data_6U5C
# 
_entry.id   6U5C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6U5C         
WWPDB D_1000243868 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6U5C 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wolff, A.M.'    1 0000-0003-0474-7673 
'Thompson, M.C.' 2 0000-0002-6099-2027 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Iucrj 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2052-2525 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                306 
_citation.page_last                 323 
_citation.title                     
;Comparing serial X-ray crystallography and microcrystal electron diffraction (MicroED) as methods for routine structure determination from small macromolecular crystals
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S205225252000072X 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.ordinal 
_citation_author.name 
_citation_author.identifier_ORCID 
primary 1  'Wolff, A.M.'       0000-0003-0474-7673 
primary 2  'Young, I.D.'       0000-0003-4713-9504 
primary 3  'Sierra, R.G.'      0000-0002-6253-8282 
primary 4  'Brewster, A.S.'    0000-0002-0908-7822 
primary 5  'Martynowycz, M.W.' 0000-0003-0055-230X 
primary 6  'Nango, E.'         0000-0001-9851-7355 
primary 7  'Sugahara, M.'      ?                   
primary 8  'Nakane, T.'        0000-0003-2697-2767 
primary 9  'Ito, K.'           ?                   
primary 10 'Aquila, A.'        ?                   
primary 11 'Bhowmick, A.'      ?                   
primary 12 'Biel, J.T.'        0000-0002-0935-8362 
primary 13 'Carbajo, S.'       0000-0002-5292-4470 
primary 14 'Cohen, A.E.'       0000-0003-2414-9427 
primary 15 'Cortez, S.'        ?                   
primary 16 'Gonzalez, A.'      ?                   
primary 17 'Hino, T.'          0000-0002-8813-4622 
primary 18 'Im, D.'            ?                   
primary 19 'Koralek, J.D.'     0000-0001-8289-0497 
primary 20 'Kubo, M.'          0000-0001-8691-6252 
primary 21 'Lazarou, T.S.'     ?                   
primary 22 'Nomura, T.'        ?                   
primary 23 'Owada, S.'         ?                   
primary 24 'Samelson, A.'      ?                   
primary 25 'Tanaka, T.'        ?                   
primary 26 'Tanaka, R.'        ?                   
primary 27 'Thompson, E.M.'    ?                   
primary 28 'van den Bedem, H.' 0000-0003-2358-841X 
primary 29 'Woldeyes, R.A.'    0000-0003-0737-8383 
primary 30 'Yumoto, F.'        0000-0002-9592-397X 
primary 31 'Zhao, W.'          ?                   
primary 32 'Tono, K.'          ?                   
primary 33 'Boutet, S.'        ?                   
primary 34 'Iwata, S.'         ?                   
primary 35 'Gonen, T.'         0000-0002-9254-4069 
primary 36 'Sauter, N.K.'      ?                   
primary 37 'Fraser, J.S.'      0000-0002-5080-2859 
primary 38 'Thompson, M.C.'    0000-0002-6099-2027 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6U5C 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     43.010 
_cell.length_a_esd                 ? 
_cell.length_b                     52.610 
_cell.length_b_esd                 ? 
_cell.length_c                     89.320 
_cell.length_c_esd                 ? 
_cell.volume                       202109.375 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6U5C 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Peptidyl-prolyl cis-trans isomerase A' 18036.504 1   5.2.1.8 ? ? ? 
2 water   nat water                                   18.015    139 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPIase A,Cyclophilin A,Cyclosporin A-binding protein,Rotamase A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   ASN n 
1 4   PRO n 
1 5   THR n 
1 6   VAL n 
1 7   PHE n 
1 8   PHE n 
1 9   ASP n 
1 10  ILE n 
1 11  ALA n 
1 12  VAL n 
1 13  ASP n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  LEU n 
1 18  GLY n 
1 19  ARG n 
1 20  VAL n 
1 21  SER n 
1 22  PHE n 
1 23  GLU n 
1 24  LEU n 
1 25  PHE n 
1 26  ALA n 
1 27  ASP n 
1 28  LYS n 
1 29  VAL n 
1 30  PRO n 
1 31  LYS n 
1 32  THR n 
1 33  ALA n 
1 34  GLU n 
1 35  ASN n 
1 36  PHE n 
1 37  ARG n 
1 38  ALA n 
1 39  LEU n 
1 40  SER n 
1 41  THR n 
1 42  GLY n 
1 43  GLU n 
1 44  LYS n 
1 45  GLY n 
1 46  PHE n 
1 47  GLY n 
1 48  TYR n 
1 49  LYS n 
1 50  GLY n 
1 51  SER n 
1 52  CYS n 
1 53  PHE n 
1 54  HIS n 
1 55  ARG n 
1 56  ILE n 
1 57  ILE n 
1 58  PRO n 
1 59  GLY n 
1 60  PHE n 
1 61  MET n 
1 62  CYS n 
1 63  GLN n 
1 64  GLY n 
1 65  GLY n 
1 66  ASP n 
1 67  PHE n 
1 68  THR n 
1 69  ARG n 
1 70  HIS n 
1 71  ASN n 
1 72  GLY n 
1 73  THR n 
1 74  GLY n 
1 75  GLY n 
1 76  LYS n 
1 77  SER n 
1 78  ILE n 
1 79  TYR n 
1 80  GLY n 
1 81  GLU n 
1 82  LYS n 
1 83  PHE n 
1 84  GLU n 
1 85  ASP n 
1 86  GLU n 
1 87  ASN n 
1 88  PHE n 
1 89  ILE n 
1 90  LEU n 
1 91  LYS n 
1 92  HIS n 
1 93  THR n 
1 94  GLY n 
1 95  PRO n 
1 96  GLY n 
1 97  ILE n 
1 98  LEU n 
1 99  SER n 
1 100 MET n 
1 101 ALA n 
1 102 ASN n 
1 103 ALA n 
1 104 GLY n 
1 105 PRO n 
1 106 ASN n 
1 107 THR n 
1 108 ASN n 
1 109 GLY n 
1 110 SER n 
1 111 GLN n 
1 112 PHE n 
1 113 PHE n 
1 114 ILE n 
1 115 CYS n 
1 116 THR n 
1 117 ALA n 
1 118 LYS n 
1 119 THR n 
1 120 GLU n 
1 121 TRP n 
1 122 LEU n 
1 123 ASP n 
1 124 GLY n 
1 125 LYS n 
1 126 HIS n 
1 127 VAL n 
1 128 VAL n 
1 129 PHE n 
1 130 GLY n 
1 131 LYS n 
1 132 VAL n 
1 133 LYS n 
1 134 GLU n 
1 135 GLY n 
1 136 MET n 
1 137 ASN n 
1 138 ILE n 
1 139 VAL n 
1 140 GLU n 
1 141 ALA n 
1 142 MET n 
1 143 GLU n 
1 144 ARG n 
1 145 PHE n 
1 146 GLY n 
1 147 SER n 
1 148 ARG n 
1 149 ASN n 
1 150 GLY n 
1 151 LYS n 
1 152 THR n 
1 153 SER n 
1 154 LYS n 
1 155 LYS n 
1 156 ILE n 
1 157 THR n 
1 158 ILE n 
1 159 ALA n 
1 160 ASP n 
1 161 CYS n 
1 162 GLY n 
1 163 GLN n 
1 164 LEU n 
1 165 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   165 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PPIA, CYPA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPIA_HUMAN 
_struct_ref.pdbx_db_accession          P62937 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6U5C 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 165 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P62937 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  165 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       165 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6U5C 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'BATCH MODE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM HEPES, pH 7.5, 5 mM TCEP, 20% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     291 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   Y 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX170-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-12-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.32 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'FREE ELECTRON LASER' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLAC LCLS BEAMLINE MFX' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.32 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MFX 
_diffrn_source.pdbx_synchrotron_site       'SLAC LCLS' 
# 
_reflns.B_iso_Wilson_estimate            20.21 
_reflns.entry_id                         6U5C 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.62 
_reflns.d_resolution_low                 20.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       26445 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.95 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  224.08 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.312 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.993 
_reflns.pdbx_R_split                     .083 
# 
_reflns_shell.d_res_high                  1.62 
_reflns_shell.d_res_low                   1.65 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.747 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1297 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.865 
_reflns_shell.pdbx_R_split                .284 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               26.29 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6U5C 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.62 
_refine.ls_d_res_low                             19.91 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     26445 
_refine.ls_number_reflns_R_free                  832 
_refine.ls_number_reflns_R_work                  25613 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_percent_reflns_R_free                 3.15 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1369 
_refine.ls_R_factor_R_free                       0.1569 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1362 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 4YUM' 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 14.4232 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1368 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.62 
_refine_hist.d_res_low                        19.91 
_refine_hist.number_atoms_solvent             139 
_refine_hist.number_atoms_total               1388 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1249 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0052  ? 1430 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.8453  ? 1942 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0573  ? 197  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0046  ? 265  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.9854 ? 860  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.62 1.72  . . 135 4189 100.00 . . . 0.2455 . 0.2398 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.72 1.85  . . 136 4196 100.00 . . . 0.1790 . 0.1743 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.85 2.04  . . 139 4241 100.00 . . . 0.1666 . 0.1440 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.04 2.34  . . 137 4230 100.00 . . . 0.1459 . 0.1200 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.34 2.94  . . 140 4297 100.00 . . . 0.1618 . 0.1383 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.94 19.91 . . 145 4460 99.91  . . . 0.1414 . 0.1209 . . . . . . . . . . 
# 
_struct.entry_id                     6U5C 
_struct.title                        'RT XFEL structure of CypA solved using MESH injection system' 
_struct.pdbx_descriptor              'Peptidyl-prolyl cis-trans isomerase A (E.C.5.2.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6U5C 
_struct_keywords.text            'Peptidyl-prolyl, cis-trans, isomerase, cyclophilin' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 VAL A 29  ? GLY A 42  ? VAL A 29  GLY A 42  1 ? 14 
HELX_P HELX_P2 AA2 THR A 119 ? ASP A 123 ? THR A 119 ASP A 123 5 ? 5  
HELX_P HELX_P3 AA3 GLY A 135 ? ARG A 144 ? GLY A 135 ARG A 144 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 53  ? ILE A 57  ? PHE A 53  ILE A 57  
AA1 2 MET A 61  ? GLY A 64  ? MET A 61  GLY A 64  
AA1 3 PHE A 112 ? CYS A 115 ? PHE A 112 CYS A 115 
AA1 4 ILE A 97  ? MET A 100 ? ILE A 97  MET A 100 
AA1 5 VAL A 128 ? GLU A 134 ? VAL A 128 GLU A 134 
AA1 6 GLU A 15  ? LEU A 24  ? GLU A 15  LEU A 24  
AA1 7 THR A 5   ? VAL A 12  ? THR A 5   VAL A 12  
AA1 8 ILE A 156 ? GLN A 163 ? ILE A 156 GLN A 163 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 55  ? N ARG A 55  O GLN A 63  ? O GLN A 63  
AA1 2 3 N CYS A 62  ? N CYS A 62  O ILE A 114 ? O ILE A 114 
AA1 3 4 O CYS A 115 ? O CYS A 115 N ILE A 97  ? N ILE A 97  
AA1 4 5 N LEU A 98  ? N LEU A 98  O GLY A 130 ? O GLY A 130 
AA1 5 6 O LYS A 133 ? O LYS A 133 N SER A 21  ? N SER A 21  
AA1 6 7 O PHE A 22  ? O PHE A 22  N VAL A 6   ? N VAL A 6   
AA1 7 8 N ASP A 9   ? N ASP A 9   O ASP A 160 ? O ASP A 160 
# 
_atom_sites.entry_id                    6U5C 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.023250 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019008 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011196 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
H ? ? 0.51345 0.48472 24.73122 6.32584  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . VAL A 1 2   ? 21.04265  -1.94080 18.99141 1.000 68.43789  ? 2   VAL A N    1 
ATOM   2    C CA   . VAL A 1 2   ? 19.88069  -2.25265 18.17223 1.000 59.11462  ? 2   VAL A CA   1 
ATOM   3    C C    . VAL A 1 2   ? 19.02910  -1.00259 17.99215 1.000 49.79970  ? 2   VAL A C    1 
ATOM   4    O O    . VAL A 1 2   ? 19.34586  0.06251  18.52196 1.000 50.00763  ? 2   VAL A O    1 
ATOM   5    C CB   . VAL A 1 2   ? 19.03263  -3.38106 18.78292 1.000 62.13776  ? 2   VAL A CB   1 
ATOM   6    C CG1  . VAL A 1 2   ? 19.90512  -4.57851 19.12272 1.000 69.23059  ? 2   VAL A CG1  1 
ATOM   7    C CG2  . VAL A 1 2   ? 18.27672  -2.87819 20.00751 1.000 62.44749  ? 2   VAL A CG2  1 
ATOM   8    H HA   . VAL A 1 2   ? 20.19290  -2.55747 17.30591 1.000 70.95015  ? 2   VAL A HA   1 
ATOM   9    H HB   . VAL A 1 2   ? 18.37522  -3.67256 18.13196 1.000 74.57792  ? 2   VAL A HB   1 
ATOM   10   H HG11 . VAL A 1 2   ? 20.74225  -4.50700 18.63795 1.000 83.08931  ? 2   VAL A HG11 1 
ATOM   11   H HG12 . VAL A 1 2   ? 20.07534  -4.58438 20.07766 1.000 83.08931  ? 2   VAL A HG12 1 
ATOM   12   H HG13 . VAL A 1 2   ? 19.44158  -5.39046 18.86436 1.000 83.08931  ? 2   VAL A HG13 1 
ATOM   13   H HG21 . VAL A 1 2   ? 18.79251  -2.17342 20.42961 1.000 74.94960  ? 2   VAL A HG21 1 
ATOM   14   H HG22 . VAL A 1 2   ? 17.41422  -2.53423 19.72700 1.000 74.94960  ? 2   VAL A HG22 1 
ATOM   15   H HG23 . VAL A 1 2   ? 18.15365  -3.61440 20.62699 1.000 74.94960  ? 2   VAL A HG23 1 
ATOM   16   N N    . ASN A 1 3   ? 17.93158  -1.14461 17.26204 1.000 44.52988  ? 3   ASN A N    1 
ATOM   17   C CA   . ASN A 1 3   ? 17.09304  0.00541  16.97008 1.000 30.45567  ? 3   ASN A CA   1 
ATOM   18   C C    . ASN A 1 3   ? 16.34467  0.44933  18.22252 1.000 25.31057  ? 3   ASN A C    1 
ATOM   19   O O    . ASN A 1 3   ? 15.87673  -0.39032 18.99766 1.000 30.42762  ? 3   ASN A O    1 
ATOM   20   C CB   . ASN A 1 3   ? 16.08678  -0.32246 15.87344 1.000 25.83638  ? 3   ASN A CB   1 
ATOM   21   C CG   . ASN A 1 3   ? 16.70782  -0.33608 14.50138 1.000 28.52180  ? 3   ASN A CG   1 
ATOM   22   O OD1  . ASN A 1 3   ? 17.71549  0.32605  14.25289 1.000 30.26996  ? 3   ASN A OD1  1 
ATOM   23   N ND2  . ASN A 1 3   ? 16.10071  -1.08414 13.59148 1.000 36.04288  ? 3   ASN A ND2  1 
ATOM   24   H H    . ASN A 1 3   ? 17.65385  -1.88687 16.92809 1.000 53.44847  ? 3   ASN A H    1 
ATOM   25   H HA   . ASN A 1 3   ? 17.65559  0.73482  16.66611 1.000 36.55942  ? 3   ASN A HA   1 
ATOM   26   H HB2  . ASN A 1 3   ? 15.71039  -1.20052 16.04150 1.000 31.01627  ? 3   ASN A HB2  1 
ATOM   27   H HB3  . ASN A 1 3   ? 15.38410  0.34621  15.87846 1.000 31.01627  ? 3   ASN A HB3  1 
ATOM   28   H HD21 . ASN A 1 3   ? 16.41400  -1.12740 12.79175 1.000 43.26407  ? 3   ASN A HD21 1 
ATOM   29   H HD22 . ASN A 1 3   ? 15.39341  -1.52636 13.80072 1.000 43.26407  ? 3   ASN A HD22 1 
ATOM   30   N N    . PRO A 1 4   ? 16.18992  1.75344  18.43610 1.000 27.80816  ? 4   PRO A N    1 
ATOM   31   C CA   . PRO A 1 4   ? 15.45435  2.20802  19.61796 1.000 24.36148  ? 4   PRO A CA   1 
ATOM   32   C C    . PRO A 1 4   ? 13.96350  1.95615  19.48884 1.000 33.24149  ? 4   PRO A C    1 
ATOM   33   O O    . PRO A 1 4   ? 13.40525  1.89141  18.38946 1.000 24.51727  ? 4   PRO A O    1 
ATOM   34   C CB   . PRO A 1 4   ? 15.76042  3.70913  19.68191 1.000 39.59105  ? 4   PRO A CB   1 
ATOM   35   C CG   . PRO A 1 4   ? 16.07889  4.08575  18.29717 1.000 41.06481  ? 4   PRO A CG   1 
ATOM   36   C CD   . PRO A 1 4   ? 16.70724  2.88215  17.63866 1.000 33.61119  ? 4   PRO A CD   1 
ATOM   37   H HA   . PRO A 1 4   ? 15.79054  1.77125  20.41616 1.000 29.24639  ? 4   PRO A HA   1 
ATOM   38   H HB2  . PRO A 1 4   ? 14.98328  4.19208  20.00395 1.000 47.52188  ? 4   PRO A HB2  1 
ATOM   39   H HB3  . PRO A 1 4   ? 16.51643  3.86820  20.26846 1.000 47.52188  ? 4   PRO A HB3  1 
ATOM   40   H HG2  . PRO A 1 4   ? 15.26278  4.33592  17.83642 1.000 49.29038  ? 4   PRO A HG2  1 
ATOM   41   H HG3  . PRO A 1 4   ? 16.69930  4.83138  18.30155 1.000 49.29038  ? 4   PRO A HG3  1 
ATOM   42   H HD2  . PRO A 1 4   ? 16.42652  2.80870  16.71308 1.000 40.34604  ? 4   PRO A HD2  1 
ATOM   43   H HD3  . PRO A 1 4   ? 17.67490  2.92629  17.68936 1.000 40.34604  ? 4   PRO A HD3  1 
ATOM   44   N N    . THR A 1 5   ? 13.33046  1.80067  20.64844 1.000 24.40159  ? 5   THR A N    1 
ATOM   45   C CA   . THR A 1 5   ? 11.88880  1.66959  20.77969 1.000 22.24477  ? 5   THR A CA   1 
ATOM   46   C C    . THR A 1 5   ? 11.37976  2.85224  21.59091 1.000 22.36478  ? 5   THR A C    1 
ATOM   47   O O    . THR A 1 5   ? 11.91630  3.14830  22.66358 1.000 24.90141  ? 5   THR A O    1 
ATOM   48   C CB   . THR A 1 5   ? 11.50090  0.36434  21.48140 1.000 26.51245  ? 5   THR A CB   1 
ATOM   49   O OG1  . THR A 1 5   ? 12.00557  -0.75509 20.74555 1.000 34.47492  ? 5   THR A OG1  1 
ATOM   50   C CG2  . THR A 1 5   ? 9.98140   0.25866  21.60181 1.000 38.75796  ? 5   THR A CG2  1 
ATOM   51   H H    . THR A 1 5   ? 13.73645  1.76700  21.40582 1.000 29.29452  ? 5   THR A H    1 
ATOM   52   H HA   . THR A 1 5   ? 11.47965  1.67117  19.90021 1.000 26.70633  ? 5   THR A HA   1 
ATOM   53   H HB   . THR A 1 5   ? 11.88119  0.35087  22.37364 1.000 31.82755  ? 5   THR A HB   1 
ATOM   54   H HG1  . THR A 1 5   ? 11.82315  -1.46938 21.14817 1.000 41.38252  ? 5   THR A HG1  1 
ATOM   55   H HG21 . THR A 1 5   ? 9.73296   -0.63201 21.89486 1.000 46.52216  ? 5   THR A HG21 1 
ATOM   56   H HG22 . THR A 1 5   ? 9.65395   0.90502  22.24672 1.000 46.52216  ? 5   THR A HG22 1 
ATOM   57   H HG23 . THR A 1 5   ? 9.56748   0.43415  20.74229 1.000 46.52216  ? 5   THR A HG23 1 
ATOM   58   N N    A VAL A 1 6   ? 10.35791  3.53135  21.08716 0.639 17.84730  ? 6   VAL A N    1 
ATOM   59   N N    B VAL A 1 6   ? 10.34632  3.50897  21.07333 0.361 17.94755  ? 6   VAL A N    1 
ATOM   60   C CA   A VAL A 1 6   ? 9.74897   4.62722  21.82872 0.639 16.57033  ? 6   VAL A CA   1 
ATOM   61   C CA   B VAL A 1 6   ? 9.69260   4.64601  21.70339 0.361 20.53948  ? 6   VAL A CA   1 
ATOM   62   C C    A VAL A 1 6   ? 8.26436   4.34406  21.99385 0.639 23.83608  ? 6   VAL A C    1 
ATOM   63   C C    B VAL A 1 6   ? 8.26907   4.22498  22.04974 0.361 22.28647  ? 6   VAL A C    1 
ATOM   64   O O    A VAL A 1 6   ? 7.64275   3.66661  21.16866 0.639 19.56593  ? 6   VAL A O    1 
ATOM   65   O O    B VAL A 1 6   ? 7.70768   3.30214  21.45938 0.361 18.16977  ? 6   VAL A O    1 
ATOM   66   C CB   A VAL A 1 6   ? 9.96642   5.99524  21.14708 0.639 35.69478  ? 6   VAL A CB   1 
ATOM   67   C CB   B VAL A 1 6   ? 9.71519   5.87052  20.76342 0.361 16.54155  ? 6   VAL A CB   1 
ATOM   68   C CG1  A VAL A 1 6   ? 11.44710  6.31787  21.07082 0.639 32.89663  ? 6   VAL A CG1  1 
ATOM   69   C CG1  B VAL A 1 6   ? 8.58517   6.83209  21.05987 0.361 14.87959  ? 6   VAL A CG1  1 
ATOM   70   C CG2  A VAL A 1 6   ? 9.33751   6.00705  19.76946 0.639 24.30735  ? 6   VAL A CG2  1 
ATOM   71   C CG2  B VAL A 1 6   ? 11.07366  6.56830  20.84752 0.361 23.02835  ? 6   VAL A CG2  1 
ATOM   72   H H    A VAL A 1 6   ? 10.00082  3.37665  20.32025 0.639 21.42937  ? 6   VAL A H    1 
ATOM   73   H H    B VAL A 1 6   ? 9.98868   3.30267  20.31892 0.361 21.54968  ? 6   VAL A H    1 
ATOM   74   H HA   A VAL A 1 6   ? 10.15459  4.66558  22.70900 0.639 19.82134  ? 6   VAL A HA   1 
ATOM   75   H HA   B VAL A 1 6   ? 10.13701  4.89258  22.52958 0.361 24.65999  ? 6   VAL A HA   1 
ATOM   76   H HB   A VAL A 1 6   ? 9.53639   6.68507  21.67634 0.639 42.84635  ? 6   VAL A HB   1 
ATOM   77   H HB   B VAL A 1 6   ? 9.58185   5.56179  19.85358 0.361 19.86247  ? 6   VAL A HB   1 
ATOM   78   H HG11 A VAL A 1 6   ? 11.56032  7.18365  20.64832 0.639 39.48857  ? 6   VAL A HG11 1 
ATOM   79   H HG11 B VAL A 1 6   ? 8.72852   7.65137  20.56074 0.361 17.86811  ? 6   VAL A HG11 1 
ATOM   80   H HG12 A VAL A 1 6   ? 11.81264  6.33783  21.96909 0.639 39.48857  ? 6   VAL A HG12 1 
ATOM   81   H HG12 B VAL A 1 6   ? 7.74601   6.42498  20.79346 0.361 17.86811  ? 6   VAL A HG12 1 
ATOM   82   H HG13 A VAL A 1 6   ? 11.89287  5.63357  20.54745 0.639 39.48857  ? 6   VAL A HG13 1 
ATOM   83   H HG13 B VAL A 1 6   ? 8.57343   7.02199  22.01103 0.361 17.86811  ? 6   VAL A HG13 1 
ATOM   84   H HG21 A VAL A 1 6   ? 8.38430   5.84967  19.85610 0.639 29.18144  ? 6   VAL A HG21 1 
ATOM   85   H HG21 B VAL A 1 6   ? 11.07681  7.32721  20.24341 0.361 27.64664  ? 6   VAL A HG21 1 
ATOM   86   H HG22 A VAL A 1 6   ? 9.49401   6.87153  19.35827 0.639 29.18144  ? 6   VAL A HG22 1 
ATOM   87   H HG22 B VAL A 1 6   ? 11.21800  6.86978  21.75811 0.361 27.64664  ? 6   VAL A HG22 1 
ATOM   88   H HG23 A VAL A 1 6   ? 9.74081   5.30734  19.23219 0.639 29.18144  ? 6   VAL A HG23 1 
ATOM   89   H HG23 B VAL A 1 6   ? 11.76763  5.94014  20.59313 0.361 27.64664  ? 6   VAL A HG23 1 
ATOM   90   N N    . PHE A 1 7   ? 7.69985   4.85723  23.08007 1.000 21.43424  ? 7   PHE A N    1 
ATOM   91   C CA   . PHE A 1 7   ? 6.28808   4.67794  23.37240 1.000 19.06592  ? 7   PHE A CA   1 
ATOM   92   C C    . PHE A 1 7   ? 5.55020   6.00706  23.40927 1.000 18.84316  ? 7   PHE A C    1 
ATOM   93   O O    . PHE A 1 7   ? 6.11973   7.05491  23.73465 1.000 18.01955  ? 7   PHE A O    1 
ATOM   94   C CB   . PHE A 1 7   ? 6.08284   3.93476  24.70736 1.000 19.95672  ? 7   PHE A CB   1 
ATOM   95   C CG   . PHE A 1 7   ? 6.34726   4.77426  25.91961 1.000 21.19561  ? 7   PHE A CG   1 
ATOM   96   C CD1  . PHE A 1 7   ? 7.61541   4.83672  26.47634 1.000 25.03405  ? 7   PHE A CD1  1 
ATOM   97   C CD2  . PHE A 1 7   ? 5.32163   5.49528  26.50784 1.000 22.29622  ? 7   PHE A CD2  1 
ATOM   98   C CE1  . PHE A 1 7   ? 7.85582   5.61339  27.59439 1.000 32.02289  ? 7   PHE A CE1  1 
ATOM   99   C CE2  . PHE A 1 7   ? 5.55144   6.26791  27.61807 1.000 22.37265  ? 7   PHE A CE2  1 
ATOM   100  C CZ   . PHE A 1 7   ? 6.82093   6.33092  28.16624 1.000 25.30085  ? 7   PHE A CZ   1 
ATOM   101  H H    . PHE A 1 7   ? 8.12061   5.31958  23.67066 1.000 25.73370  ? 7   PHE A H    1 
ATOM   102  H HA   . PHE A 1 7   ? 5.89427   4.15595  22.65592 1.000 22.89172  ? 7   PHE A HA   1 
ATOM   103  H HB2  . PHE A 1 7   ? 5.16341   3.62935  24.75496 1.000 23.96068  ? 7   PHE A HB2  1 
ATOM   104  H HB3  . PHE A 1 7   ? 6.68641   3.17598  24.73671 1.000 23.96068  ? 7   PHE A HB3  1 
ATOM   105  H HD1  . PHE A 1 7   ? 8.31078   4.35167  26.09411 1.000 30.05347  ? 7   PHE A HD1  1 
ATOM   106  H HD2  . PHE A 1 7   ? 4.46601   5.45525  26.14561 1.000 26.76808  ? 7   PHE A HD2  1 
ATOM   107  H HE1  . PHE A 1 7   ? 8.70981   5.65322  27.96047 1.000 38.44008  ? 7   PHE A HE1  1 
ATOM   108  H HE2  . PHE A 1 7   ? 4.85450   6.74916  28.00223 1.000 26.85979  ? 7   PHE A HE2  1 
ATOM   109  H HZ   . PHE A 1 7   ? 6.97780   6.85516  28.91822 1.000 30.37363  ? 7   PHE A HZ   1 
ATOM   110  N N    . PHE A 1 8   ? 4.27721   5.93683  23.02320 1.000 18.89258  ? 8   PHE A N    1 
ATOM   111  C CA   . PHE A 1 8   ? 3.29505   6.98178  23.25016 1.000 16.35923  ? 8   PHE A CA   1 
ATOM   112  C C    . PHE A 1 8   ? 2.20130   6.40416  24.14165 1.000 16.53517  ? 8   PHE A C    1 
ATOM   113  O O    . PHE A 1 8   ? 1.65728   5.33761  23.82971 1.000 17.46012  ? 8   PHE A O    1 
ATOM   114  C CB   . PHE A 1 8   ? 2.59500   7.44744  21.96903 1.000 15.39082  ? 8   PHE A CB   1 
ATOM   115  C CG   . PHE A 1 8   ? 3.43685   8.24117  21.00890 1.000 16.62251  ? 8   PHE A CG   1 
ATOM   116  C CD1  . PHE A 1 8   ? 4.72123   8.65329  21.30209 1.000 19.80410  ? 8   PHE A CD1  1 
ATOM   117  C CD2  . PHE A 1 8   ? 2.89426   8.59213  19.78283 1.000 18.42728  ? 8   PHE A CD2  1 
ATOM   118  C CE1  . PHE A 1 8   ? 5.44994   9.39651  20.37930 1.000 20.34114  ? 8   PHE A CE1  1 
ATOM   119  C CE2  . PHE A 1 8   ? 3.61452   9.32802  18.86701 1.000 17.63402  ? 8   PHE A CE2  1 
ATOM   120  C CZ   . PHE A 1 8   ? 4.89080   9.73281  19.16534 1.000 17.94041  ? 8   PHE A CZ   1 
ATOM   121  H H    . PHE A 1 8   ? 3.94825   5.25905  22.60847 1.000 22.68371  ? 8   PHE A H    1 
ATOM   122  H HA   . PHE A 1 8   ? 3.75461   7.73528  23.65257 1.000 19.64369  ? 8   PHE A HA   1 
ATOM   123  H HB2  . PHE A 1 8   ? 2.28051   6.66288  21.49315 1.000 18.48160  ? 8   PHE A HB2  1 
ATOM   124  H HB3  . PHE A 1 8   ? 1.84322   8.00646  22.22046 1.000 18.48160  ? 8   PHE A HB3  1 
ATOM   125  H HD1  . PHE A 1 8   ? 5.10167   8.43272  22.12155 1.000 23.77754  ? 8   PHE A HD1  1 
ATOM   126  H HD2  . PHE A 1 8   ? 2.02790   8.32602  19.57425 1.000 22.12534  ? 8   PHE A HD2  1 
ATOM   127  H HE1  . PHE A 1 8   ? 6.31633   9.66706  20.58195 1.000 24.42198  ? 8   PHE A HE1  1 
ATOM   128  H HE2  . PHE A 1 8   ? 3.23559   9.55007  18.04725 1.000 21.17344  ? 8   PHE A HE2  1 
ATOM   129  H HZ   . PHE A 1 8   ? 5.37730   10.23269 18.55026 1.000 21.54110  ? 8   PHE A HZ   1 
ATOM   130  N N    . ASP A 1 9   ? 1.84558   7.10865  25.21256 1.000 17.37616  ? 9   ASP A N    1 
ATOM   131  C CA   . ASP A 1 9   ? 0.62942   6.82150  25.96663 1.000 18.56132  ? 9   ASP A CA   1 
ATOM   132  C C    . ASP A 1 9   ? -0.44764  7.77527  25.46302 1.000 20.47711  ? 9   ASP A C    1 
ATOM   133  O O    . ASP A 1 9   ? -0.29132  8.99647  25.56688 1.000 19.75023  ? 9   ASP A O    1 
ATOM   134  C CB   . ASP A 1 9   ? 0.83190   6.99348  27.46898 1.000 17.63359  ? 9   ASP A CB   1 
ATOM   135  C CG   . ASP A 1 9   ? 1.60356   5.84939  28.09286 1.000 22.62132  ? 9   ASP A CG   1 
ATOM   136  O OD1  . ASP A 1 9   ? 1.71670   4.76568  27.48004 1.000 25.74372  ? 9   ASP A OD1  1 
ATOM   137  O OD2  . ASP A 1 9   ? 2.09325   6.04020  29.22039 1.000 27.48071  ? 9   ASP A OD2  1 
ATOM   138  H H    . ASP A 1 9   ? 2.29993   7.76801  25.52625 1.000 20.86400  ? 9   ASP A H    1 
ATOM   139  H HA   . ASP A 1 9   ? 0.36051   5.90122  25.81942 1.000 22.28619  ? 9   ASP A HA   1 
ATOM   140  H HB2  . ASP A 1 9   ? 1.32757   7.81174  27.62919 1.000 21.09725  ? 9   ASP A HB2  1 
ATOM   141  H HB3  . ASP A 1 9   ? -0.03523  7.04086  27.90111 1.000 21.09725  ? 9   ASP A HB3  1 
ATOM   142  N N    . ILE A 1 10  ? -1.52509  7.22206  24.91583 1.000 16.56206  ? 10  ILE A N    1 
ATOM   143  C CA   . ILE A 1 10  ? -2.56132  7.99283  24.23459 1.000 19.27013  ? 10  ILE A CA   1 
ATOM   144  C C    . ILE A 1 10  ? -3.72663  8.23104  25.18315 1.000 18.47331  ? 10  ILE A C    1 
ATOM   145  O O    . ILE A 1 10  ? -4.13846  7.32588  25.91857 1.000 19.90323  ? 10  ILE A O    1 
ATOM   146  C CB   . ILE A 1 10  ? -3.04431  7.25955  22.96288 1.000 18.35473  ? 10  ILE A CB   1 
ATOM   147  C CG1  . ILE A 1 10  ? -1.87027  6.94077  22.03456 1.000 24.27825  ? 10  ILE A CG1  1 
ATOM   148  C CG2  . ILE A 1 10  ? -4.16003  8.05446  22.28167 1.000 19.47264  ? 10  ILE A CG2  1 
ATOM   149  C CD1  . ILE A 1 10  ? -1.18952  8.13152  21.44431 1.000 23.04075  ? 10  ILE A CD1  1 
ATOM   150  H H    . ILE A 1 10  ? -1.68317  6.37678  24.92645 1.000 19.88708  ? 10  ILE A H    1 
ATOM   151  H HA   . ILE A 1 10  ? -2.19245  8.85449  23.98483 1.000 23.13677  ? 10  ILE A HA   1 
ATOM   152  H HB   . ILE A 1 10  ? -3.42459  6.40362  23.21523 1.000 22.03828  ? 10  ILE A HB   1 
ATOM   153  H HG12 . ILE A 1 10  ? -1.20546  6.44656  22.53923 1.000 29.14651  ? 10  ILE A HG12 1 
ATOM   154  H HG13 . ILE A 1 10  ? -2.19849  6.39971  21.29943 1.000 29.14651  ? 10  ILE A HG13 1 
ATOM   155  H HG21 . ILE A 1 10  ? -4.27771  7.72257  21.37784 1.000 23.37978  ? 10  ILE A HG21 1 
ATOM   156  H HG22 . ILE A 1 10  ? -4.98130  7.94110  22.78522 1.000 23.37978  ? 10  ILE A HG22 1 
ATOM   157  H HG23 . ILE A 1 10  ? -3.91197  8.99196  22.26011 1.000 23.37978  ? 10  ILE A HG23 1 
ATOM   158  H HD11 . ILE A 1 10  ? -0.53243  7.83106  20.79711 1.000 27.66151  ? 10  ILE A HD11 1 
ATOM   159  H HD12 . ILE A 1 10  ? -1.85191  8.69007  21.00826 1.000 27.66151  ? 10  ILE A HD12 1 
ATOM   160  H HD13 . ILE A 1 10  ? -0.75229  8.62890  22.15307 1.000 27.66151  ? 10  ILE A HD13 1 
ATOM   161  N N    . ALA A 1 11  ? -4.28272  9.44095  25.14962 1.000 17.87570  ? 11  ALA A N    1 
ATOM   162  C CA   . ALA A 1 11  ? -5.48168  9.76326  25.90890 1.000 20.62144  ? 11  ALA A CA   1 
ATOM   163  C C    . ALA A 1 11  ? -6.54335  10.31779 24.97025 1.000 20.31995  ? 11  ALA A C    1 
ATOM   164  O O    . ALA A 1 11  ? -6.22898  10.93071 23.94894 1.000 19.65658  ? 11  ALA A O    1 
ATOM   165  C CB   . ALA A 1 11  ? -5.20206  10.77958 27.02062 1.000 23.02839  ? 11  ALA A CB   1 
ATOM   166  H H    . ALA A 1 11  ? -3.97713  10.09842 24.68708 1.000 21.38778  ? 11  ALA A H    1 
ATOM   167  H HA   . ALA A 1 11  ? -5.82302  8.95432  26.32121 1.000 24.75834  ? 11  ALA A HA   1 
ATOM   168  H HB1  . ALA A 1 11  ? -6.03942  11.01853 27.44798 1.000 27.64668  ? 11  ALA A HB1  1 
ATOM   169  H HB2  . ALA A 1 11  ? -4.60157  10.38057 27.66954 1.000 27.64668  ? 11  ALA A HB2  1 
ATOM   170  H HB3  . ALA A 1 11  ? -4.79228  11.56814 26.63185 1.000 27.64668  ? 11  ALA A HB3  1 
ATOM   171  N N    . VAL A 1 12  ? -7.80409  10.09557 25.33072 1.000 21.03825  ? 12  VAL A N    1 
ATOM   172  C CA   . VAL A 1 12  ? -8.95889  10.55943 24.56758 1.000 21.96729  ? 12  VAL A CA   1 
ATOM   173  C C    . VAL A 1 12  ? -9.76157  11.45436 25.49879 1.000 23.81100  ? 12  VAL A C    1 
ATOM   174  O O    . VAL A 1 12  ? -10.33613 10.96891 26.48072 1.000 24.71178  ? 12  VAL A O    1 
ATOM   175  C CB   . VAL A 1 12  ? -9.81165  9.39026  24.05474 1.000 23.91491  ? 12  VAL A CB   1 
ATOM   176  C CG1  . VAL A 1 12  ? -11.05048 9.89506  23.33146 1.000 28.25510  ? 12  VAL A CG1  1 
ATOM   177  C CG2  . VAL A 1 12  ? -8.97133  8.48992  23.17282 1.000 26.18812  ? 12  VAL A CG2  1 
ATOM   178  H H    . VAL A 1 12  ? -8.02360  9.66205  26.04028 1.000 25.18283  ? 12  VAL A H    1 
ATOM   179  H HA   . VAL A 1 12  ? -8.66596  11.08053 23.80368 1.000 26.29769  ? 12  VAL A HA   1 
ATOM   180  H HB   . VAL A 1 12  ? -10.12395 8.86416  24.80746 1.000 28.71050  ? 12  VAL A HB   1 
ATOM   181  H HG11 . VAL A 1 12  ? -11.47423 9.15174  22.87449 1.000 33.91873  ? 12  VAL A HG11 1 
ATOM   182  H HG12 . VAL A 1 12  ? -11.66202 10.27611 23.98086 1.000 33.91873  ? 12  VAL A HG12 1 
ATOM   183  H HG13 . VAL A 1 12  ? -10.78697 10.57180 22.68844 1.000 33.91873  ? 12  VAL A HG13 1 
ATOM   184  H HG21 . VAL A 1 12  ? -9.55193  7.85371  22.72669 1.000 31.43836  ? 12  VAL A HG21 1 
ATOM   185  H HG22 . VAL A 1 12  ? -8.50937  9.03355  22.51558 1.000 31.43836  ? 12  VAL A HG22 1 
ATOM   186  H HG23 . VAL A 1 12  ? -8.32710  8.01938  23.72461 1.000 31.43836  ? 12  VAL A HG23 1 
ATOM   187  N N    . ASP A 1 13  ? -9.80763  12.75507 25.19785 1.000 24.06738  ? 13  ASP A N    1 
ATOM   188  C CA   . ASP A 1 13  ? -10.44257 13.73691 26.08242 1.000 25.63416  ? 13  ASP A CA   1 
ATOM   189  C C    . ASP A 1 13  ? -9.94305  13.55929 27.51456 1.000 25.87090  ? 13  ASP A C    1 
ATOM   190  O O    . ASP A 1 13  ? -10.70329 13.62967 28.48492 1.000 29.98574  ? 13  ASP A O    1 
ATOM   191  C CB   . ASP A 1 13  ? -11.96624 13.64376 26.01628 1.000 27.58542  ? 13  ASP A CB   1 
ATOM   192  C CG   . ASP A 1 13  ? -12.55398 14.42521 24.84743 1.000 31.62408  ? 13  ASP A CG   1 
ATOM   193  O OD1  . ASP A 1 13  ? -11.80434 15.13666 24.14279 1.000 30.55946  ? 13  ASP A OD1  1 
ATOM   194  O OD2  . ASP A 1 13  ? -13.77861 14.32393 24.63389 1.000 42.25542  ? 13  ASP A OD2  1 
ATOM   195  H H    . ASP A 1 13  ? -9.47573  13.09647 24.48169 1.000 28.89347  ? 13  ASP A H    1 
