.112  1.00 26.46  ? 151 TYR B CE2 1 
ATOM   5356 C CZ  . TYR B 1 154 ? -35.932 92.434  23.247  1.00 23.57  ? 151 TYR B CZ  1 
ATOM   5357 O OH  . TYR B 1 154 ? -35.850 91.135  22.798  1.00 18.80  ? 151 TYR B OH  1 
ATOM   5358 N N   . ARG B 1 155 ? -34.855 98.474  22.489  1.00 15.68  ? 152 ARG B N   1 
ATOM   5359 C CA  . ARG B 1 155 ? -33.956 98.701  21.366  1.00 21.02  ? 152 ARG B CA  1 
ATOM   5360 C C   . ARG B 1 155 ? -33.155 97.443  21.056  1.00 27.92  ? 152 ARG B C   1 
ATOM   5361 O O   . ARG B 1 155 ? -32.582 96.816  21.952  1.00 21.19  ? 152 ARG B O   1 
ATOM   5362 C CB  . ARG B 1 155 ? -33.019 99.868  21.672  1.00 20.96  ? 152 ARG B CB  1 
ATOM   5363 C CG  . ARG B 1 155 ? -33.685 101.232 21.601  1.00 23.86  ? 152 ARG B CG  1 
ATOM   5364 C CD  . ARG B 1 155 ? -32.758 102.324 22.105  1.00 18.21  ? 152 ARG B CD  1 
ATOM   5365 N NE  . ARG B 1 155 ? -32.645 102.314 23.560  1.00 22.23  ? 152 ARG B NE  1 
ATOM   5366 C CZ  . ARG B 1 155 ? -31.819 103.092 24.250  1.00 22.80  ? 152 ARG B CZ  1 
ATOM   5367 N NH1 . ARG B 1 155 ? -31.024 103.944 23.617  1.00 25.89  ? 152 ARG B NH1 1 
ATOM   5368 N NH2 . ARG B 1 155 ? -31.785 103.017 25.574  1.00 32.49  ? 152 ARG B NH2 1 
ATOM   5369 N N   . VAL B 1 156 ? -33.123 97.074  19.777  1.00 22.55  ? 153 VAL B N   1 
ATOM   5370 C CA  . VAL B 1 156 ? -32.406 95.898  19.311  1.00 14.37  ? 153 VAL B CA  1 
ATOM   5371 C C   . VAL B 1 156 ? -31.284 96.349  18.381  1.00 21.10  ? 153 VAL B C   1 
ATOM   5372 O O   . VAL B 1 156 ? -31.182 97.520  18.013  1.00 26.19  ? 153 VAL B O   1 
ATOM   5373 C CB  . VAL B 1 156 ? -33.332 94.891  18.602  1.00 22.77  ? 153 VAL B CB  1 
ATOM   5374 C CG1 . VAL B 1 156 ? -34.349 94.325  19.581  1.00 17.28  ? 153 VAL B CG1 1 
ATOM   5375 C CG2 . VAL B 1 156 ? -34.030 95.555  17.425  1.00 13.18  ? 153 VAL B CG2 1 
ATOM   5376 N N   . GLY B 1 157 ? -30.437 95.392  18.005  1.00 23.85  ? 154 GLY B N   1 
ATOM   5377 C CA  . GLY B 1 157 ? -29.342 95.689  17.104  1.00 15.31  ? 154 GLY B CA  1 
ATOM   5378 C C   . GLY B 1 157 ? -28.326 96.634  17.724  1.00 18.15  ? 154 GLY B C   1 
ATOM   5379 O O   . GLY B 1 157 ? -28.096 96.644  18.938  1.00 22.80  ? 154 GLY B O   1 
ATOM   5380 N N   . ALA B 1 158 ? -27.710 97.449  16.865  1.00 20.60  ? 155 ALA B N   1 
ATOM   5381 C CA  . ALA B 1 158 ? -26.705 98.397  17.333  1.00 21.96  ? 155 ALA B CA  1 
ATOM   5382 C C   . ALA B 1 158 ? -27.316 99.441  18.258  1.00 26.31  ? 155 ALA B C   1 
ATOM   5383 O O   . ALA B 1 158 ? -26.680 99.873  19.226  1.00 20.29  ? 155 ALA B O   1 
ATOM   5384 C CB  . ALA B 1 158 ? -26.024 99.070  16.141  1.00 16.19  ? 155 ALA B CB  1 
ATOM   5385 N N   . PHE B 1 159 ? -28.554 99.855  17.982  1.00 29.71  ? 156 PHE B N   1 
ATOM   5386 C CA  . PHE B 1 159 ? -29.196 100.875 18.803  1.00 23.73  ? 156 PHE B CA  1 
ATOM   5387 C C   . PHE B 1 159 ? -29.422 100.407 20.233  1.00 21.48  ? 156 PHE B C   1 
ATOM   5388 O O   . PHE B 1 159 ? -29.575 101.242 21.131  1.00 25.50  ? 156 PHE B O   1 
ATOM   5389 C CB  . PHE B 1 159 ? -30.525 101.293 18.174  1.00 18.09  ? 156 PHE B CB  1 
ATOM   5390 C CG  . PHE B 1 159 ? -30.422 101.632 16.716  1.00 23.62  ? 156 PHE B CG  1 
ATOM   5391 C CD1 . PHE B 1 159 ? -30.674 100.672 15.750  1.00 19.93  ? 156 PHE B CD1 1 
ATOM   5392 C CD2 . PHE B 1 159 ? -30.063 102.906 16.312  1.00 21.21  ? 156 PHE B CD2 1 
ATOM   5393 C CE1 . PHE B 1 159 ? -30.575 100.978 14.407  1.00 23.94  ? 156 PHE B CE1 1 
ATOM   5394 C CE2 . PHE B 1 159 ? -29.963 103.219 14.970  1.00 21.08  ? 156 PHE B CE2 1 
ATOM   5395 C CZ  . PHE B 1 159 ? -30.219 102.253 14.017  1.00 23.46  ? 156 PHE B CZ  1 
ATOM   5396 N N   . GLY B 1 160 ? -29.437 99.099  20.468  1.00 28.61  ? 157 GLY B N   1 
ATOM   5397 C CA  . GLY B 1 160 ? -29.679 98.589  21.800  1.00 24.58  ? 157 GLY B CA  1 
ATOM   5398 C C   . GLY B 1 160 ? -28.495 97.890  22.433  1.00 27.07  ? 157 GLY B C   1 
ATOM   5399 O O   . GLY B 1 160 ? -28.457 97.724  23.655  1.00 22.66  ? 157 GLY B O   1 
ATOM   5400 N N   . PHE B 1 161 ? -27.517 97.466  21.624  1.00 24.80  ? 158 PHE B N   1 
ATOM   5401 C CA  . PHE B 1 161 ? -26.440 96.648  22.166  1.00 24.65  ? 158 PHE B CA  1 
ATOM   5402 C C   . PHE B 1 161 ? -25.071 96.921  21.552  1.00 29.57  ? 158 PHE B C   1 
ATOM   5403 O O   . PHE B 1 161 ? -24.133 96.157  21.818  1.00 30.57  ? 158 PHE B O   1 
ATOM   5404 C CB  . PHE B 1 161 ? -26.789 95.161  22.019  1.00 16.40  ? 158 PHE B CB  1 
ATOM   5405 C CG  . PHE B 1 161 ? -28.041 94.768  22.748  1.00 19.23  ? 158 PHE B CG  1 
ATOM   5406 C CD1 . PHE B 1 161 ? -29.246 94.658  22.074  1.00 19.06  ? 158 PHE B CD1 1 
ATOM   5407 C CD2 . PHE B 1 161 ? -28.018 94.537  24.113  1.00 18.92  ? 158 PHE B CD2 1 
ATOM   5408 C CE1 . PHE B 1 161 ? -30.403 94.308  22.746  1.00 15.59  ? 158 PHE B CE1 1 
ATOM   5409 C CE2 . PHE B 1 161 ? -29.170 94.187  24.791  1.00 24.25  ? 158 PHE B CE2 1 
ATOM   5410 C CZ  . PHE B 1 161 ? -30.365 94.073  24.106  1.00 20.26  ? 158 PHE B CZ  1 
ATOM   5411 N N   . LEU B 1 162 ? -24.912 97.970  20.748  1.00 23.64  ? 159 LEU B N   1 
ATOM   5412 C CA  . LEU B 1 162 ? -23.572 98.393  20.363  1.00 24.51  ? 159 LEU B CA  1 
ATOM   5413 C C   . LEU B 1 162 ? -22.841 98.896  21.600  1.00 33.26  ? 159 LEU B C   1 
ATOM   5414 O O   . LEU B 1 162 ? -23.358 99.742  22.335  1.00 33.02  ? 159 LEU B O   1 
ATOM   5415 C CB  . LEU B 1 162 ? -23.626 99.481  19.292  1.00 25.82  ? 159 LEU B CB  1 
ATOM   5416 C CG  . LEU B 1 162 ? -22.286 100.056 18.825  1.00 24.52  ? 159 LEU B CG  1 
ATOM   5417 C CD1 . LEU B 1 162 ? -22.259 100.181 17.311  1.00 23.45  ? 159 LEU B CD1 1 
ATOM   5418 C CD2 . LEU B 1 162 ? -22.011 101.407 19.473  1.00 23.64  ? 159 LEU B CD2 1 
ATOM   5419 N N   . ALA B 1 163 ? -21.642 98.371  21.837  1.00 34.26  ? 160 ALA B N   1 
ATOM   5420 C CA  . ALA B 1 163 ? -20.937 98.624  23.086  1.00 33.80  ? 160 ALA B CA  1 
ATOM   5421 C C   . ALA B 1 163 ? -19.477 98.937  22.808  1.00 38.43  ? 160 ALA B C   1 
ATOM   5422 O O   . ALA B 1 163 ? -18.776 98.141  22.177  1.00 42.30  ? 160 ALA B O   1 
ATOM   5423 C CB  . ALA B 1 163 ? -21.052 97.425  24.032  1.00 36.12  ? 160 ALA B CB  1 
ATOM   5424 N N   . LEU B 1 164 ? -19.030 100.099 23.273  1.00 37.41  ? 161 LEU B N   1 
ATOM   5425 C CA  . LEU B 1 164 ? -17.613 100.389 23.424  1.00 39.96  ? 161 LEU B CA  1 
ATOM   5426 C C   . LEU B 1 164 ? -17.298 100.308 24.912  1.00 46.50  ? 161 LEU B C   1 
ATOM   5427 O O   . LEU B 1 164 ? -17.444 101.304 25.632  1.00 41.10  ? 161 LEU B O   1 
ATOM   5428 C CB  . LEU B 1 164 ? -17.258 101.763 22.853  1.00 44.31  ? 161 LEU B CB  1 
ATOM   5429 C CG  . LEU B 1 164 ? -17.306 101.903 21.330  1.00 38.10  ? 161 LEU B CG  1 
ATOM   5430 C CD1 . LEU B 1 164 ? -16.929 103.313 20.908  1.00 42.38  ? 161 LEU B CD1 1 
ATOM   5431 C CD2 . LEU B 1 164 ? -16.391 100.883 20.669  1.00 35.12  ? 161 LEU B CD2 1 
ATOM   5432 N N   . PRO B 1 165 ? -16.887 99.139  25.406  1.00 42.90  ? 162 PRO B N   1 
ATOM   5433 C CA  . PRO B 1 165 ? -16.778 98.943  26.858  1.00 44.98  ? 162 PRO B CA  1 
ATOM   5434 C C   . PRO B 1 165 ? -15.820 99.935  27.502  1.00 40.60  ? 162 PRO B C   1 
ATOM   5435 O O   . PRO B 1 165 ? -14.792 100.301 26.929  1.00 40.36  ? 162 PRO B O   1 
ATOM   5436 C CB  . PRO B 1 165 ? -16.266 97.504  26.981  1.00 42.19  ? 162 PRO B CB  1 
ATOM   5437 C CG  . PRO B 1 165 ? -16.682 96.845  25.706  1.00 45.66  ? 162 PRO B CG  1 
ATOM   5438 C CD  . PRO B 1 165 ? -16.579 97.911  24.656  1.00 41.55  ? 162 PRO B CD  1 
ATOM   5439 N N   . GLY B 1 166 ? -16.176 100.372 28.709  1.00 56.76  ? 163 GLY B N   1 
ATOM   5440 C CA  . GLY B 1 166 ? -15.431 101.371 29.437  1.00 58.65  ? 163 GLY B CA  1 
ATOM   5441 C C   . GLY B 1 166 ? -15.825 102.798 29.116  1.00 63.03  ? 163 GLY B C   1 
ATOM   5442 O O   . GLY B 1 166 ? -15.756 103.664 29.994  1.00 71.29  ? 163 GLY B O   1 
ATOM   5443 N N   . SER B 1 167 ? -16.245 103.061 27.881  1.00 56.39  ? 164 SER B N   1 
ATOM   5444 C CA  . SER B 1 167 ? -16.629 104.406 27.483  1.00 65.51  ? 164 SER B CA  1 
ATOM   5445 C C   . SER B 1 167 ? -17.981 104.771 28.095  1.00 61.92  ? 164 SER B C   1 
ATOM   5446 O O   . SER B 1 167 ? -18.642 103.963 28.754  1.00 54.74  ? 164 SER B O   1 
ATOM   5447 C CB  . SER B 1 167 ? -16.675 104.519 25.961  1.00 54.20  ? 164 SER B CB  1 
ATOM   5448 O OG  . SER B 1 167 ? -17.770 103.795 25.428  1.00 58.16  ? 164 SER B OG  1 
ATOM   5449 N N   . ARG B 1 168 ? -18.400 106.016 27.861  1.00 54.71  ? 165 ARG B N   1 
ATOM   5450 C CA  . ARG B 1 168 ? -19.653 106.524 28.396  1.00 61.34  ? 165 ARG B CA  1 
ATOM   5451 C C   . ARG B 1 168 ? -20.656 106.944 27.333  1.00 51.33  ? 165 ARG B C   1 
ATOM   5452 O O   . ARG B 1 168 ? -21.838 107.099 27.658  1.00 40.84  ? 165 ARG B O   1 
ATOM   5453 C CB  . ARG B 1 168 ? -19.390 107.714 29.334  1.00 67.19  ? 165 ARG B CB  1 
ATOM   5454 C CG  . ARG B 1 168 ? -18.512 107.362 30.527  1.00 88.22  ? 165 ARG B CG  1 
ATOM   5455 C CD  . ARG B 1 168 ? -18.241 108.571 31.407  1.00 107.37 ? 165 ARG B CD  1 
ATOM   5456 N NE  . ARG B 1 168 ? -17.440 109.581 30.722  1.00 120.67 ? 165 ARG B NE  1 
ATOM   5457 C CZ  . ARG B 1 168 ? -16.111 109.626 30.750  1.00 119.09 ? 165 ARG B CZ  1 
ATOM   5458 N NH1 . ARG B 1 168 ? -15.428 108.714 31.429  1.00 118.81 ? 165 ARG B NH1 1 
ATOM   5459 N NH2 . ARG B 1 168 ? -15.465 110.583 30.098  1.00 100.74 ? 165 ARG B NH2 1 
ATOM   5460 N N   . GLU B 1 169 ? -20.230 107.130 26.082  1.00 47.34  ? 166 GLU B N   1 
ATOM   5461 C CA  . GLU B 1 169 ? -21.163 107.453 25.011  1.00 44.52  ? 166 GLU B CA  1 
ATOM   5462 C C   . GLU B 1 169 ? -21.878 106.223 24.471  1.00 46.74  ? 166 GLU B C   1 
ATOM   5463 O O   . GLU B 1 169 ? -22.946 106.359 23.863  1.00 43.17  ? 166 GLU B O   1 
ATOM   5464 C CB  . GLU B 1 169 ? -20.440 108.165 23.866  1.00 46.63  ? 166 GLU B CB  1 
ATOM   5465 C CG  . GLU B 1 169 ? -19.879 109.534 24.221  1.00 61.52  ? 166 GLU B CG  1 
ATOM   5466 C CD  . GLU B 1 169 ? -18.512 109.457 24.874  1.00 71.12  ? 166 GLU B CD  1 
ATOM   5467 O OE1 . GLU B 1 169 ? -17.965 108.340 24.986  1.00 67.47  ? 166 GLU B OE1 1 
ATOM   5468 O OE2 . GLU B 1 169 ? -17.983 110.516 25.273  1.00 64.43  ? 166 GLU B OE2 1 
ATOM   5469 N N   . ALA B 1 170 ? -21.316 105.034 24.675  1.00 39.92  ? 167 ALA B N   1 
ATOM   5470 C CA  . ALA B 1 170 ? -21.940 103.785 24.234  1.00 41.91  ? 167 ALA B CA  1 
ATOM   5471 C C   . ALA B 1 170 ? -21.556 102.679 25.203  1.00 39.62  ? 167 ALA B C   1 
ATOM   5472 O O   . ALA B 1 170 ? -20.712 101.825 24.903  1.00 41.25  ? 167 ALA B O   1 
ATOM   5473 C CB  . ALA B 1 170 ? -21.525 103.431 22.805  1.00 30.93  ? 167 ALA B CB  1 
ATOM   5474 N N   . PRO B 1 171 ? -22.166 102.660 26.393  1.00 40.94  ? 168 PRO B N   1 
ATOM   5475 C CA  . PRO B 1 171 ? -21.787 101.653 27.395  1.00 39.51  ? 168 PRO B CA  1 
ATOM   5476 C C   . PRO B 1 171 ? -22.295 100.255 27.092  1.00 43.78  ? 168 PRO B C   1 
ATOM   5477 O O   . PRO B 1 171 ? -21.745 99.288  27.636  1.00 47.92  ? 168 PRO B O   1 
ATOM   5478 C CB  . PRO B 1 171 ? -22.415 102.194 28.686  1.00 36.99  ? 168 PRO B CB  1 
ATOM   5479 C CG  . PRO B 1 171 ? -23.614 102.947 28.211  1.00 38.31  ? 168 PRO B CG  1 
ATOM   5480 C CD  . PRO B 1 171 ? -23.233 103.552 26.880  1.00 34.74  ? 168 PRO B CD  1 
ATOM   5481 N N   . GLY B 1 172 ? -23.321 100.114 26.259  1.00 43.54  ? 169 GLY B N   1 
ATOM   5482 C CA  . GLY B 1 172 ? -23.880 98.819  25.943  1.00 27.53  ? 169 GLY B CA  1 
ATOM   5483 C C   . GLY B 1 172 ? -24.986 98.408  26.898  1.00 30.99  ? 169 GLY B C   1 
ATOM   5484 O O   . GLY B 1 172 ? -25.222 99.023  27.942  1.00 31.12  ? 169 GLY B O   1 
ATOM   5485 N N   . ASN B 1 173 ? -25.684 97.339  26.513  1.00 30.63  ? 170 ASN B N   1 
ATOM   5486 C CA  . ASN B 1 173 ? -26.774 96.750  27.290  1.00 31.09  ? 170 ASN B CA  1 
ATOM   5487 C C   . ASN B 1 173 ? -27.929 97.722  27.517  1.00 31.50  ? 170 ASN B C   1 
ATOM   5488 O O   . ASN B 1 173 ? -28.754 97.505  28.410  1.00 35.01  ? 170 ASN B O   1 
ATOM   5489 C CB  . ASN B 1 173 ? -26.273 96.214  28.637  1.00 25.33  ? 170 ASN B CB  1 
ATOM   5490 C CG  . ASN B 1 173 ? -25.189 95.167  28.480  1.00 41.59  ? 170 ASN B CG  1 
ATOM   5491 O OD1 . ASN B 1 173 ? -25.183 94.405  27.516  1.00 30.77  ? 170 ASN B OD1 1 
ATOM   5492 N ND2 . ASN B 1 173 ? -24.262 95.127  29.431  1.00 37.85  ? 170 ASN B ND2 1 
ATOM   5493 N N   . VAL B 1 174 ? -28.013 98.795  26.724  1.00 33.80  ? 171 VAL B N   1 
ATOM   5494 C CA  . VAL B 1 174 ? -29.096 99.756  26.902  1.00 30.40  ? 171 VAL B CA  1 
ATOM   5495 C C   . VAL B 1 174 ? -30.442 99.157  26.518  1.00 24.84  ? 171 VAL B C   1 
ATOM   5496 O O   . VAL B 1 174 ? -31.480 99.608  27.013  1.00 28.51  ? 171 VAL B O   1 
ATOM   5497 C CB  . VAL B 1 174 ? -28.824 101.048 26.107  1.00 32.79  ? 171 VAL B CB  1 
ATOM   5498 C CG1 . VAL B 1 174 ? -27.551 101.718 26.603  1.00 30.26  ? 171 VAL B CG1 1 
ATOM   5499 C CG2 . VAL B 1 174 ? -28.733 100.757 24.618  1.00 28.80  ? 171 VAL B CG2 1 
ATOM   5500 N N   . GLY B 1 175 ? -30.452 98.144  25.648  1.00 21.31  ? 172 GLY B N   1 
ATOM   5501 C CA  . GLY B 1 175 ? -31.685 97.432  25.366  1.00 21.04  ? 172 GLY B CA  1 
ATOM   5502 C C   . GLY B 1 175 ? -32.206 96.668  26.566  1.00 30.10  ? 172 GLY B C   1 
ATOM   5503 O O   . GLY B 1 175 ? -33.421 96.572  26.765  1.00 27.00  ? 172 GLY B O   1 
ATOM   5504 N N   . LEU B 1 176 ? -31.303 96.111  27.378  1.00 25.06  ? 173 LEU B N   1 
ATOM   5505 C CA  . LEU B 1 176 ? -31.717 95.489  28.631  1.00 24.43  ? 173 LEU B CA  1 
ATOM   5506 C C   . LEU B 1 176 ? -32.221 96.525  29.625  1.00 23.23  ? 173 LEU B C   1 
ATOM   5507 O O   . LEU B 1 176 ? -33.135 96.240  30.406  1.00 23.06  ? 173 LEU B O   1 
ATOM   5508 C CB  . LEU B 1 176 ? -30.559 94.696  29.236  1.00 27.75  ? 173 LEU B CB  1 
ATOM   5509 C CG  . LEU B 1 176 ? -30.122 93.439  28.482  1.00 29.45  ? 173 LEU B CG  1 
ATOM   5510 C CD1 . LEU B 1 176 ? -28.801 92.915  29.024  1.00 23.16  ? 173 LEU B CD1 1 
ATOM   5511 C CD2 . LEU B 1 176 ? -31.199 92.371  28.572  1.00 23.05  ? 173 LEU B CD2 1 
ATOM   5512 N N   . LEU B 1 177 ? -31.636 97.726  29.617  1.00 23.01  ? 174 LEU B N   1 
ATOM   5513 C CA  . LEU B 1 177 ? -32.118 98.785  30.495  1.00 25.69  ? 174 LEU B CA  1 
ATOM   5514 C C   . LEU B 1 177 ? -33.482 99.300  30.052  1.00 32.25  ? 174 LEU B C   1 
ATOM   5515 O O   . LEU B 1 177 ? -34.263 99.773  30.886  1.00 29.48  ? 174 LEU B O   1 
ATOM   5516 C CB  . LEU B 1 177 ? -31.101 99.924  30.548  1.00 26.11  ? 174 LEU B CB  1 
ATOM   5517 C CG  . LEU B 1 177 ? -29.728 99.544  31.108  1.00 30.65  ? 174 LEU B CG  1 
ATOM   5518 C CD1 . LEU B 1 177 ? -28.798 100.747 31.141  1.00 23.17  ? 174 LEU B CD1 1 
ATOM   5519 C CD2 . LEU B 1 177 ? -29.867 98.930  32.493  1.00 29.90  ? 174 LEU B CD2 1 
ATOM   5520 N N   . ASP B 1 178 ? -33.785 99.220  28.753  1.00 29.84  ? 175 ASP B N   1 
ATOM   5521 C CA  . ASP B 1 178 ? -35.137 99.524  28.293  1.00 19.10  ? 175 ASP B CA  1 
ATOM   5522 C C   . ASP B 1 178 ? -36.149 98.581  28.929  1.00 22.99  ? 175 ASP B C   1 
ATOM   5523 O O   . ASP B 1 178 ? -37.239 99.005  29.331  1.00 30.23  ? 175 ASP B O   1 
ATOM   5524 C CB  . ASP B 1 178 ? -35.217 99.432  26.767  1.00 22.76  ? 175 ASP B CB  1 
ATOM   5525 C CG  . ASP B 1 178 ? -34.334 100.447 26.068  1.00 31.12  ? 175 ASP B CG  1 
ATOM   5526 O OD1 . ASP B 1 178 ? -33.922 101.432 26.715  1.00 23.40  ? 175 ASP B OD1 1 
ATOM   5527 O OD2 . ASP B 1 178 ? -34.060 100.263 24.863  1.00 22.62  ? 175 ASP B OD2 1 
ATOM   5528 N N   . GLN B 1 179 ? -35.804 97.295  29.026  1.00 27.77  ? 176 GLN B N   1 
ATOM   5529 C CA  . GLN B 1 179 ? -36.697 96.330  29.657  1.00 26.34  ? 176 GLN B CA  1 
ATOM   5530 C C   . GLN B 1 179 ? -36.800 96.575  31.157  1.00 25.64  ? 176 GLN B C   1 
ATOM   5531 O O   . GLN B 1 179 ? -37.887 96.468  31.736  1.00 22.51  ? 176 GLN B O   1 
ATOM   5532 C CB  . GLN B 1 179 ? -36.211 94.909  29.381  1.00 23.79  ? 176 GLN B CB  1 
ATOM   5533 C CG  . GLN B 1 179 ? -35.993 94.594  27.912  1.00 23.74  ? 176 GLN B CG  1 
ATOM   5534 C CD  . GLN B 1 179 ? -35.360 93.233  27.705  1.00 35.02  ? 176 GLN B CD  1 
ATOM   5535 O OE1 . GLN B 1 179 ? -35.114 92.500  28.664  1.00 24.61  ? 176 GLN B OE1 1 
ATOM   5536 N NE2 . GLN B 1 179 ? -35.091 92.887  26.451  1.00 23.15  ? 176 GLN B NE2 1 
ATOM   5537 N N   . ARG B 1 180 ? -35.675 96.899  31.802  1.00 23.79  ? 177 ARG B N   1 
ATOM   5538 C CA  . ARG B 1 180 ? -35.696 97.184  33.233  1.00 32.06  ? 177 ARG B CA  1 
ATOM   5539 C C   . ARG B 1 180 ? -36.558 98.402  33.540  1.00 26.70  ? 177 ARG B C   1 
ATOM   5540 O O   . ARG B 1 180 ? -37.325 98.401  34.510  1.00 31.37  ? 177 ARG B O   1 
ATOM   5541 C CB  . ARG B 1 180 ? -34.270 97.393  33.746  1.00 27.97  ? 177 ARG B CB  1 
ATOM   5542 C CG  . ARG B 1 180 ? -34.192 97.881  35.184  1.00 34.81  ? 177 ARG B CG  1 
ATOM   5543 C CD  . ARG B 1 180 ? -32.767 98.244  35.568  1.00 30.88  ? 177 ARG B CD  1 
ATOM   5544 N NE  . ARG B 1 180 ? -31.915 97.067  35.714  1.00 34.30  ? 177 ARG B NE  1 
ATOM   5545 C CZ  . ARG B 1 180 ? -30.603 97.118  35.918  1.00 32.52  ? 177 ARG B CZ  1 
ATOM   5546 N NH1 . ARG B 1 180 ? -29.988 98.290  35.995  1.00 33.73  ? 177 ARG B NH1 1 
ATOM   5547 N NH2 . ARG B 1 180 ? -29.904 95.998  36.045  1.00 34.20  ? 177 ARG B NH2 1 
ATOM   5548 N N   . LEU B 1 181 ? -36.445 99.452  32.722  1.00 32.54  ? 178 LEU B N   1 
ATOM   5549 C CA  . LEU B 1 181 ? -37.284 100.631 32.913  1.00 33.61  ? 178 LEU B CA  1 
ATOM   5550 C C   . LEU B 1 181 ? -38.758 100.284 32.753  1.00 27.95  ? 178 LEU B C   1 
ATOM   5551 O O   . LEU B 1 181 ? -39.610 100.809 33.480  1.00 32.16  ? 178 LEU B O   1 
ATOM   5552 C CB  . LEU B 1 181 ? -36.878 101.728 31.929  1.00 26.15  ? 178 LEU B CB  1 
ATOM   5553 C CG  . LEU B 1 181 ? -37.624 103.059 32.043  1.00 33.27  ? 178 LEU B CG  1 
ATOM   5554 C CD1 . LEU B 1 181 ? -37.490 103.630 33.446  1.00 27.60  ? 178 LEU B CD1 1 
ATOM   5555 C CD2 . LEU B 1 181 ? -37.104 104.045 31.013  1.00 20.77  ? 178 LEU B CD2 1 
ATOM   5556 N N   . ALA B 1 182 ? -39.077 99.395  31.809  1.00 24.14  ? 179 ALA B N   1 
ATOM   5557 C CA  . ALA B 1 182 ? -40.454 98.940  31.661  1.00 23.78  ? 179 ALA B CA  1 
ATOM   5558 C C   . ALA B 1 182 ? -40.916 98.151  32.879  1.00 33.43  ? 179 ALA B C   1 
ATOM   5559 O O   . ALA B 1 182 ? -42.100 98.198  33.231  1.00 31.44  ? 179 ALA B O   1 
ATOM   5560 C CB  . ALA B 1 182 ? -40.597 98.097  30.395  1.00 16.84  ? 179 ALA B CB  1 
ATOM   5561 N N   . LEU B 1 183 ? -40.006 97.423  33.530  1.00 34.33  ? 180 LEU B N   1 
ATOM   5562 C CA  . LEU B 1 183 ? -40.368 96.725  34.759  1.00 36.91  ? 180 LEU B CA  1 
ATOM   5563 C C   . LEU B 1 183 ? -40.573 97.706  35.905  1.00 31.50  ? 180 LEU B C   1 
ATOM   5564 O O   . LEU B 1 183 ? -41.467 97.517  36.739  1.00 27.30  ? 180 LEU B O   1 
ATOM   5565 C CB  . LEU B 1 183 ? -39.298 95.693  35.116  1.00 24.43  ? 180 LEU B CB  1 
ATOM   5566 C CG  . LEU B 1 183 ? -39.062 94.585  34.088  1.00 32.82  ? 180 LEU B CG  1 
ATOM   5567 C CD1 . LEU B 1 183 ? -38.127 93.521  34.644  1.00 30.35  ? 180 LEU B CD1 1 
ATOM   5568 C CD2 . LEU B 1 183 ? -40.381 93.973  33.643  1.00 27.80  ? 180 LEU B CD2 1 
ATOM   5569 N N   . GLN B 1 184 ? -39.754 98.759  35.965  1.00 23.82  ? 181 GLN B N   1 
ATOM   5570 C CA  . GLN B 1 184 ? -39.981 99.815  36.946  1.00 30.63  ? 181 GLN B CA  1 
ATOM   5571 C C   . GLN B 1 184 ? -41.302 100.527 36.695  1.00 40.44  ? 181 GLN B C   1 
ATOM   5572 O O   . GLN B 1 184 ? -41.970 100.950 37.646  1.00 40.92  ? 181 GLN B O   1 
ATOM   5573 C CB  . GLN B 1 184 ? -38.823 100.813 36.921  1.00 23.75  ? 181 GLN B CB  1 
ATOM   5574 C CG  . GLN B 1 184 ? -37.495 100.234 37.382  1.00 36.09  ? 181 GLN B CG  1 
ATOM   5575 C CD  . GLN B 1 184 ? -36.334 101.183 37.159  1.00 47.25  ? 181 GLN B CD  1 
ATOM   5576 O OE1 . GLN B 1 184 ? -36.410 102.093 36.332  1.00 49.36  ? 181 GLN B OE1 1 
ATOM   5577 N NE2 . GLN B 1 184 ? -35.250 100.976 37.898  1.00 32.97  ? 181 GLN B NE2 1 
ATOM   5578 N N   . TRP B 1 185 ? -41.696 100.665 35.427  1.00 35.06  ? 182 TRP B N   1 
ATOM   5579 C CA  . TRP B 1 185 ? -42.989 101.264 35.113  1.00 35.62  ? 182 TRP B CA  1 
ATOM   5580 C C   . TRP B 1 185 ? -44.133 100.383 35.598  1.00 33.83  ? 182 TRP B C   1 
ATOM   5581 O O   . TRP B 1 185 ? -45.168 100.891 36.046  1.00 35.21  ? 182 TRP B O   1 
ATOM   5582 C CB  . TRP B 1 185 ? -43.101 101.511 33.608  1.00 29.99  ? 182 TRP B CB  1 
ATOM   5583 C CG  . TRP B 1 185 ? -44.309 102.307 33.209  1.00 28.87  ? 182 TRP B CG  1 
ATOM   5584 C CD1 . TRP B 1 185 ? -44.368 103.655 32.997  1.00 27.85  ? 182 TRP B CD1 1 
ATOM   5585 C CD2 . TRP B 1 185 ? -45.632 101.807 32.972  1.00 22.42  ? 182 TRP B CD2 1 
ATOM   5586 N NE1 . TRP B 1 185 ? -45.644 104.024 32.644  1.00 30.68  ? 182 TRP B NE1 1 
ATOM   5587 C CE2 . TRP B 1 185 ? -46.438 102.908 32.621  1.00 26.11  ? 182 TRP B CE2 1 
ATOM   5588 C CE3 . TRP B 1 185 ? -46.211 100.535 33.021  1.00 24.87  ? 182 TRP B CE3 1 
ATOM   5589 C CZ2 . TRP B 1 185 ? -47.793 102.776 32.323  1.00 22.37  ? 182 TRP B CZ2 1 
ATOM   5590 C CZ3 . TRP B 1 185 ? -47.557 100.406 32.726  1.00 22.01  ? 182 TRP B CZ3 1 
ATOM   5591 C CH2 . TRP B 1 185 ? -48.332 101.520 32.381  1.00 26.05  ? 182 TRP B CH2 1 
ATOM   5592 N N   . VAL B 1 186 ? -43.967 99.062  35.512  1.00 32.19  ? 183 VAL B N   1 
ATOM   5593 C CA  . VAL B 1 186 ? -45.001 98.149  35.987  1.00 30.40  ? 183 VAL B CA  1 
ATOM   5594 C C   . VAL B 1 186 ? -45.158 98.261  37.499  1.00 36.69  ? 183 VAL B C   1 
ATOM   5595 O O   . VAL B 1 186 ? -46.277 98.246  38.023  1.00 34.52  ? 183 VAL B O   1 
ATOM   5596 C CB  . VAL B 1 186 ? -44.681 96.707  35.549  1.00 38.41  ? 183 VAL B CB  1 
ATOM   5597 C CG1 . VAL B 1 186 ? -45.615 95.717  36.228  1.00 24.75  ? 183 VAL B CG1 1 
ATOM   5598 C CG2 . VAL B 1 186 ? -44.784 96.581  34.037  1.00 23.98  ? 183 VAL B CG2 1 
ATOM   5599 N N   . GLN B 1 187 ? -44.044 98.393  38.224  1.00 28.77  ? 184 GLN B N   1 
ATOM   5600 C CA  . GLN B 1 187 ? -44.126 98.515  39.676  1.00 42.46  ? 184 GLN B CA  1 
ATOM   5601 C C   . GLN B 1 187 ? -44.845 99.790  40.098  1.00 41.16  ? 184 GLN B C   1 
ATOM   5602 O O   . GLN B 1 187 ? -45.476 99.822  41.161  1.00 41.21  ? 184 GLN B O   1 
ATOM   5603 C CB  . GLN B 1 187 ? -42.726 98.470  40.288  1.00 32.42  ? 184 GLN B CB  1 
ATOM   5604 C CG  . GLN B 1 187 ? -42.085 97.096  40.242  1.00 35.67  ? 184 GLN B CG  1 
ATOM   5605 C CD  . GLN B 1 187 ? -42.906 96.055  40.976  1.00 37.46  ? 184 GLN B CD  1 
ATOM   5606 O OE1 . GLN B 1 187 ? -43.385 96.294  42.085  1.00 42.83  ? 184 GLN B OE1 1 
ATOM   5607 N NE2 . GLN B 1 187 ? -43.082 94.895  40.355  1.00 46.83  ? 184 GLN B NE2 1 
ATOM   5608 N N   . GLU B 1 188 ? -44.773 100.841 39.283  1.00 36.79  ? 185 GLU B N   1 
ATOM   5609 C CA  . GLU B 1 188 ? -45.340 102.132 39.648  1.00 38.07  ? 185 GLU B CA  1 
ATOM   5610 C C   . GLU B 1 188 ? -46.735 102.374 39.087  1.00 35.76  ? 185 GLU B C   1 
ATOM   5611 O O   . GLU B 1 188 ? -47.429 103.269 39.581  1.00 47.30  ? 185 GLU B O   1 
ATOM   5612 C CB  . GLU B 1 188 ? -44.420 103.268 39.182  1.00 35.30  ? 185 GLU B CB  1 
ATOM   5613 C CG  . GLU B 1 188 ? -43.026 103.233 39.783  1.00 44.33  ? 185 GLU B CG  1 
ATOM   5614 C CD  . GLU B 1 188 ? -42.154 104.372 39.290  1.00 53.52  ? 185 GLU B CD  1 
ATOM   5615 O OE1 . GLU B 1 188 ? -40.965 104.422 39.671  1.00 53.08  ? 185 GLU B OE1 1 
ATOM   5616 O OE2 . GLU B 1 188 ? -42.657 105.217 38.520  1.00 52.87  ? 185 GLU B OE2 1 
ATOM   5617 N N   . ASN B 1 189 ? -47.167 101.611 38.081  1.00 29.36  ? 186 ASN B N   1 
ATOM   5618 C CA  . ASN B 1 189 ? -48.423 101.929 37.410  1.00 27.10  ? 186 ASN B CA  1 
ATOM   5619 C C   . ASN B 1 189 ? -49.343 100.747 37.144  1.00 26.19  ? 186 ASN B C   1 
ATOM   5620 O O   . ASN B 1 189 ? -50.499 100.983 36.777  1.00 34.56  ? 186 ASN B O   1 
ATOM   5621 C CB  . ASN B 1 189 ? -48.145 102.636 36.074  1.00 27.79  ? 186 ASN B CB  1 
ATOM   5622 C CG  . ASN B 1 189 ? -47.343 103.910 36.245  1.00 31.02  ? 186 ASN B CG  1 
ATOM   5623 O OD1 . ASN B 1 189 ? -47.883 104.952 36.617  1.00 42.55  ? 186 ASN B OD1 1 
ATOM   5624 N ND2 . ASN B 1 189 ? -46.047 103.834 35.969  1.00 33.53  ? 186 ASN B ND2 1 
ATOM   5625 N N   . VAL B 1 190 ? -48.899 99.498  37.308  1.00 24.84  ? 187 VAL B N   1 
ATOM   5626 C CA  . VAL B 1 190 ? -49.761 98.371  36.963  1.00 28.31  ? 187 VAL B CA  1 
ATOM   5627 C C   . VAL B 1 190 ? -50.954 98.262  37.904  1.00 33.54  ? 187 VAL B C   1 
ATOM   5628 O O   . VAL B 1 190 ? -51.951 97.616  37.560  1.00 31.84  ? 187 VAL B O   1 
ATOM   5629 C CB  . VAL B 1 190 ? -48.965 97.051  36.945  1.00 35.17  ? 187 VAL B CB  1 
ATOM   5630 C CG1 . VAL B 1 190 ? -48.889 96.441  38.340  1.00 31.15  ? 187 VAL B CG1 1 
ATOM   5631 C CG2 . VAL B 1 190 ? -49.577 96.071  35.954  1.00 24.70  ? 187 VAL B CG2 1 
ATOM   5632 N N   . ALA B 1 191 ? -50.885 98.882  39.086  1.00 35.50  ? 188 ALA B N   1 
ATOM   5633 C CA  . ALA B 1 191 ? -52.023 98.858  39.997  1.00 37.15  ? 188 ALA B CA  1 
ATOM   5634 C C   . ALA B 1 191 ? -53.210 99.626  39.431  1.00 35.67  ? 188 ALA B C   1 
ATOM   5635 O O   . ALA B 1 191 ? -54.362 99.291  39.729  1.00 35.90  ? 188 ALA B O   1 
ATOM   5636 C CB  . ALA B 1 191 ? -51.621 99.428  41.358  1.00 28.21  ? 188 ALA B CB  1 
ATOM   5637 N N   . ALA B 1 192 ? -52.952 100.650 38.613  1.00 37.12  ? 189 ALA B N   1 
ATOM   5638 C CA  . ALA B 1 192 ? -54.033 101.416 38.005  1.00 24.34  ? 189 ALA B CA  1 
ATOM   5639 C C   . ALA B 1 192 ? -54.846 100.589 37.019  1.00 38.63  ? 189 ALA B C   1 
ATOM   5640 O O   . ALA B 1 192 ? -55.979 100.963 36.702  1.00 37.06  ? 189 ALA B O   1 
ATOM   5641 C CB  . ALA B 1 192 ? -53.471 102.654 37.305  1.00 24.78  ? 189 ALA B CB  1 
ATOM   5642 N N   . PHE B 1 193 ? -54.296 99.479  36.529  1.00 40.88  ? 190 PHE B N   1 
ATOM   5643 C CA  . PHE B 1 193 ? -54.996 98.590  35.614  1.00 34.05  ? 190 PHE B CA  1 
ATOM   5644 C C   . PHE B 1 193 ? -55.578 97.372  36.318  1.00 35.88  ? 190 PHE B C   1 
ATOM   5645 O O   . PHE B 1 193 ? -56.112 96.480  35.652  1.00 39.95  ? 190 PHE B O   1 
ATOM   5646 C CB  . PHE B 1 193 ? -54.057 98.143  34.491  1.00 33.99  ? 190 PHE B CB  1 
ATOM   5647 C CG  . PHE B 1 193 ? -53.471 99.279  33.702  1.00 28.62  ? 190 PHE B CG  1 
ATOM   5648 C CD1 . PHE B 1 193 ? -52.281 99.872  34.093  1.00 23.02  ? 190 PHE B CD1 1 
ATOM   5649 C CD2 . PHE B 1 193 ? -54.108 99.752  32.566  1.00 27.45  ? 190 PHE B CD2 1 
ATOM   5650 C CE1 . PHE B 1 193 ? -51.739 100.917 33.369  1.00 26.48  ? 190 PHE B CE1 1 
ATOM   5651 C CE2 . PHE B 1 193 ? -53.570 100.797 31.837  1.00 29.85  ? 190 PHE B CE2 1 
ATOM   5652 C CZ  . PHE B 1 193 ? -52.384 101.380 32.239  1.00 33.34  ? 190 PHE B CZ  1 
ATOM   5653 N N   . GLY B 1 194 ? -55.489 97.317  37.644  1.00 39.80  ? 191 GLY B N   1 
ATOM   5654 C CA  . GLY B 1 194 ? -55.953 96.164  38.387  1.00 35.59  ? 191 GLY B CA  1 
ATOM   5655 C C   . GLY B 1 194 ? -54.924 95.077  38.583  1.00 48.74  ? 191 GLY B C   1 
ATOM   5656 O O   . GLY B 1 194 ? -55.295 93.952  38.938  1.00 41.76  ? 191 GLY B O   1 
ATOM   5657 N N   . GLY B 1 195 ? -53.646 95.371  38.365  1.00 40.66  ? 192 GLY B N   1 
ATOM   5658 C CA  . GLY B 1 195 ? -52.590 94.387  38.490  1.00 44.45  ? 192 GLY B CA  1 
ATOM   5659 C C   . GLY B 1 195 ? -51.861 94.489  39.817  1.00 44.38  ? 192 GLY B C   1 
ATOM   5660 O O   . GLY B 1 195 ? -51.762 95.560  40.410  1.00 44.51  ? 192 GLY B O   1 
ATOM   5661 N N   . ASP B 1 196 ? -51.345 93.349  40.275  1.00 36.17  ? 193 ASP B N   1 
ATOM   5662 C CA  . ASP B 1 196 ? -50.642 93.277  41.546  1.00 32.66  ? 193 ASP B CA  1 
ATOM   5663 C C   . ASP B 1 196 ? -49.147 93.409  41.301  1.00 35.03  ? 193 ASP B C   1 
ATOM   5664 O O   . ASP B 1 196 ? -48.541 92.489  40.732  1.00 41.62  ? 193 ASP B O   1 
ATOM   5665 C CB  . ASP B 1 196 ? -50.952 91.960  42.255  1.00 44.22  ? 193 ASP B CB  1 
ATOM   5666 C CG  . ASP B 1 196 ? -50.440 91.925  43.685  1.00 45.75  ? 193 ASP B CG  1 
ATOM   5667 O OD1 . ASP B 1 196 ? -49.809 92.910  44.125  1.00 39.86  ? 193 ASP B OD1 1 
ATOM   5668 O OD2 . ASP B 1 196 ? -50.672 90.909  44.372  1.00 45.46  ? 193 ASP B OD2 1 
ATOM   5669 N N   . PRO B 1 197 ? -48.510 94.513  41.705  1.00 33.57  ? 194 PRO B N   1 
ATOM   5670 C CA  . PRO B 1 197 ? -47.059 94.645  41.497  1.00 23.39  ? 194 PRO B CA  1 
ATOM   5671 C C   . PRO B 1 197 ? -46.224 93.701  42.348  1.00 36.56  ? 194 PRO B C   1 
ATOM   5672 O O   . PRO B 1 197 ? -45.009 93.614  42.126  1.00 34.42  ? 194 PRO B O   1 
ATOM   5673 C CB  . PRO B 1 197 ? -46.785 96.110  41.863  1.00 27.39  ? 194 PRO B CB  1 
ATOM   5674 C CG  . PRO B 1 197 ? -47.897 96.484  42.787  1.00 20.23  ? 194 PRO B CG  1 
ATOM   5675 C CD  . PRO B 1 197 ? -49.100 95.719  42.313  1.00 31.52  ? 194 PRO B CD  1 
ATOM   5676 N N   . THR B 1 198 ? -46.821 92.998  43.309  1.00 40.71  ? 195 THR B N   1 
ATOM   5677 C CA  . THR B 1 198 ? -46.100 92.021  44.113  1.00 45.54  ? 195 THR B CA  1 
ATOM   5678 C C   . THR B 1 198 ? -46.150 90.618  43.523  1.00 45.68  ? 195 THR B C   1 
ATOM   5679 O O   . THR B 1 198 ? -45.594 89.690  44.120  1.00 56.71  ? 195 THR B O   1 
ATOM   5680 C CB  . THR B 1 198 ? -46.651 91.991  45.543  1.00 38.24  ? 195 THR B CB  1 
ATOM   5681 O OG1 . THR B 1 198 ? -48.021 91.571  45.523  1.00 33.47  ? 195 THR B OG1 1 
ATOM   5682 C CG2 . THR B 1 198 ? -46.556 93.369  46.182  1.00 28.65  ? 195 THR B CG2 1 
ATOM   5683 N N   . SER B 1 199 ? -46.799 90.439  42.363  1.00 40.77  ? 196 SER B N   1 
ATOM   5684 C CA  . SER B 1 199 ? -46.900 89.144  41.698  1.00 39.48  ? 196 SER B CA  1 
ATOM   5685 C C   . SER B 1 199 ? -46.644 89.355  40.201  1.00 36.49  ? 196 SER B C   1 
ATOM   5686 O O   . SER B 1 199 ? -47.540 89.266  39.363  1.00 40.83  ? 196 SER B O   1 
ATOM   5687 C CB  . SER B 1 199 ? -48.261 88.491  41.949  1.00 30.19  ? 196 SER B CB  1 
ATOM   5688 O OG  . SER B 1 199 ? -48.333 87.209  41.351  1.00 44.15  ? 196 SER B OG  1 
ATOM   5689 N N   . VAL B 1 200 ? -45.391 89.641  39.859  1.00 36.85  ? 197 VAL B N   1 
ATOM   5690 C CA  . VAL B 1 200 ? -44.978 89.898  38.483  1.00 36.40  ? 197 VAL B CA  1 
ATOM   5691 C C   . VAL B 1 200 ? -44.194 88.690  37.990  1.00 38.71  ? 197 VAL B C   1 
ATOM   5692 O O   . VAL B 1 200 ? -43.196 88.294  38.605  1.00 28.98  ? 197 VAL B O   1 
ATOM   5693 C CB  . VAL B 1 200 ? -44.142 91.182  38.373  1.00 37.29  ? 197 VAL B CB  1 
ATOM   5694 C CG1 . VAL B 1 200 ? -43.672 91.387  36.942  1.00 35.67  ? 197 VAL B CG1 1 
ATOM   5695 C CG2 . VAL B 1 200 ? -44.947 92.381  38.853  1.00 26.74  ? 197 VAL B CG2 1 
ATOM   5696 N N   . THR B 1 201 ? -44.642 88.109  36.878  1.00 38.30  ? 198 THR B N   1 
ATOM   5697 C CA  . THR B 1 201 ? -44.018 86.928  36.288  1.00 29.41  ? 198 THR B CA  1 
ATOM   5698 C C   . THR B 1 201 ? -43.513 87.285  34.896  1.00 30.42  ? 198 THR B C   1 
ATOM   5699 O O   . THR B 1 201 ? -44.310 87.560  33.993  1.00 29.88  ? 198 THR B O   1 
ATOM   5700 C CB  . THR B 1 201 ? -45.003 85.761  36.222  1.00 32.07  ? 198 THR B CB  1 
ATOM   5701 O OG1 . THR B 1 201 ? -45.398 85.389  37.548  1.00 34.92  ? 198 THR B OG1 1 
ATOM   5702 C CG2 . THR B 1 201 ? -44.366 84.564  35.530  1.00 29.16  ? 198 THR B CG2 1 
ATOM   5703 N N   . LEU B 1 202 ? -42.193 87.280  34.724  1.00 27.03  ? 199 LEU B N   1 
ATOM   5704 C CA  . LEU B 1 202 ? -41.600 87.509  33.415  1.00 27.05  ? 199 LEU B CA  1 
ATOM   5705 C C   . LEU B 1 202 ? -41.627 86.228  32.594  1.00 34.88  ? 199 LEU B C   1 
ATOM   5706 O O   . LEU B 1 202 ? -41.320 85.144  33.099  1.00 36.30  ? 199 LEU B O   1 
ATOM   5707 C CB  . LEU B 1 202 ? -40.156 87.993  33.552  1.00 24.26  ? 199 LEU B CB  1 
ATOM   5708 C CG  . LEU B 1 202 ? -39.859 89.219  34.413  1.00 30.95  ? 199 LEU B CG  1 
ATOM   5709 C CD1 . LEU B 1 202 ? -38.388 89.589  34.305  1.00 25.02  ? 199 LEU B CD1 1 
ATOM   5710 C CD2 . LEU B 1 202 ? -40.737 90.384  34.006  1.00 41.42  ? 199 LEU B CD2 1 
ATOM   5711 N N   . PHE B 1 203 ? -41.998 86.352  31.322  1.00 27.69  ? 200 PHE B N   1 
ATOM   5712 C CA  . PHE B 1 203 ? -41.884 85.236  30.397  1.00 25.71  ? 200 PHE B CA  1 
ATOM   5713 C C   . PHE B 1 203 ? -41.492 85.754  29.022  1.00 33.93  ? 200 PHE B C   1 
ATOM   5714 O O   . PHE B 1 203 ? -42.020 86.765  28.552  1.00 34.64  ? 200 PHE B O   1 
ATOM   5715 C CB  . PHE B 1 203 ? -43.177 84.395  30.330  1.00 27.93  ? 200 PHE B CB  1 
ATOM   5716 C CG  . PHE B 1 203 ? -44.321 85.043  29.597  1.00 30.19  ? 200 PHE B CG  1 
ATOM   5717 C CD1 . PHE B 1 203 ? -45.015 84.329  28.633  1.00 23.38  ? 200 PHE B CD1 1 
ATOM   5718 C CD2 . PHE B 1 203 ? -44.740 86.327  29.901  1.00 30.83  ? 200 PHE B CD2 1 
ATOM   5719 C CE1 . PHE B 1 203 ? -46.081 84.893  27.961  1.00 33.45  ? 200 PHE B CE1 1 
ATOM   5720 C CE2 . PHE B 1 203 ? -45.807 86.897  29.231  1.00 26.66  ? 200 PHE B CE2 1 
ATOM   5721 C CZ  . PHE B 1 203 ? -46.477 86.180  28.260  1.00 21.93  ? 200 PHE B CZ  1 
ATOM   5722 N N   . GLY B 1 204 ? -40.536 85.064  28.399  1.00 33.17  ? 201 GLY B N   1 
ATOM   5723 C CA  . GLY B 1 204 ? -40.039 85.445  27.094  1.00 28.14  ? 201 GLY B CA  1 
ATOM   5724 C C   . GLY B 1 204 ? -39.560 84.225  26.340  1.00 34.53  ? 201 GLY B C   1 
ATOM   5725 O O   . GLY B 1 204 ? -39.505 83.116  26.878  1.00 34.28  ? 201 GLY B O   1 
ATOM   5726 N N   . GLU B 1 205 ? -39.206 84.444  25.077  1.00 25.84  ? 202 GLU B N   1 
ATOM   5727 C CA  . GLU B 1 205 ? -38.807 83.367  24.185  1.00 26.08  ? 202 GLU B CA  1 
ATOM   5728 C C   . GLU B 1 205 ? -37.531 83.754  23.452  1.00 30.85  ? 202 GLU B C   1 
ATOM   5729 O O   . GLU B 1 205 ? -37.330 84.923  23.113  1.00 29.02  ? 202 GLU B O   1 
ATOM   5730 C CB  . GLU B 1 205 ? -39.928 83.041  23.188  1.00 27.11  ? 202 GLU B CB  1 
ATOM   5731 C CG  . GLU B 1 205 ? -39.764 81.717  22.464  1.00 21.21  ? 202 GLU B CG  1 
ATOM   5732 C CD  . GLU B 1 205 ? -39.043 81.867  21.143  1.00 33.04  ? 202 GLU B CD  1 
ATOM   5733 O OE1 . GLU B 1 205 ? -38.820 83.019  20.718  1.00 28.16  ? 202 GLU B OE1 1 
ATOM   5734 O OE2 . GLU B 1 205 ? -38.702 80.834  20.529  1.00 37.36  ? 202 GLU B OE2 1 
ATOM   5735 N N   . SER B 1 206 ? -36.668 82.760  23.223  1.00 34.51  ? 203 SER B N   1 
ATOM   5736 C CA  . SER B 1 206 ? -35.384 82.942  22.550  1.00 32.50  ? 203 SER B CA  1 
ATOM   5737 C C   . SER B 1 206 ? -34.554 84.034  23.214  1.00 25.51  ? 203 SER B C   1 
ATOM   5738 O O   . SER B 1 206 ? -34.146 83.894  24.372  1.00 30.28  ? 203 SER B O   1 
ATOM   5739 C CB  . SER B 1 206 ? -35.589 83.263  21.068  1.00 36.18  ? 203 SER B CB  1 
ATOM   5740 O OG  . SER B 1 206 ? -34.490 82.801  20.301  1.00 44.86  ? 203 SER B OG  1 
ATOM   5741 N N   . ALA B 1 207 ? -34.294 85.124  22.485  1.00 27.88  ? 204 ALA B N   1 
ATOM   5742 C CA  . ALA B 1 207 ? -33.558 86.241  23.067  1.00 28.30  ? 204 ALA B CA  1 
ATOM   5743 C C   . ALA B 1 207 ? -34.332 86.881  24.211  1.00 25.94  ? 204 ALA B C   1 
ATOM   5744 O O   . ALA B 1 207 ? -33.729 87.454  25.125  1.00 21.16  ? 204 ALA B O   1 
ATOM   5745 C CB  . ALA B 1 207 ? -33.237 87.280  21.993  1.00 24.91  ? 204 ALA B CB  1 
ATOM   5746 N N   . GLY B 1 208 ? -35.663 86.798  24.176  1.00 25.66  ? 205 GLY B N   1 
ATOM   5747 C CA  . GLY B 1 208 ? -36.448 87.255  25.310  1.00 26.19  ? 205 GLY B CA  1 
ATOM   5748 C C   . GLY B 1 208 ? -36.250 86.381  26.533  1.00 28.36  ? 205 GLY B C   1 
ATOM   5749 O O   . GLY B 1 208 ? -36.200 86.879  27.661  1.00 24.88  ? 205 GLY B O   1 
ATOM   5750 N N   . ALA B 1 209 ? -36.135 85.066  26.328  1.00 30.89  ? 206 ALA B N   1 
ATOM   5751 C CA  . ALA B 1 209 ? -35.838 84.170  27.440  1.00 29.32  ? 206 ALA B CA  1 
ATOM   5752 C C   . ALA B 1 209 ? -34.453 84.446  28.007  1.00 26.83  ? 206 ALA B C   1 
ATOM   5753 O O   . ALA B 1 209 ? -34.258 84.426  29.228  1.00 28.20  ? 206 ALA B O   1 
ATOM   5754 C CB  . ALA B 1 209 ? -35.956 82.714  26.990  1.00 26.60  ? 206 ALA B CB  1 
ATOM   5755 N N   . ALA B 1 210 ? -33.477 84.707  27.134  1.00 26.43  ? 207 ALA B N   1 
ATOM   5756 C CA  . ALA B 1 210 ? -32.154 85.098  27.605  1.00 20.35  ? 207 ALA B CA  1 
ATOM   5757 C C   . ALA B 1 210 ? -32.215 86.409  28.377  1.00 31.43  ? 207 ALA B C   1 
ATOM   5758 O O   . ALA B 1 210 ? -31.494 86.592  29.365  1.00 27.48  ? 207 ALA B O   1 
ATOM   5759 C CB  . ALA B 1 210 ? -31.188 85.211  26.425  1.00 20.54  ? 207 ALA B CB  1 
ATOM   5760 N N   . SER B 1 211 ? -33.078 87.332  27.944  1.00 28.37  ? 208 SER B N   1 
ATOM   5761 C CA  . SER B 1 211 ? -33.247 88.587  28.670  1.00 29.69  ? 208 SER B CA  1 
ATOM   5762 C C   . SER B 1 211 ? -33.849 88.350  30.049  1.00 23.32  ? 208 SER B C   1 
ATOM   5763 O O   . SER B 1 211 ? -33.428 88.973  31.031  1.00 26.57  ? 208 SER B O   1 
ATOM   5764 C CB  . SER B 1 211 ? -34.120 89.548  27.861  1.00 24.63  ? 208 SER B CB  1 
ATOM   5765 O OG  . SER B 1 211 ? -33.495 89.901  26.640  1.00 24.63  ? 208 SER B OG  1 
ATOM   5766 N N   . VAL B 1 212 ? -34.837 87.456  30.141  1.00 22.28  ? 209 VAL B N   1 
ATOM   5767 C CA  . VAL B 1 212 ? -35.422 87.120  31.437  1.00 20.35  ? 209 VAL B CA  1 
ATOM   5768 C C   . VAL B 1 212 ? -34.364 86.532  32.360  1.00 34.59  ? 209 VAL B C   1 
ATOM   5769 O O   . VAL B 1 212 ? -34.319 86.842  33.558  1.00 36.11  ? 209 VAL B O   1 
ATOM   5770 C CB  . VAL B 1 212 ? -36.612 86.159  31.253  1.00 22.60  ? 209 VAL B CB  1 
ATOM   5771 C CG1 . VAL B 1 212 ? -37.121 85.674  32.599  1.00 23.23  ? 209 VAL B CG1 1 
ATOM   5772 C CG2 . VAL B 1 212 ? -37.728 86.839  30.476  1.00 17.82  ? 209 VAL B CG2 1 
ATOM   5773 N N   . GLY B 1 213 ? -33.488 85.683  31.818  1.00 27.97  ? 210 GLY B N   1 
ATOM   5774 C CA  . GLY B 1 213 ? -32.432 85.108  32.633  1.00 27.90  ? 210 GLY B CA  1 
ATOM   5775 C C   . GLY B 1 213 ? -31.424 86.139  33.103  1.00 32.28  ? 210 GLY B C   1 
ATOM   5776 O O   . GLY B 1 213 ? -30.914 86.054  34.224  1.00 34.22  ? 210 GLY B O   1 
ATOM   5777 N N   . MET B 1 214 ? -31.124 87.129  32.258  1.00 29.20  ? 211 MET B N   1 
ATOM   5778 C CA  . MET B 1 214 ? -30.168 88.161  32.649  1.00 30.83  ? 211 MET B CA  1 
ATOM   5779 C C   . MET B 1 214 ? -30.741 89.085  33.715  1.00 32.71  ? 211 MET B C   1 
ATOM   5780 O O   . MET B 1 214 ? -29.985 89.649  34.514  1.00 35.66  ? 211 MET B O   1 
ATOM   5781 C CB  . MET B 1 214 ? -29.727 88.964  31.425  1.00 27.22  ? 211 MET B CB  1 
ATOM   5782 C CG  . MET B 1 214 ? -28.944 88.148  30.410  1.00 31.54  ? 211 MET B CG  1 
ATOM   5783 S SD  . MET B 1 214 ? -28.407 89.103  28.982  1.00 53.30  ? 211 MET B SD  1 
ATOM   5784 C CE  . MET B 1 214 ? -27.806 87.798  27.913  1.00 32.12  ? 211 MET B CE  1 
ATOM   5785 N N   . HIS B 1 215 ? -32.065 89.258  33.745  1.00 25.52  ? 212 HIS B N   1 
ATOM   5786 C CA  . HIS B 1 215 ? -32.675 90.019  34.830  1.00 37.41  ? 212 HIS B CA  1 
ATOM   5787 C C   . HIS B 1 215 ? -32.632 89.244  36.141  1.00 32.99  ? 212 HIS B C   1 
ATOM   5788 O O   . HIS B 1 215 ? -32.595 89.851  37.217  1.00 35.42  ? 212 HIS B O   1 
ATOM   5789 C CB  . HIS B 1 215 ? -34.113 90.395  34.474  1.00 23.31  ? 212 HIS B CB  1 
ATOM   5790 C CG  . HIS B 1 215 ? -34.217 91.431  33.398  1.00 34.84  ? 212 HIS B CG  1 
ATOM   5791 N ND1 . HIS B 1 215 ? -33.570 92.646  33.471  1.00 41.87  ? 212 HIS B ND1 1 
ATOM   5792 C CD2 . HIS B 1 215 ? -34.894 91.436  32.225  1.00 26.04  ? 212 HIS B CD2 1 
ATOM   5793 C CE1 . HIS B 1 215 ? -33.842 93.354  32.389  1.00 29.89  ? 212 HIS B CE1 1 
ATOM   5794 N NE2 . HIS B 1 215 ? -34.643 92.642  31.617  1.00 37.08  ? 212 HIS B NE2 1 
ATOM   5795 N N   . LEU B 1 216 ? -32.638 87.910  36.071  1.00 37.25  ? 213 LEU B N   1 
ATOM   5796 C CA  . LEU B 1 216 ? -32.450 87.102  37.270  1.00 38.24  ? 213 LEU B CA  1 
ATOM   5797 C C   . LEU B 1 216 ? -31.054 87.281  37.851  1.00 26.62  ? 213 LEU B C   1 
ATOM   5798 O O   . LEU B 1 216 ? -30.878 87.206  39.072  1.00 44.28  ? 213 LEU B O   1 
ATOM   5799 C CB  . LEU B 1 216 ? -32.699 85.627  36.956  1.00 32.20  ? 213 LEU B CB  1 
ATOM   5800 C CG  . LEU B 1 216 ? -34.148 85.167  36.811  1.00 36.52  ? 213 LEU B CG  1 
ATOM   5801 C CD1 . LEU B 1 216 ? -34.207 83.786  36.179  1.00 28.05  ? 213 LEU B CD1 1 
ATOM   5802 C CD2 . LEU B 1 216 ? -34.825 85.159  38.168  1.00 38.90  ? 213 LEU B CD2 1 
ATOM   5803 N N   . LEU B 1 217 ? -30.060 87.519  37.000  1.00 32.08  ? 214 LEU B N   1 
ATOM   5804 C CA  . LEU B 1 217 ? -28.672 87.635  37.424  1.00 37.49  ? 214 LEU B CA  1 
ATOM   5805 C C   . LEU B 1 217 ? -28.242 89.074  37.676  1.00 38.04  ? 214 LEU B C   1 
ATOM   5806 O O   . LEU B 1 217 ? -27.079 89.304  38.026  1.00 38.28  ? 214 LEU B O   1 
ATOM   5807 C CB  . LEU B 1 217 ? -27.754 86.998  36.376  1.00 29.82  ? 214 LEU B CB  1 
ATOM   5808 C CG  . LEU B 1 217 ? -28.107 85.564  35.974  1.00 36.32  ? 214 LEU B CG  1 
ATOM   5809 C CD1 . LEU B 1 217 ? -27.194 85.072  34.861  1.00 42.37  ? 214 LEU B CD1 1 
ATOM   5810 C CD2 . LEU B 1 217 ? -28.042 84.634  37.176  1.00 41.10  ? 214 LEU B CD2 1 
ATOM   5811 N N   . SER B 1 218 ? -29.141 90.042  37.507  1.00 40.10  ? 215 SER B N   1 
ATOM   5812 C CA  . SER B 1 218 ? -28.827 91.442  37.755  1.00 42.88  ? 215 SER B CA  1 
ATOM   5813 C C   . SER B 1 218 ? -29.560 91.908  39.003  1.00 44.41  ? 215 SER B C   1 
ATOM   5814 O O   . SER B 1 218 ? -30.800 91.896  39.023  1.00 41.33  ? 215 SER B O   1 
ATOM   5815 C CB  . SER B 1 218 ? -29.211 92.306  36.555  1.00 37.91  ? 215 SER B CB  1 
ATOM   5816 O OG  . SER B 1 218 ? -28.716 93.626  36.698  1.00 40.86  ? 215 SER B OG  1 
ATOM   5817 N N   . PRO B 1 219 ? -28.849 92.306  40.055  1.00 43.16  ? 216 PRO B N   1 
ATOM   5818 C CA  . PRO B 1 219 ? -29.509 92.706  41.310  1.00 47.50  ? 216 PRO B CA  1 
ATOM   5819 C C   . PRO B 1 219 ? -30.504 93.842  41.120  1.00 39.00  ? 216 PRO B C   1 
ATOM   5820 O O   . PRO B 1 219 ? -31.616 93.768  41.664  1.00 32.40  ? 216 PRO B O   1 
ATOM   5821 C CB  . PRO B 1 219 ? -28.335 93.122  42.210  1.00 35.24  ? 216 PRO B CB  1 
ATOM   5822 C CG  . PRO B 1 219 ? -27.189 92.310  41.704  1.00 40.86  ? 216 PRO B CG  1 
ATOM   5823 C CD  . PRO B 1 219 ? -27.388 92.186  40.213  1.00 38.80  ? 216 PRO B CD  1 
ATOM   5824 N N   . PRO B 1 220 ? -30.172 94.913  40.380  1.00 35.48  ? 217 PRO B N   1 
ATOM   5825 C CA  . PRO B 1 220 ? -31.161 95.995  40.221  1.00 33.08  ? 217 PRO B CA  1 
ATOM   5826 C C   . PRO B 1 220 ? -32.439 95.561  39.524  1.00 44.40  ? 217 PRO B C   1 
ATOM   5827 O O   . PRO B 1 220 ? -33.478 96.205  39.713  1.00 37.90  ? 217 PRO B O   1 
ATOM   5828 C CB  . PRO B 1 220 ? -30.408 97.049  39.396  1.00 26.83  ? 217 PRO B CB  1 
ATOM   5829 C CG  . PRO B 1 220 ? -28.981 96.768  39.640  1.00 38.60  ? 217 PRO B CG  1 
ATOM   5830 C CD  . PRO B 1 220 ? -28.900 95.280  39.726  1.00 34.85  ? 217 PRO B CD  1 
ATOM   5831 N N   . SER B 1 221 ? -32.401 94.492  38.729  1.00 35.86  ? 218 SER B N   1 
ATOM   5832 C CA  . SER B 1 221 ? -33.592 94.002  38.050  1.00 31.29  ? 218 SER B CA  1 
ATOM   5833 C C   . SER B 1 221 ? -34.309 92.903  38.823  1.00 38.61  ? 218 SER B C   1 
ATOM   5834 O O   . SER B 1 221 ? -35.518 92.723  38.635  1.00 34.15  ? 218 SER B O   1 
ATOM   5835 C CB  . SER B 1 221 ? -33.229 93.479  36.656  1.00 31.63  ? 218 SER B CB  1 
ATOM   5836 O OG  . SER B 1 221 ? -32.579 94.477  35.887  1.00 41.12  ? 218 SER B OG  1 
ATOM   5837 N N   . ARG B 1 222 ? -33.596 92.175  39.688  1.00 44.18  ? 219 ARG B N   1 
ATOM   5838 C CA  . ARG B 1 222 ? -34.195 91.039  40.383  1.00 48.56  ? 219 ARG B CA  1 
ATOM   5839 C C   . ARG B 1 222 ? -35.341 91.467  41.292  1.00 40.89  ? 219 ARG B C   1 
ATOM   5840 O O   . ARG B 1 222 ? -36.299 90.709  41.480  1.00 42.91  ? 219 ARG B O   1 
ATOM   5841 C CB  . ARG B 1 222 ? -33.122 90.298  41.184  1.00 46.46  ? 219 ARG B CB  1 
ATOM   5842 C CG  . ARG B 1 222 ? -33.624 89.069  41.926  1.00 38.25  ? 219 ARG B CG  1 
ATOM   5843 C CD  . ARG B 1 222 ? -34.255 88.066  40.975  1.00 41.98  ? 219 ARG B CD  1 
ATOM   5844 N NE  . ARG B 1 222 ? -34.745 86.884  41.677  1.00 48.99  ? 219 ARG B NE  1 
ATOM   5845 C CZ  . ARG B 1 222 ? -35.958 86.782  42.211  1.00 50.70  ? 219 ARG B CZ  1 
ATOM   5846 N NH1 . ARG B 1 222 ? -36.810 87.795  42.125  1.00 46.14  ? 219 ARG B NH1 1 
ATOM   5847 N NH2 . ARG B 1 222 ? -36.320 85.668  42.833  1.00 55.00  ? 219 ARG B NH2 1 
ATOM   5848 N N   . GLY B 1 223 ? -35.269 92.671  41.855  1.00 39.07  ? 220 GLY B N   1 
ATOM   5849 C CA  . GLY B 1 223 ? -36.312 93.154  42.735  1.00 35.84  ? 220 GLY B CA  1 
ATOM   5850 C C   . GLY B 1 223 ? -37.581 93.619  42.061  1.00 43.72  ? 220 GLY B C   1 
ATOM   5851 O O   . GLY B 1 223 ? -38.533 93.995  42.751  1.00 43.46  ? 220 GLY B O   1 
ATOM   5852 N N   . LEU B 1 224 ? -37.632 93.601  40.731  1.00 33.43  ? 221 LEU B N   1 
ATOM   5853 C CA  . LEU B 1 224 ? -38.785 94.083  39.985  1.00 28.44  ? 221 LEU B CA  1 
ATOM   5854 C C   . LEU B 1 224 ? -39.738 92.970  39.569  1.00 39.13  ? 221 LEU B C   1 
ATOM   5855 O O   . LEU B 1 224 ? -40.778 93.256  38.968  1.00 38.59  ? 221 LEU B O   1 
ATOM   5856 C CB  . LEU B 1 224 ? -38.320 94.854  38.745  1.00 28.83  ? 221 LEU B CB  1 
ATOM   5857 C CG  . LEU B 1 224 ? -37.387 96.034  39.020  1.00 30.19  ? 221 LEU B CG  1 
ATOM   5858 C CD1 . LEU B 1 224 ? -36.860 96.622  37.721  1.00 31.08  ? 221 LEU B CD1 1 
ATOM   5859 C CD2 . LEU B 1 224 ? -38.097 97.098  39.845  1.00 31.57  ? 221 LEU B CD2 1 
ATOM   5860 N N   . PHE B 1 225 ? -39.413 91.716  39.872  1.00 37.01  ? 222 PHE B N   1 
ATOM   5861 C CA  . PHE B 1 225 ? -40.270 90.596  39.512  1.00 36.46  ? 222 PHE B CA  1 
ATOM   5862 C C   . PHE B 1 225 ? -40.053 89.471  40.513  1.00 31.50  ? 222 PHE B C   1 
ATOM   5863 O O   . PHE B 1 225 ? -39.123 89.501  41.324  1.00 35.11  ? 222 PHE B O   1 
ATOM   5864 C CB  . PHE B 1 225 ? -40.004 90.122  38.078  1.00 28.86  ? 222 PHE B CB  1 
ATOM   5865 C CG  . PHE B 1 225 ? -38.622 89.573  37.865  1.00 27.13  ? 222 PHE B CG  1 
ATOM   5866 C CD1 . PHE B 1 225 ? -37.545 90.421  37.665  1.00 25.24  ? 222 PHE B CD1 1 
ATOM   5867 C CD2 . PHE B 1 225 ? -38.402 88.206  37.857  1.00 28.89  ? 222 PHE B CD2 1 
ATOM   5868 C CE1 . PHE B 1 225 ? -36.275 89.916  37.467  1.00 36.61  ? 222 PHE B CE1 1 
ATOM   5869 C CE2 . PHE B 1 225 ? -37.136 87.697  37.659  1.00 36.48  ? 222 PHE B CE2 1 
ATOM   5870 C CZ  . PHE B 1 225 ? -36.070 88.552  37.464  1.00 38.73  ? 222 PHE B CZ  1 
ATOM   5871 N N   . HIS B 1 226 ? -40.925 88.468  40.444  1.00 34.66  ? 223 HIS B N   1 
ATOM   5872 C CA  . HIS B 1 226 ? -40.917 87.371  41.403  1.00 42.87  ? 223 HIS B CA  1 
ATOM   5873 C C   . HIS B 1 226 ? -40.877 85.989  40.771  1.00 38.87  ? 223 HIS B C   1 
ATOM   5874 O O   . HIS B 1 226 ? -40.525 85.029  41.467  1.00 39.87  ? 223 HIS B O   1 
ATOM   5875 C CB  . HIS B 1 226 ? -42.145 87.462  42.321  1.00 39.61  ? 223 HIS B CB  1 
ATOM   5876 C CG  . HIS B 1 226 ? -42.389 88.837  42.860  1.00 54.06  ? 223 HIS B CG  1 
ATOM   5877 N ND1 . HIS B 1 226 ? -42.931 89.849  42.096  1.00 51.36  ? 223 HIS B ND1 1 
ATOM   5878 C CD2 . HIS B 1 226 ? -42.152 89.373  44.080  1.00 59.10  ? 223 HIS B CD2 1 
ATOM   5879 C CE1 . HIS B 1 226 ? -43.020 90.948  42.825  1.00 50.56  ? 223 HIS B CE1 1 
ATOM   5880 N NE2 . HIS B 1 226 ? -42.557 90.685  44.033  1.00 64.45  ? 223 HIS B NE2 1 
ATOM   5881 N N   . ARG B 1 227 ? -41.221 85.849  39.493  1.00 32.44  ? 224 ARG B N   1 
ATOM   5882 C CA  . ARG B 1 227 ? -41.172 84.568  38.806  1.00 29.43  ? 224 ARG B CA  1 
ATOM   5883 C C   . ARG B 1 227 ? -40.594 84.777  37.415  1.00 39.48  ? 224 ARG B C   1 
ATOM   5884 O O   . ARG B 1 227 ? -40.549 85.897  36.900  1.00 37.85  ? 224 ARG B O   1 
ATOM   5885 C CB  . ARG B 1 227 ? -42.560 83.922  38.718  1.00 34.97  ? 224 ARG B CB  1 
ATOM   5886 C CG  . ARG B 1 227 ? -43.155 83.551  40.064  1.00 37.44  ? 224 ARG B CG  1 
ATOM   5887 C CD  . ARG B 1 227 ? -44.632 83.236  39.936  1.00 39.55  ? 224 ARG B CD  1 
ATOM   5888 N NE  . ARG B 1 227 ? -45.197 82.734  41.185  1.00 55.73  ? 224 ARG B NE  1 
ATOM   5889 C CZ  . ARG B 1 227 ? -45.702 83.506  42.141  1.00 59.49  ? 224 ARG B CZ  1 
ATOM   5890 N NH1 . ARG B 1 227 ? -45.712 84.824  41.995  1.00 60.76  ? 224 ARG B NH1 1 
ATOM   5891 N NH2 . ARG B 1 227 ? -46.197 82.960  43.243  1.00 61.54  ? 224 ARG B NH2 1 
ATOM   5892 N N   . ALA B 1 228 ? -40.151 83.680  36.806  1.00 37.93  ? 225 ALA B N   1 
ATOM   5893 C CA  . ALA B 1 228 ? -39.513 83.734  35.500  1.00 30.26  ? 225 ALA B CA  1 
ATOM   5894 C C   . ALA B 1 228 ? -39.914 82.520  34.677  1.00 35.71  ? 225 ALA B C   1 
ATOM   5895 O O   . ALA B 1 228 ? -39.998 81.405  35.200  1.00 36.03  ? 225 ALA B O   1 
ATOM   5896 C CB  . ALA B 1 228 ? -37.986 83.796  35.627  1.00 33.21  ? 225 ALA B CB  1 
ATOM   5897 N N   . VAL B 1 229 ? -40.165 82.746  33.390  1.00 31.19  ? 226 VAL B N   1 
ATOM   5898 C CA  . VAL B 1 229 ? -40.435 81.680  32.433  1.00 32.58  ? 226 VAL B CA  1 
ATOM   5899 C C   . VAL B 1 229 ? -39.514 81.887  31.240  1.00 33.74  ? 226 VAL B C   1 
ATOM   5900 O O   . VAL B 1 229 ? -39.583 82.926  30.573  1.00 35.49  ? 226 VAL B O   1 
ATOM   5901 C CB  . VAL B 1 229 ? -41.905 81.654  31.981  1.00 23.10  ? 226 VAL B CB  1 
ATOM   5902 C CG1 . VAL B 1 229 ? -42.148 80.496  31.024  1.00 23.80  ? 226 VAL B CG1 1 
ATOM   5903 C CG2 . VAL B 1 229 ? -42.837 81.569  33.177  1.00 30.55  ? 226 VAL B CG2 1 
ATOM   5904 N N   . LEU B 1 230 ? -38.654 80.907  30.976  1.00 36.65  ? 227 LEU B N   1 
ATOM   5905 C CA  . LEU B 1 230 ? -37.685 80.974  29.887  1.00 33.58  ? 227 LEU B CA  1 
ATOM   5906 C C   . LEU B 1 230 ? -38.057 79.921  28.851  1.00 31.54  ? 227 LEU B C   1 
ATOM   5907 O O   . LEU B 1 230 ? -37.944 78.718  29.111  1.00 37.88  ? 227 LEU B O   1 
ATOM   5908 C CB  . LEU B 1 230 ? -36.262 80.765  30.403  1.00 30.28  ? 227 LEU B CB  1 
ATOM   5909 C CG  . LEU B 1 230 ? -35.657 81.863  31.285  1.00 25.63  ? 227 LEU B CG  1 
ATOM   5910 C CD1 . LEU B 1 230 ? -36.119 81.748  32.733  1.00 28.76  ? 227 LEU B CD1 1 
ATOM   5911 C CD2 . LEU B 1 230 ? -34.139 81.842  31.200  1.00 24.10  ? 227 LEU B CD2 1 
ATOM   5912 N N   . GLN B 1 231 ? -38.498 80.374  27.681  1.00 28.82  ? 228 GLN B N   1 
ATOM   5913 C CA  . GLN B 1 231 ? -38.959 79.497  26.610  1.00 21.75  ? 228 GLN B CA  1 
ATOM   5914 C C   . GLN B 1 231 ? -37.910 79.487  25.504  1.00 35.87  ? 228 GLN B C   1 
ATOM   5915 O O   . GLN B 1 231 ? -37.708 80.500  24.825  1.00 27.82  ? 228 GLN B O   1 
ATOM   5916 C CB  . GLN B 1 231 ? -40.314 79.960  26.077  1.00 21.06  ? 228 GLN B CB  1 
ATOM   5917 C CG  . GLN B 1 231 ? -41.359 80.192  27.157  1.00 23.68  ? 228 GLN B CG  1 
ATOM   5918 C CD  . GLN B 1 231 ? -42.633 80.808  26.612  1.00 38.28  ? 228 GLN B CD  1 
ATOM   5919 O OE1 . GLN B 1 231 ? -43.396 81.436  27.345  1.00 33.61  ? 228 GLN B OE1 1 
ATOM   5920 N NE2 . GLN B 1 231 ? -42.871 80.628  25.317  1.00 31.49  ? 228 GLN B NE2 1 
ATOM   5921 N N   . SER B 1 232 ? -37.241 78.345  25.332  1.00 29.06  ? 229 SER B N   1 
ATOM   5922 C CA  . SER B 1 232 ? -36.294 78.134  24.235  1.00 24.65  ? 229 SER B CA  1 
ATOM   5923 C C   . SER B 1 232 ? -35.182 79.183  24.239  1.00 22.19  ? 229 SER B C   1 
ATOM   5924 O O   . SER B 1 232 ? -34.835 79.757  23.204  1.00 22.62  ? 229 SER B O   1 
ATOM   5925 C CB  . SER B 1 232 ? -37.018 78.112  22.886  1.00 23.97  ? 229 SER B CB  1 
ATOM   5926 O OG  . SER B 1 232 ? -37.991 77.083  22.842  1.00 26.89  ? 229 SER B OG  1 
ATOM   5927 N N   . GLY B 1 233 ? -34.618 79.429  25.413  1.00 20.53  ? 230 GLY B N   1 
ATOM   5928 C CA  . GLY B 1 233 ? -33.550 80.404  25.527  1.00 17.55  ? 230 GLY B CA  1 
ATOM   5929 C C   . GLY B 1 233 ? -32.996 80.431  26.934  1.00 16.71  ? 230 GLY B C   1 
ATOM   5930 O O   . GLY B 1 233 ? -33.660 80.032  27.897  1.00 25.79  ? 230 GLY B O   1 
ATOM   5931 N N   . ALA B 1 234 ? -31.762 80.921  27.035  1.00 20.79  ? 231 ALA B N   1 
ATOM   5932 C CA  . ALA B 1 234 ? -31.062 81.012  28.308  1.00 19.63  ? 231 ALA B CA  1 
ATOM   5933 C C   . ALA B 1 234 ? -29.969 82.060  28.180  1.00 24.88  ? 231 ALA B C   1 
ATOM   5934 O O   . ALA B 1 234 ? -29.430 82.254  27.085  1.00 25.58  ? 231 ALA B O   1 
ATOM   5935 C CB  . ALA B 1 234 ? -30.463 79.657  28.711  1.00 23.03  ? 231 ALA B CB  1 
ATOM   5936 N N   . PRO B 1 235 ? -29.621 82.752  29.270  1.00 21.77  ? 232 PRO B N   1 
ATOM   5937 C CA  . PRO B 1 235 ? -28.553 83.759  29.183  1.00 22.54  ? 232 PRO B CA  1 
ATOM   5938 C C   . PRO B 1 235 ? -27.162 83.166  29.047  1.00 27.96  ? 232 PRO B C   1 
ATOM   5939 O O   . PRO B 1 235 ? -26.238 83.888  28.654  1.00 29.29  ? 232 PRO B O   1 
ATOM   5940 C CB  . PRO B 1 235 ? -28.698 84.536  30.497  1.00 22.26  ? 232 PRO B CB  1 
ATOM   5941 C CG  . PRO B 1 235 ? -29.300 83.549  31.441  1.00 25.36  ? 232 PRO B CG  1 
ATOM   5942 C CD  . PRO B 1 235 ? -30.227 82.700  30.612  1.00 24.15  ? 232 PRO B CD  1 
ATOM   5943 N N   . ASN B 1 236 ? -26.981 81.884  29.356  1.00 32.64  ? 233 ASN B N   1 
ATOM   5944 C CA  . ASN B 1 236 ? -25.669 81.253  29.337  1.00 40.45  ? 233 ASN B CA  1 
ATOM   5945 C C   . ASN B 1 236 ? -25.337 80.603  27.998  1.00 37.00  ? 233 ASN B C   1 
ATOM   5946 O O   . ASN B 1 236 ? -24.358 79.855  27.913  1.00 53.04  ? 233 ASN B O   1 
ATOM   5947 C CB  . ASN B 1 236 ? -25.571 80.215  30.459  1.00 23.81  ? 233 ASN B CB  1 
ATOM   5948 C CG  . ASN B 1 236 ? -26.684 79.186  30.402  1.00 30.80  ? 233 ASN B CG  1 
ATOM   5949 O OD1 . ASN B 1 236 ? -27.830 79.475  30.747  1.00 32.33  ? 233 ASN B OD1 1 
ATOM   5950 N ND2 . ASN B 1 236 ? -26.349 77.975  29.974  1.00 35.64  ? 233 ASN B ND2 1 
ATOM   5951 N N   . GLY B 1 237 ? -26.119 80.872  26.956  1.00 44.04  ? 234 GLY B N   1 
ATOM   5952 C CA  . GLY B 1 237 ? -25.870 80.303  25.654  1.00 48.05  ? 234 GLY B CA  1 
ATOM   5953 C C   . GLY B 1 237 ? -24.651 80.906  24.985  1.00 46.12  ? 234 GLY B C   1 
ATOM   5954 O O   . GLY B 1 237 ? -24.142 81.954  25.395  1.00 51.29  ? 234 GLY B O   1 
ATOM   5955 N N   . PRO B 1 238 ? -24.152 80.246  23.935  1.00 29.94  ? 235 PRO B N   1 
ATOM   5956 C CA  . PRO B 1 238 ? -22.988 80.776  23.210  1.00 26.80  ? 235 PRO B CA  1 
ATOM   5957 C C   . PRO B 1 238 ? -23.302 81.970  22.323  1.00 29.11  ? 235 PRO B C   1 
ATOM   5958 O O   . PRO B 1 238 ? -22.379 82.532  21.722  1.00 28.00  ? 235 PRO B O   1 
ATOM   5959 C CB  . PRO B 1 238 ? -22.531 79.576  22.371  1.00 22.35  ? 235 PRO B CB  1 
ATOM   5960 C CG  . PRO B 1 238 ? -23.786 78.805  22.131  1.00 30.72  ? 235 PRO B CG  1 
ATOM   5961 C CD  . PRO B 1 238 ? -24.609 78.957  23.385  1.00 28.30  ? 235 PRO B CD  1 
ATOM   5962 N N   . TRP B 1 239 ? -24.569 82.374  22.221  1.00 19.43  ? 236 TRP B N   1 
ATOM   5963 C CA  . TRP B 1 239 ? -24.973 83.475  21.359  1.00 31.27  ? 236 TRP B CA  1 
ATOM   5964 C C   . TRP B 1 239 ? -25.507 84.681  22.114  1.00 29.47  ? 236 TRP B C   1 
ATOM   5965 O O   . TRP B 1 239 ? -25.609 85.760  21.524  1.00 30.40  ? 236 TRP B O   1 
ATOM   5966 C CB  . TRP B 1 239 ? -26.050 83.003  20.372  1.00 17.43  ? 236 TRP B CB  1 
ATOM   5967 C CG  . TRP B 1 239 ? -27.223 82.373  21.061  1.00 24.45  ? 236 TRP B CG  1 
ATOM   5968 C CD1 . TRP B 1 239 ? -27.400 81.047  21.328  1.00 24.15  ? 236 TRP B CD1 1 
ATOM   5969 C CD2 . TRP B 1 239 ? -28.373 83.046  21.588  1.00 23.99  ? 236 TRP B CD2 1 
ATOM   5970 N NE1 . TRP B 1 239 ? -28.593 80.851  21.982  1.00 24.32  ? 236 TRP B NE1 1 
ATOM   5971 C CE2 . TRP B 1 239 ? -29.209 82.062  22.154  1.00 26.28  ? 236 TRP B CE2 1 
ATOM   5972 C CE3 . TRP B 1 239 ? -28.780 84.383  21.632  1.00 24.00  ? 236 TRP B CE3 1 
ATOM   5973 C CZ2 . TRP B 1 239 ? -30.427 82.374  22.756  1.00 31.21  ? 236 TRP B CZ2 1 
ATOM   5974 C CZ3 . TRP B 1 239 ? -29.988 84.690  22.231  1.00 25.08  ? 236 TRP B CZ3 1 
ATOM   5975 C CH2 . TRP B 1 239 ? -30.797 83.690  22.784  1.00 28.18  ? 236 TRP B CH2 1 
ATOM   5976 N N   . ALA B 1 240 ? -25.851 84.528  23.394  1.00 25.02  ? 237 ALA B N   1 
ATOM   5977 C CA  . ALA B 1 240 ? -26.532 85.588  24.125  1.00 24.55  ? 237 ALA B CA  1 
ATOM   5978 C C   . ALA B 1 240 ? -25.592 86.672  24.634  1.00 25.68  ? 237 ALA B C   1 
ATOM   5979 O O   . ALA B 1 240 ? -26.051 87.783  24.916  1.00 30.65  ? 237 ALA B O   1 
ATOM   5980 C CB  . ALA B 1 240 ? -27.310 84.996  25.302  1.00 22.49  ? 237 ALA B CB  1 
ATOM   5981 N N   . THR B 1 241 ? -24.299 86.383  24.764  1.00 25.15  ? 238 THR B N   1 
ATOM   5982 C CA  . THR B 1 241 ? -23.352 87.357  25.288  1.00 22.24  ? 238 THR B CA  1 
ATOM   5983 C C   . THR B 1 241 ? -22.095 87.370  24.431  1.00 23.54  ? 238 THR B C   1 
ATOM   5984 O O   . THR B 1 241 ? -21.817 86.434  23.679  1.00 27.75  ? 238 THR B O   1 
ATOM   5985 C CB  . THR B 1 241 ? -22.974 87.065  26.749  1.00 27.19  ? 238 THR B CB  1 
ATOM   5986 O OG1 . THR B 1 241 ? -22.493 85.720  26.860  1.00 30.67  ? 238 THR B OG1 1 
ATOM   5987 C CG2 . THR B 1 241 ? -24.174 87.255  27.668  1.00 20.34  ? 238 THR B CG2 1 
ATOM   5988 N N   . VAL B 1 242 ? -21.334 88.460  24.559  1.00 21.70  ? 239 VAL B N   1 
ATOM   5989 C CA  . VAL B 1 242 ? -20.034 88.602  23.917  1.00 29.57  ? 239 VAL B CA  1 
ATOM   5990 C C   . VAL B 1 242 ? -19.085 89.283  24.892  1.00 28.37  ? 239 VAL B C   1 
ATOM   5991 O O   . VAL B 1 242 ? -19.502 89.932  25.854  1.00 30.01  ? 239 VAL B O   1 
ATOM   5992 C CB  . VAL B 1 242 ? -20.101 89.406  22.598  1.00 28.51  ? 239 VAL B CB  1 
ATOM   5993 C CG1 . VAL B 1 242 ? -20.729 88.573  21.491  1.00 35.24  ? 239 VAL B CG1 1 
ATOM   5994 C CG2 . VAL B 1 242 ? -20.867 90.705  22.805  1.00 31.37  ? 239 VAL B CG2 1 
ATOM   5995 N N   . GLY B 1 243 ? -17.786 89.126  24.630  1.00 40.65  ? 240 GLY B N   1 
ATOM   5996 C CA  . GLY B 1 243 ? -16.778 89.747  25.460  1.00 33.87  ? 240 GLY B CA  1 
ATOM   5997 C C   . GLY B 1 243 ? -16.572 91.214  25.131  1.00 38.73  ? 240 GLY B C   1 
ATOM   5998 O O   . GLY B 1 243 ? -17.020 91.723  24.103  1.00 39.06  ? 240 GLY B O   1 
ATOM   5999 N N   . MET B 1 244 ? -15.872 91.901  26.037  1.00 36.03  ? 241 MET B N   1 
ATOM   6000 C CA  . MET B 1 244 ? -15.611 93.325  25.845  1.00 40.83  ? 241 MET B CA  1 
ATOM   6001 C C   . MET B 1 244 ? -14.733 93.568  24.624  1.00 42.19  ? 241 MET B C   1 
ATOM   6002 O O   . MET B 1 244 ? -14.960 94.520  23.867  1.00 42.95  ? 241 MET B O   1 
ATOM   6003 C CB  . MET B 1 244 ? -14.964 93.917  27.097  1.00 38.47  ? 241 MET B CB  1 
ATOM   6004 C CG  . MET B 1 244 ? -15.916 94.073  28.271  1.00 48.56  ? 241 MET B CG  1 
ATOM   6005 S SD  . MET B 1 244 ? -15.142 94.847  29.704  1.00 72.38  ? 241 MET B SD  1 
ATOM   6006 C CE  . MET B 1 244 ? -13.961 93.587  30.175  1.00 51.16  ? 241 MET B CE  1 
ATOM   6007 N N   . GLY B 1 245 ? -13.726 92.719  24.414  1.00 32.16  ? 242 GLY B N   1 
ATOM   6008 C CA  . GLY B 1 245 ? -12.853 92.894  23.265  1.00 30.45  ? 242 GLY B CA  1 
ATOM   6009 C C   . GLY B 1 245 ? -13.566 92.667  21.946  1.00 38.29  ? 242 GLY B C   1 
ATOM   6010 O O   . GLY B 1 245 ? -13.333 93.388  20.972  1.00 38.68  ? 242 GLY B O   1 
ATOM   6011 N N   . GLU B 1 246 ? -14.448 91.666  21.896  1.00 38.21  ? 243 GLU B N   1 
ATOM   6012 C CA  . GLU B 1 246 ? -15.171 91.384  20.660  1.00 46.08  ? 243 GLU B CA  1 
ATOM   6013 C C   . GLU B 1 246 ? -16.238 92.438  20.391  1.00 43.20  ? 243 GLU B C   1 
ATOM   6014 O O   . GLU B 1 246 ? -16.454 92.829  19.237  1.00 27.74  ? 243 GLU B O   1 
ATOM   6015 C CB  . GLU B 1 246 ? -15.792 89.988  20.722  1.00 35.36  ? 243 GLU B CB  1 
ATOM   6016 C CG  . GLU B 1 246 ? -16.597 89.601  19.488  1.00 43.76  ? 243 GLU B CG  1 
ATOM   6017 C CD  . GLU B 1 246 ? -15.746 89.484  18.236  1.00 40.35  ? 243 GLU B CD  1 
ATOM   6018 O OE1 . GLU B 1 246 ? -14.516 89.301  18.359  1.00 45.90  ? 243 GLU B OE1 1 
ATOM   6019 O OE2 . GLU B 1 246 ? -16.310 89.576  17.125  1.00 42.42  ? 243 GLU B OE2 1 
ATOM   6020 N N   . ALA B 1 247 ? -16.914 92.912  21.441  1.00 35.84  ? 244 ALA B N   1 
ATOM   6021 C CA  . ALA B 1 247 ? -17.914 93.960  21.263  1.00 33.36  ? 244 ALA B CA  1 
ATOM   6022 C C   . ALA B 1 247 ? -17.285 95.252  20.760  1.00 40.39  ? 244 ALA B C   1 
ATOM   6023 O O   . ALA B 1 247 ? -17.912 95.988  19.988  1.00 35.79  ? 244 ALA B O   1 
ATOM   6024 C CB  . ALA B 1 247 ? -18.659 94.206  22.575  1.00 32.45  ? 244 ALA B CB  1 
ATOM   6025 N N   . ARG B 1 248 ? -16.052 95.543  21.180  1.00 35.65  ? 245 ARG B N   1 
ATOM   6026 C CA  . ARG B 1 248 ? -15.361 96.725  20.679  1.00 35.18  ? 245 ARG B CA  1 
ATOM   6027 C C   . ARG B 1 248 ? -14.968 96.555  19.217  1.00 36.74  ? 245 ARG B C   1 
ATOM   6028 O O   . ARG B 1 248 ? -15.032 97.511  18.435  1.00 30.99  ? 245 ARG B O   1 
ATOM   6029 C CB  . ARG B 1 248 ? -14.132 97.016  21.540  1.00 38.71  ? 245 ARG B CB  1 
ATOM   6030 C CG  . ARG B 1 248 ? -13.246 98.131  21.012  1.00 31.97  ? 245 ARG B CG  1 
ATOM   6031 C CD  . ARG B 1 248 ? -12.194 98.526  22.033  1.00 35.05  ? 245 ARG B CD  1 
ATOM   6032 N NE  . ARG B 1 248 ? -12.802 99.029  23.261  1.00 42.45  ? 245 ARG B NE  1 
ATOM   6033 C CZ  . ARG B 1 248 ? -13.142 100.298 23.459  1.00 46.34  ? 245 ARG B CZ  1 
ATOM   6034 N NH1 . ARG B 1 248 ? -12.931 101.199 22.508  1.00 36.06  ? 245 ARG B NH1 1 
ATOM   6035 N NH2 . ARG B 1 248 ? -13.692 100.668 24.608  1.00 43.16  ? 245 ARG B NH2 1 
ATOM   6036 N N   . ARG B 1 249 ? -14.564 95.343  18.828  1.00 31.98  ? 246 ARG B N   1 
ATOM   6037 C CA  . ARG B 1 249 ? -14.185 95.104  17.439  1.00 38.68  ? 246 ARG B CA  1 
ATOM   6038 C C   . ARG B 1 249 ? -15.385 95.227  16.509  1.00 28.67  ? 246 ARG B C   1 
ATOM   6039 O O   . ARG B 1 249 ? -15.267 95.766  15.402  1.00 32.66  ? 246 ARG B O   1 
ATOM   6040 C CB  . ARG B 1 249 ? -13.541 93.725  17.299  1.00 28.93  ? 246 ARG B CB  1 
ATOM   6041 C CG  . ARG B 1 249 ? -12.933 93.471  15.928  1.00 42.92  ? 246 ARG B CG  1 
ATOM   6042 C CD  . ARG B 1 249 ? -12.766 91.986  15.656  1.00 40.87  ? 246 ARG B CD  1 
ATOM   6043 N NE  . ARG B 1 249 ? -14.050 91.293  15.627  1.00 54.77  ? 246 ARG B NE  1 
ATOM   6044 C CZ  . ARG B 1 249 ? -14.845 91.235  14.564  1.00 47.91  ? 246 ARG B CZ  1 
ATOM   6045 N NH1 . ARG B 1 249 ? -14.491 91.834  13.434  1.00 40.82  ? 246 ARG B NH1 1 
ATOM   6046 N NH2 . ARG B 1 249 ? -15.998 90.582  14.629  1.00 36.41  ? 246 ARG B NH2 1 
ATOM   6047 N N   . ARG B 1 250 ? -16.549 94.734  16.939  1.00 30.12  ? 247 ARG B N   1 
ATOM   6048 C CA  . ARG B 1 250 ? -17.738 94.811  16.097  1.00 28.99  ? 247 ARG B CA  1 
ATOM   6049 C C   . ARG B 1 250 ? -18.239 96.245  15.977  1.00 28.50  ? 247 ARG B C   1 
ATOM   6050 O O   . ARG B 1 250 ? -18.662 96.671  14.895  1.00 29.64  ? 247 ARG B O   1 
ATOM   6051 C CB  . ARG B 1 250 ? -18.833 93.900  16.653  1.00 31.83  ? 247 ARG B CB  1 
ATOM   6052 C CG  . ARG B 1 250 ? -18.451 92.428  16.682  1.00 30.55  ? 247 ARG B CG  1 
ATOM   6053 C CD  . ARG B 1 250 ? -19.565 91.572  17.263  1.00 31.29  ? 247 ARG B CD  1 
ATOM   6054 N NE  . ARG B 1 250 ? -19.206 90.157  17.289  1.00 35.59  ? 247 ARG B NE  1 
ATOM   6055 C CZ  . ARG B 1 250 ? -20.002 89.191  17.735  1.00 37.34  ? 247 ARG B CZ  1 
ATOM   6056 N NH1 . ARG B 1 250 ? -21.211 89.485  18.195  1.00 31.40  ? 247 ARG B NH1 1 
ATOM   6057 N NH2 . ARG B 1 250 ? -19.592 87.930  17.721  1.00 26.99  ? 247 ARG B NH2 1 
ATOM   6058 N N   . ALA B 1 251 ? -18.197 97.005  17.074  1.00 30.46  ? 248 ALA B N   1 
ATOM   6059 C CA  . ALA B 1 251 ? -18.620 98.401  17.020  1.00 29.03  ? 248 ALA B CA  1 
ATOM   6060 C C   . ALA B 1 251 ? -17.679 99.229  16.154  1.00 28.80  ? 248 ALA B C   1 
ATOM   6061 O O   . ALA B 1 251 ? -18.122 100.125 15.426  1.00 27.03  ? 248 ALA B O   1 
ATOM   6062 C CB  . ALA B 1 251 ? -18.703 98.981  18.432  1.00 22.76  ? 248 ALA B CB  1 
ATOM   6063 N N   . THR B 1 252 ? -16.376 98.944  16.219  1.00 32.44  ? 249 THR B N   1 
ATOM   6064 C CA  . THR B 1 252 ? -15.421 99.659  15.380  1.00 27.95  ? 249 THR B CA  1 
ATOM   6065 C C   . THR B 1 252 ? -15.576 99.268  13.916  1.00 30.10  ? 249 THR B C   1 
ATOM   6066 O O   . THR B 1 252 ? -15.434 100.112 13.023  1.00 33.98  ? 249 THR B O   1 
ATOM   6067 C CB  . THR B 1 252 ? -13.995 99.389  15.862  1.00 33.43  ? 249 THR B CB  1 
ATOM   6068 O OG1 . THR B 1 252 ? -13.891 99.716  17.254  1.00 36.56  ? 249 THR B OG1 1 
ATOM   6069 C CG2 . THR B 1 252 ? -12.994 100.226 15.078  1.00 25.56  ? 249 THR B CG2 1 
ATOM   6070 N N   . GLN B 1 253 ? -15.878 97.995  13.650  1.00 30.00  ? 250 GLN B N   1 
ATOM   6071 C CA  . GLN B 1 253 ? -16.074 97.554  12.273  1.00 28.09  ? 250 GLN B CA  1 
ATOM   6072 C C   . GLN B 1 253 ? -17.330 98.169  11.669  1.00 33.94  ? 250 GLN B C   1 
ATOM   6073 O O   . GLN B 1 253 ? -17.333 98.561  10.496  1.00 30.53  ? 250 GLN B O   1 
ATOM   6074 C CB  . GLN B 1 253 ? -16.136 96.027  12.214  1.00 30.02  ? 250 GLN B CB  1 
ATOM   6075 C CG  . GLN B 1 253 ? -16.443 95.461  10.833  1.00 37.88  ? 250 GLN B CG  1 
ATOM   6076 C CD  . GLN B 1 253 ? -15.367 95.775  9.809   1.00 47.99  ? 250 GLN B CD  1 
ATOM   6077 O OE1 . GLN B 1 253 ? -14.229 96.093  10.159  1.00 64.21  ? 250 GLN B OE1 1 
ATOM   6078 N NE2 . GLN B 1 253 ? -15.724 95.686  8.533   1.00 55.68  ? 250 GLN B NE2 1 
ATOM   6079 N N   . LEU B 1 254 ? -18.409 98.262  12.452  1.00 33.01  ? 251 LEU B N   1 
ATOM   6080 C CA  . LEU B 1 254 ? -19.620 98.912  11.961  1.00 30.05  ? 251 LEU B CA  1 
ATOM   6081 C C   . LEU B 1 254 ? -19.367 100.383 11.658  1.00 26.08  ? 251 LEU B C   1 
ATOM   6082 O O   . LEU B 1 254 ? -19.853 100.909 10.650  1.00 36.33  ? 251 LEU B O   1 
ATOM   6083 C CB  . LEU B 1 254 ? -20.751 98.766  12.979  1.00 29.79  ? 251 LEU B CB  1 
ATOM   6084 C CG  . LEU B 1 254 ? -22.055 99.473  12.599  1.00 24.85  ? 251 LEU B CG  1 
ATOM   6085 C CD1 . LEU B 1 254 ? -22.694 98.810  11.387  1.00 21.65  ? 251 LEU B CD1 1 
ATOM   6086 C CD2 . LEU B 1 254 ? -23.023 99.511  13.772  1.00 32.61  ? 251 LEU B CD2 1 
ATOM   6087 N N   . ALA B 1 255 ? -18.607 101.062 12.521  1.00 28.78  ? 252 ALA B N   1 
ATOM   6088 C CA  . ALA B 1 255 ? -18.268 102.458 12.268  1.00 34.14  ? 252 ALA B CA  1 
ATOM   6089 C C   . ALA B 1 255 ? -17.456 102.602 10.988  1.00 33.56  ? 252 ALA B C   1 
ATOM   6090 O O   . ALA B 1 255 ? -17.677 103.534 10.205  1.00 33.83  ? 252 ALA B O   1 
ATOM   6091 C CB  . ALA B 1 255 ? -17.505 103.036 13.459  1.00 38.47  ? 252 ALA B CB  1 
ATOM   6092 N N   . HIS B 1 256 ? -16.513 101.686 10.755  1.00 31.51  ? 253 HIS B N   1 
ATOM   6093 C CA  . HIS B 1 256 ? -15.725 101.730 9.528   1.00 32.38  ? 253 HIS B CA  1 
ATOM   6094 C C   . HIS B 1 256 ? -16.603 101.534 8.299   1.00 29.22  ? 253 HIS B C   1 
ATOM   6095 O O   . HIS B 1 256 ? -16.395 102.184 7.267   1.00 31.72  ? 253 HIS B O   1 
ATOM   6096 C CB  . HIS B 1 256 ? -14.626 100.669 9.572   1.00 31.05  ? 253 HIS B CB  1 
ATOM   6097 C CG  . HIS B 1 256 ? -13.955 100.442 8.253   1.00 43.82  ? 253 HIS B CG  1 
ATOM   6098 N ND1 . HIS B 1 256 ? -13.006 101.300 7.742   1.00 40.44  ? 253 HIS B ND1 1 
ATOM   6099 C CD2 . HIS B 1 256 ? -14.104 99.456  7.336   1.00 34.86  ? 253 HIS B CD2 1 
ATOM   6100 C CE1 . HIS B 1 256 ? -12.594 100.850 6.570   1.00 44.28  ? 253 HIS B CE1 1 
ATOM   6101 N NE2 . HIS B 1 256 ? -13.246 99.733  6.300   1.00 41.20  ? 253 HIS B NE2 1 
ATOM   6102 N N   . LEU B 1 257 ? -17.594 100.643 8.390   1.00 29.87  ? 254 LEU B N   1 
ATOM   6103 C CA  . LEU B 1 257 ? -18.456 100.370 7.245   1.00 32.25  ? 254 LEU B CA  1 
ATOM   6104 C C   . LEU B 1 257 ? -19.319 101.572 6.883   1.00 33.56  ? 254 LEU B C   1 
ATOM   6105 O O   . LEU B 1 257 ? -19.713 101.719 5.721   1.00 28.87  ? 254 LEU B O   1 
ATOM   6106 C CB  . LEU B 1 257 ? -19.335 99.152  7.528   1.00 24.91  ? 254 LEU B CB  1 
ATOM   6107 C CG  . LEU B 1 257 ? -18.627 97.796  7.544   1.00 30.34  ? 254 LEU B CG  1 
ATOM   6108 C CD1 . LEU B 1 257 ? -19.567 96.705  8.030   1.00 22.72  ? 254 LEU B CD1 1 
ATOM   6109 C CD2 . LEU B 1 257 ? -18.084 97.462  6.163   1.00 23.03  ? 254 LEU B CD2 1 
ATOM   6110 N N   . VAL B 1 258 ? -19.623 102.434 7.849   1.00 27.86  ? 255 VAL B N   1 
ATOM   6111 C CA  . VAL B 1 258 ? -20.435 103.618 7.600   1.00 28.68  ? 255 VAL B CA  1 
ATOM   6112 C C   . VAL B 1 258 ? -19.572 104.877 7.493   1.00 33.39  ? 255 VAL B C   1 
ATOM   6113 O O   . VAL B 1 258 ? -20.088 105.990 7.587   1.00 38.08  ? 255 VAL B O   1 
ATOM   6114 C CB  . VAL B 1 258 ? -21.532 103.783 8.663   1.00 31.38  ? 255 VAL B CB  1 
ATOM   6115 C CG1 . VAL B 1 258 ? -22.454 102.572 8.663   1.00 26.36  ? 255 VAL B CG1 1 
ATOM   6116 C CG2 . VAL B 1 258 ? -20.915 103.990 10.038  1.00 27.52  ? 255 VAL B CG2 1 
ATOM   6117 N N   . GLY B 1 259 ? -18.266 104.718 7.296   1.00 35.20  ? 256 GLY B N   1 
ATOM   6118 C CA  . GLY B 1 259 ? -17.394 105.861 7.107   1.00 38.58  ? 256 GLY B CA  1 
ATOM   6119 C C   . GLY B 1 259 ? -17.021 106.604 8.368   1.00 40.14  ? 256 GLY B C   1 
ATOM   6120 O O   . GLY B 1 259 ? -16.776 107.814 8.314   1.00 46.27  ? 256 GLY B O   1 
ATOM   6121 N N   . CYS B 1 260 ? -16.966 105.918 9.506   1.00 37.83  ? 257 CYS B N   1 
ATOM   6122 C CA  . CYS B 1 260 ? -16.597 106.531 10.769  1.00 46.08  ? 257 CYS B CA  1 
ATOM   6123 C C   . CYS B 1 260 ? -15.317 105.900 11.298  1.00 47.62  ? 257 CYS B C   1 
ATOM   6124 O O   . CYS B 1 260 ? -15.238 104.668 11.404  1.00 48.35  ? 257 CYS B O   1 
ATOM   6125 C CB  . CYS B 1 260 ? -17.721 106.377 11.806  1.00 37.83  ? 257 CYS B CB  1 
ATOM   6126 S SG  . CYS B 1 260 ? -19.186 107.386 11.490  1.00 53.67  ? 257 CYS B SG  1 
ATOM   6127 N N   . PRO B 1 261 ? -14.294 106.697 11.641  1.00 58.84  ? 258 PRO B N   1 
ATOM   6128 C CA  . PRO B 1 261 ? -14.302 108.157 11.509  1.00 65.48  ? 258 PRO B CA  1 
ATOM   6129 C C   . PRO B 1 261 ? -13.936 108.606 10.096  1.00 69.24  ? 258 PRO B C   1 
ATOM   6130 O O   . PRO B 1 261 ? -13.391 107.804 9.337   1.00 64.24  ? 258 PRO B O   1 
ATOM   6131 C CB  . PRO B 1 261 ? -13.238 108.595 12.514  1.00 60.53  ? 258 PRO B CB  1 
ATOM   6132 C CG  . PRO B 1 261 ? -12.254 107.477 12.494  1.00 60.20  ? 258 PRO B CG  1 
ATOM   6133 C CD  . PRO B 1 261 ? -13.053 106.213 12.273  1.00 60.23  ? 258 PRO B CD  1 
ATOM   6134 N N   . PRO B 1 262 ? -14.247 109.855 9.747   1.00 71.88  ? 259 PRO B N   1 
ATOM   6135 C CA  . PRO B 1 262 ? -13.826 110.374 8.441   1.00 70.43  ? 259 PRO B CA  1 
ATOM   6136 C C   . PRO B 1 262 ? -12.315 110.288 8.280   1.00 81.48  ? 259 PRO B C   1 
ATOM   6137 O O   . PRO B 1 262 ? -11.560 110.454 9.240   1.00 90.82  ? 259 PRO B O   1 
ATOM   6138 C CB  . PRO B 1 262 ? -14.311 111.828 8.464   1.00 70.26  ? 259 PRO B CB  1 
ATOM   6139 C CG  . PRO B 1 262 ? -15.457 111.820 9.420   1.00 70.00  ? 259 PRO B CG  1 
ATOM   6140 C CD  . PRO B 1 262 ? -15.095 110.814 10.477  1.00 65.50  ? 259 PRO B CD  1 
ATOM   6141 N N   . GLY B 1 263 ? -11.883 110.016 7.049   1.00 74.87  ? 260 GLY B N   1 
ATOM   6142 C CA  . GLY B 1 263 ? -10.479 109.813 6.744   1.00 76.96  ? 260 GLY B CA  1 
ATOM   6143 C C   . GLY B 1 263 ? -9.566  110.922 7.224   1.00 87.55  ? 260 GLY B C   1 
ATOM   6144 O O   . GLY B 1 263 ? -9.621  112.047 6.719   1.00 91.89  ? 260 GLY B O   1 
ATOM   6145 N N   . GLY B 1 264 ? -8.722  110.612 8.200   1.00 91.21  ? 261 GLY B N   1 
ATOM   6146 C CA  . GLY B 1 264 ? -7.825  111.582 8.781   1.00 88.19  ? 261 GLY B CA  1 
ATOM   6147 C C   . GLY B 1 264 ? -8.250  112.137 10.122  1.00 90.16  ? 261 GLY B C   1 
ATOM   6148 O O   . GLY B 1 264 ? -7.848  113.255 10.463  1.00 95.13  ? 261 GLY B O   1 
ATOM   6149 N N   . THR B 1 265 ? -9.045  111.397 10.891  1.00 83.31  ? 262 THR B N   1 
ATOM   6150 C CA  . THR B 1 265 ? -9.548  111.849 12.180  1.00 90.07  ? 262 THR B CA  1 
ATOM   6151 C C   . THR B 1 265 ? -9.244  110.795 13.235  1.00 88.54  ? 262 THR B C   1 
ATOM   6152 O O   . THR B 1 265 ? -9.337  109.594 12.965  1.00 85.83  ? 262 THR B O   1 
ATOM   6153 C CB  . THR B 1 265 ? -11.062 112.122 12.120  1.00 85.30  ? 262 THR B CB  1 
ATOM   6154 O OG1 . THR B 1 265 ? -11.330 113.118 11.125  1.00 80.09  ? 262 THR B OG1 1 
ATOM   6155 C CG2 . THR B 1 265 ? -11.584 112.607 13.466  1.00 85.48  ? 262 THR B CG2 1 
ATOM   6156 N N   . GLY B 1 266 ? -8.867  111.251 14.428  1.00 95.18  ? 263 GLY B N   1 
ATOM   6157 C CA  . GLY B 1 266 ? -8.621  110.327 15.519  1.00 92.71  ? 263 GLY B CA  1 
ATOM   6158 C C   . GLY B 1 266 ? -9.850  109.500 15.845  1.00 90.54  ? 263 GLY B C   1 
ATOM   6159 O O   . GLY B 1 266 ? -10.989 109.948 15.698  1.00 79.33  ? 263 GLY B O   1 
ATOM   6160 N N   . GLY B 1 267 ? -9.610  108.272 16.295  1.00 94.33  ? 264 GLY B N   1 
ATOM   6161 C CA  . GLY B 1 267 ? -10.695 107.338 16.516  1.00 77.01  ? 264 GLY B CA  1 
ATOM   6162 C C   . GLY B 1 267 ? -10.883 106.896 17.952  1.00 74.36  ? 264 GLY B C   1 
ATOM   6163 O O   . GLY B 1 267 ? -11.006 105.697 18.221  1.00 68.30  ? 264 GLY B O   1 
ATOM   6164 N N   . ASN B 1 268 ? -10.909 107.844 18.886  1.00 69.37  ? 265 ASN B N   1 
ATOM   6165 C CA  . ASN B 1 268 ? -11.239 107.497 20.258  1.00 61.81  ? 265 ASN B CA  1 
ATOM   6166 C C   . ASN B 1 268 ? -12.739 107.230 20.381  1.00 56.38  ? 265 ASN B C   1 
ATOM   6167 O O   . ASN B 1 268 ? -13.519 107.461 19.452  1.00 53.72  ? 265 ASN B O   1 
ATOM   6168 C CB  . ASN B 1 268 ? -10.788 108.598 21.220  1.00 58.24  ? 265 ASN B CB  1 
ATOM   6169 C CG  . ASN B 1 268 ? -11.310 109.972 20.836  1.00 66.84  ? 265 ASN B CG  1 
ATOM   6170 O OD1 . ASN B 1 268 ? -12.482 110.137 20.502  1.00 67.01  ? 265 ASN B OD1 1 
ATOM   6171 N ND2 . ASN B 1 268 ? -10.433 110.968 20.885  1.00 64.51  ? 265 ASN B ND2 1 
ATOM   6172 N N   . ASP B 1 269 ? -13.141 106.734 21.553  1.00 56.24  ? 266 ASP B N   1 
ATOM   6173 C CA  . ASP B 1 269 ? -14.529 106.321 21.742  1.00 51.34  ? 266 ASP B CA  1 
ATOM   6174 C C   . ASP B 1 269 ? -15.497 107.492 21.619  1.00 53.53  ? 266 ASP B C   1 
ATOM   6175 O O   . ASP B 1 269 ? -16.623 107.315 21.141  1.00 53.69  ? 266 ASP B O   1 
ATOM   6176 C CB  . ASP B 1 269 ? -14.691 105.636 23.098  1.00 46.96  ? 266 ASP B CB  1 
ATOM   6177 C CG  . ASP B 1 269 ? -13.976 104.301 23.164  1.00 55.73  ? 266 ASP B CG  1 
ATOM   6178 O OD1 . ASP B 1 269 ? -13.464 103.848 22.119  1.00 50.34  ? 266 ASP B OD1 1 
ATOM   6179 O OD2 . ASP B 1 269 ? -13.924 103.706 24.261  1.00 55.70  ? 266 ASP B OD2 1 
ATOM   6180 N N   . THR B 1 270 ? -15.083 108.689 22.037  1.00 56.27  ? 267 THR B N   1 
ATOM   6181 C CA  . THR B 1 270 ? -15.970 109.845 21.954  1.00 57.14  ? 267 THR B CA  1 
ATOM   6182 C C   . THR B 1 270 ? -16.212 110.252 20.505  1.00 49.48  ? 267 THR B C   1 
ATOM   6183 O O   . THR B 1 270 ? -17.361 110.426 20.081  1.00 44.02  ? 267 THR B O   1 
ATOM   6184 C CB  . THR B 1 270 ? -15.390 111.014 22.751  1.00 55.18  ? 267 THR B CB  1 
ATOM   6185 O OG1 . THR B 1 270 ? -15.323 110.663 24.139  1.00 44.50  ? 267 THR B OG1 1 
ATOM   6186 C CG2 . THR B 1 270 ? -16.258 112.254 22.589  1.00 42.97  ? 267 THR B CG2 1 
ATOM   6187 N N   . GLU B 1 271 ? -15.138 110.404 19.728  1.00 52.40  ? 268 GLU B N   1 
ATOM   6188 C CA  . GLU B 1 271 ? -15.276 110.809 18.334  1.00 57.08  ? 268 GLU B CA  1 
ATOM   6189 C C   . GLU B 1 271 ? -15.873 109.710 17.464  1.00 54.38  ? 268 GLU B C   1 
ATOM   6190 O O   . GLU B 1 271 ? -16.424 110.011 16.400  1.00 56.74  ? 268 GLU B O   1 
ATOM   6191 C CB  . GLU B 1 271 ? -13.918 111.240 17.780  1.00 51.72  ? 268 GLU B CB  1 
ATOM   6192 C CG  . GLU B 1 271 ? -13.380 112.516 18.409  1.00 72.94  ? 268 GLU B CG  1 
ATOM   6193 C CD  . GLU B 1 271 ? -11.880 112.664 18.248  1.00 87.73  ? 268 GLU B CD  1 
ATOM   6194 O OE1 . GLU B 1 271 ? -11.202 111.641 18.017  1.00 74.49  ? 268 GLU B OE1 1 
ATOM   6195 O OE2 . GLU B 1 271 ? -11.379 113.803 18.355  1.00 78.54  ? 268 GLU B OE2 1 
ATOM   6196 N N   . LEU B 1 272 ? -15.781 108.449 17.890  1.00 48.89  ? 269 LEU B N   1 
ATOM   6197 C CA  . LEU B 1 272 ? -16.350 107.361 17.103  1.00 47.06  ? 269 LEU B CA  1 
ATOM   6198 C C   . LEU B 1 272 ? -17.864 107.285 17.266  1.00 44.26  ? 269 LEU B C   1 
ATOM   6199 O O   . LEU B 1 272 ? -18.587 107.085 16.284  1.00 41.49  ? 269 LEU B O   1 
ATOM   6200 C CB  . LEU B 1 272 ? -15.703 106.032 17.497  1.00 49.30  ? 269 LEU B CB  1 
ATOM   6201 C CG  . LEU B 1 272 ? -15.808 104.897 16.477  1.00 50.82  ? 269 LEU B CG  1 
ATOM   6202 C CD1 . LEU B 1 272 ? -15.087 105.273 15.193  1.00 37.52  ? 269 LEU B CD1 1 
ATOM   6203 C CD2 . LEU B 1 272 ? -15.249 103.603 17.050  1.00 45.67  ? 269 LEU B CD2 1 
ATOM   6204 N N   . VAL B 1 273 ? -18.360 107.444 18.495  1.00 36.76  ? 270 VAL B N   1 
ATOM   6205 C CA  . VAL B 1 273 ? -19.802 107.416 18.722  1.00 37.56  ? 270 VAL B CA  1 
ATOM   6206 C C   . VAL B 1 273 ? -20.452 108.684 18.181  1.00 41.75  ? 270 VAL B C   1 
ATOM   6207 O O   . VAL B 1 273 ? -21.577 108.650 17.668  1.00 42.74  ? 270 VAL B O   1 
ATOM   6208 C CB  . VAL B 1 273 ? -20.102 107.213 20.219  1.00 34.02  ? 270 VAL B CB  1 
ATOM   6209 C CG1 . VAL B 1 273 ? -21.603 107.235 20.474  1.00 37.21  ? 270 VAL B CG1 1 
ATOM   6210 C CG2 . VAL B 1 273 ? -19.503 105.905 20.704  1.00 40.03  ? 270 VAL B CG2 1 
ATOM   6211 N N   . ALA B 1 274 ? -19.756 109.819 18.282  1.00 40.31  ? 271 ALA B N   1 
ATOM   6212 C CA  . ALA B 1 274 ? -20.294 111.066 17.747  1.00 36.95  ? 271 ALA B CA  1 
ATOM   6213 C C   . ALA B 1 274 ? -20.498 110.975 16.240  1.00 44.62  ? 271 ALA B C   1 
ATOM   6214 O O   . ALA B 1 274 ? -21.476 111.508 15.704  1.00 46.48  ? 271 ALA B O   1 
ATOM   6215 C CB  . ALA B 1 274 ? -19.368 112.231 18.095  1.00 36.69  ? 271 ALA B CB  1 
ATOM   6216 N N   . CYS B 1 275 ? -19.583 110.300 15.539  1.00 39.75  ? 272 CYS B N   1 
ATOM   6217 C CA  . CYS B 1 275 ? -19.765 110.081 14.108  1.00 38.00  ? 272 CYS B CA  1 
ATOM   6218 C C   . CYS B 1 275 ? -20.911 109.113 13.842  1.00 36.23  ? 272 CYS B C   1 
ATOM   6219 O O   . CYS B 1 275 ? -21.641 109.264 12.855  1.00 35.51  ? 272 CYS B O   1 
ATOM   6220 C CB  . CYS B 1 275 ? -18.466 109.563 13.490  1.00 39.36  ? 272 CYS B CB  1 
ATOM   6221 S SG  . CYS B 1 275 ? -18.521 109.296 11.701  1.00 68.30  ? 272 CYS B SG  1 
ATOM   6222 N N   . LEU B 1 276 ? -21.084 108.113 14.710  1.00 33.94  ? 273 LEU B N   1 
ATOM   6223 C CA  . LEU B 1 276 ? -22.178 107.163 14.541  1.00 30.62  ? 273 LEU B CA  1 
ATOM   6224 C C   . LEU B 1 276 ? -23.535 107.816 14.768  1.00 36.09  ? 273 LEU B C   1 
ATOM   6225 O O   . LEU B 1 276 ? -24.518 107.441 14.118  1.00 39.28  ? 273 LEU B O   1 
ATOM   6226 C CB  . LEU B 1 276 ? -22.002 105.977 15.489  1.00 31.62  ? 273 LEU B CB  1 
ATOM   6227 C CG  . LEU B 1 276 ? -20.952 104.932 15.109  1.00 44.24  ? 273 LEU B CG  1 
ATOM   6228 C CD1 . LEU B 1 276 ? -20.817 103.887 16.206  1.00 27.57  ? 273 LEU B CD1 1 
ATOM   6229 C CD2 . LEU B 1 276 ? -21.314 104.276 13.786  1.00 28.23  ? 273 LEU B CD2 1 
ATOM   6230 N N   . ARG B 1 277 ? -23.614 108.788 15.680  1.00 32.44  ? 274 ARG B N   1 
ATOM   6231 C CA  . ARG B 1 277 ? -24.892 109.427 15.970  1.00 39.56  ? 274 ARG B CA  1 
ATOM   6232 C C   . ARG B 1 277 ? -25.363 110.334 14.841  1.00 33.07  ? 274 ARG B C   1 
ATOM   6233 O O   . ARG B 1 277 ? -26.544 110.693 14.807  1.00 37.81  ? 274 ARG B O   1 
ATOM   6234 C CB  . ARG B 1 277 ? -24.806 110.217 17.278  1.00 38.25  ? 274 ARG B CB  1 
ATOM   6235 C CG  . ARG B 1 277 ? -24.858 109.350 18.528  1.00 34.73  ? 274 ARG B CG  1 
ATOM   6236 C CD  . ARG B 1 277 ? -25.225 110.171 19.756  1.00 36.62  ? 274 ARG B CD  1 
ATOM   6237 N NE  . ARG B 1 277 ? -24.074 110.459 20.606  1.00 48.21  ? 274 ARG B NE  1 
ATOM   6238 C CZ  . ARG B 1 277 ? -23.812 109.828 21.746  1.00 48.05  ? 274 ARG B CZ  1 
ATOM   6239 N NH1 . ARG B 1 277 ? -24.623 108.872 22.179  1.00 36.67  ? 274 ARG B NH1 1 
ATOM   6240 N NH2 . ARG B 1 277 ? -22.742 110.155 22.457  1.00 42.59  ? 274 ARG B NH2 1 
ATOM   6241 N N   . THR B 1 278 ? -24.476 110.711 13.920  1.00 33.51  ? 275 THR B N   1 
ATOM   6242 C CA  . THR B 1 278 ? -24.871 111.521 12.775  1.00 32.11  ? 275 THR B CA  1 
ATOM   6243 C C   . THR B 1 278 ? -25.387 110.688 11.610  1.00 35.34  ? 275 THR B C   1 
ATOM   6244 O O   . THR B 1 278 ? -26.013 111.243 10.699  1.00 38.88  ? 275 THR B O   1 
ATOM   6245 C CB  . THR B 1 278 ? -23.696 112.378 12.293  1.00 37.70  ? 275 THR B CB  1 
ATOM   6246 O OG1 . THR B 1 278 ? -22.663 111.529 11.777  1.00 42.78  ? 275 THR B OG1 1 
ATOM   6247 C CG2 . THR B 1 278 ? -23.139 113.210 13.437  1.00 30.76  ? 275 THR B CG2 1 
ATOM   6248 N N   . ARG B 1 279 ? -25.141 109.380 11.616  1.00 33.51  ? 276 ARG B N   1 
ATOM   6249 C CA  . ARG B 1 279 ? -25.576 108.525 10.521  1.00 27.39  ? 276 ARG B CA  1 
ATOM   6250 C C   . ARG B 1 279 ? -27.070 108.228 10.640  1.00 27.47  ? 276 ARG B C   1 
ATOM   6251 O O   . ARG B 1 279 ? -27.583 108.060 11.750  1.00 34.02  ? 276 ARG B O   1 
ATOM   6252 C CB  . ARG B 1 279 ? -24.790 107.216 10.517  1.00 26.91  ? 276 ARG B CB  1 
ATOM   6253 C CG  . ARG B 1 279 ? -23.318 107.375 10.183  1.00 33.57  ? 276 ARG B CG  1 
ATOM   6254 C CD  . ARG B 1 279 ? -23.133 107.884 8.764   1.00 39.33  ? 276 ARG B CD  1 
ATOM   6255 N NE  . ARG B 1 279 ? -21.724 108.051 8.421   1.00 43.33  ? 276 ARG B NE  1 
ATOM   6256 C CZ  . ARG B 1 279 ? -21.041 109.177 8.600   1.00 57.70  ? 276 ARG B CZ  1 
ATOM   6257 N NH1 . ARG B 1 279 ? -21.638 110.241 9.120   1.00 57.27  ? 276 ARG B NH1 1 
ATOM   6258 N NH2 . ARG B 1 279 ? -19.761 109.241 8.258   1.00 50.29  ? 276 ARG B NH2 1 
ATOM   6259 N N   . PRO B 1 280 ? -27.788 108.172 9.519   1.00 27.41  ? 277 PRO B N   1 
ATOM   6260 C CA  . PRO B 1 280 ? -29.191 107.750 9.567   1.00 33.11  ? 277 PRO B CA  1 
ATOM   6261 C C   . PRO B 1 280 ? -29.315 106.335 10.111  1.00 28.63  ? 277 PRO B C   1 
ATOM   6262 O O   . PRO B 1 280 ? -28.426 105.498 9.938   1.00 27.62  ? 277 PRO B O   1 
ATOM   6263 C CB  . PRO B 1 280 ? -29.639 107.831 8.103   1.00 24.69  ? 277 PRO B CB  1 
ATOM   6264 C CG  . PRO B 1 280 ? -28.693 108.803 7.472   1.00 27.02  ? 277 PRO B CG  1 
ATOM   6265 C CD  . PRO B 1 280 ? -27.380 108.593 8.168   1.00 26.16  ? 277 PRO B CD  1 
ATOM   6266 N N   . ALA B 1 281 ? -30.440 106.076 10.781  1.00 25.90  ? 278 ALA B N   1 
ATOM   6267 C CA  . ALA B 1 281 ? -30.626 104.794 11.453  1.00 25.95  ? 278 ALA B CA  1 
ATOM   6268 C C   . ALA B 1 281 ? -30.617 103.636 10.462  1.00 29.14  ? 278 ALA B C   1 
ATOM   6269 O O   . ALA B 1 281 ? -30.104 102.553 10.768  1.00 24.23  ? 278 ALA B O   1 
ATOM   6270 C CB  . ALA B 1 281 ? -31.929 104.807 12.251  1.00 25.98  ? 278 ALA B CB  1 
ATOM   6271 N N   . GLN B 1 282 ? -31.176 103.846 9.268   1.00 27.00  ? 279 GLN B N   1 
ATOM   6272 C CA  . GLN B 1 282 ? -31.214 102.777 8.276   1.00 27.23  ? 279 GLN B CA  1 
ATOM   6273 C C   . GLN B 1 282 ? -29.820 102.436 7.761   1.00 25.72  ? 279 GLN B C   1 
ATOM   6274 O O   . GLN B 1 282 ? -29.569 101.290 7.370   1.00 22.09  ? 279 GLN B O   1 
ATOM   6275 C CB  . GLN B 1 282 ? -32.131 103.169 7.116   1.00 20.62  ? 279 GLN B CB  1 
ATOM   6276 C CG  . GLN B 1 282 ? -32.386 102.052 6.115   1.00 17.54  ? 279 GLN B CG  1 
ATOM   6277 C CD  . GLN B 1 282 ? -33.093 100.863 6.736   1.00 27.12  ? 279 GLN B CD  1 
ATOM   6278 O OE1 . GLN B 1 282 ? -34.144 101.007 7.360   1.00 25.45  ? 279 GLN B OE1 1 
ATOM   6279 N NE2 . GLN B 1 282 ? -32.514 99.679  6.572   1.00 23.66  ? 279 GLN B NE2 1 
ATOM   6280 N N   . VAL B 1 283 ? -28.903 103.407 7.759   1.00 24.81  ? 280 VAL B N   1 
ATOM   6281 C CA  . VAL B 1 283 ? -27.546 103.147 7.289   1.00 27.74  ? 280 VAL B CA  1 
ATOM   6282 C C   . VAL B 1 283 ? -26.843 102.151 8.204   1.00 29.85  ? 280 VAL B C   1 
ATOM   6283 O O   . VAL B 1 283 ? -26.141 101.246 7.736   1.00 31.82  ? 280 VAL B O   1 
ATOM   6284 C CB  . VAL B 1 283 ? -26.760 104.466 7.174   1.00 26.53  ? 280 VAL B CB  1 
ATOM   6285 C CG1 . VAL B 1 283 ? -25.304 104.193 6.828   1.00 24.36  ? 280 VAL B CG1 1 
ATOM   6286 C CG2 . VAL B 1 283 ? -27.397 105.370 6.129   1.00 23.27  ? 280 VAL B CG2 1 
ATOM   6287 N N   . LEU B 1 284 ? -27.022 102.294 9.520   1.00 30.25  ? 281 LEU B N   1 
ATOM   6288 C CA  . LEU B 1 284 ? -26.403 101.359 10.454  1.00 26.06  ? 281 LEU B CA  1 
ATOM   6289 C C   . LEU B 1 284 ? -27.005 99.966  10.324  1.00 32.26  ? 281 LEU B C   1 
ATOM   6290 O O   . LEU B 1 284 ? -26.296 98.962  10.463  1.00 28.63  ? 281 LEU B O   1 
ATOM   6291 C CB  . LEU B 1 284 ? -26.549 101.873 11.886  1.00 17.61  ? 281 LEU B CB  1 
ATOM   6292 C CG  . LEU B 1 284 ? -25.901 103.222 12.202  1.00 31.06  ? 281 LEU B CG  1 
ATOM   6293 C CD1 . LEU B 1 284 ? -26.087 103.574 13.670  1.00 23.53  ? 281 LEU B CD1 1 
ATOM   6294 C CD2 . LEU B 1 284 ? -24.426 103.209 11.832  1.00 23.51  ? 281 LEU B CD2 1 
ATOM   6295 N N   . VAL B 1 285 ? -28.310 99.885  10.055  1.00 25.37  ? 282 VAL B N   1 
ATOM   6296 C CA  . VAL B 1 285 ? -28.966 98.587  9.930   1.00 25.66  ? 282 VAL B CA  1 
ATOM   6297 C C   . VAL B 1 285 ? -28.460 97.845  8.698   1.00 30.53  ? 282 VAL B C   1 
ATOM   6298 O O   . VAL B 1 285 ? -28.282 96.621  8.724   1.00 28.05  ? 282 VAL B O   1 
ATOM   6299 C CB  . VAL B 1 285 ? -30.495 98.767  9.899   1.00 29.03  ? 282 VAL B CB  1 
ATOM   6300 C CG1 . VAL B 1 285 ? -31.188 97.441  9.626   1.00 24.63  ? 282 VAL B CG1 1 
ATOM   6301 C CG2 . VAL B 1 285 ? -30.985 99.365  11.209  1.00 23.45  ? 282 VAL B CG2 1 
ATOM   6302 N N   . ASN B 1 286 ? -28.203 98.570  7.607   1.00 25.01  ? 283 ASN B N   1 
ATOM   6303 C CA  . ASN B 1 286 ? -27.800 97.939  6.355   1.00 25.62  ? 283 ASN B CA  1 
ATOM   6304 C C   . ASN B 1 286 ? -26.412 97.313  6.414   1.00 27.41  ? 283 ASN B C   1 
ATOM   6305 O O   . ASN B 1 286 ? -26.037 96.603  5.475   1.00 33.21  ? 283 ASN B O   1 
ATOM   6306 C CB  . ASN B 1 286 ? -27.856 98.957  5.213   1.00 22.24  ? 283 ASN B CB  1 
ATOM   6307 C CG  . ASN B 1 286 ? -29.262 99.458  4.947   1.00 26.68  ? 283 ASN B CG  1 
ATOM   6308 O OD1 . ASN B 1 286 ? -30.241 98.861  5.395   1.00 27.25  ? 283 ASN B OD1 1 
ATOM   6309 N ND2 . ASN B 1 286 ? -29.369 100.557 4.209   1.00 29.93  ? 283 ASN B ND2 1 
ATOM   6310 N N   . HIS B 1 287 ? -25.645 97.553  7.479   1.00 30.16  ? 284 HIS B N   1 
ATOM   6311 C CA  . HIS B 1 287 ? -24.311 96.980  7.624   1.00 30.55  ? 284 HIS B CA  1 
ATOM   6312 C C   . HIS B 1 287 ? -24.174 96.159  8.902   1.00 33.60  ? 284 HIS B C   1 
ATOM   6313 O O   . HIS B 1 287 ? -23.053 95.870  9.332   1.00 39.16  ? 284 HIS B O   1 
ATOM   6314 C CB  . HIS B 1 287 ? -23.248 98.079  7.588   1.00 23.70  ? 284 HIS B CB  1 
ATOM   6315 C CG  . HIS B 1 287 ? -23.222 98.853  6.308   1.00 24.74  ? 284 HIS B CG  1 
ATOM   6316 N ND1 . HIS B 1 287 ? -22.637 98.369  5.157   1.00 27.78  ? 284 HIS B ND1 1 
ATOM   6317 C CD2 . HIS B 1 287 ? -23.705 100.079 5.997   1.00 23.22  ? 284 HIS B CD2 1 
ATOM   6318 C CE1 . HIS B 1 287 ? -22.765 99.262  4.192   1.00 30.95  ? 284 HIS B CE1 1 
ATOM   6319 N NE2 . HIS B 1 287 ? -23.408 100.309 4.675   1.00 31.37  ? 284 HIS B NE2 1 
ATOM   6320 N N   . GLU B 1 288 ? -25.295 95.772  9.513   1.00 32.64  ? 285 GLU B N   1 
ATOM   6321 C CA  . GLU B 1 288 ? -25.239 95.079  10.797  1.00 35.04  ? 285 GLU B CA  1 
ATOM   6322 C C   . GLU B 1 288 ? -24.668 93.673  10.654  1.00 34.62  ? 285 GLU B C   1 
ATOM   6323 O O   . GLU B 1 288 ? -23.848 93.246  11.476  1.00 38.96  ? 285 GLU B O   1 
ATOM   6324 C CB  . GLU B 1 288 ? -26.632 95.032  11.423  1.00 28.53  ? 285 GLU B CB  1 
ATOM   6325 C CG  . GLU B 1 288 ? -26.750 94.079  12.598  1.00 40.42  ? 285 GLU B CG  1 
ATOM   6326 C CD  . GLU B 1 288 ? -28.130 94.095  13.221  1.00 35.65  ? 285 GLU B CD  1 
ATOM   6327 O OE1 . GLU B 1 288 ? -28.541 95.157  13.734  1.00 39.98  ? 285 GLU B OE1 1 
ATOM   6328 O OE2 . GLU B 1 288 ? -28.807 93.048  13.185  1.00 49.69  ? 285 GLU B OE2 1 
ATOM   6329 N N   . TRP B 1 289 ? -25.083 92.939  9.623   1.00 32.17  ? 286 TRP B N   1 
ATOM   6330 C CA  . TRP B 1 289 ? -24.657 91.554  9.465   1.00 53.39  ? 286 TRP B CA  1 
ATOM   6331 C C   . TRP B 1 289 ? -23.235 91.415  8.939   1.00 53.14  ? 286 TRP B C   1 
ATOM   6332 O O   . TRP B 1 289 ? -22.708 90.297  8.924   1.00 54.96  ? 286 TRP B O   1 
ATOM   6333 C CB  . TRP B 1 289 ? -25.621 90.812  8.536   1.00 39.02  ? 286 TRP B CB  1 
ATOM   6334 C CG  . TRP B 1 289 ? -26.961 90.574  9.151   1.00 50.44  ? 286 TRP B CG  1 
ATOM   6335 C CD1 . TRP B 1 289 ? -28.121 91.239  8.879   1.00 44.45  ? 286 TRP B CD1 1 
ATOM   6336 C CD2 . TRP B 1 289 ? -27.279 89.608  10.160  1.00 43.81  ? 286 TRP B CD2 1 
ATOM   6337 N NE1 . TRP B 1 289 ? -29.143 90.741  9.650   1.00 41.99  ? 286 TRP B NE1 1 
ATOM   6338 C CE2 . TRP B 1 289 ? -28.652 89.740  10.446  1.00 41.89  ? 286 TRP B CE2 1 
ATOM   6339 C CE3 . TRP B 1 289 ? -26.537 88.642  10.846  1.00 43.42  ? 286 TRP B CE3 1 
ATOM   6340 C CZ2 . TRP B 1 289 ? -29.298 88.943  11.388  1.00 35.02  ? 286 TRP B CZ2 1 
ATOM   6341 C CZ3 . TRP B 1 289 ? -27.179 87.852  11.780  1.00 38.86  ? 286 TRP B CZ3 1 
ATOM   6342 C CH2 . TRP B 1 289 ? -28.545 88.007  12.043  1.00 44.97  ? 286 TRP B CH2 1 
ATOM   6343 N N   . HIS B 1 290 ? -22.600 92.508  8.520   1.00 43.00  ? 287 HIS B N   1 
ATOM   6344 C CA  . HIS B 1 290 ? -21.270 92.460  7.931   1.00 41.40  ? 287 HIS B CA  1 
ATOM   6345 C C   . HIS B 1 290 ? -20.157 92.608  8.965   1.00 41.17  ? 287 HIS B C   1 
ATOM   6346 O O   . HIS B 1 290 ? -19.013 92.892  8.592   1.00 55.92  ? 287 HIS B O   1 
ATOM   6347 C CB  . HIS B 1 290 ? -21.134 93.538  6.853   1.00 45.79  ? 287 HIS B CB  1 
ATOM   6348 C CG  . HIS B 1 290 ? -22.169 93.447  5.776   1.00 58.86  ? 287 HIS B CG  1 
ATOM   6349 N ND1 . HIS B 1 290 ? -22.487 94.509  4.956   1.00 65.53  ? 287 HIS B ND1 1 
ATOM   6350 C CD2 . HIS B 1 290 ? -22.960 92.420  5.382   1.00 65.39  ? 287 HIS B CD2 1 
ATOM   6351 C CE1 . HIS B 1 290 ? -23.428 94.141  4.106   1.00 78.45  ? 287 HIS B CE1 1 
ATOM   6352 N NE2 . HIS B 1 290 ? -23.733 92.877  4.343   1.00 71.83  ? 287 HIS B NE2 1 
ATOM   6353 N N   . VAL B 1 291 ? -20.462 92.423  10.248  1.00 32.47  ? 288 VAL B N   1 
ATOM   6354 C CA  . VAL B 1 291 ? -19.467 92.513  11.309  1.00 33.28  ? 288 VAL B CA  1 
ATOM   6355 C C   . VAL B 1 291 ? -19.264 91.193  12.036  1.00 38.64  ? 288 VAL B C   1 
ATOM   6356 O O   . VAL B 1 291 ? -18.447 91.130  12.960  1.00 42.84  ? 288 VAL B O   1 
ATOM   6357 C CB  . VAL B 1 291 ? -19.815 93.626  12.319  1.00 33.14  ? 288 VAL B CB  1 
ATOM   6358 C CG1 . VAL B 1 291 ? -20.055 94.945  11.599  1.00 37.37  ? 288 VAL B CG1 1 
ATOM   6359 C CG2 . VAL B 1 291 ? -21.023 93.233  13.151  1.00 31.46  ? 288 VAL B CG2 1 
ATOM   6360 N N   . LEU B 1 292 ? -19.982 90.140  11.655  1.00 41.79  ? 289 LEU B N   1 
ATOM   6361 C CA  . LEU B 1 292 ? -19.783 88.845  12.288  1.00 48.96  ? 289 LEU B CA  1 
ATOM   6362 C C   . LEU B 1 292 ? -18.414 88.283  11.908  1.00 55.29  ? 289 LEU B C   1 
ATOM   6363 O O   . LEU B 1 292 ? -17.952 88.480  10.780  1.00 54.53  ? 289 LEU B O   1 
ATOM   6364 C CB  . LEU B 1 292 ? -20.886 87.868  11.882  1.00 46.58  ? 289 LEU B CB  1 
ATOM   6365 C CG  . LEU B 1 292 ? -22.256 88.098  12.524  1.00 44.29  ? 289 LEU B CG  1 
ATOM   6366 C CD1 . LEU B 1 292 ? -23.259 87.060  12.043  1.00 40.33  ? 289 LEU B CD1 1 
ATOM   6367 C CD2 . LEU B 1 292 ? -22.147 88.078  14.042  1.00 33.38  ? 289 LEU B CD2 1 
ATOM   6368 N N   . PRO B 1 293 ? -17.741 87.582  12.826  1.00 65.01  ? 290 PRO B N   1 
ATOM   6369 C CA  . PRO B 1 293 ? -16.370 87.134  12.535  1.00 68.98  ? 290 PRO B CA  1 
ATOM   6370 C C   . PRO B 1 293 ? -16.289 86.053  11.471  1.00 66.12  ? 290 PRO B C   1 
ATOM   6371 O O   . PRO B 1 293 ? -15.295 86.006  10.735  1.00 76.91  ? 290 PRO B O   1 
ATOM   6372 C CB  . PRO B 1 293 ? -15.872 86.627  13.896  1.00 56.74  ? 290 PRO B CB  1 
ATOM   6373 C CG  . PRO B 1 293 ? -17.115 86.249  14.633  1.00 54.79  ? 290 PRO B CG  1 
ATOM   6374 C CD  . PRO B 1 293 ? -18.167 87.226  14.191  1.00 59.11  ? 290 PRO B CD  1 
ATOM   6375 N N   . GLN B 1 294 ? -17.291 85.184  11.360  1.00 59.61  ? 291 GLN B N   1 
ATOM   6376 C CA  . GLN B 1 294 ? -17.259 84.118  10.369  1.00 70.59  ? 291 GLN B CA  1 
ATOM   6377 C C   . GLN B 1 294 ? -18.683 83.746  9.982   1.00 71.02  ? 291 GLN B C   1 
ATOM   6378 O O   . GLN B 1 294 ? -19.651 84.123  10.649  1.00 66.03  ? 291 GLN B O   1 
ATOM   6379 C CB  . GLN B 1 294 ? -16.503 82.887  10.887  1.00 60.12  ? 291 GLN B CB  1 
ATOM   6380 C CG  . GLN B 1 294 ? -17.138 82.223  12.102  1.00 63.06  ? 291 GLN B CG  1 
ATOM   6381 C CD  . GLN B 1 294 ? -16.713 82.862  13.410  1.00 74.34  ? 291 GLN B CD  1 
ATOM   6382 O OE1 . GLN B 1 294 ? -15.580 83.326  13.549  1.00 73.87  ? 291 GLN B OE1 1 
ATOM   6383 N NE2 . GLN B 1 294 ? -17.621 82.889  14.379  1.00 61.97  ? 291 GLN B NE2 1 
ATOM   6384 N N   . GLU B 1 295 ? -18.800 83.004  8.881   1.00 63.29  ? 292 GLU B N   1 
ATOM   6385 C CA  . GLU B 1 295 ? -20.096 82.495  8.455   1.00 52.89  ? 292 GLU B CA  1 
ATOM   6386 C C   . GLU B 1 295 ? -20.634 81.513  9.486   1.00 47.73  ? 292 GLU B C   1 
ATOM   6387 O O   . GLU B 1 295 ? -19.921 80.607  9.929   1.00 46.68  ? 292 GLU B O   1 