ATOM   196  H HA   . ASP A 1 13  ? -10.19628 14.62684 25.78534 1.000 30.69794  ? 13  ASP A HA   1 
ATOM   197  H HB2  . ASP A 1 13  ? -12.22201 12.71367 25.91421 1.000 33.03944  ? 13  ASP A HB2  1 
ATOM   198  H HB3  . ASP A 1 13  ? -12.34082 14.00281 26.83583 1.000 33.03944  ? 13  ASP A HB3  1 
ATOM   199  N N    . GLY A 1 14  ? -8.64338  13.29764 27.63769 1.000 26.74094  ? 14  GLY A N    1 
ATOM   200  C CA   . GLY A 1 14  ? -7.99969  13.14204 28.91892 1.000 33.09931  ? 14  GLY A CA   1 
ATOM   201  C C    . GLY A 1 14  ? -8.09322  11.76808 29.54274 1.000 30.36756  ? 14  GLY A C    1 
ATOM   202  O O    . GLY A 1 14  ? -7.39602  11.51361 30.53340 1.000 42.60972  ? 14  GLY A O    1 
ATOM   203  H H    . GLY A 1 14  ? -8.10753  13.20505 26.97144 1.000 32.10174  ? 14  GLY A H    1 
ATOM   204  H HA2  . GLY A 1 14  ? -7.05824  13.35189 28.81625 1.000 39.73179  ? 14  GLY A HA2  1 
ATOM   205  H HA3  . GLY A 1 14  ? -8.39768  13.77175 29.54018 1.000 39.73179  ? 14  GLY A HA3  1 
ATOM   206  N N    A GLU A 1 15  ? -8.97062  10.87899 29.03051 0.503 24.96547  ? 15  GLU A N    1 
ATOM   207  N N    B GLU A 1 15  ? -8.88660  10.86913 28.99273 0.497 24.84206  ? 15  GLU A N    1 
ATOM   208  C CA   A GLU A 1 15  ? -9.02947  9.52526  29.57109 0.503 25.27972  ? 15  GLU A CA   1 
ATOM   209  C CA   B GLU A 1 15  ? -9.03246  9.53584  29.57550 0.497 25.28767  ? 15  GLU A CA   1 
ATOM   210  C C    A GLU A 1 15  ? -7.94799  8.66139  28.92661 0.503 26.18583  ? 15  GLU A C    1 
ATOM   211  C C    B GLU A 1 15  ? -8.05303  8.56669  28.92111 0.497 24.92364  ? 15  GLU A C    1 
ATOM   212  O O    A GLU A 1 15  ? -7.73266  8.74246  27.71385 0.503 22.43485  ? 15  GLU A O    1 
ATOM   213  O O    B GLU A 1 15  ? -7.99922  8.49341  27.68770 0.497 27.32228  ? 15  GLU A O    1 
ATOM   214  C CB   A GLU A 1 15  ? -10.39654 8.88034  29.32674 0.503 29.00675  ? 15  GLU A CB   1 
ATOM   215  C CB   B GLU A 1 15  ? -10.46491 9.04427  29.40472 0.497 32.36618  ? 15  GLU A CB   1 
ATOM   216  C CG   A GLU A 1 15  ? -10.47527 7.45075  29.87544 0.503 42.47165  ? 15  GLU A CG   1 
ATOM   217  C CG   B GLU A 1 15  ? -11.49672 9.95972  30.06943 0.497 33.60775  ? 15  GLU A CG   1 
ATOM   218  C CD   A GLU A 1 15  ? -11.85881 6.82729  29.78642 0.503 46.88360  ? 15  GLU A CD   1 
ATOM   219  C CD   B GLU A 1 15  ? -12.92303 9.47481  29.90567 0.497 50.80524  ? 15  GLU A CD   1 
ATOM   220  O OE1  A GLU A 1 15  ? -12.51202 6.94721  28.72816 0.503 40.71762  ? 15  GLU A OE1  1 
ATOM   221  O OE1  B GLU A 1 15  ? -13.83357 10.32575 29.80608 0.497 57.83237  ? 15  GLU A OE1  1 
ATOM   222  O OE2  A GLU A 1 15  ? -12.28749 6.20683  30.78319 0.503 41.44585  ? 15  GLU A OE2  1 
ATOM   223  O OE2  B GLU A 1 15  ? -13.13299 8.24457  29.87836 0.497 57.71024  ? 15  GLU A OE2  1 
ATOM   224  H H    A GLU A 1 15  ? -9.52133  11.03949 28.38976 0.503 29.89551  ? 15  GLU A H    1 
ATOM   225  H H    B GLU A 1 15  ? -9.35394  10.99913 28.28260 0.497 29.74742  ? 15  GLU A H    1 
ATOM   226  H HA   A GLU A 1 15  ? -8.88430  9.56407  30.52938 0.503 30.27260  ? 15  GLU A HA   1 
ATOM   227  H HA   B GLU A 1 15  ? -8.83060  9.55924  30.52397 0.497 30.28214  ? 15  GLU A HA   1 
ATOM   228  H HB2  A GLU A 1 15  ? -11.08003 9.41026  29.76598 0.503 34.82071  ? 15  GLU A HB2  1 
ATOM   229  H HB2  B GLU A 1 15  ? -10.67109 8.99912  28.45796 0.497 38.85203  ? 15  GLU A HB2  1 
ATOM   230  H HB3  A GLU A 1 15  ? -10.56512 8.84691  28.37209 0.503 34.82071  ? 15  GLU A HB3  1 
ATOM   231  H HB3  B GLU A 1 15  ? -10.54495 8.16390  29.80404 0.497 38.85203  ? 15  GLU A HB3  1 
ATOM   232  H HG2  A GLU A 1 15  ? -9.86660  6.88967  29.36986 0.503 50.97859  ? 15  GLU A HG2  1 
ATOM   233  H HG2  B GLU A 1 15  ? -11.30658 10.00933 31.01932 0.497 40.34191  ? 15  GLU A HG2  1 
ATOM   234  H HG3  A GLU A 1 15  ? -10.21712 7.46187  30.81039 0.503 50.97859  ? 15  GLU A HG3  1 
ATOM   235  H HG3  B GLU A 1 15  ? -11.43517 10.84252 29.67222 0.497 40.34191  ? 15  GLU A HG3  1 
ATOM   236  N N    . PRO A 1 16  ? -7.26745  7.81767  29.70144 1.000 25.66913  ? 16  PRO A N    1 
ATOM   237  C CA   . PRO A 1 16  ? -6.27150  6.92403  29.09660 1.000 24.71372  ? 16  PRO A CA   1 
ATOM   238  C C    . PRO A 1 16  ? -6.92615  5.91232  28.17193 1.000 26.57198  ? 16  PRO A C    1 
ATOM   239  O O    . PRO A 1 16  ? -7.95515  5.31637  28.49726 1.000 30.32333  ? 16  PRO A O    1 
ATOM   240  C CB   . PRO A 1 16  ? -5.61765  6.23122  30.30106 1.000 32.16582  ? 16  PRO A CB   1 
ATOM   241  C CG   . PRO A 1 16  ? -5.98131  7.04803  31.48292 1.000 48.70806  ? 16  PRO A CG   1 
ATOM   242  C CD   . PRO A 1 16  ? -7.31278  7.67095  31.16856 1.000 30.00761  ? 16  PRO A CD   1 
ATOM   243  H HA   . PRO A 1 16  ? -5.60655  7.43834  28.61263 1.000 29.66908  ? 16  PRO A HA   1 
ATOM   244  H HB2  . PRO A 1 16  ? -5.96349  5.32901  30.38658 1.000 38.61159  ? 16  PRO A HB2  1 
ATOM   245  H HB3  . PRO A 1 16  ? -4.65529  6.20770  30.18184 1.000 38.61159  ? 16  PRO A HB3  1 
ATOM   246  H HG2  . PRO A 1 16  ? -6.04619  6.47822  32.26522 1.000 58.46228  ? 16  PRO A HG2  1 
ATOM   247  H HG3  . PRO A 1 16  ? -5.30856  7.73210  31.62560 1.000 58.46228  ? 16  PRO A HG3  1 
ATOM   248  H HD2  . PRO A 1 16  ? -8.04045  7.08829  31.43671 1.000 36.02174  ? 16  PRO A HD2  1 
ATOM   249  H HD3  . PRO A 1 16  ? -7.40265  8.53453  31.60106 1.000 36.02174  ? 16  PRO A HD3  1 
ATOM   250  N N    . LEU A 1 17  ? -6.31946  5.73404  27.00212 1.000 21.21261  ? 17  LEU A N    1 
ATOM   251  C CA   . LEU A 1 17  ? -6.73041  4.72450  26.03762 1.000 21.38404  ? 17  LEU A CA   1 
ATOM   252  C C    . LEU A 1 17  ? -5.77721  3.54046  26.04742 1.000 25.96205  ? 17  LEU A C    1 
ATOM   253  O O    . LEU A 1 17  ? -6.19538  2.40003  26.25809 1.000 27.16434  ? 17  LEU A O    1 
ATOM   254  C CB   . LEU A 1 17  ? -6.79826  5.33094  24.63370 1.000 20.44159  ? 17  LEU A CB   1 
ATOM   255  C CG   . LEU A 1 17  ? -7.19299  4.37966  23.50373 1.000 22.29183  ? 17  LEU A CG   1 
ATOM   256  C CD1  . LEU A 1 17  ? -8.60117  3.88009  23.68152 1.000 33.34357  ? 17  LEU A CD1  1 
ATOM   257  C CD2  . LEU A 1 17  ? -7.04990  5.09096  22.16384 1.000 28.99360  ? 17  LEU A CD2  1 
ATOM   258  H H    . LEU A 1 17  ? -5.64708  6.20085  26.73832 1.000 25.39207  ? 17  LEU A H    1 
ATOM   259  H HA   . LEU A 1 17  ? -7.62126  4.40980  26.25728 1.000 25.59779  ? 17  LEU A HA   1 
ATOM   260  H HB2  . LEU A 1 17  ? -7.45229  6.04716  24.64616 1.000 24.46687  ? 17  LEU A HB2  1 
ATOM   261  H HB3  . LEU A 1 17  ? -5.92204  5.68556  24.41601 1.000 24.46687  ? 17  LEU A HB3  1 
ATOM   262  H HG   . LEU A 1 17  ? -6.60550  3.60795  23.51849 1.000 26.76280  ? 17  LEU A HG   1 
ATOM   263  H HD11 . LEU A 1 17  ? -8.83559  3.32035  22.92479 1.000 40.02489  ? 17  LEU A HD11 1 
ATOM   264  H HD12 . LEU A 1 17  ? -8.65242  3.36540  24.50211 1.000 40.02489  ? 17  LEU A HD12 1 
ATOM   265  H HD13 . LEU A 1 17  ? -9.20213  4.63998  23.72961 1.000 40.02489  ? 17  LEU A HD13 1 
ATOM   266  H HD21 . LEU A 1 17  ? -7.33698  4.49261  21.45641 1.000 34.80493  ? 17  LEU A HD21 1 
ATOM   267  H HD22 . LEU A 1 17  ? -7.60354  5.88743  22.16841 1.000 34.80493  ? 17  LEU A HD22 1 
ATOM   268  H HD23 . LEU A 1 17  ? -6.12021  5.33511  22.03361 1.000 34.80493  ? 17  LEU A HD23 1 
ATOM   269  N N    . GLY A 1 18  ? -4.49108  3.79922  25.86094 1.000 20.14005  ? 18  GLY A N    1 
ATOM   270  C CA   . GLY A 1 18  ? -3.51544  2.73502  25.89840 1.000 20.07212  ? 18  GLY A CA   1 
ATOM   271  C C    . GLY A 1 18  ? -2.18867  3.21886  25.35758 1.000 19.92279  ? 18  GLY A C    1 
ATOM   272  O O    . GLY A 1 18  ? -2.00192  4.40606  25.07761 1.000 21.60619  ? 18  GLY A O    1 
ATOM   273  H H    . GLY A 1 18  ? -4.16364  4.58035  25.71193 1.000 24.18067  ? 18  GLY A H    1 
ATOM   274  H HA2  . GLY A 1 18  ? -3.39097  2.43415  26.81212 1.000 24.02348  ? 18  GLY A HA2  1 
ATOM   275  H HA3  . GLY A 1 18  ? -3.82088  1.98887  25.35907 1.000 24.02348  ? 18  GLY A HA3  1 
ATOM   276  N N    . ARG A 1 19  ? -1.28081  2.26349  25.19685 1.000 18.89502  ? 19  ARG A N    1 
ATOM   277  C CA   . ARG A 1 19  ? 0.09256   2.53590  24.81332 1.000 18.01180  ? 19  ARG A CA   1 
ATOM   278  C C    . ARG A 1 19  ? 0.40422   1.94524  23.44690 1.000 17.66839  ? 19  ARG A C    1 
ATOM   279  O O    . ARG A 1 19  ? 0.03238   0.80679  23.14666 1.000 18.63880  ? 19  ARG A O    1 
ATOM   280  C CB   . ARG A 1 19  ? 1.05969   1.96581  25.86086 1.000 18.90579  ? 19  ARG A CB   1 
ATOM   281  C CG   . ARG A 1 19  ? 2.52019   2.09219  25.48695 1.000 18.41758  ? 19  ARG A CG   1 
ATOM   282  C CD   . ARG A 1 19  ? 3.41361   1.69316  26.64110 1.000 19.61388  ? 19  ARG A CD   1 
ATOM   283  N NE   . ARG A 1 19  ? 3.42589   2.71227  27.68869 1.000 21.91239  ? 19  ARG A NE   1 
ATOM   284  C CZ   . ARG A 1 19  ? 4.23482   2.68800  28.74163 1.000 26.41644  ? 19  ARG A CZ   1 
ATOM   285  N NH1  . ARG A 1 19  ? 5.09446   1.68901  28.88861 1.000 28.54719  ? 19  ARG A NH1  1 
ATOM   286  N NH2  . ARG A 1 19  ? 4.18274   3.65770  29.64738 1.000 25.76257  ? 19  ARG A NH2  1 
ATOM   287  H H    . ARG A 1 19  ? -1.44437  1.42657  25.30827 1.000 22.61095  ? 19  ARG A H    1 
ATOM   288  H HA   . ARG A 1 19  ? 0.22109   3.49492  24.74498 1.000 21.55110  ? 19  ARG A HA   1 
ATOM   289  H HB2  . ARG A 1 19  ? 0.92731   2.44040  26.69641 1.000 22.62389  ? 19  ARG A HB2  1 
ATOM   290  H HB3  . ARG A 1 19  ? 0.86677   1.02278  25.98080 1.000 22.62389  ? 19  ARG A HB3  1 
ATOM   291  H HG2  . ARG A 1 19  ? 2.71253   1.51053  24.73490 1.000 22.03804  ? 19  ARG A HG2  1 
ATOM   292  H HG3  . ARG A 1 19  ? 2.71501   3.01304  25.25246 1.000 22.03804  ? 19  ARG A HG3  1 
ATOM   293  H HD2  . ARG A 1 19  ? 3.08911   0.86414  27.02624 1.000 23.47359  ? 19  ARG A HD2  1 
ATOM   294  H HD3  . ARG A 1 19  ? 4.32105   1.57643  26.31887 1.000 23.47359  ? 19  ARG A HD3  1 
ATOM   295  H HE   . ARG A 1 19  ? 2.87475   3.36876  27.61886 1.000 26.30748  ? 19  ARG A HE   1 
ATOM   296  H HH11 . ARG A 1 19  ? 5.12672   1.05984  28.30320 1.000 34.26924  ? 19  ARG A HH11 1 
ATOM   297  H HH12 . ARG A 1 19  ? 5.61968   1.67032  29.56934 1.000 34.26924  ? 19  ARG A HH12 1 
ATOM   298  H HH21 . ARG A 1 19  ? 3.62376   4.30445  29.55327 1.000 30.92770  ? 19  ARG A HH21 1 
ATOM   299  H HH22 . ARG A 1 19  ? 4.70800   3.63896  30.32808 1.000 30.92770  ? 19  ARG A HH22 1 
ATOM   300  N N    A VAL A 1 20  ? 1.08671   2.74549  22.62860 0.665 16.52334  ? 20  VAL A N    1 
ATOM   301  N N    B VAL A 1 20  ? 1.08688   2.72074  22.61292 0.335 16.53495  ? 20  VAL A N    1 
ATOM   302  C CA   A VAL A 1 20  ? 1.66454   2.31947  21.35978 0.665 16.26739  ? 20  VAL A CA   1 
ATOM   303  C CA   B VAL A 1 20  ? 1.55307   2.24916  21.31504 0.335 16.33046  ? 20  VAL A CA   1 
ATOM   304  C C    A VAL A 1 20  ? 3.17909   2.40268  21.48690 0.665 16.38433  ? 20  VAL A C    1 
ATOM   305  C C    B VAL A 1 20  ? 3.05335   2.49276  21.24125 0.335 15.92802  ? 20  VAL A C    1 
ATOM   306  O O    A VAL A 1 20  ? 3.71096   3.37671  22.03196 0.665 15.99688  ? 20  VAL A O    1 
ATOM   307  O O    B VAL A 1 20  ? 3.51776   3.61824  21.45563 0.335 26.75978  ? 20  VAL A O    1 
ATOM   308  C CB   A VAL A 1 20  ? 1.16366   3.19836  20.19547 0.665 18.20438  ? 20  VAL A CB   1 
ATOM   309  C CB   B VAL A 1 20  ? 0.82028   2.94190  20.15015 0.335 15.67727  ? 20  VAL A CB   1 
ATOM   310  C CG1  A VAL A 1 20  ? 1.69072   2.69511  18.84583 0.665 24.82105  ? 20  VAL A CG1  1 
ATOM   311  C CG1  B VAL A 1 20  ? 0.94052   4.44388  20.27692 0.335 14.69453  ? 20  VAL A CG1  1 
ATOM   312  C CG2  A VAL A 1 20  ? -0.35409  3.25662  20.20610 0.665 21.93545  ? 20  VAL A CG2  1 
ATOM   313  C CG2  B VAL A 1 20  ? 1.36704   2.45904  18.80714 0.335 21.45115  ? 20  VAL A CG2  1 
ATOM   314  H H    A VAL A 1 20  ? 1.23323   3.57606  22.79675 0.665 19.76494  ? 20  VAL A H    1 
ATOM   315  H H    B VAL A 1 20  ? 1.29567   3.53813  22.77994 0.335 19.77888  ? 20  VAL A H    1 
ATOM   316  H HA   A VAL A 1 20  ? 1.41403   1.40072  21.17530 0.665 19.45780  ? 20  VAL A HA   1 
ATOM   317  H HA   B VAL A 1 20  ? 1.39305   1.29562  21.23725 0.335 19.53349  ? 20  VAL A HA   1 
ATOM   318  H HB   A VAL A 1 20  ? 1.50616   4.09822  20.31312 0.665 21.85787  ? 20  VAL A HB   1 
ATOM   319  H HB   B VAL A 1 20  ? -0.12120  2.71101  20.18476 0.335 18.74966  ? 20  VAL A HB   1 
ATOM   320  H HG11 A VAL A 1 20  ? 1.34016   3.25991  18.13943 0.665 29.79788  ? 20  VAL A HG11 1 
ATOM   321  H HG11 B VAL A 1 20  ? 0.40990   4.86299  19.58144 0.335 17.57038  ? 20  VAL A HG11 1 
ATOM   322  H HG12 A VAL A 1 20  ? 2.65990   2.73464  18.85068 0.665 29.79788  ? 20  VAL A HG12 1 
ATOM   323  H HG12 B VAL A 1 20  ? 0.61480   4.71422  21.14969 0.335 17.57038  ? 20  VAL A HG12 1 
ATOM   324  H HG13 A VAL A 1 20  ? 1.39765   1.77992  18.71374 0.665 29.79788  ? 20  VAL A HG13 1 
ATOM   325  H HG13 B VAL A 1 20  ? 1.87220   4.69549  20.17906 0.335 17.57038  ? 20  VAL A HG13 1 
ATOM   326  H HG21 A VAL A 1 20  ? -0.65718  3.73746  19.42008 0.665 26.33515  ? 20  VAL A HG21 1 
ATOM   327  H HG21 B VAL A 1 20  ? 0.78748   2.77726  18.09740 0.335 25.75399  ? 20  VAL A HG21 1 
ATOM   328  H HG22 A VAL A 1 20  ? -0.70491  2.35233  20.19640 0.665 26.33515  ? 20  VAL A HG22 1 
ATOM   329  H HG22 B VAL A 1 20  ? 2.26266   2.81122  18.68576 0.335 25.75399  ? 20  VAL A HG22 1 
ATOM   330  H HG23 A VAL A 1 20  ? -0.64686  3.71640  21.00847 0.665 26.33515  ? 20  VAL A HG23 1 
ATOM   331  H HG23 B VAL A 1 20  ? 1.38993   1.48931  18.80573 0.335 25.75399  ? 20  VAL A HG23 1 
ATOM   332  N N    A SER A 1 21  ? 3.87457   1.38266  20.99455 0.665 16.76547  ? 21  SER A N    1 
ATOM   333  N N    B SER A 1 21  ? 3.80809   1.43723  20.96136 0.335 18.66788  ? 21  SER A N    1 
ATOM   334  C CA   A SER A 1 21  ? 5.32672   1.41693  20.91197 0.665 16.83755  ? 21  SER A CA   1 
ATOM   335  C CA   B SER A 1 21  ? 5.25723   1.50550  20.87314 0.335 17.16390  ? 21  SER A CA   1 
ATOM   336  C C    A SER A 1 21  ? 5.75170   1.27622  19.45712 0.665 16.62903  ? 21  SER A C    1 
ATOM   337  C C    B SER A 1 21  ? 5.68952   1.37004  19.42111 0.335 16.52395  ? 21  SER A C    1 
ATOM   338  O O    A SER A 1 21  ? 5.10840   0.57442  18.66674 0.665 18.89691  ? 21  SER A O    1 
ATOM   339  O O    B SER A 1 21  ? 4.98266   0.78531  18.59331 0.335 17.87199  ? 21  SER A O    1 
ATOM   340  C CB   A SER A 1 21  ? 5.97750   0.32137  21.75953 0.665 25.23013  ? 21  SER A CB   1 
ATOM   341  C CB   B SER A 1 21  ? 5.90583   0.42055  21.73211 0.335 22.63441  ? 21  SER A CB   1 
ATOM   342  O OG   A SER A 1 21  ? 5.76328   -0.95688 21.19926 0.665 26.47585  ? 21  SER A OG   1 
ATOM   343  O OG   B SER A 1 21  ? 5.57677   0.61699  23.09805 0.335 29.19002  ? 21  SER A OG   1 
ATOM   344  H H    A SER A 1 21  ? 3.52282   0.65512  20.70033 0.665 20.09104  ? 21  SER A H    1 
ATOM   345  H H    B SER A 1 21  ? 3.49325   0.65043  20.81500 0.335 22.41406  ? 21  SER A H    1 
ATOM   346  H HA   A SER A 1 21  ? 5.64891   2.26790  21.24803 0.665 20.14199  ? 21  SER A HA   1 
ATOM   347  H HA   B SER A 1 21  ? 5.57185   2.36369  21.19783 0.335 20.60930  ? 21  SER A HA   1 
ATOM   348  H HB2  A SER A 1 21  ? 6.93205   0.48705  21.80737 0.665 30.28877  ? 21  SER A HB2  1 
ATOM   349  H HB2  B SER A 1 21  ? 5.58037   -0.44785 21.44775 0.335 27.17391  ? 21  SER A HB2  1 
ATOM   350  H HB3  A SER A 1 21  ? 5.59210   0.34254  22.64943 0.665 30.28877  ? 21  SER A HB3  1 
ATOM   351  H HB3  B SER A 1 21  ? 6.86912   0.46451  21.62700 0.335 27.17391  ? 21  SER A HB3  1 
ATOM   352  H HG   A SER A 1 21  ? 6.18178   -1.53724 21.63930 0.665 31.78363  ? 21  SER A HG   1 
ATOM   353  H HG   B SER A 1 21  ? 5.92460   0.01314  23.56708 0.335 35.04064  ? 21  SER A HG   1 
ATOM   354  N N    . PHE A 1 22  ? 6.82379   1.98987  19.11282 1.000 17.78674  ? 22  PHE A N    1 
ATOM   355  C CA   . PHE A 1 22  ? 7.36477   2.02300  17.76989 1.000 18.63380  ? 22  PHE A CA   1 
ATOM   356  C C    . PHE A 1 22  ? 8.81730   1.58899  17.75557 1.000 20.59176  ? 22  PHE A C    1 
ATOM   357  O O    . PHE A 1 22  ? 9.60646   2.02885  18.59612 1.000 22.46570  ? 22  PHE A O    1 
ATOM   358  C CB   . PHE A 1 22  ? 7.33117   3.43592  17.19878 1.000 16.19199  ? 22  PHE A CB   1 
ATOM   359  C CG   . PHE A 1 22  ? 6.02607   4.12822  17.34800 1.000 16.65412  ? 22  PHE A CG   1 
ATOM   360  C CD1  . PHE A 1 22  ? 5.02929   3.94719  16.41041 1.000 20.78488  ? 22  PHE A CD1  1 
ATOM   361  C CD2  . PHE A 1 22  ? 5.79781   4.98409  18.40829 1.000 21.54598  ? 22  PHE A CD2  1 
ATOM   362  C CE1  . PHE A 1 22  ? 3.81729   4.60570  16.53225 1.000 19.43580  ? 22  PHE A CE1  1 
ATOM   363  C CE2  . PHE A 1 22  ? 4.59349   5.64076  18.53441 1.000 26.48826  ? 22  PHE A CE2  1 
ATOM   364  C CZ   . PHE A 1 22  ? 3.60062   5.45023  17.59450 1.000 23.83549  ? 22  PHE A CZ   1 
ATOM   365  H H    . PHE A 1 22  ? 7.26755   2.47914  19.66353 1.000 21.35669  ? 22  PHE A H    1 
ATOM   366  H HA   . PHE A 1 22  ? 6.83903   1.41304  17.22911 1.000 22.37317  ? 22  PHE A HA   1 
ATOM   367  H HB2  . PHE A 1 22  ? 8.00008   3.96990  17.65521 1.000 19.44300  ? 22  PHE A HB2  1 
ATOM   368  H HB3  . PHE A 1 22  ? 7.53253   3.39117  16.25097 1.000 19.44300  ? 22  PHE A HB3  1 
ATOM   369  H HD1  . PHE A 1 22  ? 5.17317   3.37727  15.68972 1.000 24.95447  ? 22  PHE A HD1  1 
ATOM   370  H HD2  . PHE A 1 22  ? 6.46395   5.11823  19.04324 1.000 25.86779  ? 22  PHE A HD2  1 
ATOM   371  H HE1  . PHE A 1 22  ? 3.15108   4.47668  15.89631 1.000 23.33557  ? 22  PHE A HE1  1 
ATOM   372  H HE2  . PHE A 1 22  ? 4.44921   6.21285  19.25329 1.000 31.79853  ? 22  PHE A HE2  1 
ATOM   373  H HZ   . PHE A 1 22  ? 2.78693   5.89238  17.67994 1.000 28.61520  ? 22  PHE A HZ   1 
ATOM   374  N N    . GLU A 1 23  ? 9.17653   0.76434  16.77770 1.000 19.35108  ? 23  GLU A N    1 
ATOM   375  C CA   . GLU A 1 23  ? 10.57435  0.54894  16.43479 1.000 18.88031  ? 23  GLU A CA   1 
ATOM   376  C C    . GLU A 1 23  ? 10.99100  1.61728  15.42743 1.000 20.86273  ? 23  GLU A C    1 
ATOM   377  O O    . GLU A 1 23  ? 10.29579  1.84210  14.43059 1.000 20.47728  ? 23  GLU A O    1 
ATOM   378  C CB   . GLU A 1 23  ? 10.80388  -0.84456 15.85247 1.000 21.25159  ? 23  GLU A CB   1 
ATOM   379  C CG   . GLU A 1 23  ? 12.25206  -1.06523 15.43187 1.000 24.77479  ? 23  GLU A CG   1 
ATOM   380  C CD   . GLU A 1 23  ? 12.50260  -2.41417 14.77421 1.000 33.44784  ? 23  GLU A CD   1 
ATOM   381  O OE1  . GLU A 1 23  ? 11.58057  -3.25649 14.73193 1.000 39.06717  ? 23  GLU A OE1  1 
ATOM   382  O OE2  . GLU A 1 23  ? 13.63407  -2.62631 14.29151 1.000 33.67993  ? 23  GLU A OE2  1 
ATOM   383  H H    . GLU A 1 23  ? 8.62384   0.31533  16.29548 1.000 23.23391  ? 23  GLU A H    1 
ATOM   384  H HA   . GLU A 1 23  ? 11.12145  0.61811  17.23278 1.000 22.66898  ? 23  GLU A HA   1 
ATOM   385  H HB2  . GLU A 1 23  ? 10.57911  -1.50927 16.52221 1.000 25.51452  ? 23  GLU A HB2  1 
ATOM   386  H HB3  . GLU A 1 23  ? 10.24142  -0.95821 15.07041 1.000 25.51452  ? 23  GLU A HB3  1 
ATOM   387  H HG2  . GLU A 1 23  ? 12.50076  -0.37602 14.79623 1.000 29.74236  ? 23  GLU A HG2  1 
ATOM   388  H HG3  . GLU A 1 23  ? 12.81711  -1.01064 16.21841 1.000 29.74236  ? 23  GLU A HG3  1 
ATOM   389  N N    . LEU A 1 24  ? 12.10983  2.28299  15.69939 1.000 19.16850  ? 24  LEU A N    1 
ATOM   390  C CA   . LEU A 1 24  ? 12.66153  3.30033  14.81464 1.000 18.96913  ? 24  LEU A CA   1 
ATOM   391  C C    . LEU A 1 24  ? 13.85091  2.71716  14.06685 1.000 20.37931  ? 24  LEU A C    1 
ATOM   392  O O    . LEU A 1 24  ? 14.76211  2.15601  14.68313 1.000 21.65308  ? 24  LEU A O    1 
ATOM   393  C CB   . LEU A 1 24  ? 13.09042  4.53079  15.60702 1.000 21.74217  ? 24  LEU A CB   1 
ATOM   394  C CG   . LEU A 1 24  ? 12.01096  5.13141  16.50562 1.000 21.96575  ? 24  LEU A CG   1 
ATOM   395  C CD1  . LEU A 1 24  ? 12.58041  6.33679  17.22306 1.000 23.93464  ? 24  LEU A CD1  1 
ATOM   396  C CD2  . LEU A 1 24  ? 10.78806  5.48332  15.67761 1.000 21.07727  ? 24  LEU A CD2  1 
ATOM   397  H H    . LEU A 1 24  ? 12.57846  2.15849  16.40966 1.000 23.01482  ? 24  LEU A H    1 
ATOM   398  H HA   . LEU A 1 24  ? 11.99113  3.57345  14.16899 1.000 22.77557  ? 24  LEU A HA   1 
ATOM   399  H HB2  . LEU A 1 24  ? 13.83747  4.28417  16.17447 1.000 26.10322  ? 24  LEU A HB2  1 
ATOM   400  H HB3  . LEU A 1 24  ? 13.36309  5.21876  14.97993 1.000 26.10322  ? 24  LEU A HB3  1 
ATOM   401  H HG   . LEU A 1 24  ? 11.72358  4.49419  17.17812 1.000 26.37152  ? 24  LEU A HG   1 
ATOM   402  H HD11 . LEU A 1 24  ? 11.89982  6.70790  17.80614 1.000 28.73418  ? 24  LEU A HD11 1 
ATOM   403  H HD12 . LEU A 1 24  ? 13.34862  6.05914  17.74619 1.000 28.73418  ? 24  LEU A HD12 1 
ATOM   404  H HD13 . LEU A 1 24  ? 12.84914  6.99765  16.56584 1.000 28.73418  ? 24  LEU A HD13 1 
ATOM   405  H HD21 . LEU A 1 24  ? 10.17110  5.99256  16.22619 1.000 25.30533  ? 24  LEU A HD21 1 
ATOM   406  H HD22 . LEU A 1 24  ? 11.06562  6.01259  14.91358 1.000 25.30533  ? 24  LEU A HD22 1 
ATOM   407  H HD23 . LEU A 1 24  ? 10.36433  4.66443  15.37635 1.000 25.30533  ? 24  LEU A HD23 1 
ATOM   408  N N    . PHE A 1 25  ? 13.84806  2.85726  12.74320 1.000 20.53611  ? 25  PHE A N    1 
ATOM   409  C CA   . PHE A 1 25  ? 14.83202  2.17311  11.90453 1.000 21.08454  ? 25  PHE A CA   1 
ATOM   410  C C    . PHE A 1 25  ? 16.10931  3.00846  11.79812 1.000 22.37982  ? 25  PHE A C    1 
ATOM   411  O O    . PHE A 1 25  ? 16.50519  3.48283  10.73211 1.000 24.26057  ? 25  PHE A O    1 
ATOM   412  C CB   . PHE A 1 25  ? 14.24896  1.88522  10.52742 1.000 21.91188  ? 25  PHE A CB   1 
ATOM   413  C CG   . PHE A 1 25  ? 13.02699  1.02004  10.55090 1.000 29.68367  ? 25  PHE A CG   1 
ATOM   414  C CD1  . PHE A 1 25  ? 12.98288  -0.12634 11.32688 1.000 44.12547  ? 25  PHE A CD1  1 
ATOM   415  C CD2  . PHE A 1 25  ? 11.91783  1.35805  9.79716  1.000 27.68020  ? 25  PHE A CD2  1 
ATOM   416  C CE1  . PHE A 1 25  ? 11.85690  -0.92053 11.34666 1.000 39.46804  ? 25  PHE A CE1  1 
ATOM   417  C CE2  . PHE A 1 25  ? 10.78866  0.57023  9.81474  1.000 28.04044  ? 25  PHE A CE2  1 
ATOM   418  C CZ   . PHE A 1 25  ? 10.75875  -0.57330 10.58805 1.000 25.97090  ? 25  PHE A CZ   1 
ATOM   419  H H    . PHE A 1 25  ? 13.28761  3.34215  12.30687 1.000 24.65594  ? 25  PHE A H    1 
ATOM   420  H HA   . PHE A 1 25  ? 15.05704  1.33161  12.33132 1.000 25.31406  ? 25  PHE A HA   1 
ATOM   421  H HB2  . PHE A 1 25  ? 14.00637  2.72679  10.11053 1.000 26.30687  ? 25  PHE A HB2  1 
ATOM   422  H HB3  . PHE A 1 25  ? 14.92070  1.43225  9.99404  1.000 26.30687  ? 25  PHE A HB3  1 
ATOM   423  H HD1  . PHE A 1 25  ? 13.72139  -0.36276 11.84030 1.000 52.96317  ? 25  PHE A HD1  1 
ATOM   424  H HD2  . PHE A 1 25  ? 11.93479  2.12587  9.27268  1.000 33.22886  ? 25  PHE A HD2  1 
ATOM   425  H HE1  . PHE A 1 25  ? 11.83758  -1.68883 11.87034 1.000 47.37426  ? 25  PHE A HE1  1 
ATOM   426  H HE2  . PHE A 1 25  ? 10.04709  0.80804  9.30640  1.000 33.66114  ? 25  PHE A HE2  1 
ATOM   427  H HZ   . PHE A 1 25  ? 9.99860   -1.10900 10.59732 1.000 31.17770  ? 25  PHE A HZ   1 
ATOM   428  N N    . ALA A 1 26  ? 16.77414  3.16427  12.94220 1.000 25.20885  ? 26  ALA A N    1 
ATOM   429  C CA   . ALA A 1 26  ? 18.01414  3.92886  12.97395 1.000 24.47522  ? 26  ALA A CA   1 
ATOM   430  C C    . ALA A 1 26  ? 19.10685  3.29615  12.12430 1.000 25.48325  ? 26  ALA A C    1 
ATOM   431  O O    . ALA A 1 26  ? 20.03712  3.99830  11.71019 1.000 28.77720  ? 26  ALA A O    1 
ATOM   432  C CB   . ALA A 1 26  ? 18.49530  4.07416  14.41735 1.000 29.59421  ? 26  ALA A CB   1 
ATOM   433  H H    . ALA A 1 26  ? 16.53092  2.84170  13.70141 1.000 30.26324  ? 26  ALA A H    1 
ATOM   434  H HA   . ALA A 1 26  ? 17.84235  4.81555  12.62016 1.000 29.38287  ? 26  ALA A HA   1 
ATOM   435  H HB1  . ALA A 1 26  ? 19.33435  4.56085  14.42306 1.000 35.52567  ? 26  ALA A HB1  1 
ATOM   436  H HB2  . ALA A 1 26  ? 17.82733  4.56052  14.92546 1.000 35.52567  ? 26  ALA A HB2  1 
ATOM   437  H HB3  . ALA A 1 26  ? 18.62247  3.19119  14.79824 1.000 35.52567  ? 26  ALA A HB3  1 
ATOM   438  N N    . ASP A 1 27  ? 19.02010  1.98915  11.85702 1.000 28.51989  ? 27  ASP A N    1 
ATOM   439  C CA   . ASP A 1 27  ? 20.02099  1.34318  11.01971 1.000 28.44772  ? 27  ASP A CA   1 
ATOM   440  C C    . ASP A 1 27  ? 19.91476  1.77499  9.56315  1.000 29.60159  ? 27  ASP A C    1 
ATOM   441  O O    . ASP A 1 27  ? 20.90120  1.66866  8.82863  1.000 32.55574  ? 27  ASP A O    1 
ATOM   442  C CB   . ASP A 1 27  ? 19.92201  -0.18685 11.13252 1.000 39.90070  ? 27  ASP A CB   1 
ATOM   443  C CG   . ASP A 1 27  ? 18.53889  -0.73518 10.79383 1.000 38.32422  ? 27  ASP A CG   1 
ATOM   444  O OD1  . ASP A 1 27  ? 17.53991  0.00842  10.86483 1.000 34.98569  ? 27  ASP A OD1  1 
ATOM   445  O OD2  . ASP A 1 27  ? 18.45413  -1.93771 10.46646 1.000 60.97287  ? 27  ASP A OD2  1 
ATOM   446  H H    . ASP A 1 27  ? 18.40050  1.46714  12.14547 1.000 34.23648  ? 27  ASP A H    1 
ATOM   447  H HA   . ASP A 1 27  ? 20.90034  1.59519  11.34240 1.000 34.14988  ? 27  ASP A HA   1 
ATOM   448  H HB2  . ASP A 1 27  ? 20.55813  -0.58770 10.51968 1.000 47.89345  ? 27  ASP A HB2  1 
ATOM   449  H HB3  . ASP A 1 27  ? 20.12945  -0.44761 12.04350 1.000 47.89345  ? 27  ASP A HB3  1 
ATOM   450  N N    . LYS A 1 28  ? 18.76224  2.27920  9.13139  1.000 26.85822  ? 28  LYS A N    1 
ATOM   451  C CA   . LYS A 1 28  ? 18.58698  2.67564  7.74098  1.000 25.93528  ? 28  LYS A CA   1 
ATOM   452  C C    . LYS A 1 28  ? 18.34784  4.16352  7.54421  1.000 24.84205  ? 28  LYS A C    1 
ATOM   453  O O    . LYS A 1 28  ? 18.77123  4.70105  6.51730  1.000 25.24896  ? 28  LYS A O    1 
ATOM   454  C CB   . LYS A 1 28  ? 17.43363  1.87852  7.11064  1.000 33.41595  ? 28  LYS A CB   1 
ATOM   455  C CG   . LYS A 1 28  ? 17.76029  0.39333  7.00860  1.000 52.58303  ? 28  LYS A CG   1 
ATOM   456  C CD   . LYS A 1 28  ? 16.82727  -0.34680 6.07440  1.000 61.65093  ? 28  LYS A CD   1 
ATOM   457  C CE   . LYS A 1 28  ? 17.20609  -1.81870 5.98920  1.000 71.62984  ? 28  LYS A CE   1 
ATOM   458  N NZ   . LYS A 1 28  ? 17.17225  -2.48088 7.32487  1.000 71.94976  ? 28  LYS A NZ   1 
ATOM   459  H H    . LYS A 1 28  ? 18.06892  2.40054  9.62555  1.000 32.24247  ? 28  LYS A H    1 
ATOM   460  H HA   . LYS A 1 28  ? 19.39484  2.45963  7.24945  1.000 31.13494  ? 28  LYS A HA   1 
ATOM   461  H HB2  . LYS A 1 28  ? 16.63959  1.97847  7.65873  1.000 40.11175  ? 28  LYS A HB2  1 
ATOM   462  H HB3  . LYS A 1 28  ? 17.26424  2.21492  6.21675  1.000 40.11175  ? 28  LYS A HB3  1 
ATOM   463  H HG2  . LYS A 1 28  ? 18.66452  0.29020  6.67300  1.000 63.11225  ? 28  LYS A HG2  1 
ATOM   464  H HG3  . LYS A 1 28  ? 17.68498  -0.00873 7.88814  1.000 63.11225  ? 28  LYS A HG3  1 
ATOM   465  H HD2  . LYS A 1 28  ? 15.91787  -0.28138 6.40549  1.000 73.99373  ? 28  LYS A HD2  1 
ATOM   466  H HD3  . LYS A 1 28  ? 16.88538  0.03822  5.18599  1.000 73.99373  ? 28  LYS A HD3  1 
ATOM   467  H HE2  . LYS A 1 28  ? 16.57921  -2.27676 5.40773  1.000 85.96842  ? 28  LYS A HE2  1 
ATOM   468  H HE3  . LYS A 1 28  ? 18.10556  -1.89706 5.63465  1.000 85.96842  ? 28  LYS A HE3  1 
ATOM   469  H HZ1  . LYS A 1 28  ? 16.36781  -2.38304 7.69284  1.000 86.35232  ? 28  LYS A HZ1  1 
ATOM   470  H HZ2  . LYS A 1 28  ? 17.34671  -3.34934 7.23858  1.000 86.35232  ? 28  LYS A HZ2  1 
ATOM   471  H HZ3  . LYS A 1 28  ? 17.78151  -2.11577 7.86116  1.000 86.35232  ? 28  LYS A HZ3  1 
ATOM   472  N N    . VAL A 1 29  ? 17.70581  4.84119  8.49194  1.000 22.72959  ? 29  VAL A N    1 
ATOM   473  C CA   . VAL A 1 29  ? 17.49861  6.28720  8.41769  1.000 21.71533  ? 29  VAL A CA   1 
ATOM   474  C C    . VAL A 1 29  ? 17.89764  6.89610  9.75622  1.000 21.35582  ? 29  VAL A C    1 
ATOM   475  O O    . VAL A 1 29  ? 17.02946  7.33451  10.52573 1.000 19.99413  ? 29  VAL A O    1 
ATOM   476  C CB   . VAL A 1 29  ? 16.04555  6.65093  8.07507  1.000 21.68904  ? 29  VAL A CB   1 
ATOM   477  C CG1  . VAL A 1 29  ? 15.83354  6.62626  6.56780  1.000 27.26088  ? 29  VAL A CG1  1 
ATOM   478  C CG2  . VAL A 1 29  ? 15.08128  5.71755  8.77291  1.000 31.48431  ? 29  VAL A CG2  1 
ATOM   479  H H    . VAL A 1 29  ? 17.37506  4.48157  9.19967  1.000 27.21244  ? 29  VAL A H    1 
ATOM   480  H HA   . VAL A 1 29  ? 18.06676  6.64261  7.71642  1.000 25.99533  ? 29  VAL A HA   1 
ATOM   481  H HB   . VAL A 1 29  ? 15.86455  7.55065  8.38916  1.000 26.03946  ? 29  VAL A HB   1 
ATOM   482  H HG11 . VAL A 1 29  ? 14.89389  6.77509  6.37859  1.000 32.72567  ? 29  VAL A HG11 1 
ATOM   483  H HG12 . VAL A 1 29  ? 16.36767  7.32707  6.16225  1.000 32.72567  ? 29  VAL A HG12 1 
ATOM   484  H HG13 . VAL A 1 29  ? 16.10712  5.76127  6.22453  1.000 32.72567  ? 29  VAL A HG13 1 
ATOM   485  H HG21 . VAL A 1 29  ? 14.17772  6.04914  8.65240  1.000 37.79378  ? 29  VAL A HG21 1 
ATOM   486  H HG22 . VAL A 1 29  ? 15.16300  4.83191  8.38578  1.000 37.79378  ? 29  VAL A HG22 1 
ATOM   487  H HG23 . VAL A 1 29  ? 15.29917  5.68699  9.71762  1.000 37.79378  ? 29  VAL A HG23 1 
ATOM   488  N N    . PRO A 1 30  ? 19.19132  6.96001  10.06904 1.000 22.79206  ? 30  PRO A N    1 
ATOM   489  C CA   . PRO A 1 30  ? 19.58380  7.37316  11.42911 1.000 22.85315  ? 30  PRO A CA   1 
ATOM   490  C C    . PRO A 1 30  ? 19.22069  8.80701  11.77945 1.000 26.79440  ? 30  PRO A C    1 
ATOM   491  O O    . PRO A 1 30  ? 18.84884  9.07891  12.92769 1.000 21.33959  ? 30  PRO A O    1 
ATOM   492  C CB   . PRO A 1 30  ? 21.10604  7.15014  11.43087 1.000 25.06935  ? 30  PRO A CB   1 
ATOM   493  C CG   . PRO A 1 30  ? 21.49942  7.14123  9.96508  1.000 32.75000  ? 30  PRO A CG   1 
ATOM   494  C CD   . PRO A 1 30  ? 20.33874  6.51466  9.25681  1.000 27.31407  ? 30  PRO A CD   1 
ATOM   495  H HA   . PRO A 1 30  ? 19.16229  6.78447  12.07461 1.000 27.36983  ? 30  PRO A HA   1 
ATOM   496  H HB2  . PRO A 1 30  ? 21.54577  7.87348  11.90449 1.000 30.02928  ? 30  PRO A HB2  1 
ATOM   497  H HB3  . PRO A 1 30  ? 21.31558  6.30195  11.85226 1.000 30.02928  ? 30  PRO A HB3  1 
ATOM   498  H HG2  . PRO A 1 30  ? 21.64503  8.04914  9.65621  1.000 39.31261  ? 30  PRO A HG2  1 
ATOM   499  H HG3  . PRO A 1 30  ? 22.30540  6.61570  9.84215  1.000 39.31261  ? 30  PRO A HG3  1 
ATOM   500  H HD2  . PRO A 1 30  ? 20.26867  6.84155  8.34625  1.000 32.78949  ? 30  PRO A HD2  1 
ATOM   501  H HD3  . PRO A 1 30  ? 20.41132  5.54738  9.25739  1.000 32.78949  ? 30  PRO A HD3  1 
ATOM   502  N N    . LYS A 1 31  ? 19.32594  9.74178  10.83782 1.000 22.23770  ? 31  LYS A N    1 
ATOM   503  C CA   . LYS A 1 31  ? 19.04210  11.13401 11.17103 1.000 22.77613  ? 31  LYS A CA   1 
ATOM   504  C C    . LYS A 1 31  ? 17.55462  11.35206 11.41901 1.000 22.77903  ? 31  LYS A C    1 
ATOM   505  O O    . LYS A 1 31  ? 17.17214  12.08641 12.33797 1.000 21.48487  ? 31  LYS A O    1 
ATOM   506  C CB   . LYS A 1 31  ? 19.54892  12.04016 10.05374 1.000 23.20845  ? 31  LYS A CB   1 
ATOM   507  C CG   . LYS A 1 31  ? 19.31546  13.50887 10.29409 1.000 25.83871  ? 31  LYS A CG   1 
ATOM   508  C CD   . LYS A 1 31  ? 20.10908  14.33764 9.29986  1.000 32.30023  ? 31  LYS A CD   1 
ATOM   509  C CE   . LYS A 1 31  ? 19.88456  15.81787 9.52366  1.000 25.58093  ? 31  LYS A CE   1 
ATOM   510  N NZ   . LYS A 1 31  ? 20.78148  16.61860 8.65483  1.000 28.62028  ? 31  LYS A NZ   1 
ATOM   511  H H    . LYS A 1 31  ? 19.55360  9.60058  10.02061 1.000 26.69785  ? 31  LYS A H    1 
ATOM   512  H HA   . LYS A 1 31  ? 19.51167  11.36952 11.98647 1.000 27.34397  ? 31  LYS A HA   1 