ATOM   6388 C CB  . GLU B 1 295 ? -19.982 81.818  7.090   1.00 54.72  ? 292 GLU B CB  1 
ATOM   6389 C CG  . GLU B 1 295 ? -19.896 82.783  5.921   1.00 80.18  ? 292 GLU B CG  1 
ATOM   6390 C CD  . GLU B 1 295 ? -21.057 83.757  5.889   1.00 81.58  ? 292 GLU B CD  1 
ATOM   6391 O OE1 . GLU B 1 295 ? -20.812 84.980  5.957   1.00 75.32  ? 292 GLU B OE1 1 
ATOM   6392 O OE2 . GLU B 1 295 ? -22.217 83.299  5.807   1.00 79.43  ? 292 GLU B OE2 1 
ATOM   6393 N N   . SER B 1 296 ? -21.896 81.691  9.865   1.00 43.31  ? 293 SER B N   1 
ATOM   6394 C CA  . SER B 1 296 ? -22.472 80.899  10.941  1.00 41.88  ? 293 SER B CA  1 
ATOM   6395 C C   . SER B 1 296 ? -23.987 81.026  10.908  1.00 43.87  ? 293 SER B C   1 
ATOM   6396 O O   . SER B 1 296 ? -24.552 81.850  10.184  1.00 36.95  ? 293 SER B O   1 
ATOM   6397 C CB  . SER B 1 296 ? -21.931 81.342  12.303  1.00 44.85  ? 293 SER B CB  1 
ATOM   6398 O OG  . SER B 1 296 ? -22.236 82.705  12.547  1.00 44.53  ? 293 SER B OG  1 
ATOM   6399 N N   . VAL B 1 297 ? -24.635 80.182  11.706  1.00 32.35  ? 294 VAL B N   1 
ATOM   6400 C CA  . VAL B 1 297 ? -26.047 80.313  12.026  1.00 27.82  ? 294 VAL B CA  1 
ATOM   6401 C C   . VAL B 1 297 ? -26.165 80.430  13.539  1.00 31.21  ? 294 VAL B C   1 
ATOM   6402 O O   . VAL B 1 297 ? -25.279 80.010  14.289  1.00 31.61  ? 294 VAL B O   1 
ATOM   6403 C CB  . VAL B 1 297 ? -26.890 79.134  11.497  1.00 31.87  ? 294 VAL B CB  1 
ATOM   6404 C CG1 . VAL B 1 297 ? -26.829 79.077  9.978   1.00 31.22  ? 294 VAL B CG1 1 
ATOM   6405 C CG2 . VAL B 1 297 ? -26.416 77.824  12.106  1.00 30.94  ? 294 VAL B CG2 1 
ATOM   6406 N N   . PHE B 1 298 ? -27.271 81.028  13.982  1.00 36.42  ? 295 PHE B N   1 
ATOM   6407 C CA  . PHE B 1 298 ? -27.548 81.235  15.404  1.00 28.88  ? 295 PHE B CA  1 
ATOM   6408 C C   . PHE B 1 298 ? -26.485 82.112  16.065  1.00 27.08  ? 295 PHE B C   1 
ATOM   6409 O O   . PHE B 1 298 ? -26.141 81.918  17.233  1.00 27.59  ? 295 PHE B O   1 
ATOM   6410 C CB  . PHE B 1 298 ? -27.685 79.898  16.141  1.00 24.91  ? 295 PHE B CB  1 
ATOM   6411 C CG  . PHE B 1 298 ? -28.798 79.869  17.148  1.00 29.92  ? 295 PHE B CG  1 
ATOM   6412 C CD1 . PHE B 1 298 ? -28.940 80.886  18.076  1.00 28.34  ? 295 PHE B CD1 1 
ATOM   6413 C CD2 . PHE B 1 298 ? -29.710 78.826  17.160  1.00 23.30  ? 295 PHE B CD2 1 
ATOM   6414 C CE1 . PHE B 1 298 ? -29.963 80.858  19.003  1.00 26.25  ? 295 PHE B CE1 1 
ATOM   6415 C CE2 . PHE B 1 298 ? -30.735 78.794  18.085  1.00 26.94  ? 295 PHE B CE2 1 
ATOM   6416 C CZ  . PHE B 1 298 ? -30.863 79.812  19.006  1.00 28.21  ? 295 PHE B CZ  1 
ATOM   6417 N N   . ARG B 1 299 ? -25.953 83.077  15.317  1.00 22.06  ? 296 ARG B N   1 
ATOM   6418 C CA  . ARG B 1 299 ? -25.008 84.058  15.833  1.00 26.44  ? 296 ARG B CA  1 
ATOM   6419 C C   . ARG B 1 299 ? -25.466 85.447  15.419  1.00 34.09  ? 296 ARG B C   1 
ATOM   6420 O O   . ARG B 1 299 ? -25.933 85.646  14.294  1.00 32.14  ? 296 ARG B O   1 
ATOM   6421 C CB  . ARG B 1 299 ? -23.585 83.798  15.322  1.00 19.24  ? 296 ARG B CB  1 
ATOM   6422 C CG  . ARG B 1 299 ? -22.949 82.531  15.868  1.00 32.59  ? 296 ARG B CG  1 
ATOM   6423 C CD  . ARG B 1 299 ? -22.793 82.593  17.379  1.00 29.24  ? 296 ARG B CD  1 
ATOM   6424 N NE  . ARG B 1 299 ? -22.114 81.412  17.904  1.00 28.33  ? 296 ARG B NE  1 
ATOM   6425 C CZ  . ARG B 1 299 ? -22.736 80.304  18.294  1.00 27.37  ? 296 ARG B CZ  1 
ATOM   6426 N NH1 . ARG B 1 299 ? -24.058 80.222  18.222  1.00 20.36  ? 296 ARG B NH1 1 
ATOM   6427 N NH2 . ARG B 1 299 ? -22.036 79.278  18.758  1.00 32.29  ? 296 ARG B NH2 1 
ATOM   6428 N N   . PHE B 1 300 ? -25.329 86.408  16.331  1.00 26.27  ? 297 PHE B N   1 
ATOM   6429 C CA  . PHE B 1 300 ? -25.867 87.744  16.132  1.00 26.95  ? 297 PHE B CA  1 
ATOM   6430 C C   . PHE B 1 300 ? -24.818 88.787  16.486  1.00 27.42  ? 297 PHE B C   1 
ATOM   6431 O O   . PHE B 1 300 ? -23.970 88.572  17.357  1.00 37.08  ? 297 PHE B O   1 
ATOM   6432 C CB  . PHE B 1 300 ? -27.138 87.941  16.964  1.00 20.76  ? 297 PHE B CB  1 
ATOM   6433 C CG  . PHE B 1 300 ? -28.076 86.771  16.898  1.00 18.92  ? 297 PHE B CG  1 
ATOM   6434 C CD1 . PHE B 1 300 ? -28.813 86.523  15.752  1.00 24.68  ? 297 PHE B CD1 1 
ATOM   6435 C CD2 . PHE B 1 300 ? -28.202 85.904  17.970  1.00 25.32  ? 297 PHE B CD2 1 
ATOM   6436 C CE1 . PHE B 1 300 ? -29.669 85.441  15.681  1.00 22.69  ? 297 PHE B CE1 1 
ATOM   6437 C CE2 . PHE B 1 300 ? -29.057 84.819  17.905  1.00 23.84  ? 297 PHE B CE2 1 
ATOM   6438 C CZ  . PHE B 1 300 ? -29.791 84.588  16.758  1.00 23.55  ? 297 PHE B CZ  1 
ATOM   6439 N N   . SER B 1 301 ? -24.891 89.927  15.797  1.00 25.68  ? 298 SER B N   1 
ATOM   6440 C CA  . SER B 1 301 ? -23.825 90.922  15.869  1.00 26.01  ? 298 SER B CA  1 
ATOM   6441 C C   . SER B 1 301 ? -23.789 91.609  17.229  1.00 28.09  ? 298 SER B C   1 
ATOM   6442 O O   . SER B 1 301 ? -22.789 91.532  17.952  1.00 33.58  ? 298 SER B O   1 
ATOM   6443 C CB  . SER B 1 301 ? -23.999 91.950  14.749  1.00 33.56  ? 298 SER B CB  1 
ATOM   6444 O OG  . SER B 1 301 ? -23.874 91.341  13.476  1.00 39.50  ? 298 SER B OG  1 
ATOM   6445 N N   . PHE B 1 302 ? -24.868 92.298  17.591  1.00 24.57  ? 299 PHE B N   1 
ATOM   6446 C CA  . PHE B 1 302 ? -24.905 93.128  18.791  1.00 25.33  ? 299 PHE B CA  1 
ATOM   6447 C C   . PHE B 1 302 ? -25.825 92.479  19.817  1.00 29.81  ? 299 PHE B C   1 
ATOM   6448 O O   . PHE B 1 302 ? -27.053 92.531  19.684  1.00 20.85  ? 299 PHE B O   1 
ATOM   6449 C CB  . PHE B 1 302 ? -25.348 94.546  18.445  1.00 24.36  ? 299 PHE B CB  1 
ATOM   6450 C CG  . PHE B 1 302 ? -24.475 95.208  17.420  1.00 22.97  ? 299 PHE B CG  1 
ATOM   6451 C CD1 . PHE B 1 302 ? -23.238 95.719  17.774  1.00 16.42  ? 299 PHE B CD1 1 
ATOM   6452 C CD2 . PHE B 1 302 ? -24.882 95.306  16.100  1.00 24.06  ? 299 PHE B CD2 1 
ATOM   6453 C CE1 . PHE B 1 302 ? -22.426 96.322  16.835  1.00 23.73  ? 299 PHE B CE1 1 
ATOM   6454 C CE2 . PHE B 1 302 ? -24.075 95.909  15.154  1.00 24.67  ? 299 PHE B CE2 1 
ATOM   6455 C CZ  . PHE B 1 302 ? -22.845 96.417  15.523  1.00 21.37  ? 299 PHE B CZ  1 
ATOM   6456 N N   . VAL B 1 303 ? -25.223 91.872  20.834  1.00 22.48  ? 300 VAL B N   1 
ATOM   6457 C CA  . VAL B 1 303 ? -25.937 91.171  21.899  1.00 23.68  ? 300 VAL B CA  1 
ATOM   6458 C C   . VAL B 1 303 ? -25.454 91.746  23.227  1.00 25.59  ? 300 VAL B C   1 
ATOM   6459 O O   . VAL B 1 303 ? -24.513 92.554  23.231  1.00 18.54  ? 300 VAL B O   1 
ATOM   6460 C CB  . VAL B 1 303 ? -25.706 89.653  21.808  1.00 30.38  ? 300 VAL B CB  1 
ATOM   6461 C CG1 . VAL B 1 303 ? -26.220 89.113  20.482  1.00 20.14  ? 300 VAL B CG1 1 
ATOM   6462 C CG2 . VAL B 1 303 ? -24.233 89.331  21.986  1.00 22.82  ? 300 VAL B CG2 1 
ATOM   6463 N N   . PRO B 1 304 ? -26.065 91.399  24.363  1.00 16.96  ? 301 PRO B N   1 
ATOM   6464 C CA  . PRO B 1 304 ? -25.549 91.882  25.650  1.00 24.44  ? 301 PRO B CA  1 
ATOM   6465 C C   . PRO B 1 304 ? -24.072 91.559  25.834  1.00 33.49  ? 301 PRO B C   1 
ATOM   6466 O O   . PRO B 1 304 ? -23.583 90.514  25.399  1.00 26.91  ? 301 PRO B O   1 
ATOM   6467 C CB  . PRO B 1 304 ? -26.420 91.148  26.672  1.00 23.07  ? 301 PRO B CB  1 
ATOM   6468 C CG  . PRO B 1 304 ? -27.717 90.977  25.972  1.00 24.27  ? 301 PRO B CG  1 
ATOM   6469 C CD  . PRO B 1 304 ? -27.382 90.749  24.520  1.00 21.04  ? 301 PRO B CD  1 
ATOM   6470 N N   . VAL B 1 305 ? -23.358 92.475  26.484  1.00 18.93  ? 302 VAL B N   1 
ATOM   6471 C CA  . VAL B 1 305 ? -21.915 92.377  26.668  1.00 31.44  ? 302 VAL B CA  1 
ATOM   6472 C C   . VAL B 1 305 ? -21.616 92.182  28.148  1.00 36.50  ? 302 VAL B C   1 
ATOM   6473 O O   . VAL B 1 305 ? -22.238 92.817  29.009  1.00 36.25  ? 302 VAL B O   1 
ATOM   6474 C CB  . VAL B 1 305 ? -21.196 93.624  26.111  1.00 25.44  ? 302 VAL B CB  1 
ATOM   6475 C CG1 . VAL B 1 305 ? -21.775 94.898  26.715  1.00 35.33  ? 302 VAL B CG1 1 
ATOM   6476 C CG2 . VAL B 1 305 ? -19.695 93.541  26.356  1.00 39.14  ? 302 VAL B CG2 1 
ATOM   6477 N N   . VAL B 1 306 ? -20.675 91.288  28.444  1.00 41.86  ? 303 VAL B N   1 
ATOM   6478 C CA  . VAL B 1 306 ? -20.203 91.072  29.810  1.00 43.60  ? 303 VAL B CA  1 
ATOM   6479 C C   . VAL B 1 306 ? -19.273 92.235  30.147  1.00 39.46  ? 303 VAL B C   1 
ATOM   6480 O O   . VAL B 1 306 ? -18.093 92.225  29.795  1.00 43.46  ? 303 VAL B O   1 
ATOM   6481 C CB  . VAL B 1 306 ? -19.503 89.721  29.968  1.00 43.14  ? 303 VAL B CB  1 
ATOM   6482 C CG1 . VAL B 1 306 ? -19.083 89.507  31.415  1.00 33.83  ? 303 VAL B CG1 1 
ATOM   6483 C CG2 . VAL B 1 306 ? -20.413 88.596  29.499  1.00 36.32  ? 303 VAL B CG2 1 
ATOM   6484 N N   . ASP B 1 307 ? -19.807 93.245  30.833  1.00 46.22  ? 304 ASP B N   1 
ATOM   6485 C CA  . ASP B 1 307 ? -19.086 94.486  31.078  1.00 50.77  ? 304 ASP B CA  1 
ATOM   6486 C C   . ASP B 1 307 ? -18.731 94.716  32.539  1.00 48.38  ? 304 ASP B C   1 
ATOM   6487 O O   . ASP B 1 307 ? -17.933 95.614  32.827  1.00 43.57  ? 304 ASP B O   1 
ATOM   6488 C CB  . ASP B 1 307 ? -19.911 95.678  30.572  1.00 45.42  ? 304 ASP B CB  1 
ATOM   6489 C CG  . ASP B 1 307 ? -21.299 95.724  31.183  1.00 55.24  ? 304 ASP B CG  1 
ATOM   6490 O OD1 . ASP B 1 307 ? -21.784 94.667  31.641  1.00 48.96  ? 304 ASP B OD1 1 
ATOM   6491 O OD2 . ASP B 1 307 ? -21.908 96.815  31.204  1.00 66.29  ? 304 ASP B OD2 1 
ATOM   6492 N N   . GLY B 1 308 ? -19.292 93.940  33.463  1.00 48.00  ? 305 GLY B N   1 
ATOM   6493 C CA  . GLY B 1 308 ? -19.102 94.185  34.875  1.00 55.14  ? 305 GLY B CA  1 
ATOM   6494 C C   . GLY B 1 308 ? -20.090 95.152  35.488  1.00 55.07  ? 305 GLY B C   1 
ATOM   6495 O O   . GLY B 1 308 ? -19.980 95.450  36.685  1.00 53.02  ? 305 GLY B O   1 
ATOM   6496 N N   . ASP B 1 309 ? -21.049 95.653  34.709  1.00 50.52  ? 306 ASP B N   1 
ATOM   6497 C CA  . ASP B 1 309 ? -22.049 96.587  35.209  1.00 46.81  ? 306 ASP B CA  1 
ATOM   6498 C C   . ASP B 1 309 ? -23.402 95.896  35.329  1.00 46.73  ? 306 ASP B C   1 
ATOM   6499 O O   . ASP B 1 309 ? -23.790 95.466  36.421  1.00 55.25  ? 306 ASP B O   1 
ATOM   6500 C CB  . ASP B 1 309 ? -22.145 97.807  34.291  1.00 54.09  ? 306 ASP B CB  1 
ATOM   6501 C CG  . ASP B 1 309 ? -23.010 98.909  34.869  1.00 58.66  ? 306 ASP B CG  1 
ATOM   6502 O OD1 . ASP B 1 309 ? -23.394 98.813  36.054  1.00 62.73  ? 306 ASP B OD1 1 
ATOM   6503 O OD2 . ASP B 1 309 ? -23.307 99.876  34.136  1.00 59.36  ? 306 ASP B OD2 1 
ATOM   6504 N N   . PHE B 1 310 ? -24.130 95.791  34.213  1.00 45.78  ? 307 PHE B N   1 
ATOM   6505 C CA  . PHE B 1 310 ? -25.388 95.051  34.220  1.00 41.21  ? 307 PHE B CA  1 
ATOM   6506 C C   . PHE B 1 310 ? -25.153 93.587  34.567  1.00 36.17  ? 307 PHE B C   1 
ATOM   6507 O O   . PHE B 1 310 ? -25.947 92.974  35.290  1.00 41.27  ? 307 PHE B O   1 
ATOM   6508 C CB  . PHE B 1 310 ? -26.081 95.179  32.863  1.00 35.85  ? 307 PHE B CB  1 
ATOM   6509 C CG  . PHE B 1 310 ? -27.501 94.682  32.852  1.00 33.19  ? 307 PHE B CG  1 
ATOM   6510 C CD1 . PHE B 1 310 ? -27.781 93.337  32.669  1.00 28.21  ? 307 PHE B CD1 1 
ATOM   6511 C CD2 . PHE B 1 310 ? -28.558 95.563  33.013  1.00 31.96  ? 307 PHE B CD2 1 
ATOM   6512 C CE1 . PHE B 1 310 ? -29.085 92.880  32.658  1.00 31.26  ? 307 PHE B CE1 1 
ATOM   6513 C CE2 . PHE B 1 310 ? -29.865 95.112  32.998  1.00 34.17  ? 307 PHE B CE2 1 
ATOM   6514 C CZ  . PHE B 1 310 ? -30.128 93.768  32.822  1.00 34.67  ? 307 PHE B CZ  1 
ATOM   6515 N N   . LEU B 1 311 ? -24.068 93.012  34.056  1.00 45.64  ? 308 LEU B N   1 
ATOM   6516 C CA  . LEU B 1 311 ? -23.646 91.653  34.382  1.00 48.38  ? 308 LEU B CA  1 
ATOM   6517 C C   . LEU B 1 311 ? -22.264 91.756  35.018  1.00 41.95  ? 308 LEU B C   1 
ATOM   6518 O O   . LEU B 1 311 ? -21.264 91.933  34.315  1.00 43.57  ? 308 LEU B O   1 
ATOM   6519 C CB  . LEU B 1 311 ? -23.626 90.766  33.139  1.00 35.46  ? 308 LEU B CB  1 
ATOM   6520 C CG  . LEU B 1 311 ? -24.967 90.507  32.451  1.00 36.66  ? 308 LEU B CG  1 
ATOM   6521 C CD1 . LEU B 1 311 ? -24.756 89.826  31.108  1.00 40.66  ? 308 LEU B CD1 1 
ATOM   6522 C CD2 . LEU B 1 311 ? -25.869 89.667  33.341  1.00 36.88  ? 308 LEU B CD2 1 
ATOM   6523 N N   . SER B 1 312 ? -22.210 91.651  36.349  1.00 43.08  ? 309 SER B N   1 
ATOM   6524 C CA  . SER B 1 312 ? -20.939 91.767  37.059  1.00 44.66  ? 309 SER B CA  1 
ATOM   6525 C C   . SER B 1 312 ? -19.949 90.684  36.652  1.00 47.91  ? 309 SER B C   1 
ATOM   6526 O O   . SER B 1 312 ? -18.739 90.866  36.830  1.00 54.60  ? 309 SER B O   1 
ATOM   6527 C CB  . SER B 1 312 ? -21.175 91.719  38.569  1.00 39.29  ? 309 SER B CB  1 
ATOM   6528 O OG  . SER B 1 312 ? -21.829 90.520  38.945  1.00 39.67  ? 309 SER B OG  1 
ATOM   6529 N N   . ASP B 1 313 ? -20.433 89.569  36.114  1.00 48.94  ? 310 ASP B N   1 
ATOM   6530 C CA  . ASP B 1 313 ? -19.578 88.505  35.613  1.00 46.94  ? 310 ASP B CA  1 
ATOM   6531 C C   . ASP B 1 313 ? -20.302 87.835  34.452  1.00 44.26  ? 310 ASP B C   1 
ATOM   6532 O O   . ASP B 1 313 ? -21.398 88.247  34.059  1.00 45.77  ? 310 ASP B O   1 
ATOM   6533 C CB  . ASP B 1 313 ? -19.231 87.509  36.726  1.00 47.81  ? 310 ASP B CB  1 
ATOM   6534 C CG  . ASP B 1 313 ? -17.947 86.749  36.453  1.00 55.04  ? 310 ASP B CG  1 
ATOM   6535 O OD1 . ASP B 1 313 ? -17.571 86.615  35.270  1.00 60.08  ? 310 ASP B OD1 1 
ATOM   6536 O OD2 . ASP B 1 313 ? -17.313 86.286  37.424  1.00 68.21  ? 310 ASP B OD2 1 
ATOM   6537 N N   . THR B 1 314 ? -19.681 86.798  33.896  1.00 36.18  ? 311 THR B N   1 
ATOM   6538 C CA  . THR B 1 314 ? -20.326 86.038  32.839  1.00 41.43  ? 311 THR B CA  1 
ATOM   6539 C C   . THR B 1 314 ? -21.594 85.378  33.380  1.00 40.15  ? 311 THR B C   1 
ATOM   6540 O O   . THR B 1 314 ? -21.680 85.069  34.573  1.00 47.14  ? 311 THR B O   1 
ATOM   6541 C CB  . THR B 1 314 ? -19.382 84.973  32.282  1.00 39.42  ? 311 THR B CB  1 
ATOM   6542 O OG1 . THR B 1 314 ? -19.129 83.984  33.287  1.00 44.29  ? 311 THR B OG1 1 
ATOM   6543 C CG2 . THR B 1 314 ? -18.065 85.602  31.852  1.00 42.30  ? 311 THR B CG2 1 
ATOM   6544 N N   . PRO B 1 315 ? -22.604 85.171  32.530  1.00 36.03  ? 312 PRO B N   1 
ATOM   6545 C CA  . PRO B 1 315 ? -23.820 84.490  33.007  1.00 39.28  ? 312 PRO B CA  1 
ATOM   6546 C C   . PRO B 1 315 ? -23.545 83.121  33.603  1.00 35.53  ? 312 PRO B C   1 
ATOM   6547 O O   . PRO B 1 315 ? -24.193 82.737  34.584  1.00 41.49  ? 312 PRO B O   1 
ATOM   6548 C CB  . PRO B 1 315 ? -24.686 84.403  31.743  1.00 30.27  ? 312 PRO B CB  1 
ATOM   6549 C CG  . PRO B 1 315 ? -24.223 85.538  30.897  1.00 34.94  ? 312 PRO B CG  1 
ATOM   6550 C CD  . PRO B 1 315 ? -22.745 85.650  31.144  1.00 37.12  ? 312 PRO B CD  1 
ATOM   6551 N N   . GLU B 1 316 ? -22.589 82.376  33.043  1.00 43.19  ? 313 GLU B N   1 
ATOM   6552 C CA  . GLU B 1 316 ? -22.248 81.069  33.597  1.00 46.75  ? 313 GLU B CA  1 
ATOM   6553 C C   . GLU B 1 316 ? -21.713 81.194  35.019  1.00 40.18  ? 313 GLU B C   1 
ATOM   6554 O O   . GLU B 1 316 ? -22.067 80.397  35.896  1.00 37.92  ? 313 GLU B O   1 
ATOM   6555 C CB  . GLU B 1 316 ? -21.231 80.369  32.696  1.00 37.67  ? 313 GLU B CB  1 
ATOM   6556 C CG  . GLU B 1 316 ? -20.631 79.106  33.293  1.00 55.19  ? 313 GLU B CG  1 
ATOM   6557 C CD  . GLU B 1 316 ? -19.644 78.433  32.359  1.00 69.10  ? 313 GLU B CD  1 
ATOM   6558 O OE1 . GLU B 1 316 ? -19.980 77.367  31.802  1.00 81.03  ? 313 GLU B OE1 1 
ATOM   6559 O OE2 . GLU B 1 316 ? -18.534 78.975  32.176  1.00 62.73  ? 313 GLU B OE2 1 
ATOM   6560 N N   . ALA B 1 317 ? -20.864 82.193  35.269  1.00 38.98  ? 314 ALA B N   1 
ATOM   6561 C CA  . ALA B 1 317 ? -20.308 82.371  36.606  1.00 38.32  ? 314 ALA B CA  1 
ATOM   6562 C C   . ALA B 1 317 ? -21.378 82.805  37.600  1.00 48.91  ? 314 ALA B C   1 
ATOM   6563 O O   . ALA B 1 317 ? -21.371 82.369  38.758  1.00 52.04  ? 314 ALA B O   1 
ATOM   6564 C CB  . ALA B 1 317 ? -19.166 83.386  36.568  1.00 34.77  ? 314 ALA B CB  1 
ATOM   6565 N N   . LEU B 1 318 ? -22.306 83.663  37.170  1.00 41.51  ? 315 LEU B N   1 
ATOM   6566 C CA  . LEU B 1 318 ? -23.357 84.127  38.070  1.00 36.60  ? 315 LEU B CA  1 
ATOM   6567 C C   . LEU B 1 318 ? -24.373 83.031  38.365  1.00 32.11  ? 315 LEU B C   1 
ATOM   6568 O O   . LEU B 1 318 ? -24.939 82.993  39.464  1.00 40.39  ? 315 LEU B O   1 
ATOM   6569 C CB  . LEU B 1 318 ? -24.052 85.352  37.477  1.00 38.20  ? 315 LEU B CB  1 
ATOM   6570 C CG  . LEU B 1 318 ? -23.178 86.591  37.270  1.00 37.72  ? 315 LEU B CG  1 
ATOM   6571 C CD1 . LEU B 1 318 ? -23.952 87.680  36.544  1.00 42.82  ? 315 LEU B CD1 1 
ATOM   6572 C CD2 . LEU B 1 318 ? -22.649 87.103  38.601  1.00 35.28  ? 315 LEU B CD2 1 
ATOM   6573 N N   . ILE B 1 319 ? -24.618 82.138  37.405  1.00 34.50  ? 316 ILE B N   1 
ATOM   6574 C CA  . ILE B 1 319 ? -25.559 81.045  37.629  1.00 34.89  ? 316 ILE B CA  1 
ATOM   6575 C C   . ILE B 1 319 ? -24.987 80.042  38.625  1.00 42.81  ? 316 ILE B C   1 
ATOM   6576 O O   . ILE B 1 319 ? -25.707 79.519  39.484  1.00 49.26  ? 316 ILE B O   1 
ATOM   6577 C CB  . ILE B 1 319 ? -25.925 80.378  36.290  1.00 40.87  ? 316 ILE B CB  1 
ATOM   6578 C CG1 . ILE B 1 319 ? -26.785 81.316  35.442  1.00 35.18  ? 316 ILE B CG1 1 
ATOM   6579 C CG2 . ILE B 1 319 ? -26.656 79.065  36.518  1.00 39.06  ? 316 ILE B CG2 1 
ATOM   6580 C CD1 . ILE B 1 319 ? -26.884 80.904  33.987  1.00 28.21  ? 316 ILE B CD1 1 
ATOM   6581 N N   . ASN B 1 320 ? -23.683 79.769  38.538  1.00 38.98  ? 317 ASN B N   1 
ATOM   6582 C CA  . ASN B 1 320 ? -23.069 78.798  39.438  1.00 43.10  ? 317 ASN B CA  1 
ATOM   6583 C C   . ASN B 1 320 ? -23.017 79.317  40.870  1.00 43.59  ? 317 ASN B C   1 
ATOM   6584 O O   . ASN B 1 320 ? -23.287 78.569  41.817  1.00 51.04  ? 317 ASN B O   1 
ATOM   6585 C CB  . ASN B 1 320 ? -21.665 78.442  38.948  1.00 42.45  ? 317 ASN B CB  1 
ATOM   6586 C CG  . ASN B 1 320 ? -21.671 77.791  37.580  1.00 38.56  ? 317 ASN B CG  1 
ATOM   6587 O OD1 . ASN B 1 320 ? -22.643 77.141  37.193  1.00 41.80  ? 317 ASN B OD1 1 
ATOM   6588 N ND2 . ASN B 1 320 ? -20.582 77.961  36.839  1.00 41.68  ? 317 ASN B ND2 1 
ATOM   6589 N N   . ALA B 1 321 ? -22.676 80.591  41.050  1.00 40.12  ? 318 ALA B N   1 
ATOM   6590 C CA  . ALA B 1 321 ? -22.519 81.180  42.372  1.00 39.72  ? 318 ALA B CA  1 
ATOM   6591 C C   . ALA B 1 321 ? -23.792 81.839  42.889  1.00 44.84  ? 318 ALA B C   1 
ATOM   6592 O O   . ALA B 1 321 ? -23.737 82.566  43.886  1.00 63.60  ? 318 ALA B O   1 
ATOM   6593 C CB  . ALA B 1 321 ? -21.378 82.200  42.360  1.00 32.22  ? 318 ALA B CB  1 
ATOM   6594 N N   . GLY B 1 322 ? -24.931 81.599  42.247  1.00 48.06  ? 319 GLY B N   1 
ATOM   6595 C CA  . GLY B 1 322 ? -26.164 82.251  42.634  1.00 40.96  ? 319 GLY B CA  1 
ATOM   6596 C C   . GLY B 1 322 ? -27.003 81.426  43.595  1.00 49.15  ? 319 GLY B C   1 
ATOM   6597 O O   . GLY B 1 322 ? -27.042 80.200  43.527  1.00 48.77  ? 319 GLY B O   1 
ATOM   6598 N N   . ASP B 1 323 ? -27.677 82.126  44.504  1.00 47.39  ? 320 ASP B N   1 
ATOM   6599 C CA  . ASP B 1 323 ? -28.621 81.524  45.437  1.00 42.75  ? 320 ASP B CA  1 
ATOM   6600 C C   . ASP B 1 323 ? -30.028 81.937  45.027  1.00 42.82  ? 320 ASP B C   1 
ATOM   6601 O O   . ASP B 1 323 ? -30.371 83.124  45.079  1.00 50.30  ? 320 ASP B O   1 
ATOM   6602 C CB  . ASP B 1 323 ? -28.321 81.946  46.876  1.00 52.09  ? 320 ASP B CB  1 
ATOM   6603 C CG  . ASP B 1 323 ? -29.478 81.670  47.817  1.00 56.15  ? 320 ASP B CG  1 
ATOM   6604 O OD1 . ASP B 1 323 ? -30.218 82.621  48.146  1.00 70.53  ? 320 ASP B OD1 1 
ATOM   6605 O OD2 . ASP B 1 323 ? -29.660 80.497  48.207  1.00 62.94  ? 320 ASP B OD2 1 
ATOM   6606 N N   . PHE B 1 324 ? -30.836 80.960  44.618  1.00 40.14  ? 321 PHE B N   1 
ATOM   6607 C CA  . PHE B 1 324 ? -32.151 81.215  44.045  1.00 39.65  ? 321 PHE B CA  1 
ATOM   6608 C C   . PHE B 1 324 ? -33.283 80.718  44.940  1.00 47.62  ? 321 PHE B C   1 
ATOM   6609 O O   . PHE B 1 324 ? -34.327 80.287  44.444  1.00 43.33  ? 321 PHE B O   1 
ATOM   6610 C CB  . PHE B 1 324 ? -32.254 80.580  42.660  1.00 42.83  ? 321 PHE B CB  1 
ATOM   6611 C CG  . PHE B 1 324 ? -31.137 80.964  41.732  1.00 38.61  ? 321 PHE B CG  1 
ATOM   6612 C CD1 . PHE B 1 324 ? -31.187 82.151  41.020  1.00 44.75  ? 321 PHE B CD1 1 
ATOM   6613 C CD2 . PHE B 1 324 ? -30.038 80.137  41.570  1.00 37.76  ? 321 PHE B CD2 1 
ATOM   6614 C CE1 . PHE B 1 324 ? -30.160 82.507  40.164  1.00 47.30  ? 321 PHE B CE1 1 
ATOM   6615 C CE2 . PHE B 1 324 ? -29.008 80.486  40.715  1.00 37.43  ? 321 PHE B CE2 1 
ATOM   6616 C CZ  . PHE B 1 324 ? -29.070 81.673  40.012  1.00 43.16  ? 321 PHE B CZ  1 
ATOM   6617 N N   . HIS B 1 325 ? -33.096 80.771  46.256  1.00 52.61  ? 322 HIS B N   1 
ATOM   6618 C CA  . HIS B 1 325 ? -34.161 80.383  47.171  1.00 52.04  ? 322 HIS B CA  1 
ATOM   6619 C C   . HIS B 1 325 ? -35.305 81.387  47.110  1.00 46.89  ? 322 HIS B C   1 
ATOM   6620 O O   . HIS B 1 325 ? -35.088 82.600  47.037  1.00 42.16  ? 322 HIS B O   1 
ATOM   6621 C CB  . HIS B 1 325 ? -33.630 80.274  48.600  1.00 56.19  ? 322 HIS B CB  1 
ATOM   6622 C CG  . HIS B 1 325 ? -32.847 79.025  48.860  1.00 54.09  ? 322 HIS B CG  1 
ATOM   6623 N ND1 . HIS B 1 325 ? -31.485 78.945  48.663  1.00 55.60  ? 322 HIS B ND1 1 
ATOM   6624 C CD2 . HIS B 1 325 ? -33.236 77.804  49.298  1.00 48.52  ? 322 HIS B CD2 1 
ATOM   6625 C CE1 . HIS B 1 325 ? -31.069 77.729  48.971  1.00 52.55  ? 322 HIS B CE1 1 
ATOM   6626 N NE2 . HIS B 1 325 ? -32.111 77.017  49.359  1.00 50.87  ? 322 HIS B NE2 1 
ATOM   6627 N N   . GLY B 1 326 ? -36.532 80.871  47.138  1.00 44.05  ? 323 GLY B N   1 
ATOM   6628 C CA  . GLY B 1 326 ? -37.703 81.713  47.006  1.00 46.82  ? 323 GLY B CA  1 
ATOM   6629 C C   . GLY B 1 326 ? -38.026 82.124  45.589  1.00 59.41  ? 323 GLY B C   1 
ATOM   6630 O O   . GLY B 1 326 ? -38.659 83.165  45.385  1.00 51.66  ? 323 GLY B O   1 
ATOM   6631 N N   . LEU B 1 327 ? -37.613 81.335  44.600  1.00 57.44  ? 324 LEU B N   1 
ATOM   6632 C CA  . LEU B 1 327 ? -37.814 81.654  43.193  1.00 38.91  ? 324 LEU B CA  1 
ATOM   6633 C C   . LEU B 1 327 ? -38.420 80.452  42.485  1.00 41.61  ? 324 LEU B C   1 
ATOM   6634 O O   . LEU B 1 327 ? -37.967 79.320  42.681  1.00 48.42  ? 324 LEU B O   1 
ATOM   6635 C CB  . LEU B 1 327 ? -36.493 82.051  42.526  1.00 45.39  ? 324 LEU B CB  1 
ATOM   6636 C CG  . LEU B 1 327 ? -36.477 82.137  40.998  1.00 49.05  ? 324 LEU B CG  1 
ATOM   6637 C CD1 . LEU B 1 327 ? -37.392 83.247  40.506  1.00 48.04  ? 324 LEU B CD1 1 
ATOM   6638 C CD2 . LEU B 1 327 ? -35.058 82.335  40.488  1.00 41.19  ? 324 LEU B CD2 1 
ATOM   6639 N N   . GLN B 1 328 ? -39.442 80.698  41.670  1.00 32.41  ? 325 GLN B N   1 
ATOM   6640 C CA  . GLN B 1 328 ? -40.064 79.670  40.846  1.00 36.35  ? 325 GLN B CA  1 
ATOM   6641 C C   . GLN B 1 328 ? -39.774 79.972  39.383  1.00 43.34  ? 325 GLN B C   1 
ATOM   6642 O O   . GLN B 1 328 ? -39.988 81.099  38.924  1.00 34.85  ? 325 GLN B O   1 
ATOM   6643 C CB  . GLN B 1 328 ? -41.574 79.599  41.088  1.00 41.67  ? 325 GLN B CB  1 
ATOM   6644 C CG  . GLN B 1 328 ? -41.969 79.276  42.523  1.00 49.10  ? 325 GLN B CG  1 
ATOM   6645 C CD  . GLN B 1 328 ? -41.942 80.493  43.426  1.00 46.18  ? 325 GLN B CD  1 
ATOM   6646 O OE1 . GLN B 1 328 ? -42.684 81.452  43.215  1.00 49.25  ? 325 GLN B OE1 1 
ATOM   6647 N NE2 . GLN B 1 328 ? -41.079 80.464  44.435  1.00 46.94  ? 325 GLN B NE2 1 
ATOM   6648 N N   . VAL B 1 329 ? -39.279 78.971  38.658  1.00 35.61  ? 326 VAL B N   1 
ATOM   6649 C CA  . VAL B 1 329 ? -38.886 79.127  37.263  1.00 33.67  ? 326 VAL B CA  1 
ATOM   6650 C C   . VAL B 1 329 ? -39.583 78.062  36.430  1.00 37.29  ? 326 VAL B C   1 
ATOM   6651 O O   . VAL B 1 329 ? -39.714 76.910  36.859  1.00 42.93  ? 326 VAL B O   1 
ATOM   6652 C CB  . VAL B 1 329 ? -37.354 79.036  37.087  1.00 36.58  ? 326 VAL B CB  1 
ATOM   6653 C CG1 . VAL B 1 329 ? -36.963 79.325  35.647  1.00 34.93  ? 326 VAL B CG1 1 
ATOM   6654 C CG2 . VAL B 1 329 ? -36.649 79.995  38.031  1.00 43.94  ? 326 VAL B CG2 1 
ATOM   6655 N N   . LEU B 1 330 ? -40.035 78.451  35.240  1.00 36.04  ? 327 LEU B N   1 
ATOM   6656 C CA  . LEU B 1 330 ? -40.631 77.538  34.269  1.00 30.60  ? 327 LEU B CA  1 
ATOM   6657 C C   . LEU B 1 330 ? -39.800 77.605  32.994  1.00 35.93  ? 327 LEU B C   1 
ATOM   6658 O O   . LEU B 1 330 ? -39.803 78.626  32.300  1.00 40.10  ? 327 LEU B O   1 
ATOM   6659 C CB  . LEU B 1 330 ? -42.091 77.900  33.999  1.00 30.55  ? 327 LEU B CB  1 
ATOM   6660 C CG  . LEU B 1 330 ? -42.805 77.114  32.898  1.00 35.52  ? 327 LEU B CG  1 
ATOM   6661 C CD1 . LEU B 1 330 ? -42.771 75.624  33.190  1.00 38.79  ? 327 LEU B CD1 1 
ATOM   6662 C CD2 . LEU B 1 330 ? -44.238 77.597  32.739  1.00 32.10  ? 327 LEU B CD2 1 
ATOM   6663 N N   . VAL B 1 331 ? -39.083 76.526  32.688  1.00 34.88  ? 328 VAL B N   1 
ATOM   6664 C CA  . VAL B 1 331 ? -38.231 76.469  31.510  1.00 25.14  ? 328 VAL B CA  1 
ATOM   6665 C C   . VAL B 1 331 ? -38.747 75.379  30.580  1.00 30.77  ? 328 VAL B C   1 
ATOM   6666 O O   . VAL B 1 331 ? -39.521 74.504  30.974  1.00 32.78  ? 328 VAL B O   1 
ATOM   6667 C CB  . VAL B 1 331 ? -36.753 76.220  31.870  1.00 33.03  ? 328 VAL B CB  1 
ATOM   6668 C CG1 . VAL B 1 331 ? -36.187 77.407  32.629  1.00 34.19  ? 328 VAL B CG1 1 
ATOM   6669 C CG2 . VAL B 1 331 ? -36.616 74.943  32.687  1.00 32.60  ? 328 VAL B CG2 1 
ATOM   6670 N N   . GLY B 1 332 ? -38.308 75.443  29.329  1.00 23.25  ? 329 GLY B N   1 
ATOM   6671 C CA  . GLY B 1 332 ? -38.716 74.449  28.353  1.00 27.08  ? 329 GLY B CA  1 
ATOM   6672 C C   . GLY B 1 332 ? -38.164 74.783  26.987  1.00 26.49  ? 329 GLY B C   1 
ATOM   6673 O O   . GLY B 1 332 ? -37.637 75.876  26.749  1.00 25.40  ? 329 GLY B O   1 
ATOM   6674 N N   . VAL B 1 333 ? -38.290 73.809  26.085  1.00 26.30  ? 330 VAL B N   1 
ATOM   6675 C CA  . VAL B 1 333 ? -37.818 73.918  24.710  1.00 26.28  ? 330 VAL B CA  1 
ATOM   6676 C C   . VAL B 1 333 ? -38.854 73.279  23.793  1.00 24.18  ? 330 VAL B C   1 
ATOM   6677 O O   . VAL B 1 333 ? -39.782 72.603  24.241  1.00 25.84  ? 330 VAL B O   1 
ATOM   6678 C CB  . VAL B 1 333 ? -36.442 73.247  24.505  1.00 28.07  ? 330 VAL B CB  1 
ATOM   6679 C CG1 . VAL B 1 333 ? -35.368 73.946  25.326  1.00 27.84  ? 330 VAL B CG1 1 
ATOM   6680 C CG2 . VAL B 1 333 ? -36.518 71.768  24.860  1.00 24.78  ? 330 VAL B CG2 1 
ATOM   6681 N N   . VAL B 1 334 ? -38.685 73.503  22.491  1.00 24.99  ? 331 VAL B N   1 
ATOM   6682 C CA  . VAL B 1 334 ? -39.514 72.841  21.490  1.00 26.71  ? 331 VAL B CA  1 
ATOM   6683 C C   . VAL B 1 334 ? -38.789 71.582  21.035  1.00 20.57  ? 331 VAL B C   1 
ATOM   6684 O O   . VAL B 1 334 ? -37.611 71.385  21.353  1.00 31.66  ? 331 VAL B O   1 
ATOM   6685 C CB  . VAL B 1 334 ? -39.830 73.769  20.302  1.00 26.69  ? 331 VAL B CB  1 
ATOM   6686 C CG1 . VAL B 1 334 ? -40.386 75.097  20.798  1.00 27.47  ? 331 VAL B CG1 1 
ATOM   6687 C CG2 . VAL B 1 334 ? -38.596 73.980  19.441  1.00 19.94  ? 331 VAL B CG2 1 
ATOM   6688 N N   . LYS B 1 335 ? -39.483 70.722  20.287  1.00 21.38  ? 332 LYS B N   1 
ATOM   6689 C CA  . LYS B 1 335 ? -38.908 69.428  19.932  1.00 30.41  ? 332 LYS B CA  1 
ATOM   6690 C C   . LYS B 1 335 ? -37.758 69.575  18.942  1.00 33.22  ? 332 LYS B C   1 
ATOM   6691 O O   . LYS B 1 335 ? -36.772 68.833  19.016  1.00 34.79  ? 332 LYS B O   1 
ATOM   6692 C CB  . LYS B 1 335 ? -39.991 68.509  19.366  1.00 34.37  ? 332 LYS B CB  1 
ATOM   6693 C CG  . LYS B 1 335 ? -39.491 67.115  19.022  1.00 35.03  ? 332 LYS B CG  1 
ATOM   6694 C CD  . LYS B 1 335 ? -40.630 66.181  18.654  1.00 35.02  ? 332 LYS B CD  1 
ATOM   6695 C CE  . LYS B 1 335 ? -40.104 64.794  18.314  1.00 45.39  ? 332 LYS B CE  1 
ATOM   6696 N NZ  . LYS B 1 335 ? -41.203 63.817  18.084  1.00 55.52  ? 332 LYS B NZ  1 
ATOM   6697 N N   . ASP B 1 336 ? -37.859 70.525  18.015  1.00 26.40  ? 333 ASP B N   1 
ATOM   6698 C CA  . ASP B 1 336 ? -36.864 70.718  16.959  1.00 29.00  ? 333 ASP B CA  1 
ATOM   6699 C C   . ASP B 1 336 ? -36.371 72.161  17.018  1.00 35.02  ? 333 ASP B C   1 
ATOM   6700 O O   . ASP B 1 336 ? -36.830 73.024  16.267  1.00 36.18  ? 333 ASP B O   1 
ATOM   6701 C CB  . ASP B 1 336 ? -37.461 70.374  15.600  1.00 25.66  ? 333 ASP B CB  1 
ATOM   6702 C CG  . ASP B 1 336 ? -37.912 68.930  15.516  1.00 33.56  ? 333 ASP B CG  1 
ATOM   6703 O OD1 . ASP B 1 336 ? -37.073 68.030  15.728  1.00 39.86  ? 333 ASP B OD1 1 
ATOM   6704 O OD2 . ASP B 1 336 ? -39.110 68.694  15.254  1.00 33.01  ? 333 ASP B OD2 1 
ATOM   6705 N N   . GLU B 1 337 ? -35.412 72.412  17.912  1.00 23.18  ? 334 GLU B N   1 
ATOM   6706 C CA  . GLU B 1 337 ? -34.938 73.774  18.133  1.00 26.44  ? 334 GLU B CA  1 
ATOM   6707 C C   . GLU B 1 337 ? -34.086 74.285  16.978  1.00 32.31  ? 334 GLU B C   1 
ATOM   6708 O O   . GLU B 1 337 ? -34.119 75.483  16.674  1.00 22.07  ? 334 GLU B O   1 
ATOM   6709 C CB  . GLU B 1 337 ? -34.144 73.845  19.438  1.00 25.45  ? 334 GLU B CB  1 
ATOM   6710 C CG  . GLU B 1 337 ? -34.994 73.781  20.696  1.00 31.97  ? 334 GLU B CG  1 
ATOM   6711 C CD  . GLU B 1 337 ? -35.729 75.079  20.968  1.00 35.34  ? 334 GLU B CD  1 
ATOM   6712 O OE1 . GLU B 1 337 ? -35.412 76.096  20.315  1.00 34.30  ? 334 GLU B OE1 1 
ATOM   6713 O OE2 . GLU B 1 337 ? -36.625 75.084  21.837  1.00 36.89  ? 334 GLU B OE2 1 
ATOM   6714 N N   . GLY B 1 338 ? -33.325 73.410  16.326  1.00 22.56  ? 335 GLY B N   1 
ATOM   6715 C CA  . GLY B 1 338 ? -32.333 73.862  15.369  1.00 21.65  ? 335 GLY B CA  1 
ATOM   6716 C C   . GLY B 1 338 ? -32.743 73.842  13.909  1.00 16.08  ? 335 GLY B C   1 
ATOM   6717 O O   . GLY B 1 338 ? -32.020 74.373  13.061  1.00 26.89  ? 335 GLY B O   1 
ATOM   6718 N N   . SER B 1 339 ? -33.897 73.246  13.599  1.00 17.86  ? 336 SER B N   1 
ATOM   6719 C CA  . SER B 1 339 ? -34.286 73.072  12.201  1.00 25.31  ? 336 SER B CA  1 
ATOM   6720 C C   . SER B 1 339 ? -34.546 74.403  11.505  1.00 30.00  ? 336 SER B C   1 
ATOM   6721 O O   . SER B 1 339 ? -34.261 74.540  10.310  1.00 32.12  ? 336 SER B O   1 
ATOM   6722 C CB  . SER B 1 339 ? -35.523 72.178  12.109  1.00 26.97  ? 336 SER B CB  1 
ATOM   6723 O OG  . SER B 1 339 ? -36.638 72.782  12.743  1.00 32.20  ? 336 SER B OG  1 
ATOM   6724 N N   . TYR B 1 340 ? -35.081 75.389  12.229  1.00 28.16  ? 337 TYR B N   1 
ATOM   6725 C CA  . TYR B 1 340 ? -35.392 76.683  11.625  1.00 28.13  ? 337 TYR B CA  1 
ATOM   6726 C C   . TYR B 1 340 ? -34.133 77.392  11.143  1.00 32.43  ? 337 TYR B C   1 
ATOM   6727 O O   . TYR B 1 340 ? -34.146 78.059  10.102  1.00 27.34  ? 337 TYR B O   1 
ATOM   6728 C CB  . TYR B 1 340 ? -36.150 77.547  12.637  1.00 40.91  ? 337 TYR B CB  1 
ATOM   6729 C CG  . TYR B 1 340 ? -36.324 79.003  12.262  1.00 32.46  ? 337 TYR B CG  1 
ATOM   6730 C CD1 . TYR B 1 340 ? -37.412 79.420  11.510  1.00 47.46  ? 337 TYR B CD1 1 
ATOM   6731 C CD2 . TYR B 1 340 ? -35.418 79.966  12.692  1.00 36.74  ? 337 TYR B CD2 1 
ATOM   6732 C CE1 . TYR B 1 340 ? -37.583 80.751  11.179  1.00 50.55  ? 337 TYR B CE1 1 
ATOM   6733 C CE2 . TYR B 1 340 ? -35.580 81.298  12.362  1.00 49.14  ? 337 TYR B CE2 1 
ATOM   6734 C CZ  . TYR B 1 340 ? -36.665 81.684  11.605  1.00 61.15  ? 337 TYR B CZ  1 
ATOM   6735 O OH  . TYR B 1 340 ? -36.836 83.009  11.273  1.00 54.56  ? 337 TYR B OH  1 
ATOM   6736 N N   . PHE B 1 341 ? -33.034 77.249  11.879  1.00 24.30  ? 338 PHE B N   1 
ATOM   6737 C CA  . PHE B 1 341 ? -31.825 78.017  11.619  1.00 32.21  ? 338 PHE B CA  1 
ATOM   6738 C C   . PHE B 1 341 ? -30.943 77.409  10.536  1.00 29.55  ? 338 PHE B C   1 
ATOM   6739 O O   . PHE B 1 341 ? -29.944 78.030  10.156  1.00 27.81  ? 338 PHE B O   1 
ATOM   6740 C CB  . PHE B 1 341 ? -31.027 78.168  12.918  1.00 26.09  ? 338 PHE B CB  1 
ATOM   6741 C CG  . PHE B 1 341 ? -31.833 78.731  14.055  1.00 33.58  ? 338 PHE B CG  1 
ATOM   6742 C CD1 . PHE B 1 341 ? -32.578 77.900  14.876  1.00 29.52  ? 338 PHE B CD1 1 
ATOM   6743 C CD2 . PHE B 1 341 ? -31.851 80.093  14.299  1.00 41.93  ? 338 PHE B CD2 1 
ATOM   6744 C CE1 . PHE B 1 341 ? -33.325 78.419  15.916  1.00 31.93  ? 338 PHE B CE1 1 
ATOM   6745 C CE2 . PHE B 1 341 ? -32.594 80.618  15.339  1.00 32.85  ? 338 PHE B CE2 1 
ATOM   6746 C CZ  . PHE B 1 341 ? -33.332 79.780  16.149  1.00 32.60  ? 338 PHE B CZ  1 
ATOM   6747 N N   . LEU B 1 342 ? -31.289 76.228  10.022  1.00 24.04  ? 339 LEU B N   1 
ATOM   6748 C CA  . LEU B 1 342 ? -30.434 75.562  9.047   1.00 27.53  ? 339 LEU B CA  1 
ATOM   6749 C C   . LEU B 1 342 ? -30.565 76.161  7.652   1.00 28.88  ? 339 LEU B C   1 
ATOM   6750 O O   . LEU B 1 342 ? -29.621 76.077  6.858   1.00 25.66  ? 339 LEU B O   1 
ATOM   6751 C CB  . LEU B 1 342 ? -30.748 74.066  9.011   1.00 26.08  ? 339 LEU B CB  1 
ATOM   6752 C CG  . LEU B 1 342 ? -30.514 73.336  10.336  1.00 33.40  ? 339 LEU B CG  1 
ATOM   6753 C CD1 . LEU B 1 342 ? -30.832 71.855  10.214  1.00 18.66  ? 339 LEU B CD1 1 
ATOM   6754 C CD2 . LEU B 1 342 ? -29.085 73.544  10.811  1.00 27.26  ? 339 LEU B CD2 1 
ATOM   6755 N N   . VAL B 1 343 ? -31.703 76.775  7.334   1.00 28.46  ? 340 VAL B N   1 
ATOM   6756 C CA  . VAL B 1 343 ? -31.917 77.345  6.007   1.00 23.95  ? 340 VAL B CA  1 
ATOM   6757 C C   . VAL B 1 343 ? -31.270 78.721  5.917   1.00 27.92  ? 340 VAL B C   1 
ATOM   6758 O O   . VAL B 1 343 ? -31.418 79.422  4.910   1.00 29.76  ? 340 VAL B O   1 
ATOM   6759 C CB  . VAL B 1 343 ? -33.417 77.424  5.668   1.00 28.11  ? 340 VAL B CB  1 
ATOM   6760 C CG1 . VAL B 1 343 ? -34.003 76.029  5.532   1.00 29.87  ? 340 VAL B CG1 1 
ATOM   6761 C CG2 . VAL B 1 343 ? -34.159 78.222  6.730   1.00 28.43  ? 340 VAL B CG2 1 
ATOM   6762 N N   . TYR B 1 344 ? -30.543 79.115  6.963   1.00 20.78  ? 341 TYR B N   1 
ATOM   6763 C CA  . TYR B 1 344 ? -29.889 80.416  7.016   1.00 27.97  ? 341 TYR B CA  1 
ATOM   6764 C C   . TYR B 1 344 ? -28.372 80.320  6.882   1.00 27.79  ? 341 TYR B C   1 
ATOM   6765 O O   . TYR B 1 344 ? -27.658 81.220  7.333   1.00 38.87  ? 341 TYR B O   1 
ATOM   6766 C CB  . TYR B 1 344 ? -30.254 81.143  8.311   1.00 29.01  ? 341 TYR B CB  1 
ATOM   6767 C CG  . TYR B 1 344 ? -31.630 81.768  8.302   1.00 30.51  ? 341 TYR B CG  1 
ATOM   6768 C CD1 . TYR B 1 344 ? -31.825 83.055  7.819   1.00 30.39  ? 341 TYR B CD1 1 
ATOM   6769 C CD2 . TYR B 1 344 ? -32.734 81.073  8.778   1.00 29.82  ? 341 TYR B CD2 1 
ATOM   6770 C CE1 . TYR B 1 344 ? -33.078 83.636  7.814   1.00 32.83  ? 341 TYR B CE1 1 
ATOM   6771 C CE2 . TYR B 1 344 ? -33.993 81.644  8.773   1.00 40.70  ? 341 TYR B CE2 1 
ATOM   6772 C CZ  . TYR B 1 344 ? -34.159 82.925  8.289   1.00 34.69  ? 341 TYR B CZ  1 
ATOM   6773 O OH  . TYR B 1 344 ? -35.409 83.498  8.282   1.00 35.78  ? 341 TYR B OH  1 
ATOM   6774 N N   . GLY B 1 345 ? -27.861 79.251  6.273   1.00 29.67  ? 342 GLY B N   1 
ATOM   6775 C CA  . GLY B 1 345 ? -26.430 79.156  6.060   1.00 40.11  ? 342 GLY B CA  1 
ATOM   6776 C C   . GLY B 1 345 ? -25.877 77.756  5.891   1.00 30.76  ? 342 GLY B C   1 
ATOM   6777 O O   . GLY B 1 345 ? -24.795 77.584  5.323   1.00 39.29  ? 342 GLY B O   1 
ATOM   6778 N N   . ALA B 1 346 ? -26.593 76.751  6.378   1.00 26.05  ? 343 ALA B N   1 
ATOM   6779 C CA  . ALA B 1 346 ? -26.100 75.382  6.280   1.00 26.92  ? 343 ALA B CA  1 
ATOM   6780 C C   . ALA B 1 346 ? -26.178 74.904  4.834   1.00 32.31  ? 343 ALA B C   1 
ATOM   6781 O O   . ALA B 1 346 ? -27.218 75.074  4.185   1.00 32.12  ? 343 ALA B O   1 
ATOM   6782 C CB  . ALA B 1 346 ? -26.898 74.454  7.193   1.00 20.83  ? 343 ALA B CB  1 
ATOM   6783 N N   . PRO B 1 347 ? -25.113 74.311  4.296   1.00 29.75  ? 344 PRO B N   1 
ATOM   6784 C CA  . PRO B 1 347 ? -25.125 73.915  2.882   1.00 26.27  ? 344 PRO B CA  1 
ATOM   6785 C C   . PRO B 1 347 ? -26.124 72.800  2.613   1.00 25.22  ? 344 PRO B C   1 
ATOM   6786 O O   . PRO B 1 347 ? -26.305 71.889  3.426   1.00 24.77  ? 344 PRO B O   1 
ATOM   6787 C CB  . PRO B 1 347 ? -23.686 73.445  2.630   1.00 26.70  ? 344 PRO B CB  1 
ATOM   6788 C CG  . PRO B 1 347 ? -22.879 74.022  3.756   1.00 31.28  ? 344 PRO B CG  1 
ATOM   6789 C CD  . PRO B 1 347 ? -23.807 74.068  4.928   1.00 28.35  ? 344 PRO B CD  1 
ATOM   6790 N N   . GLY B 1 348 ? -26.775 72.883  1.454   1.00 27.38  ? 345 GLY B N   1 
ATOM   6791 C CA  . GLY B 1 348 ? -27.713 71.871  1.016   1.00 20.29  ? 345 GLY B CA  1 
ATOM   6792 C C   . GLY B 1 348 ? -29.097 71.960  1.618   1.00 28.50  ? 345 GLY B C   1 
ATOM   6793 O O   . GLY B 1 348 ? -29.921 71.072  1.362   1.00 22.45  ? 345 GLY B O   1 
ATOM   6794 N N   . PHE B 1 349 ? -29.387 72.993  2.401   1.00 28.47  ? 346 PHE B N   1 
ATOM   6795 C CA  . PHE B 1 349 ? -30.677 73.128  3.063   1.00 29.27  ? 346 PHE B CA  1 
ATOM   6796 C C   . PHE B 1 349 ? -31.563 74.121  2.324   1.00 28.28  ? 346 PHE B C   1 
ATOM   6797 O O   . PHE B 1 349 ? -31.093 75.151  1.834   1.00 30.73  ? 346 PHE B O   1 
ATOM   6798 C CB  . PHE B 1 349 ? -30.503 73.562  4.519   1.00 28.31  ? 346 PHE B CB  1 
ATOM   6799 C CG  . PHE B 1 349 ? -30.230 72.424  5.456   1.00 28.05  ? 346 PHE B CG  1 
ATOM   6800 C CD1 . PHE B 1 349 ? -31.273 71.742  6.059   1.00 30.55  ? 346 PHE B CD1 1 
ATOM   6801 C CD2 . PHE B 1 349 ? -28.932 72.027  5.727   1.00 32.23  ? 346 PHE B CD2 1 
ATOM   6802 C CE1 . PHE B 1 349 ? -31.027 70.689  6.918   1.00 31.39  ? 346 PHE B CE1 1 
ATOM   6803 C CE2 . PHE B 1 349 ? -28.680 70.978  6.587   1.00 26.73  ? 346 PHE B CE2 1 
ATOM   6804 C CZ  . PHE B 1 349 ? -29.728 70.307  7.183   1.00 26.03  ? 346 PHE B CZ  1 
ATOM   6805 N N   . SER B 1 350 ? -32.852 73.797  2.253   1.00 32.55  ? 347 SER B N   1 
ATOM   6806 C CA  . SER B 1 350 ? -33.842 74.635  1.594   1.00 29.65  ? 347 SER B CA  1 
ATOM   6807 C C   . SER B 1 350 ? -35.211 74.275  2.148   1.00 28.90  ? 347 SER B C   1 
ATOM   6808 O O   . SER B 1 350 ? -35.527 73.094  2.308   1.00 31.90  ? 347 SER B O   1 
ATOM   6809 C CB  . SER B 1 350 ? -33.813 74.446  0.072   1.00 29.61  ? 347 SER B CB  1 
ATOM   6810 O OG  . SER B 1 350 ? -34.943 75.045  -0.538  1.00 31.64  ? 347 SER B OG  1 
ATOM   6811 N N   . LYS B 1 351 ? -36.016 75.297  2.443   1.00 33.85  ? 348 LYS B N   1 
ATOM   6812 C CA  . LYS B 1 351 ? -37.353 75.050  2.968   1.00 28.96  ? 348 LYS B CA  1 
ATOM   6813 C C   . LYS B 1 351 ? -38.301 74.490  1.918   1.00 25.51  ? 348 LYS B C   1 
ATOM   6814 O O   . LYS B 1 351 ? -39.382 74.011  2.278   1.00 25.33  ? 348 LYS B O   1 
ATOM   6815 C CB  . LYS B 1 351 ? -37.944 76.336  3.551   1.00 31.12  ? 348 LYS B CB  1 
ATOM   6816 C CG  . LYS B 1 351 ? -38.667 77.201  2.530   1.00 27.15  ? 348 LYS B CG  1 
ATOM   6817 C CD  . LYS B 1 351 ? -39.445 78.320  3.202   1.00 30.25  ? 348 LYS B CD  1 
ATOM   6818 C CE  . LYS B 1 351 ? -40.310 79.066  2.199   1.00 25.09  ? 348 LYS B CE  1 
ATOM   6819 N NZ  . LYS B 1 351 ? -41.290 78.161  1.535   1.00 25.23  ? 348 LYS B NZ  1 
ATOM   6820 N N   . ASP B 1 352 ? -37.926 74.530  0.641   1.00 24.46  ? 349 ASP B N   1 
ATOM   6821 C CA  . ASP B 1 352 ? -38.804 74.122  -0.446  1.00 31.55  ? 349 ASP B CA  1 
ATOM   6822 C C   . ASP B 1 352 ? -38.475 72.737  -0.990  1.00 28.98  ? 349 ASP B C   1 
ATOM   6823 O O   . ASP B 1 352 ? -39.064 72.322  -1.994  1.00 27.90  ? 349 ASP B O   1 
ATOM   6824 C CB  . ASP B 1 352 ? -38.758 75.161  -1.567  1.00 26.19  ? 349 ASP B CB  1 
ATOM   6825 C CG  . ASP B 1 352 ? -39.294 76.512  -1.127  1.00 28.52  ? 349 ASP B CG  1 
ATOM   6826 O OD1 . ASP B 1 352 ? -40.331 76.541  -0.432  1.00 27.61  ? 349 ASP B OD1 1 
ATOM   6827 O OD2 . ASP B 1 352 ? -38.674 77.542  -1.465  1.00 32.97  ? 349 ASP B OD2 1 
ATOM   6828 N N   . ASN B 1 353 ? -37.552 72.015  -0.359  1.00 23.80  ? 350 ASN B N   1 
ATOM   6829 C CA  . ASN B 1 353 ? -37.315 70.611  -0.678  1.00 33.49  ? 350 ASN B CA  1 
ATOM   6830 C C   . ASN B 1 353 ? -37.153 69.852  0.635   1.00 32.88  ? 350 ASN B C   1 
ATOM   6831 O O   . ASN B 1 353 ? -37.427 70.379  1.718   1.00 29.62  ? 350 ASN B O   1 
ATOM   6832 C CB  . ASN B 1 353 ? -36.114 70.444  -1.624  1.00 21.40  ? 350 ASN B CB  1 
ATOM   6833 C CG  . ASN B 1 353 ? -34.820 71.008  -1.056  1.00 33.04  ? 350 ASN B CG  1 
ATOM   6834 O OD1 . ASN B 1 353 ? -34.663 71.166  0.155   1.00 33.63  ? 350 ASN B OD1 1 
ATOM   6835 N ND2 . ASN B 1 353 ? -33.876 71.307  -1.943  1.00 28.57  ? 350 ASN B ND2 1 
ATOM   6836 N N   . GLU B 1 354 ? -36.698 68.605  0.542   1.00 31.89  ? 351 GLU B N   1 
ATOM   6837 C CA  . GLU B 1 354 ? -36.561 67.751  1.713   1.00 32.50  ? 351 GLU B CA  1 
ATOM   6838 C C   . GLU B 1 354 ? -35.243 67.949  2.450   1.00 29.46  ? 351 GLU B C   1 
ATOM   6839 O O   . GLU B 1 354 ? -35.076 67.390  3.540   1.00 31.95  ? 351 GLU B O   1 
ATOM   6840 C CB  . GLU B 1 354 ? -36.709 66.280  1.312   1.00 41.42  ? 351 GLU B CB  1 
ATOM   6841 C CG  . GLU B 1 354 ? -37.941 66.002  0.466   1.00 41.16  ? 351 GLU B CG  1 
ATOM   6842 C CD  . GLU B 1 354 ? -39.210 66.556  1.086   1.00 56.81  ? 351 GLU B CD  1 
ATOM   6843 O OE1 . GLU B 1 354 ? -39.422 66.351  2.300   1.00 59.19  ? 351 GLU B OE1 1 
ATOM   6844 O OE2 . GLU B 1 354 ? -39.992 67.207  0.360   1.00 72.70  ? 351 GLU B OE2 1 
ATOM   6845 N N   . SER B 1 355 ? -34.315 68.725  1.885   1.00 30.00  ? 352 SER B N   1 
ATOM   6846 C CA  . SER B 1 355 ? -33.027 69.016  2.519   1.00 29.24  ? 352 SER B CA  1 
ATOM   6847 C C   . SER B 1 355 ? -32.282 67.734  2.882   1.00 31.45  ? 352 SER B C   1 
ATOM   6848 O O   . SER B 1 355 ? -31.674 67.621  3.949   1.00 29.49  ? 352 SER B O   1 
ATOM   6849 C CB  . SER B 1 355 ? -33.208 69.910  3.747   1.00 28.07  ? 352 SER B CB  1 
ATOM   6850 O OG  . SER B 1 355 ? -33.652 71.203  3.374   1.00 28.66  ? 352 SER B OG  1 
ATOM   6851 N N   . LEU B 1 356 ? -32.334 66.754  1.983   1.00 38.99  ? 353 LEU B N   1 
ATOM   6852 C CA  . LEU B 1 356 ? -31.620 65.491  2.161   1.00 35.04  ? 353 LEU B CA  1 
ATOM   6853 C C   . LEU B 1 356 ? -30.150 65.741  1.852   1.00 27.41  ? 353 LEU B C   1 
ATOM   6854 O O   . LEU B 1 356 ? -29.679 65.534  0.733   1.00 35.91  ? 353 LEU B O   1 
ATOM   6855 C CB  . LEU B 1 356 ? -32.213 64.408  1.269   1.00 32.54  ? 353 LEU B CB  1 
ATOM   6856 C CG  . LEU B 1 356 ? -33.690 64.090  1.511   1.00 35.17  ? 353 LEU B CG  1 
ATOM   6857 C CD1 . LEU B 1 356 ? -34.210 63.116  0.465   1.00 35.33  ? 353 LEU B CD1 1 
ATOM   6858 C CD2 . LEU B 1 356 ? -33.900 63.538  2.913   1.00 22.95  ? 353 LEU B CD2 1 
ATOM   6859 N N   . ILE B 1 357 ? -29.413 66.196  2.865   1.00 24.06  ? 354 ILE B N   1 
ATOM   6860 C CA  . ILE B 1 357 ? -28.029 66.604  2.665   1.00 32.88  ? 354 ILE B CA  1 
ATOM   6861 C C   . ILE B 1 357 ? -27.124 65.379  2.584   1.00 34.76  ? 354 ILE B C   1 
ATOM   6862 O O   . ILE B 1 357 ? -27.446 64.293  3.071   1.00 31.10  ? 354 ILE B O   1 
ATOM   6863 C CB  . ILE B 1 357 ? -27.571 67.563  3.778   1.00 29.79  ? 354 ILE B CB  1 
ATOM   6864 C CG1 . ILE B 1 357 ? -27.666 66.877  5.143   1.00 29.74  ? 354 ILE B CG1 1 
ATOM   6865 C CG2 . ILE B 1 357 ? -28.401 68.836  3.755   1.00 32.52  ? 354 ILE B CG2 1 
ATOM   6866 C CD1 . ILE B 1 357 ? -27.161 67.724  6.290   1.00 28.15  ? 354 ILE B CD1 1 
ATOM   6867 N N   . SER B 1 358 ? -25.965 65.568  1.957   1.00 38.37  ? 355 SER B N   1 
ATOM   6868 C CA  . SER B 1 358 ? -24.974 64.516  1.822   1.00 29.75  ? 355 SER B CA  1 
ATOM   6869 C C   . SER B 1 358 ? -24.040 64.517  3.031   1.00 37.61  ? 355 SER B C   1 
ATOM   6870 O O   . SER B 1 358 ? -24.136 65.361  3.926   1.00 35.48  ? 355 SER B O   1 
ATOM   6871 C CB  . SER B 1 358 ? -24.189 64.688  0.522   1.00 22.77  ? 355 SER B CB  1 
ATOM   6872 O OG  . SER B 1 358 ? -23.467 65.908  0.520   1.00 30.58  ? 355 SER B OG  1 
ATOM   6873 N N   . ARG B 1 359 ? -23.120 63.549  3.058   1.00 40.98  ? 356 ARG B N   1 
ATOM   6874 C CA  . ARG B 1 359 ? -22.159 63.472  4.154   1.00 27.09  ? 356 ARG B CA  1 
ATOM   6875 C C   . ARG B 1 359 ? -21.241 64.687  4.168   1.00 32.19  ? 356 ARG B C   1 
ATOM   6876 O O   . ARG B 1 359 ? -20.943 65.238  5.234   1.00 31.94  ? 356 ARG B O   1 
ATOM   6877 C CB  . ARG B 1 359 ? -21.343 62.184  4.047   1.00 44.68  ? 356 ARG B CB  1 
ATOM   6878 C CG  . ARG B 1 359 ? -20.327 61.992  5.164   1.00 37.58  ? 356 ARG B CG  1 
ATOM   6879 C CD  . ARG B 1 359 ? -21.011 61.759  6.500   1.00 33.71  ? 356 ARG B CD  1 
ATOM   6880 N NE  . ARG B 1 359 ? -20.051 61.632  7.593   1.00 35.02  ? 356 ARG B NE  1 
ATOM   6881 C CZ  . ARG B 1 359 ? -20.387 61.403  8.858   1.00 33.23  ? 356 ARG B CZ  1 
ATOM   6882 N NH1 . ARG B 1 359 ? -21.663 61.271  9.195   1.00 29.55  ? 356 ARG B NH1 1 
ATOM   6883 N NH2 . ARG B 1 359 ? -19.447 61.303  9.788   1.00 30.02  ? 356 ARG B NH2 1 
ATOM   6884 N N   . ALA B 1 360 ? -20.783 65.120  2.990   1.00 28.73  ? 357 ALA B N   1 
ATOM   6885 C CA  . ALA B 1 360 ? -19.901 66.281  2.920   1.00 34.02  ? 357 ALA B CA  1 
ATOM   6886 C C   . ALA B 1 360 ? -20.620 67.549  3.363   1.00 34.42  ? 357 ALA B C   1 
ATOM   6887 O O   . ALA B 1 360 ? -20.022 68.412  4.017   1.00 40.55  ? 357 ALA B O   1 
ATOM   6888 C CB  . ALA B 1 360 ? -19.353 66.440  1.503   1.00 20.27  ? 357 ALA B CB  1 
ATOM   6889 N N   . GLU B 1 361 ? -21.903 67.681  3.016   1.00 34.13  ? 358 GLU B N   1 
ATOM   6890 C CA  . GLU B 1 361 ? -22.666 68.848  3.444   1.00 38.76  ? 358 GLU B CA  1 
ATOM   6891 C C   . GLU B 1 361 ? -22.895 68.847  4.950   1.00 26.66  ? 358 GLU B C   1 
ATOM   6892 O O   . GLU B 1 361 ? -22.933 69.916  5.570   1.00 31.80  ? 358 GLU B O   1 
ATOM   6893 C CB  . GLU B 1 361 ? -23.998 68.908  2.697   1.00 28.56  ? 358 GLU B CB  1 
ATOM   6894 C CG  . GLU B 1 361 ? -23.857 69.268  1.225   1.00 35.35  ? 358 GLU B CG  1 
ATOM   6895 C CD  . GLU B 1 361 ? -25.159 69.137  0.460   1.00 40.15  ? 358 GLU B CD  1 
ATOM   6896 O OE1 . GLU B 1 361 ? -25.975 68.262  0.817   1.00 40.23  ? 358 GLU B OE1 1 
ATOM   6897 O OE2 . GLU B 1 361 ? -25.368 69.911  -0.498  1.00 50.36  ? 358 GLU B OE2 1 
ATOM   6898 N N   . PHE B 1 362 ? -23.045 67.665  5.554   1.00 26.58  ? 359 PHE B N   1 
ATOM   6899 C CA  . PHE B 1 362 ? -23.167 67.592  7.007   1.00 36.49  ? 359 PHE B CA  1 
ATOM   6900 C C   . PHE B 1 362 ? -21.877 68.026  7.690   1.00 35.39  ? 359 PHE B C   1 
ATOM   6901 O O   . PHE B 1 362 ? -21.911 68.775  8.673   1.00 29.72  ? 359 PHE B O   1 
ATOM   6902 C CB  . PHE B 1 362 ? -23.551 66.174  7.433   1.00 28.85  ? 359 PHE B CB  1 
ATOM   6903 C CG  . PHE B 1 362 ? -23.506 65.954  8.920   1.00 30.62  ? 359 PHE B CG  1 
ATOM   6904 C CD1 . PHE B 1 362 ? -24.544 66.386  9.730   1.00 25.96  ? 359 PHE B CD1 1 
ATOM   6905 C CD2 . PHE B 1 362 ? -22.429 65.307  9.508   1.00 32.08  ? 359 PHE B CD2 1 
ATOM   6906 C CE1 . PHE B 1 362 ? -24.506 66.184  11.098  1.00 31.04  ? 359 PHE B CE1 1 
ATOM   6907 C CE2 . PHE B 1 362 ? -22.386 65.102  10.875  1.00 27.56  ? 359 PHE B CE2 1 
ATOM   6908 C CZ  . PHE B 1 362 ? -23.426 65.541  11.670  1.00 30.36  ? 359 PHE B CZ  1 
ATOM   6909 N N   . LEU B 1 363 ? -20.730 67.566  7.182   1.00 34.55  ? 360 LEU B N   1 
ATOM   6910 C CA  . LEU B 1 363 ? -19.452 67.942  7.779   1.00 40.89  ? 360 LEU B CA  1 
ATOM   6911 C C   . LEU B 1 363 ? -19.202 69.439  7.652   1.00 37.90  ? 360 LEU B C   1 
ATOM   6912 O O   . LEU B 1 363 ? -18.650 70.064  8.565   1.00 35.13  ? 360 LEU B O   1 
ATOM   6913 C CB  . LEU B 1 363 ? -18.318 67.149  7.130   1.00 42.79  ? 360 LEU B CB  1 
ATOM   6914 C CG  . LEU B 1 363 ? -18.390 65.626  7.268   1.00 36.82  ? 360 LEU B CG  1 
ATOM   6915 C CD1 . LEU B 1 363 ? -17.247 64.962  6.516   1.00 29.90  ? 360 LEU B CD1 1 
ATOM   6916 C CD2 . LEU B 1 363 ? -18.380 65.218  8.734   1.00 37.37  ? 360 LEU B CD2 1 
ATOM   6917 N N   . ALA B 1 364 ? -19.602 70.033  6.525   1.00 33.00  ? 361 ALA B N   1 
ATOM   6918 C CA  . ALA B 1 364 ? -19.463 71.476  6.367   1.00 38.54  ? 361 ALA B CA  1 
ATOM   6919 C C   . ALA B 1 364 ? -20.466 72.224  7.236   1.00 26.42  ? 361 ALA B C   1 
ATOM   6920 O O   . ALA B 1 364 ? -20.151 73.287  7.784   1.00 28.35  ? 361 ALA B O   1 
ATOM   6921 C CB  . ALA B 1 364 ? -19.629 71.864  4.898   1.00 23.13  ? 361 ALA B CB  1 
ATOM   6922 N N   . GLY B 1 365 ? -21.678 71.683  7.377   1.00 31.97  ? 362 GLY B N   1 
ATOM   6923 C CA  . GLY B 1 365 ? -22.686 72.343  8.189   1.00 28.96  ? 362 GLY B CA  1 
ATOM   6924 C C   . GLY B 1 365 ? -22.323 72.411  9.658   1.00 26.02  ? 362 GLY B C   1 
ATOM   6925 O O   . GLY B 1 365 ? -22.726 73.346  10.356  1.00 29.42  ? 362 GLY B O   1 
ATOM   6926 N N   . VAL B 1 366 ? -21.562 71.429  10.148  1.00 30.33  ? 363 VAL B N   1 
ATOM   6927 C CA  . VAL B 1 366 ? -21.134 71.445  11.545  1.00 26.95  ? 363 VAL B CA  1 
ATOM   6928 C C   . VAL B 1 366 ? -20.261 72.663  11.819  1.00 28.95  ? 363 VAL B C   1 
ATOM   6929 O O   . VAL B 1 366 ? -20.373 73.302  12.873  1.00 31.01  ? 363 VAL B O   1 
ATOM   6930 C CB  . VAL B 1 366 ? -20.408 70.133  11.897  1.00 30.31  ? 363 VAL B CB  1 
ATOM   6931 C CG1 . VAL B 1 366 ? -19.777 70.223  13.278  1.00 25.07  ? 363 VAL B CG1 1 
ATOM   6932 C CG2 . VAL B 1 366 ? -21.372 68.960  11.832  1.00 24.07  ? 363 VAL B CG2 1 
ATOM   6933 N N   . ARG B 1 367 ? -19.387 73.013  10.872  1.00 23.67  ? 364 ARG B N   1 
ATOM   6934 C CA  . ARG B 1 367 ? -18.540 74.186  11.052  1.00 32.33  ? 364 ARG B CA  1 
ATOM   6935 C C   . ARG B 1 367 ? -19.355 75.473  11.028  1.00 40.94  ? 364 ARG B C   1 
ATOM   6936 O O   . ARG B 1 367 ? -18.957 76.469  11.644  1.00 33.79  ? 364 ARG B O   1 
ATOM   6937 C CB  . ARG B 1 367 ? -17.452 74.224  9.977   1.00 37.43  ? 364 ARG B CB  1 
ATOM   6938 C CG  . ARG B 1 367 ? -16.699 72.912  9.805   1.00 38.32  ? 364 ARG B CG  1 
ATOM   6939 C CD  . ARG B 1 367 ? -16.211 72.366  11.139  1.00 43.23  ? 364 ARG B CD  1 
ATOM   6940 N NE  . ARG B 1 367 ? -15.198 73.217  11.755  1.00 52.69  ? 364 ARG B NE  1 
ATOM   6941 C CZ  . ARG B 1 367 ? -13.892 72.972  11.713  1.00 54.36  ? 364 ARG B CZ  1 
ATOM   6942 N NH1 . ARG B 1 367 ? -13.437 71.897  11.085  1.00 48.26  ? 364 ARG B NH1 1 
ATOM   6943 N NH2 . ARG B 1 367 ? -13.040 73.800  12.303  1.00 50.95  ? 364 ARG B NH2 1 
ATOM   6944 N N   . VAL B 1 368 ? -20.490 75.472  10.329  1.00 28.86  ? 365 VAL B N   1 
ATOM   6945 C CA  . VAL B 1 368 ? -21.372 76.633  10.336  1.00 33.74  ? 365 VAL B CA  1 
ATOM   6946 C C   . VAL B 1 368 ? -22.238 76.641  11.590  1.00 28.88  ? 365 VAL B C   1 
ATOM   6947 O O   . VAL B 1 368 ? -22.459 77.693  12.199  1.00 35.27  ? 365 VAL B O   1 
ATOM   6948 C CB  . VAL B 1 368 ? -22.224 76.658  9.053   1.00 36.03  ? 365 VAL B CB  1 
ATOM   6949 C CG1 . VAL B 1 368 ? -23.202 77.823  9.078   1.00 28.12  ? 365 VAL B CG1 1 
ATOM   6950 C CG2 . VAL B 1 368 ? -21.327 76.736  7.826   1.00 26.32  ? 365 VAL B CG2 1 
ATOM   6951 N N   . GLY B 1 369 ? -22.733 75.470  12.001  1.00 27.89  ? 366 GLY B N   1 
ATOM   6952 C CA  . GLY B 1 369 ? -23.542 75.397  13.205  1.00 22.78  ? 366 GLY B CA  1 
ATOM   6953 C C   . GLY B 1 369 ? -22.742 75.575  14.479  1.00 29.96  ? 366 GLY B C   1 
ATOM   6954 O O   . GLY B 1 369 ? -23.267 76.070  15.481  1.00 34.43  ? 366 GLY B O   1 
ATOM   6955 N N   . VAL B 1 370 ? -21.475 75.172  14.468  1.00 31.43  ? 367 VAL B N   1 
ATOM   6956 C CA  . VAL B 1 370 ? -20.579 75.378  15.602  1.00 35.27  ? 367 VAL B CA  1 
ATOM   6957 C C   . VAL B 1 370 ? -19.435 76.269  15.131  1.00 36.72  ? 367 VAL B C   1 
ATOM   6958 O O   . VAL B 1 370 ? -18.342 75.770  14.827  1.00 37.73  ? 367 VAL B O   1 
ATOM   6959 C CB  . VAL B 1 370 ? -20.062 74.044  16.165  1.00 33.09  ? 367 VAL B CB  1 
ATOM   6960 C CG1 . VAL B 1 370 ? -19.368 74.263  17.501  1.00 28.06  ? 367 VAL B CG1 1 
ATOM   6961 C CG2 . VAL B 1 370 ? -21.205 73.049  16.308  1.00 22.92  ? 367 VAL B CG2 1 
ATOM   6962 N N   . PRO B 1 371 ? -19.637 77.584  15.057  1.00 35.88  ? 368 PRO B N   1 
ATOM   6963 C CA  . PRO B 1 371 ? -18.639 78.445  14.414  1.00 34.73  ? 368 PRO B CA  1 
ATOM   6964 C C   . PRO B 1 371 ? -17.401 78.646  15.273  1.00 36.70  ? 368 PRO B C   1 
ATOM   6965 O O   . PRO B 1 371 ? -17.479 78.764  16.498  1.00 40.32  ? 368 PRO B O   1 
ATOM   6966 C CB  . PRO B 1 371 ? -19.392 79.764  14.211  1.00 36.82  ? 368 PRO B CB  1 
ATOM   6967 C CG  . PRO B 1 371 ? -20.405 79.775  15.307  1.00 36.03  ? 368 PRO B CG  1 
ATOM   6968 C CD  . PRO B 1 371 ? -20.819 78.341  15.506  1.00 35.85  ? 368 PRO B CD  1 
ATOM   6969 N N   . GLN B 1 372 ? -16.250 78.684  14.600  1.00 40.66  ? 369 GLN B N   1 
ATOM   6970 C CA  . GLN B 1 372 ? -14.963 79.039  15.197  1.00 55.27  ? 369 GLN B CA  1 
ATOM   6971 C C   . GLN B 1 372 ? -14.628 78.144  16.393  1.00 60.04  ? 369 GLN B C   1 
ATOM   6972 O O   . GLN B 1 372 ? -14.509 78.593  17.535  1.00 56.22  ? 369 GLN B O   1 
ATOM   6973 C CB  . GLN B 1 372 ? -14.933 80.520  15.587  1.00 64.29  ? 369 GLN B CB  1 
ATOM   6974 C CG  . GLN B 1 372 ? -13.532 81.105  15.614  1.00 78.78  ? 369 GLN B CG  1 
ATOM   6975 C CD  . GLN B 1 372 ? -12.788 80.873  14.311  1.00 87.78  ? 369 GLN B CD  1 
ATOM   6976 O OE1 . GLN B 1 372 ? -11.800 80.140  14.269  1.00 81.73  ? 369 GLN B OE1 1 
ATOM   6977 N NE2 . GLN B 1 372 ? -13.262 81.499  13.239  1.00 87.96  ? 369 GLN B NE2 1 
ATOM   6978 N N   . VAL B 1 373 ? -14.480 76.852  16.103  1.00 52.22  ? 370 VAL B N   1 
ATOM   6979 C CA  . VAL B 1 373 ? -13.935 75.890  17.049  1.00 44.30  ? 370 VAL B CA  1 
ATOM   6980 C C   . VAL B 1 373 ? -12.851 75.098  16.332  1.00 44.23  ? 370 VAL B C   1 
ATOM   6981 O O   . VAL B 1 373 ? -12.808 75.031  15.101  1.00 49.06  ? 370 VAL B O   1 
ATOM   6982 C CB  . VAL B 1 373 ? -15.008 74.941  17.632  1.00 38.41  ? 370 VAL B CB  1 
ATOM   6983 C CG1 . VAL B 1 373 ? -16.046 75.727  18.420  1.00 43.87  ? 370 VAL B CG1 1 
ATOM   6984 C CG2 . VAL B 1 373 ? -15.665 74.128  16.529  1.00 35.37  ? 370 VAL B CG2 1 
ATOM   6985 N N   . SER B 1 374 ? -11.961 74.504  17.122  1.00 47.38  ? 371 SER B N   1 
ATOM   6986 C CA  . SER B 1 374 ? -10.848 73.753  16.562  1.00 42.16  ? 371 SER B CA  1 
ATOM   6987 C C   . SER B 1 374 ? -11.355 72.568  15.743  1.00 42.28  ? 371 SER B C   1 
ATOM   6988 O O   . SER B 1 374 ? -12.468 72.072  15.937  1.00 40.26  ? 371 SER B O   1 
ATOM   6989 C CB  . SER B 1 374 ? -9.920  73.265  17.674  1.00 42.56  ? 371 SER B CB  1 
ATOM   6990 O OG  . SER B 1 374 ? -10.611 72.423  18.581  1.00 53.94  ? 371 SER B OG  1 
ATOM   6991 N N   . ASP B 1 375 ? -10.515 72.121  14.805  1.00 41.54  ? 372 ASP B N   1 
ATOM   6992 C CA  . ASP B 1 375 ? -10.869 70.960  13.995  1.00 39.21  ? 372 ASP B CA  1 
ATOM   6993 C C   . ASP B 1 375 ? -11.057 69.718  14.856  1.00 43.90  ? 372 ASP B C   1 
ATOM   6994 O O   . ASP B 1 375 ? -11.889 68.862  14.536  1.00 43.48  ? 372 ASP B O   1 
ATOM   6995 C CB  . ASP B 1 375 ? -9.800  70.712  12.930  1.00 53.23  ? 372 ASP B CB  1 
ATOM   6996 C CG  . ASP B 1 375 ? -9.716  71.837  11.916  1.00 61.33  ? 372 ASP B CG  1 
ATOM   6997 O OD1 . ASP B 1 375 ? -10.727 72.546  11.725  1.00 58.28  ? 372 ASP B OD1 1 
ATOM   6998 O OD2 . ASP B 1 375 ? -8.639  72.010  11.307  1.00 60.98  ? 372 ASP B OD2 1 
ATOM   6999 N N   . LEU B 1 376 ? -10.299 69.604  15.949  1.00 32.54  ? 373 LEU B N   1 
ATOM   7000 C CA  . LEU B 1 376 ? -10.494 68.489  16.869  1.00 37.79  ? 373 LEU B CA  1 
ATOM   7001 C C   . LEU B 1 376 ? -11.847 68.581  17.562  1.00 44.83  ? 373 LEU B C   1 
ATOM   7002 O O   . LEU B 1 376 ? -12.500 67.558  17.801  1.00 43.16  ? 373 LEU B O   1 
ATOM   7003 C CB  . LEU B 1 376 ? -9.362  68.452  17.896  1.00 40.31  ? 373 LEU B CB  1 
ATOM   7004 C CG  . LEU B 1 376 ? -9.412  67.318  18.921  1.00 48.64  ? 373 LEU B CG  1 
ATOM   7005 C CD1 . LEU B 1 376 ? -9.325  65.965  18.231  1.00 43.50  ? 373 LEU B CD1 1 
ATOM   7006 C CD2 . LEU B 1 376 ? -8.302  67.473  19.949  1.00 50.17  ? 373 LEU B CD2 1 
ATOM   7007 N N   . ALA B 1 377 ? -12.285 69.798  17.892  1.00 41.48  ? 374 ALA B N   1 
ATOM   7008 C CA  . ALA B 1 377 ? -13.603 69.970  18.494  1.00 32.63  ? 374 ALA B CA  1 
ATOM   7009 C C   . ALA B 1 377 ? -14.708 69.602  17.513  1.00 30.80  ? 374 ALA B C   1 
ATOM   7010 O O   . ALA B 1 377 ? -15.717 69.003  17.901  1.00 30.15  ? 374 ALA B O   1 
ATOM   7011 C CB  . ALA B 1 377 ? -13.774 71.408  18.983  1.00 35.76  ? 374 ALA B CB  1 
ATOM   7012 N N   . ALA B 1 378 ? -14.533 69.951  16.236  1.00 25.55  ? 375 ALA B N   1 
ATOM   7013 C CA  . ALA B 1 378 ? -15.528 69.598  15.229  1.00 33.83  ? 375 ALA B CA  1 
ATOM   7014 C C   . ALA B 1 378 ? -15.611 68.089  15.041  1.00 37.17  ? 375 ALA B C   1 
ATOM   7015 O O   . ALA B 1 378 ? -16.701 67.543  14.829  1.00 35.11  ? 375 ALA B O   1 
ATOM   7016 C CB  . ALA B 1 378 ? -15.203 70.287  13.906  1.00 26.36  ? 375 ALA B CB  1 
ATOM   7017 N N   . GLU B 1 379 ? -14.470 67.397  15.112  1.00 35.84  ? 376 GLU B N   1 
ATOM   7018 C CA  . GLU B 1 379 ? -14.480 65.942  15.011  1.00 40.00  ? 376 GLU B CA  1 
ATOM   7019 C C   . GLU B 1 379 ? -15.239 65.308  16.169  1.00 33.22  ? 376 GLU B C   1 
ATOM   7020 O O   . GLU B 1 379 ? -15.899 64.278  15.989  1.00 35.33  ? 376 GLU B O   1 
ATOM   7021 C CB  . GLU B 1 379 ? -13.048 65.408  14.960  1.00 46.78  ? 376 GLU B CB  1 
ATOM   7022 C CG  . GLU B 1 379 ? -12.275 65.800  13.709  1.00 51.27  ? 376 GLU B CG  1 
ATOM   7023 C CD  . GLU B 1 379 ? -12.520 64.859  12.545  1.00 68.82  ? 376 GLU B CD  1 
ATOM   7024 O OE1 . GLU B 1 379 ? -13.432 64.011  12.639  1.00 66.28  ? 376 GLU B OE1 1 
ATOM   7025 O OE2 . GLU B 1 379 ? -11.791 64.963  11.535  1.00 75.96  ? 376 GLU B OE2 1 
ATOM   7026 N N   . ALA B 1 380 ? -15.160 65.905  17.360  1.00 31.62  ? 377 ALA B N   1 
ATOM   7027 C CA  . ALA B 1 380 ? -15.917 65.390  18.496  1.00 31.18  ? 377 ALA B CA  1 
ATOM   7028 C C   . ALA B 1 380 ? -17.414 65.580  18.291  1.00 29.72  ? 377 ALA B C   1 
ATOM   7029 O O   . ALA B 1 380 ? -18.213 64.721  18.682  1.00 34.45  ? 377 ALA B O   1 
ATOM   7030 C CB  . ALA B 1 380 ? -15.460 66.071  19.786  1.00 25.43  ? 377 ALA B CB  1 
ATOM   7031 N N   . VAL B 1 381 ? -17.812 66.699  17.682  1.00 36.61  ? 378 VAL B N   1 
ATOM   7032 C CA  . VAL B 1 381 ? -19.224 66.924  17.393  1.00 24.86  ? 378 VAL B CA  1 
ATOM   7033 C C   . VAL B 1 381 ? -19.727 65.907  16.377  1.00 27.21  ? 378 VAL B C   1 
ATOM   7034 O O   . VAL B 1 381 ? -20.818 65.344  16.529  1.00 33.04  ? 378 VAL B O   1 
ATOM   7035 C CB  . VAL B 1 381 ? -19.447 68.368  16.909  1.00 23.74  ? 378 VAL B CB  1 
ATOM   7036 C CG1 . VAL B 1 381 ? -20.906 68.583  16.534  1.00 19.73  ? 378 VAL B CG1 1 
ATOM   7037 C CG2 . VAL B 1 381 ? -19.016 69.360  17.978  1.00 21.82  ? 378 VAL B CG2 1 
ATOM   7038 N N   . VAL B 1 382 ? -18.940 65.652  15.329  1.00 25.70  ? 379 VAL B N   1 
ATOM   7039 C CA  . VAL B 1 382 ? -19.328 64.663  14.327  1.00 28.50  ? 379 VAL B CA  1 
ATOM   7040 C C   . VAL B 1 382 ? -19.426 63.279  14.955  1.00 34.76  ? 379 VAL B C   1 
ATOM   7041 O O   . VAL B 1 382 ? -20.324 62.494  14.627  1.00 36.11  ? 379 VAL B O   1 
ATOM   7042 C CB  . VAL B 1 382 ? -18.338 64.684  13.146  1.00 31.01  ? 379 VAL B CB  1 
ATOM   7043 C CG1 . VAL B 1 382 ? -18.669 63.584  12.150  1.00 37.35  ? 379 VAL B CG1 1 
ATOM   7044 C CG2 . VAL B 1 382 ? -18.355 66.044  12.465  1.00 22.80  ? 379 VAL B CG2 1 
ATOM   7045 N N   . LEU B 1 383 ? -18.517 62.963  15.881  1.00 36.90  ? 380 LEU B N   1 
ATOM   7046 C CA  . LEU B 1 383 ? -18.519 61.644  16.506  1.00 35.63  ? 380 LEU B CA  1 
ATOM   7047 C C   . LEU B 1 383 ? -19.797 61.407  17.304  1.00 39.38  ? 380 LEU B C   1 
ATOM   7048 O O   . LEU B 1 383 ? -20.380 60.318  17.248  1.00 38.97  ? 380 LEU B O   1 
ATOM   7049 C CB  . LEU B 1 383 ? -17.283 61.494  17.399  1.00 44.29  ? 380 LEU B CB  1 
ATOM   7050 C CG  . LEU B 1 383 ? -17.015 60.202  18.186  1.00 44.61  ? 380 LEU B CG  1 
ATOM   7051 C CD1 . LEU B 1 383 ? -17.665 60.219  19.571  1.00 42.20  ? 380 LEU B CD1 1 
ATOM   7052 C CD2 . LEU B 1 383 ? -17.416 58.955  17.399  1.00 37.16  ? 380 LEU B CD2 1 
ATOM   7053 N N   A HIS B 1 384 ? -20.249 62.414  18.051  0.51 34.80  ? 381 HIS B N   1 
ATOM   7054 N N   B HIS B 1 384 ? -20.253 62.419  18.047  0.49 35.02  ? 381 HIS B N   1 
ATOM   7055 C CA  A HIS B 1 384 ? -21.420 62.230  18.900  0.51 32.39  ? 381 HIS B CA  1 
ATOM   7056 C CA  B HIS B 1 384 ? -21.418 62.251  18.908  0.49 32.54  ? 381 HIS B CA  1 
ATOM   7057 C C   A HIS B 1 384 ? -22.720 62.243  18.107  0.51 34.02  ? 381 HIS B C   1 
ATOM   7058 C C   B HIS B 1 384 ? -22.731 62.290  18.137  0.49 33.98  ? 381 HIS B C   1 
ATOM   7059 O O   A HIS B 1 384 ? -23.690 61.591  18.510  0.51 35.37  ? 381 HIS B O   1 
ATOM   7060 O O   B HIS B 1 384 ? -23.723 61.706  18.587  0.49 35.35  ? 381 HIS B O   1 
ATOM   7061 C CB  A HIS B 1 384 ? -21.460 63.310  19.983  0.51 30.55  ? 381 HIS B CB  1 
ATOM   7062 C CB  B HIS B 1 384 ? -21.428 63.326  19.996  0.49 30.43  ? 381 HIS B CB  1 
ATOM   7063 C CG  A HIS B 1 384 ? -22.570 63.130  20.972  0.51 30.74  ? 381 HIS B CG  1 
ATOM   7064 C CG  B HIS B 1 384 ? -20.892 62.860  21.313  0.49 32.54  ? 381 HIS B CG  1 
ATOM   7065 N ND1 A HIS B 1 384 ? -23.876 63.469  20.694  0.51 31.61  ? 381 HIS B ND1 1 
ATOM   7066 N ND1 B HIS B 1 384 ? -19.554 62.607  21.526  0.49 33.83  ? 381 HIS B ND1 1 
ATOM   7067 C CD2 A HIS B 1 384 ? -22.568 62.643  22.235  0.51 28.20  ? 381 HIS B CD2 1 
ATOM   7068 C CD2 B HIS B 1 384 ? -21.515 62.601  22.487  0.49 29.84  ? 381 HIS B CD2 1 
ATOM   7069 C CE1 A HIS B 1 384 ? -24.632 63.198  21.742  0.51 29.41  ? 381 HIS B CE1 1 
ATOM   7070 C CE1 B HIS B 1 384 ? -19.376 62.213  22.775  0.49 33.79  ? 381 HIS B CE1 1 
ATOM   7071 N NE2 A HIS B 1 384 ? -23.863 62.697  22.692  0.51 34.19  ? 381 HIS B NE2 1 
ATOM   7072 N NE2 B HIS B 1 384 ? -20.551 62.200  23.379  0.49 33.63  ? 381 HIS B NE2 1 
ATOM   7073 N N   . TYR B 1 385 ? -22.766 62.966  16.987  1.00 29.83  ? 382 TYR B N   1 
ATOM   7074 C CA  . TYR B 1 385 ? -24.000 63.153  16.234  1.00 35.32  ? 382 TYR B CA  1 
ATOM   7075 C C   . TYR B 1 385 ? -24.040 62.351  14.938  1.00 33.60  ? 382 TYR B C   1 
ATOM   7076 O O   . TYR B 1 385 ? -24.846 62.656  14.053  1.00 38.82  ? 382 TYR B O   1 
ATOM   7077 C CB  . TYR B 1 385 ? -24.218 64.639  15.950  1.00 21.97  ? 382 TYR B CB  1 
ATOM   7078 C CG  . TYR B 1 385 ? -24.630 65.423  17.174  1.00 27.90  ? 382 TYR B CG  1 
ATOM   7079 C CD1 . TYR B 1 385 ? -25.969 65.552  17.519  1.00 29.10  ? 382 TYR B CD1 1 
ATOM   7080 C CD2 . TYR B 1 385 ? -23.681 66.024  17.991  1.00 24.55  ? 382 TYR B CD2 1 
ATOM   7081 C CE1 . TYR B 1 385 ? -26.352 66.262  18.639  1.00 21.61  ? 382 TYR B CE1 1 
ATOM   7082 C CE2 . TYR B 1 385 ? -24.056 66.737  19.114  1.00 28.38  ? 382 TYR B CE2 1 
ATOM   7083 C CZ  . TYR B 1 385 ? -25.393 66.853  19.433  1.00 22.11  ? 382 TYR B CZ  1 
ATOM   7084 O OH  . TYR B 1 385 ? -25.772 67.561  20.549  1.00 34.33  ? 382 TYR B OH  1 
ATOM   7085 N N   . THR B 1 386 ? -23.203 61.327  14.807  1.00 36.33  ? 383 THR B N   1 
ATOM   7086 C CA  . THR B 1 386 ? -23.222 60.447  13.646  1.00 34.05  ? 383 THR B CA  1 
ATOM   7087 C C   . THR B 1 386 ? -23.711 59.071  14.074  1.00 35.34  ? 383 THR B C   1 
ATOM   7088 O O   . THR B 1 386 ? -23.147 58.466  14.991  1.00 39.88  ? 383 THR B O   1 
ATOM   7089 C CB  . THR B 1 386 ? -21.840 60.338  13.000  1.00 32.09  ? 383 THR B CB  1 
ATOM   7090 O OG1 . THR B 1 386 ? -21.464 61.606  12.448  1.00 33.95  ? 383 THR B OG1 1 
ATOM   7091 C CG2 . THR B 1 386 ? -21.848 59.290  11.897  1.00 34.24  ? 383 THR B CG2 1 
ATOM   7092 N N   . ASP B 1 387 ? -24.764 58.590  13.419  1.00 36.41  ? 384 ASP B N   1 
ATOM   7093 C CA  . ASP B 1 387 ? -25.189 57.199  13.554  1.00 34.98  ? 384 ASP B CA  1 
ATOM   7094 C C   . ASP B 1 387 ? -24.244 56.366  12.701  1.00 41.61  ? 384 ASP B C   1 
ATOM   7095 O O   . ASP B 1 387 ? -24.381 56.306  11.478  1.00 32.12  ? 384 ASP B O   1 
ATOM   7096 C CB  . ASP B 1 387 ? -26.641 57.032  13.120  1.00 42.49  ? 384 ASP B CB  1 
ATOM   7097 C CG  . ASP B 1 387 ? -27.207 55.663  13.466  1.00 50.73  ? 384 ASP B CG  1 
ATOM   7098 O OD1 . ASP B 1 387 ? -26.425 54.702  13.626  1.00 55.79  ? 384 ASP B OD1 1 
ATOM   7099 O OD2 . ASP B 1 387 ? -28.446 55.547  13.574  1.00 53.91  ? 384 ASP B OD2 1 
ATOM   7100 N N   . TRP B 1 388 ? -23.271 55.722  13.343  1.00 41.62  ? 385 TRP B N   1 
ATOM   7101 C CA  . TRP B 1 388 ? -22.239 55.014  12.596  1.00 45.28  ? 385 TRP B CA  1 
ATOM   7102 C C   . TRP B 1 388 ? -22.730 53.710  11.984  1.00 31.94  ? 385 TRP B C   1 
ATOM   7103 O O   . TRP B 1 388 ? -21.953 53.044  11.292  1.00 43.02  ? 385 TRP B O   1 
ATOM   7104 C CB  . TRP B 1 388 ? -21.033 54.770  13.500  1.00 36.46  ? 385 TRP B CB  1 
ATOM   7105 C CG  . TRP B 1 388 ? -20.381 56.052  13.897  1.00 24.42  ? 385 TRP B CG  1 
ATOM   7106 C CD1 . TRP B 1 388 ? -20.539 56.725  15.073  1.00 32.24  ? 385 TRP B CD1 1 
ATOM   7107 C CD2 . TRP B 1 388 ? -19.494 56.843  13.098  1.00 24.70  ? 385 TRP B CD2 1 
ATOM   7108 N NE1 . TRP B 1 388 ? -19.789 57.877  15.063  1.00 30.72  ? 385 TRP B NE1 1 
ATOM   7109 C CE2 . TRP B 1 388 ? -19.139 57.973  13.860  1.00 27.26  ? 385 TRP B CE2 1 
ATOM   7110 C CE3 . TRP B 1 388 ? -18.959 56.700  11.813  1.00 27.38  ? 385 TRP B CE3 1 
ATOM   7111 C CZ2 . TRP B 1 388 ? -18.273 58.954  13.382  1.00 32.14  ? 385 TRP B CZ2 1 
ATOM   7112 C CZ3 . TRP B 1 388 ? -18.100 57.675  11.340  1.00 29.42  ? 385 TRP B CZ3 1 
ATOM   7113 C CH2 . TRP B 1 388 ? -17.765 58.787  12.123  1.00 31.33  ? 385 TRP B CH2 1 
ATOM   7114 N N   . LEU B 1 389 ? -23.987 53.335  12.212  1.00 37.33  ? 386 LEU B N   1 
ATOM   7115 C CA  . LEU B 1 389 ? -24.602 52.251  11.462  1.00 38.73  ? 386 LEU B CA  1 
ATOM   7116 C C   . LEU B 1 389 ? -25.240 52.736  10.167  1.00 47.02  ? 386 LEU B C   1 
ATOM   7117 O O   . LEU B 1 389 ? -25.427 51.936  9.243   1.00 53.96  ? 386 LEU B O   1 
ATOM   7118 C CB  . LEU B 1 389 ? -25.649 51.538  12.326  1.00 47.57  ? 386 LEU B CB  1 
ATOM   7119 C CG  . LEU B 1 389 ? -26.067 50.134  11.888  1.00 57.91  ? 386 LEU B CG  1 
ATOM   7120 C CD1 . LEU B 1 389 ? -24.843 49.264  11.650  1.00 46.41  ? 386 LEU B CD1 1 
ATOM   7121 C CD2 . LEU B 1 389 ? -26.976 49.504  12.932  1.00 53.26  ? 386 LEU B CD2 1 
ATOM   7122 N N   . HIS B 1 390 ? -25.572 54.025  10.082  1.00 42.97  ? 387 HIS B N   1 
ATOM   7123 C CA  . HIS B 1 390 ? -26.055 54.650  8.848   1.00 35.97  ? 387 HIS B CA  1 
ATOM   7124 C C   . HIS B 1 390 ? -25.379 56.007  8.703   1.00 45.27  ? 387 HIS B C   1 
ATOM   7125 O O   . HIS B 1 390 ? -26.027 57.057  8.783   1.00 34.45  ? 387 HIS B O   1 
ATOM   7126 C CB  . HIS B 1 390 ? -27.579 54.793  8.866   1.00 31.46  ? 387 HIS B CB  1 
ATOM   7127 C CG  . HIS B 1 390 ? -28.301 53.563  9.322   1.00 38.10  ? 387 HIS B CG  1 
ATOM   7128 N ND1 . HIS B 1 390 ? -28.562 52.500  8.485   1.00 40.30  ? 387 HIS B ND1 1 
ATOM   7129 C CD2 . HIS B 1 390 ? -28.823 53.231  10.526  1.00 35.21  ? 387 HIS B CD2 1 
ATOM   7130 C CE1 . HIS B 1 390 ? -29.211 51.564  9.156   1.00 48.98  ? 387 HIS B CE1 1 
ATOM   7131 N NE2 . HIS B 1 390 ? -29.382 51.983  10.396  1.00 51.53  ? 387 HIS B NE2 1 
ATOM   7132 N N   . PRO B 1 391 ? -24.059 56.022  8.486   1.00 41.09  ? 388 PRO B N   1 
ATOM   7133 C CA  . PRO B 1 391 ? -23.322 57.295  8.522   1.00 35.89  ? 388 PRO B CA  1 
ATOM   7134 C C   . PRO B 1 391 ? -23.550 58.179  7.308   1.00 36.82  ? 388 PRO B C   1 
ATOM   7135 O O   . PRO B 1 391 ? -23.106 59.335  7.322   1.00 36.89  ? 388 PRO B O   1 
ATOM   7136 C CB  . PRO B 1 391 ? -21.859 56.845  8.607   1.00 37.97  ? 388 PRO B CB  1 
ATOM   7137 C CG  . PRO B 1 391 ? -21.846 55.542  7.882   1.00 38.71  ? 388 PRO B CG  1 
ATOM   7138 C CD  . PRO B 1 391 ? -23.177 54.884  8.168   1.00 34.39  ? 388 PRO B CD  1 
ATOM   7139 N N   . GLU B 1 392 ? -24.218 57.687  6.266   1.00 38.74  ? 389 GLU B N   1 
ATOM   7140 C CA  . GLU B 1 392 ? -24.435 58.463  5.053   1.00 45.93  ? 389 GLU B CA  1 
ATOM   7141 C C   . GLU B 1 392 ? -25.909 58.675  4.736   1.00 32.28  ? 389 GLU B C   1 
ATOM   7142 O O   . GLU B 1 392 ? -26.225 59.233  3.678   1.00 38.92  ? 389 GLU B O   1 
ATOM   7143 C CB  . GLU B 1 392 ? -23.747 57.783  3.860   1.00 43.87  ? 389 GLU B CB  1 
ATOM   7144 C CG  . GLU B 1 392 ? -22.280 57.459  4.086   1.00 46.80  ? 389 GLU B CG  1 
ATOM   7145 C CD  . GLU B 1 392 ? -21.356 58.323  3.251   1.00 57.28  ? 389 GLU B CD  1 
ATOM   7146 O OE1 . GLU B 1 392 ? -20.155 58.399  3.581   1.00 57.86  ? 389 GLU B OE1 1 
ATOM   7147 O OE2 . GLU B 1 392 ? -21.830 58.925  2.263   1.00 62.57  ? 389 GLU B OE2 1 
ATOM   7148 N N   . ASP B 1 393 ? -26.814 58.250  5.608   1.00 32.47  ? 390 ASP B N   1 
ATOM   7149 C CA  . ASP B 1 393 ? -28.245 58.422  5.371   1.00 36.49  ? 390 ASP B CA  1 
ATOM   7150 C C   . ASP B 1 393 ? -28.596 59.905  5.375   1.00 38.00  ? 390 ASP B C   1 
ATOM   7151 O O   . ASP B 1 393 ? -28.419 60.569  6.405   1.00 33.29  ? 390 ASP B O   1 
ATOM   7152 C CB  . ASP B 1 393 ? -29.048 57.679  6.435   1.00 29.03  ? 390 ASP B CB  1 
ATOM   7153 C CG  . ASP B 1 393 ? -30.532 57.629  6.121   1.00 38.54  ? 390 ASP B CG  1 
ATOM   7154 O OD1 . ASP B 1 393 ? -30.911 57.905  4.963   1.00 46.76  ? 390 ASP B OD1 1 
ATOM   7155 O OD2 . ASP B 1 393 ? -31.322 57.314  7.037   1.00 38.84  ? 390 ASP B OD2 1 
ATOM   7156 N N   . PRO B 1 394 ? -29.089 60.464  4.264   1.00 41.56  ? 391 PRO B N   1 
ATOM   7157 C CA  . PRO B 1 394 ? -29.359 61.913  4.237   1.00 35.21  ? 391 PRO B CA  1 
ATOM   7158 C C   . PRO B 1 394 ? -30.388 62.363  5.259   1.00 28.74  ? 391 PRO B C   1 
ATOM   7159 O O   . PRO B 1 394 ? -30.230 63.433  5.860   1.00 26.77  ? 391 PRO B O   1 
ATOM   7160 C CB  . PRO B 1 394 ? -29.846 62.146  2.799   1.00 37.89  ? 391 PRO B CB  1 
ATOM   7161 C CG  . PRO B 1 394 ? -29.283 61.002  2.015   1.00 34.36  ? 391 PRO B CG  1 
ATOM   7162 C CD  . PRO B 1 394 ? -29.306 59.834  2.951   1.00 33.94  ? 391 PRO B CD  1 
ATOM   7163 N N   . ALA B 1 395 ? -31.443 61.573  5.477   1.00 30.55  ? 392 ALA B N   1 
ATOM   7164 C CA  . ALA B 1 395 ? -32.470 61.965  6.436   1.00 29.33  ? 392 ALA B CA  1 
ATOM   7165 C C   . ALA B 1 395 ? -31.916 62.009  7.854   1.00 41.84  ? 392 ALA B C   1 
ATOM   7166 O O   . ALA B 1 395 ? -32.218 62.933  8.618   1.00 31.85  ? 392 ALA B O   1 
ATOM   7167 C CB  . ALA B 1 395 ? -33.662 61.011  6.354   1.00 30.16  ? 392 ALA B CB  1 
ATOM   7168 N N   . ARG B 1 396 ? -31.100 61.019  8.225   1.00 42.69  ? 393 ARG B N   1 
ATOM   7169 C CA  . ARG B 1 396 ? -30.508 61.016  9.558   1.00 29.23  ? 393 ARG B CA  1 
ATOM   7170 C C   . ARG B 1 396 ? -29.508 62.154  9.722   1.00 31.25  ? 393 ARG B C   1 
ATOM   7171 O O   . ARG B 1 396 ? -29.416 62.755  10.798  1.00 27.97  ? 393 ARG B O   1 
ATOM   7172 C CB  . ARG B 1 396 ? -29.843 59.669  9.838   1.00 32.03  ? 393 ARG B CB  1 
ATOM   7173 C CG  . ARG B 1 396 ? -30.823 58.539  10.115  1.00 36.76  ? 393 ARG B CG  1 
ATOM   7174 C CD  . ARG B 1 396 ? -30.093 57.258  10.489  1.00 42.68  ? 393 ARG B CD  1 
ATOM   7175 N NE  . ARG B 1 396 ? -31.014 56.195  10.880  1.00 42.90  ? 393 ARG B NE  1 
ATOM   7176 C CZ  . ARG B 1 396 ? -31.535 55.309  10.037  1.00 41.40  ? 393 ARG B CZ  1 
ATOM   7177 N NH1 . ARG B 1 396 ? -31.226 55.356  8.749   1.00 42.84  ? 393 ARG B NH1 1 
ATOM   7178 N NH2 . ARG B 1 396 ? -32.365 54.375  10.482  1.00 37.50  ? 393 ARG B NH2 1 
ATOM   7179 N N   . LEU B 1 397 ? -28.753 62.467  8.665   1.00 32.45  ? 394 LEU B N   1 
ATOM   7180 C CA  . LEU B 1 397 ? -27.816 63.584  8.735   1.00 29.66  ? 394 LEU B CA  1 
ATOM   7181 C C   . LEU B 1 397 ? -28.550 64.912  8.871   1.00 31.31  ? 394 LEU B C   1 
ATOM   7182 O O   . LEU B 1 397 ? -28.085 65.817  9.574   1.00 29.45  ? 394 LEU B O   1 
ATOM   7183 C CB  . LEU B 1 397 ? -26.915 63.594  7.501   1.00 29.85  ? 394 LEU B CB  1 
ATOM   7184 C CG  . LEU B 1 397 ? -25.917 62.442  7.377   1.00 37.99  ? 394 LEU B CG  1 
ATOM   7185 C CD1 . LEU B 1 397 ? -25.167 62.523  6.058   1.00 33.33  ? 394 LEU B CD1 1 
ATOM   7186 C CD2 . LEU B 1 397 ? -24.949 62.446  8.550   1.00 26.91  ? 394 LEU B CD2 1 
ATOM   7187 N N   . ARG B 1 398 ? -29.697 65.047  8.201   1.00 29.34  ? 395 ARG B N   1 
ATOM   7188 C CA  . ARG B 1 398 ? -30.493 66.264  8.322   1.00 31.17  ? 395 ARG B CA  1 
ATOM   7189 C C   . ARG B 1 398 ? -30.986 66.453  9.751   1.00 32.01  ? 395 ARG B C   1 
ATOM   7190 O O   . ARG B 1 398 ? -30.891 67.550  10.314  1.00 26.80  ? 395 ARG B O   1 
ATOM   7191 C CB  . ARG B 1 398 ? -31.668 66.213  7.346   1.00 30.35  ? 395 ARG B CB  1 
ATOM   7192 C CG  . ARG B 1 398 ? -32.598 67.411  7.410   1.00 31.95  ? 395 ARG B CG  1 
ATOM   7193 C CD  . ARG B 1 398 ? -33.875 67.124  6.645   1.00 26.19  ? 395 ARG B CD  1 
ATOM   7194 N NE  . ARG B 1 398 ? -34.590 65.986  7.215   1.00 30.19  ? 395 ARG B NE  1 
ATOM   7195 C CZ  . ARG B 1 398 ? -35.535 65.299  6.580   1.00 31.79  ? 395 ARG B CZ  1 
ATOM   7196 N NH1 . ARG B 1 398 ? -35.879 65.627  5.343   1.00 25.31  ? 395 ARG B NH1 1 
ATOM   7197 N NH2 . ARG B 1 398 ? -36.131 64.279  7.182   1.00 24.96  ? 395 ARG B NH2 1 
ATOM   7198 N N   . GLU B 1 399 ? -31.518 65.388  10.357  1.00 30.22  ? 396 GLU B N   1 
ATOM   7199 C CA  . GLU B 1 399 ? -31.941 65.468  11.751  1.00 32.45  ? 396 GLU B CA  1 
ATOM   7200 C C   . GLU B 1 399 ? -30.752 65.604  12.692  1.00 30.06  ? 396 GLU B C   1 
ATOM   7201 O O   . GLU B 1 399 ? -30.892 66.162  13.787  1.00 33.04  ? 396 GLU B O   1 
ATOM   7202 C CB  . GLU B 1 399 ? -32.774 64.240  12.124  1.00 26.85  ? 396 GLU B CB  1 
ATOM   7203 C CG  . GLU B 1 399 ? -34.278 64.450  12.027  1.00 45.70  ? 396 GLU B CG  1 
ATOM   7204 C CD  . GLU B 1 399 ? -34.768 64.560  10.596  1.00 56.79  ? 396 GLU B CD  1 
ATOM   7205 O OE1 . GLU B 1 399 ? -34.657 63.564  9.851   1.00 57.10  ? 396 GLU B OE1 1 
ATOM   7206 O OE2 . GLU B 1 399 ? -35.263 65.642  10.216  1.00 53.26  ? 396 GLU B OE2 1 
ATOM   7207 N N   . ALA B 1 400 ? -29.581 65.106  12.290  1.00 31.10  ? 397 ALA B N   1 
ATOM   7208 C CA  . ALA B 1 400 ? -28.401 65.210  13.142  1.00 26.29  ? 397 ALA B CA  1 
ATOM   7209 C C   . ALA B 1 400 ? -27.926 66.653  13.248  1.00 27.46  ? 397 ALA B C   1 
ATOM   7210 O O   . ALA B 1 400 ? -27.690 67.159  14.351  1.00 24.92  ? 397 ALA B O   1 
ATOM   7211 C CB  . ALA B 1 400 ? -27.285 64.312  12.609  1.00 32.35  ? 397 ALA B CB  1 
ATOM   7212 N N   . LEU B 1 401 ? -27.777 67.333  12.107  1.00 25.02  ? 398 LEU B N   1 
ATOM   7213 C CA  . LEU B 1 401 ? -27.333 68.723  12.131  1.00 28.92  ? 398 LEU B CA  1 
ATOM   7214 C C   . LEU B 1 401 ? -28.352 69.622  12.819  1.00 25.23  ? 398 LEU B C   1 
ATOM   7215 O O   . LEU B 1 401 ? -27.976 70.618  13.448  1.00 26.39  ? 398 LEU B O   1 
ATOM   7216 C CB  . LEU B 1 401 ? -27.059 69.215  10.710  1.00 24.45  ? 398 LEU B CB  1 
ATOM   7217 C CG  . LEU B 1 401 ? -26.385 70.584  10.596  1.00 25.03  ? 398 LEU B CG  1 
ATOM   7218 C CD1 . LEU B 1 401 ? -25.054 70.586  11.332  1.00 28.70  ? 398 LEU B CD1 1 
ATOM   7219 C CD2 . LEU B 1 401 ? -26.194 70.974  9.140   1.00 25.55  ? 398 LEU B CD2 1 
ATOM   7220 N N   . SER B 1 402 ? -29.642 69.290  12.711  1.00 23.77  ? 399 SER B N   1 
ATOM   7221 C CA  . SER B 1 402 ? -30.655 70.023  13.462  1.00 28.43  ? 399 SER B CA  1 
ATOM   7222 C C   . SER B 1 402 ? -30.441 69.868  14.961  1.00 31.76  ? 399 SER B C   1 
ATOM   7223 O O   . SER B 1 402 ? -30.570 70.837  15.719  1.00 24.35  ? 399 SER B O   1 
ATOM   7224 C CB  . SER B 1 402 ? -32.052 69.544  13.066  1.00 26.87  ? 399 SER B CB  1 
ATOM   7225 O OG  . SER B 1 402 ? -33.042 70.117  13.903  1.00 31.89  ? 399 SER B OG  1 
ATOM   7226 N N   . ASP B 1 403 ? -30.108 68.654  15.408  1.00 27.14  ? 400 ASP B N   1 
ATOM   7227 C CA  . ASP B 1 403 ? -29.812 68.444  16.820  1.00 26.41  ? 400 ASP B CA  1 
ATOM   7228 C C   . ASP B 1 403 ? -28.534 69.158  17.238  1.00 26.12  ? 400 ASP B C   1 
ATOM   7229 O O   . ASP B 1 403 ? -28.435 69.626  18.377  1.00 23.37  ? 400 ASP B O   1 
ATOM   7230 C CB  . ASP B 1 403 ? -29.707 66.949  17.121  1.00 34.08  ? 400 ASP B CB  1 
ATOM   7231 C CG  . ASP B 1 403 ? -31.030 66.225  16.957  1.00 37.11  ? 400 ASP B CG  1 
ATOM   7232 O OD1 . ASP B 1 403 ? -32.087 66.861  17.154  1.00 43.05  ? 400 ASP B OD1 1 
ATOM   7233 O OD2 . ASP B 1 403 ? -31.013 65.019  16.633  1.00 32.68  ? 400 ASP B OD2 1 
ATOM   7234 N N   . VAL B 1 404 ? -27.552 69.255  16.338  1.00 21.26  ? 401 VAL B N   1 
ATOM   7235 C CA  . VAL B 1 404 ? -26.304 69.940  16.667  1.00 24.17  ? 401 VAL B CA  1 
ATOM   7236 C C   . VAL B 1 404 ? -26.572 71.403  16.995  1.00 27.46  ? 401 VAL B C   1 
ATOM   7237 O O   . VAL B 1 404 ? -26.121 71.921  18.023  1.00 24.29  ? 401 VAL B O   1 
ATOM   7238 C CB  . VAL B 1 404 ? -25.291 69.801  15.516  1.00 22.93  ? 401 VAL B CB  1 
ATOM   7239 C CG1 . VAL B 1 404 ? -24.071 70.671  15.776  1.00 19.50  ? 401 VAL B CG1 1 
ATOM   7240 C CG2 . VAL B 1 404 ? -24.880 68.349  15.341  1.00 23.07  ? 401 VAL B CG2 1 
ATOM   7241 N N   . VAL B 1 405 ? -27.319 72.088  16.127  1.00 26.35  ? 402 VAL B N   1 
ATOM   7242 C CA  . VAL B 1 405 ? -27.583 73.508  16.335  1.00 25.29  ? 402 VAL B CA  1 
ATOM   7243 C C   . VAL B 1 405 ? -28.531 73.713  17.511  1.00 21.61  ? 402 VAL B C   1 
ATOM   7244 O O   . VAL B 1 405 ? -28.356 74.640  18.312  1.00 23.80  ? 402 VAL B O   1 
ATOM   7245 C CB  . VAL B 1 405 ? -28.133 74.137  15.042  1.00 30.50  ? 402 VAL B CB  1 
ATOM   7246 C CG1 . VAL B 1 405 ? -28.458 75.608  15.257  1.00 24.14  ? 402 VAL B CG1 1 
ATOM   7247 C CG2 . VAL B 1 405 ? -27.133 73.968  13.909  1.00 24.52  ? 402 VAL B CG2 1 
ATOM   7248 N N   . GLY B 1 406 ? -29.539 72.850  17.643  1.00 20.97  ? 403 GLY B N   1 
ATOM   7249 C CA  . GLY B 1 406 ? -30.510 73.021  18.713  1.00 20.54  ? 403 GLY B CA  1 
ATOM   7250 C C   . GLY B 1 406 ? -29.921 72.766  20.088  1.00 28.54  ? 403 GLY B C   1 
ATOM   7251 O O   . GLY B 1 406 ? -30.146 73.538  21.025  1.00 28.10  ? 403 GLY B O   1 
ATOM   7252 N N   . ASP B 1 407 ? -29.160 71.678  20.230  1.00 30.18  ? 404 ASP B N   1 
ATOM   7253 C CA  . ASP B 1 407 ? -28.572 71.355  21.527  1.00 21.47  ? 404 ASP B CA  1 
ATOM   7254 C C   . ASP B 1 407 ? -27.500 72.365  21.915  1.00 21.79  ? 404 ASP B C   1 
ATOM   7255 O O   . ASP B 1 407 ? -27.436 72.797  23.072  1.00 25.66  ? 404 ASP B O   1 
ATOM   7256 C CB  . ASP B 1 407 ? -27.991 69.941  21.506  1.00 22.70  ? 404 ASP B CB  1 
ATOM   7257 C CG  . ASP B 1 407 ? -29.036 68.883  21.210  1.00 31.32  ? 404 ASP B CG  1 
ATOM   7258 O OD1 . ASP B 1 407 ? -30.239 69.218  21.204  1.00 35.85  ? 404 ASP B OD1 1 
ATOM   7259 O OD2 . ASP B 1 407 ? -28.653 67.718  20.975  1.00 38.59  ? 404 ASP B OD2 1 
ATOM   7260 N N   . HIS B 1 408 ? -26.653 72.756  20.961  1.00 21.79  ? 405 HIS B N   1 
ATOM   7261 C CA  . HIS B 1 408 ? -25.551 73.663  21.265  1.00 27.00  ? 405 HIS B CA  1 
ATOM   7262 C C   . HIS B 1 408 ? -26.044 75.047  21.671  1.00 31.78  ? 405 HIS B C   1 
ATOM   7263 O O   . HIS B 1 408 ? -25.424 75.697  22.521  1.00 25.78  ? 405 HIS B O   1 
ATOM   7264 C CB  . HIS B 1 408 ? -24.617 73.763  20.058  1.00 22.49  ? 405 HIS B CB  1 
ATOM   7265 C CG  . HIS B 1 408 ? -23.551 74.805  20.194  1.00 24.80  ? 405 HIS B CG  1 
ATOM   7266 N ND1 . HIS B 1 408 ? -22.677 74.844  21.260  1.00 33.86  ? 405 HIS B ND1 1 
ATOM   7267 C CD2 . HIS B 1 408 ? -23.211 75.841  19.391  1.00 26.49  ? 405 HIS B CD2 1 
ATOM   7268 C CE1 . HIS B 1 408 ? -21.849 75.862  21.109  1.00 33.21  ? 405 HIS B CE1 1 
ATOM   7269 N NE2 . HIS B 1 408 ? -22.151 76.483  19.983  1.00 30.99  ? 405 HIS B NE2 1 
ATOM   7270 N N   . ASN B 1 409 ? -27.152 75.509  21.094  1.00 25.63  ? 406 ASN B N   1 
ATOM   7271 C CA  . ASN B 1 409 ? -27.608 76.876  21.309  1.00 30.02  ? 406 ASN B CA  1 
ATOM   7272 C C   . ASN B 1 409 ? -28.763 76.998  22.293  1.00 16.68  ? 406 ASN B C   1 
ATOM   7273 O O   . ASN B 1 409 ? -28.895 78.043  22.937  1.00 23.46  ? 406 ASN B O   1 
ATOM   7274 C CB  . ASN B 1 409 ? -28.028 77.512  19.979  1.00 21.93  ? 406 ASN B CB  1 
ATOM   7275 C CG  . ASN B 1 409 ? -26.858 77.731  19.040  1.00 23.32  ? 406 ASN B CG  1 
ATOM   7276 O OD1 . ASN B 1 409 ? -26.020 78.604  19.268  1.00 28.08  ? 406 ASN B OD1 1 
ATOM   7277 N ND2 . ASN B 1 409 ? -26.802 76.946  17.971  1.00 17.01  ? 406 ASN B ND2 1 
ATOM   7278 N N   . VAL B 1 410 ? -29.605 75.975  22.429  1.00 18.79  ? 407 VAL B N   1 
ATOM   7279 C CA  . VAL B 1 410 ? -30.827 76.120  23.213  1.00 22.26  ? 407 VAL B CA  1 
ATOM   7280 C C   . VAL B 1 410 ? -30.941 75.043  24.285  1.00 24.91  ? 407 VAL B C   1 
ATOM   7281 O O   . VAL B 1 410 ? -30.913 75.344  25.483  1.00 27.80  ? 407 VAL B O   1 
ATOM   7282 C CB  . VAL B 1 410 ? -32.070 76.100  22.305  1.00 27.86  ? 407 VAL B CB  1 
ATOM   7283 C CG1 . VAL B 1 410 ? -33.329 76.263  23.138  1.00 27.04  ? 407 VAL B CG1 1 
ATOM   7284 C CG2 . VAL B 1 410 ? -31.982 77.189  21.247  1.00 17.22  ? 407 VAL B CG2 1 
ATOM   7285 N N   . VAL B 1 411 ? -31.074 73.783  23.858  1.00 25.49  ? 408 VAL B N   1 
ATOM   7286 C CA  . VAL B 1 411 ? -31.488 72.715  24.769  1.00 25.99  ? 408 VAL B CA  1 
ATOM   7287 C C   . VAL B 1 411 ? -30.494 72.559  25.914  1.00 27.42  ? 408 VAL B C   1 
ATOM   7288 O O   . VAL B 1 411 ? -30.878 72.480  27.087  1.00 30.71  ? 408 VAL B O   1 
ATOM   7289 C CB  . VAL B 1 411 ? -31.669 71.395  23.999  1.00 22.53  ? 408 VAL B CB  1 
ATOM   7290 C CG1 . VAL B 1 411 ? -32.098 70.284  24.947  1.00 31.23  ? 408 VAL B CG1 1 
ATOM   7291 C CG2 . VAL B 1 411 ? -32.683 71.568  22.880  1.00 28.92  ? 408 VAL B CG2 1 
ATOM   7292 N N   . CYS B 1 412 ? -29.208 72.514  25.596  1.00 21.13  ? 409 CYS B N   1 
ATOM   7293 C CA  . CYS B 1 412 ? -28.206 72.268  26.626  1.00 31.77  ? 409 CYS B CA  1 
ATOM   7294 C C   . CYS B 1 412 ? -27.936 73.502  27.486  1.00 30.09  ? 409 CYS B C   1 
ATOM   7295 O O   . CYS B 1 412 ? -27.751 73.358  28.701  1.00 33.38  ? 409 CYS B O   1 
ATOM   7296 C CB  . CYS B 1 412 ? -26.916 71.746  25.995  1.00 24.79  ? 409 CYS B CB  1 
ATOM   7297 S SG  . CYS B 1 412 ? -27.169 70.182  25.135  1.00 28.68  ? 409 CYS B SG  1 
ATOM   7298 N N   . PRO B 1 413 ? -27.888 74.718  26.925  1.00 33.28  ? 410 PRO B N   1 
ATOM   7299 C CA  . PRO B 1 413 ? -27.854 75.898  27.806  1.00 31.98  ? 410 PRO B CA  1 
ATOM   7300 C C   . PRO B 1 413 ? -29.057 75.990  28.730  1.00 28.19  ? 410 PRO B C   1 
ATOM   7301 O O   . PRO B 1 413 ? -28.916 76.445  29.872  1.00 27.88  ? 410 PRO B O   1 
ATOM   7302 C CB  . PRO B 1 413 ? -27.807 77.071  26.818  1.00 30.06  ? 410 PRO B CB  1 
ATOM   7303 C CG  . PRO B 1 413 ? -27.140 76.512  25.625  1.00 31.30  ? 410 PRO B CG  1 
ATOM   7304 C CD  . PRO B 1 413 ? -27.628 75.093  25.521  1.00 29.05  ? 410 PRO B CD  1 
ATOM   7305 N N   . VAL B 1 414 ? -30.236 75.566  28.272  1.00 24.43  ? 411 VAL B N   1 
ATOM   7306 C CA  . VAL B 1 414 ? -31.415 75.579  29.132  1.00 26.84  ? 411 VAL B CA  1 
ATOM   7307 C C   . VAL B 1 414 ? -31.311 74.495  30.198  1.00 36.33  ? 411 VAL B C   1 
ATOM   7308 O O   . VAL B 1 414 ? -31.605 74.734  31.376  1.00 27.83  ? 411 VAL B O   1 
ATOM   7309 C CB  . VAL B 1 414 ? -32.693 75.427  28.288  1.00 26.43  ? 411 VAL B CB  1 
ATOM   7310 C CG1 . VAL B 1 414 ? -33.878 75.067  29.169  1.00 24.74  ? 411 VAL B CG1 1 
ATOM   7311 C CG2 . VAL B 1 414 ? -32.975 76.711  27.520  1.00 27.54  ? 411 VAL B CG2 1 
ATOM   7312 N N   . ALA B 1 415 ? -30.891 73.288  29.807  1.00 32.88  ? 412 ALA B N   1 
ATOM   7313 C CA  . ALA B 1 415 ? -30.742 72.206  30.775  1.00 24.07  ? 412 ALA B CA  1 
ATOM   7314 C C   . ALA B 1 415 ? -29.662 72.529  31.800  1.00 26.18  ? 412 ALA B C   1 
ATOM   7315 O O   . ALA B 1 415 ? -29.806 72.210  32.987  1.00 28.52  ? 412 ALA B O   1 
ATOM   7316 C CB  . ALA B 1 415 ? -30.428 70.894  30.056  1.00 27.03  ? 412 ALA B CB  1 
ATOM   7317 N N   . GLN B 1 416 ? -28.570 73.157  31.359  1.00 23.88  ? 413 GLN B N   1 
ATOM   7318 C CA  . GLN B 1 416 ? -27.544 73.613  32.292  1.00 21.74  ? 413 GLN B CA  1 
ATOM   7319 C C   . GLN B 1 416 ? -28.131 74.584  33.308  1.00 39.93  ? 413 GLN B C   1 
ATOM   7320 O O   . GLN B 1 416 ? -27.891 74.462  34.515  1.00 35.20  ? 413 GLN B O   1 
ATOM   7321 C CB  . GLN B 1 416 ? -26.396 74.269  31.523  1.00 27.53  ? 413 GLN B CB  1 
ATOM   7322 C CG  . GLN B 1 416 ? -25.322 74.894  32.402  1.00 34.45  ? 413 GLN B CG  1 
ATOM   7323 C CD  . GLN B 1 416 ? -24.207 73.926  32.743  1.00 52.43  ? 413 GLN B CD  1 
ATOM   7324 O OE1 . GLN B 1 416 ? -23.295 73.707  31.944  1.00 65.21  ? 413 GLN B OE1 1 
ATOM   7325 N NE2 . GLN B 1 416 ? -24.272 73.341  33.933  1.00 57.23  ? 413 GLN B NE2 1 
ATOM   7326 N N   . LEU B 1 417 ? -28.914 75.555  32.832  1.00 37.04  ? 414 LEU B N   1 
ATOM   7327 C CA  . LEU B 1 417 ? -29.516 76.536  33.728  1.00 31.63  ? 414 LEU B CA  1 
ATOM   7328 C C   . LEU B 1 417 ? -30.535 75.890  34.659  1.00 31.41  ? 414 LEU B C   1 
ATOM   7329 O O   . LEU B 1 417 ? -30.547 76.170  35.863  1.00 29.57  ? 414 LEU B O   1 
ATOM   7330 C CB  . LEU B 1 417 ? -30.164 77.655  32.914  1.00 32.51  ? 414 LEU B CB  1 
ATOM   7331 C CG  . LEU B 1 417 ? -30.983 78.689  33.689  1.00 32.40  ? 414 LEU B CG  1 
ATOM   7332 C CD1 . LEU B 1 417 ? -30.109 79.436  34.683  1.00 35.69  ? 414 LEU B CD1 1 
ATOM   7333 C CD2 . LEU B 1 417 ? -31.658 79.655  32.732  1.00 32.01  ? 414 LEU B CD2 1 
ATOM   7334 N N   . ALA B 1 418 ? -31.393 75.018  34.121  1.00 26.68  ? 415 ALA B N   1 
ATOM   7335 C CA  . ALA B 1 418 ? -32.431 74.398  34.939  1.00 29.09  ? 415 ALA B CA  1 
ATOM   7336 C C   . ALA B 1 418 ? -31.839 73.534  36.046  1.00 40.81  ? 415 ALA B C   1 
ATOM   7337 O O   . ALA B 1 418 ? -32.400 73.464  37.146  1.00 35.50  ? 415 ALA B O   1 
ATOM   7338 C CB  . ALA B 1 418 ? -33.364 73.568  34.059  1.00 25.70  ? 415 ALA B CB  1 
ATOM   7339 N N   . GLY B 1 419 ? -30.713 72.873  35.780  1.00 37.60  ? 416 GLY B N   1 
ATOM   7340 C CA  . GLY B 1 419 ? -30.094 72.053  36.807  1.00 32.84  ? 416 GLY B CA  1 
ATOM   7341 C C   . GLY B 1 419 ? -29.479 72.876  37.922  1.00 32.26  ? 416 GLY B C   1 
ATOM   7342 O O   . GLY B 1 419 ? -29.637 72.553  39.103  1.00 32.72  ? 416 GLY B O   1 
ATOM   7343 N N   . ARG B 1 420 ? -28.766 73.948  37.566  1.00 29.07  ? 417 ARG B N   1 
ATOM   7344 C CA  . ARG B 1 420 ? -28.149 74.794  38.583  1.00 30.70  ? 417 ARG B CA  1 
ATOM   7345 C C   . ARG B 1 420 ? -29.192 75.550  39.396  1.00 42.39  ? 417 ARG B C   1 
ATOM   7346 O O   . ARG B 1 420 ? -28.979 75.805  40.587  1.00 46.02  ? 417 ARG B O   1 
ATOM   7347 C CB  . ARG B 1 420 ? -27.175 75.775  37.932  1.00 33.55  ? 417 ARG B CB  1 
ATOM   7348 C CG  . ARG B 1 420 ? -26.112 75.129  37.055  1.00 42.23  ? 417 ARG B CG  1 
ATOM   7349 C CD  . ARG B 1 420 ? -25.116 74.316  37.866  1.00 52.80  ? 417 ARG B CD  1 
ATOM   7350 N NE  . ARG B 1 420 ? -24.456 75.121  38.890  1.00 57.76  ? 417 ARG B NE  1 
ATOM   7351 C CZ  . ARG B 1 420 ? -23.301 74.798  39.464  1.00 53.87  ? 417 ARG B CZ  1 
ATOM   7352 N NH1 . ARG B 1 420 ? -22.668 73.689  39.106  1.00 58.58  ? 417 ARG B NH1 1 
ATOM   7353 N NH2 . ARG B 1 420 ? -22.774 75.587  40.390  1.00 51.13  ? 417 ARG B NH2 1 
ATOM   7354 N N   . LEU B 1 421 ? -30.317 75.918  38.779  1.00 35.87  ? 418 LEU B N   1 
ATOM   7355 C CA  . LEU B 1 421 ? -31.366 76.626  39.507  1.00 39.05  ? 418 LEU B CA  1 
ATOM   7356 C C   . LEU B 1 421 ? -32.017 75.725  40.549  1.00 40.28  ? 418 LEU B C   1 
ATOM   7357 O O   . LEU B 1 421 ? -32.172 76.115  41.713  1.00 38.04  ? 418 LEU B O   1 
ATOM   7358 C CB  . LEU B 1 421 ? -32.417 77.161  38.533  1.00 35.61  ? 418 LEU B CB  1 
ATOM   7359 C CG  . LEU B 1 421 ? -32.056 78.363  37.659  1.00 33.56  ? 418 LEU B CG  1 
ATOM   7360 C CD1 . LEU B 1 421 ? -33.191 78.673  36.696  1.00 33.49  ? 418 LEU B CD1 1 
ATOM   7361 C CD2 . LEU B 1 421 ? -31.735 79.576  38.512  1.00 34.62  ? 418 LEU B CD2 1 
ATOM   7362 N N   . ALA B 1 422 ? -32.408 74.513  40.146  1.00 32.68  ? 419 ALA B N   1 
ATOM   7363 C CA  . ALA B 1 422 ? -33.093 73.611  41.066  1.00 34.62  ? 419 ALA B CA  1 
ATOM   7364 C C   . ALA B 1 422 ? -32.173 73.161  42.193  1.00 41.27  ? 419 ALA B C   1 
ATOM   7365 O O   . ALA B 1 422 ? -32.615 73.004  43.337  1.00 45.64  ? 419 ALA B O   1 
ATOM   7366 C CB  . ALA B 1 422 ? -33.639 72.403  40.306  1.00 38.03  ? 419 ALA B CB  1 
ATOM   7367 N N   . ALA B 1 423 ? -30.893 72.953  41.895  1.00 38.94  ? 420 ALA B N   1 
ATOM   7368 C CA  . ALA B 1 423 ? -29.937 72.498  42.895  1.00 45.68  ? 420 ALA B CA  1 
ATOM   7369 C C   . ALA B 1 423 ? -29.418 73.621  43.782  1.00 48.62  ? 420 ALA B C   1 
ATOM   7370 O O   . ALA B 1 423 ? -28.531 73.374  44.607  1.00 64.64  ? 420 ALA B O   1 
ATOM   7371 C CB  . ALA B 1 423 ? -28.759 71.797  42.213  1.00 37.24  ? 420 ALA B CB  1 
ATOM   7372 N N   . GLN B 1 424 ? -29.938 74.842  43.640  1.00 48.37  ? 421 GLN B N   1 
ATOM   7373 C CA  . GLN B 1 424 ? -29.455 75.975  44.422  1.00 40.74  ? 421 GLN B CA  1 
ATOM   7374 C C   . GLN B 1 424 ? -30.604 76.808  44.979  1.00 33.96  ? 421 GLN B C   1 
ATOM   7375 O O   . GLN B 1 424 ? -30.436 78.002  45.244  1.00 48.65  ? 421 GLN B O   1 
ATOM   7376 C CB  . GLN B 1 424 ? -28.506 76.845  43.595  1.00 32.89  ? 421 GLN B CB  1 
ATOM   7377 C CG  . GLN B 1 424 ? -27.181 76.158  43.273  1.00 34.88  ? 421 GLN B CG  1 
ATOM   7378 C CD  . GLN B 1 424 ? -26.348 76.914  42.257  1.00 47.70  ? 421 GLN B CD  1 
ATOM   7379 O OE1 . GLN B 1 424 ? -25.657 76.314  41.433  1.00 44.82  ? 421 GLN B OE1 1 
ATOM   7380 N NE2 . GLN B 1 424 ? -26.400 78.237  42.317  1.00 48.15  ? 421 GLN B NE2 1 
ATOM   7381 N N   . GLY B 1 425 ? -31.777 76.196  45.167  1.00 33.78  ? 422 GLY B N   1 
ATOM   7382 C CA  . GLY B 1 425 ? -32.873 76.789  45.916  1.00 48.15  ? 422 GLY B CA  1 
ATOM   7383 C C   . GLY B 1 425 ? -34.147 76.981  45.116  1.00 43.45  ? 422 GLY B C   1 
ATOM   7384 O O   . GLY B 1 425 ? -35.242 76.943  45.687  1.00 39.12  ? 422 GLY B O   1 
ATOM   7385 N N   . ALA B 1 426 ? -34.028 77.193  43.809  1.00 38.36  ? 423 ALA B N   1 
ATOM   7386 C CA  . ALA B 1 426 ? -35.192 77.519  42.999  1.00 38.37  ? 423 ALA B CA  1 
ATOM   7387 C C   . ALA B 1 426 ? -36.039 76.283  42.719  1.00 35.89  ? 423 ALA B C   1 
ATOM   7388 O O   . ALA B 1 426 ? -35.530 75.165  42.594  1.00 49.05  ? 423 ALA B O   1 
ATOM   7389 C CB  . ALA B 1 426 ? -34.768 78.161  41.677  1.00 37.67  ? 423 ALA B CB  1 
ATOM   7390 N N   . ARG B 1 427 ? -37.349 76.497  42.628  1.00 30.70  ? 424 ARG B N   1 
ATOM   7391 C CA  . ARG B 1 427 ? -38.279 75.468  42.179  1.00 35.26  ? 424 ARG B CA  1 
ATOM   7392 C C   . ARG B 1 427 ? -38.454 75.599  40.671  1.00 47.49  ? 424 ARG B C   1 
ATOM   7393 O O   . ARG B 1 427 ? -38.906 76.640  40.183  1.00 39.53  ? 424 ARG B O   1 
ATOM   7394 C CB  . ARG B 1 427 ? -39.624 75.592  42.892  1.00 34.14  ? 424 ARG B CB  1 
ATOM   7395 C CG  . ARG B 1 427 ? -40.699 74.679  42.327  1.00 49.41  ? 424 ARG B CG  1 
ATOM   7396 C CD  . ARG B 1 427 ? -41.919 74.631  43.230  1.00 65.06  ? 424 ARG B CD  1 
ATOM   7397 N NE  . ARG B 1 427 ? -41.562 74.251  44.594  1.00 78.00  ? 424 ARG B NE  1 
ATOM   7398 C CZ  . ARG B 1 427 ? -41.335 73.002  44.987  1.00 79.74  ? 424 ARG B CZ  1 
ATOM   7399 N NH1 . ARG B 1 427 ? -41.424 72.004  44.118  1.00 65.64  ? 424 ARG B NH1 1 
ATOM   7400 N NH2 . ARG B 1 427 ? -41.015 72.749  46.249  1.00 65.09  ? 424 ARG B NH2 1 
ATOM   7401 N N   . VAL B 1 428 ? -38.096 74.548  39.939  1.00 41.73  ? 425 VAL B N   1 
ATOM   7402 C CA  . VAL B 1 428 ? -38.040 74.584  38.484  1.00 30.32  ? 425 VAL B CA  1 
ATOM   7403 C C   . VAL B 1 428 ? -39.040 73.587  37.916  1.00 35.43  ? 425 VAL B C   1 
ATOM   7404 O O   . VAL B 1 428 ? -39.154 72.458  38.405  1.00 40.32  ? 425 VAL B O   1 
ATOM   7405 C CB  . VAL B 1 428 ? -36.616 74.281  37.970  1.00 34.70  ? 425 VAL B CB  1 
ATOM   7406 C CG1 . VAL B 1 428 ? -36.559 74.381  36.454  1.00 34.23  ? 425 VAL B CG1 1 
ATOM   7407 C CG2 . VAL B 1 428 ? -35.610 75.224  38.611  1.00 27.46  ? 425 VAL B CG2 1 
ATOM   7408 N N   . TYR B 1 429 ? -39.768 74.015  36.887  1.00 31.45  ? 426 TYR B N   1 
ATOM   7409 C CA  . TYR B 1 429 ? -40.632 73.146  36.100  1.00 30.29  ? 426 TYR B CA  1 
ATOM   7410 C C   . TYR B 1 429 ? -40.154 73.175  34.656  1.00 30.42  ? 426 TYR B C   1 
ATOM   7411 O O   . TYR B 1 429 ? -39.894 74.252  34.108  1.00 34.14  ? 426 TYR B O   1 
ATOM   7412 C CB  . TYR B 1 429 ? -42.096 73.585  36.188  1.00 26.65  ? 426 TYR B CB  1 
ATOM   7413 C CG  . TYR B 1 429 ? -42.703 73.449  37.566  1.00 38.83  ? 426 TYR B CG  1 
ATOM   7414 C CD1 . TYR B 1 429 ? -43.361 72.286  37.943  1.00 42.37  ? 426 TYR B CD1 1 
ATOM   7415 C CD2 . TYR B 1 429 ? -42.623 74.485  38.487  1.00 36.08  ? 426 TYR B CD2 1 
ATOM   7416 C CE1 . TYR B 1 429 ? -43.920 72.157  39.202  1.00 46.09  ? 426 TYR B CE1 1 
ATOM   7417 C CE2 . TYR B 1 429 ? -43.178 74.366  39.747  1.00 37.64  ? 426 TYR B CE2 1 
ATOM   7418 C CZ  . TYR B 1 429 ? -43.826 73.200  40.099  1.00 45.20  ? 426 TYR B CZ  1 
ATOM   7419 O OH  . TYR B 1 429 ? -44.380 73.077  41.353  1.00 43.00  ? 426 TYR B OH  1 
ATOM   7420 N N   . ALA B 1 430 ? -40.034 71.999  34.046  1.00 38.94  ? 427 ALA B N   1 