ATOM   513  H HB2  . LYS A 1 31  ? 20.50468  11.90654 9.95594  1.000 27.86275  ? 31  LYS A HB2  1 
ATOM   514  H HB3  . LYS A 1 31  ? 19.09457  11.80107 9.23076  1.000 27.86275  ? 31  LYS A HB3  1 
ATOM   515  H HG2  . LYS A 1 31  ? 18.37324  13.71139 10.18411 1.000 31.01906  ? 31  LYS A HG2  1 
ATOM   516  H HG3  . LYS A 1 31  ? 19.60245  13.74203 11.19084 1.000 31.01906  ? 31  LYS A HG3  1 
ATOM   517  H HD2  . LYS A 1 31  ? 21.05504  14.15136 9.40647  1.000 38.77289  ? 31  LYS A HD2  1 
ATOM   518  H HD3  . LYS A 1 31  ? 19.82718  14.11757 8.39819  1.000 38.77289  ? 31  LYS A HD3  1 
ATOM   519  H HE2  . LYS A 1 31  ? 18.96559  16.04281 9.30968  1.000 30.70973  ? 31  LYS A HE2  1 
ATOM   520  H HE3  . LYS A 1 31  ? 20.07324  16.03853 10.44920 1.000 30.70973  ? 31  LYS A HE3  1 
ATOM   521  H HZ1  . LYS A 1 31  ? 21.62931  16.38976 8.79945  1.000 34.35695  ? 31  LYS A HZ1  1 
ATOM   522  H HZ2  . LYS A 1 31  ? 20.58517  16.47372 7.79893  1.000 34.35695  ? 31  LYS A HZ2  1 
ATOM   523  H HZ3  . LYS A 1 31  ? 20.68211  17.48526 8.83126  1.000 34.35695  ? 31  LYS A HZ3  1 
ATOM   524  N N    . THR A 1 32  ? 16.70288  10.71734 10.61238 1.000 19.05699  ? 32  THR A N    1 
ATOM   525  C CA   . THR A 1 32  ? 15.26021  10.83792 10.79360 1.000 17.61579  ? 32  THR A CA   1 
ATOM   526  C C    . THR A 1 32  ? 14.80545  10.12337 12.05701 1.000 18.28948  ? 32  THR A C    1 
ATOM   527  O O    . THR A 1 32  ? 13.94711  10.62602 12.79375 1.000 17.61737  ? 32  THR A O    1 
ATOM   528  C CB   . THR A 1 32  ? 14.55305  10.26502 9.56409  1.000 17.40192  ? 32  THR A CB   1 
ATOM   529  O OG1  . THR A 1 32  ? 15.10908  10.85865 8.38234  1.000 18.68601  ? 32  THR A OG1  1 
ATOM   530  C CG2  . THR A 1 32  ? 13.05893  10.51998 9.61440  1.000 17.30015  ? 32  THR A CG2  1 
ATOM   531  H H    . THR A 1 32  ? 16.93469  10.21294 9.95553  1.000 22.80532  ? 32  THR A H    1 
ATOM   532  H HA   . THR A 1 32  ? 15.02003  11.77365 10.88091 1.000 21.07589  ? 32  THR A HA   1 
ATOM   533  H HB   . THR A 1 32  ? 14.68021  9.30372  9.53913  1.000 20.81924  ? 32  THR A HB   1 
ATOM   534  H HG1  . THR A 1 32  ? 15.89862  10.59396 8.27210  1.000 22.43583  ? 32  THR A HG1  1 
ATOM   535  H HG21 . THR A 1 32  ? 12.66160  10.33568 8.74892  1.000 20.77280  ? 32  THR A HG21 1 
ATOM   536  H HG22 . THR A 1 32  ? 12.64660  9.94594  10.27875 1.000 20.77280  ? 32  THR A HG22 1 
ATOM   537  H HG23 . THR A 1 32  ? 12.88803  11.44566 9.84855  1.000 20.77280  ? 32  THR A HG23 1 
ATOM   538  N N    . ALA A 1 33  ? 15.36872  8.94662  12.32302 1.000 17.52936  ? 33  ALA A N    1 
ATOM   539  C CA   . ALA A 1 33  ? 15.00016  8.21853  13.52870 1.000 17.71993  ? 33  ALA A CA   1 
ATOM   540  C C    . ALA A 1 33  ? 15.39175  9.00190  14.77270 1.000 19.41829  ? 33  ALA A C    1 
ATOM   541  O O    . ALA A 1 33  ? 14.63379  9.05643  15.74832 1.000 18.99849  ? 33  ALA A O    1 
ATOM   542  C CB   . ALA A 1 33  ? 15.66105  6.84152  13.53155 1.000 21.31964  ? 33  ALA A CB   1 
ATOM   543  H H    . ALA A 1 33  ? 15.95565  8.55647  11.83018 1.000 21.01059  ? 33  ALA A H    1 
ATOM   544  H HA   . ALA A 1 33  ? 14.03906  8.08792  13.53981 1.000 21.27653  ? 33  ALA A HA   1 
ATOM   545  H HB1  . ALA A 1 33  ? 15.40509  6.37006  14.33969 1.000 25.59618  ? 33  ALA A HB1  1 
ATOM   546  H HB2  . ALA A 1 33  ? 15.36379  6.34695  12.75184 1.000 25.59618  ? 33  ALA A HB2  1 
ATOM   547  H HB3  . ALA A 1 33  ? 16.62420  6.95344  13.50486 1.000 25.59618  ? 33  ALA A HB3  1 
ATOM   548  N N    . GLU A 1 34  ? 16.56960  9.62845  14.74941 1.000 18.62311  ? 34  GLU A N    1 
ATOM   549  C CA   . GLU A 1 34  ? 17.05200  10.34260 15.92709 1.000 21.60754  ? 34  GLU A CA   1 
ATOM   550  C C    . GLU A 1 34  ? 16.16636  11.54151 16.24033 1.000 21.86098  ? 34  GLU A C    1 
ATOM   551  O O    . GLU A 1 34  ? 15.91890  11.84090 17.41302 1.000 21.42704  ? 34  GLU A O    1 
ATOM   552  C CB   . GLU A 1 34  ? 18.50564  10.77237 15.71614 1.000 21.74667  ? 34  GLU A CB   1 
ATOM   553  C CG   . GLU A 1 34  ? 19.09952  11.66481 16.81080 1.000 24.90160  ? 34  GLU A CG   1 
ATOM   554  C CD   . GLU A 1 34  ? 19.12246  11.02228 18.18926 1.000 36.02557  ? 34  GLU A CD   1 
ATOM   555  O OE1  . GLU A 1 34  ? 18.90388  9.79866  18.30170 1.000 28.08121  ? 34  GLU A OE1  1 
ATOM   556  O OE2  . GLU A 1 34  ? 19.35835  11.75606 19.17087 1.000 33.87358  ? 34  GLU A OE2  1 
ATOM   557  H H    . GLU A 1 34  ? 17.10029  9.65416  14.07316 1.000 22.28467  ? 34  GLU A H    1 
ATOM   558  H HA   . GLU A 1 34  ? 17.02790  9.74823  16.69327 1.000 25.94166  ? 34  GLU A HA   1 
ATOM   559  H HB2  . GLU A 1 34  ? 19.05471  9.97431  15.66589 1.000 26.10861  ? 34  GLU A HB2  1 
ATOM   560  H HB3  . GLU A 1 34  ? 18.55937  11.26508 14.88232 1.000 26.10861  ? 34  GLU A HB3  1 
ATOM   561  H HG2  . GLU A 1 34  ? 20.01410  11.88294 16.57232 1.000 29.89453  ? 34  GLU A HG2  1 
ATOM   562  H HG3  . GLU A 1 34  ? 18.57041  12.47545 16.87252 1.000 29.89453  ? 34  GLU A HG3  1 
ATOM   563  N N    . ASN A 1 35  ? 15.67733  12.23394 15.20536 1.000 20.03264  ? 35  ASN A N    1 
ATOM   564  C CA   . ASN A 1 35  ? 14.76111  13.35561 15.40522 1.000 18.70688  ? 35  ASN A CA   1 
ATOM   565  C C    . ASN A 1 35  ? 13.51423  12.91163 16.16194 1.000 17.51094  ? 35  ASN A C    1 
ATOM   566  O O    . ASN A 1 35  ? 13.12524  13.52308 17.16421 1.000 17.35051  ? 35  ASN A O    1 
ATOM   567  C CB   . ASN A 1 35  ? 14.40026  13.96122 14.03906 1.000 19.56557  ? 35  ASN A CB   1 
ATOM   568  C CG   . ASN A 1 35  ? 13.43694  15.12422 14.14404 1.000 19.79434  ? 35  ASN A CG   1 
ATOM   569  O OD1  . ASN A 1 35  ? 13.74454  16.14664 14.74969 1.000 20.39283  ? 35  ASN A OD1  1 
ATOM   570  N ND2  . ASN A 1 35  ? 12.27983  14.99098 13.51133 1.000 16.84807  ? 35  ASN A ND2  1 
ATOM   571  H H    . ASN A 1 35  ? 15.86093  12.07361 14.38063 1.000 24.05178  ? 35  ASN A H    1 
ATOM   572  H HA   . ASN A 1 35  ? 15.19437  14.04225 15.93597 1.000 22.46087  ? 35  ASN A HA   1 
ATOM   573  H HB2  . ASN A 1 35  ? 15.21032  14.28155 13.61235 1.000 23.49130  ? 35  ASN A HB2  1 
ATOM   574  H HB3  . ASN A 1 35  ? 13.98469  13.27731 13.49091 1.000 23.49130  ? 35  ASN A HB3  1 
ATOM   575  H HD21 . ASN A 1 35  ? 11.69840  15.62399 13.54051 1.000 20.23030  ? 35  ASN A HD21 1 
ATOM   576  H HD22 . ASN A 1 35  ? 12.11051  14.27153 13.07164 1.000 20.23030  ? 35  ASN A HD22 1 
ATOM   577  N N    . PHE A 1 36  ? 12.88504  11.83129 15.70372 1.000 15.57572  ? 36  PHE A N    1 
ATOM   578  C CA   . PHE A 1 36  ? 11.69000  11.32331 16.36997 1.000 16.30369  ? 36  PHE A CA   1 
ATOM   579  C C    . PHE A 1 36  ? 12.00425  10.82459 17.77293 1.000 17.15394  ? 36  PHE A C    1 
ATOM   580  O O    . PHE A 1 36  ? 11.22090  11.04211 18.70503 1.000 18.21240  ? 36  PHE A O    1 
ATOM   581  C CB   . PHE A 1 36  ? 11.08942  10.20288 15.52478 1.000 17.03178  ? 36  PHE A CB   1 
ATOM   582  C CG   . PHE A 1 36  ? 9.70976   9.77608  15.93695 1.000 16.38878  ? 36  PHE A CG   1 
ATOM   583  C CD1  . PHE A 1 36  ? 8.59924   10.37907 15.37545 1.000 17.44502  ? 36  PHE A CD1  1 
ATOM   584  C CD2  . PHE A 1 36  ? 9.52134   8.73404  16.83468 1.000 17.53819  ? 36  PHE A CD2  1 
ATOM   585  C CE1  . PHE A 1 36  ? 7.33017   9.97085  15.71143 1.000 16.91699  ? 36  PHE A CE1  1 
ATOM   586  C CE2  . PHE A 1 36  ? 8.24403   8.32993  17.18681 1.000 22.16518  ? 36  PHE A CE2  1 
ATOM   587  C CZ   . PHE A 1 36  ? 7.14972   8.95066  16.62083 1.000 17.15898  ? 36  PHE A CZ   1 
ATOM   588  H H    . PHE A 1 36  ? 13.12738  11.37755 15.01452 1.000 18.70348  ? 36  PHE A H    1 
ATOM   589  H HA   . PHE A 1 36  ? 11.03922  12.03782 16.45269 1.000 19.57704  ? 36  PHE A HA   1 
ATOM   590  H HB2  . PHE A 1 36  ? 11.03894  10.50446 14.60424 1.000 20.45075  ? 36  PHE A HB2  1 
ATOM   591  H HB3  . PHE A 1 36  ? 11.66655  9.42583  15.58815 1.000 20.45075  ? 36  PHE A HB3  1 
ATOM   592  H HD1  . PHE A 1 36  ? 8.71228   11.06952 14.76275 1.000 20.94664  ? 36  PHE A HD1  1 
ATOM   593  H HD2  . PHE A 1 36  ? 10.25897  8.30361  17.20280 1.000 21.05844  ? 36  PHE A HD2  1 
ATOM   594  H HE1  . PHE A 1 36  ? 6.59210   10.38370 15.32451 1.000 20.31300  ? 36  PHE A HE1  1 
ATOM   595  H HE2  . PHE A 1 36  ? 8.12468   7.64298  17.80225 1.000 26.61083  ? 36  PHE A HE2  1 
ATOM   596  H HZ   . PHE A 1 36  ? 6.29044   8.68092  16.85274 1.000 20.60339  ? 36  PHE A HZ   1 
ATOM   597  N N    . ARG A 1 37  ? 13.13176  10.13456 17.94060 1.000 16.75495  ? 37  ARG A N    1 
ATOM   598  C CA   . ARG A 1 37  ? 13.50818  9.65157  19.26510 1.000 18.83832  ? 37  ARG A CA   1 
ATOM   599  C C    . ARG A 1 37  ? 13.66062  10.81080 20.24498 1.000 21.17152  ? 37  ARG A C    1 
ATOM   600  O O    . ARG A 1 37  ? 13.09824  10.79011 21.34672 1.000 20.49817  ? 37  ARG A O    1 
ATOM   601  C CB   . ARG A 1 37  ? 14.80529  8.84421  19.17556 1.000 20.90199  ? 37  ARG A CB   1 
ATOM   602  C CG   . ARG A 1 37  ? 15.14058  8.08382  20.45275 1.000 21.31059  ? 37  ARG A CG   1 
ATOM   603  C CD   . ARG A 1 37  ? 16.62506  7.75542  20.57771 1.000 23.29003  ? 37  ARG A CD   1 
ATOM   604  N NE   . ARG A 1 37  ? 17.43165  8.97022  20.60042 1.000 27.50423  ? 37  ARG A NE   1 
ATOM   605  C CZ   . ARG A 1 37  ? 17.58939  9.74302  21.66982 1.000 24.78774  ? 37  ARG A CZ   1 
ATOM   606  N NH1  . ARG A 1 37  ? 17.00031  9.42684  22.81575 1.000 31.03338  ? 37  ARG A NH1  1 
ATOM   607  N NH2  . ARG A 1 37  ? 18.33267  10.83664 21.58957 1.000 28.51754  ? 37  ARG A NH2  1 
ATOM   608  H H    . ARG A 1 37  ? 13.68654  9.93624  17.31411 1.000 20.11855  ? 37  ARG A H    1 
ATOM   609  H HA   . ARG A 1 37  ? 12.81058  9.06533  19.59766 1.000 22.61860  ? 37  ARG A HA   1 
ATOM   610  H HB2  . ARG A 1 37  ? 14.72129  8.19678  18.45815 1.000 25.09500  ? 37  ARG A HB2  1 
ATOM   611  H HB3  . ARG A 1 37  ? 15.53885  9.45126  18.99040 1.000 25.09500  ? 37  ARG A HB3  1 
ATOM   612  H HG2  . ARG A 1 37  ? 14.88901  8.62484  21.21754 1.000 25.58532  ? 37  ARG A HG2  1 
ATOM   613  H HG3  . ARG A 1 37  ? 14.64813  7.24816  20.46115 1.000 25.58532  ? 37  ARG A HG3  1 
ATOM   614  H HD2  . ARG A 1 37  ? 16.77954  7.26923  21.40272 1.000 27.96065  ? 37  ARG A HD2  1 
ATOM   615  H HD3  . ARG A 1 37  ? 16.90149  7.21786  19.81909 1.000 27.96065  ? 37  ARG A HD3  1 
ATOM   616  H HE   . ARG A 1 37  ? 17.83107  9.20139  19.87473 1.000 33.01769  ? 37  ARG A HE   1 
ATOM   617  H HH11 . ARG A 1 37  ? 16.51416  8.71940  22.86848 1.000 37.25267  ? 37  ARG A HH11 1 
ATOM   618  H HH12 . ARG A 1 37  ? 17.10461  9.92933  23.50584 1.000 37.25267  ? 37  ARG A HH12 1 
ATOM   619  H HH21 . ARG A 1 37  ? 18.71194  11.04521 20.84643 1.000 34.23366  ? 37  ARG A HH21 1 
ATOM   620  H HH22 . ARG A 1 37  ? 18.43592  11.33805 22.28060 1.000 34.23366  ? 37  ARG A HH22 1 
ATOM   621  N N    . ALA A 1 38  ? 14.41074  11.84156 19.85364 1.000 19.18349  ? 38  ALA A N    1 
ATOM   622  C CA   . ALA A 1 38  ? 14.67973  12.94854 20.76552 1.000 22.37355  ? 38  ALA A CA   1 
ATOM   623  C C    . ALA A 1 38  ? 13.41859  13.75322 21.06364 1.000 19.91196  ? 38  ALA A C    1 
ATOM   624  O O    . ALA A 1 38  ? 13.24912  14.25654 22.18002 1.000 21.64920  ? 38  ALA A O    1 
ATOM   625  C CB   . ALA A 1 38  ? 15.76320  13.85076 20.17707 1.000 24.09023  ? 38  ALA A CB   1 
ATOM   626  H H    . ALA A 1 38  ? 14.77015  11.92224 19.07652 1.000 23.03280  ? 38  ALA A H    1 
ATOM   627  H HA   . ALA A 1 38  ? 15.00362  12.58689 21.60528 1.000 26.86087  ? 38  ALA A HA   1 
ATOM   628  H HB1  . ALA A 1 38  ? 15.98056  14.54382 20.81997 1.000 28.92089  ? 38  ALA A HB1  1 
ATOM   629  H HB2  . ALA A 1 38  ? 16.55042  13.31662 19.98766 1.000 28.92089  ? 38  ALA A HB2  1 
ATOM   630  H HB3  . ALA A 1 38  ? 15.43049  14.25131 19.35868 1.000 28.92089  ? 38  ALA A HB3  1 
ATOM   631  N N    . LEU A 1 39  ? 12.53243  13.90939 20.07546 1.000 18.39390  ? 39  LEU A N    1 
ATOM   632  C CA   . LEU A 1 39  ? 11.26761  14.59313 20.33307 1.000 18.20456  ? 39  LEU A CA   1 
ATOM   633  C C    . LEU A 1 39  ? 10.38066  13.78205 21.27113 1.000 20.01603  ? 39  LEU A C    1 
ATOM   634  O O    . LEU A 1 39  ? 9.57472   14.35590 22.01515 1.000 21.43352  ? 39  LEU A O    1 
ATOM   635  C CB   . LEU A 1 39  ? 10.54291  14.86956 19.01561 1.000 16.67903  ? 39  LEU A CB   1 
ATOM   636  C CG   . LEU A 1 39  ? 11.23095  15.88467 18.10096 1.000 18.68517  ? 39  LEU A CG   1 
ATOM   637  C CD1  . LEU A 1 39  ? 10.54437  15.94902 16.74862 1.000 18.85867  ? 39  LEU A CD1  1 
ATOM   638  C CD2  . LEU A 1 39  ? 11.24978  17.26265 18.74461 1.000 23.47584  ? 39  LEU A CD2  1 
ATOM   639  H H    . LEU A 1 39  ? 12.63830  13.63487 19.26736 1.000 22.08529  ? 39  LEU A H    1 
ATOM   640  H HA   . LEU A 1 39  ? 11.44982  15.44729 20.75510 1.000 21.85809  ? 39  LEU A HA   1 
ATOM   641  H HB2  . LEU A 1 39  ? 10.47123  14.03613 18.52453 1.000 20.02745  ? 39  LEU A HB2  1 
ATOM   642  H HB3  . LEU A 1 39  ? 9.65842   15.21226 19.21842 1.000 20.02745  ? 39  LEU A HB3  1 
ATOM   643  H HG   . LEU A 1 39  ? 12.14755  15.59966 17.96129 1.000 22.43482  ? 39  LEU A HG   1 
ATOM   644  H HD11 . LEU A 1 39  ? 11.07809  16.49362 16.14907 1.000 22.64302  ? 39  LEU A HD11 1 
ATOM   645  H HD12 . LEU A 1 39  ? 10.46141  15.05019 16.39348 1.000 22.64302  ? 39  LEU A HD12 1 
ATOM   646  H HD13 . LEU A 1 39  ? 9.66510   16.34342 16.85929 1.000 22.64302  ? 39  LEU A HD13 1 
ATOM   647  H HD21 . LEU A 1 39  ? 11.62297  17.89989 18.11569 1.000 28.18362  ? 39  LEU A HD21 1 
ATOM   648  H HD22 . LEU A 1 39  ? 10.34207  17.51669 18.97356 1.000 28.18362  ? 39  LEU A HD22 1 
ATOM   649  H HD23 . LEU A 1 39  ? 11.79603  17.22967 19.54550 1.000 28.18362  ? 39  LEU A HD23 1 
ATOM   650  N N    . SER A 1 40  ? 10.52709  12.45360 21.26259 1.000 17.99849  ? 40  SER A N    1 
ATOM   651  C CA   . SER A 1 40  ? 9.74299   11.60560 22.15124 1.000 19.65515  ? 40  SER A CA   1 
ATOM   652  C C    . SER A 1 40  ? 10.26912  11.63194 23.58443 1.000 22.22946  ? 40  SER A C    1 
ATOM   653  O O    . SER A 1 40  ? 9.48319   11.48008 24.52466 1.000 23.38738  ? 40  SER A O    1 
ATOM   654  C CB   . SER A 1 40  ? 9.72294   10.16133 21.63591 1.000 18.95211  ? 40  SER A CB   1 
ATOM   655  O OG   . SER A 1 40  ? 9.11342   10.05477 20.35886 1.000 20.59153  ? 40  SER A OG   1 
ATOM   656  H H    . SER A 1 40  ? 11.07146  12.02469 20.75337 1.000 21.61081  ? 40  SER A H    1 
ATOM   657  H HA   . SER A 1 40  ? 8.83038   11.93428 22.15644 1.000 23.59879  ? 40  SER A HA   1 
ATOM   658  H HB2  . SER A 1 40  ? 10.63676  9.84257  21.57092 1.000 22.75514  ? 40  SER A HB2  1 
ATOM   659  H HB3  . SER A 1 40  ? 9.22485   9.61494  22.26381 1.000 22.75514  ? 40  SER A HB3  1 
ATOM   660  H HG   . SER A 1 40  ? 9.57365   10.46172 19.78600 1.000 24.72245  ? 40  SER A HG   1 
ATOM   661  N N    . THR A 1 41  ? 11.57715  11.80679 23.78896 1.000 19.34181  ? 41  THR A N    1 
ATOM   662  C CA   . THR A 1 41  ? 12.07635  11.90421 25.15644 1.000 22.84130  ? 41  THR A CA   1 
ATOM   663  C C    . THR A 1 41  ? 12.04576  13.32984 25.68997 1.000 22.20465  ? 41  THR A C    1 
ATOM   664  O O    . THR A 1 41  ? 12.12360  13.52828 26.90983 1.000 24.48570  ? 41  THR A O    1 
ATOM   665  C CB   . THR A 1 41  ? 13.51709  11.39519 25.27268 1.000 29.81620  ? 41  THR A CB   1 
ATOM   666  O OG1  . THR A 1 41  ? 14.38079  12.28648 24.55670 1.000 25.85480  ? 41  THR A OG1  1 
ATOM   667  C CG2  . THR A 1 41  ? 13.64862  9.98330  24.73116 1.000 29.03400  ? 41  THR A CG2  1 
ATOM   668  H H    . THR A 1 41  ? 12.17278  11.86950 23.17181 1.000 23.22278  ? 41  THR A H    1 
ATOM   669  H HA   . THR A 1 41  ? 11.51733  11.33585 25.70904 1.000 27.42217  ? 41  THR A HA   1 
ATOM   670  H HB   . THR A 1 41  ? 13.78171  11.36503 26.20540 1.000 35.79206  ? 41  THR A HB   1 
ATOM   671  H HG1  . THR A 1 41  ? 15.18152  12.05369 24.65790 1.000 31.03838  ? 41  THR A HG1  1 
ATOM   672  H HG21 . THR A 1 41  ? 14.54395  9.64753  24.89413 1.000 34.85342  ? 41  THR A HG21 1 
ATOM   673  H HG22 . THR A 1 41  ? 13.00907  9.39944  25.16818 1.000 34.85342  ? 41  THR A HG22 1 
ATOM   674  H HG23 . THR A 1 41  ? 13.47910  9.97713  23.77611 1.000 34.85342  ? 41  THR A HG23 1 
ATOM   675  N N    . GLY A 1 42  ? 11.95846  14.32055 24.80642 1.000 24.54049  ? 42  GLY A N    1 
ATOM   676  C CA   . GLY A 1 42  ? 11.98754  15.70157 25.22480 1.000 25.14070  ? 42  GLY A CA   1 
ATOM   677  C C    . GLY A 1 42  ? 13.34706  16.19475 25.64282 1.000 29.35068  ? 42  GLY A C    1 
ATOM   678  O O    . GLY A 1 42  ? 13.44674  17.28004 26.22190 1.000 30.13042  ? 42  GLY A O    1 
ATOM   679  H H    . GLY A 1 42  ? 11.88157  14.21081 23.95693 1.000 29.46120  ? 42  GLY A H    1 
ATOM   680  H HA2  . GLY A 1 42  ? 11.68163  16.25707 24.49081 1.000 30.18145  ? 42  GLY A HA2  1 
ATOM   681  H HA3  . GLY A 1 42  ? 11.38568  15.81296 25.97730 1.000 30.18145  ? 42  GLY A HA3  1 
ATOM   682  N N    . GLU A 1 43  ? 14.40583  15.44309 25.34542 1.000 26.67214  ? 43  GLU A N    1 
ATOM   683  C CA   . GLU A 1 43  ? 15.69907  15.74468 25.94039 1.000 29.12152  ? 43  GLU A CA   1 
ATOM   684  C C    . GLU A 1 43  ? 16.29668  17.04679 25.42591 1.000 37.92588  ? 43  GLU A C    1 
ATOM   685  O O    . GLU A 1 43  ? 17.20276  17.58551 26.06903 1.000 36.02717  ? 43  GLU A O    1 
ATOM   686  C CB   . GLU A 1 43  ? 16.66999  14.58774 25.70638 1.000 33.81493  ? 43  GLU A CB   1 
ATOM   687  C CG   . GLU A 1 43  ? 16.97533  14.28308 24.25731 1.000 41.17939  ? 43  GLU A CG   1 
ATOM   688  C CD   . GLU A 1 43  ? 17.62708  12.92626 24.09745 1.000 40.44715  ? 43  GLU A CD   1 
ATOM   689  O OE1  . GLU A 1 43  ? 16.98988  11.91271 24.45849 1.000 32.91994  ? 43  GLU A OE1  1 
ATOM   690  O OE2  . GLU A 1 43  ? 18.78349  12.87335 23.63065 1.000 35.74554  ? 43  GLU A OE2  1 
ATOM   691  H H    . GLU A 1 43  ? 14.39935  14.76771 24.81304 1.000 32.01918  ? 43  GLU A H    1 
ATOM   692  H HA   . GLU A 1 43  ? 15.57920  15.84178 26.89804 1.000 34.95844  ? 43  GLU A HA   1 
ATOM   693  H HB2  . GLU A 1 43  ? 17.51063  14.80148 26.14060 1.000 40.59053  ? 43  GLU A HB2  1 
ATOM   694  H HB3  . GLU A 1 43  ? 16.28945  13.78550 26.09688 1.000 40.59053  ? 43  GLU A HB3  1 
ATOM   695  H HG2  . GLU A 1 43  ? 16.14958  14.28628 23.74838 1.000 49.42788  ? 43  GLU A HG2  1 
ATOM   696  H HG3  . GLU A 1 43  ? 17.58199  14.95534 23.90954 1.000 49.42788  ? 43  GLU A HG3  1 
ATOM   697  N N    A LYS A 1 44  ? 15.81594  17.56880 24.30054 0.493 33.47267  ? 44  LYS A N    1 
ATOM   698  N N    B LYS A 1 44  ? 15.81359  17.56539 24.29690 0.507 33.45629  ? 44  LYS A N    1 
ATOM   699  C CA   A LYS A 1 44  ? 16.31018  18.83578 23.77900 0.493 32.22499  ? 44  LYS A CA   1 
ATOM   700  C CA   B LYS A 1 44  ? 16.29229  18.83372 23.76388 0.507 32.26451  ? 44  LYS A CA   1 
ATOM   701  C C    A LYS A 1 44  ? 15.52668  20.03390 24.30355 0.493 37.13934  ? 44  LYS A C    1 
ATOM   702  C C    B LYS A 1 44  ? 15.54357  20.03493 24.32843 0.507 37.33772  ? 44  LYS A C    1 
ATOM   703  O O    A LYS A 1 44  ? 15.83009  21.16873 23.91997 0.493 45.16115  ? 44  LYS A O    1 
ATOM   704  O O    B LYS A 1 44  ? 15.88836  21.17411 23.99537 0.507 45.41943  ? 44  LYS A O    1 
ATOM   705  C CB   A LYS A 1 44  ? 16.27007  18.83798 22.24560 0.493 41.61496  ? 44  LYS A CB   1 
ATOM   706  C CB   B LYS A 1 44  ? 16.17280  18.85601 22.23634 0.507 41.73654  ? 44  LYS A CB   1 
ATOM   707  C CG   A LYS A 1 44  ? 16.72795  17.54070 21.59506 0.493 49.89313  ? 44  LYS A CG   1 
ATOM   708  C CG   B LYS A 1 44  ? 16.90746  17.74033 21.52315 0.507 45.26801  ? 44  LYS A CG   1 
ATOM   709  C CD   A LYS A 1 44  ? 18.19433  17.23871 21.86173 0.493 48.55072  ? 44  LYS A CD   1 
ATOM   710  C CD   B LYS A 1 44  ? 18.36865  17.71015 21.91465 0.507 50.41315  ? 44  LYS A CD   1 
ATOM   711  C CE   A LYS A 1 44  ? 19.11450  18.12238 21.03339 0.493 52.64952  ? 44  LYS A CE   1 
ATOM   712  C CE   B LYS A 1 44  ? 19.23624  17.20762 20.77607 0.507 51.21806  ? 44  LYS A CE   1 
ATOM   713  N NZ   A LYS A 1 44  ? 20.54504  17.74013 21.20763 0.493 54.00322  ? 44  LYS A NZ   1 
ATOM   714  N NZ   B LYS A 1 44  ? 20.68017  17.41316 21.08038 0.507 54.35173  ? 44  LYS A NZ   1 
ATOM   715  H H    A LYS A 1 44  ? 15.20138  17.20543 23.82109 0.493 40.17982  ? 44  LYS A H    1 
ATOM   716  H H    B LYS A 1 44  ? 15.20189  17.19518 23.81902 0.507 40.16016  ? 44  LYS A H    1 
ATOM   717  H HA   A LYS A 1 44  ? 17.23606  18.93575 24.05040 0.493 38.68259  ? 44  LYS A HA   1 
ATOM   718  H HA   B LYS A 1 44  ? 17.23051  18.91830 23.99515 0.507 38.73003  ? 44  LYS A HA   1 
ATOM   719  H HB2  A LYS A 1 44  ? 15.35696  19.00066 21.96158 0.493 49.95057  ? 44  LYS A HB2  1 
ATOM   720  H HB2  B LYS A 1 44  ? 15.23467  18.78449 22.00033 0.507 50.09646  ? 44  LYS A HB2  1 
ATOM   721  H HB3  A LYS A 1 44  ? 16.84896  19.54645 21.92333 0.493 49.95057  ? 44  LYS A HB3  1 
ATOM   722  H HB3  B LYS A 1 44  ? 16.53336  19.69609 21.91205 0.507 50.09646  ? 44  LYS A HB3  1 
ATOM   723  H HG2  A LYS A 1 44  ? 16.20135  16.80622 21.94738 0.493 59.88437  ? 44  LYS A HG2  1 
ATOM   724  H HG2  B LYS A 1 44  ? 16.50915  16.88840 21.76078 0.507 54.33423  ? 44  LYS A HG2  1 
ATOM   725  H HG3  A LYS A 1 44  ? 16.60483  17.60667 20.63517 0.493 59.88437  ? 44  LYS A HG3  1 
ATOM   726  H HG3  B LYS A 1 44  ? 16.85007  17.87753 20.56462 0.507 54.33423  ? 44  LYS A HG3  1 
ATOM   727  H HD2  A LYS A 1 44  ? 18.38761  17.39437 22.79945 0.493 58.27347  ? 44  LYS A HD2  1 
ATOM   728  H HD2  B LYS A 1 44  ? 18.65818  18.60643 22.14651 0.507 60.50840  ? 44  LYS A HD2  1 
ATOM   729  H HD3  A LYS A 1 44  ? 18.37688  16.31354 21.63450 0.493 58.27347  ? 44  LYS A HD3  1 
ATOM   730  H HD3  B LYS A 1 44  ? 18.48635  17.11690 22.67300 0.507 60.50840  ? 44  LYS A HD3  1 
ATOM   731  H HE2  A LYS A 1 44  ? 18.88702  18.03166 20.09482 0.493 63.19203  ? 44  LYS A HE2  1 
ATOM   732  H HE2  B LYS A 1 44  ? 19.08112  16.25910 20.64512 0.507 61.47429  ? 44  LYS A HE2  1 
ATOM   733  H HE3  A LYS A 1 44  ? 19.00960  19.04543 21.31246 0.493 63.19203  ? 44  LYS A HE3  1 
ATOM   734  H HE3  B LYS A 1 44  ? 19.02012  17.69418 19.96524 0.507 61.47429  ? 44  LYS A HE3  1 
ATOM   735  H HZ1  A LYS A 1 44  ? 21.06316  18.26464 20.70909 0.493 64.81648  ? 44  LYS A HZ1  1 
ATOM   736  H HZ1  B LYS A 1 44  ? 21.17716  16.87226 20.57787 0.507 65.23469  ? 44  LYS A HZ1  1 
ATOM   737  H HZ2  A LYS A 1 44  ? 20.78169  17.82752 22.06113 0.493 64.81648  ? 44  LYS A HZ2  1 
ATOM   738  H HZ2  B LYS A 1 44  ? 20.90982  18.25628 20.91154 0.507 65.23469  ? 44  LYS A HZ2  1 
ATOM   739  H HZ3  A LYS A 1 44  ? 20.66647  16.89412 20.95939 0.493 64.81648  ? 44  LYS A HZ3  1 
ATOM   740  H HZ3  B LYS A 1 44  ? 20.83854  17.23693 21.93826 0.507 65.23469  ? 44  LYS A HZ3  1 
ATOM   741  N N    . GLY A 1 45  ? 14.51819  19.81097 25.14704 1.000 33.41713  ? 45  GLY A N    1 
ATOM   742  C CA   . GLY A 1 45  ? 13.74262  20.88660 25.72894 1.000 32.32092  ? 45  GLY A CA   1 
ATOM   743  C C    . GLY A 1 45  ? 12.38456  21.11011 25.10023 1.000 28.82277  ? 45  GLY A C    1 
ATOM   744  O O    . GLY A 1 45  ? 11.64499  21.99210 25.55779 1.000 32.56179  ? 45  GLY A O    1 
ATOM   745  H H    . GLY A 1 45  ? 14.25110  19.02798 25.38196 1.000 40.11317  ? 45  GLY A H    1 
ATOM   746  H HA2  . GLY A 1 45  ? 13.60425  20.69496 26.66970 1.000 38.79772  ? 45  GLY A HA2  1 
ATOM   747  H HA3  . GLY A 1 45  ? 14.24578  21.71167 25.64540 1.000 38.79772  ? 45  GLY A HA3  1 
ATOM   748  N N    . PHE A 1 46  ? 12.03997  20.34269 24.06796 1.000 27.98582  ? 46  PHE A N    1 
ATOM   749  C CA   . PHE A 1 46  ? 10.74950  20.41909 23.39740 1.000 28.80079  ? 46  PHE A CA   1 
ATOM   750  C C    . PHE A 1 46  ? 10.47119  19.05499 22.78066 1.000 26.07565  ? 46  PHE A C    1 
ATOM   751  O O    . PHE A 1 46  ? 11.38136  18.24253 22.60196 1.000 25.20347  ? 46  PHE A O    1 
ATOM   752  C CB   . PHE A 1 46  ? 10.73060  21.52333 22.33196 1.000 27.05310  ? 46  PHE A CB   1 
ATOM   753  C CG   . PHE A 1 46  ? 11.85225  21.43139 21.33372 1.000 24.74253  ? 46  PHE A CG   1 
ATOM   754  C CD1  . PHE A 1 46  ? 13.07236  22.03190 21.59233 1.000 35.99277  ? 46  PHE A CD1  1 
ATOM   755  C CD2  . PHE A 1 46  ? 11.68409  20.75722 20.13505 1.000 26.67996  ? 46  PHE A CD2  1 
ATOM   756  C CE1  . PHE A 1 46  ? 14.10619  21.95609 20.68518 1.000 34.83297  ? 46  PHE A CE1  1 
ATOM   757  C CE2  . PHE A 1 46  ? 12.71852  20.68014 19.21843 1.000 31.29930  ? 46  PHE A CE2  1 
ATOM   758  C CZ   . PHE A 1 46  ? 13.93009  21.28550 19.49514 1.000 43.23105  ? 46  PHE A CZ   1 
ATOM   759  H H    . PHE A 1 46  ? 12.55777  19.74748 23.72561 1.000 33.59560  ? 46  PHE A H    1 
ATOM   760  H HA   . PHE A 1 46  ? 10.04740  20.62245 24.03505 1.000 34.57356  ? 46  PHE A HA   1 
ATOM   761  H HB2  . PHE A 1 46  ? 9.89501   21.46847 21.84237 1.000 32.47633  ? 46  PHE A HB2  1 
ATOM   762  H HB3  . PHE A 1 46  ? 10.79981  22.38358 22.77475 1.000 32.47633  ? 46  PHE A HB3  1 
ATOM   763  H HD1  . PHE A 1 46  ? 13.19592  22.49333 22.39028 1.000 43.20393  ? 46  PHE A HD1  1 
ATOM   764  H HD2  . PHE A 1 46  ? 10.86864  20.35271 19.94450 1.000 32.02857  ? 46  PHE A HD2  1 
ATOM   765  H HE1  . PHE A 1 46  ? 14.92296  22.35766 20.87626 1.000 41.81217  ? 46  PHE A HE1  1 
ATOM   766  H HE2  . PHE A 1 46  ? 12.59864  20.22200 18.41803 1.000 37.57177  ? 46  PHE A HE2  1 
ATOM   767  H HZ   . PHE A 1 46  ? 14.62505  21.24003 18.87881 1.000 51.88987  ? 46  PHE A HZ   1 
ATOM   768  N N    . GLY A 1 47  ? 9.21110   18.79733 22.45846 1.000 22.67724  ? 47  GLY A N    1 
ATOM   769  C CA   . GLY A 1 47  ? 8.89010   17.52543 21.83696 1.000 20.26032  ? 47  GLY A CA   1 
ATOM   770  C C    . GLY A 1 47  ? 7.40472   17.22330 21.91290 1.000 20.35037  ? 47  GLY A C    1 
ATOM   771  O O    . GLY A 1 47  ? 6.57969   18.11926 22.06644 1.000 20.34324  ? 47  GLY A O    1 
ATOM   772  H H    . GLY A 1 47  ? 8.54548   19.32678 22.58588 1.000 27.22530  ? 47  GLY A H    1 
ATOM   773  H HA2  . GLY A 1 47  ? 9.15318   17.54493 20.90352 1.000 24.32499  ? 47  GLY A HA2  1 
ATOM   774  H HA3  . GLY A 1 47  ? 9.37257   16.81391 22.28625 1.000 24.32499  ? 47  GLY A HA3  1 
ATOM   775  N N    . TYR A 1 48  ? 7.09681   15.93108 21.82471 1.000 18.21899  ? 48  TYR A N    1 
ATOM   776  C CA   . TYR A 1 48  ? 5.73130   15.50961 21.56481 1.000 15.61177  ? 48  TYR A CA   1 
ATOM   777  C C    . TYR A 1 48  ? 4.83457   15.45383 22.79405 1.000 16.22237  ? 48  TYR A C    1 
ATOM   778  O O    . TYR A 1 48  ? 3.60866   15.41635 22.63810 1.000 17.15703  ? 48  TYR A O    1 
ATOM   779  C CB   . TYR A 1 48  ? 5.74543   14.12654 20.93618 1.000 15.91384  ? 48  TYR A CB   1 
ATOM   780  C CG   . TYR A 1 48  ? 6.34471   14.05413 19.55919 1.000 15.68370  ? 48  TYR A CG   1 
ATOM   781  C CD1  . TYR A 1 48  ? 6.04031   15.00089 18.59093 1.000 16.01277  ? 48  TYR A CD1  1 
ATOM   782  C CD2  . TYR A 1 48  ? 7.20068   13.02364 19.21855 1.000 16.42639  ? 48  TYR A CD2  1 
ATOM   783  C CE1  . TYR A 1 48  ? 6.56832   14.91394 17.31608 1.000 15.39130  ? 48  TYR A CE1  1 
ATOM   784  C CE2  . TYR A 1 48  ? 7.73674   12.93049 17.94901 1.000 17.26896  ? 48  TYR A CE2  1 
ATOM   785  C CZ   . TYR A 1 48  ? 7.42269   13.87785 17.00307 1.000 14.52816  ? 48  TYR A CZ   1 
ATOM   786  O OH   . TYR A 1 48  ? 7.98143   13.75850 15.74880 1.000 15.69141  ? 48  TYR A OH   1 
ATOM   787  H H    . TYR A 1 48  ? 7.65913   15.28621 21.91152 1.000 21.87540  ? 48  TYR A H    1 
ATOM   788  H HA   . TYR A 1 48  ? 5.34368   16.15723 20.95552 1.000 18.74674  ? 48  TYR A HA   1 
ATOM   789  H HB2  . TYR A 1 48  ? 6.26048   13.53581 21.50772 1.000 19.10922  ? 48  TYR A HB2  1 
ATOM   790  H HB3  . TYR A 1 48  ? 4.83063   13.81062 20.87098 1.000 19.10922  ? 48  TYR A HB3  1 
ATOM   791  H HD1  . TYR A 1 48  ? 5.47169   15.70551 18.80324 1.000 19.22793  ? 48  TYR A HD1  1 
ATOM   792  H HD2  . TYR A 1 48  ? 7.41943   12.38195 19.85516 1.000 19.72428  ? 48  TYR A HD2  1 
ATOM   793  H HE1  . TYR A 1 48  ? 6.34875   15.54992 16.67403 1.000 18.48218  ? 48  TYR A HE1  1 
ATOM   794  H HE2  . TYR A 1 48  ? 8.30847   12.22904 17.73456 1.000 20.73537  ? 48  TYR A HE2  1 
ATOM   795  H HH   . TYR A 1 48  ? 7.47885   14.11133 15.17564 1.000 18.84231  ? 48  TYR A HH   1 
ATOM   796  N N    . LYS A 1 49  ? 5.38855   15.40521 23.99921 1.000 18.31366  ? 49  LYS A N    1 
ATOM   797  C CA   . LYS A 1 49  ? 4.53717   15.19310 25.15989 1.000 17.85381  ? 49  LYS A CA   1 
ATOM   798  C C    . LYS A 1 49  ? 3.49946   16.30316 25.27327 1.000 19.72331  ? 49  LYS A C    1 
ATOM   799  O O    . LYS A 1 49  ? 3.83797   17.49172 25.30287 1.000 19.29580  ? 49  LYS A O    1 
ATOM   800  C CB   . LYS A 1 49  ? 5.36129   15.12322 26.43942 1.000 19.53930  ? 49  LYS A CB   1 
ATOM   801  C CG   . LYS A 1 49  ? 4.50906   14.79687 27.64786 1.000 20.95121  ? 49  LYS A CG   1 
ATOM   802  C CD   . LYS A 1 49  ? 5.35870   14.62045 28.89261 1.000 26.37645  ? 49  LYS A CD   1 
ATOM   803  C CE   . LYS A 1 49  ? 4.49908   14.20753 30.07266 1.000 35.34024  ? 49  LYS A CE   1 
ATOM   804  N NZ   . LYS A 1 49  ? 5.31917   13.90910 31.27350 1.000 50.71498  ? 49  LYS A NZ   1 
ATOM   805  H H    . LYS A 1 49  ? 6.22798   15.48951 24.16607 1.000 21.98901  ? 49  LYS A H    1 
ATOM   806  H HA   . LYS A 1 49  ? 4.07946   14.34462 25.05269 1.000 21.43718  ? 49  LYS A HA   1 
ATOM   807  H HB2  . LYS A 1 49  ? 6.03442   14.43093 26.34709 1.000 23.45978  ? 49  LYS A HB2  1 
ATOM   808  H HB3  . LYS A 1 49  ? 5.78683   15.98157 26.59124 1.000 23.45978  ? 49  LYS A HB3  1 
ATOM   809  H HG2  . LYS A 1 49  ? 3.88335   15.52114 27.80539 1.000 25.15407  ? 49  LYS A HG2  1 
ATOM   810  H HG3  . LYS A 1 49  ? 4.02672   13.97066 27.48778 1.000 25.15407  ? 49  LYS A HG3  1 
ATOM   811  H HD2  . LYS A 1 49  ? 6.02209   13.92994 28.73761 1.000 31.66436  ? 49  LYS A HD2  1 
ATOM   812  H HD3  . LYS A 1 49  ? 5.79654   15.45872 29.10824 1.000 31.66436  ? 49  LYS A HD3  1 
ATOM   813  H HE2  . LYS A 1 49  ? 3.88946   14.92924 30.29267 1.000 42.42090  ? 49  LYS A HE2  1 
ATOM   814  H HE3  . LYS A 1 49  ? 3.99863   13.40970 29.84048 1.000 42.42090  ? 49  LYS A HE3  1 
ATOM   815  H HZ1  . LYS A 1 49  ? 4.79528   13.63958 31.94059 1.000 60.87059  ? 49  LYS A HZ1  1 
ATOM   816  H HZ2  . LYS A 1 49  ? 5.90603   13.26589 31.08916 1.000 60.87059  ? 49  LYS A HZ2  1 
ATOM   817  H HZ3  . LYS A 1 49  ? 5.76068   14.63824 31.52947 1.000 60.87059  ? 49  LYS A HZ3  1 
ATOM   818  N N    . GLY A 1 50  ? 2.23093   15.90380 25.35668 1.000 18.94446  ? 50  GLY A N    1 
ATOM   819  C CA   . GLY A 1 50  ? 1.13240   16.82823 25.49393 1.000 20.87694  ? 50  GLY A CA   1 
ATOM   820  C C    . GLY A 1 50  ? 0.49899   17.25295 24.19192 1.000 17.56028  ? 50  GLY A C    1 
ATOM   821  O O    . GLY A 1 50  ? -0.54368  17.92262 24.21646 1.000 24.02840  ? 50  GLY A O    1 
ATOM   822  H H    . GLY A 1 50  ? 1.98514   15.07997 25.33464 1.000 22.74596  ? 50  GLY A H    1 
ATOM   823  H HA2  . GLY A 1 50  ? 0.44375   16.41463 26.03761 1.000 25.06495  ? 50  GLY A HA2  1 
ATOM   824  H HA3  . GLY A 1 50  ? 1.45185   17.62671 25.94257 1.000 25.06495  ? 50  GLY A HA3  1 
ATOM   825  N N    . SER A 1 51  ? 1.08407   16.87755 23.06245 1.000 15.97817  ? 51  SER A N    1 
ATOM   826  C CA   . SER A 1 51  ? 0.61023   17.29996 21.75577 1.000 17.62352  ? 51  SER A CA   1 
ATOM   827  C C    . SER A 1 51  ? -0.50369  16.37474 21.28196 1.000 20.66964  ? 51  SER A C    1 
ATOM   828  O O    . SER A 1 51  ? -0.76168  15.31734 21.86135 1.000 18.01604  ? 51  SER A O    1 
ATOM   829  C CB   . SER A 1 51  ? 1.76363   17.33219 20.75201 1.000 18.80506  ? 51  SER A CB   1 