ATOM   7421 C CA  . ALA B 1 430 ? -39.510 71.871  32.695  1.00 25.83  ? 427 ALA B CA  1 
ATOM   7422 C C   . ALA B 1 430 ? -40.538 71.207  31.789  1.00 28.19  ? 427 ALA B C   1 
ATOM   7423 O O   . ALA B 1 430 ? -41.341 70.380  32.233  1.00 28.97  ? 427 ALA B O   1 
ATOM   7424 C CB  . ALA B 1 430 ? -38.205 71.066  32.679  1.00 26.14  ? 427 ALA B CB  1 
ATOM   7425 N N   . TYR B 1 431 ? -40.505 71.577  30.509  1.00 23.02  ? 428 TYR B N   1 
ATOM   7426 C CA  . TYR B 1 431 ? -41.417 71.027  29.518  1.00 24.64  ? 428 TYR B CA  1 
ATOM   7427 C C   . TYR B 1 431 ? -40.684 70.848  28.196  1.00 24.29  ? 428 TYR B C   1 
ATOM   7428 O O   . TYR B 1 431 ? -39.591 71.380  27.986  1.00 28.53  ? 428 TYR B O   1 
ATOM   7429 C CB  . TYR B 1 431 ? -42.654 71.919  29.322  1.00 28.63  ? 428 TYR B CB  1 
ATOM   7430 C CG  . TYR B 1 431 ? -42.372 73.253  28.654  1.00 30.49  ? 428 TYR B CG  1 
ATOM   7431 C CD1 . TYR B 1 431 ? -42.321 73.365  27.268  1.00 28.04  ? 428 TYR B CD1 1 
ATOM   7432 C CD2 . TYR B 1 431 ? -42.174 74.401  29.410  1.00 31.93  ? 428 TYR B CD2 1 
ATOM   7433 C CE1 . TYR B 1 431 ? -42.064 74.577  26.657  1.00 30.61  ? 428 TYR B CE1 1 
ATOM   7434 C CE2 . TYR B 1 431 ? -41.920 75.620  28.805  1.00 30.13  ? 428 TYR B CE2 1 
ATOM   7435 C CZ  . TYR B 1 431 ? -41.866 75.700  27.429  1.00 28.85  ? 428 TYR B CZ  1 
ATOM   7436 O OH  . TYR B 1 431 ? -41.612 76.908  26.822  1.00 28.01  ? 428 TYR B OH  1 
ATOM   7437 N N   . VAL B 1 432 ? -41.310 70.092  27.296  1.00 29.05  ? 429 VAL B N   1 
ATOM   7438 C CA  . VAL B 1 432 ? -40.864 69.965  25.912  1.00 29.10  ? 429 VAL B CA  1 
ATOM   7439 C C   . VAL B 1 432 ? -42.098 70.035  25.024  1.00 32.59  ? 429 VAL B C   1 
ATOM   7440 O O   . VAL B 1 432 ? -42.984 69.178  25.119  1.00 26.97  ? 429 VAL B O   1 
ATOM   7441 C CB  . VAL B 1 432 ? -40.088 68.661  25.653  1.00 31.32  ? 429 VAL B CB  1 
ATOM   7442 C CG1 . VAL B 1 432 ? -39.920 68.437  24.160  1.00 25.19  ? 429 VAL B CG1 1 
ATOM   7443 C CG2 . VAL B 1 432 ? -38.728 68.713  26.327  1.00 35.42  ? 429 VAL B CG2 1 
ATOM   7444 N N   . PHE B 1 433 ? -42.162 71.055  24.172  1.00 29.96  ? 430 PHE B N   1 
ATOM   7445 C CA  . PHE B 1 433 ? -43.312 71.264  23.299  1.00 27.27  ? 430 PHE B CA  1 
ATOM   7446 C C   . PHE B 1 433 ? -43.166 70.394  22.055  1.00 33.59  ? 430 PHE B C   1 
ATOM   7447 O O   . PHE B 1 433 ? -42.201 70.545  21.297  1.00 30.57  ? 430 PHE B O   1 
ATOM   7448 C CB  . PHE B 1 433 ? -43.419 72.741  22.927  1.00 29.97  ? 430 PHE B CB  1 
ATOM   7449 C CG  . PHE B 1 433 ? -44.744 73.127  22.340  1.00 30.25  ? 430 PHE B CG  1 
ATOM   7450 C CD1 . PHE B 1 433 ? -45.806 73.465  23.162  1.00 20.35  ? 430 PHE B CD1 1 
ATOM   7451 C CD2 . PHE B 1 433 ? -44.926 73.164  20.969  1.00 26.43  ? 430 PHE B CD2 1 
ATOM   7452 C CE1 . PHE B 1 433 ? -47.026 73.825  22.626  1.00 26.67  ? 430 PHE B CE1 1 
ATOM   7453 C CE2 . PHE B 1 433 ? -46.145 73.523  20.428  1.00 36.13  ? 430 PHE B CE2 1 
ATOM   7454 C CZ  . PHE B 1 433 ? -47.196 73.854  21.258  1.00 28.43  ? 430 PHE B CZ  1 
ATOM   7455 N N   . GLU B 1 434 ? -44.124 69.485  21.841  1.00 33.31  ? 431 GLU B N   1 
ATOM   7456 C CA  . GLU B 1 434 ? -44.008 68.490  20.779  1.00 32.38  ? 431 GLU B CA  1 
ATOM   7457 C C   . GLU B 1 434 ? -45.205 68.490  19.833  1.00 34.47  ? 431 GLU B C   1 
ATOM   7458 O O   . GLU B 1 434 ? -45.452 67.480  19.165  1.00 38.21  ? 431 GLU B O   1 
ATOM   7459 C CB  . GLU B 1 434 ? -43.825 67.088  21.366  1.00 35.90  ? 431 GLU B CB  1 
ATOM   7460 C CG  . GLU B 1 434 ? -42.705 66.966  22.381  1.00 39.35  ? 431 GLU B CG  1 
ATOM   7461 C CD  . GLU B 1 434 ? -42.371 65.522  22.700  1.00 45.37  ? 431 GLU B CD  1 
ATOM   7462 O OE1 . GLU B 1 434 ? -41.285 65.058  22.293  1.00 50.31  ? 431 GLU B OE1 1 
ATOM   7463 O OE2 . GLU B 1 434 ? -43.200 64.848  23.345  1.00 48.24  ? 431 GLU B OE2 1 
ATOM   7464 N N   . HIS B 1 435 ? -45.952 69.585  19.750  1.00 33.65  ? 432 HIS B N   1 
ATOM   7465 C CA  . HIS B 1 435 ? -47.103 69.672  18.859  1.00 29.47  ? 432 HIS B CA  1 
ATOM   7466 C C   . HIS B 1 435 ? -46.775 70.599  17.697  1.00 31.12  ? 432 HIS B C   1 
ATOM   7467 O O   . HIS B 1 435 ? -46.457 71.774  17.905  1.00 31.50  ? 432 HIS B O   1 
ATOM   7468 C CB  . HIS B 1 435 ? -48.347 70.168  19.594  1.00 35.68  ? 432 HIS B CB  1 
ATOM   7469 C CG  . HIS B 1 435 ? -49.526 70.381  18.695  1.00 32.54  ? 432 HIS B CG  1 
ATOM   7470 N ND1 . HIS B 1 435 ? -50.120 69.356  17.991  1.00 39.55  ? 432 HIS B ND1 1 
ATOM   7471 C CD2 . HIS B 1 435 ? -50.212 71.504  18.375  1.00 31.19  ? 432 HIS B CD2 1 
ATOM   7472 C CE1 . HIS B 1 435 ? -51.125 69.836  17.281  1.00 30.42  ? 432 HIS B CE1 1 
ATOM   7473 N NE2 . HIS B 1 435 ? -51.202 71.137  17.496  1.00 31.94  ? 432 HIS B NE2 1 
ATOM   7474 N N   . ARG B 1 436 ? -46.857 70.069  16.480  1.00 28.27  ? 433 ARG B N   1 
ATOM   7475 C CA  . ARG B 1 436 ? -46.712 70.869  15.272  1.00 29.34  ? 433 ARG B CA  1 
ATOM   7476 C C   . ARG B 1 436 ? -48.081 71.409  14.879  1.00 31.21  ? 433 ARG B C   1 
ATOM   7477 O O   . ARG B 1 436 ? -49.026 70.635  14.690  1.00 31.45  ? 433 ARG B O   1 
ATOM   7478 C CB  . ARG B 1 436 ? -46.111 70.042  14.137  1.00 28.11  ? 433 ARG B CB  1 
ATOM   7479 C CG  . ARG B 1 436 ? -46.076 70.765  12.798  1.00 25.77  ? 433 ARG B CG  1 
ATOM   7480 C CD  . ARG B 1 436 ? -45.635 69.837  11.678  1.00 31.43  ? 433 ARG B CD  1 
ATOM   7481 N NE  . ARG B 1 436 ? -45.714 70.483  10.371  1.00 29.46  ? 433 ARG B NE  1 
ATOM   7482 C CZ  . ARG B 1 436 ? -44.690 71.074  9.764   1.00 34.40  ? 433 ARG B CZ  1 
ATOM   7483 N NH1 . ARG B 1 436 ? -43.497 71.100  10.344  1.00 26.28  ? 433 ARG B NH1 1 
ATOM   7484 N NH2 . ARG B 1 436 ? -44.856 71.637  8.575   1.00 34.05  ? 433 ARG B NH2 1 
ATOM   7485 N N   . ALA B 1 437 ? -48.186 72.732  14.764  1.00 26.48  ? 434 ALA B N   1 
ATOM   7486 C CA  . ALA B 1 437 ? -49.458 73.355  14.429  1.00 27.82  ? 434 ALA B CA  1 
ATOM   7487 C C   . ALA B 1 437 ? -49.952 72.877  13.070  1.00 30.89  ? 434 ALA B C   1 
ATOM   7488 O O   . ALA B 1 437 ? -49.169 72.681  12.137  1.00 37.15  ? 434 ALA B O   1 
ATOM   7489 C CB  . ALA B 1 437 ? -49.320 74.878  14.435  1.00 29.74  ? 434 ALA B CB  1 
ATOM   7490 N N   . SER B 1 438 ? -51.269 72.684  12.965  1.00 27.14  ? 435 SER B N   1 
ATOM   7491 C CA  . SER B 1 438 ? -51.863 72.230  11.713  1.00 32.14  ? 435 SER B CA  1 
ATOM   7492 C C   . SER B 1 438 ? -51.758 73.273  10.609  1.00 27.83  ? 435 SER B C   1 
ATOM   7493 O O   . SER B 1 438 ? -51.862 72.921  9.429   1.00 32.39  ? 435 SER B O   1 
ATOM   7494 C CB  . SER B 1 438 ? -53.329 71.855  11.934  1.00 29.51  ? 435 SER B CB  1 
ATOM   7495 O OG  . SER B 1 438 ? -54.078 72.974  12.375  1.00 33.86  ? 435 SER B OG  1 
ATOM   7496 N N   . THR B 1 439 ? -51.554 74.540  10.962  1.00 24.75  ? 436 THR B N   1 
ATOM   7497 C CA  . THR B 1 439 ? -51.457 75.624  9.996   1.00 36.24  ? 436 THR B CA  1 
ATOM   7498 C C   . THR B 1 439 ? -50.021 76.074  9.760   1.00 35.50  ? 436 THR B C   1 
ATOM   7499 O O   . THR B 1 439 ? -49.805 77.136  9.168   1.00 33.90  ? 436 THR B O   1 
ATOM   7500 C CB  . THR B 1 439 ? -52.302 76.814  10.456  1.00 37.14  ? 436 THR B CB  1 
ATOM   7501 O OG1 . THR B 1 439 ? -51.854 77.248  11.747  1.00 25.67  ? 436 THR B OG1 1 
ATOM   7502 C CG2 . THR B 1 439 ? -53.770 76.422  10.541  1.00 36.97  ? 436 THR B CG2 1 
ATOM   7503 N N   . LEU B 1 440 ? -49.040 75.292  10.204  1.00 27.73  ? 437 LEU B N   1 
ATOM   7504 C CA  . LEU B 1 440 ? -47.644 75.684  10.062  1.00 35.37  ? 437 LEU B CA  1 
ATOM   7505 C C   . LEU B 1 440 ? -47.239 75.701  8.592   1.00 32.18  ? 437 LEU B C   1 
ATOM   7506 O O   . LEU B 1 440 ? -47.486 74.742  7.855   1.00 27.54  ? 437 LEU B O   1 
ATOM   7507 C CB  . LEU B 1 440 ? -46.748 74.732  10.850  1.00 32.25  ? 437 LEU B CB  1 
ATOM   7508 C CG  . LEU B 1 440 ? -45.253 75.051  10.851  1.00 37.33  ? 437 LEU B CG  1 
ATOM   7509 C CD1 . LEU B 1 440 ? -45.003 76.454  11.375  1.00 30.81  ? 437 LEU B CD1 1 
ATOM   7510 C CD2 . LEU B 1 440 ? -44.502 74.027  11.679  1.00 42.91  ? 437 LEU B CD2 1 
ATOM   7511 N N   . SER B 1 441 ? -46.615 76.801  8.169   1.00 28.61  ? 438 SER B N   1 
ATOM   7512 C CA  . SER B 1 441 ? -46.211 76.968  6.779   1.00 32.09  ? 438 SER B CA  1 
ATOM   7513 C C   . SER B 1 441 ? -44.815 76.436  6.492   1.00 25.06  ? 438 SER B C   1 
ATOM   7514 O O   . SER B 1 441 ? -44.477 76.228  5.321   1.00 28.51  ? 438 SER B O   1 
ATOM   7515 C CB  . SER B 1 441 ? -46.282 78.447  6.385   1.00 26.09  ? 438 SER B CB  1 
ATOM   7516 O OG  . SER B 1 441 ? -45.435 79.235  7.204   1.00 29.77  ? 438 SER B OG  1 
ATOM   7517 N N   . TRP B 1 442 ? -43.998 76.219  7.520   1.00 30.29  ? 439 TRP B N   1 
ATOM   7518 C CA  . TRP B 1 442 ? -42.675 75.656  7.323   1.00 27.98  ? 439 TRP B CA  1 
ATOM   7519 C C   . TRP B 1 442 ? -42.783 74.202  6.865   1.00 24.12  ? 439 TRP B C   1 
ATOM   7520 O O   . TRP B 1 442 ? -43.786 73.533  7.127   1.00 26.50  ? 439 TRP B O   1 
ATOM   7521 C CB  . TRP B 1 442 ? -41.860 75.754  8.610   1.00 20.46  ? 439 TRP B CB  1 
ATOM   7522 C CG  . TRP B 1 442 ? -41.406 77.147  8.914   1.00 21.16  ? 439 TRP B CG  1 
ATOM   7523 C CD1 . TRP B 1 442 ? -41.919 77.991  9.854   1.00 21.27  ? 439 TRP B CD1 1 
ATOM   7524 C CD2 . TRP B 1 442 ? -40.350 77.866  8.263   1.00 25.61  ? 439 TRP B CD2 1 
ATOM   7525 N NE1 . TRP B 1 442 ? -41.244 79.188  9.835   1.00 20.05  ? 439 TRP B NE1 1 
ATOM   7526 C CE2 . TRP B 1 442 ? -40.277 79.137  8.866   1.00 29.81  ? 439 TRP B CE2 1 
ATOM   7527 C CE3 . TRP B 1 442 ? -39.459 77.558  7.230   1.00 22.31  ? 439 TRP B CE3 1 
ATOM   7528 C CZ2 . TRP B 1 442 ? -39.350 80.099  8.469   1.00 23.80  ? 439 TRP B CZ2 1 
ATOM   7529 C CZ3 . TRP B 1 442 ? -38.538 78.513  6.840   1.00 18.97  ? 439 TRP B CZ3 1 
ATOM   7530 C CH2 . TRP B 1 442 ? -38.490 79.767  7.459   1.00 25.13  ? 439 TRP B CH2 1 
ATOM   7531 N N   . PRO B 1 443 ? -41.765 73.693  6.168   1.00 28.39  ? 440 PRO B N   1 
ATOM   7532 C CA  . PRO B 1 443 ? -41.837 72.320  5.655   1.00 29.40  ? 440 PRO B CA  1 
ATOM   7533 C C   . PRO B 1 443 ? -41.966 71.297  6.775   1.00 26.50  ? 440 PRO B C   1 
ATOM   7534 O O   . PRO B 1 443 ? -41.695 71.571  7.946   1.00 32.10  ? 440 PRO B O   1 
ATOM   7535 C CB  . PRO B 1 443 ? -40.514 72.151  4.895   1.00 23.04  ? 440 PRO B CB  1 
ATOM   7536 C CG  . PRO B 1 443 ? -39.613 73.201  5.459   1.00 28.64  ? 440 PRO B CG  1 
ATOM   7537 C CD  . PRO B 1 443 ? -40.509 74.355  5.778   1.00 27.73  ? 440 PRO B CD  1 
ATOM   7538 N N   . LEU B 1 444 ? -42.388 70.092  6.387   1.00 37.12  ? 441 LEU B N   1 
ATOM   7539 C CA  . LEU B 1 444 ? -42.666 69.051  7.371   1.00 33.86  ? 441 LEU B CA  1 
ATOM   7540 C C   . LEU B 1 444 ? -41.394 68.537  8.035   1.00 32.95  ? 441 LEU B C   1 
ATOM   7541 O O   . LEU B 1 444 ? -41.435 68.114  9.195   1.00 33.86  ? 441 LEU B O   1 
ATOM   7542 C CB  . LEU B 1 444 ? -43.427 67.901  6.710   1.00 28.41  ? 441 LEU B CB  1 
ATOM   7543 C CG  . LEU B 1 444 ? -44.045 66.855  7.640   1.00 41.34  ? 441 LEU B CG  1 
ATOM   7544 C CD1 . LEU B 1 444 ? -45.072 67.496  8.561   1.00 43.21  ? 441 LEU B CD1 1 
ATOM   7545 C CD2 . LEU B 1 444 ? -44.671 65.724  6.838   1.00 43.07  ? 441 LEU B CD2 1 
ATOM   7546 N N   . TRP B 1 445 ? -40.257 68.573  7.331   1.00 28.08  ? 442 TRP B N   1 
ATOM   7547 C CA  . TRP B 1 445 ? -39.029 68.024  7.897   1.00 27.20  ? 442 TRP B CA  1 
ATOM   7548 C C   . TRP B 1 445 ? -38.491 68.865  9.047   1.00 33.90  ? 442 TRP B C   1 
ATOM   7549 O O   . TRP B 1 445 ? -37.643 68.380  9.804   1.00 35.47  ? 442 TRP B O   1 
ATOM   7550 C CB  . TRP B 1 445 ? -37.956 67.867  6.814   1.00 23.72  ? 442 TRP B CB  1 
ATOM   7551 C CG  . TRP B 1 445 ? -37.496 69.147  6.175   1.00 30.54  ? 442 TRP B CG  1 
ATOM   7552 C CD1 . TRP B 1 445 ? -37.926 69.672  4.991   1.00 37.33  ? 442 TRP B CD1 1 
ATOM   7553 C CD2 . TRP B 1 445 ? -36.499 70.051  6.675   1.00 24.77  ? 442 TRP B CD2 1 
ATOM   7554 N NE1 . TRP B 1 445 ? -37.267 70.849  4.726   1.00 29.82  ? 442 TRP B NE1 1 
ATOM   7555 C CE2 . TRP B 1 445 ? -36.387 71.104  5.744   1.00 19.33  ? 442 TRP B CE2 1 
ATOM   7556 C CE3 . TRP B 1 445 ? -35.696 70.075  7.820   1.00 25.88  ? 442 TRP B CE3 1 
ATOM   7557 C CZ2 . TRP B 1 445 ? -35.506 72.169  5.925   1.00 20.77  ? 442 TRP B CZ2 1 
ATOM   7558 C CZ3 . TRP B 1 445 ? -34.822 71.133  7.997   1.00 21.90  ? 442 TRP B CZ3 1 
ATOM   7559 C CH2 . TRP B 1 445 ? -34.734 72.165  7.054   1.00 24.00  ? 442 TRP B CH2 1 
ATOM   7560 N N   . MET B 1 446 ? -38.959 70.106  9.198   1.00 29.00  ? 443 MET B N   1 
ATOM   7561 C CA  . MET B 1 446 ? -38.571 70.921  10.343  1.00 25.99  ? 443 MET B CA  1 
ATOM   7562 C C   . MET B 1 446 ? -39.284 70.520  11.626  1.00 24.89  ? 443 MET B C   1 
ATOM   7563 O O   . MET B 1 446 ? -38.841 70.915  12.710  1.00 30.07  ? 443 MET B O   1 
ATOM   7564 C CB  . MET B 1 446 ? -38.824 72.405  10.059  1.00 22.99  ? 443 MET B CB  1 
ATOM   7565 C CG  . MET B 1 446 ? -37.855 73.026  9.068   1.00 22.16  ? 443 MET B CG  1 
ATOM   7566 S SD  . MET B 1 446 ? -38.081 74.809  8.920   1.00 32.33  ? 443 MET B SD  1 
ATOM   7567 C CE  . MET B 1 446 ? -36.775 75.231  7.771   1.00 22.38  ? 443 MET B CE  1 
ATOM   7568 N N   . GLY B 1 447 ? -40.358 69.752  11.536  1.00 27.50  ? 444 GLY B N   1 
ATOM   7569 C CA  . GLY B 1 447 ? -40.979 69.236  12.746  1.00 25.64  ? 444 GLY B CA  1 
ATOM   7570 C C   . GLY B 1 447 ? -41.664 70.352  13.504  1.00 31.61  ? 444 GLY B C   1 
ATOM   7571 O O   . GLY B 1 447 ? -42.540 71.046  12.973  1.00 29.18  ? 444 GLY B O   1 
ATOM   7572 N N   . VAL B 1 448 ? -41.261 70.526  14.760  1.00 24.88  ? 445 VAL B N   1 
ATOM   7573 C CA  . VAL B 1 448 ? -41.765 71.596  15.615  1.00 23.84  ? 445 VAL B CA  1 
ATOM   7574 C C   . VAL B 1 448 ? -40.672 72.652  15.734  1.00 21.23  ? 445 VAL B C   1 
ATOM   7575 O O   . VAL B 1 448 ? -39.822 72.567  16.633  1.00 23.59  ? 445 VAL B O   1 
ATOM   7576 C CB  . VAL B 1 448 ? -42.183 71.061  16.994  1.00 26.53  ? 445 VAL B CB  1 
ATOM   7577 C CG1 . VAL B 1 448 ? -42.848 72.158  17.823  1.00 24.41  ? 445 VAL B CG1 1 
ATOM   7578 C CG2 . VAL B 1 448 ? -43.109 69.865  16.837  1.00 26.08  ? 445 VAL B CG2 1 
ATOM   7579 N N   . PRO B 1 449 ? -40.654 73.658  14.864  1.00 25.80  ? 446 PRO B N   1 
ATOM   7580 C CA  . PRO B 1 449 ? -39.509 74.572  14.810  1.00 23.65  ? 446 PRO B CA  1 
ATOM   7581 C C   . PRO B 1 449 ? -39.480 75.512  16.006  1.00 27.31  ? 446 PRO B C   1 
ATOM   7582 O O   . PRO B 1 449 ? -40.439 75.648  16.767  1.00 19.69  ? 446 PRO B O   1 
ATOM   7583 C CB  . PRO B 1 449 ? -39.722 75.346  13.503  1.00 22.86  ? 446 PRO B CB  1 
ATOM   7584 C CG  . PRO B 1 449 ? -40.795 74.587  12.757  1.00 27.00  ? 446 PRO B CG  1 
ATOM   7585 C CD  . PRO B 1 449 ? -41.637 73.951  13.813  1.00 26.50  ? 446 PRO B CD  1 
ATOM   7586 N N   . HIS B 1 450 ? -38.335 76.174  16.148  1.00 28.91  ? 447 HIS B N   1 
ATOM   7587 C CA  . HIS B 1 450 ? -38.141 77.151  17.209  1.00 25.80  ? 447 HIS B CA  1 
ATOM   7588 C C   . HIS B 1 450 ? -39.088 78.331  17.031  1.00 34.58  ? 447 HIS B C   1 
ATOM   7589 O O   . HIS B 1 450 ? -39.163 78.927  15.952  1.00 28.48  ? 447 HIS B O   1 
ATOM   7590 C CB  . HIS B 1 450 ? -36.687 77.625  17.200  1.00 26.22  ? 447 HIS B CB  1 
ATOM   7591 C CG  . HIS B 1 450 ? -36.414 78.780  18.110  1.00 30.62  ? 447 HIS B CG  1 
ATOM   7592 N ND1 . HIS B 1 450 ? -36.000 78.619  19.415  1.00 32.98  ? 447 HIS B ND1 1 
ATOM   7593 C CD2 . HIS B 1 450 ? -36.480 80.116  17.899  1.00 32.12  ? 447 HIS B CD2 1 
ATOM   7594 C CE1 . HIS B 1 450 ? -35.830 79.805  19.970  1.00 32.58  ? 447 HIS B CE1 1 
ATOM   7595 N NE2 . HIS B 1 450 ? -36.115 80.730  19.072  1.00 39.42  ? 447 HIS B NE2 1 
ATOM   7596 N N   . GLY B 1 451 ? -39.821 78.662  18.095  1.00 31.03  ? 448 GLY B N   1 
ATOM   7597 C CA  . GLY B 1 451 ? -40.685 79.823  18.114  1.00 31.64  ? 448 GLY B CA  1 
ATOM   7598 C C   . GLY B 1 451 ? -42.157 79.541  17.899  1.00 35.01  ? 448 GLY B C   1 
ATOM   7599 O O   . GLY B 1 451 ? -42.969 80.467  18.028  1.00 27.51  ? 448 GLY B O   1 
ATOM   7600 N N   . TYR B 1 452 ? -42.532 78.300  17.588  1.00 19.11  ? 449 TYR B N   1 
ATOM   7601 C CA  . TYR B 1 452 ? -43.905 77.983  17.219  1.00 22.15  ? 449 TYR B CA  1 
ATOM   7602 C C   . TYR B 1 452 ? -44.669 77.283  18.337  1.00 28.56  ? 449 TYR B C   1 
ATOM   7603 O O   . TYR B 1 452 ? -45.615 76.532  18.074  1.00 27.32  ? 449 TYR B O   1 
ATOM   7604 C CB  . TYR B 1 452 ? -43.923 77.165  15.930  1.00 18.28  ? 449 TYR B CB  1 
ATOM   7605 C CG  . TYR B 1 452 ? -43.528 78.019  14.751  1.00 27.90  ? 449 TYR B CG  1 
ATOM   7606 C CD1 . TYR B 1 452 ? -44.479 78.753  14.055  1.00 25.15  ? 449 TYR B CD1 1 
ATOM   7607 C CD2 . TYR B 1 452 ? -42.199 78.135  14.366  1.00 18.77  ? 449 TYR B CD2 1 
ATOM   7608 C CE1 . TYR B 1 452 ? -44.122 79.555  12.990  1.00 24.92  ? 449 TYR B CE1 1 
ATOM   7609 C CE2 . TYR B 1 452 ? -41.833 78.935  13.302  1.00 28.17  ? 449 TYR B CE2 1 
ATOM   7610 C CZ  . TYR B 1 452 ? -42.799 79.642  12.618  1.00 22.42  ? 449 TYR B CZ  1 
ATOM   7611 O OH  . TYR B 1 452 ? -42.441 80.441  11.557  1.00 32.66  ? 449 TYR B OH  1 
ATOM   7612 N N   . GLU B 1 453 ? -44.272 77.522  19.585  1.00 23.48  ? 450 GLU B N   1 
ATOM   7613 C CA  . GLU B 1 453 ? -45.127 77.284  20.737  1.00 28.80  ? 450 GLU B CA  1 
ATOM   7614 C C   . GLU B 1 453 ? -45.758 78.569  21.250  1.00 35.78  ? 450 GLU B C   1 
ATOM   7615 O O   . GLU B 1 453 ? -46.670 78.509  22.082  1.00 30.75  ? 450 GLU B O   1 
ATOM   7616 C CB  . GLU B 1 453 ? -44.330 76.619  21.869  1.00 18.63  ? 450 GLU B CB  1 
ATOM   7617 C CG  . GLU B 1 453 ? -43.662 77.593  22.839  1.00 18.14  ? 450 GLU B CG  1 
ATOM   7618 C CD  . GLU B 1 453 ? -42.463 78.317  22.246  1.00 32.49  ? 450 GLU B CD  1 
ATOM   7619 O OE1 . GLU B 1 453 ? -42.157 78.114  21.052  1.00 29.61  ? 450 GLU B OE1 1 
ATOM   7620 O OE2 . GLU B 1 453 ? -41.819 79.093  22.984  1.00 27.83  ? 450 GLU B OE2 1 
ATOM   7621 N N   . ILE B 1 454 ? -45.299 79.723  20.757  1.00 25.70  ? 451 ILE B N   1 
ATOM   7622 C CA  . ILE B 1 454 ? -45.780 81.012  21.247  1.00 29.60  ? 451 ILE B CA  1 
ATOM   7623 C C   . ILE B 1 454 ? -47.255 81.198  20.916  1.00 27.47  ? 451 ILE B C   1 
ATOM   7624 O O   . ILE B 1 454 ? -48.035 81.682  21.745  1.00 30.44  ? 451 ILE B O   1 
ATOM   7625 C CB  . ILE B 1 454 ? -44.922 82.150  20.662  1.00 25.79  ? 451 ILE B CB  1 
ATOM   7626 C CG1 . ILE B 1 454 ? -43.447 81.941  21.010  1.00 25.85  ? 451 ILE B CG1 1 
ATOM   7627 C CG2 . ILE B 1 454 ? -45.409 83.502  21.158  1.00 28.55  ? 451 ILE B CG2 1 
ATOM   7628 C CD1 . ILE B 1 454 ? -42.520 82.952  20.366  1.00 30.05  ? 451 ILE B CD1 1 
ATOM   7629 N N   . GLU B 1 455 ? -47.660 80.817  19.701  1.00 25.02  ? 452 GLU B N   1 
ATOM   7630 C CA  . GLU B 1 455 ? -49.042 81.028  19.277  1.00 28.87  ? 452 GLU B CA  1 
ATOM   7631 C C   . GLU B 1 455 ? -50.026 80.251  20.141  1.00 32.38  ? 452 GLU B C   1 
ATOM   7632 O O   . GLU B 1 455 ? -51.190 80.648  20.266  1.00 35.57  ? 452 GLU B O   1 
ATOM   7633 C CB  . GLU B 1 455 ? -49.202 80.646  17.805  1.00 21.86  ? 452 GLU B CB  1 
ATOM   7634 C CG  . GLU B 1 455 ? -48.653 79.273  17.455  1.00 28.76  ? 452 GLU B CG  1 
ATOM   7635 C CD  . GLU B 1 455 ? -48.529 79.063  15.958  1.00 37.46  ? 452 GLU B CD  1 
ATOM   7636 O OE1 . GLU B 1 455 ? -49.553 78.764  15.308  1.00 38.89  ? 452 GLU B OE1 1 
ATOM   7637 O OE2 . GLU B 1 455 ? -47.408 79.211  15.428  1.00 32.69  ? 452 GLU B OE2 1 
ATOM   7638 N N   . PHE B 1 456 ? -49.585 79.149  20.748  1.00 28.84  ? 453 PHE B N   1 
ATOM   7639 C CA  . PHE B 1 456 ? -50.467 78.395  21.630  1.00 31.53  ? 453 PHE B CA  1 
ATOM   7640 C C   . PHE B 1 456 ? -50.475 78.956  23.046  1.00 25.40  ? 453 PHE B C   1 
ATOM   7641 O O   . PHE B 1 456 ? -51.483 78.831  23.750  1.00 36.15  ? 453 PHE B O   1 
ATOM   7642 C CB  . PHE B 1 456 ? -50.064 76.921  21.642  1.00 26.17  ? 453 PHE B CB  1 
ATOM   7643 C CG  . PHE B 1 456 ? -50.337 76.211  20.348  1.00 23.23  ? 453 PHE B CG  1 
ATOM   7644 C CD1 . PHE B 1 456 ? -49.369 76.145  19.361  1.00 24.28  ? 453 PHE B CD1 1 
ATOM   7645 C CD2 . PHE B 1 456 ? -51.567 75.619  20.116  1.00 25.30  ? 453 PHE B CD2 1 
ATOM   7646 C CE1 . PHE B 1 456 ? -49.621 75.495  18.166  1.00 31.36  ? 453 PHE B CE1 1 
ATOM   7647 C CE2 . PHE B 1 456 ? -51.825 74.968  18.925  1.00 24.60  ? 453 PHE B CE2 1 
ATOM   7648 C CZ  . PHE B 1 456 ? -50.851 74.906  17.949  1.00 31.42  ? 453 PHE B CZ  1 
ATOM   7649 N N   . ILE B 1 457 ? -49.375 79.577  23.477  1.00 27.48  ? 454 ILE B N   1 
ATOM   7650 C CA  . ILE B 1 457 ? -49.348 80.198  24.797  1.00 29.17  ? 454 ILE B CA  1 
ATOM   7651 C C   . ILE B 1 457 ? -50.248 81.427  24.830  1.00 33.43  ? 454 ILE B C   1 
ATOM   7652 O O   . ILE B 1 457 ? -50.876 81.719  25.856  1.00 39.34  ? 454 ILE B O   1 
ATOM   7653 C CB  . ILE B 1 457 ? -47.900 80.543  25.194  1.00 34.77  ? 454 ILE B CB  1 
ATOM   7654 C CG1 . ILE B 1 457 ? -47.023 79.290  25.161  1.00 33.20  ? 454 ILE B CG1 1 
ATOM   7655 C CG2 . ILE B 1 457 ? -47.855 81.177  26.576  1.00 22.47  ? 454 ILE B CG2 1 
ATOM   7656 C CD1 . ILE B 1 457 ? -47.470 78.206  26.116  1.00 37.62  ? 454 ILE B CD1 1 
ATOM   7657 N N   . PHE B 1 458 ? -50.339 82.158  23.721  1.00 30.87  ? 455 PHE B N   1 
ATOM   7658 C CA  . PHE B 1 458 ? -51.153 83.363  23.641  1.00 34.35  ? 455 PHE B CA  1 
ATOM   7659 C C   . PHE B 1 458 ? -52.576 83.092  23.165  1.00 30.35  ? 455 PHE B C   1 
ATOM   7660 O O   . PHE B 1 458 ? -53.320 84.044  22.909  1.00 37.16  ? 455 PHE B O   1 
ATOM   7661 C CB  . PHE B 1 458 ? -50.485 84.390  22.722  1.00 22.57  ? 455 PHE B CB  1 
ATOM   7662 C CG  . PHE B 1 458 ? -49.331 85.112  23.358  1.00 32.97  ? 455 PHE B CG  1 
ATOM   7663 C CD1 . PHE B 1 458 ? -48.049 84.591  23.299  1.00 23.67  ? 455 PHE B CD1 1 
ATOM   7664 C CD2 . PHE B 1 458 ? -49.529 86.315  24.017  1.00 25.34  ? 455 PHE B CD2 1 
ATOM   7665 C CE1 . PHE B 1 458 ? -46.986 85.256  23.884  1.00 23.98  ? 455 PHE B CE1 1 
ATOM   7666 C CE2 . PHE B 1 458 ? -48.472 86.984  24.605  1.00 25.37  ? 455 PHE B CE2 1 
ATOM   7667 C CZ  . PHE B 1 458 ? -47.198 86.454  24.537  1.00 29.04  ? 455 PHE B CZ  1 
ATOM   7668 N N   . GLY B 1 459 ? -52.969 81.827  23.038  1.00 28.89  ? 456 GLY B N   1 
ATOM   7669 C CA  . GLY B 1 459 ? -54.331 81.503  22.655  1.00 24.75  ? 456 GLY B CA  1 
ATOM   7670 C C   . GLY B 1 459 ? -54.717 81.925  21.256  1.00 30.21  ? 456 GLY B C   1 
ATOM   7671 O O   . GLY B 1 459 ? -55.899 82.170  20.994  1.00 37.82  ? 456 GLY B O   1 
ATOM   7672 N N   . ILE B 1 460 ? -53.745 82.018  20.344  1.00 29.13  ? 457 ILE B N   1 
ATOM   7673 C CA  . ILE B 1 460 ? -54.058 82.395  18.962  1.00 22.41  ? 457 ILE B CA  1 
ATOM   7674 C C   . ILE B 1 460 ? -55.039 81.434  18.303  1.00 31.59  ? 457 ILE B C   1 
ATOM   7675 O O   . ILE B 1 460 ? -55.875 81.892  17.510  1.00 35.50  ? 457 ILE B O   1 
ATOM   7676 C CB  . ILE B 1 460 ? -52.762 82.578  18.160  1.00 29.77  ? 457 ILE B CB  1 
ATOM   7677 C CG1 . ILE B 1 460 ? -51.841 83.576  18.864  1.00 24.82  ? 457 ILE B CG1 1 
ATOM   7678 C CG2 . ILE B 1 460 ? -53.062 83.053  16.745  1.00 23.43  ? 457 ILE B CG2 1 
ATOM   7679 C CD1 . ILE B 1 460 ? -52.469 84.934  19.091  1.00 28.10  ? 457 ILE B CD1 1 
ATOM   7680 N N   . PRO B 1 461 ? -55.007 80.101  18.559  1.00 31.24  ? 458 PRO B N   1 
ATOM   7681 C CA  . PRO B 1 461 ? -56.028 79.222  17.965  1.00 33.74  ? 458 PRO B CA  1 
ATOM   7682 C C   . PRO B 1 461 ? -57.467 79.628  18.258  1.00 38.97  ? 458 PRO B C   1 
ATOM   7683 O O   . PRO B 1 461 ? -58.385 79.201  17.550  1.00 38.01  ? 458 PRO B O   1 
ATOM   7684 C CB  . PRO B 1 461 ? -55.706 77.857  18.583  1.00 33.62  ? 458 PRO B CB  1 
ATOM   7685 C CG  . PRO B 1 461 ? -54.244 77.893  18.774  1.00 36.82  ? 458 PRO B CG  1 
ATOM   7686 C CD  . PRO B 1 461 ? -53.913 79.310  19.158  1.00 30.01  ? 458 PRO B CD  1 
ATOM   7687 N N   . LEU B 1 462 ? -57.684 80.444  19.290  1.00 31.24  ? 459 LEU B N   1 
ATOM   7688 C CA  . LEU B 1 462 ? -59.028 80.912  19.606  1.00 33.28  ? 459 LEU B CA  1 
ATOM   7689 C C   . LEU B 1 462 ? -59.520 81.998  18.658  1.00 41.17  ? 459 LEU B C   1 
ATOM   7690 O O   . LEU B 1 462 ? -60.707 82.342  18.702  1.00 40.04  ? 459 LEU B O   1 
ATOM   7691 C CB  . LEU B 1 462 ? -59.082 81.426  21.047  1.00 34.43  ? 459 LEU B CB  1 
ATOM   7692 C CG  . LEU B 1 462 ? -58.749 80.407  22.139  1.00 39.42  ? 459 LEU B CG  1 
ATOM   7693 C CD1 . LEU B 1 462 ? -58.915 81.024  23.519  1.00 42.86  ? 459 LEU B CD1 1 
ATOM   7694 C CD2 . LEU B 1 462 ? -59.612 79.162  21.995  1.00 41.19  ? 459 LEU B CD2 1 
ATOM   7695 N N   . ASP B 1 463 ? -58.652 82.541  17.814  1.00 38.70  ? 460 ASP B N   1 
ATOM   7696 C CA  . ASP B 1 463 ? -59.052 83.566  16.855  1.00 35.83  ? 460 ASP B CA  1 
ATOM   7697 C C   . ASP B 1 463 ? -60.009 82.964  15.833  1.00 41.95  ? 460 ASP B C   1 
ATOM   7698 O O   . ASP B 1 463 ? -59.641 82.000  15.148  1.00 39.39  ? 460 ASP B O   1 
ATOM   7699 C CB  . ASP B 1 463 ? -57.817 84.144  16.165  1.00 40.13  ? 460 ASP B CB  1 
ATOM   7700 C CG  . ASP B 1 463 ? -58.107 85.428  15.401  1.00 43.30  ? 460 ASP B CG  1 
ATOM   7701 O OD1 . ASP B 1 463 ? -59.251 85.621  14.938  1.00 43.92  ? 460 ASP B OD1 1 
ATOM   7702 O OD2 . ASP B 1 463 ? -57.177 86.250  15.257  1.00 52.47  ? 460 ASP B OD2 1 
ATOM   7703 N N   . PRO B 1 464 ? -61.231 83.485  15.696  1.00 47.21  ? 461 PRO B N   1 
ATOM   7704 C CA  . PRO B 1 464 ? -62.174 82.900  14.728  1.00 42.62  ? 461 PRO B CA  1 
ATOM   7705 C C   . PRO B 1 464 ? -61.730 83.033  13.282  1.00 47.19  ? 461 PRO B C   1 
ATOM   7706 O O   . PRO B 1 464 ? -62.187 82.253  12.437  1.00 42.52  ? 461 PRO B O   1 
ATOM   7707 C CB  . PRO B 1 464 ? -63.473 83.679  14.984  1.00 41.59  ? 461 PRO B CB  1 
ATOM   7708 C CG  . PRO B 1 464 ? -63.313 84.269  16.350  1.00 46.75  ? 461 PRO B CG  1 
ATOM   7709 C CD  . PRO B 1 464 ? -61.851 84.552  16.498  1.00 45.68  ? 461 PRO B CD  1 
ATOM   7710 N N   . SER B 1 465 ? -60.860 83.990  12.965  1.00 40.45  ? 462 SER B N   1 
ATOM   7711 C CA  . SER B 1 465 ? -60.405 84.199  11.597  1.00 43.79  ? 462 SER B CA  1 
ATOM   7712 C C   . SER B 1 465 ? -59.278 83.255  11.191  1.00 46.97  ? 462 SER B C   1 
ATOM   7713 O O   . SER B 1 465 ? -58.701 83.434  10.113  1.00 51.02  ? 462 SER B O   1 
ATOM   7714 C CB  . SER B 1 465 ? -59.955 85.651  11.409  1.00 36.80  ? 462 SER B CB  1 
ATOM   7715 O OG  . SER B 1 465 ? -58.853 85.957  12.245  1.00 51.22  ? 462 SER B OG  1 
ATOM   7716 N N   . ARG B 1 466 ? -58.954 82.264  12.017  1.00 41.02  ? 463 ARG B N   1 
ATOM   7717 C CA  . ARG B 1 466 ? -57.890 81.316  11.727  1.00 42.73  ? 463 ARG B CA  1 
ATOM   7718 C C   . ARG B 1 466 ? -58.474 79.917  11.569  1.00 43.70  ? 463 ARG B C   1 
ATOM   7719 O O   . ARG B 1 466 ? -59.612 79.647  11.961  1.00 42.86  ? 463 ARG B O   1 
ATOM   7720 C CB  . ARG B 1 466 ? -56.824 81.327  12.830  1.00 42.79  ? 463 ARG B CB  1 
ATOM   7721 C CG  . ARG B 1 466 ? -56.390 82.725  13.234  1.00 33.03  ? 463 ARG B CG  1 
ATOM   7722 C CD  . ARG B 1 466 ? -54.898 82.936  13.052  1.00 40.47  ? 463 ARG B CD  1 
ATOM   7723 N NE  . ARG B 1 466 ? -54.519 84.321  13.317  1.00 54.26  ? 463 ARG B NE  1 
ATOM   7724 C CZ  . ARG B 1 466 ? -53.280 84.792  13.216  1.00 55.52  ? 463 ARG B CZ  1 
ATOM   7725 N NH1 . ARG B 1 466 ? -52.290 83.988  12.854  1.00 55.47  ? 463 ARG B NH1 1 
ATOM   7726 N NH2 . ARG B 1 466 ? -53.032 86.069  13.476  1.00 53.54  ? 463 ARG B NH2 1 
ATOM   7727 N N   . ASN B 1 467 ? -57.673 79.024  10.988  1.00 39.89  ? 464 ASN B N   1 
ATOM   7728 C CA  . ASN B 1 467 ? -58.145 77.681  10.672  1.00 46.35  ? 464 ASN B CA  1 
ATOM   7729 C C   . ASN B 1 467 ? -57.494 76.634  11.569  1.00 40.52  ? 464 ASN B C   1 
ATOM   7730 O O   . ASN B 1 467 ? -57.005 75.608  11.083  1.00 45.19  ? 464 ASN B O   1 
ATOM   7731 C CB  . ASN B 1 467 ? -57.883 77.362  9.197   1.00 46.20  ? 464 ASN B CB  1 
ATOM   7732 C CG  . ASN B 1 467 ? -58.675 76.164  8.708   1.00 50.08  ? 464 ASN B CG  1 
ATOM   7733 O OD1 . ASN B 1 467 ? -59.636 75.738  9.349   1.00 58.23  ? 464 ASN B OD1 1 
ATOM   7734 N ND2 . ASN B 1 467 ? -58.274 75.613  7.568   1.00 52.34  ? 464 ASN B ND2 1 
ATOM   7735 N N   . TYR B 1 468 ? -57.478 76.880  12.876  1.00 35.07  ? 465 TYR B N   1 
ATOM   7736 C CA  . TYR B 1 468 ? -57.001 75.883  13.821  1.00 35.88  ? 465 TYR B CA  1 
ATOM   7737 C C   . TYR B 1 468 ? -58.088 74.849  14.093  1.00 38.80  ? 465 TYR B C   1 
ATOM   7738 O O   . TYR B 1 468 ? -59.285 75.136  14.002  1.00 40.15  ? 465 TYR B O   1 
ATOM   7739 C CB  . TYR B 1 468 ? -56.570 76.539  15.134  1.00 32.18  ? 465 TYR B CB  1 
ATOM   7740 C CG  . TYR B 1 468 ? -55.265 77.301  15.056  1.00 34.76  ? 465 TYR B CG  1 
ATOM   7741 C CD1 . TYR B 1 468 ? -55.231 78.619  14.618  1.00 39.01  ? 465 TYR B CD1 1 
ATOM   7742 C CD2 . TYR B 1 468 ? -54.068 76.705  15.433  1.00 35.52  ? 465 TYR B CD2 1 
ATOM   7743 C CE1 . TYR B 1 468 ? -54.041 79.320  14.553  1.00 34.06  ? 465 TYR B CE1 1 
ATOM   7744 C CE2 . TYR B 1 468 ? -52.872 77.399  15.371  1.00 30.95  ? 465 TYR B CE2 1 
ATOM   7745 C CZ  . TYR B 1 468 ? -52.865 78.705  14.930  1.00 39.33  ? 465 TYR B CZ  1 
ATOM   7746 O OH  . TYR B 1 468 ? -51.680 79.401  14.866  1.00 37.12  ? 465 TYR B OH  1 
ATOM   7747 N N   . THR B 1 469 ? -57.659 73.637  14.431  1.00 36.27  ? 466 THR B N   1 
ATOM   7748 C CA  . THR B 1 469 ? -58.594 72.555  14.693  1.00 38.67  ? 466 THR B CA  1 
ATOM   7749 C C   . THR B 1 469 ? -59.226 72.710  16.075  1.00 34.73  ? 466 THR B C   1 
ATOM   7750 O O   . THR B 1 469 ? -58.822 73.546  16.888  1.00 34.49  ? 466 THR B O   1 
ATOM   7751 C CB  . THR B 1 469 ? -57.897 71.199  14.586  1.00 36.52  ? 466 THR B CB  1 
ATOM   7752 O OG1 . THR B 1 469 ? -56.966 71.052  15.665  1.00 42.53  ? 466 THR B OG1 1 
ATOM   7753 C CG2 . THR B 1 469 ? -57.154 71.086  13.263  1.00 38.26  ? 466 THR B CG2 1 
ATOM   7754 N N   . ALA B 1 470 ? -60.238 71.879  16.336  1.00 43.84  ? 467 ALA B N   1 
ATOM   7755 C CA  . ALA B 1 470 ? -60.914 71.920  17.628  1.00 41.06  ? 467 ALA B CA  1 
ATOM   7756 C C   . ALA B 1 470 ? -60.016 71.417  18.751  1.00 40.93  ? 467 ALA B C   1 
ATOM   7757 O O   . ALA B 1 470 ? -60.101 71.916  19.879  1.00 40.53  ? 467 ALA B O   1 
ATOM   7758 C CB  . ALA B 1 470 ? -62.204 71.103  17.573  1.00 36.68  ? 467 ALA B CB  1 
ATOM   7759 N N   . GLU B 1 471 ? -59.158 70.433  18.468  1.00 41.47  ? 468 GLU B N   1 
ATOM   7760 C CA  . GLU B 1 471 ? -58.244 69.939  19.494  1.00 38.49  ? 468 GLU B CA  1 
ATOM   7761 C C   . GLU B 1 471 ? -57.216 70.998  19.869  1.00 37.95  ? 468 GLU B C   1 
ATOM   7762 O O   . GLU B 1 471 ? -56.831 71.112  21.039  1.00 36.82  ? 468 GLU B O   1 
ATOM   7763 C CB  . GLU B 1 471 ? -57.542 68.667  19.016  1.00 44.73  ? 468 GLU B CB  1 
ATOM   7764 C CG  . GLU B 1 471 ? -58.463 67.587  18.471  1.00 51.51  ? 468 GLU B CG  1 
ATOM   7765 C CD  . GLU B 1 471 ? -58.664 67.695  16.971  1.00 77.99  ? 468 GLU B CD  1 
ATOM   7766 O OE1 . GLU B 1 471 ? -59.632 68.359  16.542  1.00 59.83  ? 468 GLU B OE1 1 
ATOM   7767 O OE2 . GLU B 1 471 ? -57.845 67.122  16.221  1.00 80.51  ? 468 GLU B OE2 1 
ATOM   7768 N N   . GLU B 1 472 ? -56.759 71.781  18.888  1.00 38.02  ? 469 GLU B N   1 
ATOM   7769 C CA  . GLU B 1 472 ? -55.758 72.806  19.163  1.00 39.73  ? 469 GLU B CA  1 
ATOM   7770 C C   . GLU B 1 472 ? -56.327 73.941  20.004  1.00 32.94  ? 469 GLU B C   1 
ATOM   7771 O O   . GLU B 1 472 ? -55.585 74.584  20.755  1.00 31.24  ? 469 GLU B O   1 
ATOM   7772 C CB  . GLU B 1 472 ? -55.186 73.341  17.850  1.00 36.01  ? 469 GLU B CB  1 
ATOM   7773 C CG  . GLU B 1 472 ? -54.330 72.330  17.101  1.00 39.85  ? 469 GLU B CG  1 
ATOM   7774 C CD  . GLU B 1 472 ? -53.927 72.808  15.720  1.00 39.47  ? 469 GLU B CD  1 
ATOM   7775 O OE1 . GLU B 1 472 ? -54.766 73.430  15.036  1.00 38.41  ? 469 GLU B OE1 1 
ATOM   7776 O OE2 . GLU B 1 472 ? -52.768 72.564  15.321  1.00 37.64  ? 469 GLU B OE2 1 
ATOM   7777 N N   . LYS B 1 473 ? -57.632 74.203  19.896  1.00 36.83  ? 470 LYS B N   1 
ATOM   7778 C CA  . LYS B 1 473 ? -58.250 75.209  20.754  1.00 43.85  ? 470 LYS B CA  1 
ATOM   7779 C C   . LYS B 1 473 ? -58.288 74.744  22.204  1.00 40.37  ? 470 LYS B C   1 
ATOM   7780 O O   . LYS B 1 473 ? -57.997 75.522  23.120  1.00 48.40  ? 470 LYS B O   1 
ATOM   7781 C CB  . LYS B 1 473 ? -59.658 75.535  20.255  1.00 38.95  ? 470 LYS B CB  1 
ATOM   7782 C CG  . LYS B 1 473 ? -59.693 76.227  18.902  1.00 47.96  ? 470 LYS B CG  1 
ATOM   7783 C CD  . LYS B 1 473 ? -61.121 76.510  18.465  1.00 47.85  ? 470 LYS B CD  1 
ATOM   7784 C CE  . LYS B 1 473 ? -61.157 77.213  17.118  1.00 46.12  ? 470 LYS B CE  1 
ATOM   7785 N NZ  . LYS B 1 473 ? -62.552 77.441  16.649  1.00 55.16  ? 470 LYS B NZ  1 
ATOM   7786 N N   . ILE B 1 474 ? -58.646 73.478  22.431  1.00 39.24  ? 471 ILE B N   1 
ATOM   7787 C CA  . ILE B 1 474 ? -58.618 72.930  23.783  1.00 39.37  ? 471 ILE B CA  1 
ATOM   7788 C C   . ILE B 1 474 ? -57.184 72.847  24.292  1.00 39.55  ? 471 ILE B C   1 
ATOM   7789 O O   . ILE B 1 474 ? -56.909 73.128  25.465  1.00 38.62  ? 471 ILE B O   1 
ATOM   7790 C CB  . ILE B 1 474 ? -59.311 71.556  23.813  1.00 41.52  ? 471 ILE B CB  1 
ATOM   7791 C CG1 . ILE B 1 474 ? -60.737 71.666  23.269  1.00 43.17  ? 471 ILE B CG1 1 
ATOM   7792 C CG2 . ILE B 1 474 ? -59.319 70.989  25.226  1.00 46.24  ? 471 ILE B CG2 1 
ATOM   7793 C CD1 . ILE B 1 474 ? -61.470 70.343  23.199  1.00 41.86  ? 471 ILE B CD1 1 
ATOM   7794 N N   . PHE B 1 475 ? -56.250 72.466  23.417  1.00 40.55  ? 472 PHE B N   1 
ATOM   7795 C CA  . PHE B 1 475 ? -54.847 72.390  23.810  1.00 37.20  ? 472 PHE B CA  1 
ATOM   7796 C C   . PHE B 1 475 ? -54.282 73.763  24.148  1.00 32.04  ? 472 PHE B C   1 
ATOM   7797 O O   . PHE B 1 475 ? -53.440 73.883  25.045  1.00 32.95  ? 472 PHE B O   1 
ATOM   7798 C CB  . PHE B 1 475 ? -54.033 71.731  22.695  1.00 41.74  ? 472 PHE B CB  1 
ATOM   7799 C CG  . PHE B 1 475 ? -52.549 71.751  22.927  1.00 35.34  ? 472 PHE B CG  1 
ATOM   7800 C CD1 . PHE B 1 475 ? -51.999 71.147  24.045  1.00 36.45  ? 472 PHE B CD1 1 
ATOM   7801 C CD2 . PHE B 1 475 ? -51.702 72.357  22.014  1.00 30.68  ? 472 PHE B CD2 1 
ATOM   7802 C CE1 . PHE B 1 475 ? -50.633 71.161  24.256  1.00 36.43  ? 472 PHE B CE1 1 
ATOM   7803 C CE2 . PHE B 1 475 ? -50.336 72.372  22.218  1.00 32.26  ? 472 PHE B CE2 1 
ATOM   7804 C CZ  . PHE B 1 475 ? -49.801 71.772  23.340  1.00 41.10  ? 472 PHE B CZ  1 
ATOM   7805 N N   . ALA B 1 476 ? -54.735 74.807  23.451  1.00 30.84  ? 473 ALA B N   1 
ATOM   7806 C CA  . ALA B 1 476 ? -54.269 76.156  23.758  1.00 36.77  ? 473 ALA B CA  1 
ATOM   7807 C C   . ALA B 1 476 ? -54.785 76.622  25.113  1.00 36.56  ? 473 ALA B C   1 
ATOM   7808 O O   . ALA B 1 476 ? -54.079 77.327  25.844  1.00 33.99  ? 473 ALA B O   1 
ATOM   7809 C CB  . ALA B 1 476 ? -54.699 77.124  22.656  1.00 32.56  ? 473 ALA B CB  1 
ATOM   7810 N N   . GLN B 1 477 ? -56.013 76.236  25.467  1.00 36.77  ? 474 GLN B N   1 
ATOM   7811 C CA  . GLN B 1 477 ? -56.564 76.621  26.762  1.00 35.44  ? 474 GLN B CA  1 
ATOM   7812 C C   . GLN B 1 477 ? -55.846 75.922  27.909  1.00 36.39  ? 474 GLN B C   1 
ATOM   7813 O O   . GLN B 1 477 ? -55.731 76.488  29.002  1.00 38.02  ? 474 GLN B O   1 
ATOM   7814 C CB  . GLN B 1 477 ? -58.063 76.325  26.800  1.00 32.57  ? 474 GLN B CB  1 
ATOM   7815 C CG  . GLN B 1 477 ? -58.884 77.230  25.893  1.00 39.47  ? 474 GLN B CG  1 
ATOM   7816 C CD  . GLN B 1 477 ? -60.273 76.689  25.622  1.00 44.17  ? 474 GLN B CD  1 
ATOM   7817 O OE1 . GLN B 1 477 ? -60.508 75.483  25.697  1.00 49.42  ? 474 GLN B OE1 1 
ATOM   7818 N NE2 . GLN B 1 477 ? -61.203 77.581  25.302  1.00 55.61  ? 474 GLN B NE2 1 
ATOM   7819 N N   . ARG B 1 478 ? -55.358 74.700  27.681  1.00 36.17  ? 475 ARG B N   1 
ATOM   7820 C CA  . ARG B 1 478 ? -54.559 74.019  28.696  1.00 29.89  ? 475 ARG B CA  1 
ATOM   7821 C C   . ARG B 1 478 ? -53.269 74.779  28.975  1.00 37.62  ? 475 ARG B C   1 
ATOM   7822 O O   . ARG B 1 478 ? -52.897 74.993  30.134  1.00 39.05  ? 475 ARG B O   1 
ATOM   7823 C CB  . ARG B 1 478 ? -54.243 72.592  28.248  1.00 38.43  ? 475 ARG B CB  1 
ATOM   7824 C CG  . ARG B 1 478 ? -55.401 71.617  28.318  1.00 39.66  ? 475 ARG B CG  1 
ATOM   7825 C CD  . ARG B 1 478 ? -54.950 70.260  27.808  1.00 45.11  ? 475 ARG B CD  1 
ATOM   7826 N NE  . ARG B 1 478 ? -53.684 69.863  28.417  1.00 42.42  ? 475 ARG B NE  1 
ATOM   7827 C CZ  . ARG B 1 478 ? -52.841 68.982  27.887  1.00 37.15  ? 475 ARG B CZ  1 
ATOM   7828 N NH1 . ARG B 1 478 ? -53.123 68.406  26.727  1.00 34.37  ? 475 ARG B NH1 1 
ATOM   7829 N NH2 . ARG B 1 478 ? -51.711 68.684  28.514  1.00 41.16  ? 475 ARG B NH2 1 
ATOM   7830 N N   . LEU B 1 479 ? -52.568 75.190  27.915  1.00 33.37  ? 476 LEU B N   1 
ATOM   7831 C CA  . LEU B 1 479 ? -51.293 75.877  28.087  1.00 37.77  ? 476 LEU B CA  1 
ATOM   7832 C C   . LEU B 1 479 ? -51.477 77.233  28.756  1.00 29.55  ? 476 LEU B C   1 
ATOM   7833 O O   . LEU B 1 479 ? -50.676 77.619  29.615  1.00 39.08  ? 476 LEU B O   1 
ATOM   7834 C CB  . LEU B 1 479 ? -50.596 76.032  26.737  1.00 33.99  ? 476 LEU B CB  1 
ATOM   7835 C CG  . LEU B 1 479 ? -50.271 74.727  26.010  1.00 29.93  ? 476 LEU B CG  1 
ATOM   7836 C CD1 . LEU B 1 479 ? -49.603 75.021  24.683  1.00 37.43  ? 476 LEU B CD1 1 
ATOM   7837 C CD2 . LEU B 1 479 ? -49.392 73.835  26.872  1.00 32.21  ? 476 LEU B CD2 1 
ATOM   7838 N N   . MET B 1 480 ? -52.520 77.973  28.371  1.00 29.15  ? 477 MET B N   1 
ATOM   7839 C CA  . MET B 1 480 ? -52.816 79.228  29.052  1.00 34.07  ? 477 MET B CA  1 
ATOM   7840 C C   . MET B 1 480 ? -53.142 78.996  30.521  1.00 32.86  ? 477 MET B C   1 
ATOM   7841 O O   . MET B 1 480 ? -52.800 79.825  31.372  1.00 28.14  ? 477 MET B O   1 
ATOM   7842 C CB  . MET B 1 480 ? -53.970 79.951  28.355  1.00 38.11  ? 477 MET B CB  1 
ATOM   7843 C CG  . MET B 1 480 ? -53.645 80.415  26.943  1.00 36.12  ? 477 MET B CG  1 
ATOM   7844 S SD  . MET B 1 480 ? -54.924 81.465  26.224  1.00 37.16  ? 477 MET B SD  1 
ATOM   7845 C CE  . MET B 1 480 ? -56.310 80.332  26.168  1.00 28.89  ? 477 MET B CE  1 
ATOM   7846 N N   . ARG B 1 481 ? -53.791 77.873  30.838  1.00 36.45  ? 478 ARG B N   1 
ATOM   7847 C CA  . ARG B 1 481 ? -54.025 77.521  32.234  1.00 36.11  ? 478 ARG B CA  1 
ATOM   7848 C C   . ARG B 1 481 ? -52.714 77.227  32.953  1.00 41.29  ? 478 ARG B C   1 
ATOM   7849 O O   . ARG B 1 481 ? -52.517 77.654  34.097  1.00 37.54  ? 478 ARG B O   1 
ATOM   7850 C CB  . ARG B 1 481 ? -54.966 76.319  32.321  1.00 37.20  ? 478 ARG B CB  1 
ATOM   7851 C CG  . ARG B 1 481 ? -55.319 75.901  33.741  1.00 49.20  ? 478 ARG B CG  1 
ATOM   7852 C CD  . ARG B 1 481 ? -56.237 76.915  34.403  1.00 54.31  ? 478 ARG B CD  1 
ATOM   7853 N NE  . ARG B 1 481 ? -57.530 76.998  33.730  1.00 53.78  ? 478 ARG B NE  1 
ATOM   7854 C CZ  . ARG B 1 481 ? -58.486 77.862  34.052  1.00 65.68  ? 478 ARG B CZ  1 
ATOM   7855 N NH1 . ARG B 1 481 ? -58.298 78.726  35.040  1.00 68.01  ? 478 ARG B NH1 1 
ATOM   7856 N NH2 . ARG B 1 481 ? -59.632 77.865  33.383  1.00 61.78  ? 478 ARG B NH2 1 
ATOM   7857 N N   . TYR B 1 482 ? -51.805 76.500  32.296  1.00 37.42  ? 479 TYR B N   1 
ATOM   7858 C CA  . TYR B 1 482 ? -50.507 76.202  32.895  1.00 37.56  ? 479 TYR B CA  1 
ATOM   7859 C C   . TYR B 1 482 ? -49.733 77.480  33.195  1.00 32.22  ? 479 TYR B C   1 
ATOM   7860 O O   . TYR B 1 482 ? -49.229 77.670  34.308  1.00 30.53  ? 479 TYR B O   1 
ATOM   7861 C CB  . TYR B 1 482 ? -49.696 75.296  31.967  1.00 37.74  ? 479 TYR B CB  1 
ATOM   7862 C CG  . TYR B 1 482 ? -50.210 73.879  31.848  1.00 38.06  ? 479 TYR B CG  1 
ATOM   7863 C CD1 . TYR B 1 482 ? -50.681 73.191  32.959  1.00 40.72  ? 479 TYR B CD1 1 
ATOM   7864 C CD2 . TYR B 1 482 ? -50.220 73.227  30.621  1.00 38.39  ? 479 TYR B CD2 1 
ATOM   7865 C CE1 . TYR B 1 482 ? -51.148 71.893  32.850  1.00 36.51  ? 479 TYR B CE1 1 
ATOM   7866 C CE2 . TYR B 1 482 ? -50.685 71.932  30.503  1.00 42.80  ? 479 TYR B CE2 1 
ATOM   7867 C CZ  . TYR B 1 482 ? -51.147 71.269  31.619  1.00 41.70  ? 479 TYR B CZ  1 
ATOM   7868 O OH  . TYR B 1 482 ? -51.611 69.979  31.502  1.00 43.99  ? 479 TYR B OH  1 
ATOM   7869 N N   . TRP B 1 483 ? -49.625 78.369  32.204  1.00 28.12  ? 480 TRP B N   1 
ATOM   7870 C CA  . TRP B 1 483 ? -48.850 79.592  32.383  1.00 33.70  ? 480 TRP B CA  1 
ATOM   7871 C C   . TRP B 1 483 ? -49.471 80.497  33.440  1.00 26.02  ? 480 TRP B C   1 
ATOM   7872 O O   . TRP B 1 483 ? -48.756 81.106  34.244  1.00 27.38  ? 480 TRP B O   1 
ATOM   7873 C CB  . TRP B 1 483 ? -48.723 80.328  31.049  1.00 26.97  ? 480 TRP B CB  1 
ATOM   7874 C CG  . TRP B 1 483 ? -47.407 80.113  30.358  1.00 29.44  ? 480 TRP B CG  1 
ATOM   7875 C CD1 . TRP B 1 483 ? -46.472 81.062  30.066  1.00 27.71  ? 480 TRP B CD1 1 
ATOM   7876 C CD2 . TRP B 1 483 ? -46.876 78.868  29.883  1.00 28.48  ? 480 TRP B CD2 1 
ATOM   7877 N NE1 . TRP B 1 483 ? -45.396 80.489  29.433  1.00 29.60  ? 480 TRP B NE1 1 
ATOM   7878 C CE2 . TRP B 1 483 ? -45.619 79.143  29.309  1.00 28.94  ? 480 TRP B CE2 1 
ATOM   7879 C CE3 . TRP B 1 483 ? -47.343 77.550  29.885  1.00 33.47  ? 480 TRP B CE3 1 
ATOM   7880 C CZ2 . TRP B 1 483 ? -44.822 78.149  28.744  1.00 27.06  ? 480 TRP B CZ2 1 
ATOM   7881 C CZ3 . TRP B 1 483 ? -46.551 76.564  29.323  1.00 29.21  ? 480 TRP B CZ3 1 
ATOM   7882 C CH2 . TRP B 1 483 ? -45.305 76.869  28.761  1.00 28.36  ? 480 TRP B CH2 1 
ATOM   7883 N N   . ALA B 1 484 ? -50.803 80.595  33.458  1.00 26.86  ? 481 ALA B N   1 
ATOM   7884 C CA  . ALA B 1 484 ? -51.462 81.464  34.427  1.00 36.02  ? 481 ALA B CA  1 
ATOM   7885 C C   . ALA B 1 484 ? -51.344 80.911  35.842  1.00 35.09  ? 481 ALA B C   1 
ATOM   7886 O O   . ALA B 1 484 ? -51.103 81.668  36.790  1.00 33.24  ? 481 ALA B O   1 
ATOM   7887 C CB  . ALA B 1 484 ? -52.928 81.657  34.050  1.00 35.11  ? 481 ALA B CB  1 
ATOM   7888 N N   . ASN B 1 485 ? -51.518 79.596  36.006  1.00 43.11  ? 482 ASN B N   1 
ATOM   7889 C CA  . ASN B 1 485 ? -51.371 78.994  37.328  1.00 39.75  ? 482 ASN B CA  1 
ATOM   7890 C C   . ASN B 1 485 ? -49.966 79.207  37.873  1.00 34.08  ? 482 ASN B C   1 
ATOM   7891 O O   . ASN B 1 485 ? -49.788 79.451  39.073  1.00 40.09  ? 482 ASN B O   1 
ATOM   7892 C CB  . ASN B 1 485 ? -51.704 77.503  37.273  1.00 31.87  ? 482 ASN B CB  1 
ATOM   7893 C CG  . ASN B 1 485 ? -53.180 77.243  37.052  1.00 38.41  ? 482 ASN B CG  1 
ATOM   7894 O OD1 . ASN B 1 485 ? -54.022 78.094  37.337  1.00 48.26  ? 482 ASN B OD1 1 
ATOM   7895 N ND2 . ASN B 1 485 ? -53.501 76.059  36.545  1.00 45.29  ? 482 ASN B ND2 1 
ATOM   7896 N N   . PHE B 1 486 ? -48.953 79.120  37.007  1.00 32.20  ? 483 PHE B N   1 
ATOM   7897 C CA  . PHE B 1 486 ? -47.594 79.414  37.445  1.00 34.38  ? 483 PHE B CA  1 
ATOM   7898 C C   . PHE B 1 486 ? -47.439 80.887  37.799  1.00 36.19  ? 483 PHE B C   1 
ATOM   7899 O O   . PHE B 1 486 ? -46.712 81.232  38.736  1.00 32.42  ? 483 PHE B O   1 
ATOM   7900 C CB  . PHE B 1 486 ? -46.588 79.014  36.366  1.00 28.65  ? 483 PHE B CB  1 
ATOM   7901 C CG  . PHE B 1 486 ? -45.167 79.349  36.715  1.00 30.13  ? 483 PHE B CG  1 
ATOM   7902 C CD1 . PHE B 1 486 ? -44.436 78.529  37.559  1.00 23.18  ? 483 PHE B CD1 1 
ATOM   7903 C CD2 . PHE B 1 486 ? -44.564 80.489  36.208  1.00 18.87  ? 483 PHE B CD2 1 
ATOM   7904 C CE1 . PHE B 1 486 ? -43.129 78.837  37.887  1.00 32.56  ? 483 PHE B CE1 1 
ATOM   7905 C CE2 . PHE B 1 486 ? -43.257 80.802  36.534  1.00 35.22  ? 483 PHE B CE2 1 
ATOM   7906 C CZ  . PHE B 1 486 ? -42.539 79.974  37.373  1.00 28.34  ? 483 PHE B CZ  1 
ATOM   7907 N N   . ALA B 1 487 ? -48.111 81.771  37.059  1.00 37.88  ? 484 ALA B N   1 
ATOM   7908 C CA  . ALA B 1 487 ? -48.050 83.191  37.383  1.00 39.03  ? 484 ALA B CA  1 
ATOM   7909 C C   . ALA B 1 487 ? -48.770 83.499  38.688  1.00 36.70  ? 484 ALA B C   1 
ATOM   7910 O O   . ALA B 1 487 ? -48.351 84.395  39.430  1.00 43.28  ? 484 ALA B O   1 
ATOM   7911 C CB  . ALA B 1 487 ? -48.644 84.018  36.243  1.00 35.83  ? 484 ALA B CB  1 
ATOM   7912 N N   . ARG B 1 488 ? -49.844 82.769  38.989  1.00 27.04  ? 485 ARG B N   1 
ATOM   7913 C CA  . ARG B 1 488 ? -50.606 83.026  40.205  1.00 40.15  ? 485 ARG B CA  1 
ATOM   7914 C C   . ARG B 1 488 ? -49.938 82.409  41.429  1.00 44.22  ? 485 ARG B C   1 
ATOM   7915 O O   . ARG B 1 488 ? -49.707 83.095  42.431  1.00 37.20  ? 485 ARG B O   1 
ATOM   7916 C CB  . ARG B 1 488 ? -52.035 82.495  40.054  1.00 35.68  ? 485 ARG B CB  1 
ATOM   7917 C CG  . ARG B 1 488 ? -52.886 83.263  39.055  1.00 36.43  ? 485 ARG B CG  1 
ATOM   7918 C CD  . ARG B 1 488 ? -54.331 82.788  39.066  1.00 29.59  ? 485 ARG B CD  1 
ATOM   7919 N NE  . ARG B 1 488 ? -54.505 81.533  38.342  1.00 45.83  ? 485 ARG B NE  1 
ATOM   7920 C CZ  . ARG B 1 488 ? -54.921 81.451  37.082  1.00 37.65  ? 485 ARG B CZ  1 
ATOM   7921 N NH1 . ARG B 1 488 ? -55.210 82.553  36.404  1.00 42.10  ? 485 ARG B NH1 1 
ATOM   7922 N NH2 . ARG B 1 488 ? -55.051 80.266  36.501  1.00 34.12  ? 485 ARG B NH2 1 
ATOM   7923 N N   . THR B 1 489 ? -49.611 81.117  41.363  1.00 40.25  ? 486 THR B N   1 
ATOM   7924 C CA  . THR B 1 489 ? -49.161 80.374  42.531  1.00 43.24  ? 486 THR B CA  1 
ATOM   7925 C C   . THR B 1 489 ? -47.711 79.918  42.459  1.00 42.22  ? 486 THR B C   1 
ATOM   7926 O O   . THR B 1 489 ? -47.191 79.417  43.462  1.00 42.58  ? 486 THR B O   1 
ATOM   7927 C CB  . THR B 1 489 ? -50.052 79.140  42.745  1.00 46.33  ? 486 THR B CB  1 
ATOM   7928 O OG1 . THR B 1 489 ? -49.855 78.216  41.668  1.00 38.63  ? 486 THR B OG1 1 
ATOM   7929 C CG2 . THR B 1 489 ? -51.518 79.544  42.793  1.00 41.31  ? 486 THR B CG2 1 
ATOM   7930 N N   . GLY B 1 490 ? -47.044 80.076  41.319  1.00 40.43  ? 487 GLY B N   1 
ATOM   7931 C CA  . GLY B 1 490 ? -45.727 79.498  41.148  1.00 25.10  ? 487 GLY B CA  1 
ATOM   7932 C C   . GLY B 1 490 ? -45.730 78.020  40.844  1.00 35.54  ? 487 GLY B C   1 
ATOM   7933 O O   . GLY B 1 490 ? -44.673 77.383  40.913  1.00 36.94  ? 487 GLY B O   1 
ATOM   7934 N N   . ASP B 1 491 ? -46.887 77.457  40.508  1.00 33.12  ? 488 ASP B N   1 
ATOM   7935 C CA  . ASP B 1 491 ? -47.055 76.035  40.248  1.00 41.36  ? 488 ASP B CA  1 
ATOM   7936 C C   . ASP B 1 491 ? -47.996 75.864  39.062  1.00 38.81  ? 488 ASP B C   1 