ATOM   830  O OG   . SER A 1 51  ? 2.23502   16.03308 20.44975 1.000 17.96581  ? 51  SER A OG   1 
ATOM   831  H H    . SER A 1 51  ? 1.77420   16.36562 23.02712 1.000 19.18642  ? 51  SER A H    1 
ATOM   832  H HA   . SER A 1 51  ? 0.25155   18.19929 21.81457 1.000 21.16084  ? 51  SER A HA   1 
ATOM   833  H HB2  . SER A 1 51  ? 1.45280   17.74934 19.93331 1.000 22.57868  ? 51  SER A HB2  1 
ATOM   834  H HB3  . SER A 1 51  ? 2.49247   17.84790 21.13114 1.000 22.57868  ? 51  SER A HB3  1 
ATOM   835  H HG   . SER A 1 51  ? 2.71438   15.74802 21.07788 1.000 21.57158  ? 51  SER A HG   1 
ATOM   836  N N    . CYS A 1 52  ? -1.17857  16.78742 20.21637 1.000 16.73093  ? 52  CYS A N    1 
ATOM   837  C CA   . CYS A 1 52  ? -2.36246  16.07156 19.77954 1.000 16.33186  ? 52  CYS A CA   1 
ATOM   838  C C    . CYS A 1 52  ? -2.17948  15.48170 18.38875 1.000 19.34884  ? 52  CYS A C    1 
ATOM   839  O O    . CYS A 1 52  ? -1.26002  15.83389 17.64591 1.000 18.65717  ? 52  CYS A O    1 
ATOM   840  C CB   . CYS A 1 52  ? -3.59958  16.98153 19.78828 1.000 21.87083  ? 52  CYS A CB   1 
ATOM   841  S SG   . CYS A 1 52  ? -3.69321  18.15468 18.41321 1.000 24.27122  ? 52  CYS A SG   1 
ATOM   842  H H    . CYS A 1 52  ? -0.97016  17.47124 19.73830 1.000 20.08973  ? 52  CYS A H    1 
ATOM   843  H HA   . CYS A 1 52  ? -2.50766  15.33220 20.39042 1.000 19.61084  ? 52  CYS A HA   1 
ATOM   844  H HB2  . CYS A 1 52  ? -4.39184  16.42322 19.74925 1.000 26.25761  ? 52  CYS A HB2  1 
ATOM   845  H HB3  . CYS A 1 52  ? -3.59655  17.49616 20.61049 1.000 26.25761  ? 52  CYS A HB3  1 
ATOM   846  H HG   . CYS A 1 52  ? -2.73290  18.87347 18.44683 1.000 29.13807  ? 52  CYS A HG   1 
ATOM   847  N N    . PHE A 1 53  ? -3.05572  14.53202 18.07513 1.000 14.62048  ? 53  PHE A N    1 
ATOM   848  C CA   . PHE A 1 53  ? -3.23253  14.03648 16.71605 1.000 15.12290  ? 53  PHE A CA   1 
ATOM   849  C C    . PHE A 1 53  ? -4.31765  14.88932 16.08387 1.000 17.87850  ? 53  PHE A C    1 
ATOM   850  O O    . PHE A 1 53  ? -5.49031  14.78215 16.45614 1.000 20.63768  ? 53  PHE A O    1 
ATOM   851  C CB   . PHE A 1 53  ? -3.62101  12.56510 16.71389 1.000 17.92537  ? 53  PHE A CB   1 
ATOM   852  C CG   . PHE A 1 53  ? -2.46329  11.65135 16.92004 1.000 14.22782  ? 53  PHE A CG   1 
ATOM   853  C CD1  . PHE A 1 53  ? -2.01908  11.34784 18.19685 1.000 19.05075  ? 53  PHE A CD1  1 
ATOM   854  C CD2  . PHE A 1 53  ? -1.80376  11.10385 15.83727 1.000 17.45507  ? 53  PHE A CD2  1 
ATOM   855  C CE1  . PHE A 1 53  ? -0.94207  10.50996 18.38420 1.000 19.11786  ? 53  PHE A CE1  1 
ATOM   856  C CE2  . PHE A 1 53  ? -0.72868  10.26437 16.02181 1.000 22.03223  ? 53  PHE A CE2  1 
ATOM   857  C CZ   . PHE A 1 53  ? -0.29493  9.97086  17.29484 1.000 25.31958  ? 53  PHE A CZ   1 
ATOM   858  H H    . PHE A 1 53  ? -3.57187  14.15013 18.64727 1.000 17.55718  ? 53  PHE A H    1 
ATOM   859  H HA   . PHE A 1 53  ? -2.40662  14.11842 16.21400 1.000 18.16009  ? 53  PHE A HA   1 
ATOM   860  H HB2  . PHE A 1 53  ? -4.25665  12.40723 17.42938 1.000 21.52306  ? 53  PHE A HB2  1 
ATOM   861  H HB3  . PHE A 1 53  ? -4.02365  12.34803 15.85852 1.000 21.52306  ? 53  PHE A HB3  1 
ATOM   862  H HD1  . PHE A 1 53  ? -2.45217  11.71327 18.93427 1.000 22.87351  ? 53  PHE A HD1  1 
ATOM   863  H HD2  . PHE A 1 53  ? -2.08877  11.30431 14.97502 1.000 20.95870  ? 53  PHE A HD2  1 
ATOM   864  H HE1  . PHE A 1 53  ? -0.65250  10.30871 19.24475 1.000 22.95404  ? 53  PHE A HE1  1 
ATOM   865  H HE2  . PHE A 1 53  ? -0.29528  9.89540  15.28633 1.000 26.45128  ? 53  PHE A HE2  1 
ATOM   866  H HZ   . PHE A 1 53  ? 0.43522   9.40843  17.41917 1.000 30.39611  ? 53  PHE A HZ   1 
ATOM   867  N N    . HIS A 1 54  ? -3.93616  15.74559 15.14524 1.000 17.44879  ? 54  HIS A N    1 
ATOM   868  C CA   . HIS A 1 54  ? -4.87209  16.73689 14.64076 1.000 16.56013  ? 54  HIS A CA   1 
ATOM   869  C C    . HIS A 1 54  ? -5.65000  16.26813 13.42036 1.000 18.38447  ? 54  HIS A C    1 
ATOM   870  O O    . HIS A 1 54  ? -6.64325  16.90651 13.06287 1.000 20.23772  ? 54  HIS A O    1 
ATOM   871  C CB   . HIS A 1 54  ? -4.13332  18.03689 14.30330 1.000 18.59779  ? 54  HIS A CB   1 
ATOM   872  C CG   . HIS A 1 54  ? -3.16155  17.89688 13.17833 1.000 19.89310  ? 54  HIS A CG   1 
ATOM   873  N ND1  . HIS A 1 54  ? -1.86664  17.46251 13.36279 1.000 21.76041  ? 54  HIS A ND1  1 
ATOM   874  C CD2  . HIS A 1 54  ? -3.29953  18.12135 11.85142 1.000 22.33567  ? 54  HIS A CD2  1 
ATOM   875  C CE1  . HIS A 1 54  ? -1.24867  17.42696 12.19591 1.000 21.65600  ? 54  HIS A CE1  1 
ATOM   876  N NE2  . HIS A 1 54  ? -2.09575  17.82160 11.26308 1.000 20.62942  ? 54  HIS A NE2  1 
ATOM   877  H H    . HIS A 1 54  ? -3.15290  15.77113 14.79105 1.000 20.95116  ? 54  HIS A H    1 
ATOM   878  H HA   . HIS A 1 54  ? -5.51607  16.93124 15.33963 1.000 19.88477  ? 54  HIS A HA   1 
ATOM   879  H HB2  . HIS A 1 54  ? -4.78456  18.71002 14.05093 1.000 22.32996  ? 54  HIS A HB2  1 
ATOM   880  H HB3  . HIS A 1 54  ? -3.64085  18.32885 15.08633 1.000 22.32996  ? 54  HIS A HB3  1 
ATOM   881  H HD2  . HIS A 1 54  ? -4.06591  18.42222 11.41893 1.000 26.81542  ? 54  HIS A HD2  1 
ATOM   882  H HE1  . HIS A 1 54  ? -0.36662  17.16792 12.05525 1.000 25.99981  ? 54  HIS A HE1  1 
ATOM   883  H HE2  . HIS A 1 54  ? -1.92164  17.88123 10.42300 1.000 24.76792  ? 54  HIS A HE2  1 
ATOM   884  N N    A ARG A 1 55  ? -5.22846  15.18125 12.78059 0.751 16.02560  ? 55  ARG A N    1 
ATOM   885  N N    B ARG A 1 55  ? -5.25377  15.16271 12.79025 0.249 16.52543  ? 55  ARG A N    1 
ATOM   886  C CA   A ARG A 1 55  ? -5.85816  14.70512 11.55454 0.751 17.27307  ? 55  ARG A CA   1 
ATOM   887  C CA   B ARG A 1 55  ? -5.89137  14.73018 11.54715 0.249 17.61880  ? 55  ARG A CA   1 
ATOM   888  C C    A ARG A 1 55  ? -5.88559  13.18761 11.59632 0.751 15.72306  ? 55  ARG A C    1 
ATOM   889  C C    B ARG A 1 55  ? -5.89215  13.20955 11.50110 0.249 15.69095  ? 55  ARG A C    1 
ATOM   890  O O    A ARG A 1 55  ? -4.83401  12.54540 11.67797 0.751 17.52194  ? 55  ARG A O    1 
ATOM   891  O O    B ARG A 1 55  ? -4.83067  12.59140 11.37944 0.249 19.09395  ? 55  ARG A O    1 
ATOM   892  C CB   A ARG A 1 55  ? -5.09971  15.21530 10.32520 0.751 18.06396  ? 55  ARG A CB   1 
ATOM   893  C CB   B ARG A 1 55  ? -5.16317  15.32419 10.34175 0.249 19.85153  ? 55  ARG A CB   1 
ATOM   894  C CG   A ARG A 1 55  ? -5.78341  14.95970 8.99375  0.751 23.87080  ? 55  ARG A CG   1 
ATOM   895  C CG   B ARG A 1 55  ? -5.78132  15.02429 8.98593  0.249 24.37658  ? 55  ARG A CG   1 
ATOM   896  C CD   A ARG A 1 55  ? -5.08712  15.72190 7.85686  0.751 30.55040  ? 55  ARG A CD   1 
ATOM   897  C CD   B ARG A 1 55  ? -5.17788  15.93244 7.91493  0.249 32.50315  ? 55  ARG A CD   1 
ATOM   898  N NE   A ARG A 1 55  ? -5.94751  15.84202 6.68166  0.751 39.06382  ? 55  ARG A NE   1 
ATOM   899  N NE   B ARG A 1 55  ? -4.76438  15.20704 6.71590  0.249 41.64814  ? 55  ARG A NE   1 
ATOM   900  C CZ   A ARG A 1 55  ? -5.74432  15.22212 5.52022  0.751 56.18798  ? 55  ARG A CZ   1 
ATOM   901  C CZ   B ARG A 1 55  ? -5.48652  15.11220 5.60138  0.249 49.45462  ? 55  ARG A CZ   1 
ATOM   902  N NH1  A ARG A 1 55  ? -4.69194  14.43185 5.34468  0.751 55.70815  ? 55  ARG A NH1  1 
ATOM   903  N NH1  B ARG A 1 55  ? -6.67604  15.69461 5.51435  0.249 50.68075  ? 55  ARG A NH1  1 
ATOM   904  N NH2  A ARG A 1 55  ? -6.60264  15.40133 4.52548  0.751 45.16396  ? 55  ARG A NH2  1 
ATOM   905  N NH2  B ARG A 1 55  ? -5.01377  14.42971 4.56808  0.249 49.29897  ? 55  ARG A NH2  1 
ATOM   906  H H    A ARG A 1 55  ? -4.56878  14.69522 13.04172 0.751 19.24334  ? 55  ARG A H    1 
ATOM   907  H H    B ARG A 1 55  ? -4.62035  14.64799 13.06125 0.249 19.84313  ? 55  ARG A H    1 
ATOM   908  H HA   A ARG A 1 55  ? -6.77331  15.02160 11.49769 0.751 20.74030  ? 55  ARG A HA   1 
ATOM   909  H HA   B ARG A 1 55  ? -6.81583  15.02370 11.53645 0.249 21.15517  ? 55  ARG A HA   1 
ATOM   910  H HB2  A ARG A 1 55  ? -4.98405  16.17440 10.41271 0.751 21.68936  ? 55  ARG A HB2  1 
ATOM   911  H HB2  B ARG A 1 55  ? -5.14418  16.28875 10.44259 0.249 23.83445  ? 55  ARG A HB2  1 
ATOM   912  H HB3  A ARG A 1 55  ? -4.23433  14.77810 10.29578 0.751 21.68936  ? 55  ARG A HB3  1 
ATOM   913  H HB3  B ARG A 1 55  ? -4.25866  14.97402 10.32966 0.249 23.83445  ? 55  ARG A HB3  1 
ATOM   914  H HG2  A ARG A 1 55  ? -5.75114  14.01158 8.79142  0.751 28.65758  ? 55  ARG A HG2  1 
ATOM   915  H HG2  B ARG A 1 55  ? -5.60538  14.10141 8.74461  0.249 29.26451  ? 55  ARG A HG2  1 
ATOM   916  H HG3  A ARG A 1 55  ? -6.70533  15.25738 9.04224  0.751 28.65758  ? 55  ARG A HG3  1 
ATOM   917  H HG3  B ARG A 1 55  ? -6.73787  15.18117 9.02211  0.249 29.26451  ? 55  ARG A HG3  1 
ATOM   918  H HD2  A ARG A 1 55  ? -4.86100  16.61478 8.16108  0.751 36.67309  ? 55  ARG A HD2  1 
ATOM   919  H HD2  B ARG A 1 55  ? -5.83898  16.59168 7.65178  0.249 39.01640  ? 55  ARG A HD2  1 
ATOM   920  H HD3  A ARG A 1 55  ? -4.28258  15.24604 7.59770  0.751 36.67309  ? 55  ARG A HD3  1 
ATOM   921  H HD3  B ARG A 1 55  ? -4.39586  16.37458 8.28080  0.249 39.01640  ? 55  ARG A HD3  1 
ATOM   922  H HE   A ARG A 1 55  ? -6.63740  16.35161 6.74471  0.751 46.88920  ? 55  ARG A HE   1 
ATOM   923  H HE   B ARG A 1 55  ? -4.00000  14.81324 6.73116  0.249 49.99038  ? 55  ARG A HE   1 
ATOM   924  H HH11 A ARG A 1 55  ? -4.13053  14.31468 5.98553  0.751 66.86240  ? 55  ARG A HH11 1 
ATOM   925  H HH11 B ARG A 1 55  ? -6.98731  16.13857 6.18188  0.249 60.82951  ? 55  ARG A HH11 1 
ATOM   926  H HH12 A ARG A 1 55  ? -4.57169  14.03714 4.59013  0.751 66.86240  ? 55  ARG A HH12 1 
ATOM   927  H HH12 B ARG A 1 55  ? -7.13549  15.62801 4.79042  0.249 60.82951  ? 55  ARG A HH12 1 
ATOM   928  H HH21 A ARG A 1 55  ? -7.28426  15.91461 4.63289  0.751 54.20937  ? 55  ARG A HH21 1 
ATOM   929  H HH21 B ARG A 1 55  ? -4.24361  14.05047 4.61933  0.249 59.17137  ? 55  ARG A HH21 1 
ATOM   930  H HH22 A ARG A 1 55  ? -6.47768  15.00429 3.77292  0.751 54.20937  ? 55  ARG A HH22 1 
ATOM   931  H HH22 B ARG A 1 55  ? -5.47721  14.36614 3.84643  0.249 59.17137  ? 55  ARG A HH22 1 
ATOM   932  N N    . ILE A 1 56  ? -7.08198  12.61497 11.55588 1.000 15.72682  ? 56  ILE A N    1 
ATOM   933  C CA   . ILE A 1 56  ? -7.24399  11.16790 11.56313 1.000 15.77481  ? 56  ILE A CA   1 
ATOM   934  C C    . ILE A 1 56  ? -8.28214  10.82677 10.50808 1.000 16.73517  ? 56  ILE A C    1 
ATOM   935  O O    . ILE A 1 56  ? -9.44573  11.23390 10.61927 1.000 17.95667  ? 56  ILE A O    1 
ATOM   936  C CB   . ILE A 1 56  ? -7.65780  10.59653 12.93027 1.000 17.82068  ? 56  ILE A CB   1 
ATOM   937  C CG1  . ILE A 1 56  ? -6.59450  10.90882 13.98293 1.000 17.84440  ? 56  ILE A CG1  1 
ATOM   938  C CG2  . ILE A 1 56  ? -7.88362  9.09614  12.79225 1.000 17.86091  ? 56  ILE A CG2  1 
ATOM   939  C CD1  . ILE A 1 56  ? -6.92944  10.37026 15.39064 1.000 24.25037  ? 56  ILE A CD1  1 
ATOM   940  H H    . ILE A 1 56  ? -7.82492  13.04694 11.52345 1.000 18.80912  ? 56  ILE A H    1 
ATOM   941  H HA   . ILE A 1 56  ? -6.39546  10.75988 11.32985 1.000 18.94239  ? 56  ILE A HA   1 
ATOM   942  H HB   . ILE A 1 56  ? -8.48374  11.01291 13.22243 1.000 21.39743  ? 56  ILE A HB   1 
ATOM   943  H HG12 . ILE A 1 56  ? -5.75534  10.50897 13.70575 1.000 21.42589  ? 56  ILE A HG12 1 
ATOM   944  H HG13 . ILE A 1 56  ? -6.49691  11.87153 14.05059 1.000 21.42589  ? 56  ILE A HG13 1 
ATOM   945  H HG21 . ILE A 1 56  ? -8.06424  8.72202  13.66878 1.000 21.44570  ? 56  ILE A HG21 1 
ATOM   946  H HG22 . ILE A 1 56  ? -8.64043  8.94338  12.20505 1.000 21.44570  ? 56  ILE A HG22 1 
ATOM   947  H HG23 . ILE A 1 56  ? -7.08661  8.69002  12.41710 1.000 21.44570  ? 56  ILE A HG23 1 
ATOM   948  H HD11 . ILE A 1 56  ? -6.40926  10.85876 16.04767 1.000 29.11306  ? 56  ILE A HD11 1 
ATOM   949  H HD12 . ILE A 1 56  ? -7.87648  10.49495 15.55939 1.000 29.11306  ? 56  ILE A HD12 1 
ATOM   950  H HD13 . ILE A 1 56  ? -6.70810  9.42662  15.42866 1.000 29.11306  ? 56  ILE A HD13 1 
ATOM   951  N N    . ILE A 1 57  ? -7.86115  10.08815 9.48935  1.000 16.73442  ? 57  ILE A N    1 
ATOM   952  C CA   . ILE A 1 57  ? -8.74722  9.66056  8.41379  1.000 18.10743  ? 57  ILE A CA   1 
ATOM   953  C C    . ILE A 1 57  ? -8.82611  8.14305  8.46891  1.000 18.19358  ? 57  ILE A C    1 
ATOM   954  O O    . ILE A 1 57  ? -7.84838  7.45619  8.13749  1.000 17.69650  ? 57  ILE A O    1 
ATOM   955  C CB   . ILE A 1 57  ? -8.25314  10.15532 7.04949  1.000 18.68832  ? 57  ILE A CB   1 
ATOM   956  C CG1  . ILE A 1 57  ? -8.19427  11.67977 7.05897  1.000 19.06562  ? 57  ILE A CG1  1 
ATOM   957  C CG2  . ILE A 1 57  ? -9.18299  9.66923  5.95614  1.000 20.39741  ? 57  ILE A CG2  1 
ATOM   958  C CD1  . ILE A 1 57  ? -7.49418  12.26847 5.87279  1.000 27.11717  ? 57  ILE A CD1  1 
ATOM   959  H H    . ILE A 1 57  ? -7.05067  9.81610  9.39598  1.000 20.01824  ? 57  ILE A H    1 
ATOM   960  H HA   . ILE A 1 57  ? -9.63488  10.02830 8.54691  1.000 21.66585  ? 57  ILE A HA   1 
ATOM   961  H HB   . ILE A 1 57  ? -7.36547  9.80300  6.87973  1.000 22.36292  ? 57  ILE A HB   1 
ATOM   962  H HG12 . ILE A 1 57  ? -9.10028  12.02609 7.06896  1.000 22.89135  ? 57  ILE A HG12 1 
ATOM   963  H HG13 . ILE A 1 57  ? -7.72016  11.96791 7.85464  1.000 22.89135  ? 57  ILE A HG13 1 
ATOM   964  H HG21 . ILE A 1 57  ? -8.88839  10.03256 5.10638  1.000 24.41383  ? 57  ILE A HG21 1 
ATOM   965  H HG22 . ILE A 1 57  ? -9.15787  8.69996  5.92801  1.000 24.41383  ? 57  ILE A HG22 1 
ATOM   966  H HG23 . ILE A 1 57  ? -10.08405 9.97126  6.15049  1.000 24.41383  ? 57  ILE A HG23 1 
ATOM   967  H HD11 . ILE A 1 57  ? -7.46916  13.23349 5.96771  1.000 32.55322  ? 57  ILE A HD11 1 
ATOM   968  H HD12 . ILE A 1 57  ? -6.59118  11.91656 5.83230  1.000 32.55322  ? 57  ILE A HD12 1 
ATOM   969  H HD13 . ILE A 1 57  ? -7.97941  12.02772 5.06812  1.000 32.55322  ? 57  ILE A HD13 1 
ATOM   970  N N    . PRO A 1 58  ? -9.95532  7.58159  8.89163  1.000 19.15718  ? 58  PRO A N    1 
ATOM   971  C CA   . PRO A 1 58  ? -10.05420 6.12342  8.98571  1.000 19.63795  ? 58  PRO A CA   1 
ATOM   972  C C    . PRO A 1 58  ? -9.78469  5.47406  7.64198  1.000 20.95981  ? 58  PRO A C    1 
ATOM   973  O O    . PRO A 1 58  ? -10.24900 5.93772  6.59615  1.000 23.96446  ? 58  PRO A O    1 
ATOM   974  C CB   . PRO A 1 58  ? -11.49809 5.89154  9.44446  1.000 21.12877  ? 58  PRO A CB   1 
ATOM   975  C CG   . PRO A 1 58  ? -11.87065 7.16560  10.13989 1.000 26.56361  ? 58  PRO A CG   1 
ATOM   976  C CD   . PRO A 1 58  ? -11.20141 8.24217  9.32199  1.000 21.30064  ? 58  PRO A CD   1 
ATOM   977  H HA   . PRO A 1 58  ? -9.44076  5.77540  9.65165  1.000 23.50248  ? 58  PRO A HA   1 
ATOM   978  H HB2  . PRO A 1 58  ? -12.07001 5.73094  8.67764  1.000 25.29146  ? 58  PRO A HB2  1 
ATOM   979  H HB3  . PRO A 1 58  ? -11.53789 5.13639  10.05196 1.000 25.29146  ? 58  PRO A HB3  1 
ATOM   980  H HG2  . PRO A 1 58  ? -12.83437 7.27580  10.14135 1.000 31.88895  ? 58  PRO A HG2  1 
ATOM   981  H HG3  . PRO A 1 58  ? -11.53606 7.15929  11.05033 1.000 31.88895  ? 58  PRO A HG3  1 
ATOM   982  H HD2  . PRO A 1 58  ? -11.74642 8.49012  8.55885  1.000 25.57339  ? 58  PRO A HD2  1 
ATOM   983  H HD3  . PRO A 1 58  ? -11.01255 9.02477  9.86307  1.000 25.57339  ? 58  PRO A HD3  1 
ATOM   984  N N    . GLY A 1 59  ? -9.04455  4.37525  7.68637  1.000 20.85867  ? 59  GLY A N    1 
ATOM   985  C CA   . GLY A 1 59  ? -8.67496  3.68134  6.48025  1.000 25.96098  ? 59  GLY A CA   1 
ATOM   986  C C    . GLY A 1 59  ? -7.56398  4.34334  5.71025  1.000 23.08676  ? 59  GLY A C    1 
ATOM   987  O O    . GLY A 1 59  ? -7.32292  3.97554  4.55573  1.000 23.50730  ? 59  GLY A O    1 
ATOM   988  H H    . GLY A 1 59  ? -8.74650  4.01604  8.40868  1.000 25.04301  ? 59  GLY A H    1 
ATOM   989  H HA2  . GLY A 1 59  ? -8.38719  2.78390  6.70980  1.000 31.16579  ? 59  GLY A HA2  1 
ATOM   990  H HA3  . GLY A 1 59  ? -9.45014  3.62563  5.89982  1.000 31.16579  ? 59  GLY A HA3  1 
ATOM   991  N N    . PHE A 1 60  ? -6.88579  5.31634  6.30881  1.000 19.12904  ? 60  PHE A N    1 
ATOM   992  C CA   . PHE A 1 60  ? -5.77483  5.99116  5.65315  1.000 18.78983  ? 60  PHE A CA   1 
ATOM   993  C C    . PHE A 1 60  ? -4.64372  6.20677  6.65219  1.000 18.97842  ? 60  PHE A C    1 
ATOM   994  O O    . PHE A 1 60  ? -3.63565  5.49413  6.59152  1.000 17.53633  ? 60  PHE A O    1 
ATOM   995  C CB   . PHE A 1 60  ? -6.26165  7.29725  5.02786  1.000 20.29991  ? 60  PHE A CB   1 
ATOM   996  C CG   . PHE A 1 60  ? -5.19540  8.07452  4.31946  1.000 21.16991  ? 60  PHE A CG   1 
ATOM   997  C CD1  . PHE A 1 60  ? -4.01606  7.47429  3.90516  1.000 22.49187  ? 60  PHE A CD1  1 
ATOM   998  C CD2  . PHE A 1 60  ? -5.38054  9.42110  4.06804  1.000 19.89366  ? 60  PHE A CD2  1 
ATOM   999  C CE1  . PHE A 1 60  ? -3.04277  8.20912  3.25568  1.000 25.14215  ? 60  PHE A CE1  1 
ATOM   1000 C CE2  . PHE A 1 60  ? -4.41405  10.16003 3.42883  1.000 23.78162  ? 60  PHE A CE2  1 
ATOM   1001 C CZ   . PHE A 1 60  ? -3.24240  9.55584  3.02002  1.000 23.29765  ? 60  PHE A CZ   1 
ATOM   1002 H H    . PHE A 1 60  ? -7.05153  5.60596  7.10144  1.000 22.89178  ? 60  PHE A H    1 
ATOM   1003 H HA   . PHE A 1 60  ? -5.41749  5.45226  4.93010  1.000 22.48473  ? 60  PHE A HA   1 
ATOM   1004 H HB2  . PHE A 1 60  ? -6.95469  7.09190  4.38100  1.000 24.37250  ? 60  PHE A HB2  1 
ATOM   1005 H HB3  . PHE A 1 60  ? -6.62012  7.86242  5.72999  1.000 24.37250  ? 60  PHE A HB3  1 
ATOM   1006 H HD1  . PHE A 1 60  ? -3.87891  6.56862  4.06595  1.000 27.00285  ? 60  PHE A HD1  1 
ATOM   1007 H HD2  . PHE A 1 60  ? -6.17041  9.83291  4.33526  1.000 23.88501  ? 60  PHE A HD2  1 
ATOM   1008 H HE1  . PHE A 1 60  ? -2.25583  7.79858  2.97805  1.000 30.18320  ? 60  PHE A HE1  1 
ATOM   1009 H HE2  . PHE A 1 60  ? -4.54942  11.06663 3.27183  1.000 28.55056  ? 60  PHE A HE2  1 
ATOM   1010 H HZ   . PHE A 1 60  ? -2.58807  10.05460 2.58645  1.000 27.96980  ? 60  PHE A HZ   1 
ATOM   1011 N N    . MET A 1 61  ? -4.77777  7.15312  7.57988  1.000 17.01268  ? 61  MET A N    1 
ATOM   1012 C CA   A MET A 1 61  ? -3.65480  7.45846  8.45618  0.406 15.29135  ? 61  MET A CA   1 
ATOM   1013 C CA   B MET A 1 61  ? -3.65720  7.43947  8.46342  0.594 15.29422  ? 61  MET A CA   1 
ATOM   1014 C C    . MET A 1 61  ? -4.10650  8.26052  9.66503  1.000 16.36574  ? 61  MET A C    1 
ATOM   1015 O O    . MET A 1 61  ? -5.19523  8.84101  9.67992  1.000 16.40455  ? 61  MET A O    1 
ATOM   1016 C CB   A MET A 1 61  ? -2.57024  8.24417  7.71059  0.406 15.32871  ? 61  MET A CB   1 
ATOM   1017 C CB   B MET A 1 61  ? -2.53168  8.15039  7.70685  0.594 15.35011  ? 61  MET A CB   1 
ATOM   1018 C CG   A MET A 1 61  ? -3.10674  9.51800  7.05766  0.406 20.45556  ? 61  MET A CG   1 
ATOM   1019 C CG   B MET A 1 61  ? -2.96561  9.40014  6.98470  0.594 27.43606  ? 61  MET A CG   1 
ATOM   1020 S SD   A MET A 1 61  ? -1.86656  10.80882 6.83169  0.406 22.66658  ? 61  MET A SD   1 
ATOM   1021 S SD   B MET A 1 61  ? -2.76582  10.80450 8.08530  0.594 22.93740  ? 61  MET A SD   1 
ATOM   1022 C CE   A MET A 1 61  ? -0.87986  10.11620 5.50822  0.406 37.78261  ? 61  MET A CE   1 
ATOM   1023 C CE   B MET A 1 61  ? -3.36628  12.14054 7.05845  0.594 31.98310  ? 61  MET A CE   1 
ATOM   1024 H H    A MET A 1 61  ? -5.48872  7.61750  7.71592  0.406 20.42783  ? 61  MET A H    1 
ATOM   1025 H H    B MET A 1 61  ? -5.48461  7.62528  7.71049  0.594 20.42783  ? 61  MET A H    1 
ATOM   1026 H HA   . MET A 1 61  ? -3.29860  6.61220  8.76903  1.000 18.29000  ? 61  MET A HA   1 
ATOM   1027 H HB2  A MET A 1 61  ? -1.87606  8.49797  8.33876  0.406 18.33139  ? 61  MET A HB2  1 
ATOM   1028 H HB2  B MET A 1 61  ? -1.84214  8.40153  8.34117  0.594 18.35706  ? 61  MET A HB2  1 
ATOM   1029 H HB3  A MET A 1 61  ? -2.19724  7.68305  7.01280  0.406 18.33139  ? 61  MET A HB3  1 
ATOM   1030 H HB3  B MET A 1 61  ? -2.16840  7.54001  7.04627  0.594 18.35706  ? 61  MET A HB3  1 
ATOM   1031 H HG2  A MET A 1 61  ? -3.46061  9.29360  6.18284  0.406 24.55929  ? 61  MET A HG2  1 
ATOM   1032 H HG2  B MET A 1 61  ? -2.41604  9.53490  6.19685  0.594 32.93589  ? 61  MET A HG2  1 
ATOM   1033 H HG3  A MET A 1 61  ? -3.81092  9.88127  7.61719  0.406 24.55929  ? 61  MET A HG3  1 
ATOM   1034 H HG3  B MET A 1 61  ? -3.89877  9.32809  6.72990  0.594 32.93589  ? 61  MET A HG3  1 
ATOM   1035 H HE1  A MET A 1 61  ? -0.84253  9.15262  5.61315  0.406 45.35174  ? 61  MET A HE1  1 
ATOM   1036 H HE1  B MET A 1 61  ? -4.33342  12.17806 7.12266  0.594 38.39233  ? 61  MET A HE1  1 
ATOM   1037 H HE2  A MET A 1 61  ? -1.28952  10.34074 4.65812  0.406 45.35174  ? 61  MET A HE2  1 
ATOM   1038 H HE2  B MET A 1 61  ? -2.98153  12.97503 7.36907  0.594 38.39233  ? 61  MET A HE2  1 
ATOM   1039 H HE3  A MET A 1 61  ? 0.01464   10.48872 5.55299  0.406 45.35174  ? 61  MET A HE3  1 
ATOM   1040 H HE3  B MET A 1 61  ? -3.10190  11.97612 6.13977  0.594 38.39233  ? 61  MET A HE3  1 
ATOM   1041 N N    . CYS A 1 62  ? -3.23480  8.27765  10.67602 1.000 13.92534  ? 62  CYS A N    1 
ATOM   1042 C CA   . CYS A 1 62  ? -3.31097  9.15685  11.83454 1.000 13.51111  ? 62  CYS A CA   1 
ATOM   1043 C C    . CYS A 1 62  ? -2.11272  10.09450 11.78445 1.000 16.16131  ? 62  CYS A C    1 
ATOM   1044 O O    . CYS A 1 62  ? -0.97052  9.62502  11.73738 1.000 19.24787  ? 62  CYS A O    1 
ATOM   1045 C CB   . CYS A 1 62  ? -3.25814  8.37121  13.14115 1.000 17.64096  ? 62  CYS A CB   1 
ATOM   1046 S SG   . CYS A 1 62  ? -4.55054  7.18078  13.33250 1.000 21.03305  ? 62  CYS A SG   1 
ATOM   1047 H H    . CYS A 1 62  ? -2.55174  7.75633  10.71115 1.000 16.72302  ? 62  CYS A H    1 
ATOM   1048 H HA   . CYS A 1 62  ? -4.14214  9.65630  11.80990 1.000 16.22594  ? 62  CYS A HA   1 
ATOM   1049 H HB2  . CYS A 1 62  ? -2.41348  7.89606  13.18198 1.000 21.18176  ? 62  CYS A HB2  1 
ATOM   1050 H HB3  . CYS A 1 62  ? -3.32334  8.99608  13.88019 1.000 21.18176  ? 62  CYS A HB3  1 
ATOM   1051 H HG   . CYS A 1 62  ? -4.49597  6.71931  14.43888 1.000 25.25227  ? 62  CYS A HG   1 
ATOM   1052 N N    . GLN A 1 63  ? -2.35612  11.40447 11.82506 1.000 14.01695  ? 63  GLN A N    1 
ATOM   1053 C CA   . GLN A 1 63  ? -1.28400  12.38393 11.70035 1.000 13.93751  ? 63  GLN A CA   1 
ATOM   1054 C C    . GLN A 1 63  ? -1.13829  13.19921 12.97537 1.000 17.65570  ? 63  GLN A C    1 
ATOM   1055 O O    . GLN A 1 63  ? -2.13062  13.68381 13.52709 1.000 16.59399  ? 63  GLN A O    1 
ATOM   1056 C CB   . GLN A 1 63  ? -1.52303  13.33970 10.52864 1.000 17.42003  ? 63  GLN A CB   1 
ATOM   1057 C CG   . GLN A 1 63  ? -0.39172  14.34683 10.33640 1.000 18.05738  ? 63  GLN A CG   1 
ATOM   1058 C CD   . GLN A 1 63  ? -0.51221  15.11326 9.03371  1.000 21.83695  ? 63  GLN A CD   1 
ATOM   1059 O OE1  . GLN A 1 63  ? -1.27507  14.72771 8.14881  1.000 30.76548  ? 63  GLN A OE1  1 
ATOM   1060 N NE2  . GLN A 1 63  ? 0.24324   16.20225 8.90695  1.000 23.75333  ? 63  GLN A NE2  1 
ATOM   1061 H H    . GLN A 1 63  ? -3.13814  11.74821 11.92452 1.000 16.83295  ? 63  GLN A H    1 
ATOM   1062 H HA   . GLN A 1 63  ? -0.45958  11.89382 11.55537 1.000 16.73762  ? 63  GLN A HA   1 
ATOM   1063 H HB2  . GLN A 1 63  ? -1.60429  12.82205 9.71234  1.000 20.91665  ? 63  GLN A HB2  1 
ATOM   1064 H HB3  . GLN A 1 63  ? -2.34081  13.83591 10.68960 1.000 20.91665  ? 63  GLN A HB3  1 
ATOM   1065 H HG2  . GLN A 1 63  ? -0.40981  14.98690 11.06501 1.000 21.68147  ? 63  GLN A HG2  1 
ATOM   1066 H HG3  . GLN A 1 63  ? 0.45557   13.87464 10.33057 1.000 21.68147  ? 63  GLN A HG3  1 
ATOM   1067 H HE21 . GLN A 1 63  ? 0.20791   16.66848 8.18516  1.000 28.51661  ? 63  GLN A HE21 1 
ATOM   1068 H HE22 . GLN A 1 63  ? 0.76655   16.43944 9.54688  1.000 28.51661  ? 63  GLN A HE22 1 
ATOM   1069 N N    . GLY A 1 64  ? 0.09967   13.37515 13.41948 1.000 14.17791  ? 64  GLY A N    1 
ATOM   1070 C CA   . GLY A 1 64  ? 0.35216   14.18924 14.58434 1.000 14.57908  ? 64  GLY A CA   1 
ATOM   1071 C C    . GLY A 1 64  ? 1.70472   14.85510 14.51269 1.000 14.55899  ? 64  GLY A C    1 
ATOM   1072 O O    . GLY A 1 64  ? 2.28865   14.97355 13.42960 1.000 15.49827  ? 64  GLY A O    1 
ATOM   1073 H H    . GLY A 1 64  ? 0.80273   13.03298 13.06139 1.000 17.02611  ? 64  GLY A H    1 
ATOM   1074 H HA2  . GLY A 1 64  ? -0.32822  14.87723 14.65263 1.000 17.50750  ? 64  GLY A HA2  1 
ATOM   1075 H HA3  . GLY A 1 64  ? 0.32184   13.63504 15.37986 1.000 17.50750  ? 64  GLY A HA3  1 
ATOM   1076 N N    . GLY A 1 65  ? 2.19664   15.32734 15.65346 1.000 15.02986  ? 65  GLY A N    1 
ATOM   1077 C CA   . GLY A 1 65  ? 3.51748   15.90503 15.71738 1.000 15.28093  ? 65  GLY A CA   1 
ATOM   1078 C C    . GLY A 1 65  ? 3.59819   17.41256 15.64956 1.000 15.73727  ? 65  GLY A C    1 
ATOM   1079 O O    . GLY A 1 65  ? 4.70914   17.94885 15.73432 1.000 15.94747  ? 65  GLY A O    1 
ATOM   1080 H H    . GLY A 1 65  ? 1.77626   15.32084 16.40368 1.000 18.04845  ? 65  GLY A H    1 
ATOM   1081 H HA2  . GLY A 1 65  ? 3.92904   15.63114 16.55194 1.000 18.34972  ? 65  GLY A HA2  1 
ATOM   1082 H HA3  . GLY A 1 65  ? 4.03872   15.55447 14.97824 1.000 18.34972  ? 65  GLY A HA3  1 
ATOM   1083 N N    . ASP A 1 66  ? 2.47981   18.11740 15.48026 1.000 14.35142  ? 66  ASP A N    1 
ATOM   1084 C CA   . ASP A 1 66  ? 2.51446   19.57872 15.46003 1.000 15.14721  ? 66  ASP A CA   1 
ATOM   1085 C C    . ASP A 1 66  ? 2.36990   20.07170 16.89118 1.000 16.80180  ? 66  ASP A C    1 
ATOM   1086 O O    . ASP A 1 66  ? 1.27158   20.38336 17.35652 1.000 16.75771  ? 66  ASP A O    1 
ATOM   1087 C CB   . ASP A 1 66  ? 1.42135   20.16344 14.57797 1.000 18.10802  ? 66  ASP A CB   1 
ATOM   1088 C CG   . ASP A 1 66  ? 1.45554   21.68740 14.54811 1.000 17.74034  ? 66  ASP A CG   1 
ATOM   1089 O OD1  . ASP A 1 66  ? 2.30509   22.28228 15.24718 1.000 15.77169  ? 66  ASP A OD1  1 
ATOM   1090 O OD2  . ASP A 1 66  ? 0.63481   22.29432 13.82752 1.000 17.87953  ? 66  ASP A OD2  1 
ATOM   1091 H H    . ASP A 1 66  ? 1.69762   17.77542 15.37619 1.000 17.23432  ? 66  ASP A H    1 
ATOM   1092 H HA   . ASP A 1 66  ? 3.37280   19.85489 15.10242 1.000 18.18926  ? 66  ASP A HA   1 
ATOM   1093 H HB2  . ASP A 1 66  ? 1.53856   19.84101 13.67067 1.000 21.74224  ? 66  ASP A HB2  1 
ATOM   1094 H HB3  . ASP A 1 66  ? 0.55618   19.88751 14.91894 1.000 21.74224  ? 66  ASP A HB3  1 
ATOM   1095 N N    . PHE A 1 67  ? 3.49346   20.17546 17.58830 1.000 15.19707  ? 67  PHE A N    1 
ATOM   1096 C CA   . PHE A 1 67  ? 3.47200   20.57090 18.98623 1.000 15.92742  ? 67  PHE A CA   1 
ATOM   1097 C C    . PHE A 1 67  ? 3.57060   22.08027 19.17512 1.000 19.14911  ? 67  PHE A C    1 
ATOM   1098 O O    . PHE A 1 67  ? 3.57589   22.53485 20.32335 1.000 19.30727  ? 67  PHE A O    1 
ATOM   1099 C CB   . PHE A 1 67  ? 4.59230   19.84504 19.76886 1.000 16.75888  ? 67  PHE A CB   1 
ATOM   1100 C CG   . PHE A 1 67  ? 5.98201   20.09623 19.24688 1.000 17.23351  ? 67  PHE A CG   1 
ATOM   1101 C CD1  . PHE A 1 67  ? 6.68353   21.22818 19.62505 1.000 22.43532  ? 67  PHE A CD1  1 
ATOM   1102 C CD2  . PHE A 1 67  ? 6.60061   19.18682 18.40394 1.000 17.55983  ? 67  PHE A CD2  1 
ATOM   1103 C CE1  . PHE A 1 67  ? 7.96450   21.46450 19.14890 1.000 31.58171  ? 67  PHE A CE1  1 
ATOM   1104 C CE2  . PHE A 1 67  ? 7.88209   19.41990 17.92774 1.000 18.81603  ? 67  PHE A CE2  1 
ATOM   1105 C CZ   . PHE A 1 67  ? 8.56131   20.55952 18.29978 1.000 22.92211  ? 67  PHE A CZ   1 
ATOM   1106 H H    . PHE A 1 67  ? 4.27866   20.02196 17.27288 1.000 18.17342  ? 67  PHE A H    1 
ATOM   1107 H HA   . PHE A 1 67  ? 2.63062   20.28965 19.37849 1.000 19.04984  ? 67  PHE A HA   1 
ATOM   1108 H HB2  . PHE A 1 67  ? 4.56767   20.14318 20.69158 1.000 20.04760  ? 67  PHE A HB2  1 
ATOM   1109 H HB3  . PHE A 1 67  ? 4.43103   18.88957 19.72452 1.000 20.04760  ? 67  PHE A HB3  1 
ATOM   1110 H HD1  . PHE A 1 67  ? 6.29044   21.83849 20.20634 1.000 26.93500  ? 67  PHE A HD1  1 
ATOM   1111 H HD2  . PHE A 1 67  ? 6.15141   18.41155 18.15478 1.000 21.08441  ? 67  PHE A HD2  1 
ATOM   1112 H HE1  . PHE A 1 67  ? 8.42042   22.23418 19.40310 1.000 37.91066  ? 67  PHE A HE1  1 
ATOM   1113 H HE2  . PHE A 1 67  ? 8.28372   18.80589 17.35625 1.000 22.59185  ? 67  PHE A HE2  1 
ATOM   1114 H HZ   . PHE A 1 67  ? 9.41976   20.71696 17.97857 1.000 27.51914  ? 67  PHE A HZ   1 
ATOM   1115 N N    . THR A 1 68  ? 3.61845   22.87786 18.10172 1.000 16.80296  ? 68  THR A N    1 
ATOM   1116 C CA   . THR A 1 68  ? 3.63077   24.32402 18.29915 1.000 18.07668  ? 68  THR A CA   1 
ATOM   1117 C C    . THR A 1 68  ? 2.33506   25.01820 17.89999 1.000 19.89262  ? 68  THR A C    1 
ATOM   1118 O O    . THR A 1 68  ? 2.00635   26.04131 18.49880 1.000 20.64223  ? 68  THR A O    1 
ATOM   1119 C CB   . THR A 1 68  ? 4.79761   25.00583 17.55758 1.000 21.71743  ? 68  THR A CB   1 
ATOM   1120 O OG1  . THR A 1 68  ? 4.62411   24.90129 16.13947 1.000 20.62780  ? 68  THR A OG1  1 
ATOM   1121 C CG2  . THR A 1 68  ? 6.14275   24.40944 17.99250 1.000 23.24304  ? 68  THR A CG2  1 
ATOM   1122 H H    . THR A 1 68  ? 3.64330   22.61167 17.28433 1.000 20.17617  ? 68  THR A H    1 
ATOM   1123 H HA   . THR A 1 68  ? 3.77742   24.47548 19.24596 1.000 21.70463  ? 68  THR A HA   1 
ATOM   1124 H HB   . THR A 1 68  ? 4.81179   25.94887 17.78426 1.000 26.07353  ? 68  THR A HB   1 
ATOM   1125 H HG1  . THR A 1 68  ? 5.09064   25.48082 15.74946 1.000 24.76597  ? 68  THR A HG1  1 
ATOM   1126 H HG21 . THR A 1 68  ? 6.87124   24.95840 17.66257 1.000 27.90426  ? 68  THR A HG21 1 
ATOM   1127 H HG22 . THR A 1 68  ? 6.19108   24.37085 18.96052 1.000 27.90426  ? 68  THR A HG22 1 
ATOM   1128 H HG23 . THR A 1 68  ? 6.23848   23.51222 17.63651 1.000 27.90426  ? 68  THR A HG23 1 
ATOM   1129 N N    A ARG A 1 69  ? 1.57869   24.48730 16.93426 0.656 18.46390  ? 69  ARG A N    1 
ATOM   1130 N N    B ARG A 1 69  ? 1.59920   24.50943 16.90308 0.344 18.49141  ? 69  ARG A N    1 
ATOM   1131 C CA   A ARG A 1 69  ? 0.32760   25.12146 16.53569 0.656 19.22602  ? 69  ARG A CA   1 
ATOM   1132 C CA   B ARG A 1 69  ? 0.33717   25.12026 16.49822 0.344 18.22756  ? 69  ARG A CA   1 
ATOM   1133 C C    A ARG A 1 69  ? -0.86568  24.17408 16.53412 0.656 16.44234  ? 69  ARG A C    1 
ATOM   1134 C C    B ARG A 1 69  ? -0.86382  24.18709 16.59893 0.344 16.78276  ? 69  ARG A C    1 
ATOM   1135 O O    A ARG A 1 69  ? -1.99329  24.62936 16.31125 0.656 20.61359  ? 69  ARG A O    1 
ATOM   1136 O O    B ARG A 1 69  ? -2.00131  24.66976 16.52832 0.344 16.82529  ? 69  ARG A O    1 
ATOM   1137 C CB   A ARG A 1 69  ? 0.49118   25.78018 15.15890 0.656 21.82937  ? 69  ARG A CB   1 
ATOM   1138 C CB   B ARG A 1 69  ? 0.43251   25.66585 15.06184 0.344 23.31876  ? 69  ARG A CB   1 
ATOM   1139 C CG   A ARG A 1 69  ? 1.66754   26.75304 15.14184 0.656 24.79563  ? 69  ARG A CG   1 
ATOM   1140 C CG   B ARG A 1 69  ? 1.17800   26.99871 14.96233 0.344 28.36984  ? 69  ARG A CG   1 
ATOM   1141 C CD   A ARG A 1 69  ? 1.73435   27.59261 13.87913 0.656 35.14566  ? 69  ARG A CD   1 
ATOM   1142 C CD   B ARG A 1 69  ? 0.94870   27.69942 13.61827 0.344 34.11907  ? 69  ARG A CD   1 
ATOM   1143 N NE   A ARG A 1 69  ? 0.48017   28.29980 13.65248 0.656 29.58092  ? 69  ARG A NE   1 
ATOM   1144 N NE   B ARG A 1 69  ? -0.47267  27.85307 13.30949 0.344 44.25600  ? 69  ARG A NE   1 
ATOM   1145 C CZ   A ARG A 1 69  ? 0.10453   29.40527 14.28974 0.656 31.87417  ? 69  ARG A CZ   1 
ATOM   1146 C CZ   B ARG A 1 69  ? -0.95653  28.44549 12.21952 0.344 35.14256  ? 69  ARG A CZ   1 
ATOM   1147 N NH1  A ARG A 1 69  ? -1.06730  29.95102 13.99864 0.656 39.35438  ? 69  ARG A NH1  1 
ATOM   1148 N NH1  B ARG A 1 69  ? -2.26885  28.51582 12.03659 0.344 24.93094  ? 69  ARG A NH1  1 
ATOM   1149 N NH2  A ARG A 1 69  ? 0.88590   29.96594 15.20801 0.656 31.06108  ? 69  ARG A NH2  1 
ATOM   1150 N NH2  B ARG A 1 69  ? -0.13642  28.94932 11.30600 0.344 44.29009  ? 69  ARG A NH2  1 
ATOM   1151 H H    A ARG A 1 69  ? 1.76997   23.76864 16.50237 0.656 22.16929  ? 69  ARG A H    1 
ATOM   1152 H H    B ARG A 1 69  ? 1.81407   23.81121 16.44929 0.344 22.20231  ? 69  ARG A H    1 
ATOM   1153 H HA   A ARG A 1 69  ? 0.11497   25.82593 17.16768 0.656 23.08383  ? 69  ARG A HA   1 
ATOM   1154 H HA   B ARG A 1 69  ? 0.16635   25.87444 17.08381 0.344 21.88569  ? 69  ARG A HA   1 
ATOM   1155 H HB2  A ARG A 1 69  ? 0.65185   25.09416 14.49222 0.656 26.20786  ? 69  ARG A HB2  1 
ATOM   1156 H HB2  B ARG A 1 69  ? 0.90407   25.02004 14.51279 0.344 27.99513  ? 69  ARG A HB2  1 
ATOM   1157 H HB3  A ARG A 1 69  ? -0.31585  26.27216 14.94085 0.656 26.20786  ? 69  ARG A HB3  1 
ATOM   1158 H HB3  B ARG A 1 69  ? -0.46461  25.80093 14.71856 0.344 27.99513  ? 69  ARG A HB3  1 
ATOM   1159 H HG2  A ARG A 1 69  ? 1.58685   27.35716 15.89645 0.656 29.76736  ? 69  ARG A HG2  1 
ATOM   1160 H HG2  B ARG A 1 69  ? 0.86766   27.58951 15.66628 0.344 34.05642  ? 69  ARG A HG2  1 
ATOM   1161 H HG3  A ARG A 1 69  ? 2.49353   26.24873 15.20744 0.656 29.76736  ? 69  ARG A HG3  1 
ATOM   1162 H HG3  B ARG A 1 69  ? 2.12971   26.83831 15.05936 0.344 34.05642  ? 69  ARG A HG3  1 
ATOM   1163 H HD2  A ARG A 1 69  ? 2.44477   28.24754 13.96434 0.656 42.18741  ? 69  ARG A HD2  1 
ATOM   1164 H HD2  B ARG A 1 69  ? 1.34854   28.58269 13.64753 0.344 40.95550  ? 69  ARG A HD2  1 
ATOM   1165 H HD3  A ARG A 1 69  ? 1.90376   27.01661 13.11727 0.656 42.18741  ? 69  ARG A HD3  1 
ATOM   1166 H HD3  B ARG A 1 69  ? 1.35608   27.17408 12.91189 0.344 40.95550  ? 69  ARG A HD3  1 
ATOM   1167 H HE   A ARG A 1 69  ? -0.05700  27.97836 13.06280 0.656 35.50972  ? 69  ARG A HE   1 
ATOM   1168 H HE   B ARG A 1 69  ? -1.03866  27.53692 13.87455 0.344 53.11981  ? 69  ARG A HE   1 
ATOM   1169 H HH11 A ARG A 1 69  ? -1.57386  29.59046 13.40451 0.656 47.23787  ? 69  ARG A HH11 1 
ATOM   1170 H HH11 B ARG A 1 69  ? -2.80306  28.17959 12.62069 0.344 29.92974  ? 69  ARG A HH11 1 
ATOM   1171 H HH12 A ARG A 1 69  ? -1.32130  30.66579 14.40385 0.656 47.23787  ? 69  ARG A HH12 1 
ATOM   1172 H HH12 B ARG A 1 69  ? -2.58521  28.89763 11.33392 0.344 29.92974  ? 69  ARG A HH12 1 
ATOM   1173 H HH21 A ARG A 1 69  ? 1.64718   29.61381 15.39788 0.656 37.28591  ? 69  ARG A HH21 1 
ATOM   1174 H HH21 B ARG A 1 69  ? 0.71484   28.89464 11.41542 0.344 53.16072  ? 69  ARG A HH21 1 
ATOM   1175 H HH22 A ARG A 1 69  ? 0.62997   30.68069 15.61203 0.656 37.28591  ? 69  ARG A HH22 1 
ATOM   1176 H HH22 B ARG A 1 69  ? -0.45618  29.33053 10.60455 0.344 53.16072  ? 69  ARG A HH22 1 
ATOM   1177 N N    . HIS A 1 70  ? -0.65018  22.88526 16.80760 1.000 16.73270  ? 70  HIS A N    1 
ATOM   1178 C CA   . HIS A 1 70  ? -1.70037  21.89991 17.08665 1.000 17.23052  ? 70  HIS A CA   1 
ATOM   1179 C C    . HIS A 1 70  ? -2.70340  21.71845 15.96263 1.000 18.98876  ? 70  HIS A C    1 
ATOM   1180 O O    . HIS A 1 70  ? -3.80676  21.21742 16.19819 1.000 23.46309  ? 70  HIS A O    1 
ATOM   1181 C CB   . HIS A 1 70  ? -2.43334  22.26602 18.39099 1.000 16.19857  ? 70  HIS A CB   1 
ATOM   1182 C CG   . HIS A 1 70  ? -1.55337  22.98199 19.36083 1.000 16.26680  ? 70  HIS A CG   1 
ATOM   1183 N ND1  . HIS A 1 70  ? -0.51370  22.35618 20.01282 1.000 20.28203  ? 70  HIS A ND1  1 
ATOM   1184 C CD2  . HIS A 1 70  ? -1.49748  24.28501 19.72471 1.000 18.21114  ? 70  HIS A CD2  1 
ATOM   1185 C CE1  . HIS A 1 70  ? 0.13115   23.23852 20.75377 1.000 19.42363  ? 70  HIS A CE1  1 
ATOM   1186 N NE2  . HIS A 1 70  ? -0.44584  24.41625 20.59636 1.000 19.88164  ? 70  HIS A NE2  1 
ATOM   1187 H H    . HIS A 1 70  ? 0.13438   22.53454 16.84022 1.000 20.09185  ? 70  HIS A H    1 
ATOM   1188 H HA   . HIS A 1 70  ? -1.26952  21.03672 17.18757 1.000 20.68923  ? 70  HIS A HA   1 
ATOM   1189 H HB2  . HIS A 1 70  ? -3.18321  22.84438 18.18100 1.000 19.45090  ? 70  HIS A HB2  1 
ATOM   1190 H HB3  . HIS A 1 70  ? -2.74994  21.45307 18.81500 1.000 19.45090  ? 70  HIS A HB3  1 
ATOM   1191 H HD2  . HIS A 1 70  ? -2.06514  24.96350 19.43781 1.000 21.86598  ? 70  HIS A HD2  1 
ATOM   1192 H HE1  . HIS A 1 70  ? 0.86660   23.06097 21.29459 1.000 23.32097  ? 70  HIS A HE1  1 
ATOM   1193 H HE2  . HIS A 1 70  ? -0.20186  25.14710 20.97837 1.000 23.87058  ? 70  HIS A HE2  1 
ATOM   1194 N N    . ASN A 1 71  ? -2.33827  22.06009 14.73763 1.000 20.83442  ? 71  ASN A N    1 
ATOM   1195 C CA   . ASN A 1 71  ? -3.31770  21.96754 13.66281 1.000 21.42785  ? 71  ASN A CA   1 
ATOM   1196 C C    . ASN A 1 71  ? -2.69847  21.61746 12.31874 1.000 20.13860  ? 71  ASN A C    1 
ATOM   1197 O O    . ASN A 1 71  ? -3.40969  21.65720 11.30608 1.000 23.44038  ? 71  ASN A O    1 
ATOM   1198 C CB   . ASN A 1 71  ? -4.10088  23.28466 13.55375 1.000 22.64231  ? 71  ASN A CB   1 
ATOM   1199 C CG   . ASN A 1 71  ? -3.22573  24.46521 13.17767 1.000 24.33112  ? 71  ASN A CG   1 
ATOM   1200 O OD1  . ASN A 1 71  ? -2.05723  24.31121 12.83129 1.000 21.05916  ? 71  ASN A OD1  1 
ATOM   1201 N ND2  . ASN A 1 71  ? -3.80525  25.65680 13.21995 1.000 29.25107  ? 71  ASN A ND2  1 
ATOM   1202 H H    . ASN A 1 71  ? -1.55822  22.33913 14.50684 1.000 25.01392  ? 71  ASN A H    1 
ATOM   1203 H HA   . ASN A 1 71  ? -3.94804  21.26229 13.87776 1.000 25.72604  ? 71  ASN A HA   1 
ATOM   1204 H HB2  . ASN A 1 71  ? -4.78393  23.18963 12.87160 1.000 27.18339  ? 71  ASN A HB2  1 
ATOM   1205 H HB3  . ASN A 1 71  ? -4.51234  23.47854 14.41050 1.000 27.18339  ? 71  ASN A HB3  1 
ATOM   1206 H HD21 . ASN A 1 71  ? -3.35561  26.36109 13.01649 1.000 35.11390  ? 71  ASN A HD21 1 
ATOM   1207 H HD22 . ASN A 1 71  ? -4.63082  25.72549 13.45084 1.000 35.11390  ? 71  ASN A HD22 1 
ATOM   1208 N N    . GLY A 1 72  ? -1.42025  21.27068 12.26681 1.000 16.85352  ? 72  GLY A N    1 
ATOM   1209 C CA   . GLY A 1 72  ? -0.79029  20.88784 11.02954 1.000 18.57632  ? 72  GLY A CA   1 
ATOM   1210 C C    . GLY A 1 72  ? 0.02303   21.96803 10.36101 1.000 22.00400  ? 72  GLY A C    1 
ATOM   1211 O O    . GLY A 1 72  ? 0.63495   21.69558 9.32116  1.000 21.62938  ? 72  GLY A O    1 
ATOM   1212 H H    . GLY A 1 72  ? -0.89587  21.25131 12.94817 1.000 20.23683  ? 72  GLY A H    1 
ATOM   1213 H HA2  . GLY A 1 72  ? -0.19882  20.13878 11.20267 1.000 22.30420  ? 72  GLY A HA2  1 
ATOM   1214 H HA3  . GLY A 1 72  ? -1.47862  20.60904 10.40554 1.000 22.30420  ? 72  GLY A HA3  1 
ATOM   1215 N N    . THR A 1 73  ? 0.05950   23.17762 10.91725 1.000 22.04064  ? 73  THR A N    1 
ATOM   1216 C CA   . THR A 1 73  ? 0.84054   24.25788 10.33530 1.000 22.49129  ? 73  THR A CA   1 
ATOM   1217 C C    . THR A 1 73  ? 2.15838   24.50051 11.05833 1.000 24.88243  ? 73  THR A C    1 
ATOM   1218 O O    . THR A 1 73  ? 2.93813   25.35315 10.62119 1.000 27.88039  ? 73  THR A O    1 
ATOM   1219 C CB   . THR A 1 73  ? 0.04101   25.56468 10.32756 1.000 25.12955  ? 73  THR A CB   1 
ATOM   1220 O OG1  . THR A 1 73  ? -0.25982  25.94524 11.67410 1.000 24.16145  ? 73  THR A OG1  1 
ATOM   1221 C CG2  . THR A 1 73  ? -1.25242  25.40950 9.55318  1.000 33.89892  ? 73  THR A CG2  1 
ATOM   1222 H H    . THR A 1 73  ? -0.36260  23.39412 11.63457 1.000 26.46138  ? 73  THR A H    1 
ATOM   1223 H HA   . THR A 1 73  ? 1.03356   24.01534 9.41616  1.000 27.00216  ? 73  THR A HA   1 
ATOM   1224 H HB   . THR A 1 73  ? 0.56684   26.25724 9.89773  1.000 30.16807  ? 73  THR A HB   1 
ATOM   1225 H HG1  . THR A 1 73  ? -0.75791  25.37045 12.03064 1.000 29.00635  ? 73  THR A HG1  1 
ATOM   1226 H HG21 . THR A 1 73  ? -1.71562  26.26051 9.50705  1.000 40.69131  ? 73  THR A HG21 1 
ATOM   1227 H HG22 . THR A 1 73  ? -1.06487  25.10391 8.65188  1.000 40.69131  ? 73  THR A HG22 1 
ATOM   1228 H HG23 . THR A 1 73  ? -1.82623  24.76217 9.99205  1.000 40.69131  ? 73  THR A HG23 1 
ATOM   1229 N N    . GLY A 1 74  ? 2.42531   23.78629 12.14776 1.000 19.01392  ? 74  GLY A N    1 
ATOM   1230 C CA   . GLY A 1 74  ? 3.63569   24.02580 12.90352 1.000 20.19995  ? 74  GLY A CA   1 
ATOM   1231 C C    . GLY A 1 74  ? 4.53733   22.82548 13.09725 1.000 21.54051  ? 74  GLY A C    1 
ATOM   1232 O O    . GLY A 1 74  ? 4.55291   21.89471 12.28462 1.000 23.06383  ? 74  GLY A O    1 
ATOM   1233 H H    . GLY A 1 74  ? 1.92208   23.16394 12.46245 1.000 22.82932  ? 74  GLY A H    1 
ATOM   1234 H HA2  . GLY A 1 74  ? 4.15291   24.70842 12.44811 1.000 24.25256  ? 74  GLY A HA2  1 
ATOM   1235 H HA3  . GLY A 1 74  ? 3.38970   24.35069 13.78377 1.000 24.25256  ? 74  GLY A HA3  1 
ATOM   1236 N N    . GLY A 1 75  ? 5.29789   22.85283 14.18546 1.000 18.54066  ? 75  GLY A N    1 
ATOM   1237 C CA   . GLY A 1 75  ? 6.30347   21.85794 14.47699 1.000 22.55407  ? 75  GLY A CA   1 
ATOM   1238 C C    . GLY A 1 75  ? 7.68623   22.30099 14.02790 1.000 23.03988  ? 75  GLY A C    1 
ATOM   1239 O O    . GLY A 1 75  ? 7.85331   23.22558 13.23001 1.000 24.80325  ? 75  GLY A O    1 
ATOM   1240 H H    . GLY A 1 75  ? 5.24359   23.46308 14.78898 1.000 22.26140  ? 75  GLY A H    1 
ATOM   1241 H HA2  . GLY A 1 75  ? 6.32818   21.69406 15.43272 1.000 27.07750  ? 75  GLY A HA2  1 
ATOM   1242 H HA3  . GLY A 1 75  ? 6.08187   21.03127 14.02045 1.000 27.07750  ? 75  GLY A HA3  1 
ATOM   1243 N N    . LYS A 1 76  ? 8.69756   21.62895 14.56763 1.000 18.84539  ? 76  LYS A N    1 
ATOM   1244 C CA   . LYS A 1 76  ? 10.07542  21.86416 14.16362 1.000 19.98549  ? 76  LYS A CA   1 
ATOM   1245 C C    . LYS A 1 76  ? 10.88778  20.63745 14.54124 1.000 20.09625  ? 76  LYS A C    1 
ATOM   1246 O O    . LYS A 1 76  ? 10.51729  19.87995 15.44193 1.000 21.60801  ? 76  LYS A O    1 
ATOM   1247 C CB   . LYS A 1 76  ? 10.65533  23.12344 14.81344 1.000 29.14066  ? 76  LYS A CB   1 
ATOM   1248 C CG   . LYS A 1 76  ? 10.71258  23.09393 16.32884 1.000 38.52889  ? 76  LYS A CG   1 
ATOM   1249 C CD   . LYS A 1 76  ? 11.42145  24.33784 16.86113 1.000 49.92485  ? 76  LYS A CD   1 
ATOM   1250 C CE   . LYS A 1 76  ? 11.41512  24.38242 18.38122 1.000 60.34058  ? 76  LYS A CE   1 
ATOM   1251 N NZ   . LYS A 1 76  ? 12.15237  25.56650 18.91120 1.000 68.28945  ? 76  LYS A NZ   1 
ATOM   1252 H H    . LYS A 1 76  ? 8.60966   21.02648 15.17500 1.000 22.62708  ? 76  LYS A H    1 
ATOM   1253 H HA   . LYS A 1 76  ? 10.11781  21.98522 13.20214 1.000 23.99520  ? 76  LYS A HA   1 
ATOM   1254 H HB2  . LYS A 1 76  ? 11.56172  23.24604 14.49042 1.000 34.98141  ? 76  LYS A HB2  1 
ATOM   1255 H HB3  . LYS A 1 76  ? 10.10664  23.88137 14.55775 1.000 34.98141  ? 76  LYS A HB3  1 
ATOM   1256 H HG2  . LYS A 1 76  ? 9.81172   23.07401 16.68796 1.000 46.24728  ? 76  LYS A HG2  1 
ATOM   1257 H HG3  . LYS A 1 76  ? 11.20342  22.30978 16.62052 1.000 46.24728  ? 76  LYS A HG3  1 
ATOM   1258 H HD2  . LYS A 1 76  ? 12.34387  24.33403 16.56108 1.000 59.92243  ? 76  LYS A HD2  1 
ATOM   1259 H HD3  . LYS A 1 76  ? 10.96879  25.13010 16.53200 1.000 59.92243  ? 76  LYS A HD3  1 
ATOM   1260 H HE2  . LYS A 1 76  ? 10.49856  24.43148 18.69493 1.000 72.42131  ? 76  LYS A HE2  1 
ATOM   1261 H HE3  . LYS A 1 76  ? 11.84118  23.58187 18.72544 1.000 72.42131  ? 76  LYS A HE3  1 
ATOM   1262 H HZ1  . LYS A 1 76  ? 12.14687  25.55520 19.80112 1.000 81.95995  ? 76  LYS A HZ1  1 
ATOM   1263 H HZ2  . LYS A 1 76  ? 12.99577  25.55201 18.62736 1.000 81.95995  ? 76  LYS A HZ2  1 
ATOM   1264 H HZ3  . LYS A 1 76  ? 11.76566  26.31697 18.62949 1.000 81.95995  ? 76  LYS A HZ3  1 
ATOM   1265 N N    . SER A 1 77  ? 11.99978  20.45210 13.84336 1.000 21.54640  ? 77  SER A N    1 
ATOM   1266 C CA   . SER A 1 77  ? 12.87797  19.33280 14.12942 1.000 18.78780  ? 77  SER A CA   1 
ATOM   1267 C C    . SER A 1 77  ? 13.95784  19.74055 15.12692 1.000 21.13479  ? 77  SER A C    1 
ATOM   1268 O O    . SER A 1 77  ? 14.10835  20.91334 15.48283 1.000 22.89431  ? 77  SER A O    1 
ATOM   1269 C CB   . SER A 1 77  ? 13.52948  18.81193 12.84996 1.000 18.34492  ? 77  SER A CB   1 
ATOM   1270 O OG   . SER A 1 77  ? 14.67614  19.57544 12.51420 1.000 22.29178  ? 77  SER A OG   1 
ATOM   1271 H H    . SER A 1 77  ? 12.26470  20.96008 13.20197 1.000 25.86829  ? 77  SER A H    1 
ATOM   1272 H HA   . SER A 1 77  ? 12.34872  18.61752 14.51566 1.000 22.55797  ? 77  SER A HA   1 
ATOM   1273 H HB2  . SER A 1 77  ? 13.79451  17.88866 12.98498 1.000 21.95084  ? 77  SER A HB2  1 
ATOM   1274 H HB3  . SER A 1 77  ? 12.88872  18.87039 12.12408 1.000 21.95084  ? 77  SER A HB3  1 
ATOM   1275 H HG   . SER A 1 77  ? 14.48049  20.39197 12.48955 1.000 26.76274  ? 77  SER A HG   1 
ATOM   1276 N N    . ILE A 1 78  ? 14.72538  18.74198 15.57368 1.000 20.70710  ? 78  ILE A N    1 
ATOM   1277 C CA   . ILE A 1 78  ? 15.85782  19.00705 16.45007 1.000 22.76627  ? 78  ILE A CA   1 
ATOM   1278 C C    . ILE A 1 78  ? 17.02649  19.62850 15.70243 1.000 26.67481  ? 78  ILE A C    1 
ATOM   1279 O O    . ILE A 1 78  ? 17.98616  20.08631 16.33461 1.000 28.62754  ? 78  ILE A O    1 
ATOM   1280 C CB   . ILE A 1 78  ? 16.34075  17.72797 17.16746 1.000 25.11258  ? 78  ILE A CB   1 
ATOM   1281 C CG1  . ILE A 1 78  ? 16.86444  16.67418 16.18888 1.000 23.49563  ? 78  ILE A CG1  1 
ATOM   1282 C CG2  . ILE A 1 78  ? 15.20807  17.14386 18.00601 1.000 25.73060  ? 78  ILE A CG2  1 
ATOM   1283 C CD1  . ILE A 1 78  ? 17.60726  15.51418 16.86221 1.000 25.69034  ? 78  ILE A CD1  1 
ATOM   1284 H H    . ILE A 1 78  ? 14.60869  17.91154 15.38303 1.000 24.86113  ? 78  ILE A H    1 
ATOM   1285 H HA   . ILE A 1 78  ? 15.55313  19.62600 17.13196 1.000 27.33213  ? 78  ILE A HA   1 
ATOM   1286 H HB   . ILE A 1 78  ? 17.08064  17.98262 17.74071 1.000 30.14771  ? 78  ILE A HB   1 
ATOM   1287 H HG12 . ILE A 1 78  ? 16.11300  16.30075 15.70227 1.000 28.20736  ? 78  ILE A HG12 1 
ATOM   1288 H HG13 . ILE A 1 78  ? 17.47997  17.10071 15.57236 1.000 28.20736  ? 78  ILE A HG13 1 
ATOM   1289 H HG21 . ILE A 1 78  ? 15.52792  16.34726 18.45770 1.000 30.88934  ? 78  ILE A HG21 1 
ATOM   1290 H HG22 . ILE A 1 78  ? 14.92585  17.80348 18.65881 1.000 30.88934  ? 78  ILE A HG22 1 
ATOM   1291 H HG23 . ILE A 1 78  ? 14.46701  16.91808 17.42227 1.000 30.88934  ? 78  ILE A HG23 1 
ATOM   1292 H HD11 . ILE A 1 78  ? 18.04409  14.98055 16.18007 1.000 30.84102  ? 78  ILE A HD11 1 
ATOM   1293 H HD12 . ILE A 1 78  ? 18.26826  15.87496 17.47362 1.000 30.84102  ? 78  ILE A HD12 1 
ATOM   1294 H HD13 . ILE A 1 78  ? 16.96845  14.97026 17.34900 1.000 30.84102  ? 78  ILE A HD13 1 
ATOM   1295 N N    . TYR A 1 79  ? 16.96286  19.64673 14.37086 1.000 23.97552  ? 79  TYR A N    1 
ATOM   1296 C CA   . TYR A 1 79  ? 18.00393  20.18520 13.50953 1.000 24.27257  ? 79  TYR A CA   1 
ATOM   1297 C C    . TYR A 1 79  ? 17.69718  21.59103 13.01427 1.000 33.29623  ? 79  TYR A C    1 
ATOM   1298 O O    . TYR A 1 79  ? 18.50012  22.16162 12.26849 1.000 43.86185  ? 79  TYR A O    1 
ATOM   1299 C CB   . TYR A 1 79  ? 18.19683  19.26556 12.30131 1.000 26.17641  ? 79  TYR A CB   1 
ATOM   1300 C CG   . TYR A 1 79  ? 18.34323  17.80880 12.65495 1.000 27.67776  ? 79  TYR A CG   1 
ATOM   1301 C CD1  . TYR A 1 79  ? 19.43197  17.36509 13.38730 1.000 25.62460  ? 79  TYR A CD1  1 
ATOM   1302 C CD2  . TYR A 1 79  ? 17.40398  16.87304 12.24379 1.000 20.89359  ? 79  TYR A CD2  1 
ATOM   1303 C CE1  . TYR A 1 79  ? 19.58365  16.03184 13.70676 1.000 26.72430  ? 79  TYR A CE1  1 
ATOM   1304 C CE2  . TYR A 1 79  ? 17.54337  15.53447 12.56519 1.000 25.79186  ? 79  TYR A CE2  1 
ATOM   1305 C CZ   . TYR A 1 79  ? 18.63352  15.12208 13.30304 1.000 26.32234  ? 79  TYR A CZ   1 
ATOM   1306 O OH   . TYR A 1 79  ? 18.79436  13.79382 13.62516 1.000 23.75448  ? 79  TYR A OH   1 
ATOM   1307 H H    . TYR A 1 79  ? 16.29432  19.33777 13.92679 1.000 28.78324  ? 79  TYR A H    1 
ATOM   1308 H HA   . TYR A 1 79  ? 18.83295  20.21897 14.01201 1.000 29.13969  ? 79  TYR A HA   1 
ATOM   1309 H HB2  . TYR A 1 79  ? 17.42560  19.35148 11.71932 1.000 31.42430  ? 79  TYR A HB2  1 
ATOM   1310 H HB3  . TYR A 1 79  ? 19.00007  19.53653 11.82984 1.000 31.42430  ? 79  TYR A HB3  1 
ATOM   1311 H HD1  . TYR A 1 79  ? 20.07269  17.97754 13.66889 1.000 30.76213  ? 79  TYR A HD1  1 
ATOM   1312 H HD2  . TYR A 1 79  ? 16.66979  17.15004 11.74467 1.000 25.08492  ? 79  TYR A HD2  1 
ATOM   1313 H HE1  . TYR A 1 79  ? 20.32452  15.74916 14.19267 1.000 32.08177  ? 79  TYR A HE1  1 
ATOM   1314 H HE2  . TYR A 1 79  ? 16.90651  14.91707 12.28570 1.000 30.96284  ? 79  TYR A HE2  1 
ATOM   1315 H HH   . TYR A 1 79  ? 18.11392  13.35808 13.39555 1.000 28.51799  ? 79  TYR A HH   1 
ATOM   1316 N N    . GLY A 1 80  ? 16.56155  22.15664 13.40115 1.000 30.22493  ? 80  GLY A N    1 
ATOM   1317 C CA   . GLY A 1 80  ? 16.08561  23.41367 12.87706 1.000 36.66291  ? 80  GLY A CA   1 
ATOM   1318 C C    . GLY A 1 80  ? 14.68203  23.26445 12.34100 1.000 26.94610  ? 80  GLY A C    1 
ATOM   1319 O O    . GLY A 1 80  ? 14.02975  22.22845 12.50794 1.000 28.28925  ? 80  GLY A O    1 
ATOM   1320 H H    . GLY A 1 80  ? 16.03558  21.81248 13.98811 1.000 36.28253  ? 80  GLY A H    1 
ATOM   1321 H HA2  . GLY A 1 80  ? 16.08350  24.08308 13.57904 1.000 44.00811  ? 80  GLY A HA2  1 
ATOM   1322 H HA3  . GLY A 1 80  ? 16.66550  23.71124 12.15866 1.000 44.00811  ? 80  GLY A HA3  1 
ATOM   1323 N N    A GLU A 1 81  ? 14.20560  24.31493 11.66934 0.504 26.76412  ? 81  GLU A N    1 
ATOM   1324 N N    B GLU A 1 81  ? 14.20929  24.31962 11.67446 0.496 26.86091  ? 81  GLU A N    1 
ATOM   1325 C CA   A GLU A 1 81  ? 12.81801  24.33174 11.21740 0.504 28.10043  ? 81  GLU A CA   1 
ATOM   1326 C CA   B GLU A 1 81  ? 12.82799  24.33911 11.20660 0.496 28.61121  ? 81  GLU A CA   1 
ATOM   1327 C C    A GLU A 1 81  ? 12.51377  23.15461 10.29737 0.504 24.22633  ? 81  GLU A C    1 
ATOM   1328 C C    B GLU A 1 81  ? 12.52680  23.14505 10.31232 0.496 24.25687  ? 81  GLU A C    1 
ATOM   1329 O O    A GLU A 1 81  ? 11.43223  22.56111 10.37507 0.504 31.36940  ? 81  GLU A O    1 
ATOM   1330 O O    B GLU A 1 81  ? 11.46216  22.52728 10.42610 0.496 31.61245  ? 81  GLU A O    1 
ATOM   1331 C CB   A GLU A 1 81  ? 12.51525  25.65121 10.50723 0.504 40.42968  ? 81  GLU A CB   1 
ATOM   1332 C CB   B GLU A 1 81  ? 12.54920  25.64190 10.45951 0.496 39.68034  ? 81  GLU A CB   1 
ATOM   1333 C CG   A GLU A 1 81  ? 12.54659  26.88127 11.40396 0.504 40.59387  ? 81  GLU A CG   1 
ATOM   1334 C CG   B GLU A 1 81  ? 11.12550  25.77933 9.95400  0.496 40.08210  ? 81  GLU A CG   1 
ATOM   1335 C CD   A GLU A 1 81  ? 11.19944  27.18752 12.03448 0.504 50.56073  ? 81  GLU A CD   1 
ATOM   1336 C CD   B GLU A 1 81  ? 10.89676  27.08437 9.21298  0.496 46.75676  ? 81  GLU A CD   1 
ATOM   1337 O OE1  A GLU A 1 81  ? 10.78400  26.45428 12.95701 0.504 36.64127  ? 81  GLU A OE1  1 
ATOM   1338 O OE1  B GLU A 1 81  ? 11.75000  27.46117 8.38037  0.496 47.07910  ? 81  GLU A OE1  1 
ATOM   1339 O OE2  A GLU A 1 81  ? 10.55247  28.16337 11.60028 0.504 62.96711  ? 81  GLU A OE2  1 
ATOM   1340 O OE2  B GLU A 1 81  ? 9.86609   27.73870 9.47264  0.496 49.10404  ? 81  GLU A OE2  1 
ATOM   1341 H H    A GLU A 1 81  ? 14.65821  25.01755 11.46669 0.504 32.12956  ? 81  GLU A H    1 
ATOM   1342 H H    B GLU A 1 81  ? 14.66223  25.02541 11.48390 0.496 32.24571  ? 81  GLU A H    1 
ATOM   1343 H HA   A GLU A 1 81  ? 12.24063  24.26204 11.99372 0.504 33.73313  ? 81  GLU A HA   1 
ATOM   1344 H HA   B GLU A 1 81  ? 12.23966  24.29488 11.97654 0.496 34.34606  ? 81  GLU A HA   1 
ATOM   1345 H HB2  A GLU A 1 81  ? 13.17490  25.78292 9.80836  0.504 48.52823  ? 81  GLU A HB2  1 
ATOM   1346 H HB2  B GLU A 1 81  ? 12.72138  26.38526 11.05840 0.496 47.62902  ? 81  GLU A HB2  1 
ATOM   1347 H HB3  A GLU A 1 81  ? 11.62783  25.59545 10.11957 0.504 48.52823  ? 81  GLU A HB3  1 
ATOM   1348 H HB3  B GLU A 1 81  ? 13.13970  25.69094 9.69152  0.496 47.62902  ? 81  GLU A HB3  1 
ATOM   1349 H HG2  A GLU A 1 81  ? 13.18526  26.73423 12.11907 0.504 48.72526  ? 81  GLU A HG2  1 
ATOM   1350 H HG2  B GLU A 1 81  ? 10.93327  25.04935 9.34483  0.496 48.11113  ? 81  GLU A HG2  1 
ATOM   1351 H HG3  A GLU A 1 81  ? 12.81148  27.65034 10.87550 0.504 48.72526  ? 81  GLU A HG3  1 
ATOM   1352 H HG3  B GLU A 1 81  ? 10.51673  25.75073 10.70864 0.496 48.11113  ? 81  GLU A HG3  1 
ATOM   1353 N N    . LYS A 1 82  ? 13.44832  22.80507 9.41685  1.000 24.34088  ? 82  LYS A N    1 
ATOM   1354 C CA   . LYS A 1 82  ? 13.23133  21.72263 8.46970  1.000 21.95171  ? 82  LYS A CA   1 
ATOM   1355 C C    . LYS A 1 82  ? 14.55173  21.01660 8.21918  1.000 23.46026  ? 82  LYS A C    1 
ATOM   1356 O O    . LYS A 1 82  ? 15.62939  21.58016 8.42688  1.000 26.06069  ? 82  LYS A O    1 
ATOM   1357 C CB   . LYS A 1 82  ? 12.64775  22.23637 7.14910  1.000 29.35794  ? 82  LYS A CB   1 
ATOM   1358 C CG   . LYS A 1 82  ? 13.49716  23.28403 6.46437  1.000 46.93067  ? 82  LYS A CG   1 
ATOM   1359 C CD   . LYS A 1 82  ? 12.76000  23.91014 5.29067  1.000 63.97018  ? 82  LYS A CD   1 
ATOM   1360 C CE   . LYS A 1 82  ? 13.59861  24.99596 4.62984  1.000 73.12182  ? 82  LYS A CE   1 
ATOM   1361 N NZ   . LYS A 1 82  ? 14.89424  24.46823 4.11212  1.000 76.93111  ? 82  LYS A NZ   1 
ATOM   1362 H H    . LYS A 1 82  ? 14.21878  23.18093 9.34810  1.000 29.22167  ? 82  LYS A H    1 
ATOM   1363 H HA   . LYS A 1 82  ? 12.60837  21.08196 8.84700  1.000 26.35467  ? 82  LYS A HA   1 
ATOM   1364 H HB2  . LYS A 1 82  ? 12.55427  21.48803 6.53905  1.000 35.24215  ? 82  LYS A HB2  1 
ATOM   1365 H HB3  . LYS A 1 82  ? 11.77934  22.63066 7.32600  1.000 35.24215  ? 82  LYS A HB3  1 
ATOM   1366 H HG2  . LYS A 1 82  ? 13.71618  23.98555 7.09746  1.000 56.32941  ? 82  LYS A HG2  1 
ATOM   1367 H HG3  . LYS A 1 82  ? 14.30979  22.87254 6.13090  1.000 56.32941  ? 82  LYS A HG3  1 
ATOM   1368 H HD2  . LYS A 1 82  ? 12.56741  23.22709 4.62941  1.000 76.77683  ? 82  LYS A HD2  1 
ATOM   1369 H HD3  . LYS A 1 82  ? 11.93399  24.30997 5.60490  1.000 76.77683  ? 82  LYS A HD3  1 
ATOM   1370 H HE2  . LYS A 1 82  ? 13.10472  25.37024 3.88359  1.000 87.75879  ? 82  LYS A HE2  1 
ATOM   1371 H HE3  . LYS A 1 82  ? 13.79262  25.68895 5.28024  1.000 87.75879  ? 82  LYS A HE3  1 
ATOM   1372 H HZ1  . LYS A 1 82  ? 15.38818  24.16009 4.78530  1.000 92.32994  ? 82  LYS A HZ1  1 
ATOM   1373 H HZ2  . LYS A 1 82  ? 14.74498  23.80594 3.53662  1.000 92.32994  ? 82  LYS A HZ2  1 
ATOM   1374 H HZ3  . LYS A 1 82  ? 15.34271  25.11559 3.69751  1.000 92.32994  ? 82  LYS A HZ3  1 
ATOM   1375 N N    . PHE A 1 83  ? 14.45972  19.76344 7.77784  1.000 19.85366  ? 83  PHE A N    1 
ATOM   1376 C CA   . PHE A 1 83  ? 15.64258  19.02416 7.36088  1.000 20.02104  ? 83  PHE A CA   1 
ATOM   1377 C C    . PHE A 1 83  ? 15.30892  18.17779 6.13903  1.000 19.78052  ? 83  PHE A C    1 
ATOM   1378 O O    . PHE A 1 83  ? 14.14941  18.02764 5.74253  1.000 19.48837  ? 83  PHE A O    1 
ATOM   1379 C CB   . PHE A 1 83  ? 16.24762  18.20357 8.52934  1.000 19.47092  ? 83  PHE A CB   1 
ATOM   1380 C CG   . PHE A 1 83  ? 15.43184  17.02029 8.99165  1.000 18.29072  ? 83  PHE A CG   1 
ATOM   1381 C CD1  . PHE A 1 83  ? 14.34882  17.17682 9.84243  1.000 18.60262  ? 83  PHE A CD1  1 
ATOM   1382 C CD2  . PHE A 1 83  ? 15.80469  15.73680 8.63325  1.000 20.10730  ? 83  PHE A CD2  1 
ATOM   1383 C CE1  . PHE A 1 83  ? 13.62714  16.07315 10.28285 1.000 17.02692  ? 83  PHE A CE1  1 
ATOM   1384 C CE2  . PHE A 1 83  ? 15.08779  14.63652 9.07325  1.000 19.16319  ? 83  PHE A CE2  1 
ATOM   1385 C CZ   . PHE A 1 83  ? 14.00672  14.80541 9.90582  1.000 23.09841  ? 83  PHE A CZ   1 
ATOM   1386 H H    . PHE A 1 83  ? 13.72374  19.32344 7.71194  1.000 23.76134  ? 83  PHE A H    1 
ATOM   1387 H HA   . PHE A 1 83  ? 16.33296  19.64309 7.07591  1.000 23.96218  ? 83  PHE A HA   1 
ATOM   1388 H HB2  . PHE A 1 83  ? 17.11161  17.86452 8.24742  1.000 23.30204  ? 83  PHE A HB2  1 
ATOM   1389 H HB3  . PHE A 1 83  ? 16.35547  18.79376 9.29154  1.000 23.30204  ? 83  PHE A HB3  1 
ATOM   1390 H HD1  . PHE A 1 83  ? 14.10234  18.02901 10.12156 1.000 22.33575  ? 83  PHE A HD1  1 
ATOM   1391 H HD2  . PHE A 1 83  ? 16.54798  15.61111 8.08862  1.000 24.14138  ? 83  PHE A HD2  1 
ATOM   1392 H HE1  . PHE A 1 83  ? 12.88681  16.19187 10.83304 1.000 20.40631  ? 83  PHE A HE1  1 
ATOM   1393 H HE2  . PHE A 1 83  ? 15.33809  13.78192 8.80508  1.000 23.00844  ? 83  PHE A HE2  1 
ATOM   1394 H HZ   . PHE A 1 83  ? 13.53393  14.06579 10.21293 1.000 27.73071  ? 83  PHE A HZ   1 
ATOM   1395 N N    . GLU A 1 84  ? 16.36722  17.65623 5.52507  1.000 20.21811  ? 84  GLU A N    1 
ATOM   1396 C CA   . GLU A 1 84  ? 16.27656  17.04588 4.21075  1.000 20.63709  ? 84  GLU A CA   1 
ATOM   1397 C C    . GLU A 1 84  ? 15.65049  15.65182 4.25983  1.000 19.78531  ? 84  GLU A C    1 
ATOM   1398 O O    . GLU A 1 84  ? 15.57682  14.99645 5.30340  1.000 19.05818  ? 84  GLU A O    1 
ATOM   1399 C CB   . GLU A 1 84  ? 17.67649  16.96188 3.58885  1.000 21.54319  ? 84  GLU A CB   1 
ATOM   1400 C CG   . GLU A 1 84  ? 18.61013  15.94008 4.24702  1.000 20.94012  ? 84  GLU A CG   1 
ATOM   1401 C CD   . GLU A 1 84  ? 19.39460  16.46034 5.45620  1.000 31.20356  ? 84  GLU A CD   1 
ATOM   1402 O OE1  . GLU A 1 84  ? 19.06045  17.52449 6.02093  1.000 21.36006  ? 84  GLU A OE1  1 
ATOM   1403 O OE2  . GLU A 1 84  ? 20.36931  15.78267 5.84158  1.000 24.66406  ? 84  GLU A OE2  1 
ATOM   1404 H H    . GLU A 1 84  ? 17.16077  17.64450 5.85634  1.000 24.19866  ? 84  GLU A H    1 
ATOM   1405 H HA   . GLU A 1 84  ? 15.70269  17.59228 3.65127  1.000 24.70144  ? 84  GLU A HA   1 
ATOM   1406 H HB2  . GLU A 1 84  ? 17.58454  16.71458 2.65542  1.000 25.78877  ? 84  GLU A HB2  1 
ATOM   1407 H HB3  . GLU A 1 84  ? 18.09852  17.83223 3.66144  1.000 25.78877  ? 84  GLU A HB3  1 
ATOM   1408 H HG2  . GLU A 1 84  ? 18.07771  15.18754 4.54888  1.000 25.06508  ? 84  GLU A HG2  1 
ATOM   1409 H HG3  . GLU A 1 84  ? 19.25688  15.64534 3.58691  1.000 25.06508  ? 84  GLU A HG3  1 
ATOM   1410 N N    . ASP A 1 85  ? 15.20161  15.20293 3.08911  1.000 16.62234  ? 85  ASP A N    1 
ATOM   1411 C CA   . ASP A 1 85  ? 14.77799  13.82135 2.90771  1.000 15.08905  ? 85  ASP A CA   1 
ATOM   1412 C C    . ASP A 1 85  ? 16.00468  12.91782 2.93174  1.000 17.94458  ? 85  ASP A C    1 
ATOM   1413 O O    . ASP A 1 85  ? 16.85679  12.98856 2.03834  1.000 19.49152  ? 85  ASP A O    1 
ATOM   1414 C CB   . ASP A 1 85  ? 14.02548  13.66491 1.59005  1.000 15.49705  ? 85  ASP A CB   1 
ATOM   1415 C CG   . ASP A 1 85  ? 12.70241  14.39777 1.58064  1.000 17.37991  ? 85  ASP A CG   1 
ATOM   1416 O OD1  . ASP A 1 85  ? 11.97131  14.31774 2.59159  1.000 16.55713  ? 85  ASP A OD1  1 
ATOM   1417 O OD2  . ASP A 1 85  ? 12.38874  15.04052 0.55287  1.000 15.99519  ? 85  ASP A OD2  1 
ATOM   1418 H H    . ASP A 1 85  ? 15.13285  15.68414 2.37967  1.000 19.95943  ? 85  ASP A H    1 
ATOM   1419 H HA   . ASP A 1 85  ? 14.17902  13.56537 3.62647  1.000 18.11947  ? 85  ASP A HA   1 
ATOM   1420 H HB2  . ASP A 1 85  ? 14.57041  14.02067 0.87075  1.000 18.60908  ? 85  ASP A HB2  1 
ATOM   1421 H HB3  . ASP A 1 85  ? 13.84793  12.72360 1.43736  1.000 18.60908  ? 85  ASP A HB3  1 
ATOM   1422 N N    . GLU A 1 86  ? 16.08862  12.05581 3.94169  1.000 16.60294  ? 86  GLU A N    1 
ATOM   1423 C CA   . GLU A 1 86  ? 17.32083  11.30978 4.17316  1.000 17.71912  ? 86  GLU A CA   1 
ATOM   1424 C C    . GLU A 1 86  ? 17.55254  10.26635 3.08558  1.000 19.43613  ? 86  GLU A C    1 
ATOM   1425 O O    . GLU A 1 86  ? 18.63312  10.20743 2.48681  1.000 22.45663  ? 86  GLU A O    1 
ATOM   1426 C CB   . GLU A 1 86  ? 17.26931  10.66755 5.55797  1.000 21.06582  ? 86  GLU A CB   1 
ATOM   1427 C CG   . GLU A 1 86  ? 18.54990  9.98428  5.96478  1.000 21.95608  ? 86  GLU A CG   1 
ATOM   1428 C CD   . GLU A 1 86  ? 18.58309  9.64551  7.44076  1.000 21.26226  ? 86  GLU A CD   1 
ATOM   1429 O OE1  . GLU A 1 86  ? 17.51479  9.69544  8.09258  1.000 21.54287  ? 86  GLU A OE1  1 
ATOM   1430 O OE2  . GLU A 1 86  ? 19.68399  9.33579  7.94562  1.000 22.58540  ? 86  GLU A OE2  1 
ATOM   1431 H H    . GLU A 1 86  ? 15.45614  11.88678 4.49936  1.000 19.93615  ? 86  GLU A H    1 
ATOM   1432 H HA   . GLU A 1 86  ? 18.07487  11.91950 4.14932  1.000 21.27556  ? 86  GLU A HA   1 
ATOM   1433 H HB2  . GLU A 1 86  ? 17.08158  11.35723 6.21371  1.000 25.29160  ? 86  GLU A HB2  1 
ATOM   1434 H HB3  . GLU A 1 86  ? 16.56410  10.00158 5.56575  1.000 25.29160  ? 86  GLU A HB3  1 
ATOM   1435 H HG2  . GLU A 1 86  ? 18.64141  9.15841  5.46431  1.000 26.35991  ? 86  GLU A HG2  1 
ATOM   1436 H HG3  . GLU A 1 86  ? 19.29740  10.57231 5.77409  1.000 26.35991  ? 86  GLU A HG3  1 
ATOM   1437 N N    . ASN A 1 87  ? 16.55341  9.43559  2.82126  1.000 19.25268  ? 87  ASN A N    1 
ATOM   1438 C CA   . ASN A 1 87  ? 16.58140  8.45569  1.74181  1.000 17.68707  ? 87  ASN A CA   1 
ATOM   1439 C C    . ASN A 1 87  ? 15.16626  7.90672  1.65050  1.000 20.16530  ? 87  ASN A C    1 
ATOM   1440 O O    . ASN A 1 87  ? 14.32640  8.17911  2.51283  1.000 19.83521  ? 87  ASN A O    1 
ATOM   1441 C CB   . ASN A 1 87  ? 17.60120  7.33874  1.98113  1.000 22.02114  ? 87  ASN A CB   1 
ATOM   1442 C CG   . ASN A 1 87  ? 17.28734  6.50591  3.21015  1.000 23.38677  ? 87  ASN A CG   1 
ATOM   1443 O OD1  . ASN A 1 87  ? 16.22142  5.89899  3.31193  1.000 22.99986  ? 87  ASN A OD1  1 
ATOM   1444 N ND2  . ASN A 1 87  ? 18.23490  6.44571  4.13687  1.000 24.07082  ? 87  ASN A ND2  1 
ATOM   1445 H H    . ASN A 1 87  ? 15.81955  9.41813  3.26930  1.000 23.11583  ? 87  ASN A H    1 
ATOM   1446 H HA   . ASN A 1 87  ? 16.83083  8.88027  0.90609  1.000 21.23709  ? 87  ASN A HA   1 
ATOM   1447 H HB2  . ASN A 1 87  ? 17.60756  6.74723  1.21237  1.000 26.43798  ? 87  ASN A HB2  1 
ATOM   1448 H HB3  . ASN A 1 87  ? 18.47877  7.73354  2.10321  1.000 26.43798  ? 87  ASN A HB3  1 
ATOM   1449 H HD21 . ASN A 1 87  ? 18.10741  5.98697  4.85305  1.000 28.89760  ? 87  ASN A HD21 1 
ATOM   1450 H HD22 . ASN A 1 87  ? 18.97659  6.86542  4.02139  1.000 28.89760  ? 87  ASN A HD22 1 
ATOM   1451 N N    . PHE A 1 88  ? 14.90975  7.11979  0.61255  1.000 19.90248  ? 88  PHE A N    1 
ATOM   1452 C CA   . PHE A 1 88  ? 13.61167  6.47943  0.43597  1.000 20.40126  ? 88  PHE A CA   1 
ATOM   1453 C C    . PHE A 1 88  ? 13.75654  4.97214  0.29208  1.000 20.77853  ? 88  PHE A C    1 
ATOM   1454 O O    . PHE A 1 88  ? 13.06267  4.32960  -0.49948 1.000 23.62244  ? 88  PHE A O    1 
ATOM   1455 C CB   . PHE A 1 88  ? 12.87868  7.07300  -0.76014 1.000 20.44214  ? 88  PHE A CB   1 
ATOM   1456 C CG   . PHE A 1 88  ? 12.62262  8.53978  -0.63044 1.000 19.04579  ? 88  PHE A CG   1 
ATOM   1457 C CD1  . PHE A 1 88  ? 11.61254  9.01024  0.19105  1.000 19.08734  ? 88  PHE A CD1  1 
ATOM   1458 C CD2  . PHE A 1 88  ? 13.39151  9.45079  -1.32494 1.000 20.40262  ? 88  PHE A CD2  1 
ATOM   1459 C CE1  . PHE A 1 88  ? 11.37168  10.36916 0.31090  1.000 17.89627  ? 88  PHE A CE1  1 
ATOM   1460 C CE2  . PHE A 1 88  ? 13.15782  10.80660 -1.20621 1.000 21.22329  ? 88  PHE A CE2  1 
ATOM   1461 C CZ   . PHE A 1 88  ? 12.14985  11.26591 -0.38520 1.000 18.71082  ? 88  PHE A CZ   1 
ATOM   1462 H H    . PHE A 1 88  ? 15.47724  6.94023  -0.00819 1.000 23.89559  ? 88  PHE A H    1 
ATOM   1463 H HA   . PHE A 1 88  ? 13.07697  6.64374  1.22844  1.000 24.49412  ? 88  PHE A HA   1 