ATOM   7937 O O   . ASP B 1 491 ? -49.158 76.284  39.127  1.00 47.98  ? 488 ASP B O   1 
ATOM   7938 C CB  . ASP B 1 491 ? -47.601 75.328  41.492  1.00 41.41  ? 488 ASP B CB  1 
ATOM   7939 C CG  . ASP B 1 491 ? -47.494 73.815  41.409  1.00 41.37  ? 488 ASP B CG  1 
ATOM   7940 O OD1 . ASP B 1 491 ? -47.633 73.253  40.303  1.00 48.43  ? 488 ASP B OD1 1 
ATOM   7941 O OD2 . ASP B 1 491 ? -47.275 73.182  42.464  1.00 55.42  ? 488 ASP B OD2 1 
ATOM   7942 N N   . PRO B 1 492 ? -47.537 75.258  37.962  1.00 44.15  ? 489 PRO B N   1 
ATOM   7943 C CA  . PRO B 1 492 ? -48.415 75.111  36.790  1.00 42.89  ? 489 PRO B CA  1 
ATOM   7944 C C   . PRO B 1 492 ? -49.577 74.160  37.013  1.00 42.28  ? 489 PRO B C   1 
ATOM   7945 O O   . PRO B 1 492 ? -50.538 74.196  36.235  1.00 42.35  ? 489 PRO B O   1 
ATOM   7946 C CB  . PRO B 1 492 ? -47.466 74.587  35.705  1.00 43.88  ? 489 PRO B CB  1 
ATOM   7947 C CG  . PRO B 1 492 ? -46.378 73.900  36.464  1.00 41.72  ? 489 PRO B CG  1 
ATOM   7948 C CD  . PRO B 1 492 ? -46.197 74.694  37.728  1.00 37.75  ? 489 PRO B CD  1 
ATOM   7949 N N   . ASN B 1 493 ? -49.525 73.318  38.041  1.00 51.49  ? 490 ASN B N   1 
ATOM   7950 C CA  . ASN B 1 493 ? -50.615 72.389  38.301  1.00 52.23  ? 490 ASN B CA  1 
ATOM   7951 C C   . ASN B 1 493 ? -51.824 73.126  38.863  1.00 48.86  ? 490 ASN B C   1 
ATOM   7952 O O   . ASN B 1 493 ? -51.691 74.043  39.678  1.00 43.94  ? 490 ASN B O   1 
ATOM   7953 C CB  . ASN B 1 493 ? -50.166 71.299  39.274  1.00 53.65  ? 490 ASN B CB  1 
ATOM   7954 C CG  . ASN B 1 493 ? -49.032 70.459  38.724  1.00 43.31  ? 490 ASN B CG  1 
ATOM   7955 O OD1 . ASN B 1 493 ? -49.259 69.477  38.017  1.00 52.23  ? 490 ASN B OD1 1 
ATOM   7956 N ND2 . ASN B 1 493 ? -47.801 70.839  39.047  1.00 40.24  ? 490 ASN B ND2 1 
ATOM   7957 N N   . GLU B 1 494 ? -53.005 72.720  38.420  1.00 58.69  ? 491 GLU B N   1 
ATOM   7958 C CA  . GLU B 1 494 ? -54.243 73.311  38.913  1.00 82.42  ? 491 GLU B CA  1 
ATOM   7959 C C   . GLU B 1 494 ? -54.448 72.925  40.372  1.00 85.16  ? 491 GLU B C   1 
ATOM   7960 O O   . GLU B 1 494 ? -54.563 71.730  40.676  1.00 86.78  ? 491 GLU B O   1 
ATOM   7961 C CB  . GLU B 1 494 ? -55.418 72.851  38.056  1.00 72.40  ? 491 GLU B CB  1 
ATOM   7962 C CG  . GLU B 1 494 ? -55.314 73.305  36.607  1.00 73.18  ? 491 GLU B CG  1 
ATOM   7963 C CD  . GLU B 1 494 ? -55.972 72.344  35.637  1.00 89.58  ? 491 GLU B CD  1 
ATOM   7964 O OE1 . GLU B 1 494 ? -57.074 71.844  35.942  1.00 94.37  ? 491 GLU B OE1 1 
ATOM   7965 O OE2 . GLU B 1 494 ? -55.377 72.084  34.569  1.00 90.39  ? 491 GLU B OE2 1 
ATOM   7966 N N   . PRO B 1 495 ? -54.499 73.885  41.300  1.00 80.31  ? 492 PRO B N   1 
ATOM   7967 C CA  . PRO B 1 495 ? -54.573 73.533  42.728  1.00 92.83  ? 492 PRO B CA  1 
ATOM   7968 C C   . PRO B 1 495 ? -55.887 72.893  43.143  1.00 106.57 ? 492 PRO B C   1 
ATOM   7969 O O   . PRO B 1 495 ? -55.985 72.415  44.281  1.00 102.86 ? 492 PRO B O   1 
ATOM   7970 C CB  . PRO B 1 495 ? -54.369 74.881  43.430  1.00 87.93  ? 492 PRO B CB  1 
ATOM   7971 C CG  . PRO B 1 495 ? -54.847 75.891  42.439  1.00 75.19  ? 492 PRO B CG  1 
ATOM   7972 C CD  . PRO B 1 495 ? -54.485 75.343  41.086  1.00 59.58  ? 492 PRO B CD  1 
ATOM   7973 N N   . ARG B 1 496 ? -56.894 72.866  42.271  1.00 109.45 ? 493 ARG B N   1 
ATOM   7974 C CA  . ARG B 1 496 ? -58.185 72.277  42.596  1.00 114.76 ? 493 ARG B CA  1 
ATOM   7975 C C   . ARG B 1 496 ? -58.396 70.905  41.970  1.00 113.43 ? 493 ARG B C   1 
ATOM   7976 O O   . ARG B 1 496 ? -59.388 70.243  42.293  1.00 114.24 ? 493 ARG B O   1 
ATOM   7977 C CB  . ARG B 1 496 ? -59.321 73.204  42.145  1.00 117.81 ? 493 ARG B CB  1 
ATOM   7978 C CG  . ARG B 1 496 ? -59.216 74.636  42.639  1.00 118.23 ? 493 ARG B CG  1 
ATOM   7979 C CD  . ARG B 1 496 ? -60.283 75.502  41.987  1.00 121.21 ? 493 ARG B CD  1 
ATOM   7980 N NE  . ARG B 1 496 ? -60.185 76.903  42.385  1.00 129.28 ? 493 ARG B NE  1 
ATOM   7981 C CZ  . ARG B 1 496 ? -60.944 77.874  41.887  1.00 124.60 ? 493 ARG B CZ  1 
ATOM   7982 N NH1 . ARG B 1 496 ? -61.858 77.597  40.967  1.00 121.31 ? 493 ARG B NH1 1 
ATOM   7983 N NH2 . ARG B 1 496 ? -60.788 79.122  42.306  1.00 106.42 ? 493 ARG B NH2 1 
ATOM   7984 N N   . ASP B 1 497 ? -57.500 70.462  41.092  1.00 105.57 ? 494 ASP B N   1 
ATOM   7985 C CA  . ASP B 1 497 ? -57.730 69.265  40.282  1.00 107.37 ? 494 ASP B CA  1 
ATOM   7986 C C   . ASP B 1 497 ? -56.642 68.225  40.510  1.00 112.81 ? 494 ASP B C   1 
ATOM   7987 O O   . ASP B 1 497 ? -55.529 68.357  39.969  1.00 105.55 ? 494 ASP B O   1 
ATOM   7988 C CB  . ASP B 1 497 ? -57.800 69.634  38.802  1.00 103.57 ? 494 ASP B CB  1 
ATOM   7989 C CG  . ASP B 1 497 ? -58.782 68.774  38.036  1.00 105.75 ? 494 ASP B CG  1 
ATOM   7990 O OD1 . ASP B 1 497 ? -59.500 69.316  37.168  1.00 101.13 ? 494 ASP B OD1 1 
ATOM   7991 O OD2 . ASP B 1 497 ? -58.854 67.561  38.318  1.00 100.43 ? 494 ASP B OD2 1 
ATOM   7992 N N   . PRO B 1 498 ? -56.905 67.177  41.297  1.00 121.91 ? 495 PRO B N   1 
ATOM   7993 C CA  . PRO B 1 498 ? -55.985 66.032  41.332  1.00 115.51 ? 495 PRO B CA  1 
ATOM   7994 C C   . PRO B 1 498 ? -56.224 65.025  40.219  1.00 109.36 ? 495 PRO B C   1 
ATOM   7995 O O   . PRO B 1 498 ? -55.410 64.105  40.056  1.00 103.40 ? 495 PRO B O   1 
ATOM   7996 C CB  . PRO B 1 498 ? -56.262 65.410  42.705  1.00 101.85 ? 495 PRO B CB  1 
ATOM   7997 C CG  . PRO B 1 498 ? -57.699 65.721  42.953  1.00 104.31 ? 495 PRO B CG  1 
ATOM   7998 C CD  . PRO B 1 498 ? -57.962 67.068  42.319  1.00 108.86 ? 495 PRO B CD  1 
ATOM   7999 N N   . LYS B 1 499 ? -57.311 65.167  39.453  1.00 110.32 ? 496 LYS B N   1 
ATOM   8000 C CA  . LYS B 1 499 ? -57.573 64.246  38.351  1.00 110.45 ? 496 LYS B CA  1 
ATOM   8001 C C   . LYS B 1 499 ? -56.548 64.406  37.236  1.00 110.20 ? 496 LYS B C   1 
ATOM   8002 O O   . LYS B 1 499 ? -56.087 63.412  36.662  1.00 105.57 ? 496 LYS B O   1 
ATOM   8003 C CB  . LYS B 1 499 ? -58.982 64.468  37.800  1.00 109.27 ? 496 LYS B CB  1 
ATOM   8004 C CG  . LYS B 1 499 ? -60.100 63.834  38.607  1.00 106.01 ? 496 LYS B CG  1 
ATOM   8005 C CD  . LYS B 1 499 ? -61.455 64.212  38.026  1.00 93.75  ? 496 LYS B CD  1 
ATOM   8006 C CE  . LYS B 1 499 ? -62.525 63.199  38.397  1.00 94.48  ? 496 LYS B CE  1 
ATOM   8007 N NZ  . LYS B 1 499 ? -62.621 62.997  39.867  1.00 69.32  ? 496 LYS B NZ  1 
ATOM   8008 N N   . ALA B 1 500 ? -56.189 65.645  36.910  1.00 112.25 ? 497 ALA B N   1 
ATOM   8009 C CA  . ALA B 1 500 ? -55.272 65.895  35.811  1.00 96.68  ? 497 ALA B CA  1 
ATOM   8010 C C   . ALA B 1 500 ? -53.897 65.306  36.122  1.00 93.67  ? 497 ALA B C   1 
ATOM   8011 O O   . ALA B 1 500 ? -53.480 65.258  37.284  1.00 92.36  ? 497 ALA B O   1 
ATOM   8012 C CB  . ALA B 1 500 ? -55.153 67.394  35.546  1.00 87.65  ? 497 ALA B CB  1 
ATOM   8013 N N   . PRO B 1 501 ? -53.177 64.836  35.103  1.00 88.57  ? 498 PRO B N   1 
ATOM   8014 C CA  . PRO B 1 501 ? -51.818 64.328  35.335  1.00 74.38  ? 498 PRO B CA  1 
ATOM   8015 C C   . PRO B 1 501 ? -50.918 65.424  35.886  1.00 62.35  ? 498 PRO B C   1 
ATOM   8016 O O   . PRO B 1 501 ? -50.882 66.543  35.369  1.00 67.03  ? 498 PRO B O   1 
ATOM   8017 C CB  . PRO B 1 501 ? -51.370 63.863  33.944  1.00 76.77  ? 498 PRO B CB  1 
ATOM   8018 C CG  . PRO B 1 501 ? -52.257 64.598  32.986  1.00 79.52  ? 498 PRO B CG  1 
ATOM   8019 C CD  . PRO B 1 501 ? -53.571 64.740  33.688  1.00 76.85  ? 498 PRO B CD  1 
ATOM   8020 N N   . GLN B 1 502 ? -50.194 65.094  36.950  1.00 54.22  ? 499 GLN B N   1 
ATOM   8021 C CA  . GLN B 1 502 ? -49.416 66.088  37.671  1.00 50.93  ? 499 GLN B CA  1 
ATOM   8022 C C   . GLN B 1 502 ? -48.114 66.407  36.946  1.00 55.36  ? 499 GLN B C   1 
ATOM   8023 O O   . GLN B 1 502 ? -47.505 65.549  36.301  1.00 48.66  ? 499 GLN B O   1 
ATOM   8024 C CB  . GLN B 1 502 ? -49.120 65.607  39.091  1.00 56.57  ? 499 GLN B CB  1 
ATOM   8025 C CG  . GLN B 1 502 ? -50.358 65.496  39.963  1.00 72.00  ? 499 GLN B CG  1 
ATOM   8026 C CD  . GLN B 1 502 ? -51.130 66.799  40.035  1.00 67.71  ? 499 GLN B CD  1 
ATOM   8027 O OE1 . GLN B 1 502 ? -50.595 67.830  40.444  1.00 61.04  ? 499 GLN B OE1 1 
ATOM   8028 N NE2 . GLN B 1 502 ? -52.394 66.762  39.626  1.00 67.83  ? 499 GLN B NE2 1 
ATOM   8029 N N   . TRP B 1 503 ? -47.694 67.667  37.061  1.00 50.19  ? 500 TRP B N   1 
ATOM   8030 C CA  . TRP B 1 503 ? -46.447 68.156  36.493  1.00 46.21  ? 500 TRP B CA  1 
ATOM   8031 C C   . TRP B 1 503 ? -45.400 68.175  37.597  1.00 41.08  ? 500 TRP B C   1 
ATOM   8032 O O   . TRP B 1 503 ? -45.400 69.098  38.427  1.00 45.49  ? 500 TRP B O   1 
ATOM   8033 C CB  . TRP B 1 503 ? -46.643 69.556  35.903  1.00 46.08  ? 500 TRP B CB  1 
ATOM   8034 C CG  . TRP B 1 503 ? -45.480 70.098  35.117  1.00 40.86  ? 500 TRP B CG  1 
ATOM   8035 C CD1 . TRP B 1 503 ? -44.169 69.726  35.211  1.00 39.07  ? 500 TRP B CD1 1 
ATOM   8036 C CD2 . TRP B 1 503 ? -45.534 71.113  34.107  1.00 43.02  ? 500 TRP B CD2 1 
ATOM   8037 N NE1 . TRP B 1 503 ? -43.406 70.448  34.326  1.00 36.68  ? 500 TRP B NE1 1 
ATOM   8038 C CE2 . TRP B 1 503 ? -44.221 71.307  33.637  1.00 39.26  ? 500 TRP B CE2 1 
ATOM   8039 C CE3 . TRP B 1 503 ? -46.568 71.877  33.556  1.00 45.16  ? 500 TRP B CE3 1 
ATOM   8040 C CZ2 . TRP B 1 503 ? -43.914 72.231  32.641  1.00 45.17  ? 500 TRP B CZ2 1 
ATOM   8041 C CZ3 . TRP B 1 503 ? -46.261 72.795  32.569  1.00 43.14  ? 500 TRP B CZ3 1 
ATOM   8042 C CH2 . TRP B 1 503 ? -44.946 72.964  32.121  1.00 47.69  ? 500 TRP B CH2 1 
ATOM   8043 N N   . PRO B 1 504 ? -44.495 67.196  37.660  1.00 33.74  ? 501 PRO B N   1 
ATOM   8044 C CA  . PRO B 1 504 ? -43.527 67.170  38.753  1.00 34.93  ? 501 PRO B CA  1 
ATOM   8045 C C   . PRO B 1 504 ? -42.456 68.224  38.552  1.00 34.10  ? 501 PRO B C   1 
ATOM   8046 O O   . PRO B 1 504 ? -42.120 68.579  37.409  1.00 39.05  ? 501 PRO B O   1 
ATOM   8047 C CB  . PRO B 1 504 ? -42.940 65.751  38.670  1.00 32.41  ? 501 PRO B CB  1 
ATOM   8048 C CG  . PRO B 1 504 ? -43.061 65.396  37.234  1.00 37.41  ? 501 PRO B CG  1 
ATOM   8049 C CD  . PRO B 1 504 ? -44.331 66.051  36.747  1.00 35.12  ? 501 PRO B CD  1 
ATOM   8050 N N   . PRO B 1 505 ? -41.904 68.770  39.632  1.00 38.86  ? 502 PRO B N   1 
ATOM   8051 C CA  . PRO B 1 505 ? -40.833 69.761  39.494  1.00 39.09  ? 502 PRO B CA  1 
ATOM   8052 C C   . PRO B 1 505 ? -39.578 69.146  38.894  1.00 39.34  ? 502 PRO B C   1 
ATOM   8053 O O   . PRO B 1 505 ? -39.362 67.933  38.924  1.00 45.56  ? 502 PRO B O   1 
ATOM   8054 C CB  . PRO B 1 505 ? -40.585 70.226  40.934  1.00 33.09  ? 502 PRO B CB  1 
ATOM   8055 C CG  . PRO B 1 505 ? -41.828 69.853  41.680  1.00 39.34  ? 502 PRO B CG  1 
ATOM   8056 C CD  . PRO B 1 505 ? -42.321 68.598  41.033  1.00 40.12  ? 502 PRO B CD  1 
ATOM   8057 N N   . TYR B 1 506 ? -38.743 70.018  38.337  1.00 46.84  ? 503 TYR B N   1 
ATOM   8058 C CA  . TYR B 1 506 ? -37.470 69.614  37.759  1.00 34.06  ? 503 TYR B CA  1 
ATOM   8059 C C   . TYR B 1 506 ? -36.384 69.688  38.824  1.00 46.15  ? 503 TYR B C   1 
ATOM   8060 O O   . TYR B 1 506 ? -36.226 70.718  39.488  1.00 42.65  ? 503 TYR B O   1 
ATOM   8061 C CB  . TYR B 1 506 ? -37.112 70.505  36.567  1.00 42.07  ? 503 TYR B CB  1 
ATOM   8062 C CG  . TYR B 1 506 ? -35.820 70.130  35.871  1.00 31.05  ? 503 TYR B CG  1 
ATOM   8063 C CD1 . TYR B 1 506 ? -34.607 70.679  36.270  1.00 30.06  ? 503 TYR B CD1 1 
ATOM   8064 C CD2 . TYR B 1 506 ? -35.815 69.235  34.808  1.00 26.14  ? 503 TYR B CD2 1 
ATOM   8065 C CE1 . TYR B 1 506 ? -33.426 70.341  35.636  1.00 35.36  ? 503 TYR B CE1 1 
ATOM   8066 C CE2 . TYR B 1 506 ? -34.638 68.893  34.167  1.00 28.74  ? 503 TYR B CE2 1 
ATOM   8067 C CZ  . TYR B 1 506 ? -33.447 69.448  34.585  1.00 31.98  ? 503 TYR B CZ  1 
ATOM   8068 O OH  . TYR B 1 506 ? -32.273 69.111  33.951  1.00 39.61  ? 503 TYR B OH  1 
ATOM   8069 N N   . THR B 1 507 ? -35.644 68.595  38.988  1.00 39.24  ? 504 THR B N   1 
ATOM   8070 C CA  . THR B 1 507 ? -34.545 68.523  39.938  1.00 50.40  ? 504 THR B CA  1 
ATOM   8071 C C   . THR B 1 507 ? -33.264 68.130  39.214  1.00 42.10  ? 504 THR B C   1 
ATOM   8072 O O   . THR B 1 507 ? -33.293 67.550  38.125  1.00 47.17  ? 504 THR B O   1 
ATOM   8073 C CB  . THR B 1 507 ? -34.838 67.520  41.064  1.00 41.70  ? 504 THR B CB  1 
ATOM   8074 O OG1 . THR B 1 507 ? -35.159 66.243  40.499  1.00 44.06  ? 504 THR B OG1 1 
ATOM   8075 C CG2 . THR B 1 507 ? -36.001 68.001  41.920  1.00 38.53  ? 504 THR B CG2 1 
ATOM   8076 N N   . ALA B 1 508 ? -32.129 68.457  39.835  1.00 36.02  ? 505 ALA B N   1 
ATOM   8077 C CA  . ALA B 1 508 ? -30.838 68.129  39.241  1.00 38.44  ? 505 ALA B CA  1 
ATOM   8078 C C   . ALA B 1 508 ? -30.582 66.628  39.199  1.00 51.57  ? 505 ALA B C   1 
ATOM   8079 O O   . ALA B 1 508 ? -29.738 66.179  38.417  1.00 56.03  ? 505 ALA B O   1 
ATOM   8080 C CB  . ALA B 1 508 ? -29.713 68.828  40.006  1.00 41.41  ? 505 ALA B CB  1 
ATOM   8081 N N   . GLY B 1 509 ? -31.288 65.848  40.014  1.00 43.96  ? 506 GLY B N   1 
ATOM   8082 C CA  . GLY B 1 509 ? -31.104 64.411  40.034  1.00 35.45  ? 506 GLY B CA  1 
ATOM   8083 C C   . GLY B 1 509 ? -32.084 63.664  39.154  1.00 36.78  ? 506 GLY B C   1 
ATOM   8084 O O   . GLY B 1 509 ? -31.680 62.923  38.253  1.00 41.39  ? 506 GLY B O   1 
ATOM   8085 N N   . ALA B 1 510 ? -33.382 63.850  39.405  1.00 37.22  ? 507 ALA B N   1 
ATOM   8086 C CA  . ALA B 1 510 ? -34.392 63.136  38.631  1.00 36.12  ? 507 ALA B CA  1 
ATOM   8087 C C   . ALA B 1 510 ? -34.519 63.705  37.223  1.00 40.08  ? 507 ALA B C   1 
ATOM   8088 O O   . ALA B 1 510 ? -34.745 62.956  36.265  1.00 41.31  ? 507 ALA B O   1 
ATOM   8089 C CB  . ALA B 1 510 ? -35.738 63.181  39.354  1.00 35.94  ? 507 ALA B CB  1 
ATOM   8090 N N   . GLN B 1 511 ? -34.382 65.026  37.082  1.00 43.06  ? 508 GLN B N   1 
ATOM   8091 C CA  . GLN B 1 511 ? -34.445 65.703  35.784  1.00 38.92  ? 508 GLN B CA  1 
ATOM   8092 C C   . GLN B 1 511 ? -35.762 65.406  35.067  1.00 34.74  ? 508 GLN B C   1 
ATOM   8093 O O   . GLN B 1 511 ? -35.792 65.078  33.880  1.00 41.95  ? 508 GLN B O   1 
ATOM   8094 C CB  . GLN B 1 511 ? -33.246 65.328  34.910  1.00 34.88  ? 508 GLN B CB  1 
ATOM   8095 C CG  . GLN B 1 511 ? -31.898 65.552  35.576  1.00 42.76  ? 508 GLN B CG  1 
ATOM   8096 C CD  . GLN B 1 511 ? -30.737 65.150  34.690  1.00 42.96  ? 508 GLN B CD  1 
ATOM   8097 O OE1 . GLN B 1 511 ? -30.882 65.031  33.473  1.00 48.79  ? 508 GLN B OE1 1 
ATOM   8098 N NE2 . GLN B 1 511 ? -29.576 64.933  35.296  1.00 48.46  ? 508 GLN B NE2 1 
ATOM   8099 N N   . GLN B 1 512 ? -36.861 65.529  35.805  1.00 35.42  ? 509 GLN B N   1 
ATOM   8100 C CA  . GLN B 1 512 ? -38.174 65.221  35.260  1.00 40.55  ? 509 GLN B CA  1 
ATOM   8101 C C   . GLN B 1 512 ? -38.740 66.410  34.494  1.00 39.75  ? 509 GLN B C   1 
ATOM   8102 O O   . GLN B 1 512 ? -38.588 67.565  34.903  1.00 34.20  ? 509 GLN B O   1 
ATOM   8103 C CB  . GLN B 1 512 ? -39.137 64.820  36.378  1.00 42.43  ? 509 GLN B CB  1 
ATOM   8104 C CG  . GLN B 1 512 ? -38.730 63.573  37.138  1.00 44.85  ? 509 GLN B CG  1 
ATOM   8105 C CD  . GLN B 1 512 ? -39.626 63.306  38.329  1.00 38.03  ? 509 GLN B CD  1 
ATOM   8106 O OE1 . GLN B 1 512 ? -39.324 63.713  39.452  1.00 45.19  ? 509 GLN B OE1 1 
ATOM   8107 N NE2 . GLN B 1 512 ? -40.734 62.615  38.092  1.00 33.31  ? 509 GLN B NE2 1 
ATOM   8108 N N   . TYR B 1 513 ? -39.392 66.115  33.373  1.00 29.66  ? 510 TYR B N   1 
ATOM   8109 C CA  . TYR B 1 513 ? -40.082 67.124  32.585  1.00 31.69  ? 510 TYR B CA  1 
ATOM   8110 C C   . TYR B 1 513 ? -41.317 66.481  31.972  1.00 30.96  ? 510 TYR B C   1 
ATOM   8111 O O   . TYR B 1 513 ? -41.474 65.257  31.981  1.00 34.22  ? 510 TYR B O   1 
ATOM   8112 C CB  . TYR B 1 513 ? -39.171 67.721  31.504  1.00 31.54  ? 510 TYR B CB  1 
ATOM   8113 C CG  . TYR B 1 513 ? -38.800 66.754  30.401  1.00 35.40  ? 510 TYR B CG  1 
ATOM   8114 C CD1 . TYR B 1 513 ? -37.705 65.910  30.530  1.00 33.94  ? 510 TYR B CD1 1 
ATOM   8115 C CD2 . TYR B 1 513 ? -39.540 66.692  29.227  1.00 33.41  ? 510 TYR B CD2 1 
ATOM   8116 C CE1 . TYR B 1 513 ? -37.362 65.026  29.523  1.00 31.80  ? 510 TYR B CE1 1 
ATOM   8117 C CE2 . TYR B 1 513 ? -39.206 65.811  28.217  1.00 35.55  ? 510 TYR B CE2 1 
ATOM   8118 C CZ  . TYR B 1 513 ? -38.115 64.983  28.368  1.00 35.24  ? 510 TYR B CZ  1 
ATOM   8119 O OH  . TYR B 1 513 ? -37.779 64.107  27.363  1.00 45.77  ? 510 TYR B OH  1 
ATOM   8120 N N   . VAL B 1 514 ? -42.199 67.320  31.434  1.00 31.44  ? 511 VAL B N   1 
ATOM   8121 C CA  . VAL B 1 514 ? -43.424 66.845  30.809  1.00 27.20  ? 511 VAL B CA  1 
ATOM   8122 C C   . VAL B 1 514 ? -43.418 67.243  29.340  1.00 29.03  ? 511 VAL B C   1 
ATOM   8123 O O   . VAL B 1 514 ? -42.740 68.185  28.923  1.00 27.40  ? 511 VAL B O   1 
ATOM   8124 C CB  . VAL B 1 514 ? -44.689 67.380  31.511  1.00 43.20  ? 511 VAL B CB  1 
ATOM   8125 C CG1 . VAL B 1 514 ? -44.665 67.030  32.992  1.00 36.62  ? 511 VAL B CG1 1 
ATOM   8126 C CG2 . VAL B 1 514 ? -44.819 68.881  31.308  1.00 41.78  ? 511 VAL B CG2 1 
ATOM   8127 N N   . SER B 1 515 ? -44.185 66.499  28.550  1.00 26.98  ? 512 SER B N   1 
ATOM   8128 C CA  . SER B 1 515 ? -44.356 66.777  27.132  1.00 28.89  ? 512 SER B CA  1 
ATOM   8129 C C   . SER B 1 515 ? -45.679 67.497  26.921  1.00 32.76  ? 512 SER B C   1 
ATOM   8130 O O   . SER B 1 515 ? -46.711 67.083  27.460  1.00 36.26  ? 512 SER B O   1 
ATOM   8131 C CB  . SER B 1 515 ? -44.315 65.486  26.313  1.00 38.10  ? 512 SER B CB  1 
ATOM   8132 O OG  . SER B 1 515 ? -45.350 64.601  26.703  1.00 43.51  ? 512 SER B OG  1 
ATOM   8133 N N   . LEU B 1 516 ? -45.647 68.575  26.142  1.00 37.41  ? 513 LEU B N   1 
ATOM   8134 C CA  . LEU B 1 516 ? -46.826 69.386  25.862  1.00 30.58  ? 513 LEU B CA  1 
ATOM   8135 C C   . LEU B 1 516 ? -47.292 69.089  24.442  1.00 31.03  ? 513 LEU B C   1 
ATOM   8136 O O   . LEU B 1 516 ? -46.641 69.494  23.472  1.00 33.78  ? 513 LEU B O   1 
ATOM   8137 C CB  . LEU B 1 516 ? -46.524 70.872  26.045  1.00 24.01  ? 513 LEU B CB  1 
ATOM   8138 C CG  . LEU B 1 516 ? -46.035 71.299  27.431  1.00 31.63  ? 513 LEU B CG  1 
ATOM   8139 C CD1 . LEU B 1 516 ? -45.839 72.806  27.493  1.00 23.78  ? 513 LEU B CD1 1 
ATOM   8140 C CD2 . LEU B 1 516 ? -47.002 70.837  28.510  1.00 29.62  ? 513 LEU B CD2 1 
ATOM   8141 N N   . ASP B 1 517 ? -48.410 68.383  24.324  1.00 28.41  ? 514 ASP B N   1 
ATOM   8142 C CA  . ASP B 1 517 ? -49.022 68.092  23.033  1.00 32.84  ? 514 ASP B CA  1 
ATOM   8143 C C   . ASP B 1 517 ? -50.505 67.821  23.265  1.00 35.18  ? 514 ASP B C   1 
ATOM   8144 O O   . ASP B 1 517 ? -51.034 68.064  24.356  1.00 30.16  ? 514 ASP B O   1 
ATOM   8145 C CB  . ASP B 1 517 ? -48.308 66.928  22.334  1.00 41.21  ? 514 ASP B CB  1 
ATOM   8146 C CG  . ASP B 1 517 ? -48.174 65.699  23.217  1.00 47.80  ? 514 ASP B CG  1 
ATOM   8147 O OD1 . ASP B 1 517 ? -48.871 65.611  24.249  1.00 55.06  ? 514 ASP B OD1 1 
ATOM   8148 O OD2 . ASP B 1 517 ? -47.358 64.816  22.878  1.00 54.70  ? 514 ASP B OD2 1 
ATOM   8149 N N   . LEU B 1 518 ? -51.181 67.310  22.233  1.00 30.80  ? 515 LEU B N   1 
ATOM   8150 C CA  . LEU B 1 518 ? -52.615 67.061  22.340  1.00 32.27  ? 515 LEU B CA  1 
ATOM   8151 C C   . LEU B 1 518 ? -52.925 65.984  23.371  1.00 44.80  ? 515 LEU B C   1 
ATOM   8152 O O   . LEU B 1 518 ? -54.010 65.987  23.964  1.00 46.71  ? 515 LEU B O   1 
ATOM   8153 C CB  . LEU B 1 518 ? -53.184 66.672  20.976  1.00 27.31  ? 515 LEU B CB  1 
ATOM   8154 C CG  . LEU B 1 518 ? -52.919 67.656  19.834  1.00 44.34  ? 515 LEU B CG  1 
ATOM   8155 C CD1 . LEU B 1 518 ? -53.631 67.215  18.563  1.00 30.97  ? 515 LEU B CD1 1 
ATOM   8156 C CD2 . LEU B 1 518 ? -53.337 69.065  20.228  1.00 36.05  ? 515 LEU B CD2 1 
ATOM   8157 N N   . ARG B 1 519 ? -51.993 65.063  23.601  1.00 48.80  ? 516 ARG B N   1 
ATOM   8158 C CA  . ARG B 1 519 ? -52.186 64.026  24.596  1.00 44.76  ? 516 ARG B CA  1 
ATOM   8159 C C   . ARG B 1 519 ? -52.022 64.605  26.000  1.00 42.39  ? 516 ARG B C   1 
ATOM   8160 O O   . ARG B 1 519 ? -51.434 65.676  26.175  1.00 46.29  ? 516 ARG B O   1 
ATOM   8161 C CB  . ARG B 1 519 ? -51.190 62.890  24.371  1.00 48.15  ? 516 ARG B CB  1 
ATOM   8162 C CG  . ARG B 1 519 ? -51.244 62.283  22.978  1.00 48.90  ? 516 ARG B CG  1 
ATOM   8163 C CD  . ARG B 1 519 ? -50.230 61.158  22.812  1.00 58.39  ? 516 ARG B CD  1 
ATOM   8164 N NE  . ARG B 1 519 ? -48.861 61.599  23.072  1.00 68.18  ? 516 ARG B NE  1 
ATOM   8165 C CZ  . ARG B 1 519 ? -48.180 61.313  24.177  1.00 70.74  ? 516 ARG B CZ  1 
ATOM   8166 N NH1 . ARG B 1 519 ? -48.736 60.579  25.131  1.00 66.05  ? 516 ARG B NH1 1 
ATOM   8167 N NH2 . ARG B 1 519 ? -46.940 61.759  24.328  1.00 63.47  ? 516 ARG B NH2 1 
ATOM   8168 N N   . PRO B 1 520 ? -52.548 63.923  27.018  1.00 41.85  ? 517 PRO B N   1 
ATOM   8169 C CA  . PRO B 1 520 ? -52.334 64.375  28.398  1.00 36.01  ? 517 PRO B CA  1 
ATOM   8170 C C   . PRO B 1 520 ? -50.855 64.399  28.754  1.00 36.74  ? 517 PRO B C   1 
ATOM   8171 O O   . PRO B 1 520 ? -49.996 63.887  28.032  1.00 43.65  ? 517 PRO B O   1 
ATOM   8172 C CB  . PRO B 1 520 ? -53.096 63.341  29.234  1.00 44.64  ? 517 PRO B CB  1 
ATOM   8173 C CG  . PRO B 1 520 ? -54.138 62.813  28.310  1.00 41.98  ? 517 PRO B CG  1 
ATOM   8174 C CD  . PRO B 1 520 ? -53.504 62.804  26.948  1.00 38.88  ? 517 PRO B CD  1 
ATOM   8175 N N   . LEU B 1 521 ? -50.563 65.012  29.900  1.00 39.36  ? 518 LEU B N   1 
ATOM   8176 C CA  . LEU B 1 521 ? -49.180 65.168  30.333  1.00 44.49  ? 518 LEU B CA  1 
ATOM   8177 C C   . LEU B 1 521 ? -48.504 63.814  30.505  1.00 47.51  ? 518 LEU B C   1 
ATOM   8178 O O   . LEU B 1 521 ? -49.102 62.857  31.005  1.00 47.36  ? 518 LEU B O   1 
ATOM   8179 C CB  . LEU B 1 521 ? -49.116 65.953  31.644  1.00 47.49  ? 518 LEU B CB  1 
ATOM   8180 C CG  . LEU B 1 521 ? -49.340 67.464  31.556  1.00 49.93  ? 518 LEU B CG  1 
ATOM   8181 C CD1 . LEU B 1 521 ? -49.101 68.118  32.908  1.00 46.05  ? 518 LEU B CD1 1 
ATOM   8182 C CD2 . LEU B 1 521 ? -48.443 68.077  30.494  1.00 41.62  ? 518 LEU B CD2 1 
ATOM   8183 N N   . GLU B 1 522 ? -47.246 63.742  30.079  1.00 45.36  ? 519 GLU B N   1 
ATOM   8184 C CA  . GLU B 1 522 ? -46.432 62.539  30.185  1.00 45.40  ? 519 GLU B CA  1 
ATOM   8185 C C   . GLU B 1 522 ? -45.080 62.924  30.763  1.00 42.02  ? 519 GLU B C   1 
ATOM   8186 O O   . GLU B 1 522 ? -44.400 63.804  30.226  1.00 42.86  ? 519 GLU B O   1 
ATOM   8187 C CB  . GLU B 1 522 ? -46.260 61.864  28.820  1.00 47.86  ? 519 GLU B CB  1 
ATOM   8188 C CG  . GLU B 1 522 ? -45.316 60.676  28.821  1.00 55.37  ? 519 GLU B CG  1 
ATOM   8189 C CD  . GLU B 1 522 ? -45.174 60.052  27.446  1.00 69.78  ? 519 GLU B CD  1 
ATOM   8190 O OE1 . GLU B 1 522 ? -46.018 60.342  26.572  1.00 66.79  ? 519 GLU B OE1 1 
ATOM   8191 O OE2 . GLU B 1 522 ? -44.218 59.276  27.237  1.00 70.98  ? 519 GLU B OE2 1 
ATOM   8192 N N   . VAL B 1 523 ? -44.693 62.269  31.852  1.00 41.30  ? 520 VAL B N   1 
ATOM   8193 C CA  . VAL B 1 523 ? -43.460 62.595  32.559  1.00 42.29  ? 520 VAL B CA  1 
ATOM   8194 C C   . VAL B 1 523 ? -42.307 61.820  31.937  1.00 37.87  ? 520 VAL B C   1 
ATOM   8195 O O   . VAL B 1 523 ? -42.396 60.602  31.740  1.00 41.27  ? 520 VAL B O   1 
ATOM   8196 C CB  . VAL B 1 523 ? -43.588 62.285  34.059  1.00 36.29  ? 520 VAL B CB  1 
ATOM   8197 C CG1 . VAL B 1 523 ? -42.308 62.666  34.788  1.00 36.16  ? 520 VAL B CG1 1 
ATOM   8198 C CG2 . VAL B 1 523 ? -44.782 63.017  34.649  1.00 33.57  ? 520 VAL B CG2 1 
ATOM   8199 N N   . ARG B 1 524 ? -41.225 62.528  31.626  1.00 41.04  ? 521 ARG B N   1 
ATOM   8200 C CA  . ARG B 1 524 ? -40.000 61.936  31.112  1.00 35.75  ? 521 ARG B CA  1 
ATOM   8201 C C   . ARG B 1 524 ? -38.824 62.474  31.915  1.00 39.18  ? 521 ARG B C   1 
ATOM   8202 O O   . ARG B 1 524 ? -38.953 63.437  32.675  1.00 38.88  ? 521 ARG B O   1 
ATOM   8203 C CB  . ARG B 1 524 ? -39.820 62.232  29.617  1.00 33.36  ? 521 ARG B CB  1 
ATOM   8204 C CG  . ARG B 1 524 ? -40.972 61.746  28.755  1.00 44.20  ? 521 ARG B CG  1 
ATOM   8205 C CD  . ARG B 1 524 ? -40.866 62.264  27.332  1.00 39.75  ? 521 ARG B CD  1 
ATOM   8206 N NE  . ARG B 1 524 ? -42.060 61.947  26.556  1.00 49.72  ? 521 ARG B NE  1 
ATOM   8207 C CZ  . ARG B 1 524 ? -42.291 62.388  25.324  1.00 40.72  ? 521 ARG B CZ  1 
ATOM   8208 N NH1 . ARG B 1 524 ? -41.406 63.171  24.721  1.00 35.95  ? 521 ARG B NH1 1 
ATOM   8209 N NH2 . ARG B 1 524 ? -43.408 62.049  24.695  1.00 50.96  ? 521 ARG B NH2 1 
ATOM   8210 N N   . ARG B 1 525 ? -37.666 61.842  31.744  1.00 40.87  ? 522 ARG B N   1 
ATOM   8211 C CA  . ARG B 1 525 ? -36.477 62.186  32.513  1.00 43.27  ? 522 ARG B CA  1 
ATOM   8212 C C   . ARG B 1 525 ? -35.322 62.496  31.574  1.00 40.95  ? 522 ARG B C   1 
ATOM   8213 O O   . ARG B 1 525 ? -35.036 61.719  30.657  1.00 45.70  ? 522 ARG B O   1 
ATOM   8214 C CB  . ARG B 1 525 ? -36.092 61.052  33.469  1.00 51.53  ? 522 ARG B CB  1 
ATOM   8215 C CG  . ARG B 1 525 ? -37.087 60.832  34.596  1.00 57.22  ? 522 ARG B CG  1 
ATOM   8216 C CD  . ARG B 1 525 ? -36.534 59.880  35.642  1.00 57.57  ? 522 ARG B CD  1 
ATOM   8217 N NE  . ARG B 1 525 ? -35.175 60.243  36.034  1.00 60.26  ? 522 ARG B NE  1 
ATOM   8218 C CZ  . ARG B 1 525 ? -34.546 59.752  37.096  1.00 68.57  ? 522 ARG B CZ  1 
ATOM   8219 N NH1 . ARG B 1 525 ? -35.156 58.880  37.887  1.00 73.53  ? 522 ARG B NH1 1 
ATOM   8220 N NH2 . ARG B 1 525 ? -33.307 60.139  37.372  1.00 60.02  ? 522 ARG B NH2 1 
ATOM   8221 N N   . GLY B 1 526 ? -34.664 63.629  31.807  1.00 39.45  ? 523 GLY B N   1 
ATOM   8222 C CA  . GLY B 1 526 ? -33.475 63.988  31.059  1.00 36.16  ? 523 GLY B CA  1 
ATOM   8223 C C   . GLY B 1 526 ? -33.732 64.839  29.833  1.00 42.81  ? 523 GLY B C   1 
ATOM   8224 O O   . GLY B 1 526 ? -34.327 64.373  28.857  1.00 47.85  ? 523 GLY B O   1 
ATOM   8225 N N   . LEU B 1 527 ? -33.284 66.096  29.872  1.00 40.71  ? 524 LEU B N   1 
ATOM   8226 C CA  . LEU B 1 527 ? -33.347 66.986  28.712  1.00 39.56  ? 524 LEU B CA  1 
ATOM   8227 C C   . LEU B 1 527 ? -32.126 66.732  27.827  1.00 35.05  ? 524 LEU B C   1 
ATOM   8228 O O   . LEU B 1 527 ? -31.187 67.529  27.752  1.00 37.05  ? 524 LEU B O   1 
ATOM   8229 C CB  . LEU B 1 527 ? -33.425 68.441  29.152  1.00 33.51  ? 524 LEU B CB  1 
ATOM   8230 C CG  . LEU B 1 527 ? -34.757 68.935  29.717  1.00 40.22  ? 524 LEU B CG  1 
ATOM   8231 C CD1 . LEU B 1 527 ? -34.631 70.375  30.188  1.00 45.74  ? 524 LEU B CD1 1 
ATOM   8232 C CD2 . LEU B 1 527 ? -35.853 68.806  28.674  1.00 35.95  ? 524 LEU B CD2 1 
ATOM   8233 N N   . ARG B 1 528 ? -32.159 65.588  27.145  1.00 38.86  ? 525 ARG B N   1 
ATOM   8234 C CA  . ARG B 1 528 ? -31.051 65.116  26.317  1.00 41.09  ? 525 ARG B CA  1 
ATOM   8235 C C   . ARG B 1 528 ? -29.756 65.078  27.129  1.00 31.44  ? 525 ARG B C   1 
ATOM   8236 O O   . ARG B 1 528 ? -28.788 65.791  26.855  1.00 30.41  ? 525 ARG B O   1 
ATOM   8237 C CB  . ARG B 1 528 ? -30.900 65.978  25.059  1.00 35.66  ? 525 ARG B CB  1 
ATOM   8238 C CG  . ARG B 1 528 ? -32.169 66.077  24.227  1.00 37.22  ? 525 ARG B CG  1 
ATOM   8239 C CD  . ARG B 1 528 ? -31.909 66.727  22.879  1.00 38.42  ? 525 ARG B CD  1 
ATOM   8240 N NE  . ARG B 1 528 ? -33.126 66.812  22.075  1.00 50.42  ? 525 ARG B NE  1 
ATOM   8241 C CZ  . ARG B 1 528 ? -33.160 67.206  20.805  1.00 54.43  ? 525 ARG B CZ  1 
ATOM   8242 N NH1 . ARG B 1 528 ? -32.040 67.550  20.184  1.00 49.15  ? 525 ARG B NH1 1 
ATOM   8243 N NH2 . ARG B 1 528 ? -34.315 67.251  20.155  1.00 44.30  ? 525 ARG B NH2 1 
ATOM   8244 N N   . ALA B 1 529 ? -29.763 64.217  28.150  1.00 29.87  ? 526 ALA B N   1 
ATOM   8245 C CA  . ALA B 1 529 ? -28.662 64.184  29.109  1.00 37.87  ? 526 ALA B CA  1 
ATOM   8246 C C   . ALA B 1 529 ? -27.354 63.766  28.450  1.00 32.39  ? 526 ALA B C   1 
ATOM   8247 O O   . ALA B 1 529 ? -26.297 64.342  28.734  1.00 38.13  ? 526 ALA B O   1 
ATOM   8248 C CB  . ALA B 1 529 ? -29.005 63.244  30.265  1.00 31.26  ? 526 ALA B CB  1 
ATOM   8249 N N   . GLN B 1 530 ? -27.401 62.765  27.569  1.00 31.45  ? 527 GLN B N   1 
ATOM   8250 C CA  . GLN B 1 530 ? -26.178 62.296  26.925  1.00 30.32  ? 527 GLN B CA  1 
ATOM   8251 C C   . GLN B 1 530 ? -25.609 63.348  25.981  1.00 38.16  ? 527 GLN B C   1 
ATOM   8252 O O   . GLN B 1 530 ? -24.393 63.570  25.951  1.00 37.31  ? 527 GLN B O   1 
ATOM   8253 C CB  . GLN B 1 530 ? -26.444 60.989  26.179  1.00 33.79  ? 527 GLN B CB  1 
ATOM   8254 C CG  . GLN B 1 530 ? -26.834 59.834  27.085  1.00 37.49  ? 527 GLN B CG  1 
ATOM   8255 C CD  . GLN B 1 530 ? -25.785 59.546  28.141  1.00 45.02  ? 527 GLN B CD  1 
ATOM   8256 O OE1 . GLN B 1 530 ? -26.056 59.622  29.339  1.00 46.18  ? 527 GLN B OE1 1 
ATOM   8257 N NE2 . GLN B 1 530 ? -24.577 59.213  27.700  1.00 37.35  ? 527 GLN B NE2 1 
ATOM   8258 N N   . ALA B 1 531 ? -26.472 64.008  25.206  1.00 33.34  ? 528 ALA B N   1 
ATOM   8259 C CA  . ALA B 1 531 ? -25.994 65.026  24.276  1.00 28.10  ? 528 ALA B CA  1 
ATOM   8260 C C   . ALA B 1 531 ? -25.487 66.257  25.015  1.00 33.05  ? 528 ALA B C   1 
ATOM   8261 O O   . ALA B 1 531 ? -24.472 66.847  24.627  1.00 31.82  ? 528 ALA B O   1 
ATOM   8262 C CB  . ALA B 1 531 ? -27.104 65.405  23.296  1.00 32.47  ? 528 ALA B CB  1 
ATOM   8263 N N   . CYS B 1 532 ? -26.174 66.658  26.085  1.00 21.33  ? 529 CYS B N   1 
ATOM   8264 C CA  . CYS B 1 532 ? -25.797 67.872  26.796  1.00 30.81  ? 529 CYS B CA  1 
ATOM   8265 C C   . CYS B 1 532 ? -24.618 67.668  27.735  1.00 30.94  ? 529 CYS B C   1 
ATOM   8266 O O   . CYS B 1 532 ? -23.993 68.653  28.143  1.00 30.34  ? 529 CYS B O   1 
ATOM   8267 C CB  . CYS B 1 532 ? -26.997 68.423  27.564  1.00 33.02  ? 529 CYS B CB  1 
ATOM   8268 S SG  . CYS B 1 532 ? -28.255 69.088  26.461  1.00 37.49  ? 529 CYS B SG  1 
ATOM   8269 N N   . ALA B 1 533 ? -24.297 66.422  28.088  1.00 29.67  ? 530 ALA B N   1 
ATOM   8270 C CA  . ALA B 1 533 ? -23.054 66.176  28.809  1.00 33.31  ? 530 ALA B CA  1 
ATOM   8271 C C   . ALA B 1 533 ? -21.845 66.431  27.920  1.00 26.66  ? 530 ALA B C   1 
ATOM   8272 O O   . ALA B 1 533 ? -20.785 66.831  28.413  1.00 30.42  ? 530 ALA B O   1 
ATOM   8273 C CB  . ALA B 1 533 ? -23.027 64.748  29.349  1.00 25.17  ? 530 ALA B CB  1 
ATOM   8274 N N   . PHE B 1 534 ? -21.988 66.211  26.611  1.00 27.35  ? 531 PHE B N   1 
ATOM   8275 C CA  . PHE B 1 534 ? -20.902 66.511  25.685  1.00 27.69  ? 531 PHE B CA  1 
ATOM   8276 C C   . PHE B 1 534 ? -20.662 68.012  25.584  1.00 34.20  ? 531 PHE B C   1 
ATOM   8277 O O   . PHE B 1 534 ? -19.511 68.464  25.593  1.00 33.45  ? 531 PHE B O   1 
ATOM   8278 C CB  . PHE B 1 534 ? -21.214 65.918  24.310  1.00 24.48  ? 531 PHE B CB  1 
ATOM   8279 C CG  . PHE B 1 534 ? -20.353 66.459  23.204  1.00 32.64  ? 531 PHE B CG  1 
ATOM   8280 C CD1 . PHE B 1 534 ? -19.050 66.018  23.043  1.00 35.08  ? 531 PHE B CD1 1 
ATOM   8281 C CD2 . PHE B 1 534 ? -20.851 67.401  22.318  1.00 32.75  ? 531 PHE B CD2 1 
ATOM   8282 C CE1 . PHE B 1 534 ? -18.257 66.512  22.023  1.00 36.48  ? 531 PHE B CE1 1 
ATOM   8283 C CE2 . PHE B 1 534 ? -20.063 67.899  21.297  1.00 35.79  ? 531 PHE B CE2 1 
ATOM   8284 C CZ  . PHE B 1 534 ? -18.765 67.453  21.149  1.00 37.00  ? 531 PHE B CZ  1 
ATOM   8285 N N   . TRP B 1 535 ? -21.735 68.801  25.495  1.00 31.12  ? 532 TRP B N   1 
ATOM   8286 C CA  . TRP B 1 535 ? -21.584 70.243  25.334  1.00 34.04  ? 532 TRP B CA  1 
ATOM   8287 C C   . TRP B 1 535 ? -21.183 70.923  26.638  1.00 25.00  ? 532 TRP B C   1 
ATOM   8288 O O   . TRP B 1 535 ? -20.349 71.835  26.632  1.00 32.34  ? 532 TRP B O   1 
ATOM   8289 C CB  . TRP B 1 535 ? -22.880 70.855  24.801  1.00 27.88  ? 532 TRP B CB  1 
ATOM   8290 C CG  . TRP B 1 535 ? -23.229 70.429  23.408  1.00 22.16  ? 532 TRP B CG  1 
ATOM   8291 C CD1 . TRP B 1 535 ? -24.205 69.548  23.040  1.00 22.31  ? 532 TRP B CD1 1 
ATOM   8292 C CD2 . TRP B 1 535 ? -22.604 70.865  22.195  1.00 16.69  ? 532 TRP B CD2 1 
ATOM   8293 N NE1 . TRP B 1 535 ? -24.226 69.410  21.673  1.00 24.43  ? 532 TRP B NE1 1 
ATOM   8294 C CE2 . TRP B 1 535 ? -23.253 70.207  21.131  1.00 22.33  ? 532 TRP B CE2 1 
ATOM   8295 C CE3 . TRP B 1 535 ? -21.558 71.747  21.906  1.00 24.99  ? 532 TRP B CE3 1 
ATOM   8296 C CZ2 . TRP B 1 535 ? -22.890 70.404  19.800  1.00 19.93  ? 532 TRP B CZ2 1 
ATOM   8297 C CZ3 . TRP B 1 535 ? -21.200 71.941  20.585  1.00 16.98  ? 532 TRP B CZ3 1 
ATOM   8298 C CH2 . TRP B 1 535 ? -21.864 71.273  19.548  1.00 23.84  ? 532 TRP B CH2 1 
ATOM   8299 N N   . ASN B 1 536 ? -21.758 70.496  27.762  1.00 22.78  ? 533 ASN B N   1 
ATOM   8300 C CA  . ASN B 1 536 ? -21.568 71.208  29.021  1.00 32.32  ? 533 ASN B CA  1 
ATOM   8301 C C   . ASN B 1 536 ? -20.360 70.730  29.813  1.00 35.37  ? 533 ASN B C   1 
ATOM   8302 O O   . ASN B 1 536 ? -19.811 71.501  30.608  1.00 42.85  ? 533 ASN B O   1 
ATOM   8303 C CB  . ASN B 1 536 ? -22.822 71.085  29.891  1.00 31.33  ? 533 ASN B CB  1 
ATOM   8304 C CG  . ASN B 1 536 ? -24.052 71.675  29.228  1.00 35.78  ? 533 ASN B CG  1 
ATOM   8305 O OD1 . ASN B 1 536 ? -23.947 72.532  28.351  1.00 37.74  ? 533 ASN B OD1 1 
ATOM   8306 N ND2 . ASN B 1 536 ? -25.227 71.219  29.647  1.00 34.58  ? 533 ASN B ND2 1 
ATOM   8307 N N   . ARG B 1 537 ? -19.928 69.484  29.625  1.00 33.51  ? 534 ARG B N   1 
ATOM   8308 C CA  . ARG B 1 537 ? -18.851 68.916  30.427  1.00 39.52  ? 534 ARG B CA  1 
ATOM   8309 C C   . ARG B 1 537 ? -17.575 68.665  29.639  1.00 35.35  ? 534 ARG B C   1 
ATOM   8310 O O   . ARG B 1 537 ? -16.501 69.118  30.045  1.00 44.38  ? 534 ARG B O   1 
ATOM   8311 C CB  . ARG B 1 537 ? -19.317 67.606  31.080  1.00 36.21  ? 534 ARG B CB  1 
ATOM   8312 C CG  . ARG B 1 537 ? -20.526 67.756  31.993  1.00 33.97  ? 534 ARG B CG  1 
ATOM   8313 C CD  . ARG B 1 537 ? -21.010 66.404  32.499  1.00 39.81  ? 534 ARG B CD  1 
ATOM   8314 N NE  . ARG B 1 537 ? -22.201 66.518  33.338  1.00 47.45  ? 534 ARG B NE  1 
ATOM   8315 C CZ  . ARG B 1 537 ? -22.176 66.602  34.665  1.00 47.57  ? 534 ARG B CZ  1 
ATOM   8316 N NH1 . ARG B 1 537 ? -21.019 66.584  35.312  1.00 35.73  ? 534 ARG B NH1 1 
ATOM   8317 N NH2 . ARG B 1 537 ? -23.310 66.703  35.346  1.00 40.28  ? 534 ARG B NH2 1 
ATOM   8318 N N   . PHE B 1 538 ? -17.657 67.947  28.519  1.00 36.15  ? 535 PHE B N   1 
ATOM   8319 C CA  . PHE B 1 538 ? -16.437 67.506  27.849  1.00 38.96  ? 535 PHE B CA  1 
ATOM   8320 C C   . PHE B 1 538 ? -15.883 68.567  26.907  1.00 39.03  ? 535 PHE B C   1 
ATOM   8321 O O   . PHE B 1 538 ? -14.681 68.858  26.932  1.00 40.68  ? 535 PHE B O   1 
ATOM   8322 C CB  . PHE B 1 538 ? -16.690 66.207  27.089  1.00 35.47  ? 535 PHE B CB  1 
ATOM   8323 C CG  . PHE B 1 538 ? -15.512 65.744  26.280  1.00 40.10  ? 535 PHE B CG  1 
ATOM   8324 C CD1 . PHE B 1 538 ? -14.396 65.205  26.902  1.00 38.83  ? 535 PHE B CD1 1 
ATOM   8325 C CD2 . PHE B 1 538 ? -15.518 65.847  24.899  1.00 38.18  ? 535 PHE B CD2 1 
ATOM   8326 C CE1 . PHE B 1 538 ? -13.309 64.778  26.160  1.00 39.58  ? 535 PHE B CE1 1 
ATOM   8327 C CE2 . PHE B 1 538 ? -14.432 65.422  24.151  1.00 40.77  ? 535 PHE B CE2 1 
ATOM   8328 C CZ  . PHE B 1 538 ? -13.328 64.887  24.784  1.00 42.37  ? 535 PHE B CZ  1 
ATOM   8329 N N   . LEU B 1 539 ? -16.739 69.144  26.064  1.00 37.16  ? 536 LEU B N   1 
ATOM   8330 C CA  . LEU B 1 539 ? -16.262 70.088  25.057  1.00 41.38  ? 536 LEU B CA  1 
ATOM   8331 C C   . LEU B 1 539 ? -15.505 71.276  25.644  1.00 40.76  ? 536 LEU B C   1 
ATOM   8332 O O   . LEU B 1 539 ? -14.511 71.698  25.026  1.00 44.13  ? 536 LEU B O   1 
ATOM   8333 C CB  . LEU B 1 539 ? -17.440 70.558  24.191  1.00 40.15  ? 536 LEU B CB  1 
ATOM   8334 C CG  . LEU B 1 539 ? -17.082 71.354  22.932  1.00 42.84  ? 536 LEU B CG  1 
ATOM   8335 C CD1 . LEU B 1 539 ? -17.923 70.900  21.750  1.00 42.17  ? 536 LEU B CD1 1 
ATOM   8336 C CD2 . LEU B 1 539 ? -17.249 72.851  23.158  1.00 52.87  ? 536 LEU B CD2 1 
ATOM   8337 N N   . PRO B 1 540 ? -15.895 71.862  26.786  1.00 42.51  ? 537 PRO B N   1 
ATOM   8338 C CA  . PRO B 1 540 ? -15.029 72.893  27.384  1.00 43.05  ? 537 PRO B CA  1 
ATOM   8339 C C   . PRO B 1 540 ? -13.641 72.382  27.730  1.00 53.14  ? 537 PRO B C   1 
ATOM   8340 O O   . PRO B 1 540 ? -12.656 73.111  27.554  1.00 57.49  ? 537 PRO B O   1 
ATOM   8341 C CB  . PRO B 1 540 ? -15.810 73.320  28.634  1.00 35.16  ? 537 PRO B CB  1 
ATOM   8342 C CG  . PRO B 1 540 ? -17.225 73.043  28.296  1.00 35.90  ? 537 PRO B CG  1 
ATOM   8343 C CD  . PRO B 1 540 ? -17.200 71.791  27.471  1.00 33.01  ? 537 PRO B CD  1 
ATOM   8344 N N   . LYS B 1 541 ? -13.533 71.145  28.221  1.00 50.77  ? 538 LYS B N   1 
ATOM   8345 C CA  . LYS B 1 541 ? -12.217 70.577  28.499  1.00 55.79  ? 538 LYS B CA  1 
ATOM   8346 C C   . LYS B 1 541 ? -11.425 70.343  27.219  1.00 55.27  ? 538 LYS B C   1 
ATOM   8347 O O   . LYS B 1 541 ? -10.197 70.489  27.217  1.00 57.80  ? 538 LYS B O   1 
ATOM   8348 C CB  . LYS B 1 541 ? -12.356 69.270  29.280  1.00 46.06  ? 538 LYS B CB  1 
ATOM   8349 C CG  . LYS B 1 541 ? -12.776 69.446  30.729  1.00 54.04  ? 538 LYS B CG  1 
ATOM   8350 C CD  . LYS B 1 541 ? -12.727 68.122  31.474  1.00 69.25  ? 538 LYS B CD  1 
ATOM   8351 C CE  . LYS B 1 541 ? -13.003 68.307  32.957  1.00 73.93  ? 538 LYS B CE  1 
ATOM   8352 N NZ  . LYS B 1 541 ? -14.357 68.873  33.204  1.00 71.73  ? 538 LYS B NZ  1 
ATOM   8353 N N   . LEU B 1 542 ? -12.104 69.984  26.127  1.00 51.98  ? 539 LEU B N   1 
ATOM   8354 C CA  . LEU B 1 542 ? -11.409 69.761  24.864  1.00 49.16  ? 539 LEU B CA  1 
ATOM   8355 C C   . LEU B 1 542 ? -10.846 71.059  24.299  1.00 61.88  ? 539 LEU B C   1 
ATOM   8356 O O   . LEU B 1 542 ? -9.833  71.036  23.589  1.00 72.55  ? 539 LEU B O   1 
ATOM   8357 C CB  . LEU B 1 542 ? -12.353 69.100  23.859  1.00 42.06  ? 539 LEU B CB  1 
ATOM   8358 C CG  . LEU B 1 542 ? -11.720 68.562  22.575  1.00 48.44  ? 539 LEU B CG  1 
ATOM   8359 C CD1 . LEU B 1 542 ? -10.630 67.552  22.901  1.00 59.72  ? 539 LEU B CD1 1 
ATOM   8360 C CD2 . LEU B 1 542 ? -12.778 67.940  21.679  1.00 45.49  ? 539 LEU B CD2 1 
ATOM   8361 N N   . LEU B 1 543 ? -11.478 72.194  24.603  1.00 59.54  ? 540 LEU B N   1 
ATOM   8362 C CA  . LEU B 1 543 ? -10.974 73.494  24.177  1.00 63.65  ? 540 LEU B CA  1 
ATOM   8363 C C   . LEU B 1 543 ? -9.908  74.045  25.113  1.00 68.66  ? 540 LEU B C   1 
ATOM   8364 O O   . LEU B 1 543 ? -9.011  74.765  24.660  1.00 72.13  ? 540 LEU B O   1 
ATOM   8365 C CB  . LEU B 1 543 ? -12.127 74.498  24.068  1.00 61.38  ? 540 LEU B CB  1 
ATOM   8366 C CG  . LEU B 1 543 ? -13.256 74.128  23.104  1.00 62.66  ? 540 LEU B CG  1 
ATOM   8367 C CD1 . LEU B 1 543 ? -14.365 75.166  23.162  1.00 51.19  ? 540 LEU B CD1 1 
ATOM   8368 C CD2 . LEU B 1 543 ? -12.733 73.970  21.682  1.00 60.53  ? 540 LEU B CD2 1 
ATOM   8369 N N   . SER B 1 544 ? -9.990  73.731  26.410  1.00 67.48  ? 541 SER B N   1 
ATOM   8370 C CA  . SER B 1 544 ? -8.966  74.186  27.346  1.00 68.40  ? 541 SER B CA  1 
ATOM   8371 C C   . SER B 1 544 ? -7.607  73.586  27.008  1.00 73.85  ? 541 SER B C   1 
ATOM   8372 O O   . SER B 1 544 ? -6.574  74.254  27.137  1.00 73.51  ? 541 SER B O   1 
ATOM   8373 C CB  . SER B 1 544 ? -9.368  73.835  28.779  1.00 68.98  ? 541 SER B CB  1 
ATOM   8374 O OG  . SER B 1 544 ? -10.606 74.432  29.123  1.00 76.58  ? 541 SER B OG  1 
ATOM   8375 N N   . ALA B 1 545 ? -7.587  72.324  26.581  1.00 74.86  ? 542 ALA B N   1 
ATOM   8376 C CA  . ALA B 1 545 ? -6.363  71.709  26.086  1.00 70.24  ? 542 ALA B CA  1 
ATOM   8377 C C   . ALA B 1 545 ? -6.101  72.027  24.621  1.00 76.37  ? 542 ALA B C   1 
ATOM   8378 O O   . ALA B 1 545 ? -5.006  71.733  24.130  1.00 75.28  ? 542 ALA B O   1 
ATOM   8379 C CB  . ALA B 1 545 ? -6.417  70.192  26.281  1.00 61.67  ? 542 ALA B CB  1 
ATOM   8380 N N   . THR B 1 546 ? -7.075  72.614  23.927  1.00 85.29  ? 543 THR B N   1 
ATOM   8381 C CA  . THR B 1 546 ? -6.950  72.995  22.521  1.00 87.52  ? 543 THR B CA  1 
ATOM   8382 C C   . THR B 1 546 ? -6.534  71.818  21.644  1.00 79.11  ? 543 THR B C   1 
ATOM   8383 O O   . THR B 1 546 ? -7.262  70.832  21.527  1.00 73.39  ? 543 THR B O   1 
ATOM   8384 C CB  . THR B 1 546 ? -5.940  74.145  22.335  1.00 86.61  ? 543 THR B CB  1 
ATOM   8385 O OG1 . THR B 1 546 ? -6.286  75.232  23.203  1.00 82.95  ? 543 THR B OG1 1 
ATOM   8386 C CG2 . THR B 1 546 ? -5.953  74.632  20.896  1.00 79.60  ? 543 THR B CG2 1 
HETATM 8387 P P1  . VX  C 2 .   ? -27.440 95.203  -16.751 1.00 39.78  ? 601 VX  A P1  1 
HETATM 8388 O O1  . VX  C 2 .   ? -28.837 94.860  -17.208 1.00 33.21  ? 601 VX  A O1  1 
HETATM 8389 O O2  . VX  C 2 .   ? -27.465 95.743  -15.194 1.00 43.27  ? 601 VX  A O2  1 
HETATM 8390 C C1  . VX  C 2 .   ? -26.349 93.703  -16.874 1.00 31.66  ? 601 VX  A C1  1 
HETATM 8391 C C2  . VX  C 2 .   ? -28.200 95.013  -14.252 1.00 39.91  ? 601 VX  A C2  1 
HETATM 8392 C C3  . VX  C 2 .   ? -27.748 95.387  -12.842 1.00 42.27  ? 601 VX  A C3  1 
HETATM 8393 C CAI . PQV D 3 .   ? -24.201 90.870  -9.416  1.00 46.72  ? 602 PQV A CAI 1 
HETATM 8394 C CAF . PQV D 3 .   ? -24.324 92.151  -10.232 1.00 38.94  ? 602 PQV A CAF 1 
HETATM 8395 C CAD . PQV D 3 .   ? -24.802 93.268  -9.315  1.00 54.27  ? 602 PQV A CAD 1 
HETATM 8396 C CAE . PQV D 3 .   ? -26.326 93.296  -9.288  1.00 41.59  ? 602 PQV A CAE 1 
HETATM 8397 C CAG . PQV D 3 .   ? -26.883 91.912  -9.578  1.00 51.17  ? 602 PQV A CAG 1 
HETATM 8398 C CAJ . PQV D 3 .   ? -26.472 90.915  -8.507  1.00 58.28  ? 602 PQV A CAJ 1 
HETATM 8399 N NAO . PQV D 3 .   ? -25.034 90.926  -8.203  1.00 69.51  ? 602 PQV A NAO 1 
HETATM 8400 C CAK . PQV D 3 .   ? -24.747 89.768  -7.340  1.00 55.39  ? 602 PQV A CAK 1 
HETATM 8401 C CAH . PQV D 3 .   ? -24.992 90.109  -5.868  1.00 63.79  ? 602 PQV A CAH 1 
HETATM 8402 N NAM . PQV D 3 .   ? -26.052 89.262  -5.296  1.00 68.76  ? 602 PQV A NAM 1 
HETATM 8403 C CAN . PQV D 3 .   ? -27.327 89.675  -5.224  1.00 63.59  ? 602 PQV A CAN 1 
HETATM 8404 O OAA . PQV D 3 .   ? -27.717 90.768  -5.630  1.00 59.15  ? 602 PQV A OAA 1 
HETATM 8405 C CAC . PQV D 3 .   ? -28.305 88.688  -4.582  1.00 60.31  ? 602 PQV A CAC 1 
HETATM 8406 N NAL . PQV D 3 .   ? -27.756 87.565  -4.099  1.00 66.91  ? 602 PQV A NAL 1 
HETATM 8407 O OAB . PQV D 3 .   ? -28.663 86.607  -3.473  1.00 74.29  ? 602 PQV A OAB 1 
HETATM 8408 C C1  . GOL E 4 .   ? -30.153 99.157  -15.234 1.00 50.83  ? 603 GOL A C1  1 
HETATM 8409 O O1  . GOL E 4 .   ? -29.073 98.630  -15.973 1.00 43.16  ? 603 GOL A O1  1 
HETATM 8410 C C2  . GOL E 4 .   ? -29.822 99.110  -13.747 1.00 55.79  ? 603 GOL A C2  1 
HETATM 8411 O O2  . GOL E 4 .   ? -28.422 99.089  -13.571 1.00 46.39  ? 603 GOL A O2  1 
HETATM 8412 C C3  . GOL E 4 .   ? -30.433 97.856  -13.134 1.00 38.64  ? 603 GOL A C3  1 
HETATM 8413 O O3  . GOL E 4 .   ? -30.022 97.740  -11.790 1.00 52.80  ? 603 GOL A O3  1 
HETATM 8414 C C1  . GOL F 4 .   ? -30.698 108.210 -8.169  1.00 31.70  ? 604 GOL A C1  1 
HETATM 8415 O O1  . GOL F 4 .   ? -29.977 108.911 -7.182  1.00 38.76  ? 604 GOL A O1  1 
HETATM 8416 C C2  . GOL F 4 .   ? -31.171 109.173 -9.253  1.00 36.62  ? 604 GOL A C2  1 
HETATM 8417 O O2  . GOL F 4 .   ? -31.066 108.552 -10.514 1.00 38.70  ? 604 GOL A O2  1 
HETATM 8418 C C3  . GOL F 4 .   ? -30.312 110.431 -9.235  1.00 41.07  ? 604 GOL A C3  1 
HETATM 8419 O O3  . GOL F 4 .   ? -30.756 111.324 -10.231 1.00 46.86  ? 604 GOL A O3  1 
HETATM 8420 N N   . NO3 G 5 .   ? -13.959 108.488 -9.363  0.78 55.71  ? 605 NO3 A N   1 
HETATM 8421 O O1  . NO3 G 5 .   ? -14.041 107.467 -10.106 0.78 46.45  ? 605 NO3 A O1  1 
HETATM 8422 O O2  . NO3 G 5 .   ? -14.690 109.495 -9.589  0.78 47.04  ? 605 NO3 A O2  1 
HETATM 8423 O O3  . NO3 G 5 .   ? -13.145 108.502 -8.394  0.78 48.78  ? 605 NO3 A O3  1 
HETATM 8424 N N   . NO3 H 5 .   ? -49.804 73.763  -14.422 0.84 62.14  ? 606 NO3 A N   1 
HETATM 8425 O O1  . NO3 H 5 .   ? -49.629 73.185  -15.534 0.84 53.80  ? 606 NO3 A O1  1 
HETATM 8426 O O2  . NO3 H 5 .   ? -50.139 74.983  -14.389 0.84 56.69  ? 606 NO3 A O2  1 
HETATM 8427 O O3  . NO3 H 5 .   ? -49.643 73.123  -13.342 0.84 48.10  ? 606 NO3 A O3  1 
HETATM 8428 N N   . NO3 I 5 .   ? -26.158 89.731  -40.620 0.76 63.00  ? 607 NO3 A N   1 
HETATM 8429 O O1  . NO3 I 5 .   ? -25.909 89.356  -39.437 0.76 54.68  ? 607 NO3 A O1  1 
HETATM 8430 O O2  . NO3 I 5 .   ? -26.876 90.754  -40.820 0.76 54.60  ? 607 NO3 A O2  1 
HETATM 8431 O O3  . NO3 I 5 .   ? -25.688 89.085  -41.601 0.76 51.86  ? 607 NO3 A O3  1 
HETATM 8432 P P1  . VX  J 2 .   ? -34.017 83.867  19.177  1.00 40.24  ? 601 VX  B P1  1 
HETATM 8433 O O1  . VX  J 2 .   ? -34.291 85.289  19.605  1.00 33.57  ? 601 VX  B O1  1 
HETATM 8434 O O2  . VX  J 2 .   ? -34.718 83.555  17.719  1.00 40.07  ? 601 VX  B O2  1 
HETATM 8435 C C1  . VX  J 2 .   ? -32.185 83.566  19.089  1.00 32.57  ? 601 VX  B C1  1 
HETATM 8436 C C2  . VX  J 2 .   ? -34.761 84.580  16.767  1.00 42.08  ? 601 VX  B C2  1 
HETATM 8437 C C3  . VX  J 2 .   ? -33.672 84.361  15.721  1.00 36.79  ? 601 VX  B C3  1 
HETATM 8438 C CAI . PQV K 3 .   ? -28.803 83.339  11.860  1.00 42.01  ? 602 PQV B CAI 1 
HETATM 8439 C CAF . PQV K 3 .   ? -29.786 82.278  12.348  1.00 40.48  ? 602 PQV B CAF 1 
HETATM 8440 C CAD . PQV K 3 .   ? -31.229 82.778  12.321  1.00 46.98  ? 602 PQV B CAD 1 
HETATM 8441 C CAE . PQV K 3 .   ? -31.338 84.193  12.884  1.00 45.85  ? 602 PQV B CAE 1 
HETATM 8442 C CAG . PQV K 3 .   ? -30.729 85.209  11.914  1.00 48.22  ? 602 PQV B CAG 1 
HETATM 8443 C CAJ . PQV K 3 .   ? -30.479 84.532  10.578  1.00 49.15  ? 602 PQV B CAJ 1 
HETATM 8444 N NAO . PQV K 3 .   ? -29.158 83.885  10.538  1.00 69.81  ? 602 PQV B NAO 1 
HETATM 8445 C CAK . PQV K 3 .   ? -28.153 84.866  10.098  1.00 56.85  ? 602 PQV B CAK 1 
HETATM 8446 C CAH . PQV K 3 .   ? -27.942 84.734  8.585   1.00 56.64  ? 602 PQV B CAH 1 
HETATM 8447 N NAM . PQV K 3 .   ? -27.941 86.039  7.898   1.00 64.10  ? 602 PQV B NAM 1 
HETATM 8448 C CAN . PQV K 3 .   ? -29.011 86.852  7.841   1.00 62.01  ? 602 PQV B CAN 1 
HETATM 8449 O OAA . PQV K 3 .   ? -30.099 86.617  8.362   1.00 56.42  ? 602 PQV B OAA 1 
HETATM 8450 C CAC . PQV K 3 .   ? -28.801 88.143  7.050   1.00 59.03  ? 602 PQV B CAC 1 
HETATM 8451 N NAL . PQV K 3 .   ? -27.617 88.250  6.434   1.00 68.33  ? 602 PQV B NAL 1 
HETATM 8452 O OAB . PQV K 3 .   ? -27.386 89.466  5.661   1.00 70.74  ? 602 PQV B OAB 1 