ATOM   1464 H HB2  . PHE A 1 88  ? 13.41441  6.93362  -1.55667 1.000 24.54318  ? 88  PHE A HB2  1 
ATOM   1465 H HB3  . PHE A 1 88  ? 12.02175  6.62843  -0.85469 1.000 24.54318  ? 88  PHE A HB3  1 
ATOM   1466 H HD1  . PHE A 1 88  ? 11.08958  8.40697  0.66800  1.000 22.91743  ? 88  PHE A HD1  1 
ATOM   1467 H HD2  . PHE A 1 88  ? 14.07454  9.14853  -1.87903 1.000 24.49576  ? 88  PHE A HD2  1 
ATOM   1468 H HE1  . PHE A 1 88  ? 10.68616  10.67462 0.86013  1.000 21.48814  ? 88  PHE A HE1  1 
ATOM   1469 H HE2  . PHE A 1 88  ? 13.68137  11.41108 -1.68098 1.000 25.48056  ? 88  PHE A HE2  1 
ATOM   1470 H HZ   . PHE A 1 88  ? 11.99617  12.17934 -0.30199 1.000 22.46560  ? 88  PHE A HZ   1 
ATOM   1471 N N    . ILE A 1 89  ? 14.64966  4.39300  1.09419  1.000 20.84135  ? 89  ILE A N    1 
ATOM   1472 C CA   . ILE A 1 89  ? 14.88212  2.95342  1.04908  1.000 26.28422  ? 89  ILE A CA   1 
ATOM   1473 C C    . ILE A 1 89  ? 13.61676  2.19429  1.42536  1.000 22.13563  ? 89  ILE A C    1 
ATOM   1474 O O    . ILE A 1 89  ? 13.25304  1.20022  0.78609  1.000 25.10497  ? 89  ILE A O    1 
ATOM   1475 C CB   . ILE A 1 89  ? 16.04918  2.57922  1.97991  1.000 28.45363  ? 89  ILE A CB   1 
ATOM   1476 C CG1  . ILE A 1 89  ? 17.35920  3.17023  1.46098  1.000 34.53391  ? 89  ILE A CG1  1 
ATOM   1477 C CG2  . ILE A 1 89  ? 16.16715  1.06749  2.12332  1.000 35.19986  ? 89  ILE A CG2  1 
ATOM   1478 C CD1  . ILE A 1 89  ? 18.44271  3.25488  2.51653  1.000 43.88038  ? 89  ILE A CD1  1 
ATOM   1479 H H    . ILE A 1 89  ? 15.13186  4.81044  1.67110  1.000 25.02223  ? 89  ILE A H    1 
ATOM   1480 H HA   . ILE A 1 89  ? 15.11828  2.70863  0.14067  1.000 31.55368  ? 89  ILE A HA   1 
ATOM   1481 H HB   . ILE A 1 89  ? 15.86522  2.95496  2.85505  1.000 34.15697  ? 89  ILE A HB   1 
ATOM   1482 H HG12 . ILE A 1 89  ? 17.68999  2.61271  0.73942  1.000 41.45331  ? 89  ILE A HG12 1 
ATOM   1483 H HG13 . ILE A 1 89  ? 17.19026  4.06829  1.13564  1.000 41.45331  ? 89  ILE A HG13 1 
ATOM   1484 H HG21 . ILE A 1 89  ? 17.04162  0.85171  2.48337  1.000 42.25244  ? 89  ILE A HG21 1 
ATOM   1485 H HG22 . ILE A 1 89  ? 15.47471  0.75237  2.72508  1.000 42.25244  ? 89  ILE A HG22 1 
ATOM   1486 H HG23 . ILE A 1 89  ? 16.05849  0.65806  1.25070  1.000 42.25244  ? 89  ILE A HG23 1 
ATOM   1487 H HD11 . ILE A 1 89  ? 19.21525  3.70524  2.14068  1.000 52.66907  ? 89  ILE A HD11 1 
ATOM   1488 H HD12 . ILE A 1 89  ? 18.10531  3.75509  3.27603  1.000 52.66907  ? 89  ILE A HD12 1 
ATOM   1489 H HD13 . ILE A 1 89  ? 18.68514  2.35726  2.79295  1.000 52.66907  ? 89  ILE A HD13 1 
ATOM   1490 N N    . LEU A 1 90  ? 12.94711  2.62696  2.48629  1.000 20.86862  ? 90  LEU A N    1 
ATOM   1491 C CA   . LEU A 1 90  ? 11.80527  1.89553  3.01187  1.000 24.44120  ? 90  LEU A CA   1 
ATOM   1492 C C    . LEU A 1 90  ? 10.51985  2.40950  2.38244  1.000 22.12686  ? 90  LEU A C    1 
ATOM   1493 O O    . LEU A 1 90  ? 10.40568  3.58212  2.01551  1.000 20.85733  ? 90  LEU A O    1 
ATOM   1494 C CB   . LEU A 1 90  ? 11.74862  2.01431  4.53125  1.000 20.26956  ? 90  LEU A CB   1 
ATOM   1495 C CG   . LEU A 1 90  ? 12.98938  1.42915  5.21422  1.000 22.97935  ? 90  LEU A CG   1 
ATOM   1496 C CD1  . LEU A 1 90  ? 12.95874  1.76113  6.68801  1.000 33.99793  ? 90  LEU A CD1  1 
ATOM   1497 C CD2  . LEU A 1 90  ? 13.07657  -0.06626 4.98185  1.000 30.21606  ? 90  LEU A CD2  1 
ATOM   1498 H H    . LEU A 1 90  ? 13.13635  3.34483  2.92040  1.000 25.05495  ? 90  LEU A H    1 
ATOM   1499 H HA   . LEU A 1 90  ? 11.88583  0.95347  2.79522  1.000 29.34205  ? 90  LEU A HA   1 
ATOM   1500 H HB2  . LEU A 1 90  ? 11.68532  2.95170  4.77245  1.000 24.33609  ? 90  LEU A HB2  1 
ATOM   1501 H HB3  . LEU A 1 90  ? 10.97075  1.53476  4.85659  1.000 24.33609  ? 90  LEU A HB3  1 
ATOM   1502 H HG   . LEU A 1 90  ? 13.79075  1.82031  4.83252  1.000 27.58783  ? 90  LEU A HG   1 
ATOM   1503 H HD11 . LEU A 1 90  ? 13.74987  1.39251  7.11127  1.000 40.81013  ? 90  LEU A HD11 1 
ATOM   1504 H HD12 . LEU A 1 90  ? 12.94548  2.72519  6.79436  1.000 40.81013  ? 90  LEU A HD12 1 
ATOM   1505 H HD13 . LEU A 1 90  ? 12.16168  1.37383  7.08247  1.000 40.81013  ? 90  LEU A HD13 1 
ATOM   1506 H HD21 . LEU A 1 90  ? 13.71590  -0.44590 5.60476  1.000 36.27188  ? 90  LEU A HD21 1 
ATOM   1507 H HD22 . LEU A 1 90  ? 12.20156  -0.45965 5.12506  1.000 36.27188  ? 90  LEU A HD22 1 
ATOM   1508 H HD23 . LEU A 1 90  ? 13.36673  -0.22784 4.07048  1.000 36.27188  ? 90  LEU A HD23 1 
ATOM   1509 N N    . LYS A 1 91  ? 9.55942   1.50633  2.23551  1.000 24.11019  ? 91  LYS A N    1 
ATOM   1510 C CA   . LYS A 1 91  ? 8.33233   1.79263  1.51632  1.000 21.13943  ? 91  LYS A CA   1 
ATOM   1511 C C    . LYS A 1 91  ? 7.13656   1.68854  2.44972  1.000 22.14461  ? 91  LYS A C    1 
ATOM   1512 O O    . LYS A 1 91  ? 7.22287   1.14559  3.55475  1.000 19.20196  ? 91  LYS A O    1 
ATOM   1513 C CB   . LYS A 1 91  ? 8.16231   0.84154  0.32791  1.000 31.07200  ? 91  LYS A CB   1 
ATOM   1514 C CG   . LYS A 1 91  ? 9.23306   1.00799  -0.73574 1.000 45.43448  ? 91  LYS A CG   1 
ATOM   1515 C CD   . LYS A 1 91  ? 8.92737   0.16103  -1.95784 1.000 65.76502  ? 91  LYS A CD   1 
ATOM   1516 C CE   . LYS A 1 91  ? 9.96933   0.36164  -3.05104 1.000 84.95798  ? 91  LYS A CE   1 
ATOM   1517 N NZ   . LYS A 1 91  ? 10.02209  1.77112  -3.53952 1.000 84.32125  ? 91  LYS A NZ   1 
ATOM   1518 H H    . LYS A 1 91  ? 9.59899   0.70698  2.55027  1.000 28.94484  ? 91  LYS A H    1 
ATOM   1519 H HA   . LYS A 1 91  ? 8.36005   2.70152  1.17860  1.000 25.37993  ? 91  LYS A HA   1 
ATOM   1520 H HB2  . LYS A 1 91  ? 8.20236   -0.07251 0.65010  1.000 37.29901  ? 91  LYS A HB2  1 
ATOM   1521 H HB3  . LYS A 1 91  ? 7.30183   1.00962  -0.08710 1.000 37.29901  ? 91  LYS A HB3  1 
ATOM   1522 H HG2  . LYS A 1 91  ? 9.27393   1.93759  -1.00971 1.000 54.53399  ? 91  LYS A HG2  1 
ATOM   1523 H HG3  . LYS A 1 91  ? 10.09026  0.72987  -0.37692 1.000 54.53399  ? 91  LYS A HG3  1 
ATOM   1524 H HD2  . LYS A 1 91  ? 8.92519   -0.77597 -1.70702 1.000 78.93063  ? 91  LYS A HD2  1 
ATOM   1525 H HD3  . LYS A 1 91  ? 8.06031   0.41129  -2.31349 1.000 78.93063  ? 91  LYS A HD3  1 
ATOM   1526 H HE2  . LYS A 1 91  ? 10.84434  0.13176  -2.70119 1.000 101.96219 ? 91  LYS A HE2  1 
ATOM   1527 H HE3  . LYS A 1 91  ? 9.75265   -0.20971 -3.80437 1.000 101.96219 ? 91  LYS A HE3  1 
ATOM   1528 H HZ1  . LYS A 1 91  ? 10.24691  2.31613  -2.87281 1.000 101.19811 ? 91  LYS A HZ1  1 
ATOM   1529 H HZ2  . LYS A 1 91  ? 10.62550  1.84564  -4.18948 1.000 101.19811 ? 91  LYS A HZ2  1 
ATOM   1530 H HZ3  . LYS A 1 91  ? 9.22613   2.01389  -3.85514 1.000 101.19811 ? 91  LYS A HZ3  1 
ATOM   1531 N N    . HIS A 1 92  ? 6.01676   2.24350  1.99036  1.000 18.98064  ? 92  HIS A N    1 
ATOM   1532 C CA   . HIS A 1 92  ? 4.76634   2.24268  2.74733  1.000 16.51814  ? 92  HIS A CA   1 
ATOM   1533 C C    . HIS A 1 92  ? 4.04326   0.93874  2.43382  1.000 22.66503  ? 92  HIS A C    1 
ATOM   1534 O O    . HIS A 1 92  ? 3.19827   0.87466  1.53978  1.000 24.79341  ? 92  HIS A O    1 
ATOM   1535 C CB   . HIS A 1 92  ? 3.91315   3.45414  2.38351  1.000 18.42710  ? 92  HIS A CB   1 
ATOM   1536 C CG   . HIS A 1 92  ? 4.56553   4.77105  2.67368  1.000 16.54659  ? 92  HIS A CG   1 
ATOM   1537 N ND1  . HIS A 1 92  ? 5.52090   5.33023  1.85162  1.000 16.94136  ? 92  HIS A ND1  1 
ATOM   1538 C CD2  . HIS A 1 92  ? 4.38626   5.64676  3.69052  1.000 16.10257  ? 92  HIS A CD2  1 
ATOM   1539 C CE1  . HIS A 1 92  ? 5.91152   6.48711  2.35752  1.000 16.12089  ? 92  HIS A CE1  1 
ATOM   1540 N NE2  . HIS A 1 92  ? 5.23220   6.70569  3.46909  1.000 16.60310  ? 92  HIS A NE2  1 
ATOM   1541 H H    . HIS A 1 92  ? 5.95449   2.63483  1.22709  1.000 22.78938  ? 92  HIS A H    1 
ATOM   1542 H HA   . HIS A 1 92  ? 4.96057   2.27934  3.69698  1.000 19.83438  ? 92  HIS A HA   1 
ATOM   1543 H HB2  . HIS A 1 92  ? 3.72014   3.42400  1.43339  1.000 22.12513  ? 92  HIS A HB2  1 
ATOM   1544 H HB3  . HIS A 1 92  ? 3.08746   3.41621  2.89115  1.000 22.12513  ? 92  HIS A HB3  1 
ATOM   1545 H HD1  . HIS A 1 92  ? 5.81644   4.98083  1.12349  1.000 20.34224  ? 92  HIS A HD1  1 
ATOM   1546 H HD2  . HIS A 1 92  ? 3.79967   5.54936  4.40558  1.000 19.33570  ? 92  HIS A HD2  1 
ATOM   1547 H HE1  . HIS A 1 92  ? 6.55493   7.05108  1.99303  1.000 19.35768  ? 92  HIS A HE1  1 
ATOM   1548 N N    . THR A 1 93  ? 4.36936   -0.11415 3.18536  1.000 19.10012  ? 93  THR A N    1 
ATOM   1549 C CA   . THR A 1 93  ? 3.95834   -1.46806 2.83592  1.000 21.67544  ? 93  THR A CA   1 
ATOM   1550 C C    . THR A 1 93  ? 2.63147   -1.89177 3.44996  1.000 26.29099  ? 93  THR A C    1 
ATOM   1551 O O    . THR A 1 93  ? 2.08547   -2.92317 3.04760  1.000 27.45435  ? 93  THR A O    1 
ATOM   1552 C CB   . THR A 1 93  ? 5.03459   -2.46774 3.27249  1.000 30.28026  ? 93  THR A CB   1 
ATOM   1553 O OG1  . THR A 1 93  ? 5.37129   -2.20861 4.64208  1.000 29.18339  ? 93  THR A OG1  1 
ATOM   1554 C CG2  . THR A 1 93  ? 6.27033   -2.34176 2.40433  1.000 35.99712  ? 93  THR A CG2  1 
ATOM   1555 H H    . THR A 1 93  ? 4.83239   -0.06648 3.90849  1.000 22.93276  ? 93  THR A H    1 
ATOM   1556 H HA   . THR A 1 93  ? 3.86073   -1.50767 1.87166  1.000 26.02314  ? 93  THR A HA   1 
ATOM   1557 H HB   . THR A 1 93  ? 4.70474   -3.37528 3.18043  1.000 36.34892  ? 93  THR A HB   1 
ATOM   1558 H HG1  . THR A 1 93  ? 5.99573   -2.71513 4.88520  1.000 35.03268  ? 93  THR A HG1  1 
ATOM   1559 H HG21 . THR A 1 93  ? 6.98093   -2.90086 2.75554  1.000 43.20915  ? 93  THR A HG21 1 
ATOM   1560 H HG22 . THR A 1 93  ? 6.06871   -2.62141 1.49766  1.000 43.20915  ? 93  THR A HG22 1 
ATOM   1561 H HG23 . THR A 1 93  ? 6.57290   -1.42028 2.38961  1.000 43.20915  ? 93  THR A HG23 1 
ATOM   1562 N N    . GLY A 1 94  ? 2.09865   -1.14556 4.40468  1.000 23.75232  ? 94  GLY A N    1 
ATOM   1563 C CA   . GLY A 1 94  ? 0.84414   -1.51475 5.00989  1.000 29.49113  ? 94  GLY A CA   1 
ATOM   1564 C C    . GLY A 1 94  ? 0.62350   -0.82679 6.33318  1.000 21.58562  ? 94  GLY A C    1 
ATOM   1565 O O    . GLY A 1 94  ? 1.33766   0.11054  6.70036  1.000 19.48792  ? 94  GLY A O    1 
ATOM   1566 H H    . GLY A 1 94  ? 2.44815   -0.42344 4.71450  1.000 28.51540  ? 94  GLY A H    1 
ATOM   1567 H HA2  . GLY A 1 94  ? 0.11692   -1.27410 4.41479  1.000 35.40197  ? 94  GLY A HA2  1 
ATOM   1568 H HA3  . GLY A 1 94  ? 0.82787   -2.47342 5.15685  1.000 35.40197  ? 94  GLY A HA3  1 
ATOM   1569 N N    A PRO A 1 95  ? -0.39084  -1.26983 7.07383  0.568 22.81525  ? 95  PRO A N    1 
ATOM   1570 N N    B PRO A 1 95  ? -0.36273  -1.29879 7.09214  0.432 22.08122  ? 95  PRO A N    1 
ATOM   1571 C CA   A PRO A 1 95  ? -0.67359  -0.64814 8.37208  0.568 21.37779  ? 95  PRO A CA   1 
ATOM   1572 C CA   B PRO A 1 95  ? -0.68125  -0.64459 8.36684  0.432 21.22732  ? 95  PRO A CA   1 
ATOM   1573 C C    A PRO A 1 95  ? 0.52163   -0.71831 9.30763  0.568 17.38819  ? 95  PRO A C    1 
ATOM   1574 C C    B PRO A 1 95  ? 0.47087   -0.74842 9.35485  0.432 18.89643  ? 95  PRO A C    1 
ATOM   1575 O O    A PRO A 1 95  ? 1.29119   -1.68233 9.30335  0.568 23.27820  ? 95  PRO A O    1 
ATOM   1576 O O    B PRO A 1 95  ? 1.15617   -1.77012 9.43718  0.432 22.05584  ? 95  PRO A O    1 
ATOM   1577 C CB   A PRO A 1 95  ? -1.85212  -1.46905 8.91405  0.568 25.32525  ? 95  PRO A CB   1 
ATOM   1578 C CB   B PRO A 1 95  ? -1.91896  -1.40663 8.85816  0.432 25.75901  ? 95  PRO A CB   1 
ATOM   1579 C CG   A PRO A 1 95  ? -2.50745  -2.03637 7.69708  0.568 26.93062  ? 95  PRO A CG   1 
ATOM   1580 C CG   B PRO A 1 95  ? -1.80953  -2.75475 8.20847  0.432 32.80867  ? 95  PRO A CG   1 
ATOM   1581 C CD   A PRO A 1 95  ? -1.38615  -2.30001 6.71963  0.568 26.87601  ? 95  PRO A CD   1 
ATOM   1582 C CD   B PRO A 1 95  ? -1.17441  -2.51010 6.86261  0.432 23.99542  ? 95  PRO A CD   1 
ATOM   1583 H HA   A PRO A 1 95  ? -0.93895  0.27723  8.25301  0.568 25.66597  ? 95  PRO A HA   1 
ATOM   1584 H HA   B PRO A 1 95  ? -0.90324  0.28901  8.22537  0.432 25.48539  ? 95  PRO A HA   1 
ATOM   1585 H HB2  A PRO A 1 95  ? -1.52597  -2.17404 9.49501  0.568 30.40292  ? 95  PRO A HB2  1 
ATOM   1586 H HB2  B PRO A 1 95  ? -1.90078  -1.48234 9.82503  0.432 30.92342  ? 95  PRO A HB2  1 
ATOM   1587 H HB3  A PRO A 1 95  ? -2.46144  -0.89281 9.40147  0.568 30.40292  ? 95  PRO A HB3  1 
ATOM   1588 H HB3  B PRO A 1 95  ? -2.72568  -0.94757 8.57644  0.432 30.92342  ? 95  PRO A HB3  1 
ATOM   1589 H HG2  A PRO A 1 95  ? -2.96681  -2.85974 7.92500  0.568 32.32936  ? 95  PRO A HG2  1 
ATOM   1590 H HG2  B PRO A 1 95  ? -1.25328  -3.33559 8.75079  0.432 39.38301  ? 95  PRO A HG2  1 
ATOM   1591 H HG3  A PRO A 1 95  ? -3.13756  -1.39452 7.33390  0.568 32.32936  ? 95  PRO A HG3  1 
ATOM   1592 H HG3  B PRO A 1 95  ? -2.69303  -3.14198 8.10656  0.432 39.38301  ? 95  PRO A HG3  1 
ATOM   1593 H HD2  A PRO A 1 95  ? -1.02183  -3.19063 6.84199  0.568 32.26382  ? 95  PRO A HD2  1 
ATOM   1594 H HD2  B PRO A 1 95  ? -0.61409  -3.25819 6.60317  0.432 28.80712  ? 95  PRO A HD2  1 
ATOM   1595 H HD3  A PRO A 1 95  ? -1.69000  -2.18860 5.80521  0.568 32.26382  ? 95  PRO A HD3  1 
ATOM   1596 H HD3  B PRO A 1 95  ? -1.84989  -2.35085 6.18492  0.432 28.80712  ? 95  PRO A HD3  1 
ATOM   1597 N N    . GLY A 1 96  ? 0.64924   0.31381  10.14039 1.000 18.25536  ? 96  GLY A N    1 
ATOM   1598 C CA   . GLY A 1 96  ? 1.67967   0.37232  11.15315 1.000 19.43437  ? 96  GLY A CA   1 
ATOM   1599 C C    . GLY A 1 96  ? 2.92392   1.13915  10.77732 1.000 19.17025  ? 96  GLY A C    1 
ATOM   1600 O O    . GLY A 1 96  ? 3.76933   1.37941  11.64876 1.000 20.41265  ? 96  GLY A O    1 
ATOM   1601 H H    . GLY A 1 96  ? 0.13660   1.00428  10.13320 1.000 21.91905  ? 96  GLY A H    1 
ATOM   1602 H HA2  . GLY A 1 96  ? 1.30790   0.78936  11.94610 1.000 23.33385  ? 96  GLY A HA2  1 
ATOM   1603 H HA3  . GLY A 1 96  ? 1.94936   -0.53387 11.36989 1.000 23.33385  ? 96  GLY A HA3  1 
ATOM   1604 N N    . ILE A 1 97  ? 3.05335   1.53126  9.51286  1.000 17.67146  ? 97  ILE A N    1 
ATOM   1605 C CA   . ILE A 1 97  ? 4.23493   2.24141  9.05128  1.000 17.54502  ? 97  ILE A CA   1 
ATOM   1606 C C    . ILE A 1 97  ? 4.22694   3.66980  9.57630  1.000 14.97886  ? 97  ILE A C    1 
ATOM   1607 O O    . ILE A 1 97  ? 3.19911   4.35754  9.55140  1.000 17.31870  ? 97  ILE A O    1 
ATOM   1608 C CB   . ILE A 1 97  ? 4.29587   2.22675  7.51138  1.000 17.31874  ? 97  ILE A CB   1 
ATOM   1609 C CG1  . ILE A 1 97  ? 4.65835   0.82912  7.00004  1.000 21.39801  ? 97  ILE A CG1  1 
ATOM   1610 C CG2  . ILE A 1 97  ? 5.21755   3.34152  7.00575  1.000 17.31661  ? 97  ILE A CG2  1 
ATOM   1611 C CD1  . ILE A 1 97  ? 6.06629   0.37533  7.30377  1.000 27.51778  ? 97  ILE A CD1  1 
ATOM   1612 H H    . ILE A 1 97  ? 2.46562   1.39623  8.89972  1.000 21.21836  ? 97  ILE A H    1 
ATOM   1613 H HA   . ILE A 1 97  ? 5.02085   1.79425  9.40240  1.000 21.06664  ? 97  ILE A HA   1 
ATOM   1614 H HB   . ILE A 1 97  ? 3.41793   2.41844  7.14618  1.000 20.79510  ? 97  ILE A HB   1 
ATOM   1615 H HG12 . ILE A 1 97  ? 4.05386   0.18852  7.40642  1.000 25.69022  ? 97  ILE A HG12 1 
ATOM   1616 H HG13 . ILE A 1 97  ? 4.55285   0.81937  6.03585  1.000 25.69022  ? 97  ILE A HG13 1 
ATOM   1617 H HG21 . ILE A 1 97  ? 5.53369   3.11156  6.11801  1.000 20.79254  ? 97  ILE A HG21 1 
ATOM   1618 H HG22 . ILE A 1 97  ? 4.71938   4.17322  6.97433  1.000 20.79254  ? 97  ILE A HG22 1 
ATOM   1619 H HG23 . ILE A 1 97  ? 5.96946   3.42903  7.61228  1.000 20.79254  ? 97  ILE A HG23 1 
ATOM   1620 H HD11 . ILE A 1 97  ? 6.22330   -0.47832 6.87073  1.000 33.03395  ? 97  ILE A HD11 1 
ATOM   1621 H HD12 . ILE A 1 97  ? 6.69083   1.03681  6.96717  1.000 33.03395  ? 97  ILE A HD12 1 
ATOM   1622 H HD13 . ILE A 1 97  ? 6.16806   0.28281  8.26397  1.000 33.03395  ? 97  ILE A HD13 1 
ATOM   1623 N N    A LEU A 1 98  ? 5.39269   4.15453  9.97855  0.687 15.94331  ? 98  LEU A N    1 
ATOM   1624 N N    B LEU A 1 98  ? 5.37299   4.09724  10.10586 0.313 13.73474  ? 98  LEU A N    1 
ATOM   1625 C CA   A LEU A 1 98  ? 5.57381   5.50201  10.50715 0.687 13.70317  ? 98  LEU A CA   1 
ATOM   1626 C CA   B LEU A 1 98  ? 5.60045   5.48803  10.44925 0.313 14.96734  ? 98  LEU A CA   1 
ATOM   1627 C C    A LEU A 1 98  ? 6.40429   6.28748  9.49949  0.687 14.68524  ? 98  LEU A C    1 
ATOM   1628 C C    B LEU A 1 98  ? 6.28325   6.17693  9.28154  0.313 12.46048  ? 98  LEU A C    1 
ATOM   1629 O O    A LEU A 1 98  ? 7.52114   5.88230  9.16725  0.687 13.79479  ? 98  LEU A O    1 
ATOM   1630 O O    B LEU A 1 98  ? 7.20483   5.63000  8.66787  0.313 16.65525  ? 98  LEU A O    1 
ATOM   1631 C CB   A LEU A 1 98  ? 6.24799   5.41184  11.87111 0.687 16.76362  ? 98  LEU A CB   1 
ATOM   1632 C CB   B LEU A 1 98  ? 6.47574   5.62908  11.68769 0.313 16.85252  ? 98  LEU A CB   1 
ATOM   1633 C CG   A LEU A 1 98  ? 6.47548   6.61545  12.77343 0.687 30.55645  ? 98  LEU A CG   1 
ATOM   1634 C CG   B LEU A 1 98  ? 5.94269   4.95941  12.94510 0.313 25.81131  ? 98  LEU A CG   1 
ATOM   1635 C CD1  A LEU A 1 98  ? 5.17089   7.19821  13.22655 0.687 25.37211  ? 98  LEU A CD1  1 
ATOM   1636 C CD1  B LEU A 1 98  ? 7.03563   4.92775  13.99538 0.313 35.44890  ? 98  LEU A CD1  1 
ATOM   1637 C CD2  A LEU A 1 98  ? 7.31644   6.13688  13.95679 0.687 23.06892  ? 98  LEU A CD2  1 
ATOM   1638 C CD2  B LEU A 1 98  ? 4.72801   5.69946  13.45055 0.313 32.74907  ? 98  LEU A CD2  1 
ATOM   1639 H HA   A LEU A 1 98  ? 4.73121   5.97016  10.61562 0.687 16.45641  ? 98  LEU A HA   1 
ATOM   1640 H HA   B LEU A 1 98  ? 4.74937   5.91216  10.64076 0.313 17.97342  ? 98  LEU A HA   1 
ATOM   1641 H HB2  A LEU A 1 98  ? 5.71619   4.79524  12.39826 0.687 20.12896  ? 98  LEU A HB2  1 
ATOM   1642 H HB2  B LEU A 1 98  ? 7.34137   5.23599  11.49512 0.313 20.23564  ? 98  LEU A HB2  1 
ATOM   1643 H HB3  A LEU A 1 98  ? 7.13020   5.03982  11.71551 0.687 20.12896  ? 98  LEU A HB3  1 
ATOM   1644 H HB3  B LEU A 1 98  ? 6.57650   6.57378  11.88335 0.313 20.23564  ? 98  LEU A HB3  1 
ATOM   1645 H HG   A LEU A 1 98  ? 6.93880   7.32678  12.30413 0.687 36.68035  ? 98  LEU A HG   1 
ATOM   1646 H HG   B LEU A 1 98  ? 5.67317   4.04760  12.75308 0.313 30.98618  ? 98  LEU A HG   1 
ATOM   1647 H HD11 A LEU A 1 98  ? 5.34695   7.91732  13.85328 0.687 30.45915  ? 98  LEU A HD11 1 
ATOM   1648 H HD11 B LEU A 1 98  ? 6.94909   4.11439  14.51678 0.313 42.55129  ? 98  LEU A HD11 1 
ATOM   1649 H HD12 A LEU A 1 98  ? 4.69334   7.54129  12.45509 0.687 30.45915  ? 98  LEU A HD12 1 
ATOM   1650 H HD12 B LEU A 1 98  ? 7.89892   4.94710  13.55348 0.313 42.55129  ? 98  LEU A HD12 1 
ATOM   1651 H HD13 A LEU A 1 98  ? 4.64783   6.50435  13.65767 0.687 30.45915  ? 98  LEU A HD13 1 
ATOM   1652 H HD13 B LEU A 1 98  ? 6.94186   5.70197  14.57217 0.313 42.55129  ? 98  LEU A HD13 1 
ATOM   1653 H HD21 A LEU A 1 98  ? 7.49966   6.89055  14.53931 0.687 27.69531  ? 98  LEU A HD21 1 
ATOM   1654 H HD21 B LEU A 1 98  ? 4.18288   5.09137  13.97396 0.313 39.31150  ? 98  LEU A HD21 1 
ATOM   1655 H HD22 A LEU A 1 98  ? 6.82221   5.45705  14.44101 0.687 27.69531  ? 98  LEU A HD22 1 
ATOM   1656 H HD22 B LEU A 1 98  ? 5.01796   6.44242  14.00267 0.313 39.31150  ? 98  LEU A HD22 1 
ATOM   1657 H HD23 A LEU A 1 98  ? 8.14866   5.76645  13.62350 0.687 27.69531  ? 98  LEU A HD23 1 
ATOM   1658 H HD23 B LEU A 1 98  ? 4.22083   6.02906  12.69224 0.313 39.31150  ? 98  LEU A HD23 1 
ATOM   1659 N N    . SER A 1 99  ? 5.84865   7.39243  8.99645  1.000 13.15318  ? 99  SER A N    1 
ATOM   1660 C CA   A SER A 1 99  ? 6.42163   8.13572  7.89227  0.923 16.07104  ? 99  SER A CA   1 
ATOM   1661 C CA   B SER A 1 99  ? 6.42120   8.14342  7.88392  0.077 16.49147  ? 99  SER A CA   1 
ATOM   1662 C C    . SER A 1 99  ? 6.32295   9.62483  8.18588  1.000 14.19717  ? 99  SER A C    1 
ATOM   1663 O O    . SER A 1 99  ? 5.45690   10.06604 8.94338  1.000 15.86687  ? 99  SER A O    1 
ATOM   1664 C CB   A SER A 1 99  ? 5.69363   7.74990  6.60907  0.923 22.13186  ? 99  SER A CB   1 
ATOM   1665 C CB   B SER A 1 99  ? 5.72969   7.81442  6.55441  0.077 18.82355  ? 99  SER A CB   1 
ATOM   1666 O OG   A SER A 1 99  ? 6.25616   8.42193  5.51606  0.923 19.75852  ? 99  SER A OG   1 
ATOM   1667 O OG   B SER A 1 99  ? 4.36802   8.19942  6.56766  0.077 18.50717  ? 99  SER A OG   1 
ATOM   1668 H H    A SER A 1 99  ? 5.11754   7.73542  9.29214  0.687 15.79643  ? 99  SER A H    1 
ATOM   1669 H H    B SER A 1 99  ? 5.22824   7.80438  9.42655  0.313 15.79643  ? 99  SER A H    1 
ATOM   1670 H HA   . SER A 1 99  ? 7.36733   7.95287  7.77775  1.000 19.80237  ? 99  SER A HA   1 
ATOM   1671 H HB2  A SER A 1 99  ? 5.77539   6.79319  6.47151  0.923 26.57085  ? 99  SER A HB2  1 
ATOM   1672 H HB2  B SER A 1 99  ? 6.18235   8.28971  5.84020  0.077 22.60088  ? 99  SER A HB2  1 
ATOM   1673 H HB3  A SER A 1 99  ? 4.75839   7.99512  6.68710  0.923 26.57085  ? 99  SER A HB3  1 
ATOM   1674 H HB3  B SER A 1 99  ? 5.78299   6.85791  6.40223  0.077 22.60088  ? 99  SER A HB3  1 
ATOM   1675 H HG   A SER A 1 99  ? 5.64911   8.70052  5.00668  0.923 23.72284  ? 99  SER A HG   1 
ATOM   1676 H HG   B SER A 1 99  ? 3.96095   7.79456  7.18083  0.077 22.22121  ? 99  SER A HG   1 
ATOM   1677 N N    . MET A 1 100 ? 7.23925   10.38377 7.59793  1.000 14.66626  ? 100 MET A N    1 
ATOM   1678 C CA   . MET A 1 100 ? 7.28869   11.81659 7.84013  1.000 13.26104  ? 100 MET A CA   1 
ATOM   1679 C C    . MET A 1 100 ? 6.31207   12.57091 6.94731  1.000 19.03431  ? 100 MET A C    1 
ATOM   1680 O O    . MET A 1 100 ? 6.27546   12.36567 5.73050  1.000 16.96173  ? 100 MET A O    1 
ATOM   1681 C CB   . MET A 1 100 ? 8.69688   12.35867 7.59277  1.000 16.58684  ? 100 MET A CB   1 
ATOM   1682 C CG   . MET A 1 100 ? 9.74117   11.95189 8.60683  1.000 18.83122  ? 100 MET A CG   1 
ATOM   1683 S SD   . MET A 1 100 ? 9.33446   12.43496 10.28781 1.000 18.38560  ? 100 MET A SD   1 
ATOM   1684 C CE   . MET A 1 100 ? 9.47547   14.22371 10.20018 1.000 20.14082  ? 100 MET A CE   1 
ATOM   1685 H H    . MET A 1 100 ? 7.84089   10.09295 7.05658  1.000 17.61212  ? 100 MET A H    1 
ATOM   1686 H HA   . MET A 1 100 ? 7.04759   11.95927 8.76879  1.000 15.92586  ? 100 MET A HA   1 
ATOM   1687 H HB2  . MET A 1 100 ? 8.99742   12.04178 6.72666  1.000 19.91682  ? 100 MET A HB2  1 
ATOM   1688 H HB3  . MET A 1 100 ? 8.65495   13.32776 7.59520  1.000 19.91682  ? 100 MET A HB3  1 
ATOM   1689 H HG2  . MET A 1 100 ? 9.83471   10.98656 8.58993  1.000 22.61008  ? 100 MET A HG2  1 
ATOM   1690 H HG3  . MET A 1 100 ? 10.58423  12.37102 8.37342  1.000 22.61008  ? 100 MET A HG3  1 
ATOM   1691 H HE1  . MET A 1 100 ? 9.26229   14.60020 11.06834 1.000 24.18159  ? 100 MET A HE1  1 
ATOM   1692 H HE2  . MET A 1 100 ? 10.38378  14.45713 9.95241  1.000 24.18159  ? 100 MET A HE2  1 
ATOM   1693 H HE3  . MET A 1 100 ? 8.85470   14.55714 9.53357  1.000 24.18159  ? 100 MET A HE3  1 
ATOM   1694 N N    . ALA A 1 101 ? 5.54127   13.46619 7.55147  1.000 12.48760  ? 101 ALA A N    1 
ATOM   1695 C CA   . ALA A 1 101 ? 4.77685   14.44420 6.79819  1.000 10.95159  ? 101 ALA A CA   1 
ATOM   1696 C C    . ALA A 1 101 ? 5.72542   15.51565 6.27977  1.000 16.19169  ? 101 ALA A C    1 
ATOM   1697 O O    . ALA A 1 101 ? 6.79695   15.74980 6.84600  1.000 18.69453  ? 101 ALA A O    1 
ATOM   1698 C CB   . ALA A 1 101 ? 3.69167   15.06136 7.67742  1.000 17.29289  ? 101 ALA A CB   1 
ATOM   1699 H H    . ALA A 1 101 ? 5.44431   13.52708 8.40382  1.000 14.99774  ? 101 ALA A H    1 
ATOM   1700 H HA   . ALA A 1 101 ? 4.33006   14.03013 6.04333  1.000 13.15452  ? 101 ALA A HA   1 
ATOM   1701 H HB1  . ALA A 1 101 ? 3.16114   15.67217 7.14231  1.000 20.76408  ? 101 ALA A HB1  1 
ATOM   1702 H HB2  . ALA A 1 101 ? 3.12838   14.35350 8.02749  1.000 20.76408  ? 101 ALA A HB2  1 
ATOM   1703 H HB3  . ALA A 1 101 ? 4.11218   15.54131 8.40798  1.000 20.76408  ? 101 ALA A HB3  1 
ATOM   1704 N N    . ASN A 1 102 ? 5.34447   16.15621 5.18434  1.000 16.36723  ? 102 ASN A N    1 
ATOM   1705 C CA   . ASN A 1 102 ? 6.16756   17.23840 4.66455  1.000 16.65068  ? 102 ASN A CA   1 
ATOM   1706 C C    . ASN A 1 102 ? 5.31324   18.12480 3.77248  1.000 18.52183  ? 102 ASN A C    1 
ATOM   1707 O O    . ASN A 1 102 ? 4.13313   17.85392 3.53229  1.000 21.81212  ? 102 ASN A O    1 
ATOM   1708 C CB   . ASN A 1 102 ? 7.39432   16.69249 3.92591  1.000 16.91220  ? 102 ASN A CB   1 
ATOM   1709 C CG   . ASN A 1 102 ? 7.02635   15.90960 2.69563  1.000 17.39002  ? 102 ASN A CG   1 
ATOM   1710 O OD1  . ASN A 1 102 ? 6.28059   16.39029 1.84461  1.000 19.31591  ? 102 ASN A OD1  1 
ATOM   1711 N ND2  . ASN A 1 102 ? 7.54478   14.69237 2.59071  1.000 16.56374  ? 102 ASN A ND2  1 
ATOM   1712 H H    . ASN A 1 102 ? 4.63105   15.98717 4.73483  1.000 19.65328  ? 102 ASN A H    1 
ATOM   1713 H HA   . ASN A 1 102 ? 6.47518   17.78092 5.40748  1.000 19.99343  ? 102 ASN A HA   1 
ATOM   1714 H HB2  . ASN A 1 102 ? 7.95615   17.43470 3.65318  1.000 20.30725  ? 102 ASN A HB2  1 
ATOM   1715 H HB3  . ASN A 1 102 ? 7.88645   16.10479 4.52032  1.000 20.30725  ? 102 ASN A HB3  1 
ATOM   1716 H HD21 . ASN A 1 102 ? 7.36392   14.20558 1.90520  1.000 19.88910  ? 102 ASN A HD21 1 
ATOM   1717 H HD22 . ASN A 1 102 ? 8.06158   14.39041 3.20824  1.000 19.88910  ? 102 ASN A HD22 1 
ATOM   1718 N N    . ALA A 1 103 ? 5.92653   19.20480 3.29328  1.000 18.06054  ? 103 ALA A N    1 
ATOM   1719 C CA   . ALA A 1 103 ? 5.25982   20.18376 2.44804  1.000 20.13207  ? 103 ALA A CA   1 
ATOM   1720 C C    . ALA A 1 103 ? 6.03872   20.40320 1.15851  1.000 23.05616  ? 103 ALA A C    1 
ATOM   1721 O O    . ALA A 1 103 ? 6.03944   21.50578 0.60693  1.000 27.18034  ? 103 ALA A O    1 
ATOM   1722 C CB   . ALA A 1 103 ? 5.07747   21.50748 3.18976  1.000 27.88313  ? 103 ALA A CB   1 
ATOM   1723 H H    . ALA A 1 103 ? 6.75058   19.39479 3.44965  1.000 21.68527  ? 103 ALA A H    1 
ATOM   1724 H HA   . ALA A 1 103 ? 4.38041   19.84738 2.21483  1.000 24.17110  ? 103 ALA A HA   1 
ATOM   1725 H HB1  . ALA A 1 103 ? 4.62945   22.13822 2.60466  1.000 33.47236  ? 103 ALA A HB1  1 
ATOM   1726 H HB2  . ALA A 1 103 ? 4.54096   21.35364 3.98310  1.000 33.47236  ? 103 ALA A HB2  1 
ATOM   1727 H HB3  . ALA A 1 103 ? 5.94895   21.85117 3.44133  1.000 33.47236  ? 103 ALA A HB3  1 
ATOM   1728 N N    . GLY A 1 104 ? 6.70167   19.36218 0.66681  1.000 20.07166  ? 104 GLY A N    1 
ATOM   1729 C CA   . GLY A 1 104 ? 7.54784   19.47473 -0.49428 1.000 19.27224  ? 104 GLY A CA   1 
ATOM   1730 C C    . GLY A 1 104 ? 8.88419   18.82225 -0.22984 1.000 16.94776  ? 104 GLY A C    1 
ATOM   1731 O O    . GLY A 1 104 ? 9.15268   18.34461 0.87778  1.000 18.13714  ? 104 GLY A O    1 
ATOM   1732 H H    . GLY A 1 104 ? 6.67185   18.56974 0.99958  1.000 24.09861  ? 104 GLY A H    1 
ATOM   1733 H HA2  . GLY A 1 104 ? 7.12818   19.03760 -1.25171 1.000 23.13930  ? 104 GLY A HA2  1 
ATOM   1734 H HA3  . GLY A 1 104 ? 7.69075   20.40987 -0.70871 1.000 23.13930  ? 104 GLY A HA3  1 
ATOM   1735 N N    . PRO A 1 105 ? 9.75796   18.78497 -1.23138 1.000 18.26715  ? 105 PRO A N    1 
ATOM   1736 C CA   A PRO A 1 105 ? 11.06835  18.15689 -1.03482 0.378 19.08330  ? 105 PRO A CA   1 
ATOM   1737 C CA   B PRO A 1 105 ? 11.06517  18.15238 -1.02892 0.622 20.10785  ? 105 PRO A CA   1 
ATOM   1738 C C    . PRO A 1 105 ? 11.83922  18.82091 0.09750  1.000 17.00045  ? 105 PRO A C    1 
ATOM   1739 O O    . PRO A 1 105 ? 11.86982  20.04787 0.21621  1.000 19.51660  ? 105 PRO A O    1 
ATOM   1740 C CB   A PRO A 1 105 ? 11.76847  18.35112 -2.38547 0.378 18.70562  ? 105 PRO A CB   1 
ATOM   1741 C CB   B PRO A 1 105 ? 11.76762  18.32162 -2.38135 0.622 18.96896  ? 105 PRO A CB   1 
ATOM   1742 C CG   A PRO A 1 105 ? 10.65329  18.56471 -3.37090 0.378 18.25996  ? 105 PRO A CG   1 
ATOM   1743 C CG   B PRO A 1 105 ? 11.05874  19.43319 -3.04857 0.622 24.06655  ? 105 PRO A CG   1 
ATOM   1744 C CD   A PRO A 1 105 ? 9.56421   19.27042 -2.61188 0.378 21.93497  ? 105 PRO A CD   1 
ATOM   1745 C CD   B PRO A 1 105 ? 9.62752   19.36057 -2.58358 0.622 24.54249  ? 105 PRO A CD   1 
ATOM   1746 H HA   . PRO A 1 105 ? 10.96899  17.20952 -0.85176 1.000 24.14203  ? 105 PRO A HA   1 
ATOM   1747 H HB2  A PRO A 1 105 ? 12.35165  19.12529 -2.34731 0.378 22.45936  ? 105 PRO A HB2  1 
ATOM   1748 H HB2  B PRO A 1 105 ? 12.70225  18.54062 -2.24206 0.622 22.77537  ? 105 PRO A HB2  1 
ATOM   1749 H HB3  A PRO A 1 105 ? 12.28242  17.55926 -2.60840 0.378 22.45936  ? 105 PRO A HB3  1 
ATOM   1750 H HB3  B PRO A 1 105 ? 11.69185  17.50333 -2.89667 0.622 22.77537  ? 105 PRO A HB3  1 
ATOM   1751 H HG2  A PRO A 1 105 ? 10.96809  19.11126 -4.10784 0.378 21.92457  ? 105 PRO A HG2  1 
ATOM   1752 H HG2  B PRO A 1 105 ? 11.46013  20.27736 -2.78940 0.622 28.89247  ? 105 PRO A HG2  1 
ATOM   1753 H HG3  A PRO A 1 105 ? 10.34134  17.70825 -3.70266 0.378 21.92457  ? 105 PRO A HG3  1 
ATOM   1754 H HG3  B PRO A 1 105 ? 11.11181  19.32214 -4.01072 0.622 28.89247  ? 105 PRO A HG3  1 
ATOM   1755 H HD2  A PRO A 1 105 ? 9.67553   20.23281 -2.65996 0.378 26.33458  ? 105 PRO A HD2  1 
ATOM   1756 H HD2  B PRO A 1 105 ? 9.22772   20.24366 -2.54877 0.622 29.46360  ? 105 PRO A HD2  1 
ATOM   1757 H HD3  A PRO A 1 105 ? 8.68927   19.02046 -2.94787 0.378 26.33458  ? 105 PRO A HD3  1 
ATOM   1758 H HD3  B PRO A 1 105 ? 9.10360   18.78165 -3.15914 0.622 29.46360  ? 105 PRO A HD3  1 
ATOM   1759 N N    . ASN A 1 106 ? 12.45332  17.99079 0.94021  1.000 17.86353  ? 106 ASN A N    1 
ATOM   1760 C CA   . ASN A 1 106 ? 13.37980  18.45441 1.97038  1.000 15.17585  ? 106 ASN A CA   1 
ATOM   1761 C C    . ASN A 1 106 ? 12.74464  19.47306 2.91172  1.000 19.43341  ? 106 ASN A C    1 
ATOM   1762 O O    . ASN A 1 106 ? 13.33274  20.50970 3.23257  1.000 18.01248  ? 106 ASN A O    1 
ATOM   1763 C CB   . ASN A 1 106 ? 14.63132  19.01564 1.29770  1.000 15.98216  ? 106 ASN A CB   1 
ATOM   1764 C CG   . ASN A 1 106 ? 15.26307  18.01725 0.35701  1.000 19.45253  ? 106 ASN A CG   1 
ATOM   1765 O OD1  . ASN A 1 106 ? 15.58834  16.90519 0.76580  1.000 18.58497  ? 106 ASN A OD1  1 
ATOM   1766 N ND2  . ASN A 1 106 ? 15.40232  18.38653 -0.91546 1.000 18.39692  ? 106 ASN A ND2  1 
ATOM   1767 H H    . ASN A 1 106 ? 12.34695  17.13741 0.93443  1.000 21.44885  ? 106 ASN A H    1 
ATOM   1768 H HA   . ASN A 1 106 ? 13.62484  17.70371 2.53368  1.000 18.22364  ? 106 ASN A HA   1 
ATOM   1769 H HB2  . ASN A 1 106 ? 14.39233  19.80469 0.78664  1.000 19.19120  ? 106 ASN A HB2  1 
ATOM   1770 H HB3  . ASN A 1 106 ? 15.28327  19.24591 1.97802  1.000 19.19120  ? 106 ASN A HB3  1 
ATOM   1771 H HD21 . ASN A 1 106 ? 15.75738  17.84708 -1.48336 1.000 22.08891  ? 106 ASN A HD21 1 
ATOM   1772 H HD22 . ASN A 1 106 ? 15.13714  19.16437 -1.16895 1.000 22.08891  ? 106 ASN A HD22 1 
ATOM   1773 N N    . THR A 1 107 ? 11.54626  19.14000 3.40234  1.000 17.25022  ? 107 THR A N    1 
ATOM   1774 C CA   . THR A 1 107 ? 10.84795  20.00221 4.34913  1.000 16.80654  ? 107 THR A CA   1 
ATOM   1775 C C    . THR A 1 107 ? 10.36917  19.23778 5.57816  1.000 18.45088  ? 107 THR A C    1 
ATOM   1776 O O    . THR A 1 107 ? 9.32326   19.56336 6.14944  1.000 20.94008  ? 107 THR A O    1 
ATOM   1777 C CB   . THR A 1 107 ? 9.65637   20.70418 3.69535  1.000 19.36120  ? 107 THR A CB   1 
ATOM   1778 O OG1  . THR A 1 107 ? 8.74034   19.72597 3.18439  1.000 17.69284  ? 107 THR A OG1  1 
ATOM   1779 C CG2  . THR A 1 107 ? 10.11827  21.61699 2.58017  1.000 26.21127  ? 107 THR A CG2  1 
ATOM   1780 H H    . THR A 1 107 ? 11.12174  18.42010 3.19953  1.000 20.71287  ? 107 THR A H    1 
ATOM   1781 H HA   . THR A 1 107 ? 11.48347  20.67417 4.64149  1.000 20.18046  ? 107 THR A HA   1 
ATOM   1782 H HB   . THR A 1 107 ? 9.19946   21.24993 4.35436  1.000 23.24605  ? 107 THR A HB   1 
ATOM   1783 H HG1  . THR A 1 107 ? 9.13314   19.22145 2.63962  1.000 21.24403  ? 107 THR A HG1  1 
ATOM   1784 H HG21 . THR A 1 107 ? 9.36669   22.12150 2.23162  1.000 31.46614  ? 107 THR A HG21 1 
ATOM   1785 H HG22 . THR A 1 107 ? 10.78585  22.23667 2.91370  1.000 31.46614  ? 107 THR A HG22 1 
ATOM   1786 H HG23 . THR A 1 107 ? 10.50606  21.09312 1.86179  1.000 31.46614  ? 107 THR A HG23 1 
ATOM   1787 N N    . ASN A 1 108 ? 11.12864  18.24415 6.01740  1.000 15.30476  ? 108 ASN A N    1 
ATOM   1788 C CA   . ASN A 1 108 ? 10.74504  17.49407 7.20193  1.000 13.19437  ? 108 ASN A CA   1 
ATOM   1789 C C    . ASN A 1 108 ? 10.88943  18.33974 8.45520  1.000 17.08228  ? 108 ASN A C    1 
ATOM   1790 O O    . ASN A 1 108 ? 11.87309  19.06051 8.61946  1.000 17.63720  ? 108 ASN A O    1 
ATOM   1791 C CB   . ASN A 1 108 ? 11.61412  16.25826 7.33955  1.000 14.97168  ? 108 ASN A CB   1 
ATOM   1792 C CG   . ASN A 1 108 ? 11.44859  15.31957 6.19380  1.000 17.06514  ? 108 ASN A CG   1 
ATOM   1793 O OD1  . ASN A 1 108 ? 10.42422  14.65254 6.07954  1.000 17.09189  ? 108 ASN A OD1  1 
ATOM   1794 N ND2  . ASN A 1 108 ? 12.43579  15.28466 5.30447  1.000 15.97403  ? 108 ASN A ND2  1 
ATOM   1795 H H    . ASN A 1 108 ? 11.86318  17.98716 5.65133  1.000 18.37833  ? 108 ASN A H    1 
ATOM   1796 H HA   . ASN A 1 108 ? 9.81685   17.22625 7.11455  1.000 15.84585  ? 108 ASN A HA   1 
ATOM   1797 H HB2  . ASN A 1 108 ? 12.54532  16.52720 7.37728  1.000 17.97863  ? 108 ASN A HB2  1 
ATOM   1798 H HB3  . ASN A 1 108 ? 11.37142  15.78799 8.15248  1.000 17.97863  ? 108 ASN A HB3  1 
ATOM   1799 H HD21 . ASN A 1 108 ? 12.38510  14.75838 4.62619  1.000 19.18145  ? 108 ASN A HD21 1 
ATOM   1800 H HD22 . ASN A 1 108 ? 13.12522  15.78835 5.40733  1.000 19.18145  ? 108 ASN A HD22 1 
ATOM   1801 N N    . GLY A 1 109 ? 9.91676   18.22349 9.35575  1.000 15.74968  ? 109 GLY A N    1 
ATOM   1802 C CA   . GLY A 1 109 ? 9.98891   18.89467 10.63587 1.000 15.20293  ? 109 GLY A CA   1 
ATOM   1803 C C    . GLY A 1 109 ? 9.78260   17.91911 11.77370 1.000 18.99653  ? 109 GLY A C    1 
ATOM   1804 O O    . GLY A 1 109 ? 10.65358  17.09438 12.06927 1.000 19.53870  ? 109 GLY A O    1 
ATOM   1805 H H    . GLY A 1 109 ? 9.20280   17.75752 9.24294  1.000 18.91223  ? 109 GLY A H    1 
ATOM   1806 H HA2  . GLY A 1 109 ? 10.85894  19.31152 10.73684 1.000 18.25612  ? 109 GLY A HA2  1 
ATOM   1807 H HA3  . GLY A 1 109 ? 9.30328   19.57913 10.68421 1.000 18.25612  ? 109 GLY A HA3  1 
ATOM   1808 N N    . SER A 1 110 ? 8.62204   18.00293 12.41503 1.000 14.53003  ? 110 SER A N    1 
ATOM   1809 C CA   . SER A 1 110 ? 8.25620   17.08547 13.47753 1.000 14.23756  ? 110 SER A CA   1 
ATOM   1810 C C    . SER A 1 110 ? 6.99459   16.28965 13.18330 1.000 16.13030  ? 110 SER A C    1 
ATOM   1811 O O    . SER A 1 110 ? 6.70113   15.33790 13.91726 1.000 16.39804  ? 110 SER A O    1 
ATOM   1812 C CB   . SER A 1 110 ? 8.06329   17.85484 14.79578 1.000 16.45015  ? 110 SER A CB   1 
ATOM   1813 O OG   . SER A 1 110 ? 7.06523   18.85754 14.68014 1.000 17.38358  ? 110 SER A OG   1 
ATOM   1814 H H    . SER A 1 110 ? 8.02118   18.59484 12.24709 1.000 17.44865  ? 110 SER A H    1 
ATOM   1815 H HA   . SER A 1 110 ? 8.97950   16.45202 13.60593 1.000 17.09768  ? 110 SER A HA   1 
ATOM   1816 H HB2  . SER A 1 110 ? 7.79712   17.22807 15.48659 1.000 19.75280  ? 110 SER A HB2  1 
ATOM   1817 H HB3  . SER A 1 110 ? 8.90291   18.27683 15.03633 1.000 19.75280  ? 110 SER A HB3  1 
ATOM   1818 H HG   . SER A 1 110 ? 6.30294   18.50473 14.67349 1.000 20.87291  ? 110 SER A HG   1 
ATOM   1819 N N    . GLN A 1 111 ? 6.23481   16.64843 12.15342 1.000 14.39202  ? 111 GLN A N    1 
ATOM   1820 C CA   . GLN A 1 111 ? 4.96325   15.98980 11.90980 1.000 12.93538  ? 111 GLN A CA   1 
ATOM   1821 C C    . GLN A 1 111 ? 5.18503   14.64986 11.22546 1.000 14.89850  ? 111 GLN A C    1 
ATOM   1822 O O    . GLN A 1 111 ? 6.09336   14.48297 10.40854 1.000 14.39715  ? 111 GLN A O    1 
ATOM   1823 C CB   . GLN A 1 111 ? 4.04805   16.86196 11.05696 1.000 14.63448  ? 111 GLN A CB   1 
ATOM   1824 C CG   . GLN A 1 111 ? 3.53384   18.09185 11.75588 1.000 13.72114  ? 111 GLN A CG   1 
ATOM   1825 C CD   . GLN A 1 111 ? 2.53158   18.83704 10.91444 1.000 17.67440  ? 111 GLN A CD   1 
ATOM   1826 O OE1  . GLN A 1 111 ? 1.56093   18.26066 10.42473 1.000 21.99178  ? 111 GLN A OE1  1 
ATOM   1827 N NE2  . GLN A 1 111 ? 2.76872   20.12286 10.72338 1.000 19.53520  ? 111 GLN A NE2  1 
ATOM   1828 H H    . GLN A 1 111 ? 6.43390   17.26506 11.58797 1.000 17.28303  ? 111 GLN A H    1 
ATOM   1829 H HA   . GLN A 1 111 ? 4.51630   15.83516 12.75669 1.000 15.53507  ? 111 GLN A HA   1 
ATOM   1830 H HB2  . GLN A 1 111 ? 4.54034   17.15366 10.27373 1.000 17.57399  ? 111 GLN A HB2  1 
ATOM   1831 H HB3  . GLN A 1 111 ? 3.27979   16.33417 10.78839 1.000 17.57399  ? 111 GLN A HB3  1 
ATOM   1832 H HG2  . GLN A 1 111 ? 3.10128   17.83142 12.58411 1.000 16.47798  ? 111 GLN A HG2  1 
ATOM   1833 H HG3  . GLN A 1 111 ? 4.27642   18.68739 11.94242 1.000 16.47798  ? 111 GLN A HG3  1 
ATOM   1834 H HE21 . GLN A 1 111 ? 3.46477   20.48821 11.07216 1.000 23.45485  ? 111 GLN A HE21 1 
ATOM   1835 H HE22 . GLN A 1 111 ? 2.22702   20.59437 10.25026 1.000 23.45485  ? 111 GLN A HE22 1 
ATOM   1836 N N    . PHE A 1 112 ? 4.33655   13.69116 11.57203 1.000 13.43483  ? 112 PHE A N    1 
ATOM   1837 C CA   . PHE A 1 112 ? 4.49509   12.32398 11.11731 1.000 12.54820  ? 112 PHE A CA   1 
ATOM   1838 C C    . PHE A 1 112 ? 3.11340   11.73305 10.92911 1.000 15.10880  ? 112 PHE A C    1 
ATOM   1839 O O    . PHE A 1 112 ? 2.11377   12.26318 11.42980 1.000 14.60510  ? 112 PHE A O    1 
ATOM   1840 C CB   . PHE A 1 112 ? 5.26455   11.48561 12.14261 1.000 16.00131  ? 112 PHE A CB   1 
ATOM   1841 C CG   . PHE A 1 112 ? 4.57455   11.43749 13.47370 1.000 14.28393  ? 112 PHE A CG   1 
ATOM   1842 C CD1  . PHE A 1 112 ? 3.62774   10.45932 13.73932 1.000 18.00241  ? 112 PHE A CD1  1 
ATOM   1843 C CD2  . PHE A 1 112 ? 4.81509   12.41100 14.43233 1.000 15.49067  ? 112 PHE A CD2  1 
ATOM   1844 C CE1  . PHE A 1 112 ? 2.95310   10.43103 14.94537 1.000 22.03457  ? 112 PHE A CE1  1 
ATOM   1845 C CE2  . PHE A 1 112 ? 4.14383   12.38994 15.64675 1.000 18.61042  ? 112 PHE A CE2  1 
ATOM   1846 C CZ   . PHE A 1 112 ? 3.21081   11.39812 15.90304 1.000 21.36150  ? 112 PHE A CZ   1 
ATOM   1847 H H    . PHE A 1 112 ? 3.65143   13.81209 12.07759 1.000 16.13441  ? 112 PHE A H    1 
ATOM   1848 H HA   . PHE A 1 112 ? 4.97499   12.31181 10.27443 1.000 15.07045  ? 112 PHE A HA   1 
ATOM   1849 H HB2  . PHE A 1 112 ? 5.34687   10.57737 11.81214 1.000 19.21418  ? 112 PHE A HB2  1 
ATOM   1850 H HB3  . PHE A 1 112 ? 6.14455   11.87244 12.27246 1.000 19.21418  ? 112 PHE A HB3  1 
ATOM   1851 H HD1  . PHE A 1 112 ? 3.44411   9.81291  13.09641 1.000 21.61550  ? 112 PHE A HD1  1 
ATOM   1852 H HD2  . PHE A 1 112 ? 5.43251   13.08463 14.25937 1.000 18.60141  ? 112 PHE A HD2  1 
ATOM   1853 H HE1  . PHE A 1 112 ? 2.32731   9.76394  15.11357 1.000 26.45410  ? 112 PHE A HE1  1 
ATOM   1854 H HE2  . PHE A 1 112 ? 4.31993   13.04051 16.28757 1.000 22.34512  ? 112 PHE A HE2  1 
ATOM   1855 H HZ   . PHE A 1 112 ? 2.75889   11.38175 16.71570 1.000 25.64642  ? 112 PHE A HZ   1 
ATOM   1856 N N    A PHE A 1 113 ? 3.04943   10.60017 10.27001 0.663 13.63919  ? 113 PHE A N    1 
ATOM   1857 N N    B PHE A 1 113 ? 3.07800   10.63298 10.15454 0.337 10.26284  ? 113 PHE A N    1 
ATOM   1858 C CA   A PHE A 1 113 ? 1.78529   9.90322  10.28589 0.663 15.74658  ? 113 PHE A CA   1 
ATOM   1859 C CA   B PHE A 1 113 ? 1.91339   9.78604  9.92205  0.337 10.51821  ? 113 PHE A CA   1 
ATOM   1860 C C    A PHE A 1 113 ? 2.01098   8.41865  10.45577 0.663 10.84920  ? 113 PHE A C    1 
ATOM   1861 C C    B PHE A 1 113 ? 2.11287   8.41603  10.58354 0.337 10.84648  ? 113 PHE A C    1 
ATOM   1862 O O    A PHE A 1 113 ? 3.04672   7.86409  10.07841 0.663 10.85820  ? 113 PHE A O    1 
ATOM   1863 O O    B PHE A 1 113 ? 3.23781   7.91037  10.64549 0.337 13.40880  ? 113 PHE A O    1 
ATOM   1864 C CB   A PHE A 1 113 ? 0.94748   10.17133 9.03915  0.663 17.81240  ? 113 PHE A CB   1 
ATOM   1865 C CB   B PHE A 1 113 ? 1.67107   9.50904  8.41892  0.337 19.37930  ? 113 PHE A CB   1 
ATOM   1866 C CG   A PHE A 1 113 ? 1.66186   9.92565  7.75402  0.663 21.88651  ? 113 PHE A CG   1 
ATOM   1867 C CG   B PHE A 1 113 ? 1.68274   10.72244 7.52430  0.337 23.10089  ? 113 PHE A CG   1 
ATOM   1868 C CD1  A PHE A 1 113 ? 2.42772   10.92029 7.17865  0.663 24.09118  ? 113 PHE A CD1  1 
ATOM   1869 C CD1  B PHE A 1 113 ? 0.98658   11.86726 7.85551  0.337 23.11886  ? 113 PHE A CD1  1 
ATOM   1870 C CD2  A PHE A 1 113 ? 1.53716   8.71642  7.09617  0.663 26.18140  ? 113 PHE A CD2  1 
ATOM   1871 C CD2  B PHE A 1 113 ? 2.37122   10.68930 6.31868  0.337 29.75057  ? 113 PHE A CD2  1 
ATOM   1872 C CE1  A PHE A 1 113 ? 3.07455   10.70855 5.97998  0.663 26.92277  ? 113 PHE A CE1  1 
ATOM   1873 C CE1  B PHE A 1 113 ? 0.99682   12.96610 7.01545  0.337 25.27082  ? 113 PHE A CE1  1 
ATOM   1874 C CE2  A PHE A 1 113 ? 2.17919   8.50036  5.89451  0.663 33.41398  ? 113 PHE A CE2  1 
ATOM   1875 C CE2  B PHE A 1 113 ? 2.38332   11.78119 5.47682  0.337 26.94482  ? 113 PHE A CE2  1 
ATOM   1876 C CZ   A PHE A 1 113 ? 2.94959   9.49809  5.33657  0.663 31.55649  ? 113 PHE A CZ   1 
ATOM   1877 C CZ   B PHE A 1 113 ? 1.69647   12.92176 5.82501  0.337 30.78046  ? 113 PHE A CZ   1 
ATOM   1878 H H    A PHE A 1 113 ? 3.69006   10.23318 9.82898  0.663 16.37964  ? 113 PHE A H    1 
ATOM   1879 H H    B PHE A 1 113 ? 3.76740   10.34527 9.72846  0.337 12.25237  ? 113 PHE A H    1 
ATOM   1880 H HA   A PHE A 1 113 ? 1.27649   10.21436 11.05089 0.663 18.90851  ? 113 PHE A HA   1 
ATOM   1881 H HA   B PHE A 1 113 ? 1.14573   10.24602 10.29624 0.337 12.55880  ? 113 PHE A HA   1 
ATOM   1882 H HB2  A PHE A 1 113 ? 0.16989   9.59176  9.05818  0.663 21.38749  ? 113 PHE A HB2  1 
ATOM   1883 H HB2  B PHE A 1 113 ? 2.36649   8.91112  8.10304  0.337 23.26777  ? 113 PHE A HB2  1 
ATOM   1884 H HB3  A PHE A 1 113 ? 0.66900   11.10046 9.04721  0.663 21.38749  ? 113 PHE A HB3  1 
ATOM   1885 H HB3  B PHE A 1 113 ? 0.80254   9.08800  8.32256  0.337 23.26777  ? 113 PHE A HB3  1 
ATOM   1886 H HD1  A PHE A 1 113 ? 2.50805   11.74289 7.60500  0.663 28.92203  ? 113 PHE A HD1  1 
ATOM   1887 H HD1  B PHE A 1 113 ? 0.50604   11.90016 8.65106  0.337 27.75525  ? 113 PHE A HD1  1 
ATOM   1888 H HD2  A PHE A 1 113 ? 1.01537   8.04195  7.46729  0.663 31.43030  ? 113 PHE A HD2  1 
ATOM   1889 H HD2  B PHE A 1 113 ? 2.83131   9.91858  6.07535  0.337 35.71330  ? 113 PHE A HD2  1 
ATOM   1890 H HE1  A PHE A 1 113 ? 3.59484   11.38279 5.60635  0.663 32.31994  ? 113 PHE A HE1  1 
ATOM   1891 H HE1  B PHE A 1 113 ? 0.53199   13.73597 7.25238  0.337 30.33759  ? 113 PHE A HE1  1 
ATOM   1892 H HE2  A PHE A 1 113 ? 2.09234   7.68214  5.46106  0.663 40.10939  ? 113 PHE A HE2  1 
ATOM   1893 H HE2  B PHE A 1 113 ? 2.85445   11.74699 4.67572  0.337 32.34639  ? 113 PHE A HE2  1 
ATOM   1894 H HZ   A PHE A 1 113 ? 3.38404   9.35368  4.52707  0.663 37.88041  ? 113 PHE A HZ   1 
ATOM   1895 H HZ   B PHE A 1 113 ? 1.70327   13.66074 5.26043  0.337 36.94916  ? 113 PHE A HZ   1 
ATOM   1896 N N    . ILE A 1 114 ? 1.03543   7.81511  11.10658 1.000 13.05208  ? 114 ILE A N    1 
ATOM   1897 C CA   . ILE A 1 114 ? 0.93462   6.37129  11.26295 1.000 12.77587  ? 114 ILE A CA   1 
ATOM   1898 C C    . ILE A 1 114 ? -0.04166  5.86670  10.20870 1.000 12.74799  ? 114 ILE A C    1 
ATOM   1899 O O    . ILE A 1 114 ? -1.22630  6.22309  10.23330 1.000 15.06569  ? 114 ILE A O    1 
ATOM   1900 C CB   . ILE A 1 114 ? 0.44824   5.99555  12.67007 1.000 15.73421  ? 114 ILE A CB   1 
ATOM   1901 C CG1  . ILE A 1 114 ? 1.29005   6.67785  13.74813 1.000 18.37406  ? 114 ILE A CG1  1 
ATOM   1902 C CG2  . ILE A 1 114 ? 0.46087   4.47647  12.83511 1.000 21.66314  ? 114 ILE A CG2  1 
ATOM   1903 C CD1  . ILE A 1 114 ? 0.67680   6.56810  15.13722 1.000 21.43088  ? 114 ILE A CD1  1 
ATOM   1904 H H    . ILE A 1 114 ? 0.38697   8.23332  11.48632 1.000 15.67511  ? 114 ILE A H    1 
ATOM   1905 H HA   . ILE A 1 114 ? 1.80261   5.96441  11.11485 1.000 15.34366  ? 114 ILE A HA   1 
ATOM   1906 H HB   . ILE A 1 114 ? -0.46240  6.31279  12.77491 1.000 18.89367  ? 114 ILE A HB   1 
ATOM   1907 H HG12 . ILE A 1 114 ? 2.16617   6.26234  13.77375 1.000 22.06149  ? 114 ILE A HG12 1 
ATOM   1908 H HG13 . ILE A 1 114 ? 1.37569   7.61958  13.53201 1.000 22.06149  ? 114 ILE A HG13 1 
ATOM   1909 H HG21 . ILE A 1 114 ? 0.36178   4.26015  13.77548 1.000 26.00838  ? 114 ILE A HG21 1 
ATOM   1910 H HG22 . ILE A 1 114 ? -0.27502  4.09772  12.32924 1.000 26.00838  ? 114 ILE A HG22 1 
ATOM   1911 H HG23 . ILE A 1 114 ? 1.30369   4.12972  12.50295 1.000 26.00838  ? 114 ILE A HG23 1 
ATOM   1912 H HD11 . ILE A 1 114 ? 1.20570   7.09291  15.75830 1.000 25.72967  ? 114 ILE A HD11 1 
ATOM   1913 H HD12 . ILE A 1 114 ? -0.23195  6.90614  15.10885 1.000 25.72967  ? 114 ILE A HD12 1 
ATOM   1914 H HD13 . ILE A 1 114 ? 0.67501   5.63694  15.40897 1.000 25.72967  ? 114 ILE A HD13 1 
ATOM   1915 N N    . CYS A 1 115 ? 0.44061   5.05423  9.27627  1.000 16.64742  ? 115 CYS A N    1 
ATOM   1916 C CA   . CYS A 1 115 ? -0.45251  4.51726  8.26131  1.000 17.19298  ? 115 CYS A CA   1 
ATOM   1917 C C    . CYS A 1 115 ? -1.34033  3.43509  8.85101  1.000 20.61170  ? 115 CYS A C    1 
ATOM   1918 O O    . CYS A 1 115 ? -0.88555  2.60105  9.63668  1.000 21.42149  ? 115 CYS A O    1 
ATOM   1919 C CB   . CYS A 1 115 ? 0.33517   3.92642  7.10213  1.000 18.60728  ? 115 CYS A CB   1 
ATOM   1920 S SG   . CYS A 1 115 ? 1.38244   5.10075  6.30372  1.000 22.26516  ? 115 CYS A SG   1 
ATOM   1921 H H    . CYS A 1 115 ? 1.26111   4.80489  9.21137  1.000 19.98952  ? 115 CYS A H    1 
ATOM   1922 H HA   . CYS A 1 115 ? -1.00567  5.23949  7.92474  1.000 20.64419  ? 115 CYS A HA   1 
ATOM   1923 H HB2  . CYS A 1 115 ? 0.89345   3.20700  7.43630  1.000 22.34135  ? 115 CYS A HB2  1 
ATOM   1924 H HB3  . CYS A 1 115 ? -0.28737  3.58391  6.44181  1.000 22.34135  ? 115 CYS A HB3  1 
ATOM   1925 H HG   . CYS A 1 115 ? 0.75713   6.10344  6.09493  1.000 26.73081  ? 115 CYS A HG   1 
ATOM   1926 N N    . THR A 1 116 ? -2.61107  3.43067  8.44949  1.000 16.52956  ? 116 THR A N    1 
ATOM   1927 C CA   . THR A 1 116 ? -3.52984  2.35891  8.81737  1.000 17.63186  ? 116 THR A CA   1 
ATOM   1928 C C    . THR A 1 116 ? -3.97248  1.57906  7.58908  1.000 21.10951  ? 116 THR A C    1 
ATOM   1929 O O    . THR A 1 116 ? -4.95678  0.83620  7.63882  1.000 26.21655  ? 116 THR A O    1 
ATOM   1930 C CB   . THR A 1 116 ? -4.73207  2.91175  9.58102  1.000 20.84811  ? 116 THR A CB   1 
ATOM   1931 O OG1  . THR A 1 116 ? -5.39688  3.90752  8.79970  1.000 23.23481  ? 116 THR A OG1  1 
ATOM   1932 C CG2  . THR A 1 116 ? -4.24928  3.51568  10.88850 1.000 23.61016  ? 116 THR A CG2  1 
ATOM   1933 H H    . THR A 1 116 ? -2.96515  4.04266  7.95989  1.000 19.84809  ? 116 THR A H    1 
ATOM   1934 H HA   . THR A 1 116 ? -3.07921  1.74279  9.41589  1.000 21.17085  ? 116 THR A HA   1 
ATOM   1935 H HB   . THR A 1 116 ? -5.36696  2.20324  9.77034  1.000 25.03035  ? 116 THR A HB   1 
ATOM   1936 H HG1  . THR A 1 116 ? -6.03282  4.23876  9.23727  1.000 27.89438  ? 116 THR A HG1  1 
ATOM   1937 H HG21 . THR A 1 116 ? -5.00729  3.80414  11.42058 1.000 28.34480  ? 116 THR A HG21 1 
ATOM   1938 H HG22 . THR A 1 116 ? -3.74392  2.85780  11.39120 1.000 28.34480  ? 116 THR A HG22 1 
ATOM   1939 H HG23 . THR A 1 116 ? -3.68028  4.28081  10.71040 1.000 28.34480  ? 116 THR A HG23 1 
ATOM   1940 N N    . ALA A 1 117 ? -3.24295  1.74000  6.49242  1.000 21.83433  ? 117 ALA A N    1 
ATOM   1941 C CA   . ALA A 1 117 ? -3.48167  1.02775  5.24789  1.000 30.33288  ? 117 ALA A CA   1 
ATOM   1942 C C    . ALA A 1 117 ? -2.18827  1.10319  4.45134  1.000 20.84087  ? 117 ALA A C    1 
ATOM   1943 O O    . ALA A 1 117 ? -1.28147  1.86882  4.78348  1.000 19.37619  ? 117 ALA A O    1 
ATOM   1944 C CB   . ALA A 1 117 ? -4.65659  1.62984  4.47787  1.000 31.36334  ? 117 ALA A CB   1 
ATOM   1945 H H    . ALA A 1 117 ? -2.57524  2.27971  6.44259  1.000 26.21381  ? 117 ALA A H    1 
ATOM   1946 H HA   . ALA A 1 117 ? -3.69745  0.09772  5.41930  1.000 36.41206  ? 117 ALA A HA   1 
ATOM   1947 H HB1  . ALA A 1 117 ? -4.78726  1.12806  3.65809  1.000 37.64862  ? 117 ALA A HB1  1 
ATOM   1948 H HB2  . ALA A 1 117 ? -5.45403  1.57859  5.02774  1.000 37.64862  ? 117 ALA A HB2  1 
ATOM   1949 H HB3  . ALA A 1 117 ? -4.45679  2.55610  4.27046  1.000 37.64862  ? 117 ALA A HB3  1 
ATOM   1950 N N    . LYS A 1 118 ? -2.10268  0.28971  3.40418  1.000 22.82356  ? 118 LYS A N    1 
ATOM   1951 C CA   . LYS A 1 118 ? -1.00076  0.40967  2.46000  1.000 23.93308  ? 118 LYS A CA   1 
ATOM   1952 C C    . LYS A 1 118 ? -1.18760  1.68896  1.65471  1.000 22.57609  ? 118 LYS A C    1 
ATOM   1953 O O    . LYS A 1 118 ? -2.26452  1.92693  1.09942  1.000 25.15165  ? 118 LYS A O    1 
ATOM   1954 C CB   . LYS A 1 118 ? -0.95916  -0.81117 1.54836  1.000 27.93098  ? 118 LYS A CB   1 
ATOM   1955 C CG   . LYS A 1 118 ? 0.17303   -0.80370 0.55271  1.000 30.49584  ? 118 LYS A CG   1 
ATOM   1956 C CD   . LYS A 1 118 ? 0.16354   -2.06858 -0.29208 1.000 41.44295  ? 118 LYS A CD   1 
ATOM   1957 C CE   . LYS A 1 118 ? 1.10122   -1.93947 -1.47972 1.000 50.75544  ? 118 LYS A CE   1 
ATOM   1958 N NZ   . LYS A 1 118 ? 1.21302   -3.22452 -2.22307 1.000 56.53215  ? 118 LYS A NZ   1 
ATOM   1959 H H    . LYS A 1 118 ? -2.66511  -0.33428 3.22005  1.000 27.40088  ? 118 LYS A H    1 
ATOM   1960 H HA   . LYS A 1 118 ? -0.15029  0.45243  2.92450  1.000 28.73231  ? 118 LYS A HA   1 
ATOM   1961 H HB2  . LYS A 1 118 ? -0.86214  -1.60472 2.09769  1.000 33.52979  ? 118 LYS A HB2  1 
ATOM   1962 H HB3  . LYS A 1 118 ? -1.78954  -0.85303 1.04874  1.000 33.52979  ? 118 LYS A HB3  1 
ATOM   1963 H HG2  . LYS A 1 118 ? 0.07954   -0.03958 -0.03744 1.000 36.60763  ? 118 LYS A HG2  1 
ATOM   1964 H HG3  . LYS A 1 118 ? 1.01881   -0.75640 1.02527  1.000 36.60763  ? 118 LYS A HG3  1 
ATOM   1965 H HD2  . LYS A 1 118 ? 0.45461   -2.81983 0.24811  1.000 49.74416  ? 118 LYS A HD2  1 
ATOM   1966 H HD3  . LYS A 1 118 ? -0.73340  -2.22746 -0.62548 1.000 49.74416  ? 118 LYS A HD3  1 
ATOM   1967 H HE2  . LYS A 1 118 ? 0.76075   -1.26371 -2.08662 1.000 60.91914  ? 118 LYS A HE2  1 
ATOM   1968 H HE3  . LYS A 1 118 ? 1.98460   -1.68942 -1.16663 1.000 60.91914  ? 118 LYS A HE3  1 
ATOM   1969 H HZ1  . LYS A 1 118 ? 1.76326   -3.12849 -2.91598 1.000 67.85119  ? 118 LYS A HZ1  1 
ATOM   1970 H HZ2  . LYS A 1 118 ? 1.53169   -3.85952 -1.68704 1.000 67.85119  ? 118 LYS A HZ2  1 
ATOM   1971 H HZ3  . LYS A 1 118 ? 0.41270   -3.47380 -2.52215 1.000 67.85119  ? 118 LYS A HZ3  1 
ATOM   1972 N N    . THR A 1 119 ? -0.15123  2.53140  1.61458  1.000 22.61271  ? 119 THR A N    1 
ATOM   1973 C CA   . THR A 1 119 ? -0.22335  3.83608  0.95736  1.000 20.32591  ? 119 THR A CA   1 
ATOM   1974 C C    . THR A 1 119 ? 0.94854   3.96251  -0.02405 1.000 17.25719  ? 119 THR A C    1 
ATOM   1975 O O    . THR A 1 119 ? 1.82688   4.81566  0.12865  1.000 19.68266  ? 119 THR A O    1 
ATOM   1976 C CB   . THR A 1 119 ? -0.21547  4.97377  1.98428  1.000 16.53428  ? 119 THR A CB   1 
ATOM   1977 O OG1  . THR A 1 119 ? 1.00090   4.93030  2.74108  1.000 19.40562  ? 119 THR A OG1  1 
ATOM   1978 C CG2  . THR A 1 119 ? -1.37975  4.85949  2.94910  1.000 19.80586  ? 119 THR A CG2  1 
ATOM   1979 H H    . THR A 1 119 ? 0.61524   2.36476  1.96721  1.000 27.14786  ? 119 THR A H    1 
ATOM   1980 H HA   . THR A 1 119 ? -1.04887  3.88243  0.45013  1.000 24.40370  ? 119 THR A HA   1 
ATOM   1981 H HB   . THR A 1 119 ? -0.29073  5.81647  1.50983  1.000 19.85374  ? 119 THR A HB   1 
ATOM   1982 H HG1  . THR A 1 119 ? 1.65462   5.10891  2.24474  1.000 23.29936  ? 119 THR A HG1  1 
ATOM   1983 H HG21 . THR A 1 119 ? -1.38198  5.61510  3.55733  1.000 23.77964  ? 119 THR A HG21 1 
ATOM   1984 H HG22 . THR A 1 119 ? -2.21676  4.84737  2.45905  1.000 23.77964  ? 119 THR A HG22 1 
ATOM   1985 H HG23 . THR A 1 119 ? -1.30466  4.04098  3.46419  1.000 23.77964  ? 119 THR A HG23 1 
ATOM   1986 N N    . GLU A 1 120 ? 0.93643   3.12294  -1.06279 1.000 20.51847  ? 120 GLU A N    1 
ATOM   1987 C CA   . GLU A 1 120 ? 2.08889   3.01276  -1.94986 1.000 20.04647  ? 120 GLU A CA   1 
ATOM   1988 C C    . GLU A 1 120 ? 2.34385   4.28645  -2.74796 1.000 17.98344  ? 120 GLU A C    1 
ATOM   1989 O O    . GLU A 1 120 ? 3.46962   4.49701  -3.21413 1.000 18.95239  ? 120 GLU A O    1 
ATOM   1990 C CB   . GLU A 1 120 ? 1.89460   1.82113  -2.89356 1.000 27.90008  ? 120 GLU A CB   1 
ATOM   1991 C CG   . GLU A 1 120 ? 0.74509   1.97437  -3.87902 1.000 42.29162  ? 120 GLU A CG   1 
ATOM   1992 C CD   . GLU A 1 120 ? -0.60016  1.46470  -3.36374 1.000 58.96538  ? 120 GLU A CD   1 
ATOM   1993 O OE1  . GLU A 1 120 ? -0.80741  1.36089  -2.13294 1.000 50.39248  ? 120 GLU A OE1  1 
ATOM   1994 O OE2  . GLU A 1 120 ? -1.46299  1.17145  -4.21689 1.000 59.79236  ? 120 GLU A OE2  1 
ATOM   1995 H H    . GLU A 1 120 ? 0.27735   2.61149  -1.27164 1.000 24.63478  ? 120 GLU A H    1 
ATOM   1996 H HA   . GLU A 1 120 ? 2.88218   2.85034  -1.41580 1.000 24.06837  ? 120 GLU A HA   1 
ATOM   1997 H HB2  . GLU A 1 120 ? 2.70745   1.69988  -3.40881 1.000 33.49271  ? 120 GLU A HB2  1 
ATOM   1998 H HB3  . GLU A 1 120 ? 1.71901   1.03038  -2.35992 1.000 33.49271  ? 120 GLU A HB3  1 
ATOM   1999 H HG2  . GLU A 1 120 ? 0.64072   2.91553  -4.08931 1.000 50.76256  ? 120 GLU A HG2  1 
ATOM   2000 H HG3  . GLU A 1 120 ? 0.95835   1.47632  -4.68361 1.000 50.76256  ? 120 GLU A HG3  1 
ATOM   2001 N N    . TRP A 1 121 ? 1.33095   5.13395  -2.92794 1.000 19.87530  ? 121 TRP A N    1 
ATOM   2002 C CA   . TRP A 1 121 ? 1.52416   6.36415  -3.68530 1.000 19.55922  ? 121 TRP A CA   1 
ATOM   2003 C C    . TRP A 1 121 ? 2.39432   7.37345  -2.94670 1.000 20.81739  ? 121 TRP A C    1 
ATOM   2004 O O    . TRP A 1 121 ? 2.83049   8.35486  -3.55709 1.000 21.67767  ? 121 TRP A O    1 
ATOM   2005 C CB   . TRP A 1 121 ? 0.16145   6.97210  -4.03732 1.000 25.16922  ? 121 TRP A CB   1 
ATOM   2006 C CG   . TRP A 1 121 ? -0.64147  7.35412  -2.85501 1.000 21.06764  ? 121 TRP A CG   1 
ATOM   2007 C CD1  . TRP A 1 121 ? -0.62925  8.55551  -2.22102 1.000 20.70276  ? 121 TRP A CD1  1 
ATOM   2008 C CD2  . TRP A 1 121 ? -1.58075  6.53566  -2.14973 1.000 18.73125  ? 121 TRP A CD2  1 
ATOM   2009 N NE1  . TRP A 1 121 ? -1.49383  8.53906  -1.16066 1.000 21.33938  ? 121 TRP A NE1  1 
ATOM   2010 C CE2  . TRP A 1 121 ? -2.09299  7.30989  -1.09565 1.000 20.04088  ? 121 TRP A CE2  1 
ATOM   2011 C CE3  . TRP A 1 121 ? -2.03625  5.22422  -2.30516 1.000 21.18960  ? 121 TRP A CE3  1 
ATOM   2012 C CZ2  . TRP A 1 121 ? -3.03805  6.82110  -0.20285 1.000 23.93753  ? 121 TRP A CZ2  1 
ATOM   2013 C CZ3  . TRP A 1 121 ? -2.97681  4.73933  -1.41291 1.000 26.21576  ? 121 TRP A CZ3  1 
ATOM   2014 C CH2  . TRP A 1 121 ? -3.46758  5.53670  -0.37808 1.000 26.73068  ? 121 TRP A CH2  1 
ATOM   2015 H H    . TRP A 1 121 ? 0.53423   5.01929  -2.62512 1.000 23.86297  ? 121 TRP A H    1 
ATOM   2016 H HA   . TRP A 1 121 ? 1.97291   6.16086  -4.52088 1.000 23.48368  ? 121 TRP A HA   1 
ATOM   2017 H HB2  . TRP A 1 121 ? 0.30374   7.77048  -4.56952 1.000 30.21568  ? 121 TRP A HB2  1 
ATOM   2018 H HB3  . TRP A 1 121 ? -0.34899  6.32178  -4.54470 1.000 30.21568  ? 121 TRP A HB3  1 
ATOM   2019 H HD1  . TRP A 1 121 ? -0.10836  9.28407  -2.47156 1.000 24.85593  ? 121 TRP A HD1  1 
ATOM   2020 H HE1  . TRP A 1 121 ? -1.63749  9.19433  -0.62254 1.000 25.61986  ? 121 TRP A HE1  1 
ATOM   2021 H HE3  . TRP A 1 121 ? -1.71432  4.68825  -2.99363 1.000 25.44013  ? 121 TRP A HE3  1 
ATOM   2022 H HZ2  . TRP A 1 121 ? -3.36625  7.34908  0.48883  1.000 28.73765  ? 121 TRP A HZ2  1 
ATOM   2023 H HZ3  . TRP A 1 121 ? -3.28696  3.86737  -1.50459 1.000 31.47152  ? 121 TRP A HZ3  1 
ATOM   2024 H HH2  . TRP A 1 121 ? -4.10121  5.18560  0.20514  1.000 32.08943  ? 121 TRP A HH2  1 
ATOM   2025 N N    . LEU A 1 122 ? 2.68290   7.14682  -1.66919 1.000 16.47427  ? 122 LEU A N    1 
ATOM   2026 C CA   . LEU A 1 122 ? 3.58959   8.00718  -0.92745 1.000 14.37123  ? 122 LEU A CA   1 
ATOM   2027 C C    . LEU A 1 122 ? 5.04103   7.55894  -1.03079 1.000 15.27238  ? 122 LEU A C    1 
ATOM   2028 O O    . LEU A 1 122 ? 5.93212   8.29792  -0.59878 1.000 15.27515  ? 122 LEU A O    1 
ATOM   2029 C CB   . LEU A 1 122 ? 3.15867   8.05744  0.53404  1.000 18.01846  ? 122 LEU A CB   1 
ATOM   2030 C CG   . LEU A 1 122 ? 1.72923   8.55891  0.75057  1.000 17.85747  ? 122 LEU A CG   1 
ATOM   2031 C CD1  . LEU A 1 122 ? 1.44372   8.46817  2.24374  1.000 26.50594  ? 122 LEU A CD1  1 
ATOM   2032 C CD2  . LEU A 1 122 ? 1.52720   9.96180  0.22540  1.000 19.60580  ? 122 LEU A CD2  1 
ATOM   2033 H H    . LEU A 1 122 ? 2.36235   6.49522  -1.20847 1.000 19.78173  ? 122 LEU A H    1 
ATOM   2034 H HA   . LEU A 1 122 ? 3.54241   8.90969  -1.27979 1.000 17.25808  ? 122 LEU A HA   1 
ATOM   2035 H HB2  . LEU A 1 122 ? 3.21648   7.16283  0.90449  1.000 21.63476  ? 122 LEU A HB2  1 
ATOM   2036 H HB3  . LEU A 1 122 ? 3.75585   8.65376  1.01225  1.000 21.63476  ? 122 LEU A HB3  1 
ATOM   2037 H HG   . LEU A 1 122 ? 1.09853   8.01433  0.25404  1.000 21.44158  ? 122 LEU A HG   1 
ATOM   2038 H HD11 . LEU A 1 122 ? 0.57020   8.85036  2.42204  1.000 31.81974  ? 122 LEU A HD11 1 
ATOM   2039 H HD12 . LEU A 1 122 ? 1.45795   7.53608  2.51191  1.000 31.81974  ? 122 LEU A HD12 1 
ATOM   2040 H HD13 . LEU A 1 122 ? 2.12540   8.96161  2.72617  1.000 31.81974  ? 122 LEU A HD13 1 
ATOM   2041 H HD21 . LEU A 1 122 ? 0.63798   10.26456 0.46732  1.000 23.53957  ? 122 LEU A HD21 1 
ATOM   2042 H HD22 . LEU A 1 122 ? 2.19404   10.54564 0.61955  1.000 23.53957  ? 122 LEU A HD22 1 
ATOM   2043 H HD23 . LEU A 1 122 ? 1.62295   9.95451  -0.73983 1.000 23.53957  ? 122 LEU A HD23 1 
ATOM   2044 N N    . ASP A 1 123 ? 5.30007   6.39059  -1.61797 1.000 15.68591  ? 123 ASP A N    1 
ATOM   2045 C CA   . ASP A 1 123 ? 6.66926   5.91778  -1.77731 1.000 17.34283  ? 123 ASP A CA   1 
ATOM   2046 C C    . ASP A 1 123 ? 7.49898   6.90986  -2.58545 1.000 19.51858  ? 123 ASP A C    1 
ATOM   2047 O O    . ASP A 1 123 ? 7.08360   7.37074  -3.65592 1.000 18.82660  ? 123 ASP A O    1 
ATOM   2048 C CB   . ASP A 1 123 ? 6.69337   4.55497  -2.47316 1.000 19.05483  ? 123 ASP A CB   1 
ATOM   2049 C CG   . ASP A 1 123 ? 6.18300   3.42502  -1.59952 1.000 23.35480  ? 123 ASP A CG   1 
ATOM   2050 O OD1  . ASP A 1 123 ? 5.97363   3.62656  -0.38439 1.000 20.49736  ? 123 ASP A OD1  1 
ATOM   2051 O OD2  . ASP A 1 123 ? 5.99642   2.31835  -2.14915 1.000 21.82191  ? 123 ASP A OD2  1 
ATOM   2052 H H    . ASP A 1 123 ? 4.70237   5.85700  -1.93046 1.000 18.83570  ? 123 ASP A H    1 
ATOM   2053 H HA   . ASP A 1 123 ? 7.06225   5.82475  -0.89538 1.000 20.82401  ? 123 ASP A HA   1 
ATOM   2054 H HB2  . ASP A 1 123 ? 6.13277   4.59625  -3.26368 1.000 22.87841  ? 123 ASP A HB2  1 
ATOM   2055 H HB3  . ASP A 1 123 ? 7.60684   4.34714  -2.72473 1.000 22.87841  ? 123 ASP A HB3  1 
ATOM   2056 N N    . GLY A 1 124 ? 8.69361   7.20962  -2.08260 1.000 16.37145  ? 124 GLY A N    1 
ATOM   2057 C CA   . GLY A 1 124 ? 9.59805   8.11840  -2.74585 1.000 18.73427  ? 124 GLY A CA   1 
ATOM   2058 C C    . GLY A 1 124 ? 9.31314   9.58163  -2.51513 1.000 20.57856  ? 124 GLY A C    1 
ATOM   2059 O O    . GLY A 1 124 ? 10.06023  10.42723 -3.02356 1.000 20.13761  ? 124 GLY A O    1 
ATOM   2060 H H    . GLY A 1 124 ? 9.00105   6.89003  -1.34576 1.000 19.65835  ? 124 GLY A H    1 
ATOM   2061 H HA2  . GLY A 1 124 ? 10.49958  7.94043  -2.43527 1.000 22.49374  ? 124 GLY A HA2  1 
ATOM   2062 H HA3  . GLY A 1 124 ? 9.55537   7.95619  -3.70124 1.000 22.49374  ? 124 GLY A HA3  1 
ATOM   2063 N N    A LYS A 1 125 ? 8.24496   9.91071  -1.79093 0.511 15.33909  ? 125 LYS A N    1 
ATOM   2064 N N    B LYS A 1 125 ? 8.27074   9.90546  -1.75750 0.489 14.73848  ? 125 LYS A N    1 
ATOM   2065 C CA   A LYS A 1 125 ? 7.91396   11.28190 -1.43806 0.511 17.65133  ? 125 LYS A CA   1 
ATOM   2066 C CA   B LYS A 1 125 ? 7.85783   11.26934 -1.45042 0.489 18.95586  ? 125 LYS A CA   1 
ATOM   2067 C C    A LYS A 1 125 ? 7.98436   11.54215 0.05631  0.511 15.31730  ? 125 LYS A C    1 
ATOM   2068 C C    B LYS A 1 125 ? 7.87371   11.56198 0.04146  0.489 18.78528  ? 125 LYS A C    1 
ATOM   2069 O O    A LYS A 1 125 ? 8.30134   12.66434 0.46672  0.511 14.73641  ? 125 LYS A O    1 
ATOM   2070 O O    B LYS A 1 125 ? 8.06880   12.71556 0.43005  0.489 19.08669  ? 125 LYS A O    1 
ATOM   2071 C CB   A LYS A 1 125 ? 6.49023   11.64439 -1.90498 0.511 25.20153  ? 125 LYS A CB   1 
ATOM   2072 C CB   B LYS A 1 125 ? 6.44738   11.51353 -2.02654 0.489 21.19233  ? 125 LYS A CB   1 
ATOM   2073 C CG   A LYS A 1 125 ? 6.20808   11.44655 -3.38264 0.511 29.21066  ? 125 LYS A CG   1 
ATOM   2074 C CG   B LYS A 1 125 ? 5.80666   12.87059 -1.73853 0.489 33.99723  ? 125 LYS A CG   1 
ATOM   2075 C CD   A LYS A 1 125 ? 4.82599   12.00225 -3.74939 0.511 26.92837  ? 125 LYS A CD   1 
ATOM   2076 C CD   B LYS A 1 125 ? 4.39461   12.95302 -2.35269 0.489 31.71891  ? 125 LYS A CD   1 
ATOM   2077 C CE   A LYS A 1 125 ? 4.48253   11.74697 -5.21511 0.511 45.26259  ? 125 LYS A CE   1 
ATOM   2078 C CE   B LYS A 1 125 ? 3.60586   14.17524 -1.86131 0.489 44.59483  ? 125 LYS A CE   1 
ATOM   2079 N NZ   A LYS A 1 125 ? 3.26300   12.49377 -5.65705 0.511 40.85594  ? 125 LYS A NZ   1 
ATOM   2080 N NZ   B LYS A 1 125 ? 2.57035   13.86890 -0.81695 0.489 32.34726  ? 125 LYS A NZ   1 
ATOM   2081 H HA   A LYS A 1 125 ? 8.53627   11.86990 -1.89401 0.511 21.19421  ? 125 LYS A HA   1 
ATOM   2082 H HA   B LYS A 1 125 ? 8.45370   11.90875 -1.87113 0.489 22.75964  ? 125 LYS A HA   1 
ATOM   2083 H HB2  A LYS A 1 125 ? 5.86045   11.09204 -1.41592 0.511 30.25445  ? 125 LYS A HB2  1 
ATOM   2084 H HB2  B LYS A 1 125 ? 6.49853   11.42447 -2.99109 0.489 25.44341  ? 125 LYS A HB2  1 
ATOM   2085 H HB3  A LYS A 1 125 ? 6.33457   12.58087 -1.70578 0.511 30.25445  ? 125 LYS A HB3  1 
ATOM   2086 H HB3  B LYS A 1 125 ? 5.85415   10.83817 -1.66201 0.489 25.44341  ? 125 LYS A HB3  1 
ATOM   2087 H HG2  A LYS A 1 125 ? 6.87734   11.91439 -3.90620 0.511 35.06541  ? 125 LYS A HG2  1 
ATOM   2088 H HG2  B LYS A 1 125 ? 5.73272   12.99665 -0.77961 0.489 40.80929  ? 125 LYS A HG2  1 
ATOM   2089 H HG3  A LYS A 1 125 ? 6.22519   10.49963 -3.59226 0.511 35.06541  ? 125 LYS A HG3  1 
ATOM   2090 H HG3  B LYS A 1 125 ? 6.35143   13.57421 -2.12461 0.489 40.80929  ? 125 LYS A HG3  1 
ATOM   2091 H HD2  A LYS A 1 125 ? 4.15197   11.57200 -3.20030 0.511 32.32666  ? 125 LYS A HD2  1 
ATOM   2092 H HD2  B LYS A 1 125 ? 4.47191   13.01416 -3.31768 0.489 38.07531  ? 125 LYS A HD2  1 
ATOM   2093 H HD3  A LYS A 1 125 ? 4.81557   12.96024 -3.59760 0.511 32.32666  ? 125 LYS A HD3  1 
ATOM   2094 H HD3  B LYS A 1 125 ? 3.89641   12.15705 -2.10955 0.489 38.07531  ? 125 LYS A HD3  1 
ATOM   2095 H HE2  A LYS A 1 125 ? 5.22627   12.03100 -5.76925 0.511 54.32772  ? 125 LYS A HE2  1 
ATOM   2096 H HE2  B LYS A 1 125 ? 4.22883   14.81198 -1.47743 0.489 53.52641  ? 125 LYS A HE2  1 