HETATM 8453 C C1  . GOL L 4 .   ? -38.131 84.977  15.558  1.00 43.90  ? 603 GOL B C1  1 
HETATM 8454 O O1  . GOL L 4 .   ? -37.364 84.748  14.397  1.00 55.46  ? 603 GOL B O1  1 
HETATM 8455 C C2  . GOL L 4 .   ? -38.569 83.644  16.153  1.00 51.43  ? 603 GOL B C2  1 
HETATM 8456 O O2  . GOL L 4 .   ? -37.910 82.589  15.488  1.00 47.25  ? 603 GOL B O2  1 
HETATM 8457 C C3  . GOL L 4 .   ? -38.208 83.613  17.632  1.00 41.29  ? 603 GOL B C3  1 
HETATM 8458 O O3  . GOL L 4 .   ? -38.730 84.759  18.268  1.00 44.74  ? 603 GOL B O3  1 
HETATM 8459 C C1  . GOL M 4 .   ? -46.823 80.258  10.675  1.00 29.41  ? 604 GOL B C1  1 
HETATM 8460 O O1  . GOL M 4 .   ? -47.084 79.304  9.671   1.00 38.32  ? 604 GOL B O1  1 
HETATM 8461 C C2  . GOL M 4 .   ? -47.858 80.131  11.787  1.00 37.80  ? 604 GOL B C2  1 
HETATM 8462 O O2  . GOL M 4 .   ? -47.312 80.606  12.998  1.00 37.07  ? 604 GOL B O2  1 
HETATM 8463 C C3  . GOL M 4 .   ? -48.259 78.670  11.947  1.00 34.96  ? 604 GOL B C3  1 
HETATM 8464 O O3  . GOL M 4 .   ? -49.624 78.589  12.289  1.00 46.89  ? 604 GOL B O3  1 
HETATM 8465 O O   . HOH N 6 .   ? -34.109 66.046  -17.287 1.00 45.92  ? 701 HOH A O   1 
HETATM 8466 O O   . HOH N 6 .   ? -29.451 119.377 -8.171  1.00 35.80  ? 702 HOH A O   1 
HETATM 8467 O O   . HOH N 6 .   ? -22.206 86.567  -24.526 1.00 31.20  ? 703 HOH A O   1 
HETATM 8468 O O   . HOH N 6 .   ? -17.508 90.682  -13.424 1.00 35.74  ? 704 HOH A O   1 
HETATM 8469 O O   . HOH N 6 .   ? -1.611  93.684  -20.019 1.00 49.48  ? 705 HOH A O   1 
HETATM 8470 O O   . HOH N 6 .   ? -52.644 83.648  -29.473 1.00 47.77  ? 706 HOH A O   1 
HETATM 8471 O O   . HOH N 6 .   ? -62.775 96.157  -28.744 1.00 38.35  ? 707 HOH A O   1 
HETATM 8472 O O   . HOH N 6 .   ? -38.959 110.909 -21.841 1.00 34.55  ? 708 HOH A O   1 
HETATM 8473 O O   . HOH N 6 .   ? -45.295 107.762 -18.785 1.00 36.52  ? 709 HOH A O   1 
HETATM 8474 O O   . HOH N 6 .   ? -36.400 83.404  -11.539 1.00 25.26  ? 710 HOH A O   1 
HETATM 8475 O O   . HOH N 6 .   ? -51.197 93.233  -33.874 1.00 36.25  ? 711 HOH A O   1 
HETATM 8476 O O   . HOH N 6 .   ? -34.206 80.024  -29.064 1.00 50.89  ? 712 HOH A O   1 
HETATM 8477 O O   . HOH N 6 .   ? -30.950 93.792  -8.257  1.00 35.46  ? 713 HOH A O   1 
HETATM 8478 O O   . HOH N 6 .   ? -62.135 100.405 -20.451 1.00 38.28  ? 714 HOH A O   1 
HETATM 8479 O O   . HOH N 6 .   ? -5.353  106.531 -1.392  1.00 40.58  ? 715 HOH A O   1 
HETATM 8480 O O   . HOH N 6 .   ? -38.957 101.413 -8.541  1.00 29.44  ? 716 HOH A O   1 
HETATM 8481 O O   . HOH N 6 .   ? -25.526 102.581 -18.465 1.00 27.38  ? 717 HOH A O   1 
HETATM 8482 O O   . HOH N 6 .   ? -30.429 80.635  -19.333 1.00 23.78  ? 718 HOH A O   1 
HETATM 8483 O O   . HOH N 6 .   ? -31.275 103.095 2.899   1.00 32.91  ? 719 HOH A O   1 
HETATM 8484 O O   . HOH N 6 .   ? -24.944 121.511 -13.247 1.00 46.69  ? 720 HOH A O   1 
HETATM 8485 O O   . HOH N 6 .   ? -15.680 109.463 -12.926 1.00 44.01  ? 721 HOH A O   1 
HETATM 8486 O O   . HOH N 6 .   ? -34.767 98.060  -15.923 1.00 23.37  ? 722 HOH A O   1 
HETATM 8487 O O   . HOH N 6 .   ? -35.531 81.188  -10.267 1.00 34.53  ? 723 HOH A O   1 
HETATM 8488 O O   . HOH N 6 .   ? -49.762 88.936  -19.973 1.00 23.88  ? 724 HOH A O   1 
HETATM 8489 O O   . HOH N 6 .   ? -35.542 87.320  -11.263 1.00 20.56  ? 725 HOH A O   1 
HETATM 8490 O O   . HOH N 6 .   ? -23.230 118.871 -30.942 1.00 42.97  ? 726 HOH A O   1 
HETATM 8491 O O   . HOH N 6 .   ? -7.125  93.541  3.802   1.00 38.73  ? 727 HOH A O   1 
HETATM 8492 O O   . HOH N 6 .   ? -34.731 117.855 -27.166 1.00 38.53  ? 728 HOH A O   1 
HETATM 8493 O O   . HOH N 6 .   ? -44.368 95.097  -6.410  1.00 33.41  ? 729 HOH A O   1 
HETATM 8494 O O   . HOH N 6 .   ? -44.844 82.810  -16.781 1.00 28.81  ? 730 HOH A O   1 
HETATM 8495 O O   . HOH N 6 .   ? -5.990  87.626  -7.465  1.00 38.95  ? 731 HOH A O   1 
HETATM 8496 O O   . HOH N 6 .   ? -43.571 105.307 -13.626 1.00 27.50  ? 732 HOH A O   1 
HETATM 8497 O O   . HOH N 6 .   ? -36.288 93.866  -9.317  1.00 22.92  ? 733 HOH A O   1 
HETATM 8498 O O   . HOH N 6 .   ? -11.262 83.821  -11.184 1.00 41.86  ? 734 HOH A O   1 
HETATM 8499 O O   . HOH N 6 .   ? -12.322 93.936  -3.367  1.00 26.45  ? 735 HOH A O   1 
HETATM 8500 O O   . HOH N 6 .   ? -11.132 99.868  -27.561 1.00 40.88  ? 736 HOH A O   1 
HETATM 8501 O O   . HOH N 6 .   ? -17.339 117.002 -23.995 1.00 42.15  ? 737 HOH A O   1 
HETATM 8502 O O   . HOH N 6 .   ? -38.430 96.254  -11.624 1.00 27.17  ? 738 HOH A O   1 
HETATM 8503 O O   . HOH N 6 .   ? -11.622 101.461 -29.344 1.00 35.72  ? 739 HOH A O   1 
HETATM 8504 O O   . HOH N 6 .   ? -24.344 104.161 -21.771 1.00 26.48  ? 740 HOH A O   1 
HETATM 8505 O O   . HOH N 6 .   ? -48.263 79.827  -13.627 1.00 29.60  ? 741 HOH A O   1 
HETATM 8506 O O   . HOH N 6 .   ? -50.981 90.530  -21.919 1.00 24.51  ? 742 HOH A O   1 
HETATM 8507 O O   . HOH N 6 .   ? -56.840 86.934  -23.722 1.00 43.92  ? 743 HOH A O   1 
HETATM 8508 O O   . HOH N 6 .   ? -12.891 98.672  -32.058 1.00 31.35  ? 744 HOH A O   1 
HETATM 8509 O O   . HOH N 6 .   ? -20.986 101.341 -12.321 1.00 22.58  ? 745 HOH A O   1 
HETATM 8510 O O   . HOH N 6 .   ? -36.768 105.329 -36.010 1.00 38.01  ? 746 HOH A O   1 
HETATM 8511 O O   . HOH N 6 .   ? -38.769 97.943  -22.323 1.00 22.77  ? 747 HOH A O   1 
HETATM 8512 O O   . HOH N 6 .   ? -62.116 102.811 -20.165 1.00 43.60  ? 748 HOH A O   1 
HETATM 8513 O O   . HOH N 6 .   ? -6.030  88.416  -1.418  1.00 36.06  ? 749 HOH A O   1 
HETATM 8514 O O   . HOH N 6 .   ? -18.359 108.276 -32.937 1.00 34.34  ? 750 HOH A O   1 
HETATM 8515 O O   . HOH N 6 .   ? -42.078 104.431 -17.390 1.00 29.20  ? 751 HOH A O   1 
HETATM 8516 O O   . HOH N 6 .   ? -38.101 78.371  -22.088 1.00 33.99  ? 752 HOH A O   1 
HETATM 8517 O O   . HOH N 6 .   ? -48.488 83.852  -24.368 1.00 29.78  ? 753 HOH A O   1 
HETATM 8518 O O   . HOH N 6 .   ? -18.818 104.411 -39.035 1.00 36.72  ? 754 HOH A O   1 
HETATM 8519 O O   . HOH N 6 .   ? -42.805 81.848  -18.445 1.00 24.53  ? 755 HOH A O   1 
HETATM 8520 O O   . HOH N 6 .   ? -8.874  80.002  -17.245 1.00 52.46  ? 756 HOH A O   1 
HETATM 8521 O O   . HOH N 6 .   ? -9.286  100.791 -18.419 1.00 36.93  ? 757 HOH A O   1 
HETATM 8522 O O   . HOH N 6 .   ? -31.480 93.062  3.330   1.00 37.02  ? 758 HOH A O   1 
HETATM 8523 O O   . HOH N 6 .   ? -30.751 86.602  -15.299 1.00 25.44  ? 759 HOH A O   1 
HETATM 8524 O O   . HOH N 6 .   ? -20.847 116.861 -24.593 1.00 35.09  ? 760 HOH A O   1 
HETATM 8525 O O   . HOH N 6 .   ? -32.239 99.649  -18.442 1.00 26.79  ? 761 HOH A O   1 
HETATM 8526 O O   . HOH N 6 .   ? -53.276 109.721 -29.899 1.00 42.15  ? 762 HOH A O   1 
HETATM 8527 O O   . HOH N 6 .   ? -29.764 92.340  -3.453  1.00 41.79  ? 763 HOH A O   1 
HETATM 8528 O O   . HOH N 6 .   ? -23.130 87.826  -9.928  1.00 34.54  ? 764 HOH A O   1 
HETATM 8529 O O   . HOH N 6 .   ? -4.712  90.285  -32.275 1.00 41.60  ? 765 HOH A O   1 
HETATM 8530 O O   . HOH N 6 .   ? -52.212 112.241 -29.509 1.00 32.32  ? 766 HOH A O   1 
HETATM 8531 O O   . HOH N 6 .   ? -34.161 97.484  -1.107  1.00 33.47  ? 767 HOH A O   1 
HETATM 8532 O O   . HOH N 6 .   ? -40.834 102.664 -20.624 1.00 33.86  ? 768 HOH A O   1 
HETATM 8533 O O   . HOH N 6 .   ? -25.151 110.858 -14.180 1.00 30.30  ? 769 HOH A O   1 
HETATM 8534 O O   . HOH N 6 .   ? -28.900 70.045  -9.181  1.00 39.15  ? 770 HOH A O   1 
HETATM 8535 O O   . HOH N 6 .   ? -40.571 87.209  -15.103 1.00 23.82  ? 771 HOH A O   1 
HETATM 8536 O O   . HOH N 6 .   ? -15.383 101.207 -14.400 1.00 26.27  ? 772 HOH A O   1 
HETATM 8537 O O   . HOH N 6 .   ? -48.716 82.973  -10.995 1.00 31.27  ? 773 HOH A O   1 
HETATM 8538 O O   . HOH N 6 .   ? -32.568 95.923  -11.628 1.00 28.84  ? 774 HOH A O   1 
HETATM 8539 O O   . HOH N 6 .   ? -34.340 111.554 -10.778 1.00 43.49  ? 775 HOH A O   1 
HETATM 8540 O O   . HOH N 6 .   ? -45.900 108.198 -16.383 1.00 36.83  ? 776 HOH A O   1 
HETATM 8541 O O   . HOH N 6 .   ? -59.716 97.425  -19.240 1.00 37.83  ? 777 HOH A O   1 
HETATM 8542 O O   . HOH N 6 .   ? -47.034 77.398  -14.242 1.00 24.96  ? 778 HOH A O   1 
HETATM 8543 O O   . HOH N 6 .   ? -20.276 117.419 -15.799 1.00 39.88  ? 779 HOH A O   1 
HETATM 8544 O O   . HOH N 6 .   ? -53.869 99.622  -17.950 1.00 37.86  ? 780 HOH A O   1 
HETATM 8545 O O   . HOH N 6 .   ? -46.735 116.086 -27.449 1.00 33.03  ? 781 HOH A O   1 
HETATM 8546 O O   . HOH N 6 .   ? -37.340 104.644 -11.525 1.00 26.69  ? 782 HOH A O   1 
HETATM 8547 O O   . HOH N 6 .   ? -34.341 115.550 -7.926  1.00 37.02  ? 783 HOH A O   1 
HETATM 8548 O O   . HOH N 6 .   ? -40.023 80.105  -1.228  1.00 30.18  ? 784 HOH A O   1 
HETATM 8549 O O   . HOH N 6 .   ? -24.426 101.115 -43.811 1.00 44.69  ? 785 HOH A O   1 
HETATM 8550 O O   . HOH N 6 .   ? -2.800  105.189 -11.277 1.00 42.04  ? 786 HOH A O   1 
HETATM 8551 O O   . HOH N 6 .   ? -31.916 89.055  -0.772  1.00 32.77  ? 787 HOH A O   1 
HETATM 8552 O O   . HOH N 6 .   ? -14.832 91.614  -24.374 1.00 40.17  ? 788 HOH A O   1 
HETATM 8553 O O   . HOH N 6 .   ? -54.480 96.796  -19.449 1.00 39.81  ? 789 HOH A O   1 
HETATM 8554 O O   . HOH N 6 .   ? -35.475 119.128 -12.318 1.00 39.13  ? 790 HOH A O   1 
HETATM 8555 O O   . HOH N 6 .   ? -31.665 97.704  -1.957  1.00 27.52  ? 791 HOH A O   1 
HETATM 8556 O O   . HOH N 6 .   ? -55.278 89.266  -18.674 1.00 34.28  ? 792 HOH A O   1 
HETATM 8557 O O   . HOH N 6 .   ? -46.096 83.398  -6.369  1.00 34.00  ? 793 HOH A O   1 
HETATM 8558 O O   . HOH N 6 .   ? -45.006 118.373 -28.511 1.00 43.96  ? 794 HOH A O   1 
HETATM 8559 O O   . HOH N 6 .   ? -16.096 102.627 -17.508 1.00 30.09  ? 795 HOH A O   1 
HETATM 8560 O O   . HOH N 6 .   ? -47.529 98.322  -18.854 1.00 29.62  ? 796 HOH A O   1 
HETATM 8561 O O   . HOH N 6 .   ? -47.342 89.650  -6.435  1.00 40.23  ? 797 HOH A O   1 
HETATM 8562 O O   . HOH N 6 .   ? -39.693 88.988  -5.555  1.00 20.52  ? 798 HOH A O   1 
HETATM 8563 O O   . HOH N 6 .   ? -31.878 97.368  -7.605  1.00 31.33  ? 799 HOH A O   1 
HETATM 8564 O O   . HOH N 6 .   ? -40.493 96.516  -5.232  1.00 28.92  ? 800 HOH A O   1 
HETATM 8565 O O   . HOH N 6 .   ? -48.111 99.969  -38.026 1.00 37.50  ? 801 HOH A O   1 
HETATM 8566 O O   . HOH N 6 .   ? -13.458 105.309 -20.814 1.00 46.33  ? 802 HOH A O   1 
HETATM 8567 O O   . HOH N 6 .   ? -33.454 68.181  -10.065 1.00 42.83  ? 803 HOH A O   1 
HETATM 8568 O O   . HOH N 6 .   ? -39.956 117.957 -22.957 1.00 47.49  ? 804 HOH A O   1 
HETATM 8569 O O   . HOH N 6 .   ? -24.654 85.726  -16.556 1.00 23.22  ? 805 HOH A O   1 
HETATM 8570 O O   . HOH N 6 .   ? -23.999 107.120 3.590   1.00 35.79  ? 806 HOH A O   1 
HETATM 8571 O O   . HOH N 6 .   ? -12.003 85.900  -4.298  1.00 35.75  ? 807 HOH A O   1 
HETATM 8572 O O   . HOH N 6 .   ? -31.761 77.400  -17.439 1.00 32.68  ? 808 HOH A O   1 
HETATM 8573 O O   . HOH N 6 .   ? -33.368 92.509  -17.831 1.00 19.36  ? 809 HOH A O   1 
HETATM 8574 O O   . HOH N 6 .   ? -30.549 107.066 -14.962 1.00 33.03  ? 810 HOH A O   1 
HETATM 8575 O O   . HOH N 6 .   ? -19.323 93.742  -1.553  1.00 24.14  ? 811 HOH A O   1 
HETATM 8576 O O   . HOH N 6 .   ? -13.787 104.644 4.170   1.00 40.62  ? 812 HOH A O   1 
HETATM 8577 O O   . HOH N 6 .   ? -13.582 106.975 -36.192 1.00 40.19  ? 813 HOH A O   1 
HETATM 8578 O O   . HOH N 6 .   ? -14.614 104.067 -10.804 1.00 47.46  ? 814 HOH A O   1 
HETATM 8579 O O   . HOH N 6 .   ? -53.632 94.618  -31.375 1.00 30.50  ? 815 HOH A O   1 
HETATM 8580 O O   . HOH N 6 .   ? -39.737 103.794 -10.496 1.00 26.28  ? 816 HOH A O   1 
HETATM 8581 O O   . HOH N 6 .   ? -36.621 86.378  -3.717  1.00 30.39  ? 817 HOH A O   1 
HETATM 8582 O O   . HOH N 6 .   ? 1.787   102.013 -2.947  1.00 37.06  ? 818 HOH A O   1 
HETATM 8583 O O   . HOH N 6 .   ? -49.986 96.826  -9.383  1.00 33.44  ? 819 HOH A O   1 
HETATM 8584 O O   . HOH N 6 .   ? -41.406 93.534  -16.042 1.00 22.24  ? 820 HOH A O   1 
HETATM 8585 O O   . HOH N 6 .   ? -32.677 80.976  -22.163 1.00 27.69  ? 821 HOH A O   1 
HETATM 8586 O O   . HOH N 6 .   ? -47.810 70.947  -14.346 1.00 43.65  ? 822 HOH A O   1 
HETATM 8587 O O   . HOH N 6 .   ? -41.220 97.254  -35.054 1.00 26.16  ? 823 HOH A O   1 
HETATM 8588 O O   . HOH N 6 .   ? -17.171 108.930 -2.097  1.00 36.58  ? 824 HOH A O   1 
HETATM 8589 O O   . HOH N 6 .   ? -23.470 83.269  -16.503 1.00 32.95  ? 825 HOH A O   1 
HETATM 8590 O O   . HOH N 6 .   ? -36.431 90.271  -2.218  1.00 33.20  ? 826 HOH A O   1 
HETATM 8591 O O   . HOH N 6 .   ? -31.812 85.103  -13.712 1.00 27.61  ? 827 HOH A O   1 
HETATM 8592 O O   . HOH N 6 .   ? -46.132 92.186  -5.823  1.00 34.78  ? 828 HOH A O   1 
HETATM 8593 O O   . HOH N 6 .   ? -46.317 81.422  -23.229 1.00 32.27  ? 829 HOH A O   1 
HETATM 8594 O O   . HOH N 6 .   ? -37.644 85.849  -12.167 1.00 18.57  ? 830 HOH A O   1 
HETATM 8595 O O   . HOH N 6 .   ? -58.044 109.372 -19.884 1.00 37.57  ? 831 HOH A O   1 
HETATM 8596 O O   . HOH N 6 .   ? -24.825 106.425 -0.783  1.00 31.59  ? 832 HOH A O   1 
HETATM 8597 O O   . HOH N 6 .   ? -14.216 90.223  -21.791 1.00 35.63  ? 833 HOH A O   1 
HETATM 8598 O O   . HOH N 6 .   ? -29.699 86.000  -11.304 1.00 35.23  ? 834 HOH A O   1 
HETATM 8599 O O   . HOH N 6 .   ? -37.295 88.987  -4.152  1.00 23.75  ? 835 HOH A O   1 
HETATM 8600 O O   . HOH N 6 .   ? -12.431 102.467 3.402   1.00 32.47  ? 836 HOH A O   1 
HETATM 8601 O O   . HOH N 6 .   ? -34.687 97.394  -13.172 1.00 25.49  ? 837 HOH A O   1 
HETATM 8602 O O   . HOH N 6 .   ? -44.520 85.473  -16.684 1.00 26.43  ? 838 HOH A O   1 
HETATM 8603 O O   . HOH N 6 .   ? -42.211 107.714 -44.685 1.00 41.77  ? 839 HOH A O   1 
HETATM 8604 O O   . HOH N 6 .   ? -53.767 89.900  -21.453 1.00 38.31  ? 840 HOH A O   1 
HETATM 8605 O O   . HOH N 6 .   ? -52.968 93.487  -29.244 1.00 31.18  ? 841 HOH A O   1 
HETATM 8606 O O   . HOH N 6 .   ? -35.423 68.012  -4.348  1.00 34.89  ? 842 HOH A O   1 
HETATM 8607 O O   . HOH N 6 .   ? -51.949 91.514  -14.506 1.00 36.02  ? 843 HOH A O   1 
HETATM 8608 O O   . HOH N 6 .   ? -41.774 73.638  -3.333  1.00 41.13  ? 844 HOH A O   1 
HETATM 8609 O O   . HOH N 6 .   ? -3.556  84.538  -9.241  1.00 48.76  ? 845 HOH A O   1 
HETATM 8610 O O   . HOH N 6 .   ? -21.409 78.903  -20.540 1.00 34.82  ? 846 HOH A O   1 
HETATM 8611 O O   . HOH N 6 .   ? -15.192 85.231  -16.642 1.00 37.58  ? 847 HOH A O   1 
HETATM 8612 O O   . HOH N 6 .   ? -32.104 107.560 -0.583  1.00 29.67  ? 848 HOH A O   1 
HETATM 8613 O O   . HOH N 6 .   ? -20.341 110.861 -1.392  1.00 37.70  ? 849 HOH A O   1 
HETATM 8614 O O   . HOH N 6 .   ? -27.521 70.516  -11.516 1.00 35.72  ? 850 HOH A O   1 
HETATM 8615 O O   . HOH N 6 .   ? -21.628 95.564  0.487   1.00 39.42  ? 851 HOH A O   1 
HETATM 8616 O O   . HOH N 6 .   ? -43.272 86.577  -14.881 1.00 32.54  ? 852 HOH A O   1 
HETATM 8617 O O   . HOH N 6 .   ? -33.588 113.255 -9.073  1.00 49.18  ? 853 HOH A O   1 
HETATM 8618 O O   . HOH N 6 .   ? -17.836 83.060  -37.502 1.00 35.55  ? 854 HOH A O   1 
HETATM 8619 O O   . HOH N 6 .   ? -28.729 104.656 2.745   1.00 25.35  ? 855 HOH A O   1 
HETATM 8620 O O   . HOH N 6 .   ? -49.032 119.502 -20.405 1.00 36.78  ? 856 HOH A O   1 
HETATM 8621 O O   . HOH N 6 .   ? -49.410 85.531  -11.426 1.00 26.72  ? 857 HOH A O   1 
HETATM 8622 O O   . HOH N 6 .   ? -29.426 79.137  -17.195 1.00 30.07  ? 858 HOH A O   1 
HETATM 8623 O O   . HOH N 6 .   ? -14.824 100.461 -16.737 1.00 33.95  ? 859 HOH A O   1 
HETATM 8624 O O   . HOH N 6 .   ? -38.485 98.518  -3.200  1.00 40.82  ? 860 HOH A O   1 
HETATM 8625 O O   . HOH N 6 .   ? -56.726 111.627 -19.632 1.00 29.86  ? 861 HOH A O   1 
HETATM 8626 O O   . HOH N 6 .   ? -48.056 82.001  -8.473  1.00 33.48  ? 862 HOH A O   1 
HETATM 8627 O O   . HOH N 6 .   ? -23.045 107.749 0.649   1.00 36.30  ? 863 HOH A O   1 
HETATM 8628 O O   . HOH N 6 .   ? -33.571 95.426  -9.082  1.00 28.24  ? 864 HOH A O   1 
HETATM 8629 O O   . HOH N 6 .   ? -59.010 91.049  -22.661 1.00 41.32  ? 865 HOH A O   1 
HETATM 8630 O O   . HOH N 6 .   ? 1.273   90.245  -11.911 1.00 44.85  ? 866 HOH A O   1 
HETATM 8631 O O   . HOH N 6 .   ? -34.367 108.620 -9.962  1.00 37.36  ? 867 HOH A O   1 
HETATM 8632 O O   . HOH N 6 .   ? -6.716  101.896 -22.054 1.00 39.11  ? 868 HOH A O   1 
HETATM 8633 O O   . HOH N 6 .   ? -52.428 86.535  -12.127 1.00 43.72  ? 869 HOH A O   1 
HETATM 8634 O O   . HOH N 6 .   ? -54.338 86.461  -14.638 1.00 43.46  ? 870 HOH A O   1 
HETATM 8635 O O   . HOH N 6 .   ? -20.060 85.323  -27.179 1.00 38.06  ? 871 HOH A O   1 
HETATM 8636 O O   . HOH N 6 .   ? -40.948 119.411 -21.213 1.00 43.08  ? 872 HOH A O   1 
HETATM 8637 O O   . HOH N 6 .   ? -49.187 77.613  -10.210 1.00 44.84  ? 873 HOH A O   1 
HETATM 8638 O O   . HOH N 6 .   ? -36.060 120.379 -26.581 1.00 34.62  ? 874 HOH A O   1 
HETATM 8639 O O   . HOH N 6 .   ? -13.975 85.140  -19.169 1.00 48.85  ? 875 HOH A O   1 
HETATM 8640 O O   . HOH N 6 .   ? -41.425 90.793  -4.107  1.00 31.16  ? 876 HOH A O   1 
HETATM 8641 O O   . HOH N 6 .   ? -19.585 92.965  0.887   1.00 47.35  ? 877 HOH A O   1 
HETATM 8642 O O   . HOH N 6 .   ? -38.664 110.244 -41.022 1.00 34.82  ? 878 HOH A O   1 
HETATM 8643 O O   . HOH N 6 .   ? -36.439 107.070 -10.089 1.00 32.48  ? 879 HOH A O   1 
HETATM 8644 O O   . HOH N 6 .   ? -38.054 91.603  -0.831  1.00 30.62  ? 880 HOH A O   1 
HETATM 8645 O O   . HOH N 6 .   ? -40.452 91.996  -2.074  1.00 34.38  ? 881 HOH A O   1 
HETATM 8646 O O   . HOH O 6 .   ? -42.553 92.126  5.614   1.00 47.34  ? 701 HOH B O   1 
HETATM 8647 O O   . HOH O 6 .   ? -53.855 92.975  21.192  1.00 37.81  ? 702 HOH B O   1 
HETATM 8648 O O   . HOH O 6 .   ? -24.961 77.636  15.901  1.00 29.90  ? 703 HOH B O   1 
HETATM 8649 O O   . HOH O 6 .   ? -23.965 83.924  27.233  1.00 34.22  ? 704 HOH B O   1 
HETATM 8650 O O   . HOH O 6 .   ? -50.837 92.639  15.914  1.00 26.24  ? 705 HOH B O   1 
HETATM 8651 O O   . HOH O 6 .   ? -52.292 113.973 31.162  1.00 35.92  ? 706 HOH B O   1 
HETATM 8652 O O   . HOH O 6 .   ? -29.914 63.186  15.540  1.00 40.05  ? 707 HOH B O   1 
HETATM 8653 O O   . HOH O 6 .   ? -51.562 81.703  12.977  1.00 38.52  ? 708 HOH B O   1 
HETATM 8654 O O   . HOH O 6 .   ? -53.370 86.021  24.273  1.00 33.61  ? 709 HOH B O   1 
HETATM 8655 O O   . HOH O 6 .   ? -28.353 97.533  14.172  1.00 24.04  ? 710 HOH B O   1 
HETATM 8656 O O   . HOH O 6 .   ? -57.280 78.799  29.597  1.00 39.32  ? 711 HOH B O   1 
HETATM 8657 O O   . HOH O 6 .   ? -24.267 97.398  31.414  1.00 51.47  ? 712 HOH B O   1 
HETATM 8658 O O   . HOH O 6 .   ? -35.206 84.022  -1.447  1.00 43.33  ? 713 HOH B O   1 
HETATM 8659 O O   . HOH O 6 .   ? -52.216 95.564  14.639  1.00 42.86  ? 714 HOH B O   1 
HETATM 8660 O O   . HOH O 6 .   ? -31.250 109.657 15.998  1.00 32.63  ? 715 HOH B O   1 
HETATM 8661 O O   . HOH O 6 .   ? -31.202 94.755  13.617  1.00 17.89  ? 716 HOH B O   1 
HETATM 8662 O O   . HOH O 6 .   ? -32.806 59.066  3.886   1.00 36.75  ? 717 HOH B O   1 
HETATM 8663 O O   . HOH O 6 .   ? -44.139 105.386 36.274  1.00 44.58  ? 718 HOH B O   1 
HETATM 8664 O O   . HOH O 6 .   ? -39.682 78.505  20.728  1.00 29.04  ? 719 HOH B O   1 
HETATM 8665 O O   . HOH O 6 .   ? -59.498 99.235  32.195  1.00 42.21  ? 720 HOH B O   1 
HETATM 8666 O O   . HOH O 6 .   ? -55.754 73.516  10.400  1.00 41.27  ? 721 HOH B O   1 
HETATM 8667 O O   . HOH O 6 .   ? -29.836 69.579  34.457  1.00 33.04  ? 722 HOH B O   1 
HETATM 8668 O O   . HOH O 6 .   ? -45.168 90.834  10.941  1.00 27.90  ? 723 HOH B O   1 
HETATM 8669 O O   . HOH O 6 .   ? -42.527 98.513  8.871   1.00 34.86  ? 724 HOH B O   1 
HETATM 8670 O O   . HOH O 6 .   ? -28.104 109.831 16.621  1.00 30.67  ? 725 HOH B O   1 
HETATM 8671 O O   . HOH O 6 .   ? -42.884 83.243  -0.538  1.00 32.96  ? 726 HOH B O   1 
HETATM 8672 O O   . HOH O 6 .   ? -40.193 88.835  18.248  1.00 19.37  ? 727 HOH B O   1 
HETATM 8673 O O   . HOH O 6 .   ? -37.253 92.216  11.653  1.00 22.63  ? 728 HOH B O   1 
HETATM 8674 O O   . HOH O 6 .   ? -32.119 105.059 19.276  1.00 26.74  ? 729 HOH B O   1 
HETATM 8675 O O   . HOH O 6 .   ? -52.665 89.223  43.106  1.00 47.13  ? 730 HOH B O   1 
HETATM 8676 O O   . HOH O 6 .   ? -31.683 66.924  31.898  1.00 33.75  ? 731 HOH B O   1 
HETATM 8677 O O   . HOH O 6 .   ? -40.686 66.617  15.217  1.00 36.31  ? 732 HOH B O   1 
HETATM 8678 O O   . HOH O 6 .   ? -17.456 68.805  3.770   1.00 37.33  ? 733 HOH B O   1 
HETATM 8679 O O   . HOH O 6 .   ? -47.910 64.168  26.439  1.00 43.84  ? 734 HOH B O   1 
HETATM 8680 O O   . HOH O 6 .   ? -40.207 76.866  24.209  1.00 27.89  ? 735 HOH B O   1 
HETATM 8681 O O   . HOH O 6 .   ? -30.750 90.494  3.332   1.00 33.35  ? 736 HOH B O   1 
HETATM 8682 O O   . HOH O 6 .   ? -22.762 93.769  21.710  1.00 25.76  ? 737 HOH B O   1 
HETATM 8683 O O   . HOH O 6 .   ? -38.227 86.302  4.332   1.00 28.45  ? 738 HOH B O   1 
HETATM 8684 O O   . HOH O 6 .   ? -49.571 67.323  27.030  1.00 34.07  ? 739 HOH B O   1 
HETATM 8685 O O   . HOH O 6 .   ? -42.078 92.287  24.792  1.00 25.56  ? 740 HOH B O   1 
HETATM 8686 O O   . HOH O 6 .   ? -16.002 75.468  13.643  1.00 42.42  ? 741 HOH B O   1 
HETATM 8687 O O   . HOH O 6 .   ? -39.610 106.295 22.373  1.00 27.09  ? 742 HOH B O   1 
HETATM 8688 O O   . HOH O 6 .   ? -37.674 71.769  41.434  1.00 37.96  ? 743 HOH B O   1 
HETATM 8689 O O   . HOH O 6 .   ? -24.672 101.665 24.379  1.00 33.84  ? 744 HOH B O   1 
HETATM 8690 O O   . HOH O 6 .   ? -47.550 86.776  38.466  1.00 32.72  ? 745 HOH B O   1 
HETATM 8691 O O   . HOH O 6 .   ? -30.111 103.817 20.823  1.00 26.75  ? 746 HOH B O   1 
HETATM 8692 O O   . HOH O 6 .   ? -33.570 99.248  17.411  1.00 29.28  ? 747 HOH B O   1 
HETATM 8693 O O   . HOH O 6 .   ? -38.851 64.030  24.940  1.00 45.64  ? 748 HOH B O   1 
HETATM 8694 O O   . HOH O 6 .   ? -56.300 90.241  44.953  1.00 45.30  ? 749 HOH B O   1 
HETATM 8695 O O   . HOH O 6 .   ? -40.748 69.567  35.352  1.00 35.17  ? 750 HOH B O   1 
HETATM 8696 O O   . HOH O 6 .   ? -22.480 67.255  -1.554  1.00 36.97  ? 751 HOH B O   1 
HETATM 8697 O O   . HOH O 6 .   ? -34.770 70.278  20.030  1.00 33.24  ? 752 HOH B O   1 
HETATM 8698 O O   . HOH O 6 .   ? -34.233 88.482  -0.876  1.00 32.86  ? 753 HOH B O   1 
HETATM 8699 O O   . HOH O 6 .   ? -19.185 78.127  18.458  1.00 43.80  ? 754 HOH B O   1 
HETATM 8700 O O   . HOH O 6 .   ? -16.738 69.113  10.181  1.00 33.47  ? 755 HOH B O   1 
HETATM 8701 O O   . HOH O 6 .   ? -62.983 87.577  30.811  1.00 49.47  ? 756 HOH B O   1 
HETATM 8702 O O   . HOH O 6 .   ? -25.371 71.311  5.880   1.00 25.23  ? 757 HOH B O   1 
HETATM 8703 O O   . HOH O 6 .   ? -25.715 97.888  12.859  1.00 41.73  ? 758 HOH B O   1 
HETATM 8704 O O   . HOH O 6 .   ? -61.166 96.820  31.897  1.00 34.74  ? 759 HOH B O   1 
HETATM 8705 O O   . HOH O 6 .   ? -41.621 106.684 24.344  1.00 26.83  ? 760 HOH B O   1 
HETATM 8706 O O   . HOH O 6 .   ? -32.966 87.247  6.051   1.00 39.66  ? 761 HOH B O   1 
HETATM 8707 O O   . HOH O 6 .   ? -65.055 87.639  29.628  1.00 53.59  ? 762 HOH B O   1 
HETATM 8708 O O   . HOH O 6 .   ? -52.721 68.146  33.178  1.00 47.79  ? 763 HOH B O   1 
HETATM 8709 O O   . HOH O 6 .   ? -62.667 105.982 24.394  1.00 46.51  ? 764 HOH B O   1 
HETATM 8710 O O   . HOH O 6 .   ? -36.090 75.333  14.800  1.00 22.61  ? 765 HOH B O   1 
HETATM 8711 O O   . HOH O 6 .   ? -34.517 107.986 26.699  1.00 25.36  ? 766 HOH B O   1 
HETATM 8712 O O   . HOH O 6 .   ? -37.393 66.046  38.765  1.00 36.59  ? 767 HOH B O   1 
HETATM 8713 O O   . HOH O 6 .   ? -64.950 89.955  29.220  1.00 44.21  ? 768 HOH B O   1 
HETATM 8714 O O   . HOH O 6 .   ? -25.535 83.892  12.227  1.00 37.54  ? 769 HOH B O   1 
HETATM 8715 O O   . HOH O 6 .   ? -28.218 91.152  17.622  1.00 26.45  ? 770 HOH B O   1 
HETATM 8716 O O   . HOH O 6 .   ? -40.351 85.694  20.919  1.00 27.56  ? 771 HOH B O   1 
HETATM 8717 O O   . HOH O 6 .   ? -47.155 91.792  22.961  1.00 32.41  ? 772 HOH B O   1 
HETATM 8718 O O   . HOH O 6 .   ? -29.923 65.288  20.745  1.00 35.80  ? 773 HOH B O   1 
HETATM 8719 O O   . HOH O 6 .   ? -46.402 74.180  16.556  1.00 29.19  ? 774 HOH B O   1 
HETATM 8720 O O   . HOH O 6 .   ? -24.298 95.473  24.488  1.00 26.41  ? 775 HOH B O   1 
HETATM 8721 O O   . HOH O 6 .   ? -23.812 74.431  24.376  1.00 33.73  ? 776 HOH B O   1 
HETATM 8722 O O   . HOH O 6 .   ? -24.653 74.786  26.913  1.00 35.96  ? 777 HOH B O   1 
HETATM 8723 O O   . HOH O 6 .   ? -42.935 110.732 21.104  1.00 35.21  ? 778 HOH B O   1 
HETATM 8724 O O   . HOH O 6 .   ? -52.169 110.624 21.529  1.00 39.05  ? 779 HOH B O   1 
HETATM 8725 O O   . HOH O 6 .   ? -29.826 67.382  30.161  1.00 36.72  ? 780 HOH B O   1 
HETATM 8726 O O   . HOH O 6 .   ? -58.841 78.862  14.837  1.00 44.20  ? 781 HOH B O   1 
HETATM 8727 O O   . HOH O 6 .   ? -20.650 96.465  19.960  1.00 32.83  ? 782 HOH B O   1 
HETATM 8728 O O   . HOH O 6 .   ? -59.031 115.741 28.749  1.00 40.87  ? 783 HOH B O   1 
HETATM 8729 O O   . HOH O 6 .   ? -40.401 92.710  14.263  1.00 28.55  ? 784 HOH B O   1 
HETATM 8730 O O   . HOH O 6 .   ? -34.181 108.377 13.540  1.00 31.28  ? 785 HOH B O   1 
HETATM 8731 O O   . HOH O 6 .   ? -49.204 92.165  19.778  1.00 34.63  ? 786 HOH B O   1 
HETATM 8732 O O   . HOH O 6 .   ? -51.245 104.542 20.542  1.00 33.55  ? 787 HOH B O   1 
HETATM 8733 O O   . HOH O 6 .   ? -46.813 99.657  21.146  1.00 26.72  ? 788 HOH B O   1 
HETATM 8734 O O   . HOH O 6 .   ? -42.556 94.865  37.508  1.00 29.90  ? 789 HOH B O   1 
HETATM 8735 O O   . HOH O 6 .   ? -61.749 90.118  29.889  1.00 38.01  ? 790 HOH B O   1 
HETATM 8736 O O   . HOH O 6 .   ? -40.484 101.867 8.329   1.00 33.99  ? 791 HOH B O   1 
HETATM 8737 O O   . HOH O 6 .   ? -27.115 92.744  15.920  1.00 25.86  ? 792 HOH B O   1 
HETATM 8738 O O   . HOH O 6 .   ? -49.471 114.820 33.922  1.00 36.98  ? 793 HOH B O   1 
HETATM 8739 O O   . HOH O 6 .   ? -28.619 77.514  3.831   1.00 29.51  ? 794 HOH B O   1 
HETATM 8740 O O   . HOH O 6 .   ? -27.225 102.321 3.630   1.00 27.72  ? 795 HOH B O   1 
HETATM 8741 O O   . HOH O 6 .   ? -45.341 106.730 31.509  1.00 31.07  ? 796 HOH B O   1 
HETATM 8742 O O   . HOH O 6 .   ? -25.321 55.168  5.566   1.00 34.46  ? 797 HOH B O   1 
HETATM 8743 O O   . HOH O 6 .   ? -24.358 86.170  18.993  1.00 20.99  ? 798 HOH B O   1 
HETATM 8744 O O   . HOH O 6 .   ? -49.184 72.467  7.686   1.00 41.52  ? 799 HOH B O   1 
HETATM 8745 O O   . HOH O 6 .   ? -18.772 111.913 8.192   1.00 48.24  ? 800 HOH B O   1 
HETATM 8746 O O   . HOH O 6 .   ? -42.564 109.565 23.898  1.00 35.13  ? 801 HOH B O   1 
HETATM 8747 O O   . HOH O 6 .   ? -54.307 93.181  18.841  1.00 44.17  ? 802 HOH B O   1 
HETATM 8748 O O   . HOH O 6 .   ? -34.447 90.371  20.170  1.00 18.00  ? 803 HOH B O   1 
HETATM 8749 O O   . HOH O 6 .   ? -34.492 101.924 17.040  1.00 37.80  ? 804 HOH B O   1 
HETATM 8750 O O   . HOH O 6 .   ? -49.741 66.542  18.297  1.00 36.60  ? 805 HOH B O   1 
HETATM 8751 O O   . HOH O 6 .   ? -47.154 87.585  13.935  1.00 32.76  ? 806 HOH B O   1 
HETATM 8752 O O   . HOH O 6 .   ? -41.505 114.037 26.030  1.00 49.76  ? 807 HOH B O   1 
HETATM 8753 O O   . HOH O 6 .   ? -34.074 94.054  4.681   1.00 36.21  ? 808 HOH B O   1 
HETATM 8754 O O   . HOH O 6 .   ? -36.034 61.885  27.920  1.00 36.76  ? 809 HOH B O   1 
HETATM 8755 O O   . HOH O 6 .   ? -42.338 76.072  3.218   1.00 34.35  ? 810 HOH B O   1 
HETATM 8756 O O   . HOH O 6 .   ? -39.523 96.795  18.527  1.00 20.30  ? 811 HOH B O   1 
HETATM 8757 O O   . HOH O 6 .   ? -35.700 66.871  23.370  1.00 41.63  ? 812 HOH B O   1 
HETATM 8758 O O   . HOH O 6 .   ? -45.813 80.696  17.320  1.00 30.92  ? 813 HOH B O   1 
HETATM 8759 O O   . HOH O 6 .   ? -32.317 70.331  19.416  1.00 36.45  ? 814 HOH B O   1 
HETATM 8760 O O   . HOH O 6 .   ? -30.871 96.182  6.311   1.00 29.79  ? 815 HOH B O   1 
HETATM 8761 O O   . HOH O 6 .   ? -35.338 67.270  -1.651  1.00 34.35  ? 816 HOH B O   1 
HETATM 8762 O O   . HOH O 6 .   ? -55.051 79.995  10.193  1.00 41.46  ? 817 HOH B O   1 
HETATM 8763 O O   . HOH O 6 .   ? -48.545 71.128  9.760   1.00 37.47  ? 818 HOH B O   1 
HETATM 8764 O O   . HOH O 6 .   ? -30.996 97.351  14.477  1.00 20.82  ? 819 HOH B O   1 
HETATM 8765 O O   . HOH O 6 .   ? -33.131 70.308  17.000  1.00 34.18  ? 820 HOH B O   1 
HETATM 8766 O O   . HOH O 6 .   ? -41.674 94.552  7.540   1.00 28.34  ? 821 HOH B O   1 
HETATM 8767 O O   . HOH O 6 .   ? -31.487 107.149 25.733  1.00 36.43  ? 822 HOH B O   1 
HETATM 8768 O O   . HOH O 6 .   ? -34.579 97.680  7.909   1.00 21.23  ? 823 HOH B O   1 
HETATM 8769 O O   . HOH O 6 .   ? -47.525 90.220  12.899  1.00 25.44  ? 824 HOH B O   1 
HETATM 8770 O O   . HOH O 6 .   ? -38.158 86.537  10.014  1.00 31.16  ? 825 HOH B O   1 
HETATM 8771 O O   . HOH O 6 .   ? -31.284 78.510  2.121   1.00 36.34  ? 826 HOH B O   1 
HETATM 8772 O O   . HOH O 6 .   ? -42.594 74.864  -1.294  1.00 34.92  ? 827 HOH B O   1 
HETATM 8773 O O   . HOH O 6 .   ? -46.685 102.577 11.915  1.00 31.97  ? 828 HOH B O   1 
HETATM 8774 O O   . HOH O 6 .   ? -22.325 107.064 5.692   1.00 39.86  ? 829 HOH B O   1 
HETATM 8775 O O   . HOH O 6 .   ? -40.787 68.008  4.368   1.00 33.41  ? 830 HOH B O   1 
HETATM 8776 O O   . HOH O 6 .   ? -33.259 105.885 8.641   1.00 33.55  ? 831 HOH B O   1 
HETATM 8777 O O   . HOH O 6 .   ? -61.604 103.479 22.404  1.00 44.93  ? 832 HOH B O   1 
HETATM 8778 O O   . HOH O 6 .   ? -24.810 82.639  7.154   1.00 50.25  ? 833 HOH B O   1 
HETATM 8779 O O   . HOH O 6 .   ? -39.444 88.969  15.585  1.00 22.54  ? 834 HOH B O   1 
HETATM 8780 O O   . HOH O 6 .   ? -19.485 86.325  8.610   1.00 46.92  ? 835 HOH B O   1 
HETATM 8781 O O   . HOH O 6 .   ? -43.820 69.728  3.765   1.00 38.00  ? 836 HOH B O   1 
HETATM 8782 O O   . HOH O 6 .   ? -37.369 87.844  14.121  1.00 31.12  ? 837 HOH B O   1 
HETATM 8783 O O   . HOH O 6 .   ? -14.325 104.375 7.062   1.00 33.39  ? 838 HOH B O   1 
HETATM 8784 O O   . HOH O 6 .   ? -33.441 95.436  6.511   1.00 24.73  ? 839 HOH B O   1 
HETATM 8785 O O   . HOH O 6 .   ? -21.875 86.326  18.911  1.00 34.12  ? 840 HOH B O   1 
HETATM 8786 O O   . HOH O 6 .   ? -32.645 67.406  -0.983  1.00 34.13  ? 841 HOH B O   1 
HETATM 8787 O O   . HOH O 6 .   ? -43.150 106.900 17.077  1.00 34.64  ? 842 HOH B O   1 
HETATM 8788 O O   . HOH O 6 .   ? -46.037 73.167  5.092   1.00 37.57  ? 843 HOH B O   1 
HETATM 8789 O O   . HOH O 6 .   ? -46.581 106.748 33.754  1.00 37.65  ? 844 HOH B O   1 
HETATM 8790 O O   . HOH O 6 .   ? -18.722 81.429  39.961  1.00 34.29  ? 845 HOH B O   1 
HETATM 8791 O O   . HOH O 6 .   ? -47.070 81.663  2.994   1.00 33.88  ? 846 HOH B O   1 
HETATM 8792 O O   . HOH O 6 .   ? -16.868 86.779  22.861  1.00 37.97  ? 847 HOH B O   1 
HETATM 8793 O O   . HOH O 6 .   ? -32.312 62.190  28.026  1.00 39.12  ? 848 HOH B O   1 
HETATM 8794 O O   . HOH O 6 .   ? -27.093 90.417  13.692  1.00 36.02  ? 849 HOH B O   1 
HETATM 8795 O O   . HOH O 6 .   ? -42.859 80.239  -0.121  1.00 31.14  ? 850 HOH B O   1 
HETATM 8796 O O   . HOH O 6 .   ? -21.196 93.556  19.659  1.00 33.14  ? 851 HOH B O   1 
HETATM 8797 O O   . HOH O 6 .   ? -36.473 107.664 13.759  1.00 26.77  ? 852 HOH B O   1 
HETATM 8798 O O   . HOH O 6 .   ? -34.105 103.309 19.128  1.00 27.36  ? 853 HOH B O   1 
HETATM 8799 O O   . HOH O 6 .   ? -46.572 82.179  0.488   1.00 40.24  ? 854 HOH B O   1 
HETATM 8800 O O   . HOH O 6 .   ? -37.321 89.098  11.441  1.00 30.32  ? 855 HOH B O   1 
HETATM 8801 O O   . HOH O 6 .   ? -65.866 90.392  22.831  1.00 36.68  ? 856 HOH B O   1 
HETATM 8802 O O   . HOH O 6 .   ? -42.510 73.702  1.964   1.00 37.77  ? 857 HOH B O   1 
HETATM 8803 O O   . HOH O 6 .   ? -21.270 75.207  24.088  1.00 44.62  ? 858 HOH B O   1 
HETATM 8804 O O   . HOH O 6 .   ? -15.476 61.527  14.432  1.00 39.95  ? 859 HOH B O   1 
HETATM 8805 O O   . HOH O 6 .   ? -49.173 83.072  12.180  1.00 37.86  ? 860 HOH B O   1 
HETATM 8806 O O   . HOH O 6 .   ? -29.291 85.556  43.192  1.00 41.98  ? 861 HOH B O   1 
HETATM 8807 O O   . HOH O 6 .   ? -32.790 108.374 10.787  1.00 39.17  ? 862 HOH B O   1 
HETATM 8808 O O   . HOH O 6 .   ? -46.602 59.594  32.298  1.00 33.38  ? 863 HOH B O   1 
HETATM 8809 O O   . HOH O 6 .   ? -39.772 105.180 36.636  1.00 45.39  ? 864 HOH B O   1 
HETATM 8810 O O   . HOH O 6 .   ? -62.957 101.160 22.035  1.00 36.55  ? 865 HOH B O   1 
HETATM 8811 O O   . HOH O 6 .   ? -30.091 110.005 28.060  1.00 47.84  ? 866 HOH B O   1 
HETATM 8812 O O   . HOH O 6 .   ? -29.517 62.717  24.434  1.00 29.70  ? 867 HOH B O   1 
HETATM 8813 O O   . HOH O 6 .   ? -46.158 113.079 25.080  1.00 40.79  ? 868 HOH B O   1 
HETATM 8814 O O   . HOH O 6 .   ? -41.312 104.062 35.254  1.00 42.18  ? 869 HOH B O   1 
HETATM 8815 O O   . HOH O 6 .   ? -38.805 109.896 14.343  1.00 41.36  ? 870 HOH B O   1 
HETATM 8816 O O   . HOH O 6 .   ? -38.525 65.930  12.214  1.00 39.71  ? 871 HOH B O   1 
HETATM 8817 O O   . HOH O 6 .   ? -21.914 81.987  29.458  1.00 35.19  ? 872 HOH B O   1 
HETATM 8818 O O   . HOH O 6 .   ? -34.414 86.406  -2.159  1.00 39.16  ? 873 HOH B O   1 
HETATM 8819 O O   . HOH O 6 .   ? -48.822 85.564  12.692  1.00 33.71  ? 874 HOH B O   1 
HETATM 8820 O O   . HOH O 6 .   ? -29.690 111.257 12.294  1.00 44.29  ? 875 HOH B O   1 
HETATM 8821 O O   . HOH O 6 .   ? -18.546 77.669  20.814  1.00 44.37  ? 876 HOH B O   1 
HETATM 8822 O O   . HOH O 6 .   ? -60.086 78.852  28.826  1.00 39.53  ? 877 HOH B O   1 
HETATM 8823 O O   . HOH O 6 .   ? -37.063 98.473  6.420   1.00 30.90  ? 878 HOH B O   1 
HETATM 8824 O O   . HOH O 6 .   ? -44.609 72.240  3.400   1.00 49.45  ? 879 HOH B O   1 
HETATM 8825 O O   . HOH O 6 .   ? -52.129 122.354 29.480  1.00 38.39  ? 880 HOH B O   1 
HETATM 8826 O O   . HOH O 6 .   ? -36.066 94.826  3.450   1.00 26.19  ? 881 HOH B O   1 
HETATM 8827 O O   . HOH O 6 .   ? -52.814 86.318  43.272  1.00 38.32  ? 882 HOH B O   1 
HETATM 8828 O O   . HOH O 6 .   ? -56.852 85.885  40.098  1.00 39.11  ? 883 HOH B O   1 
HETATM 8829 O O   . HOH O 6 .   ? -45.120 75.670  -2.305  1.00 42.44  ? 884 HOH B O   1 
HETATM 8830 O O   . HOH O 6 .   ? -37.907 96.299  4.343   1.00 37.86  ? 885 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   LEU 3   0   ?   ?   ?   A . n 
A 1 4   GLU 4   1   ?   ?   ?   A . n 
A 1 5   GLY 5   2   ?   ?   ?   A . n 
A 1 6   ARG 6   3   ?   ?   ?   A . n 
A 1 7   GLU 7   4   4   GLU GLU A . n 
A 1 8   ASP 8   5   5   ASP ASP A . n 
A 1 9   ALA 9   6   6   ALA ALA A . n 
A 1 10  GLU 10  7   7   GLU GLU A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  LEU 12  9   9   LEU LEU A . n 
A 1 13  VAL 13  10  10  VAL VAL A . n 
A 1 14  THR 14  11  11  THR THR A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ARG 16  13  13  ARG ARG A . n 
A 1 17  GLY 17  14  14  GLY GLY A . n 
A 1 18  GLY 18  15  15  GLY GLY A . n 
A 1 19  ARG 19  16  16  ARG ARG A . n 
A 1 20  LEU 20  17  17  LEU LEU A . n 
A 1 21  ARG 21  18  18  ARG ARG A . n 
A 1 22  GLY 22  19  19  GLY GLY A . n 
A 1 23  ILE 23  20  20  ILE ILE A . n 
A 1 24  ARG 24  21  21  ARG ARG A . n 
A 1 25  LEU 25  22  22  LEU LEU A . n 
A 1 26  LYS 26  23  23  LYS LYS A . n 
A 1 27  THR 27  24  24  THR THR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  GLY 29  26  26  GLY GLY A . n 
A 1 30  GLY 30  27  27  GLY GLY A . n 
A 1 31  PRO 31  28  28  PRO PRO A . n 
A 1 32  VAL 32  29  29  VAL VAL A . n 
A 1 33  SER 33  30  30  SER SER A . n 
A 1 34  ALA 34  31  31  ALA ALA A . n 
A 1 35  PHE 35  32  32  PHE PHE A . n 
A 1 36  LEU 36  33  33  LEU LEU A . n 
A 1 37  GLY 37  34  34  GLY GLY A . n 
A 1 38  ILE 38  35  35  ILE ILE A . n 
A 1 39  PRO 39  36  36  PRO PRO A . n 
A 1 40  PHE 40  37  37  PHE PHE A . n 
A 1 41  ALA 41  38  38  ALA ALA A . n 
A 1 42  GLU 42  39  39  GLU GLU A . n 
A 1 43  PRO 43  40  40  PRO PRO A . n 
A 1 44  PRO 44  41  41  PRO PRO A . n 
A 1 45  MET 45  42  42  MET MET A . n 
A 1 46  GLY 46  43  43  GLY GLY A . n 
A 1 47  PRO 47  44  44  PRO PRO A . n 
A 1 48  ARG 48  45  45  ARG ARG A . n 
A 1 49  ARG 49  46  46  ARG ARG A . n 
A 1 50  PHE 50  47  47  PHE PHE A . n 
A 1 51  LEU 51  48  48  LEU LEU A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLU 54  51  51  GLU GLU A . n 
A 1 55  PRO 55  52  52  PRO PRO A . n 
A 1 56  LYS 56  53  53  LYS LYS A . n 
A 1 57  GLN 57  54  54  GLN GLN A . n 
A 1 58  PRO 58  55  55  PRO PRO A . n 
A 1 59  TRP 59  56  56  TRP TRP A . n 
A 1 60  SER 60  57  57  SER SER A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  VAL 63  60  60  VAL VAL A . n 
A 1 64  ASP 64  61  61  ASP ASP A . n 
A 1 65  ALA 65  62  62  ALA ALA A . n 
A 1 66  THR 66  63  63  THR THR A . n 
A 1 67  THR 67  64  64  THR THR A . n 
A 1 68  PHE 68  65  65  PHE PHE A . n 
A 1 69  GLN 69  66  66  GLN GLN A . n 
A 1 70  SER 70  67  67  SER SER A . n 
A 1 71  VAL 71  68  68  VAL VAL A . n 
A 1 72  CYS 72  69  69  CYS CYS A . n 
A 1 73  TYR 73  70  70  TYR TYR A . n 
A 1 74  GLN 74  71  71  GLN GLN A . n 
A 1 75  TYR 75  72  72  TYR TYR A . n 
A 1 76  VAL 76  73  73  VAL VAL A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  THR 78  75  75  THR THR A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  TYR 80  77  77  TYR TYR A . n 
A 1 81  PRO 81  78  78  PRO PRO A . n 
A 1 82  GLY 82  79  79  GLY GLY A . n 
A 1 83  PHE 83  80  80  PHE PHE A . n 
A 1 84  GLU 84  81  81  GLU GLU A . n 
A 1 85  GLY 85  82  82  GLY GLY A . n 
A 1 86  THR 86  83  83  THR THR A . n 
A 1 87  GLU 87  84  84  GLU GLU A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  TRP 89  86  86  TRP TRP A . n 
A 1 90  ASN 90  87  87  ASN ASN A . n 
A 1 91  PRO 91  88  88  PRO PRO A . n 
A 1 92  ASN 92  89  89  ASN ASN A . n 
A 1 93  ARG 93  90  90  ARG ARG A . n 
A 1 94  GLU 94  91  91  GLU GLU A . n 
A 1 95  LEU 95  92  92  LEU LEU A . n 
A 1 96  SER 96  93  93  SER SER A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ASP 98  95  95  ASP ASP A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 LEU 100 97  97  LEU LEU A . n 
A 1 101 TYR 101 98  98  TYR TYR A . n 
A 1 102 LEU 102 99  99  LEU LEU A . n 
A 1 103 ASN 103 100 100 ASN ASN A . n 
A 1 104 VAL 104 101 101 VAL VAL A . n 
A 1 105 TRP 105 102 102 TRP TRP A . n 
A 1 106 THR 106 103 103 THR THR A . n 
A 1 107 PRO 107 104 104 PRO PRO A . n 
A 1 108 TYR 108 105 105 TYR TYR A . n 
A 1 109 PRO 109 106 106 PRO PRO A . n 
A 1 110 ARG 110 107 107 ARG ARG A . n 
A 1 111 PRO 111 108 108 PRO PRO A . n 
A 1 112 THR 112 109 109 THR THR A . n 
A 1 113 SER 113 110 110 SER SER A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 THR 115 112 112 THR THR A . n 
A 1 116 PRO 116 113 113 PRO PRO A . n 
A 1 117 VAL 117 114 114 VAL VAL A . n 
A 1 118 LEU 118 115 115 LEU LEU A . n 
A 1 119 VAL 119 116 116 VAL VAL A . n 
A 1 120 TRP 120 117 117 TRP TRP A . n 
A 1 121 ILE 121 118 118 ILE ILE A . n 
A 1 122 TYR 122 119 119 TYR TYR A . n 
A 1 123 GLY 123 120 120 GLY GLY A . n 
A 1 124 GLY 124 121 121 GLY GLY A . n 
A 1 125 GLY 125 122 122 GLY GLY A . n 
A 1 126 PHE 126 123 123 PHE PHE A . n 
A 1 127 TYR 127 124 124 TYR TYR A . n 
A 1 128 SER 128 125 125 SER SER A . n 
A 1 129 GLY 129 126 126 GLY GLY A . n 
A 1 130 ALA 130 127 127 ALA ALA A . n 
A 1 131 SER 131 128 128 SER SER A . n 
A 1 132 SER 132 129 129 SER SER A . n 
A 1 133 LEU 133 130 130 LEU LEU A . n 
A 1 134 ASP 134 131 131 ASP ASP A . n 
A 1 135 VAL 135 132 132 VAL VAL A . n 
A 1 136 TYR 136 133 133 TYR TYR A . n 
A 1 137 ASP 137 134 134 ASP ASP A . n 
A 1 138 GLY 138 135 135 GLY GLY A . n 
A 1 139 ARG 139 136 136 ARG ARG A . n 
A 1 140 PHE 140 137 137 PHE PHE A . n 
A 1 141 LEU 141 138 138 LEU LEU A . n 
A 1 142 VAL 142 139 139 VAL VAL A . n 
A 1 143 GLN 143 140 140 GLN GLN A . n 
A 1 144 ALA 144 141 141 ALA ALA A . n 
A 1 145 GLU 145 142 142 GLU GLU A . n 
A 1 146 ARG 146 143 143 ARG ARG A . n 
A 1 147 THR 147 144 144 THR THR A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 LEU 149 146 146 LEU LEU A . n 
A 1 150 VAL 150 147 147 VAL VAL A . n 
A 1 151 SER 151 148 148 SER SER A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 ASN 153 150 150 ASN ASN A . n 
A 1 154 TYR 154 151 151 TYR TYR A . n 
A 1 155 ARG 155 152 152 ARG ARG A . n 
A 1 156 VAL 156 153 153 VAL VAL A . n 
A 1 157 GLY 157 154 154 GLY GLY A . n 
A 1 158 ALA 158 155 155 ALA ALA A . n 
A 1 159 PHE 159 156 156 PHE PHE A . n 
A 1 160 GLY 160 157 157 GLY GLY A . n 
A 1 161 PHE 161 158 158 PHE PHE A . n 
A 1 162 LEU 162 159 159 LEU LEU A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 LEU 164 161 161 LEU LEU A . n 
A 1 165 PRO 165 162 162 PRO PRO A . n 
A 1 166 GLY 166 163 163 GLY GLY A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ARG 168 165 165 ARG ARG A . n 
A 1 169 GLU 169 166 166 GLU GLU A . n 
A 1 170 ALA 170 167 167 ALA ALA A . n 
A 1 171 PRO 171 168 168 PRO PRO A . n 
A 1 172 GLY 172 169 169 GLY GLY A . n 
A 1 173 ASN 173 170 170 ASN ASN A . n 
A 1 174 VAL 174 171 171 VAL VAL A . n 
A 1 175 GLY 175 172 172 GLY GLY A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 LEU 177 174 174 LEU LEU A . n 
A 1 178 ASP 178 175 175 ASP ASP A . n 
A 1 179 GLN 179 176 176 GLN GLN A . n 
A 1 180 ARG 180 177 177 ARG ARG A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 ALA 182 179 179 ALA ALA A . n 
A 1 183 LEU 183 180 180 LEU LEU A . n 
A 1 184 GLN 184 181 181 GLN GLN A . n 
A 1 185 TRP 185 182 182 TRP TRP A . n 
A 1 186 VAL 186 183 183 VAL VAL A . n 
A 1 187 GLN 187 184 184 GLN GLN A . n 
A 1 188 GLU 188 185 185 GLU GLU A . n 
A 1 189 ASN 189 186 186 ASN ASN A . n 
A 1 190 VAL 190 187 187 VAL VAL A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 GLY 194 191 191 GLY GLY A . n 
A 1 195 GLY 195 192 192 GLY GLY A . n 
A 1 196 ASP 196 193 193 ASP ASP A . n 
A 1 197 PRO 197 194 194 PRO PRO A . n 
A 1 198 THR 198 195 195 THR THR A . n 
A 1 199 SER 199 196 196 SER SER A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 THR 201 198 198 THR THR A . n 
A 1 202 LEU 202 199 199 LEU LEU A . n 
A 1 203 PHE 203 200 200 PHE PHE A . n 
A 1 204 GLY 204 201 201 GLY GLY A . n 
A 1 205 GLU 205 202 202 GLU GLU A . n 
A 1 206 SER 206 203 203 SER SER A . n 
A 1 207 ALA 207 204 204 ALA ALA A . n 
A 1 208 GLY 208 205 205 GLY GLY A . n 
A 1 209 ALA 209 206 206 ALA ALA A . n 
A 1 210 ALA 210 207 207 ALA ALA A . n 
A 1 211 SER 211 208 208 SER SER A . n 
A 1 212 VAL 212 209 209 VAL VAL A . n 
A 1 213 GLY 213 210 210 GLY GLY A . n 
A 1 214 MET 214 211 211 MET MET A . n 
A 1 215 HIS 215 212 212 HIS HIS A . n 
A 1 216 LEU 216 213 213 LEU LEU A . n 
A 1 217 LEU 217 214 214 LEU LEU A . n 
A 1 218 SER 218 215 215 SER SER A . n 
A 1 219 PRO 219 216 216 PRO PRO A . n 
A 1 220 PRO 220 217 217 PRO PRO A . n 
A 1 221 SER 221 218 218 SER SER A . n 
A 1 222 ARG 222 219 219 ARG ARG A . n 
A 1 223 GLY 223 220 220 GLY GLY A . n 
A 1 224 LEU 224 221 221 LEU LEU A . n 
A 1 225 PHE 225 222 222 PHE PHE A . n 
A 1 226 HIS 226 223 223 HIS HIS A . n 
A 1 227 ARG 227 224 224 ARG ARG A . n 
A 1 228 ALA 228 225 225 ALA ALA A . n 
A 1 229 VAL 229 226 226 VAL VAL A . n 
A 1 230 LEU 230 227 227 LEU LEU A . n 
A 1 231 GLN 231 228 228 GLN GLN A . n 
A 1 232 SER 232 229 229 SER SER A . n 
A 1 233 GLY 233 230 230 GLY GLY A . n 
A 1 234 ALA 234 231 231 ALA ALA A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 GLY 237 234 234 GLY GLY A . n 
A 1 238 PRO 238 235 235 PRO PRO A . n 
A 1 239 TRP 239 236 236 TRP TRP A . n 
A 1 240 ALA 240 237 237 ALA ALA A . n 
A 1 241 THR 241 238 238 THR THR A . n 
A 1 242 VAL 242 239 239 VAL VAL A . n 
A 1 243 GLY 243 240 240 GLY GLY A . n 
A 1 244 MET 244 241 241 MET MET A . n 
A 1 245 GLY 245 242 242 GLY GLY A . n 
A 1 246 GLU 246 243 243 GLU GLU A . n 
A 1 247 ALA 247 244 244 ALA ALA A . n 
A 1 248 ARG 248 245 245 ARG ARG A . n 
A 1 249 ARG 249 246 246 ARG ARG A . n 
A 1 250 ARG 250 247 247 ARG ARG A . n 
A 1 251 ALA 251 248 248 ALA ALA A . n 
A 1 252 THR 252 249 249 THR THR A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 HIS 256 253 253 HIS HIS A . n 
A 1 257 LEU 257 254 254 LEU LEU A . n 
A 1 258 VAL 258 255 255 VAL VAL A . n 
A 1 259 GLY 259 256 256 GLY GLY A . n 
A 1 260 CYS 260 257 257 CYS CYS A . n 
A 1 261 PRO 261 258 258 PRO PRO A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 GLY 264 261 261 GLY GLY A . n 
A 1 265 THR 265 262 262 THR THR A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 GLY 267 264 264 GLY GLY A . n 
A 1 268 ASN 268 265 265 ASN ASN A . n 
A 1 269 ASP 269 266 266 ASP ASP A . n 
A 1 270 THR 270 267 267 THR THR A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 VAL 273 270 270 VAL VAL A . n 
A 1 274 ALA 274 271 271 ALA ALA A . n 
A 1 275 CYS 275 272 272 CYS CYS A . n 
A 1 276 LEU 276 273 273 LEU LEU A . n 
A 1 277 ARG 277 274 274 ARG ARG A . n 
A 1 278 THR 278 275 275 THR THR A . n 
A 1 279 ARG 279 276 276 ARG ARG A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 ALA 281 278 278 ALA ALA A . n 
A 1 282 GLN 282 279 279 GLN GLN A . n 
A 1 283 VAL 283 280 280 VAL VAL A . n 
A 1 284 LEU 284 281 281 LEU LEU A . n 
A 1 285 VAL 285 282 282 VAL VAL A . n 
A 1 286 ASN 286 283 283 ASN ASN A . n 
A 1 287 HIS 287 284 284 HIS HIS A . n 
A 1 288 GLU 288 285 285 GLU GLU A . n 
A 1 289 TRP 289 286 286 TRP TRP A . n 
A 1 290 HIS 290 287 287 HIS HIS A . n 
A 1 291 VAL 291 288 288 VAL VAL A . n 
A 1 292 LEU 292 289 289 LEU LEU A . n 
A 1 293 PRO 293 290 290 PRO PRO A . n 
A 1 294 GLN 294 291 291 GLN GLN A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 VAL 297 294 294 VAL VAL A . n 
A 1 298 PHE 298 295 295 PHE PHE A . n 
A 1 299 ARG 299 296 296 ARG ARG A . n 
A 1 300 PHE 300 297 297 PHE PHE A . n 
A 1 301 SER 301 298 298 SER SER A . n 
A 1 302 PHE 302 299 299 PHE PHE A . n 
A 1 303 VAL 303 300 300 VAL VAL A . n 
A 1 304 PRO 304 301 301 PRO PRO A . n 
A 1 305 VAL 305 302 302 VAL VAL A . n 
A 1 306 VAL 306 303 303 VAL VAL A . n 
A 1 307 ASP 307 304 304 ASP ASP A . n 
A 1 308 GLY 308 305 305 GLY GLY A . n 
A 1 309 ASP 309 306 306 ASP ASP A . n 
A 1 310 PHE 310 307 307 PHE PHE A . n 
A 1 311 LEU 311 308 308 LEU LEU A . n 
A 1 312 SER 312 309 309 SER SER A . n 
A 1 313 ASP 313 310 310 ASP ASP A . n 
A 1 314 THR 314 311 311 THR THR A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 GLU 316 313 313 GLU GLU A . n 
A 1 317 ALA 317 314 314 ALA ALA A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 ILE 319 316 316 ILE ILE A . n 
A 1 320 ASN 320 317 317 ASN ASN A . n 
A 1 321 ALA 321 318 318 ALA ALA A . n 
A 1 322 GLY 322 319 319 GLY GLY A . n 
A 1 323 ASP 323 320 320 ASP ASP A . n 
A 1 324 PHE 324 321 321 PHE PHE A . n 
A 1 325 HIS 325 322 322 HIS HIS A . n 
A 1 326 GLY 326 323 323 GLY GLY A . n 
A 1 327 LEU 327 324 324 LEU LEU A . n 
A 1 328 GLN 328 325 325 GLN GLN A . n 
A 1 329 VAL 329 326 326 VAL VAL A . n 
A 1 330 LEU 330 327 327 LEU LEU A . n 
A 1 331 VAL 331 328 328 VAL VAL A . n 
A 1 332 GLY 332 329 329 GLY GLY A . n 
A 1 333 VAL 333 330 330 VAL VAL A . n 
A 1 334 VAL 334 331 331 VAL VAL A . n 
A 1 335 LYS 335 332 332 LYS LYS A . n 
A 1 336 ASP 336 333 333 ASP ASP A . n 
A 1 337 GLU 337 334 334 GLU GLU A . n 
A 1 338 GLY 338 335 335 GLY GLY A . n 
A 1 339 SER 339 336 336 SER SER A . n 
A 1 340 TYR 340 337 337 TYR TYR A . n 
A 1 341 PHE 341 338 338 PHE PHE A . n 
A 1 342 LEU 342 339 339 LEU LEU A . n 
A 1 343 VAL 343 340 340 VAL VAL A . n 
A 1 344 TYR 344 341 341 TYR TYR A . n 
A 1 345 GLY 345 342 342 GLY GLY A . n 
A 1 346 ALA 346 343 343 ALA ALA A . n 
A 1 347 PRO 347 344 344 PRO PRO A . n 
A 1 348 GLY 348 345 345 GLY GLY A . n 
A 1 349 PHE 349 346 346 PHE PHE A . n 
A 1 350 SER 350 347 347 SER SER A . n 
A 1 351 LYS 351 348 348 LYS LYS A . n 
A 1 352 ASP 352 349 349 ASP ASP A . n 
A 1 353 ASN 353 350 350 ASN ASN A . n 
A 1 354 GLU 354 351 351 GLU GLU A . n 
A 1 355 SER 355 352 352 SER SER A . n 
A 1 356 LEU 356 353 353 LEU LEU A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 SER 358 355 355 SER SER A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ALA 360 357 357 ALA ALA A . n 
A 1 361 GLU 361 358 358 GLU GLU A . n 
A 1 362 PHE 362 359 359 PHE PHE A . n 
A 1 363 LEU 363 360 360 LEU LEU A . n 
A 1 364 ALA 364 361 361 ALA ALA A . n 
A 1 365 GLY 365 362 362 GLY GLY A . n 
A 1 366 VAL 366 363 363 VAL VAL A . n 
A 1 367 ARG 367 364 364 ARG ARG A . n 
A 1 368 VAL 368 365 365 VAL VAL A . n 
A 1 369 GLY 369 366 366 GLY GLY A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 PRO 371 368 368 PRO PRO A . n 
A 1 372 GLN 372 369 369 GLN GLN A . n 
A 1 373 VAL 373 370 370 VAL VAL A . n 
A 1 374 SER 374 371 371 SER SER A . n 
A 1 375 ASP 375 372 372 ASP ASP A . n 
A 1 376 LEU 376 373 373 LEU LEU A . n 
A 1 377 ALA 377 374 374 ALA ALA A . n 
A 1 378 ALA 378 375 375 ALA ALA A . n 
A 1 379 GLU 379 376 376 GLU GLU A . n 
A 1 380 ALA 380 377 377 ALA ALA A . n 
A 1 381 VAL 381 378 378 VAL VAL A . n 
A 1 382 VAL 382 379 379 VAL VAL A . n 
A 1 383 LEU 383 380 380 LEU LEU A . n 
A 1 384 HIS 384 381 381 HIS HIS A . n 
A 1 385 TYR 385 382 382 TYR TYR A . n 
A 1 386 THR 386 383 383 THR THR A . n 
A 1 387 ASP 387 384 384 ASP ASP A . n 
A 1 388 TRP 388 385 385 TRP TRP A . n 
A 1 389 LEU 389 386 386 LEU LEU A . n 
A 1 390 HIS 390 387 387 HIS HIS A . n 
A 1 391 PRO 391 388 388 PRO PRO A . n 
A 1 392 GLU 392 389 389 GLU GLU A . n 
A 1 393 ASP 393 390 390 ASP ASP A . n 
A 1 394 PRO 394 391 391 PRO PRO A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 ARG 396 393 393 ARG ARG A . n 
A 1 397 LEU 397 394 394 LEU LEU A . n 
A 1 398 ARG 398 395 395 ARG ARG A . n 
A 1 399 GLU 399 396 396 GLU GLU A . n 
A 1 400 ALA 400 397 397 ALA ALA A . n 
A 1 401 LEU 401 398 398 LEU LEU A . n 
A 1 402 SER 402 399 399 SER SER A . n 
A 1 403 ASP 403 400 400 ASP ASP A . n 
A 1 404 VAL 404 401 401 VAL VAL A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 GLY 406 403 403 GLY GLY A . n 
A 1 407 ASP 407 404 404 ASP ASP A . n 
A 1 408 HIS 408 405 405 HIS HIS A . n 
A 1 409 ASN 409 406 406 ASN ASN A . n 
A 1 410 VAL 410 407 407 VAL VAL A . n 
A 1 411 VAL 411 408 408 VAL VAL A . n 
A 1 412 CYS 412 409 409 CYS CYS A . n 
A 1 413 PRO 413 410 410 PRO PRO A . n 
A 1 414 VAL 414 411 411 VAL VAL A . n 
A 1 415 ALA 415 412 412 ALA ALA A . n 
A 1 416 GLN 416 413 413 GLN GLN A . n 
A 1 417 LEU 417 414 414 LEU LEU A . n 
A 1 418 ALA 418 415 415 ALA ALA A . n 
A 1 419 GLY 419 416 416 GLY GLY A . n 
A 1 420 ARG 420 417 417 ARG ARG A . n 
A 1 421 LEU 421 418 418 LEU LEU A . n 
A 1 422 ALA 422 419 419 ALA ALA A . n 
A 1 423 ALA 423 420 420 ALA ALA A . n 
A 1 424 GLN 424 421 421 GLN GLN A . n 
A 1 425 GLY 425 422 422 GLY GLY A . n 
A 1 426 ALA 426 423 423 ALA ALA A . n 
A 1 427 ARG 427 424 424 ARG ARG A . n 
A 1 428 VAL 428 425 425 VAL VAL A . n 
A 1 429 TYR 429 426 426 TYR TYR A . n 
A 1 430 ALA 430 427 427 ALA ALA A . n 
A 1 431 TYR 431 428 428 TYR TYR A . n 
A 1 432 VAL 432 429 429 VAL VAL A . n 
A 1 433 PHE 433 430 430 PHE PHE A . n 
A 1 434 GLU 434 431 431 GLU GLU A . n 
A 1 435 HIS 435 432 432 HIS HIS A . n 
A 1 436 ARG 436 433 433 ARG ARG A . n 
A 1 437 ALA 437 434 434 ALA ALA A . n 
A 1 438 SER 438 435 435 SER SER A . n 
A 1 439 THR 439 436 436 THR THR A . n 
A 1 440 LEU 440 437 437 LEU LEU A . n 
A 1 441 SER 441 438 438 SER SER A . n 
A 1 442 TRP 442 439 439 TRP TRP A . n 
A 1 443 PRO 443 440 440 PRO PRO A . n 
A 1 444 LEU 444 441 441 LEU LEU A . n 
A 1 445 TRP 445 442 442 TRP TRP A . n 
A 1 446 MET 446 443 443 MET MET A . n 
A 1 447 GLY 447 444 444 GLY GLY A . n 
A 1 448 VAL 448 445 445 VAL VAL A . n 
A 1 449 PRO 449 446 446 PRO PRO A . n 
A 1 450 HIS 450 447 447 HIS HIS A . n 
A 1 451 GLY 451 448 448 GLY GLY A . n 
A 1 452 TYR 452 449 449 TYR TYR A . n 
A 1 453 GLU 453 450 450 GLU GLU A . n 
A 1 454 ILE 454 451 451 ILE ILE A . n 
A 1 455 GLU 455 452 452 GLU GLU A . n 
A 1 456 PHE 456 453 453 PHE PHE A . n 
A 1 457 ILE 457 454 454 ILE ILE A . n 
A 1 458 PHE 458 455 455 PHE PHE A . n 
A 1 459 GLY 459 456 456 GLY GLY A . n 
A 1 460 ILE 460 457 457 ILE ILE A . n 
A 1 461 PRO 461 458 458 PRO PRO A . n 
A 1 462 LEU 462 459 459 LEU LEU A . n 
A 1 463 ASP 463 460 460 ASP ASP A . n 
A 1 464 PRO 464 461 461 PRO PRO A . n 
A 1 465 SER 465 462 462 SER SER A . n 
A 1 466 ARG 466 463 463 ARG ARG A . n 
A 1 467 ASN 467 464 464 ASN ASN A . n 
A 1 468 TYR 468 465 465 TYR TYR A . n 
A 1 469 THR 469 466 466 THR THR A . n 
A 1 470 ALA 470 467 467 ALA ALA A . n 
A 1 471 GLU 471 468 468 GLU GLU A . n 
A 1 472 GLU 472 469 469 GLU GLU A . n 
A 1 473 LYS 473 470 470 LYS LYS A . n 
A 1 474 ILE 474 471 471 ILE ILE A . n 
A 1 475 PHE 475 472 472 PHE PHE A . n 
A 1 476 ALA 476 473 473 ALA ALA A . n 
A 1 477 GLN 477 474 474 GLN GLN A . n 
A 1 478 ARG 478 475 475 ARG ARG A . n 
A 1 479 LEU 479 476 476 LEU LEU A . n 
A 1 480 MET 480 477 477 MET MET A . n 
A 1 481 ARG 481 478 478 ARG ARG A . n 
A 1 482 TYR 482 479 479 TYR TYR A . n 
A 1 483 TRP 483 480 480 TRP TRP A . n 
A 1 484 ALA 484 481 481 ALA ALA A . n 
A 1 485 ASN 485 482 482 ASN ASN A . n 
A 1 486 PHE 486 483 483 PHE PHE A . n 
A 1 487 ALA 487 484 484 ALA ALA A . n 
A 1 488 ARG 488 485 485 ARG ARG A . n 
A 1 489 THR 489 486 486 THR THR A . n 
A 1 490 GLY 490 487 487 GLY GLY A . n 
A 1 491 ASP 491 488 488 ASP ASP A . n 
A 1 492 PRO 492 489 489 PRO PRO A . n 
A 1 493 ASN 493 490 490 ASN ASN A . n 
A 1 494 GLU 494 491 491 GLU GLU A . n 
A 1 495 PRO 495 492 492 PRO PRO A . n 
A 1 496 ARG 496 493 493 ARG ARG A . n 
A 1 497 ASP 497 494 494 ASP ASP A . n 
A 1 498 PRO 498 495 495 PRO PRO A . n 
A 1 499 LYS 499 496 496 LYS LYS A . n 
A 1 500 ALA 500 497 497 ALA ALA A . n 
A 1 501 PRO 501 498 498 PRO PRO A . n 
A 1 502 GLN 502 499 499 GLN GLN A . n 
A 1 503 TRP 503 500 500 TRP TRP A . n 
A 1 504 PRO 504 501 501 PRO PRO A . n 
A 1 505 PRO 505 502 502 PRO PRO A . n 
A 1 506 TYR 506 503 503 TYR TYR A . n 
A 1 507 THR 507 504 504 THR THR A . n 
A 1 508 ALA 508 505 505 ALA ALA A . n 
A 1 509 GLY 509 506 506 GLY GLY A . n 
A 1 510 ALA 510 507 507 ALA ALA A . n 
A 1 511 GLN 511 508 508 GLN GLN A . n 
A 1 512 GLN 512 509 509 GLN GLN A . n 
A 1 513 TYR 513 510 510 TYR TYR A . n 
A 1 514 VAL 514 511 511 VAL VAL A . n 
A 1 515 SER 515 512 512 SER SER A . n 
A 1 516 LEU 516 513 513 LEU LEU A . n 
A 1 517 ASP 517 514 514 ASP ASP A . n 
A 1 518 LEU 518 515 515 LEU LEU A . n 
A 1 519 ARG 519 516 516 ARG ARG A . n 
A 1 520 PRO 520 517 517 PRO PRO A . n 
A 1 521 LEU 521 518 518 LEU LEU A . n 
A 1 522 GLU 522 519 519 GLU GLU A . n 
A 1 523 VAL 523 520 520 VAL VAL A . n 
A 1 524 ARG 524 521 521 ARG ARG A . n 
A 1 525 ARG 525 522 522 ARG ARG A . n 
A 1 526 GLY 526 523 523 GLY GLY A . n 
A 1 527 LEU 527 524 524 LEU LEU A . n 
A 1 528 ARG 528 525 525 ARG ARG A . n 
A 1 529 ALA 529 526 526 ALA ALA A . n 
A 1 530 GLN 530 527 527 GLN GLN A . n 
A 1 531 ALA 531 528 528 ALA ALA A . n 
A 1 532 CYS 532 529 529 CYS CYS A . n 
A 1 533 ALA 533 530 530 ALA ALA A . n 
A 1 534 PHE 534 531 531 PHE PHE A . n 
A 1 535 TRP 535 532 532 TRP TRP A . n 
A 1 536 ASN 536 533 533 ASN ASN A . n 
A 1 537 ARG 537 534 534 ARG ARG A . n 
A 1 538 PHE 538 535 535 PHE PHE A . n 
A 1 539 LEU 539 536 536 LEU LEU A . n 
A 1 540 PRO 540 537 537 PRO PRO A . n 
A 1 541 LYS 541 538 538 LYS LYS A . n 
A 1 542 LEU 542 539 539 LEU LEU A . n 
A 1 543 LEU 543 540 540 LEU LEU A . n 
A 1 544 SER 544 541 541 SER SER A . n 
A 1 545 ALA 545 542 542 ALA ALA A . n 
A 1 546 THR 546 543 543 THR THR A . n 
A 1 547 ASP 547 544 ?   ?   ?   A . n 
A 1 548 THR 548 545 ?   ?   ?   A . n 
A 1 549 LEU 549 546 ?   ?   ?   A . n 
A 1 550 ASP 550 547 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   LEU 3   0   ?   ?   ?   B . n 
B 1 4   GLU 4   1   ?   ?   ?   B . n 
B 1 5   GLY 5   2   ?   ?   ?   B . n 
B 1 6   ARG 6   3   ?   ?   ?   B . n 
B 1 7   GLU 7   4   4   GLU GLU B . n 
B 1 8   ASP 8   5   5   ASP ASP B . n 
B 1 9   ALA 9   6   6   ALA ALA B . n 
B 1 10  GLU 10  7   7   GLU GLU B . n 
B 1 11  LEU 11  8   8   LEU LEU B . n 
B 1 12  LEU 12  9   9   LEU LEU B . n 
B 1 13  VAL 13  10  10  VAL VAL B . n 
B 1 14  THR 14  11  11  THR THR B . n 
B 1 15  VAL 15  12  12  VAL VAL B . n 
B 1 16  ARG 16  13  13  ARG ARG B . n 
B 1 17  GLY 17  14  14  GLY GLY B . n 
B 1 18  GLY 18  15  15  GLY GLY B . n 
B 1 19  ARG 19  16  16  ARG ARG B . n 
B 1 20  LEU 20  17  17  LEU LEU B . n 
B 1 21  ARG 21  18  18  ARG ARG B . n 
B 1 22  GLY 22  19  19  GLY GLY B . n 
B 1 23  ILE 23  20  20  ILE ILE B . n 
B 1 24  ARG 24  21  21  ARG ARG B . n 
B 1 25  LEU 25  22  22  LEU LEU B . n 
B 1 26  LYS 26  23  23  LYS LYS B . n 
B 1 27  THR 27  24  24  THR THR B . n 
B 1 28  PRO 28  25  25  PRO PRO B . n 
B 1 29  GLY 29  26  26  GLY GLY B . n 
B 1 30  GLY 30  27  27  GLY GLY B . n 
B 1 31  PRO 31  28  28  PRO PRO B . n 
B 1 32  VAL 32  29  29  VAL VAL B . n 
B 1 33  SER 33  30  30  SER SER B . n 
B 1 34  ALA 34  31  31  ALA ALA B . n 
B 1 35  PHE 35  32  32  PHE PHE B . n 
B 1 36  LEU 36  33  33  LEU LEU B . n 
B 1 37  GLY 37  34  34  GLY GLY B . n 
B 1 38  ILE 38  35  35  ILE ILE B . n 
B 1 39  PRO 39  36  36  PRO PRO B . n 
B 1 40  PHE 40  37  37  PHE PHE B . n 
B 1 41  ALA 41  38  38  ALA ALA B . n 
B 1 42  GLU 42  39  39  GLU GLU B . n 
B 1 43  PRO 43  40  40  PRO PRO B . n 
B 1 44  PRO 44  41  41  PRO PRO B . n 
B 1 45  MET 45  42  42  MET MET B . n 
B 1 46  GLY 46  43  43  GLY GLY B . n 
B 1 47  PRO 47  44  44  PRO PRO B . n 
B 1 48  ARG 48  45  45  ARG ARG B . n 
B 1 49  ARG 49  46  46  ARG ARG B . n 
B 1 50  PHE 50  47  47  PHE PHE B . n 
B 1 51  LEU 51  48  48  LEU LEU B . n 
B 1 52  PRO 52  49  49  PRO PRO B . n 
B 1 53  PRO 53  50  50  PRO PRO B . n 
B 1 54  GLU 54  51  51  GLU GLU B . n 
B 1 55  PRO 55  52  52  PRO PRO B . n 
B 1 56  LYS 56  53  53  LYS LYS B . n 
B 1 57  GLN 57  54  54  GLN GLN B . n 
B 1 58  PRO 58  55  55  PRO PRO B . n 
B 1 59  TRP 59  56  56  TRP TRP B . n 
B 1 60  SER 60  57  57  SER SER B . n 
B 1 61  GLY 61  58  58  GLY GLY B . n 
B 1 62  VAL 62  59  59  VAL VAL B . n 
B 1 63  VAL 63  60  60  VAL VAL B . n 
B 1 64  ASP 64  61  61  ASP ASP B . n 
B 1 65  ALA 65  62  62  ALA ALA B . n 
B 1 66  THR 66  63  63  THR THR B . n 
B 1 67  THR 67  64  64  THR THR B . n 
B 1 68  PHE 68  65  65  PHE PHE B . n 
B 1 69  GLN 69  66  66  GLN GLN B . n 
B 1 70  SER 70  67  67  SER SER B . n 
B 1 71  VAL 71  68  68  VAL VAL B . n 
B 1 72  CYS 72  69  69  CYS CYS B . n 
B 1 73  TYR 73  70  70  TYR TYR B . n 
B 1 74  GLN 74  71  71  GLN GLN B . n 
B 1 75  TYR 75  72  72  TYR TYR B . n 
B 1 76  VAL 76  73  73  VAL VAL B . n 
B 1 77  ASP 77  74  74  ASP ASP B . n 
B 1 78  THR 78  75  75  THR THR B . n 
B 1 79  LEU 79  76  76  LEU LEU B . n 
B 1 80  TYR 80  77  77  TYR TYR B . n 
B 1 81  PRO 81  78  78  PRO PRO B . n 
B 1 82  GLY 82  79  79  GLY GLY B . n 
B 1 83  PHE 83  80  80  PHE PHE B . n 
B 1 84  GLU 84  81  81  GLU GLU B . n 
B 1 85  GLY 85  82  82  GLY GLY B . n 
B 1 86  THR 86  83  83  THR THR B . n 
B 1 87  GLU 87  84  84  GLU GLU B . n 
B 1 88  MET 88  85  85  MET MET B . n 
B 1 89  TRP 89  86  86  TRP TRP B . n 
B 1 90  ASN 90  87  87  ASN ASN B . n 
B 1 91  PRO 91  88  88  PRO PRO B . n 
B 1 92  ASN 92  89  89  ASN ASN B . n 
B 1 93  ARG 93  90  90  ARG ARG B . n 
B 1 94  GLU 94  91  91  GLU GLU B . n 
B 1 95  LEU 95  92  92  LEU LEU B . n 
B 1 96  SER 96  93  93  SER SER B . n 
B 1 97  GLU 97  94  94  GLU GLU B . n 
B 1 98  ASP 98  95  95  ASP ASP B . n 
B 1 99  CYS 99  96  96  CYS CYS B . n 
B 1 100 LEU 100 97  97  LEU LEU B . n 
B 1 101 TYR 101 98  98  TYR TYR B . n 
B 1 102 LEU 102 99  99  LEU LEU B . n 
B 1 103 ASN 103 100 100 ASN ASN B . n 
B 1 104 VAL 104 101 101 VAL VAL B . n 
B 1 105 TRP 105 102 102 TRP TRP B . n 
B 1 106 THR 106 103 103 THR THR B . n 
B 1 107 PRO 107 104 104 PRO PRO B . n 
B 1 108 TYR 108 105 105 TYR TYR B . n 
B 1 109 PRO 109 106 106 PRO PRO B . n 
B 1 110 ARG 110 107 107 ARG ARG B . n 
B 1 111 PRO 111 108 108 PRO PRO B . n 
B 1 112 THR 112 109 109 THR THR B . n 
B 1 113 SER 113 110 110 SER SER B . n 
B 1 114 PRO 114 111 111 PRO PRO B . n 
B 1 115 THR 115 112 112 THR THR B . n 
B 1 116 PRO 116 113 113 PRO PRO B . n 
B 1 117 VAL 117 114 114 VAL VAL B . n 
B 1 118 LEU 118 115 115 LEU LEU B . n 
B 1 119 VAL 119 116 116 VAL VAL B . n 
B 1 120 TRP 120 117 117 TRP TRP B . n 
B 1 121 ILE 121 118 118 ILE ILE B . n 
B 1 122 TYR 122 119 119 TYR TYR B . n 
B 1 123 GLY 123 120 120 GLY GLY B . n 
B 1 124 GLY 124 121 121 GLY GLY B . n 
B 1 125 GLY 125 122 122 GLY GLY B . n 
B 1 126 PHE 126 123 123 PHE PHE B . n 
B 1 127 TYR 127 124 124 TYR TYR B . n 
B 1 128 SER 128 125 125 SER SER B . n 
B 1 129 GLY 129 126 126 GLY GLY B . n 
B 1 130 ALA 130 127 127 ALA ALA B . n 
B 1 131 SER 131 128 128 SER SER B . n 
B 1 132 SER 132 129 129 SER SER B . n 
B 1 133 LEU 133 130 130 LEU LEU B . n 
B 1 134 ASP 134 131 131 ASP ASP B . n 
B 1 135 VAL 135 132 132 VAL VAL B . n 
B 1 136 TYR 136 133 133 TYR TYR B . n 
B 1 137 ASP 137 134 134 ASP ASP B . n 
B 1 138 GLY 138 135 135 GLY GLY B . n 
B 1 139 ARG 139 136 136 ARG ARG B . n 
B 1 140 PHE 140 137 137 PHE PHE B . n 
B 1 141 LEU 141 138 138 LEU LEU B . n 
B 1 142 VAL 142 139 139 VAL VAL B . n 
B 1 143 GLN 143 140 140 GLN GLN B . n 
B 1 144 ALA 144 141 141 ALA ALA B . n 
B 1 145 GLU 145 142 142 GLU GLU B . n 
B 1 146 ARG 146 143 143 ARG ARG B . n 
B 1 147 THR 147 144 144 THR THR B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 LEU 149 146 146 LEU LEU B . n 
B 1 150 VAL 150 147 147 VAL VAL B . n 
B 1 151 SER 151 148 148 SER SER B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 ASN 153 150 150 ASN ASN B . n 
B 1 154 TYR 154 151 151 TYR TYR B . n 
B 1 155 ARG 155 152 152 ARG ARG B . n 
B 1 156 VAL 156 153 153 VAL VAL B . n 
B 1 157 GLY 157 154 154 GLY GLY B . n 
B 1 158 ALA 158 155 155 ALA ALA B . n 
B 1 159 PHE 159 156 156 PHE PHE B . n 
B 1 160 GLY 160 157 157 GLY GLY B . n 
B 1 161 PHE 161 158 158 PHE PHE B . n 
B 1 162 LEU 162 159 159 LEU LEU B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 LEU 164 161 161 LEU LEU B . n 
B 1 165 PRO 165 162 162 PRO PRO B . n 
B 1 166 GLY 166 163 163 GLY GLY B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ARG 168 165 165 ARG ARG B . n 
B 1 169 GLU 169 166 166 GLU GLU B . n 
B 1 170 ALA 170 167 167 ALA ALA B . n 
B 1 171 PRO 171 168 168 PRO PRO B . n 
B 1 172 GLY 172 169 169 GLY GLY B . n 
B 1 173 ASN 173 170 170 ASN ASN B . n 
B 1 174 VAL 174 171 171 VAL VAL B . n 
B 1 175 GLY 175 172 172 GLY GLY B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 LEU 177 174 174 LEU LEU B . n 
B 1 178 ASP 178 175 175 ASP ASP B . n 
B 1 179 GLN 179 176 176 GLN GLN B . n 
B 1 180 ARG 180 177 177 ARG ARG B . n 
B 1 181 LEU 181 178 178 LEU LEU B . n 
B 1 182 ALA 182 179 179 ALA ALA B . n 
B 1 183 LEU 183 180 180 LEU LEU B . n 
B 1 184 GLN 184 181 181 GLN GLN B . n 
B 1 185 TRP 185 182 182 TRP TRP B . n 
B 1 186 VAL 186 183 183 VAL VAL B . n 
B 1 187 GLN 187 184 184 GLN GLN B . n 
B 1 188 GLU 188 185 185 GLU GLU B . n 
B 1 189 ASN 189 186 186 ASN ASN B . n 
B 1 190 VAL 190 187 187 VAL VAL B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 GLY 194 191 191 GLY GLY B . n 
B 1 195 GLY 195 192 192 GLY GLY B . n 
B 1 196 ASP 196 193 193 ASP ASP B . n 
B 1 197 PRO 197 194 194 PRO PRO B . n 
B 1 198 THR 198 195 195 THR THR B . n 
B 1 199 SER 199 196 196 SER SER B . n 
B 1 200 VAL 200 197 197 VAL VAL B . n 
B 1 201 THR 201 198 198 THR THR B . n 
B 1 202 LEU 202 199 199 LEU LEU B . n 
B 1 203 PHE 203 200 200 PHE PHE B . n 
B 1 204 GLY 204 201 201 GLY GLY B . n 
B 1 205 GLU 205 202 202 GLU GLU B . n 
B 1 206 SER 206 203 203 SER SER B . n 
B 1 207 ALA 207 204 204 ALA ALA B . n 
B 1 208 GLY 208 205 205 GLY GLY B . n 
B 1 209 ALA 209 206 206 ALA ALA B . n 
B 1 210 ALA 210 207 207 ALA ALA B . n 
B 1 211 SER 211 208 208 SER SER B . n 
B 1 212 VAL 212 209 209 VAL VAL B . n 
B 1 213 GLY 213 210 210 GLY GLY B . n 
B 1 214 MET 214 211 211 MET MET B . n 
B 1 215 HIS 215 212 212 HIS HIS B . n 
B 1 216 LEU 216 213 213 LEU LEU B . n 
B 1 217 LEU 217 214 214 LEU LEU B . n 
B 1 218 SER 218 215 215 SER SER B . n 
B 1 219 PRO 219 216 216 PRO PRO B . n 
B 1 220 PRO 220 217 217 PRO PRO B . n 
B 1 221 SER 221 218 218 SER SER B . n 
B 1 222 ARG 222 219 219 ARG ARG B . n 
B 1 223 GLY 223 220 220 GLY GLY B . n 
B 1 224 LEU 224 221 221 LEU LEU B . n 
B 1 225 PHE 225 222 222 PHE PHE B . n 
B 1 226 HIS 226 223 223 HIS HIS B . n 
B 1 227 ARG 227 224 224 ARG ARG B . n 
B 1 228 ALA 228 225 225 ALA ALA B . n 
B 1 229 VAL 229 226 226 VAL VAL B . n 
B 1 230 LEU 230 227 227 LEU LEU B . n 
B 1 231 GLN 231 228 228 GLN GLN B . n 
B 1 232 SER 232 229 229 SER SER B . n 
B 1 233 GLY 233 230 230 GLY GLY B . n 
B 1 234 ALA 234 231 231 ALA ALA B . n 
B 1 235 PRO 235 232 232 PRO PRO B . n 
B 1 236 ASN 236 233 233 ASN ASN B . n 
B 1 237 GLY 237 234 234 GLY GLY B . n 
B 1 238 PRO 238 235 235 PRO PRO B . n 
B 1 239 TRP 239 236 236 TRP TRP B . n 
B 1 240 ALA 240 237 237 ALA ALA B . n 
B 1 241 THR 241 238 238 THR THR B . n 
B 1 242 VAL 242 239 239 VAL VAL B . n 
B 1 243 GLY 243 240 240 GLY GLY B . n 
B 1 244 MET 244 241 241 MET MET B . n 
B 1 245 GLY 245 242 242 GLY GLY B . n 
B 1 246 GLU 246 243 243 GLU GLU B . n 
B 1 247 ALA 247 244 244 ALA ALA B . n 
B 1 248 ARG 248 245 245 ARG ARG B . n 
B 1 249 ARG 249 246 246 ARG ARG B . n 
B 1 250 ARG 250 247 247 ARG ARG B . n 
B 1 251 ALA 251 248 248 ALA ALA B . n 
B 1 252 THR 252 249 249 THR THR B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 HIS 256 253 253 HIS HIS B . n 
B 1 257 LEU 257 254 254 LEU LEU B . n 
B 1 258 VAL 258 255 255 VAL VAL B . n 
B 1 259 GLY 259 256 256 GLY GLY B . n 
B 1 260 CYS 260 257 257 CYS CYS B . n 
B 1 261 PRO 261 258 258 PRO PRO B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 GLY 263 260 260 GLY GLY B . n 
B 1 264 GLY 264 261 261 GLY GLY B . n 
B 1 265 THR 265 262 262 THR THR B . n 
B 1 266 GLY 266 263 263 GLY GLY B . n 
B 1 267 GLY 267 264 264 GLY GLY B . n 
B 1 268 ASN 268 265 265 ASN ASN B . n 
B 1 269 ASP 269 266 266 ASP ASP B . n 
B 1 270 THR 270 267 267 THR THR B . n 
B 1 271 GLU 271 268 268 GLU GLU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 VAL 273 270 270 VAL VAL B . n 
B 1 274 ALA 274 271 271 ALA ALA B . n 
B 1 275 CYS 275 272 272 CYS CYS B . n 
B 1 276 LEU 276 273 273 LEU LEU B . n 
B 1 277 ARG 277 274 274 ARG ARG B . n 
B 1 278 THR 278 275 275 THR THR B . n 
B 1 279 ARG 279 276 276 ARG ARG B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 ALA 281 278 278 ALA ALA B . n 
B 1 282 GLN 282 279 279 GLN GLN B . n 
B 1 283 VAL 283 280 280 VAL VAL B . n 
B 1 284 LEU 284 281 281 LEU LEU B . n 
B 1 285 VAL 285 282 282 VAL VAL B . n 
B 1 286 ASN 286 283 283 ASN ASN B . n 
B 1 287 HIS 287 284 284 HIS HIS B . n 
B 1 288 GLU 288 285 285 GLU GLU B . n 
B 1 289 TRP 289 286 286 TRP TRP B . n 
B 1 290 HIS 290 287 287 HIS HIS B . n 
B 1 291 VAL 291 288 288 VAL VAL B . n 
B 1 292 LEU 292 289 289 LEU LEU B . n 
B 1 293 PRO 293 290 290 PRO PRO B . n 
B 1 294 GLN 294 291 291 GLN GLN B . n 
B 1 295 GLU 295 292 292 GLU GLU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 VAL 297 294 294 VAL VAL B . n 
B 1 298 PHE 298 295 295 PHE PHE B . n 
B 1 299 ARG 299 296 296 ARG ARG B . n 
B 1 300 PHE 300 297 297 PHE PHE B . n 
B 1 301 SER 301 298 298 SER SER B . n 
B 1 302 PHE 302 299 299 PHE PHE B . n 
B 1 303 VAL 303 300 300 VAL VAL B . n 
B 1 304 PRO 304 301 301 PRO PRO B . n 
B 1 305 VAL 305 302 302 VAL VAL B . n 
B 1 306 VAL 306 303 303 VAL VAL B . n 
B 1 307 ASP 307 304 304 ASP ASP B . n 
B 1 308 GLY 308 305 305 GLY GLY B . n 
B 1 309 ASP 309 306 306 ASP ASP B . n 
B 1 310 PHE 310 307 307 PHE PHE B . n 
B 1 311 LEU 311 308 308 LEU LEU B . n 
B 1 312 SER 312 309 309 SER SER B . n 
B 1 313 ASP 313 310 310 ASP ASP B . n 
B 1 314 THR 314 311 311 THR THR B . n 
B 1 315 PRO 315 312 312 PRO PRO B . n 
B 1 316 GLU 316 313 313 GLU GLU B . n 
B 1 317 ALA 317 314 314 ALA ALA B . n 
B 1 318 LEU 318 315 315 LEU LEU B . n 
B 1 319 ILE 319 316 316 ILE ILE B . n 
B 1 320 ASN 320 317 317 ASN ASN B . n 
B 1 321 ALA 321 318 318 ALA ALA B . n 
B 1 322 GLY 322 319 319 GLY GLY B . n 
B 1 323 ASP 323 320 320 ASP ASP B . n 
B 1 324 PHE 324 321 321 PHE PHE B . n 
B 1 325 HIS 325 322 322 HIS HIS B . n 
B 1 326 GLY 326 323 323 GLY GLY B . n 
B 1 327 LEU 327 324 324 LEU LEU B . n 
B 1 328 GLN 328 325 325 GLN GLN B . n 
B 1 329 VAL 329 326 326 VAL VAL B . n 
B 1 330 LEU 330 327 327 LEU LEU B . n 
B 1 331 VAL 331 328 328 VAL VAL B . n 
B 1 332 GLY 332 329 329 GLY GLY B . n 
B 1 333 VAL 333 330 330 VAL VAL B . n 
B 1 334 VAL 334 331 331 VAL VAL B . n 
B 1 335 LYS 335 332 332 LYS LYS B . n 
B 1 336 ASP 336 333 333 ASP ASP B . n 
B 1 337 GLU 337 334 334 GLU GLU B . n 
B 1 338 GLY 338 335 335 GLY GLY B . n 
B 1 339 SER 339 336 336 SER SER B . n 
B 1 340 TYR 340 337 337 TYR TYR B . n 
B 1 341 PHE 341 338 338 PHE PHE B . n 
B 1 342 LEU 342 339 339 LEU LEU B . n 
B 1 343 VAL 343 340 340 VAL VAL B . n 
B 1 344 TYR 344 341 341 TYR TYR B . n 
B 1 345 GLY 345 342 342 GLY GLY B . n 
B 1 346 ALA 346 343 343 ALA ALA B . n 
B 1 347 PRO 347 344 344 PRO PRO B . n 
B 1 348 GLY 348 345 345 GLY GLY B . n 
B 1 349 PHE 349 346 346 PHE PHE B . n 
B 1 350 SER 350 347 347 SER SER B . n 
B 1 351 LYS 351 348 348 LYS LYS B . n 
B 1 352 ASP 352 349 349 ASP ASP B . n 
B 1 353 ASN 353 350 350 ASN ASN B . n 
B 1 354 GLU 354 351 351 GLU GLU B . n 
B 1 355 SER 355 352 352 SER SER B . n 
B 1 356 LEU 356 353 353 LEU LEU B . n 
B 1 357 ILE 357 354 354 ILE ILE B . n 
B 1 358 SER 358 355 355 SER SER B . n 
B 1 359 ARG 359 356 356 ARG ARG B . n 
B 1 360 ALA 360 357 357 ALA ALA B . n 
B 1 361 GLU 361 358 358 GLU GLU B . n 
B 1 362 PHE 362 359 359 PHE PHE B . n 
B 1 363 LEU 363 360 360 LEU LEU B . n 
B 1 364 ALA 364 361 361 ALA ALA B . n 
B 1 365 GLY 365 362 362 GLY GLY B . n 
B 1 366 VAL 366 363 363 VAL VAL B . n 
B 1 367 ARG 367 364 364 ARG ARG B . n 
B 1 368 VAL 368 365 365 VAL VAL B . n 
B 1 369 GLY 369 366 366 GLY GLY B . n 
B 1 370 VAL 370 367 367 VAL VAL B . n 
B 1 371 PRO 371 368 368 PRO PRO B . n 
B 1 372 GLN 372 369 369 GLN GLN B . n 
B 1 373 VAL 373 370 370 VAL VAL B . n 
B 1 374 SER 374 371 371 SER SER B . n 
B 1 375 ASP 375 372 372 ASP ASP B . n 
B 1 376 LEU 376 373 373 LEU LEU B . n 
B 1 377 ALA 377 374 374 ALA ALA B . n 
B 1 378 ALA 378 375 375 ALA ALA B . n 
B 1 379 GLU 379 376 376 GLU GLU B . n 
B 1 380 ALA 380 377 377 ALA ALA B . n 
B 1 381 VAL 381 378 378 VAL VAL B . n 
B 1 382 VAL 382 379 379 VAL VAL B . n 
B 1 383 LEU 383 380 380 LEU LEU B . n 
B 1 384 HIS 384 381 381 HIS HIS B . n 
B 1 385 TYR 385 382 382 TYR TYR B . n 
B 1 386 THR 386 383 383 THR THR B . n 
B 1 387 ASP 387 384 384 ASP ASP B . n 
B 1 388 TRP 388 385 385 TRP TRP B . n 
B 1 389 LEU 389 386 386 LEU LEU B . n 
B 1 390 HIS 390 387 387 HIS HIS B . n 
B 1 391 PRO 391 388 388 PRO PRO B . n 
B 1 392 GLU 392 389 389 GLU GLU B . n 
B 1 393 ASP 393 390 390 ASP ASP B . n 
B 1 394 PRO 394 391 391 PRO PRO B . n 
B 1 395 ALA 395 392 392 ALA ALA B . n 
B 1 396 ARG 396 393 393 ARG ARG B . n 
B 1 397 LEU 397 394 394 LEU LEU B . n 
B 1 398 ARG 398 395 395 ARG ARG B . n 
B 1 399 GLU 399 396 396 GLU GLU B . n 
B 1 400 ALA 400 397 397 ALA ALA B . n 
B 1 401 LEU 401 398 398 LEU LEU B . n 
B 1 402 SER 402 399 399 SER SER B . n 
B 1 403 ASP 403 400 400 ASP ASP B . n 
B 1 404 VAL 404 401 401 VAL VAL B . n 
B 1 405 VAL 405 402 402 VAL VAL B . n 
B 1 406 GLY 406 403 403 GLY GLY B . n 
B 1 407 ASP 407 404 404 ASP ASP B . n 
B 1 408 HIS 408 405 405 HIS HIS B . n 
B 1 409 ASN 409 406 406 ASN ASN B . n 
B 1 410 VAL 410 407 407 VAL VAL B . n 
B 1 411 VAL 411 408 408 VAL VAL B . n 
B 1 412 CYS 412 409 409 CYS CYS B . n 
B 1 413 PRO 413 410 410 PRO PRO B . n 
B 1 414 VAL 414 411 411 VAL VAL B . n 
B 1 415 ALA 415 412 412 ALA ALA B . n 
B 1 416 GLN 416 413 413 GLN GLN B . n 
B 1 417 LEU 417 414 414 LEU LEU B . n 
B 1 418 ALA 418 415 415 ALA ALA B . n 
B 1 419 GLY 419 416 416 GLY GLY B . n 
B 1 420 ARG 420 417 417 ARG ARG B . n 
B 1 421 LEU 421 418 418 LEU LEU B . n 
B 1 422 ALA 422 419 419 ALA ALA B . n 
B 1 423 ALA 423 420 420 ALA ALA B . n 
B 1 424 GLN 424 421 421 GLN GLN B . n 
B 1 425 GLY 425 422 422 GLY GLY B . n 
B 1 426 ALA 426 423 423 ALA ALA B . n 
B 1 427 ARG 427 424 424 ARG ARG B . n 
B 1 428 VAL 428 425 425 VAL VAL B . n 
B 1 429 TYR 429 426 426 TYR TYR B . n 
B 1 430 ALA 430 427 427 ALA ALA B . n 
B 1 431 TYR 431 428 428 TYR TYR B . n 
B 1 432 VAL 432 429 429 VAL VAL B . n 
B 1 433 PHE 433 430 430 PHE PHE B . n 
B 1 434 GLU 434 431 431 GLU GLU B . n 
B 1 435 HIS 435 432 432 HIS HIS B . n 
B 1 436 ARG 436 433 433 ARG ARG B . n 
B 1 437 ALA 437 434 434 ALA ALA B . n 
B 1 438 SER 438 435 435 SER SER B . n 
B 1 439 THR 439 436 436 THR THR B . n 
B 1 440 LEU 440 437 437 LEU LEU B . n 
B 1 441 SER 441 438 438 SER SER B . n 
B 1 442 TRP 442 439 439 TRP TRP B . n 
B 1 443 PRO 443 440 440 PRO PRO B . n 
B 1 444 LEU 444 441 441 LEU LEU B . n 
B 1 445 TRP 445 442 442 TRP TRP B . n 
B 1 446 MET 446 443 443 MET MET B . n 
B 1 447 GLY 447 444 444 GLY GLY B . n 
B 1 448 VAL 448 445 445 VAL VAL B . n 
B 1 449 PRO 449 446 446 PRO PRO B . n 
B 1 450 HIS 450 447 447 HIS HIS B . n 
B 1 451 GLY 451 448 448 GLY GLY B . n 
B 1 452 TYR 452 449 449 TYR TYR B . n 
B 1 453 GLU 453 450 450 GLU GLU B . n 
B 1 454 ILE 454 451 451 ILE ILE B . n 
B 1 455 GLU 455 452 452 GLU GLU B . n 
B 1 456 PHE 456 453 453 PHE PHE B . n 
B 1 457 ILE 457 454 454 ILE ILE B . n 
B 1 458 PHE 458 455 455 PHE PHE B . n 
B 1 459 GLY 459 456 456 GLY GLY B . n 
B 1 460 ILE 460 457 457 ILE ILE B . n 
B 1 461 PRO 461 458 458 PRO PRO B . n 
B 1 462 LEU 462 459 459 LEU LEU B . n 
B 1 463 ASP 463 460 460 ASP ASP B . n 
B 1 464 PRO 464 461 461 PRO PRO B . n 
B 1 465 SER 465 462 462 SER SER B . n 
B 1 466 ARG 466 463 463 ARG ARG B . n 
B 1 467 ASN 467 464 464 ASN ASN B . n 
B 1 468 TYR 468 465 465 TYR TYR B . n 
B 1 469 THR 469 466 466 THR THR B . n 
B 1 470 ALA 470 467 467 ALA ALA B . n 
B 1 471 GLU 471 468 468 GLU GLU B . n 
B 1 472 GLU 472 469 469 GLU GLU B . n 
B 1 473 LYS 473 470 470 LYS LYS B . n 
B 1 474 ILE 474 471 471 ILE ILE B . n 
B 1 475 PHE 475 472 472 PHE PHE B . n 
B 1 476 ALA 476 473 473 ALA ALA B . n 
B 1 477 GLN 477 474 474 GLN GLN B . n 
B 1 478 ARG 478 475 475 ARG ARG B . n 
B 1 479 LEU 479 476 476 LEU LEU B . n 
B 1 480 MET 480 477 477 MET MET B . n 
B 1 481 ARG 481 478 478 ARG ARG B . n 
B 1 482 TYR 482 479 479 TYR TYR B . n 
B 1 483 TRP 483 480 480 TRP TRP B . n 
B 1 484 ALA 484 481 481 ALA ALA B . n 
B 1 485 ASN 485 482 482 ASN ASN B . n 
B 1 486 PHE 486 483 483 PHE PHE B . n 
B 1 487 ALA 487 484 484 ALA ALA B . n 
B 1 488 ARG 488 485 485 ARG ARG B . n 
B 1 489 THR 489 486 486 THR THR B . n 
B 1 490 GLY 490 487 487 GLY GLY B . n 
B 1 491 ASP 491 488 488 ASP ASP B . n 
B 1 492 PRO 492 489 489 PRO PRO B . n 
B 1 493 ASN 493 490 490 ASN ASN B . n 
B 1 494 GLU 494 491 491 GLU GLU B . n 
B 1 495 PRO 495 492 492 PRO PRO B . n 
B 1 496 ARG 496 493 493 ARG ARG B . n 
B 1 497 ASP 497 494 494 ASP ASP B . n 
B 1 498 PRO 498 495 495 PRO PRO B . n 
B 1 499 LYS 499 496 496 LYS LYS B . n 
B 1 500 ALA 500 497 497 ALA ALA B . n 
B 1 501 PRO 501 498 498 PRO PRO B . n 
B 1 502 GLN 502 499 499 GLN GLN B . n 
B 1 503 TRP 503 500 500 TRP TRP B . n 
B 1 504 PRO 504 501 501 PRO PRO B . n 
B 1 505 PRO 505 502 502 PRO PRO B . n 
B 1 506 TYR 506 503 503 TYR TYR B . n 
B 1 507 THR 507 504 504 THR THR B . n 
B 1 508 ALA 508 505 505 ALA ALA B . n 
B 1 509 GLY 509 506 506 GLY GLY B . n 
B 1 510 ALA 510 507 507 ALA ALA B . n 
B 1 511 GLN 511 508 508 GLN GLN B . n 
B 1 512 GLN 512 509 509 GLN GLN B . n 
B 1 513 TYR 513 510 510 TYR TYR B . n 
B 1 514 VAL 514 511 511 VAL VAL B . n 
B 1 515 SER 515 512 512 SER SER B . n 
B 1 516 LEU 516 513 513 LEU LEU B . n 
B 1 517 ASP 517 514 514 ASP ASP B . n 
B 1 518 LEU 518 515 515 LEU LEU B . n 
B 1 519 ARG 519 516 516 ARG ARG B . n 
B 1 520 PRO 520 517 517 PRO PRO B . n 
B 1 521 LEU 521 518 518 LEU LEU B . n 
B 1 522 GLU 522 519 519 GLU GLU B . n 
B 1 523 VAL 523 520 520 VAL VAL B . n 
B 1 524 ARG 524 521 521 ARG ARG B . n 
B 1 525 ARG 525 522 522 ARG ARG B . n 
B 1 526 GLY 526 523 523 GLY GLY B . n 
B 1 527 LEU 527 524 524 LEU LEU B . n 
B 1 528 ARG 528 525 525 ARG ARG B . n 
B 1 529 ALA 529 526 526 ALA ALA B . n 
B 1 530 GLN 530 527 527 GLN GLN B . n 
B 1 531 ALA 531 528 528 ALA ALA B . n 
B 1 532 CYS 532 529 529 CYS CYS B . n 
B 1 533 ALA 533 530 530 ALA ALA B . n 
B 1 534 PHE 534 531 531 PHE PHE B . n 
B 1 535 TRP 535 532 532 TRP TRP B . n 
B 1 536 ASN 536 533 533 ASN ASN B . n 
B 1 537 ARG 537 534 534 ARG ARG B . n 
B 1 538 PHE 538 535 535 PHE PHE B . n 
B 1 539 LEU 539 536 536 LEU LEU B . n 
B 1 540 PRO 540 537 537 PRO PRO B . n 
B 1 541 LYS 541 538 538 LYS LYS B . n 
B 1 542 LEU 542 539 539 LEU LEU B . n 
B 1 543 LEU 543 540 540 LEU LEU B . n 
B 1 544 SER 544 541 541 SER SER B . n 
B 1 545 ALA 545 542 542 ALA ALA B . n 
B 1 546 THR 546 543 543 THR THR B . n 
B 1 547 ASP 547 544 ?   ?   ?   B . n 
B 1 548 THR 548 545 ?   ?   ?   B . n 
B 1 549 LEU 549 546 ?   ?   ?   B . n 
B 1 550 ASP 550 547 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 VX  1   601 600 VX  VX  A . 
D 3 PQV 1   602 1   PQV DRG A . 
E 4 GOL 1   603 662 GOL GOL A . 
F 4 GOL 1   604 663 GOL GOL A . 
G 5 NO3 1   605 608 NO3 NO3 A . 
H 5 NO3 1   606 610 NO3 NO3 A . 
I 5 NO3 1   607 611 NO3 NO3 A . 
J 2 VX  1   601 600 VX  VX  B . 
K 3 PQV 1   602 2   PQV DRG B . 
L 4 GOL 1   603 664 GOL GOL B . 
M 4 GOL 1   604 665 GOL GOL B . 
N 6 HOH 1   701 139 HOH HOH A . 
N 6 HOH 2   702 182 HOH HOH A . 
N 6 HOH 3   703 18  HOH HOH A . 
N 6 HOH 4   704 106 HOH HOH A . 
N 6 HOH 5   705 213 HOH HOH A . 
N 6 HOH 6   706 280 HOH HOH A . 
N 6 HOH 7   707 90  HOH HOH A . 
N 6 HOH 8   708 38  HOH HOH A . 
N 6 HOH 9   709 127 HOH HOH A . 
N 6 HOH 10  710 23  HOH HOH A . 
N 6 HOH 11  711 138 HOH HOH A . 
N 6 HOH 12  712 75  HOH HOH A . 
N 6 HOH 13  713 187 HOH HOH A . 
N 6 HOH 14  714 226 HOH HOH A . 
N 6 HOH 15  715 304 HOH HOH A . 
N 6 HOH 16  716 208 HOH HOH A . 
N 6 HOH 17  717 4   HOH HOH A . 
N 6 HOH 18  718 30  HOH HOH A . 
N 6 HOH 19  719 276 HOH HOH A . 
N 6 HOH 20  720 216 HOH HOH A . 
N 6 HOH 21  721 267 HOH HOH A . 
N 6 HOH 22  722 9   HOH HOH A . 
N 6 HOH 23  723 122 HOH HOH A . 
N 6 HOH 24  724 59  HOH HOH A . 
N 6 HOH 25  725 8   HOH HOH A . 
N 6 HOH 26  726 316 HOH HOH A . 
N 6 HOH 27  727 371 HOH HOH A . 
N 6 HOH 28  728 261 HOH HOH A . 
N 6 HOH 29  729 302 HOH HOH A . 
N 6 HOH 30  730 119 HOH HOH A . 
N 6 HOH 31  731 340 HOH HOH A . 
N 6 HOH 32  732 45  HOH HOH A . 
N 6 HOH 33  733 12  HOH HOH A . 
N 6 HOH 34  734 132 HOH HOH A . 
N 6 HOH 35  735 65  HOH HOH A . 
N 6 HOH 36  736 260 HOH HOH A . 
N 6 HOH 37  737 148 HOH HOH A . 
N 6 HOH 38  738 172 HOH HOH A . 
N 6 HOH 39  739 61  HOH HOH A . 
N 6 HOH 40  740 13  HOH HOH A . 
N 6 HOH 41  741 136 HOH HOH A . 
N 6 HOH 42  742 26  HOH HOH A . 
N 6 HOH 43  743 308 HOH HOH A . 
N 6 HOH 44  744 181 HOH HOH A . 
N 6 HOH 45  745 3   HOH HOH A . 
N 6 HOH 46  746 326 HOH HOH A . 
N 6 HOH 47  747 69  HOH HOH A . 
N 6 HOH 48  748 283 HOH HOH A . 
N 6 HOH 49  749 221 HOH HOH A . 
N 6 HOH 50  750 96  HOH HOH A . 
N 6 HOH 51  751 39  HOH HOH A . 
N 6 HOH 52  752 111 HOH HOH A . 
N 6 HOH 53  753 168 HOH HOH A . 
N 6 HOH 54  754 247 HOH HOH A . 
N 6 HOH 55  755 41  HOH HOH A . 
N 6 HOH 56  756 279 HOH HOH A . 
N 6 HOH 57  757 134 HOH HOH A . 
N 6 HOH 58  758 246 HOH HOH A . 
N 6 HOH 59  759 24  HOH HOH A . 
N 6 HOH 60  760 51  HOH HOH A . 
N 6 HOH 61  761 7   HOH HOH A . 
N 6 HOH 62  762 159 HOH HOH A . 
N 6 HOH 63  763 103 HOH HOH A . 
N 6 HOH 64  764 93  HOH HOH A . 
N 6 HOH 65  765 284 HOH HOH A . 
N 6 HOH 66  766 89  HOH HOH A . 
N 6 HOH 67  767 154 HOH HOH A . 
N 6 HOH 68  768 85  HOH HOH A . 
N 6 HOH 69  769 100 HOH HOH A . 
N 6 HOH 70  770 281 HOH HOH A . 
N 6 HOH 71  771 40  HOH HOH A . 
N 6 HOH 72  772 71  HOH HOH A . 
N 6 HOH 73  773 163 HOH HOH A . 
N 6 HOH 74  774 77  HOH HOH A . 
N 6 HOH 75  775 290 HOH HOH A . 
N 6 HOH 76  776 161 HOH HOH A . 
N 6 HOH 77  777 64  HOH HOH A . 
N 6 HOH 78  778 28  HOH HOH A . 
N 6 HOH 79  779 235 HOH HOH A . 
N 6 HOH 80  780 334 HOH HOH A . 
N 6 HOH 81  781 238 HOH HOH A . 
N 6 HOH 82  782 199 HOH HOH A . 
N 6 HOH 83  783 220 HOH HOH A . 
N 6 HOH 84  784 131 HOH HOH A . 
N 6 HOH 85  785 301 HOH HOH A . 
N 6 HOH 86  786 268 HOH HOH A . 
N 6 HOH 87  787 128 HOH HOH A . 
N 6 HOH 88  788 314 HOH HOH A . 
N 6 HOH 89  789 351 HOH HOH A . 
N 6 HOH 90  790 239 HOH HOH A . 
N 6 HOH 91  791 31  HOH HOH A . 
N 6 HOH 92  792 68  HOH HOH A . 
N 6 HOH 93  793 92  HOH HOH A . 
N 6 HOH 94  794 335 HOH HOH A . 
N 6 HOH 95  795 60  HOH HOH A . 
N 6 HOH 96  796 197 HOH HOH A . 
N 6 HOH 97  797 274 HOH HOH A . 
N 6 HOH 98  798 17  HOH HOH A . 
N 6 HOH 99  799 169 HOH HOH A . 
N 6 HOH 100 800 76  HOH HOH A . 
N 6 HOH 101 801 266 HOH HOH A . 
N 6 HOH 102 802 222 HOH HOH A . 
N 6 HOH 103 803 324 HOH HOH A . 
N 6 HOH 104 804 225 HOH HOH A . 
N 6 HOH 105 805 80  HOH HOH A . 
N 6 HOH 106 806 322 HOH HOH A . 
N 6 HOH 107 807 369 HOH HOH A . 
N 6 HOH 108 808 210 HOH HOH A . 
N 6 HOH 109 809 5   HOH HOH A . 
N 6 HOH 110 810 50  HOH HOH A . 
N 6 HOH 111 811 48  HOH HOH A . 
N 6 HOH 112 812 350 HOH HOH A . 
N 6 HOH 113 813 46  HOH HOH A . 
N 6 HOH 114 814 194 HOH HOH A . 
N 6 HOH 115 815 215 HOH HOH A . 
N 6 HOH 116 816 224 HOH HOH A . 
N 6 HOH 117 817 145 HOH HOH A . 
N 6 HOH 118 818 186 HOH HOH A . 
N 6 HOH 119 819 180 HOH HOH A . 
N 6 HOH 120 820 86  HOH HOH A . 
N 6 HOH 121 821 99  HOH HOH A . 
N 6 HOH 122 822 310 HOH HOH A . 
N 6 HOH 123 823 107 HOH HOH A . 
N 6 HOH 124 824 126 HOH HOH A . 
N 6 HOH 125 825 156 HOH HOH A . 
N 6 HOH 126 826 164 HOH HOH A . 
N 6 HOH 127 827 74  HOH HOH A . 
N 6 HOH 128 828 198 HOH HOH A . 
N 6 HOH 129 829 190 HOH HOH A . 
N 6 HOH 130 830 22  HOH HOH A . 
N 6 HOH 131 831 298 HOH HOH A . 
N 6 HOH 132 832 357 HOH HOH A . 
N 6 HOH 133 833 241 HOH HOH A . 
N 6 HOH 134 834 135 HOH HOH A . 
N 6 HOH 135 835 87  HOH HOH A . 
N 6 HOH 136 836 348 HOH HOH A . 
N 6 HOH 137 837 52  HOH HOH A . 
N 6 HOH 138 838 166 HOH HOH A . 
N 6 HOH 139 839 373 HOH HOH A . 
N 6 HOH 140 840 149 HOH HOH A . 
N 6 HOH 141 841 253 HOH HOH A . 
N 6 HOH 142 842 313 HOH HOH A . 
N 6 HOH 143 843 110 HOH HOH A . 
N 6 HOH 144 844 285 HOH HOH A . 
N 6 HOH 145 845 312 HOH HOH A . 
N 6 HOH 146 846 233 HOH HOH A . 
N 6 HOH 147 847 185 HOH HOH A . 
N 6 HOH 148 848 174 HOH HOH A . 
N 6 HOH 149 849 325 HOH HOH A . 
N 6 HOH 150 850 329 HOH HOH A . 
N 6 HOH 151 851 354 HOH HOH A . 
N 6 HOH 152 852 203 HOH HOH A . 
N 6 HOH 153 853 320 HOH HOH A . 
N 6 HOH 154 854 287 HOH HOH A . 
N 6 HOH 155 855 141 HOH HOH A . 
N 6 HOH 156 856 143 HOH HOH A . 
N 6 HOH 157 857 42  HOH HOH A . 
N 6 HOH 158 858 158 HOH HOH A . 
N 6 HOH 159 859 147 HOH HOH A . 
N 6 HOH 160 860 295 HOH HOH A . 
N 6 HOH 161 861 188 HOH HOH A . 
N 6 HOH 162 862 109 HOH HOH A . 
N 6 HOH 163 863 358 HOH HOH A . 
N 6 HOH 164 864 205 HOH HOH A . 
N 6 HOH 165 865 130 HOH HOH A . 
N 6 HOH 166 866 374 HOH HOH A . 
N 6 HOH 167 867 250 HOH HOH A . 
N 6 HOH 168 868 101 HOH HOH A . 
N 6 HOH 169 869 377 HOH HOH A . 
N 6 HOH 170 870 368 HOH HOH A . 
N 6 HOH 171 871 173 HOH HOH A . 
N 6 HOH 172 872 372 HOH HOH A . 
N 6 HOH 173 873 242 HOH HOH A . 
N 6 HOH 174 874 232 HOH HOH A . 
N 6 HOH 175 875 270 HOH HOH A . 
N 6 HOH 176 876 263 HOH HOH A . 
N 6 HOH 177 877 347 HOH HOH A . 
N 6 HOH 178 878 303 HOH HOH A . 
N 6 HOH 179 879 207 HOH HOH A . 
N 6 HOH 180 880 218 HOH HOH A . 
N 6 HOH 181 881 265 HOH HOH A . 
O 6 HOH 1   701 191 HOH HOH B . 
O 6 HOH 2   702 184 HOH HOH B . 
O 6 HOH 3   703 115 HOH HOH B . 
O 6 HOH 4   704 11  HOH HOH B . 
O 6 HOH 5   705 35  HOH HOH B . 
O 6 HOH 6   706 102 HOH HOH B . 
O 6 HOH 7   707 256 HOH HOH B . 
O 6 HOH 8   708 289 HOH HOH B . 
O 6 HOH 9   709 20  HOH HOH B . 
O 6 HOH 10  710 25  HOH HOH B . 
O 6 HOH 11  711 258 HOH HOH B . 
O 6 HOH 12  712 53  HOH HOH B . 
O 6 HOH 13  713 349 HOH HOH B . 
O 6 HOH 14  714 311 HOH HOH B . 
O 6 HOH 15  715 133 HOH HOH B . 
O 6 HOH 16  716 15  HOH HOH B . 
O 6 HOH 17  717 201 HOH HOH B . 
O 6 HOH 18  718 231 HOH HOH B . 
O 6 HOH 19  719 2   HOH HOH B . 
O 6 HOH 20  720 360 HOH HOH B . 
O 6 HOH 21  721 171 HOH HOH B . 
O 6 HOH 22  722 116 HOH HOH B . 
O 6 HOH 23  723 229 HOH HOH B . 
O 6 HOH 24  724 140 HOH HOH B . 
O 6 HOH 25  725 56  HOH HOH B . 
O 6 HOH 26  726 91  HOH HOH B . 
O 6 HOH 27  727 10  HOH HOH B . 
O 6 HOH 28  728 14  HOH HOH B . 
O 6 HOH 29  729 114 HOH HOH B . 
O 6 HOH 30  730 223 HOH HOH B . 
O 6 HOH 31  731 84  HOH HOH B . 
O 6 HOH 32  732 234 HOH HOH B . 
O 6 HOH 33  733 352 HOH HOH B . 
O 6 HOH 34  734 259 HOH HOH B . 
O 6 HOH 35  735 27  HOH HOH B . 
O 6 HOH 36  736 219 HOH HOH B . 
O 6 HOH 37  737 37  HOH HOH B . 
O 6 HOH 38  738 19  HOH HOH B . 
O 6 HOH 39  739 33  HOH HOH B . 
O 6 HOH 40  740 54  HOH HOH B . 
O 6 HOH 41  741 321 HOH HOH B . 
O 6 HOH 42  742 88  HOH HOH B . 
O 6 HOH 43  743 248 HOH HOH B . 
O 6 HOH 44  744 72  HOH HOH B . 
O 6 HOH 45  745 137 HOH HOH B . 
O 6 HOH 46  746 67  HOH HOH B . 
O 6 HOH 47  747 34  HOH HOH B . 
O 6 HOH 48  748 288 HOH HOH B . 
O 6 HOH 49  749 278 HOH HOH B . 
O 6 HOH 50  750 82  HOH HOH B . 
O 6 HOH 51  751 365 HOH HOH B . 
O 6 HOH 52  752 120 HOH HOH B . 
O 6 HOH 53  753 152 HOH HOH B . 
O 6 HOH 54  754 317 HOH HOH B . 
O 6 HOH 55  755 95  HOH HOH B . 
O 6 HOH 56  756 328 HOH HOH B . 
O 6 HOH 57  757 57  HOH HOH B . 
O 6 HOH 58  758 124 HOH HOH B . 
O 6 HOH 59  759 165 HOH HOH B . 
O 6 HOH 60  760 94  HOH HOH B . 
O 6 HOH 61  761 364 HOH HOH B . 
O 6 HOH 62  762 337 HOH HOH B . 
O 6 HOH 63  763 343 HOH HOH B . 
O 6 HOH 64  764 254 HOH HOH B . 
O 6 HOH 65  765 6   HOH HOH B . 
O 6 HOH 66  766 125 HOH HOH B . 
O 6 HOH 67  767 21  HOH HOH B . 
O 6 HOH 68  768 273 HOH HOH B . 
O 6 HOH 69  769 112 HOH HOH B . 
O 6 HOH 70  770 49  HOH HOH B . 
O 6 HOH 71  771 29  HOH HOH B . 
O 6 HOH 72  772 62  HOH HOH B . 
O 6 HOH 73  773 118 HOH HOH B . 
O 6 HOH 74  774 117 HOH HOH B . 
O 6 HOH 75  775 121 HOH HOH B . 
O 6 HOH 76  776 251 HOH HOH B . 
O 6 HOH 77  777 217 HOH HOH B . 
O 6 HOH 78  778 47  HOH HOH B . 
O 6 HOH 79  779 58  HOH HOH B . 
O 6 HOH 80  780 157 HOH HOH B . 
O 6 HOH 81  781 297 HOH HOH B . 
O 6 HOH 82  782 97  HOH HOH B . 
O 6 HOH 83  783 367 HOH HOH B . 
O 6 HOH 84  784 286 HOH HOH B . 
O 6 HOH 85  785 153 HOH HOH B . 
O 6 HOH 86  786 98  HOH HOH B . 
O 6 HOH 87  787 332 HOH HOH B . 
O 6 HOH 88  788 193 HOH HOH B . 
O 6 HOH 89  789 83  HOH HOH B . 
O 6 HOH 90  790 209 HOH HOH B . 
O 6 HOH 91  791 236 HOH HOH B . 
O 6 HOH 92  792 36  HOH HOH B . 
O 6 HOH 93  793 294 HOH HOH B . 
O 6 HOH 94  794 55  HOH HOH B . 
O 6 HOH 95  795 63  HOH HOH B . 
O 6 HOH 96  796 195 HOH HOH B . 
O 6 HOH 97  797 189 HOH HOH B . 
O 6 HOH 98  798 66  HOH HOH B . 
O 6 HOH 99  799 330 HOH HOH B . 
O 6 HOH 100 800 315 HOH HOH B . 
O 6 HOH 101 801 146 HOH HOH B . 
O 6 HOH 102 802 269 HOH HOH B . 
O 6 HOH 103 803 1   HOH HOH B . 
O 6 HOH 104 804 204 HOH HOH B . 
O 6 HOH 105 805 252 HOH HOH B . 
O 6 HOH 106 806 245 HOH HOH B . 
O 6 HOH 107 807 327 HOH HOH B . 
O 6 HOH 108 808 179 HOH HOH B . 
O 6 HOH 109 809 249 HOH HOH B . 
O 6 HOH 110 810 264 HOH HOH B . 
O 6 HOH 111 811 44  HOH HOH B . 
O 6 HOH 112 812 333 HOH HOH B . 
O 6 HOH 113 813 32  HOH HOH B . 
O 6 HOH 114 814 142 HOH HOH B . 
O 6 HOH 115 815 150 HOH HOH B . 
O 6 HOH 116 816 292 HOH HOH B . 
O 6 HOH 117 817 346 HOH HOH B . 
O 6 HOH 118 818 307 HOH HOH B . 
O 6 HOH 119 819 43  HOH HOH B . 
O 6 HOH 120 820 105 HOH HOH B . 
O 6 HOH 121 821 73  HOH HOH B . 
O 6 HOH 122 822 323 HOH HOH B . 
O 6 HOH 123 823 16  HOH HOH B . 
O 6 HOH 124 824 129 HOH HOH B . 
O 6 HOH 125 825 155 HOH HOH B . 
O 6 HOH 126 826 240 HOH HOH B . 
O 6 HOH 127 827 318 HOH HOH B . 
O 6 HOH 128 828 192 HOH HOH B . 
O 6 HOH 129 829 341 HOH HOH B . 
O 6 HOH 130 830 196 HOH HOH B . 
O 6 HOH 131 831 123 HOH HOH B . 
O 6 HOH 132 832 366 HOH HOH B . 
O 6 HOH 133 833 359 HOH HOH B . 
O 6 HOH 134 834 79  HOH HOH B . 
O 6 HOH 135 835 299 HOH HOH B . 
O 6 HOH 136 836 345 HOH HOH B . 
O 6 HOH 137 837 178 HOH HOH B . 
O 6 HOH 138 838 272 HOH HOH B . 
O 6 HOH 139 839 78  HOH HOH B . 
O 6 HOH 140 840 144 HOH HOH B . 
O 6 HOH 141 841 319 HOH HOH B . 
O 6 HOH 142 842 175 HOH HOH B . 
O 6 HOH 143 843 306 HOH HOH B . 
O 6 HOH 144 844 214 HOH HOH B . 
O 6 HOH 145 845 271 HOH HOH B . 
O 6 HOH 146 846 200 HOH HOH B . 
O 6 HOH 147 847 183 HOH HOH B . 
O 6 HOH 148 848 282 HOH HOH B . 
O 6 HOH 149 849 177 HOH HOH B . 
O 6 HOH 150 850 160 HOH HOH B . 
O 6 HOH 151 851 167 HOH HOH B . 
O 6 HOH 152 852 70  HOH HOH B . 
O 6 HOH 153 853 162 HOH HOH B . 
O 6 HOH 154 854 275 HOH HOH B . 
O 6 HOH 155 855 212 HOH HOH B . 
O 6 HOH 156 856 176 HOH HOH B . 
O 6 HOH 157 857 355 HOH HOH B . 
O 6 HOH 158 858 336 HOH HOH B . 
O 6 HOH 159 859 291 HOH HOH B . 
O 6 HOH 160 860 227 HOH HOH B . 
O 6 HOH 161 861 356 HOH HOH B . 
O 6 HOH 162 862 170 HOH HOH B . 
O 6 HOH 163 863 296 HOH HOH B . 
O 6 HOH 164 864 228 HOH HOH B . 
O 6 HOH 165 865 375 HOH HOH B . 
O 6 HOH 166 866 362 HOH HOH B . 
O 6 HOH 167 867 81  HOH HOH B . 
O 6 HOH 168 868 244 HOH HOH B . 
O 6 HOH 169 869 255 HOH HOH B . 
O 6 HOH 170 870 339 HOH HOH B . 
O 6 HOH 171 871 104 HOH HOH B . 
O 6 HOH 172 872 113 HOH HOH B . 
O 6 HOH 173 873 331 HOH HOH B . 
O 6 HOH 174 874 277 HOH HOH B . 
O 6 HOH 175 875 370 HOH HOH B . 
O 6 HOH 176 876 309 HOH HOH B . 
O 6 HOH 177 877 237 HOH HOH B . 
O 6 HOH 178 878 243 HOH HOH B . 
O 6 HOH 179 879 363 HOH HOH B . 
O 6 HOH 180 880 257 HOH HOH B . 
O 6 HOH 181 881 211 HOH HOH B . 
O 6 HOH 182 882 300 HOH HOH B . 
O 6 HOH 183 883 338 HOH HOH B . 
O 6 HOH 184 884 353 HOH HOH B . 
O 6 HOH 185 885 262 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,N 
1 2 B,J,K,L,M,O       
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4300  ? 
1 MORE         -4    ? 
1 'SSA (A^2)'  38110 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000   
2 'crystal symmetry operation' 3_564 -x+y,-x+1,z-1/3 -0.5000000000 0.8660254038 0.0000000000 -62.1815000000 -0.8660254038 
-0.5000000000 0.0000000000 107.7015172908 0.0000000000 0.0000000000 1.0000000000 -43.0490000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-02-12 
2 'Structure model' 1 1 2020-02-19 
3 'Structure model' 1 2 2020-04-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 2 'Structure model' 'Derived calculations' 
3 3 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                  
2 2 'Structure model' citation_author           
3 2 'Structure model' pdbx_struct_assembly      
4 2 'Structure model' pdbx_struct_assembly_gen  
5 2 'Structure model' pdbx_struct_assembly_prop 
6 3 'Structure model' citation                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_DOI'    
2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
3 2 'Structure model' '_citation.title'                   
4 2 'Structure model' '_citation_author.identifier_ORCID' 
5 2 'Structure model' '_citation_author.name'             
6 3 'Structure model' '_citation.journal_volume'          
7 3 'Structure model' '_citation.page_first'              
8 3 'Structure model' '_citation.page_last'               
9 3 'Structure model' '_citation.title'                   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? . 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? . 4 
# 
_pdbx_entry_details.entry_id                 6U37 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 158 ? ? -143.11 10.99   
2  1 SER A 203 ? ? 57.24   -117.31 
3  1 ASP A 306 ? ? -98.75  -83.97  
4  1 ALA A 318 ? ? -98.70  40.36   
5  1 VAL A 407 ? ? -126.00 -64.85  
6  1 ASN A 464 ? ? -106.81 48.00   
7  1 SER B 203 ? ? 53.62   -115.53 
8  1 ASP B 306 ? ? -107.42 -81.76  
9  1 VAL B 407 ? ? -126.31 -65.20  
10 1 ASN B 464 ? ? -109.87 47.94   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 881 ? 5.87 . 
2 1 O ? B HOH 885 ? 5.84 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2  ? A GLY 1   
2  1 Y 1 A PRO -1  ? A PRO 2   
3  1 Y 1 A LEU 0   ? A LEU 3   
4  1 Y 1 A GLU 1   ? A GLU 4   
5  1 Y 1 A GLY 2   ? A GLY 5   
6  1 Y 1 A ARG 3   ? A ARG 6   
7  1 Y 1 A ASP 544 ? A ASP 547 
8  1 Y 1 A THR 545 ? A THR 548 
9  1 Y 1 A LEU 546 ? A LEU 549 
10 1 Y 1 A ASP 547 ? A ASP 550 
11 1 Y 1 B GLY -2  ? B GLY 1   
12 1 Y 1 B PRO -1  ? B PRO 2   
13 1 Y 1 B LEU 0   ? B LEU 3   
14 1 Y 1 B GLU 1   ? B GLU 4   
15 1 Y 1 B GLY 2   ? B GLY 5   
16 1 Y 1 B ARG 3   ? B ARG 6   
17 1 Y 1 B ASP 544 ? B ASP 547 
18 1 Y 1 B THR 545 ? B THR 548 
19 1 Y 1 B LEU 546 ? B LEU 549 
20 1 Y 1 B ASP 547 ? B ASP 550 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'U01 NS083451' 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        PQV 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   PQV 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'O-ETHYLMETHYLPHOSPHONIC ACID ESTER GROUP'                VX  
3 '(2E)-N-[2-(azepan-1-yl)ethyl]-2-(hydroxyimino)acetamide' PQV 
4 GLYCEROL                                                  GOL 
5 'NITRATE ION'                                             NO3 
6 water                                                     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#