ATOM   2097 H HE3  A LYS A 1 125 ? 4.31727   10.79958 -5.34177 0.511 54.32772  ? 125 LYS A HE3  1 
ATOM   2098 H HE3  B LYS A 1 125 ? 3.14864   14.57361 -2.61839 0.489 53.52641  ? 125 LYS A HE3  1 
ATOM   2099 H HZ1  A LYS A 1 125 ? 2.59889   12.36107 -5.07960 0.511 49.03974  ? 125 LYS A HZ1  1 
ATOM   2100 H HZ1  B LYS A 1 125 ? 1.79493   14.24609 -1.03729 0.489 38.82933  ? 125 LYS A HZ1  1 
ATOM   2101 H HZ2  A LYS A 1 125 ? 3.43862   13.36521 -5.69999 0.511 49.03974  ? 125 LYS A HZ2  1 
ATOM   2102 H HZ2  B LYS A 1 125 ? 2.45515   12.98881 -0.75147 0.489 38.82933  ? 125 LYS A HZ2  1 
ATOM   2103 H HZ3  A LYS A 1 125 ? 3.00745   12.21065 -6.46118 0.511 49.03974  ? 125 LYS A HZ3  1 
ATOM   2104 H HZ3  B LYS A 1 125 ? 2.83151   14.18556 -0.02726 0.489 38.82933  ? 125 LYS A HZ3  1 
ATOM   2105 N N    . HIS A 1 126 ? 7.65358   10.54816 0.87673  1.000 14.79471  ? 126 HIS A N    1 
ATOM   2106 C CA   . HIS A 1 126 ? 7.70514   10.65064 2.32908  1.000 13.51559  ? 126 HIS A CA   1 
ATOM   2107 C C    . HIS A 1 126 ? 8.67973   9.61692  2.86516  1.000 15.03860  ? 126 HIS A C    1 
ATOM   2108 O O    . HIS A 1 126 ? 8.66683   8.46641  2.41755  1.000 17.61422  ? 126 HIS A O    1 
ATOM   2109 C CB   . HIS A 1 126 ? 6.31231   10.42834 2.91053  1.000 13.87266  ? 126 HIS A CB   1 
ATOM   2110 C CG   . HIS A 1 126 ? 5.32594   11.45764 2.47373  1.000 15.85362  ? 126 HIS A CG   1 
ATOM   2111 N ND1  . HIS A 1 126 ? 5.07593   12.59722 3.20560  1.000 16.73640  ? 126 HIS A ND1  1 
ATOM   2112 C CD2  . HIS A 1 126 ? 4.56858   11.55286 1.35570  1.000 17.34782  ? 126 HIS A CD2  1 
ATOM   2113 C CE1  . HIS A 1 126 ? 4.18903   13.33965 2.56896  1.000 18.71037  ? 126 HIS A CE1  1 
ATOM   2114 N NE2  . HIS A 1 126 ? 3.86298   12.72656 1.44531  1.000 19.48446  ? 126 HIS A NE2  1 
ATOM   2115 H H    . HIS A 1 126 ? 7.38663   9.77692  0.60557  1.000 17.76626  ? 126 HIS A H    1 
ATOM   2116 H HA   . HIS A 1 126 ? 8.02463   11.52561 2.59971  1.000 16.23132  ? 126 HIS A HA   1 
ATOM   2117 H HB2  . HIS A 1 126 ? 5.98635   9.56102  2.62347  1.000 16.65980  ? 126 HIS A HB2  1 
ATOM   2118 H HB3  . HIS A 1 126 ? 6.36705   10.45844 3.87851  1.000 16.65980  ? 126 HIS A HB3  1 
ATOM   2119 H HD1  . HIS A 1 126 ? 5.44040   12.79432 3.95920  1.000 20.09629  ? 126 HIS A HD1  1 
ATOM   2120 H HD2  . HIS A 1 126 ? 4.53312   10.93863 0.65830  1.000 20.82999  ? 126 HIS A HD2  1 
ATOM   2121 H HE1  . HIS A 1 126 ? 3.85140   14.15524 2.86172  1.000 22.46506  ? 126 HIS A HE1  1 
ATOM   2122 N N    . VAL A 1 127 ? 9.51292   10.02627 3.81667  1.000 15.17986  ? 127 VAL A N    1 
ATOM   2123 C CA   . VAL A 1 127 ? 10.54069  9.14970  4.36788  1.000 13.84140  ? 127 VAL A CA   1 
ATOM   2124 C C    . VAL A 1 127 ? 9.93277   8.25350  5.43546  1.000 14.11153  ? 127 VAL A C    1 
ATOM   2125 O O    . VAL A 1 127 ? 9.46062   8.73508  6.47267  1.000 14.61978  ? 127 VAL A O    1 
ATOM   2126 C CB   . VAL A 1 127 ? 11.70674  9.96144  4.94471  1.000 14.42786  ? 127 VAL A CB   1 
ATOM   2127 C CG1  . VAL A 1 127 ? 12.74022  9.04640  5.57076  1.000 17.50286  ? 127 VAL A CG1  1 
ATOM   2128 C CG2  . VAL A 1 127 ? 12.31709  10.81496 3.85802  1.000 17.73639  ? 127 VAL A CG2  1 
ATOM   2129 H H    . VAL A 1 127 ? 9.50331   10.81358 4.16259  1.000 18.22844  ? 127 VAL A H    1 
ATOM   2130 H HA   . VAL A 1 127 ? 10.87208  8.58241  3.65426  1.000 16.62229  ? 127 VAL A HA   1 
ATOM   2131 H HB   . VAL A 1 127 ? 11.37904  10.54638 5.64568  1.000 17.32604  ? 127 VAL A HB   1 
ATOM   2132 H HG11 . VAL A 1 127 ? 13.55534  9.54919  5.72463  1.000 21.01604  ? 127 VAL A HG11 1 
ATOM   2133 H HG12 . VAL A 1 127 ? 12.39536  8.70973  6.41256  1.000 21.01604  ? 127 VAL A HG12 1 
ATOM   2134 H HG13 . VAL A 1 127 ? 12.91596  8.30831  4.96641  1.000 21.01604  ? 127 VAL A HG13 1 
ATOM   2135 H HG21 . VAL A 1 127 ? 13.02191  11.35933 4.24246  1.000 21.29628  ? 127 VAL A HG21 1 
ATOM   2136 H HG22 . VAL A 1 127 ? 12.68334  10.23680 3.17063  1.000 21.29628  ? 127 VAL A HG22 1 
ATOM   2137 H HG23 . VAL A 1 127 ? 11.62883  11.38404 3.47943  1.000 21.29628  ? 127 VAL A HG23 1 
ATOM   2138 N N    . VAL A 1 128 ? 9.98430   6.94986  5.19341  1.000 15.11240  ? 128 VAL A N    1 
ATOM   2139 C CA   . VAL A 1 128 ? 9.56402   5.94420  6.16071  1.000 15.12996  ? 128 VAL A CA   1 
ATOM   2140 C C    . VAL A 1 128 ? 10.69914  5.70385  7.14010  1.000 15.33066  ? 128 VAL A C    1 
ATOM   2141 O O    . VAL A 1 128 ? 11.84439  5.48173  6.73170  1.000 17.33305  ? 128 VAL A O    1 
ATOM   2142 C CB   . VAL A 1 128 ? 9.17339   4.64390  5.44092  1.000 16.72887  ? 128 VAL A CB   1 
ATOM   2143 C CG1  . VAL A 1 128 ? 8.94230   3.53334  6.44268  1.000 17.03310  ? 128 VAL A CG1  1 
ATOM   2144 C CG2  . VAL A 1 128 ? 7.95482   4.89699  4.57459  1.000 16.85411  ? 128 VAL A CG2  1 
ATOM   2145 H H    . VAL A 1 128 ? 10.26701  6.61163  4.45499  1.000 18.14750  ? 128 VAL A H    1 
ATOM   2146 H HA   . VAL A 1 128 ? 8.79473   6.26904  6.65425  1.000 18.16856  ? 128 VAL A HA   1 
ATOM   2147 H HB   . VAL A 1 128 ? 9.89437   4.35050  4.86214  1.000 20.08726  ? 128 VAL A HB   1 
ATOM   2148 H HG11 . VAL A 1 128 ? 8.60307   2.75320  5.97662  1.000 20.45234  ? 128 VAL A HG11 1 
ATOM   2149 H HG12 . VAL A 1 128 ? 9.78299   3.31969  6.87684  1.000 20.45234  ? 128 VAL A HG12 1 
ATOM   2150 H HG13 . VAL A 1 128 ? 8.29617   3.83188  7.10168  1.000 20.45234  ? 128 VAL A HG13 1 
ATOM   2151 H HG21 . VAL A 1 128 ? 7.79300   4.11674  4.02149  1.000 20.23755  ? 128 VAL A HG21 1 
ATOM   2152 H HG22 . VAL A 1 128 ? 7.18908   5.06134  5.14689  1.000 20.23755  ? 128 VAL A HG22 1 
ATOM   2153 H HG23 . VAL A 1 128 ? 8.12107   5.67103  4.01411  1.000 20.23755  ? 128 VAL A HG23 1 
ATOM   2154 N N    . PHE A 1 129 ? 10.38542  5.70897  8.43836  1.000 13.56204  ? 129 PHE A N    1 
ATOM   2155 C CA   . PHE A 1 129 ? 11.44219  5.59045  9.43149  1.000 15.31888  ? 129 PHE A CA   1 
ATOM   2156 C C    . PHE A 1 129 ? 11.10866  4.71488  10.63273 1.000 15.50984  ? 129 PHE A C    1 
ATOM   2157 O O    . PHE A 1 129 ? 11.96091  4.57263  11.51382 1.000 17.71079  ? 129 PHE A O    1 
ATOM   2158 C CB   . PHE A 1 129 ? 11.85450  6.99510  9.92407  1.000 19.53763  ? 129 PHE A CB   1 
ATOM   2159 C CG   . PHE A 1 129 ? 10.78003  7.70297  10.69320 1.000 18.06825  ? 129 PHE A CG   1 
ATOM   2160 C CD1  . PHE A 1 129 ? 9.78539   8.41226  10.03736 1.000 15.47482  ? 129 PHE A CD1  1 
ATOM   2161 C CD2  . PHE A 1 129 ? 10.76162  7.64921  12.07671 1.000 18.94741  ? 129 PHE A CD2  1 
ATOM   2162 C CE1  . PHE A 1 129 ? 8.79087   9.05860  10.75427 1.000 16.91871  ? 129 PHE A CE1  1 
ATOM   2163 C CE2  . PHE A 1 129 ? 9.77202   8.28223  12.79565 1.000 18.85157  ? 129 PHE A CE2  1 
ATOM   2164 C CZ   . PHE A 1 129 ? 8.78746   8.99285  12.13435 1.000 19.77734  ? 129 PHE A CZ   1 
ATOM   2165 H H    . PHE A 1 129 ? 9.58909   5.77816  8.75566  1.000 16.28706  ? 129 PHE A H    1 
ATOM   2166 H HA   . PHE A 1 129 ? 12.20581  5.17501  9.00114  1.000 18.39527  ? 129 PHE A HA   1 
ATOM   2167 H HB2  . PHE A 1 129 ? 12.62643  6.90805  10.50497 1.000 23.45776  ? 129 PHE A HB2  1 
ATOM   2168 H HB3  . PHE A 1 129 ? 12.07804  7.54241  9.15506  1.000 23.45776  ? 129 PHE A HB3  1 
ATOM   2169 H HD1  . PHE A 1 129 ? 9.78561   8.45466  9.10832  1.000 18.58240  ? 129 PHE A HD1  1 
ATOM   2170 H HD2  . PHE A 1 129 ? 11.42636  7.17939  12.52647 1.000 22.74950  ? 129 PHE A HD2  1 
ATOM   2171 H HE1  . PHE A 1 129 ? 8.12828   9.53480  10.30806 1.000 20.31507  ? 129 PHE A HE1  1 
ATOM   2172 H HE2  . PHE A 1 129 ? 9.76606   8.23178  13.72426 1.000 22.63449  ? 129 PHE A HE2  1 
ATOM   2173 H HZ   . PHE A 1 129 ? 8.12262   9.42678  12.61870 1.000 23.74542  ? 129 PHE A HZ   1 
ATOM   2174 N N    . GLY A 1 130 ? 9.93580   4.10097  10.69301 1.000 15.87317  ? 130 GLY A N    1 
ATOM   2175 C CA   . GLY A 1 130 ? 9.67146   3.20157  11.80060 1.000 19.60998  ? 130 GLY A CA   1 
ATOM   2176 C C    . GLY A 1 130 ? 8.39522   2.43212  11.56584 1.000 16.15722  ? 130 GLY A C    1 
ATOM   2177 O O    . GLY A 1 130 ? 7.75675   2.54534  10.51808 1.000 17.89420  ? 130 GLY A O    1 
ATOM   2178 H H    . GLY A 1 130 ? 9.29750   4.18620  10.12300 1.000 19.06042  ? 130 GLY A H    1 
ATOM   2179 H HA2  . GLY A 1 130 ? 10.40344  2.57208  11.89466 1.000 23.54459  ? 130 GLY A HA2  1 
ATOM   2180 H HA3  . GLY A 1 130 ? 9.58395   3.70925  12.62250 1.000 23.54459  ? 130 GLY A HA3  1 
ATOM   2181 N N    A LYS A 1 131 ? 8.02024   1.64892  12.57719 0.410 17.04754  ? 131 LYS A N    1 
ATOM   2182 N N    B LYS A 1 131 ? 8.03413   1.63156  12.56138 0.590 17.04297  ? 131 LYS A N    1 
ATOM   2183 C CA   A LYS A 1 131 ? 6.84251   0.79778  12.49226 0.410 15.33053  ? 131 LYS A CA   1 
ATOM   2184 C CA   B LYS A 1 131 ? 6.79288   0.88276  12.49266 0.590 16.88187  ? 131 LYS A CA   1 
ATOM   2185 C C    A LYS A 1 131 ? 6.29750   0.54562  13.88943 0.410 20.11478  ? 131 LYS A C    1 
ATOM   2186 C C    B LYS A 1 131 ? 6.27598   0.66500  13.90301 0.590 16.01967  ? 131 LYS A C    1 
ATOM   2187 O O    A LYS A 1 131 ? 7.06791   0.41270  14.84421 0.410 19.99300  ? 131 LYS A O    1 
ATOM   2188 O O    B LYS A 1 131 ? 7.03485   0.68660  14.87666 0.590 18.44106  ? 131 LYS A O    1 
ATOM   2189 C CB   A LYS A 1 131 ? 7.17668   -0.53426 11.80589 0.410 16.32971  ? 131 LYS A CB   1 
ATOM   2190 C CB   B LYS A 1 131 ? 6.97485   -0.45691 11.76883 0.590 21.53227  ? 131 LYS A CB   1 
ATOM   2191 C CG   A LYS A 1 131 ? 5.96033   -1.38561 11.48069 0.410 29.29116  ? 131 LYS A CG   1 
ATOM   2192 C CG   B LYS A 1 131 ? 7.74503   -1.50807 12.54331 0.590 28.68948  ? 131 LYS A CG   1 
ATOM   2193 C CD   A LYS A 1 131 ? 6.32446   -2.56312 10.58924 0.410 31.94646  ? 131 LYS A CD   1 
ATOM   2194 C CD   B LYS A 1 131 ? 7.64835   -2.85526 11.83678 0.590 33.18164  ? 131 LYS A CD   1 
ATOM   2195 C CE   A LYS A 1 131 ? 5.09774   -3.39241 10.23580 0.410 39.35483  ? 131 LYS A CE   1 
ATOM   2196 C CE   B LYS A 1 131 ? 8.63088   -3.86158 12.40005 0.590 40.30981  ? 131 LYS A CE   1 
ATOM   2197 N NZ   A LYS A 1 131 ? 3.96943   -2.54527 9.75473  0.410 35.11020  ? 131 LYS A NZ   1 
ATOM   2198 N NZ   B LYS A 1 131 ? 8.83699   -4.99005 11.44737 0.590 47.44579  ? 131 LYS A NZ   1 
ATOM   2199 H H    A LYS A 1 131 ? 8.43698   1.59482  13.32753 0.410 20.46966  ? 131 LYS A H    1 
ATOM   2200 H H    B LYS A 1 131 ? 8.48912   1.50781  13.28059 0.590 20.46417  ? 131 LYS A H    1 
ATOM   2201 H HA   A LYS A 1 131 ? 6.15222   1.24833  11.98099 0.410 18.33358  ? 131 LYS A HA   1 
ATOM   2202 H HA   B LYS A 1 131 ? 6.13311   1.39776  12.00238 0.590 20.27086  ? 131 LYS A HA   1 
ATOM   2203 H HB2  A LYS A 1 131 ? 7.63723   -0.34755 10.97286 0.410 19.53260  ? 131 LYS A HB2  1 
ATOM   2204 H HB2  B LYS A 1 131 ? 6.09738   -0.82297 11.57659 0.590 25.85133  ? 131 LYS A HB2  1 
ATOM   2205 H HB3  A LYS A 1 131 ? 7.74996   -1.05119 12.39329 0.410 19.53260  ? 131 LYS A HB3  1 
ATOM   2206 H HB3  B LYS A 1 131 ? 7.45546   -0.29556 10.94186 0.590 25.85133  ? 131 LYS A HB3  1 
ATOM   2207 H HG2  A LYS A 1 131 ? 5.58172   -1.73228 12.30371 0.410 35.16200  ? 131 LYS A HG2  1 
ATOM   2208 H HG2  B LYS A 1 131 ? 8.67923   -1.25310 12.59958 0.590 34.43999  ? 131 LYS A HG2  1 
ATOM   2209 H HG3  A LYS A 1 131 ? 5.30382   -0.84338 11.01606 0.410 35.16200  ? 131 LYS A HG3  1 
ATOM   2210 H HG3  B LYS A 1 131 ? 7.37113   -1.59680 13.43395 0.590 34.43999  ? 131 LYS A HG3  1 
ATOM   2211 H HD2  A LYS A 1 131 ? 6.71786   -2.23380 9.76602  0.410 38.34836  ? 131 LYS A HD2  1 
ATOM   2212 H HD2  B LYS A 1 131 ? 6.75286   -3.21106 11.94816 0.590 39.83058  ? 131 LYS A HD2  1 
ATOM   2213 H HD3  A LYS A 1 131 ? 6.95600   -3.13471 11.05329 0.410 38.34836  ? 131 LYS A HD3  1 
ATOM   2214 H HD3  B LYS A 1 131 ? 7.84326   -2.73647 10.89402 0.590 39.83058  ? 131 LYS A HD3  1 
ATOM   2215 H HE2  A LYS A 1 131 ? 5.32793   -4.01847 9.53156  0.410 47.23841  ? 131 LYS A HE2  1 
ATOM   2216 H HE2  B LYS A 1 131 ? 9.48513   -3.42874 12.55435 0.590 48.38439  ? 131 LYS A HE2  1 
ATOM   2217 H HE3  A LYS A 1 131 ? 4.80033   -3.87390 11.02359 0.410 47.23841  ? 131 LYS A HE3  1 
ATOM   2218 H HE3  B LYS A 1 131 ? 8.28559   -4.22034 13.23250 0.590 48.38439  ? 131 LYS A HE3  1 
ATOM   2219 H HZ1  A LYS A 1 131 ? 3.34195   -3.05598 9.38385  0.410 42.14485  ? 131 LYS A HZ1  1 
ATOM   2220 H HZ1  B LYS A 1 131 ? 8.23019   -5.62493 11.59167 0.590 56.94755  ? 131 LYS A HZ1  1 
ATOM   2221 H HZ2  A LYS A 1 131 ? 4.26283   -1.96269 9.14924  0.410 42.14485  ? 131 LYS A HZ2  1 
ATOM   2222 H HZ2  B LYS A 1 131 ? 9.64935   -5.33662 11.55719 0.590 56.94755  ? 131 LYS A HZ2  1 
ATOM   2223 H HZ3  A LYS A 1 131 ? 3.61231   -2.09818 10.43640 0.410 42.14485  ? 131 LYS A HZ3  1 
ATOM   2224 H HZ3  B LYS A 1 131 ? 8.75765   -4.69968 10.60982 0.590 56.94755  ? 131 LYS A HZ3  1 
ATOM   2225 N N    . VAL A 1 132 ? 4.96976   0.42580  13.98961 1.000 18.01198  ? 132 VAL A N    1 
ATOM   2226 C CA   . VAL A 1 132 ? 4.35750   0.05524  15.25589 1.000 19.29642  ? 132 VAL A CA   1 
ATOM   2227 C C    . VAL A 1 132 ? 4.84866   -1.33797 15.61827 1.000 20.08647  ? 132 VAL A C    1 
ATOM   2228 O O    . VAL A 1 132 ? 4.79414   -2.26909 14.80208 1.000 21.03887  ? 132 VAL A O    1 
ATOM   2229 C CB   . VAL A 1 132 ? 2.82467   0.08371  15.15837 1.000 19.68834  ? 132 VAL A CB   1 
ATOM   2230 C CG1  . VAL A 1 132 ? 2.19074   -0.52382 16.41867 1.000 18.93428  ? 132 VAL A CG1  1 
ATOM   2231 C CG2  . VAL A 1 132 ? 2.33145   1.50407  14.93366 1.000 19.36296  ? 132 VAL A CG2  1 
ATOM   2232 H H    . VAL A 1 132 ? 4.42228   0.47268  13.32805 1.000 21.62699  ? 132 VAL A H    1 
ATOM   2233 H HA   . VAL A 1 132 ? 4.61952   0.68976  15.94120 1.000 23.16832  ? 132 VAL A HA   1 
ATOM   2234 H HB   . VAL A 1 132 ? 2.54882   -0.45268 14.39870 1.000 23.63862  ? 132 VAL A HB   1 
ATOM   2235 H HG11 . VAL A 1 132 ? 1.23360   -0.36787 16.39729 1.000 22.73374  ? 132 VAL A HG11 1 
ATOM   2236 H HG12 . VAL A 1 132 ? 2.37033   -1.47692 16.43445 1.000 22.73374  ? 132 VAL A HG12 1 
ATOM   2237 H HG13 . VAL A 1 132 ? 2.57730   -0.10138 17.20163 1.000 22.73374  ? 132 VAL A HG13 1 
ATOM   2238 H HG21 . VAL A 1 132 ? 1.36148   1.50411  14.92639 1.000 23.24816  ? 132 VAL A HG21 1 
ATOM   2239 H HG22 . VAL A 1 132 ? 2.65688   2.06875  15.65208 1.000 23.24816  ? 132 VAL A HG22 1 
ATOM   2240 H HG23 . VAL A 1 132 ? 2.66863   1.82451  14.08246 1.000 23.24816  ? 132 VAL A HG23 1 
ATOM   2241 N N    . LYS A 1 133 ? 5.32749   -1.48907 16.84657 1.000 19.82492  ? 133 LYS A N    1 
ATOM   2242 C CA   . LYS A 1 133 ? 5.77435   -2.76393 17.38906 1.000 23.71575  ? 133 LYS A CA   1 
ATOM   2243 C C    . LYS A 1 133 ? 4.73759   -3.39779 18.30499 1.000 25.10220  ? 133 LYS A C    1 
ATOM   2244 O O    . LYS A 1 133 ? 4.45061   -4.59231 18.18500 1.000 30.26539  ? 133 LYS A O    1 
ATOM   2245 C CB   . LYS A 1 133 ? 7.08458   -2.53100 18.14171 1.000 28.18374  ? 133 LYS A CB   1 
ATOM   2246 C CG   . LYS A 1 133 ? 7.79205   -3.75919 18.63655 1.000 46.14079  ? 133 LYS A CG   1 
ATOM   2247 C CD   . LYS A 1 133 ? 9.15185   -3.35269 19.18861 1.000 59.65025  ? 133 LYS A CD   1 
ATOM   2248 C CE   . LYS A 1 133 ? 9.83243   -4.49278 19.92087 1.000 70.64781  ? 133 LYS A CE   1 
ATOM   2249 N NZ   . LYS A 1 133 ? 11.11409  -4.04824 20.53941 1.000 77.53079  ? 133 LYS A NZ   1 
ATOM   2250 H H    . LYS A 1 133 ? 5.40634   -0.84151 17.40697 1.000 23.72684  ? 133 LYS A H    1 
ATOM   2251 H HA   . LYS A 1 133 ? 5.93711   -3.39444 16.67013 1.000 28.47151  ? 133 LYS A HA   1 
ATOM   2252 H HB2  . LYS A 1 133 ? 7.69639   -2.06876 17.54764 1.000 33.83310  ? 133 LYS A HB2  1 
ATOM   2253 H HB3  . LYS A 1 133 ? 6.89415   -1.97935 18.91652 1.000 33.83310  ? 133 LYS A HB3  1 
ATOM   2254 H HG2  . LYS A 1 133 ? 7.27582   -4.17706 19.34351 1.000 55.38157  ? 133 LYS A HG2  1 
ATOM   2255 H HG3  . LYS A 1 133 ? 7.92130   -4.38433 17.90622 1.000 55.38157  ? 133 LYS A HG3  1 
ATOM   2256 H HD2  . LYS A 1 133 ? 9.72511   -3.07882 18.45563 1.000 71.59292  ? 133 LYS A HD2  1 
ATOM   2257 H HD3  . LYS A 1 133 ? 9.03683   -2.61850 19.81202 1.000 71.59292  ? 133 LYS A HD3  1 
ATOM   2258 H HE2  . LYS A 1 133 ? 9.24917   -4.81741 20.62467 1.000 84.78998  ? 133 LYS A HE2  1 
ATOM   2259 H HE3  . LYS A 1 133 ? 10.02642  -5.20769 19.29464 1.000 84.78998  ? 133 LYS A HE3  1 
ATOM   2260 H HZ1  . LYS A 1 133 ? 11.51793  -4.73751 20.93173 1.000 93.04956  ? 133 LYS A HZ1  1 
ATOM   2261 H HZ2  . LYS A 1 133 ? 11.65363  -3.71444 19.91525 1.000 93.04956  ? 133 LYS A HZ2  1 
ATOM   2262 H HZ3  . LYS A 1 133 ? 10.95573  -3.42047 21.15009 1.000 93.04956  ? 133 LYS A HZ3  1 
ATOM   2263 N N    . GLU A 1 134 ? 4.18900   -2.62641 19.23755 1.000 22.73037  ? 134 GLU A N    1 
ATOM   2264 C CA   . GLU A 1 134 ? 3.14303   -3.10188 20.12512 1.000 23.49420  ? 134 GLU A CA   1 
ATOM   2265 C C    . GLU A 1 134 ? 2.01254   -2.09075 20.10817 1.000 21.60236  ? 134 GLU A C    1 
ATOM   2266 O O    . GLU A 1 134 ? 2.25276   -0.88927 19.97972 1.000 20.51313  ? 134 GLU A O    1 
ATOM   2267 C CB   . GLU A 1 134 ? 3.58725   -3.24434 21.56721 1.000 25.93957  ? 134 GLU A CB   1 
ATOM   2268 C CG   . GLU A 1 134 ? 4.70607   -4.18629 21.78233 1.000 42.59578  ? 134 GLU A CG   1 
ATOM   2269 C CD   . GLU A 1 134 ? 5.05147   -4.25713 23.23174 1.000 42.07272  ? 134 GLU A CD   1 
ATOM   2270 O OE1  . GLU A 1 134 ? 5.51369   -3.23445 23.77960 1.000 46.81922  ? 134 GLU A OE1  1 
ATOM   2271 O OE2  . GLU A 1 134 ? 4.81819   -5.32170 23.83014 1.000 42.33423  ? 134 GLU A OE2  1 
ATOM   2272 H H    . GLU A 1 134 ? 4.41288   -1.80763 19.37565 1.000 27.21338  ? 134 GLU A H    1 
ATOM   2273 H HA   . GLU A 1 134 ? 2.85425   -3.97270 19.81022 1.000 28.12997  ? 134 GLU A HA   1 
ATOM   2274 H HB2  . GLU A 1 134 ? 3.87250   -2.37469 21.88852 1.000 31.06445  ? 134 GLU A HB2  1 
ATOM   2275 H HB3  . GLU A 1 134 ? 2.83475   -3.56108 22.09098 1.000 31.06445  ? 134 GLU A HB3  1 
ATOM   2276 H HG2  . GLU A 1 134 ? 4.44867   -5.07166 21.48106 1.000 51.12755  ? 134 GLU A HG2  1 
ATOM   2277 H HG3  . GLU A 1 134 ? 5.48601   -3.88271 21.29198 1.000 51.12755  ? 134 GLU A HG3  1 
ATOM   2278 N N    . GLY A 1 135 ? 0.78626   -2.56869 20.27633 1.000 21.67985  ? 135 GLY A N    1 
ATOM   2279 C CA   . GLY A 1 135 ? -0.33443  -1.66457 20.40903 1.000 22.92698  ? 135 GLY A CA   1 
ATOM   2280 C C    . GLY A 1 135 ? -0.95564  -1.19752 19.11537 1.000 20.56661  ? 135 GLY A C    1 
ATOM   2281 O O    . GLY A 1 135 ? -1.55723  -0.11647 19.08373 1.000 21.22702  ? 135 GLY A O    1 
ATOM   2282 H H    . GLY A 1 135 ? 0.58406   -3.40364 20.31589 1.000 26.02843  ? 135 GLY A H    1 
ATOM   2283 H HA2  . GLY A 1 135 ? -1.02768  -2.10790 20.92262 1.000 27.52499  ? 135 GLY A HA2  1 
ATOM   2284 H HA3  . GLY A 1 135 ? -0.03839  -0.87712 20.89192 1.000 27.52499  ? 135 GLY A HA3  1 
ATOM   2285 N N    . MET A 1 136 ? -0.84077  -1.97606 18.04058 1.000 19.68492  ? 136 MET A N    1 
ATOM   2286 C CA   . MET A 1 136 ? -1.57013  -1.62319 16.82907 1.000 19.09456  ? 136 MET A CA   1 
ATOM   2287 C C    . MET A 1 136 ? -3.06798  -1.55750 17.10408 1.000 18.32215  ? 136 MET A C    1 
ATOM   2288 O O    . MET A 1 136 ? -3.78762  -0.79654 16.44504 1.000 22.31168  ? 136 MET A O    1 
ATOM   2289 C CB   . MET A 1 136 ? -1.26132  -2.62382 15.71945 1.000 24.06851  ? 136 MET A CB   1 
ATOM   2290 C CG   . MET A 1 136 ? -1.77198  -2.18613 14.37002 1.000 28.18458  ? 136 MET A CG   1 
ATOM   2291 S SD   . MET A 1 136 ? -0.94385  -0.71731 13.74768 1.000 27.98602  ? 136 MET A SD   1 
ATOM   2292 C CE   . MET A 1 136 ? -2.18202  -0.12581 12.59534 1.000 38.32434  ? 136 MET A CE   1 
ATOM   2293 H H    . MET A 1 136 ? -0.36317  -2.68943 17.98958 1.000 23.63452  ? 136 MET A H    1 
ATOM   2294 H HA   . MET A 1 136 ? -1.27091  -0.75511 16.51631 1.000 22.92609  ? 136 MET A HA   1 
ATOM   2295 H HB2  . MET A 1 136 ? -0.29982  -2.73393 15.65400 1.000 28.89483  ? 136 MET A HB2  1 
ATOM   2296 H HB3  . MET A 1 136 ? -1.67843  -3.47232 15.93619 1.000 28.89483  ? 136 MET A HB3  1 
ATOM   2297 H HG2  . MET A 1 136 ? -1.62958  -2.90254 13.73175 1.000 33.83410  ? 136 MET A HG2  1 
ATOM   2298 H HG3  . MET A 1 136 ? -2.71891  -1.98804 14.44059 1.000 33.83410  ? 136 MET A HG3  1 
ATOM   2299 H HE1  . MET A 1 136 ? -1.84351  0.66450  12.14621 1.000 46.00182  ? 136 MET A HE1  1 
ATOM   2300 H HE2  . MET A 1 136 ? -2.36685  -0.82189 11.94556 1.000 46.00182  ? 136 MET A HE2  1 
ATOM   2301 H HE3  . MET A 1 136 ? -2.99036  0.09270  13.08498 1.000 46.00182  ? 136 MET A HE3  1 
ATOM   2302 N N    . ASN A 1 137 ? -3.54821  -2.32787 18.09157 1.000 17.99489  ? 137 ASN A N    1 
ATOM   2303 C CA   . ASN A 1 137 ? -4.95691  -2.27358 18.47302 1.000 21.52270  ? 137 ASN A CA   1 
ATOM   2304 C C    . ASN A 1 137 ? -5.33593  -0.90350 19.01842 1.000 18.00244  ? 137 ASN A C    1 
ATOM   2305 O O    . ASN A 1 137 ? -6.49484  -0.48441 18.90101 1.000 20.87859  ? 137 ASN A O    1 
ATOM   2306 C CB   . ASN A 1 137 ? -5.27765  -3.35497 19.51866 1.000 24.77030  ? 137 ASN A CB   1 
ATOM   2307 C CG   . ASN A 1 137 ? -4.38777  -3.27035 20.75864 1.000 23.64918  ? 137 ASN A CG   1 
ATOM   2308 O OD1  . ASN A 1 137 ? -3.16663  -3.19368 20.65239 1.000 22.36807  ? 137 ASN A OD1  1 
ATOM   2309 N ND2  . ASN A 1 137 ? -5.00248  -3.30883 21.93938 1.000 23.78242  ? 137 ASN A ND2  1 
ATOM   2310 H H    . ASN A 1 137 ? -3.07967  -2.88450 18.55009 1.000 21.60647  ? 137 ASN A H    1 
ATOM   2311 H HA   . ASN A 1 137 ? -5.49121  -2.45166 17.68326 1.000 25.83986  ? 137 ASN A HA   1 
ATOM   2312 H HB2  . ASN A 1 137 ? -6.19896  -3.25335 19.80458 1.000 29.73698  ? 137 ASN A HB2  1 
ATOM   2313 H HB3  . ASN A 1 137 ? -5.14916  -4.22884 19.11775 1.000 29.73698  ? 137 ASN A HB3  1 
ATOM   2314 H HD21 . ASN A 1 137 ? -4.54304  -3.26430 22.66501 1.000 28.55152  ? 137 ASN A HD21 1 
ATOM   2315 H HD22 . ASN A 1 137 ? -5.85888  -3.37819 21.97625 1.000 28.55152  ? 137 ASN A HD22 1 
ATOM   2316 N N    . ILE A 1 138 ? -4.38067  -0.20754 19.63984 1.000 18.62032  ? 138 ILE A N    1 
ATOM   2317 C CA   . ILE A 1 138 ? -4.64616  1.12876  20.15904 1.000 17.21159  ? 138 ILE A CA   1 
ATOM   2318 C C    . ILE A 1 138 ? -4.72840  2.12353  19.00880 1.000 18.41247  ? 138 ILE A C    1 
ATOM   2319 O O    . ILE A 1 138 ? -5.56578  3.03426  19.01579 1.000 18.53026  ? 138 ILE A O    1 
ATOM   2320 C CB   . ILE A 1 138 ? -3.56954  1.52540  21.18725 1.000 19.07314  ? 138 ILE A CB   1 
ATOM   2321 C CG1  . ILE A 1 138 ? -3.54824  0.53574  22.35763 1.000 19.35419  ? 138 ILE A CG1  1 
ATOM   2322 C CG2  . ILE A 1 138 ? -3.81491  2.94446  21.69775 1.000 23.99023  ? 138 ILE A CG2  1 
ATOM   2323 C CD1  . ILE A 1 138 ? -4.85732  0.43359  23.10918 1.000 23.92281  ? 138 ILE A CD1  1 
ATOM   2324 H H    . ILE A 1 138 ? -3.57782  -0.48629 19.77148 1.000 22.35700  ? 138 ILE A H    1 
ATOM   2325 H HA   . ILE A 1 138 ? -5.50108  1.12628  20.61731 1.000 20.66652  ? 138 ILE A HA   1 
ATOM   2326 H HB   . ILE A 1 138 ? -2.70656  1.49738  20.74524 1.000 22.90038  ? 138 ILE A HB   1 
ATOM   2327 H HG12 . ILE A 1 138 ? -3.33712  -0.34637 22.01381 1.000 23.23764  ? 138 ILE A HG12 1 
ATOM   2328 H HG13 . ILE A 1 138 ? -2.86795  0.81721  22.98919 1.000 23.23764  ? 138 ILE A HG13 1 
ATOM   2329 H HG21 . ILE A 1 138 ? -3.25745  3.10091  22.47599 1.000 28.80089  ? 138 ILE A HG21 1 
ATOM   2330 H HG22 . ILE A 1 138 ? -3.58903  3.57573  20.99676 1.000 28.80089  ? 138 ILE A HG22 1 
ATOM   2331 H HG23 . ILE A 1 138 ? -4.75041  3.03665  21.93703 1.000 28.80089  ? 138 ILE A HG23 1 
ATOM   2332 H HD11 . ILE A 1 138 ? -4.71780  -0.08402 23.91758 1.000 28.71998  ? 138 ILE A HD11 1 
ATOM   2333 H HD12 . ILE A 1 138 ? -5.16155  1.32620  23.33632 1.000 28.71998  ? 138 ILE A HD12 1 
ATOM   2334 H HD13 . ILE A 1 138 ? -5.51237  -0.00537 22.54426 1.000 28.71998  ? 138 ILE A HD13 1 
ATOM   2335 N N    . VAL A 1 139 ? -3.88495  1.94802  17.98760 1.000 16.54843  ? 139 VAL A N    1 
ATOM   2336 C CA   . VAL A 1 139 ? -4.01169  2.76380  16.78198 1.000 16.73124  ? 139 VAL A CA   1 
ATOM   2337 C C    . VAL A 1 139 ? -5.37197  2.53261  16.13778 1.000 18.26369  ? 139 VAL A C    1 
ATOM   2338 O O    . VAL A 1 139 ? -6.04019  3.47928  15.70872 1.000 19.08308  ? 139 VAL A O    1 
ATOM   2339 C CB   . VAL A 1 139 ? -2.86048  2.46757  15.80318 1.000 18.28806  ? 139 VAL A CB   1 
ATOM   2340 C CG1  . VAL A 1 139 ? -3.03648  3.23206  14.48829 1.000 20.86443  ? 139 VAL A CG1  1 
ATOM   2341 C CG2  . VAL A 1 139 ? -1.53392  2.84411  16.42818 1.000 23.93628  ? 139 VAL A CG2  1 
ATOM   2342 H H    . VAL A 1 139 ? -3.24422  1.37467  17.96941 1.000 19.79506  ? 139 VAL A H    1 
ATOM   2343 H HA   . VAL A 1 139 ? -3.94874  3.69879  17.03246 1.000 20.01443  ? 139 VAL A HA   1 
ATOM   2344 H HB   . VAL A 1 139 ? -2.86907  1.51756  15.60743 1.000 21.95829  ? 139 VAL A HB   1 
ATOM   2345 H HG11 . VAL A 1 139 ? -2.21455  3.17357  13.97652 1.000 25.04993  ? 139 VAL A HG11 1 
ATOM   2346 H HG12 . VAL A 1 139 ? -3.76669  2.83559  13.98778 1.000 25.04993  ? 139 VAL A HG12 1 
ATOM   2347 H HG13 . VAL A 1 139 ? -3.23712  4.16006  14.68695 1.000 25.04993  ? 139 VAL A HG13 1 
ATOM   2348 H HG21 . VAL A 1 139 ? -0.82264  2.65855  15.79528 1.000 28.73615  ? 139 VAL A HG21 1 
ATOM   2349 H HG22 . VAL A 1 139 ? -1.54447  3.78924  16.64617 1.000 28.73615  ? 139 VAL A HG22 1 
ATOM   2350 H HG23 . VAL A 1 139 ? -1.40452  2.32017  17.23418 1.000 28.73615  ? 139 VAL A HG23 1 
ATOM   2351 N N    . GLU A 1 140 ? -5.81973  1.27708  16.07956 1.000 19.18210  ? 140 GLU A N    1 
ATOM   2352 C CA   . GLU A 1 140 ? -7.13176  1.00633  15.50051 1.000 22.25507  ? 140 GLU A CA   1 
ATOM   2353 C C    . GLU A 1 140 ? -8.23262  1.68959  16.30081 1.000 24.72586  ? 140 GLU A C    1 
ATOM   2354 O O    . GLU A 1 140 ? -9.20161  2.20227  15.72712 1.000 22.13376  ? 140 GLU A O    1 
ATOM   2355 C CB   . GLU A 1 140 ? -7.36019  -0.50137 15.41977 1.000 27.12752  ? 140 GLU A CB   1 
ATOM   2356 C CG   . GLU A 1 140 ? -6.45693  -1.17584 14.39598 1.000 31.46601  ? 140 GLU A CG   1 
ATOM   2357 C CD   . GLU A 1 140 ? -6.46097  -2.69533 14.48837 1.000 49.10788  ? 140 GLU A CD   1 
ATOM   2358 O OE1  . GLU A 1 140 ? -6.99546  -3.24947 15.47346 1.000 43.60639  ? 140 GLU A OE1  1 
ATOM   2359 O OE2  . GLU A 1 140 ? -5.91861  -3.33966 13.56676 1.000 44.88512  ? 140 GLU A OE2  1 
ATOM   2360 H H    . GLU A 1 140 ? -5.39456  0.58443  16.36074 1.000 23.03113  ? 140 GLU A H    1 
ATOM   2361 H HA   . GLU A 1 140 ? -7.16393  1.35772  14.59697 1.000 26.71870  ? 140 GLU A HA   1 
ATOM   2362 H HB2  . GLU A 1 140 ? -7.17894  -0.89565 16.28729 1.000 32.56564  ? 140 GLU A HB2  1 
ATOM   2363 H HB3  . GLU A 1 140 ? -8.28115  -0.66857 15.16525 1.000 32.56564  ? 140 GLU A HB3  1 
ATOM   2364 H HG2  . GLU A 1 140 ? -6.75598  -0.93210 13.50600 1.000 37.77182  ? 140 GLU A HG2  1 
ATOM   2365 H HG3  . GLU A 1 140 ? -5.54596  -0.87278 14.53447 1.000 37.77182  ? 140 GLU A HG3  1 
ATOM   2366 N N    . ALA A 1 141 ? -8.08943  1.72384  17.62775 1.000 22.41242  ? 141 ALA A N    1 
ATOM   2367 C CA   . ALA A 1 141 ? -9.07579  2.39985  18.46246 1.000 23.26282  ? 141 ALA A CA   1 
ATOM   2368 C C    . ALA A 1 141 ? -9.07463  3.90171  18.20736 1.000 22.45732  ? 141 ALA A C    1 
ATOM   2369 O O    . ALA A 1 141 ? -10.13956 4.52853  18.15992 1.000 25.38507  ? 141 ALA A O    1 
ATOM   2370 C CB   . ALA A 1 141 ? -8.80319  2.10989  19.93840 1.000 24.32199  ? 141 ALA A CB   1 
ATOM   2371 H H    . ALA A 1 141 ? -7.43807  1.36751  18.06176 1.000 26.90752  ? 141 ALA A H    1 
ATOM   2372 H HA   . ALA A 1 141 ? -9.95628  2.05540  18.24573 1.000 27.92799  ? 141 ALA A HA   1 
ATOM   2373 H HB1  . ALA A 1 141 ? -9.47281  2.55927  20.47744 1.000 29.19900  ? 141 ALA A HB1  1 
ATOM   2374 H HB2  . ALA A 1 141 ? -8.84822  1.15219  20.08564 1.000 29.19900  ? 141 ALA A HB2  1 
ATOM   2375 H HB3  . ALA A 1 141 ? -7.91961  2.43850  20.16685 1.000 29.19900  ? 141 ALA A HB3  1 
ATOM   2376 N N    . MET A 1 142 ? -7.88864  4.49568  18.03975 1.000 20.04493  ? 142 MET A N    1 
ATOM   2377 C CA   . MET A 1 142 ? -7.81400  5.92446  17.75220 1.000 17.68879  ? 142 MET A CA   1 
ATOM   2378 C C    . MET A 1 142 ? -8.52273  6.25434  16.45294 1.000 21.11614  ? 142 MET A C    1 
ATOM   2379 O O    . MET A 1 142 ? -9.12659  7.32595  16.30943 1.000 22.01661  ? 142 MET A O    1 
ATOM   2380 C CB   . MET A 1 142 ? -6.36539  6.37304  17.62482 1.000 24.21531  ? 142 MET A CB   1 
ATOM   2381 C CG   . MET A 1 142 ? -5.57254  6.30305  18.87344 1.000 31.40668  ? 142 MET A CG   1 
ATOM   2382 S SD   . MET A 1 142 ? -3.82464  6.43918  18.48105 1.000 31.01337  ? 142 MET A SD   1 
ATOM   2383 C CE   . MET A 1 142 ? -3.78762  7.99654  17.61357 1.000 24.74988  ? 142 MET A CE   1 
ATOM   2384 H H    . MET A 1 142 ? -7.12722  4.09869  18.08709 1.000 24.06653  ? 142 MET A H    1 
ATOM   2385 H HA   . MET A 1 142 ? -8.22524  6.39139  18.49635 1.000 21.23916  ? 142 MET A HA   1 
ATOM   2386 H HB2  . MET A 1 142 ? -5.92614  5.80790  16.97016 1.000 29.07098  ? 142 MET A HB2  1 
ATOM   2387 H HB3  . MET A 1 142 ? -6.35561  7.29590  17.32627 1.000 29.07098  ? 142 MET A HB3  1 
ATOM   2388 H HG2  . MET A 1 142 ? -5.82002  7.03386  19.46128 1.000 37.70063  ? 142 MET A HG2  1 
ATOM   2389 H HG3  . MET A 1 142 ? -5.72973  5.45400  19.31538 1.000 37.70063  ? 142 MET A HG3  1 
ATOM   2390 H HE1  . MET A 1 142 ? -4.26847  7.90318  16.77633 1.000 29.71247  ? 142 MET A HE1  1 
ATOM   2391 H HE2  . MET A 1 142 ? -4.20999  8.67462  18.16376 1.000 29.71247  ? 142 MET A HE2  1 
ATOM   2392 H HE3  . MET A 1 142 ? -2.86473  8.23931  17.43968 1.000 29.71247  ? 142 MET A HE3  1 
ATOM   2393 N N    . GLU A 1 143 ? -8.39254  5.36353  15.47062 1.000 23.57495  ? 143 GLU A N    1 
ATOM   2394 C CA   . GLU A 1 143 ? -8.95441  5.59630  14.15207 1.000 26.30917  ? 143 GLU A CA   1 
ATOM   2395 C C    . GLU A 1 143 ? -10.43898 5.87953  14.23119 1.000 25.51775  ? 143 GLU A C    1 
ATOM   2396 O O    . GLU A 1 143 ? -10.97002 6.65162  13.42679 1.000 31.31457  ? 143 GLU A O    1 
ATOM   2397 C CB   . GLU A 1 143 ? -8.70408  4.37141  13.28312 1.000 36.01220  ? 143 GLU A CB   1 
ATOM   2398 C CG   . GLU A 1 143 ? -8.14377  4.66416  11.93292 1.000 46.16433  ? 143 GLU A CG   1 
ATOM   2399 C CD   . GLU A 1 143 ? -8.04703  3.42160  11.08040 1.000 25.36873  ? 143 GLU A CD   1 
ATOM   2400 O OE1  . GLU A 1 143 ? -8.16646  2.29227  11.60241 1.000 35.30818  ? 143 GLU A OE1  1 
ATOM   2401 O OE2  . GLU A 1 143 ? -7.85140  3.58255  9.86838  1.000 28.59274  ? 143 GLU A OE2  1 
ATOM   2402 H H    . GLU A 1 143 ? -7.98011  4.61263  15.54588 1.000 28.30255  ? 143 GLU A H    1 
ATOM   2403 H HA   . GLU A 1 143 ? -8.52221  6.36356  13.74536 1.000 31.58362  ? 143 GLU A HA   1 
ATOM   2404 H HB2  . GLU A 1 143 ? -8.07397  3.79325  13.74094 1.000 43.22726  ? 143 GLU A HB2  1 
ATOM   2405 H HB3  . GLU A 1 143 ? -9.54658  3.90815  13.15475 1.000 43.22726  ? 143 GLU A HB3  1 
ATOM   2406 H HG2  . GLU A 1 143 ? -8.71968  5.29927  11.47919 1.000 55.40981  ? 143 GLU A HG2  1 
ATOM   2407 H HG3  . GLU A 1 143 ? -7.25286  5.03513  12.03063 1.000 55.40981  ? 143 GLU A HG3  1 
ATOM   2408 N N    . ARG A 1 144 ? -11.12408 5.26030  15.18937 1.000 25.87057  ? 144 ARG A N    1 
ATOM   2409 C CA   . ARG A 1 144 ? -12.56947 5.38791  15.28772 1.000 29.25764  ? 144 ARG A CA   1 
ATOM   2410 C C    . ARG A 1 144 ? -13.00326 6.78533  15.69569 1.000 30.52642  ? 144 ARG A C    1 
ATOM   2411 O O    . ARG A 1 144 ? -14.18943 7.10206  15.57033 1.000 35.45359  ? 144 ARG A O    1 
ATOM   2412 C CB   . ARG A 1 144 ? -13.09735 4.33008  16.26007 1.000 41.16441  ? 144 ARG A CB   1 
ATOM   2413 C CG   . ARG A 1 144 ? -12.73314 2.90574  15.82061 1.000 54.53181  ? 144 ARG A CG   1 
ATOM   2414 C CD   . ARG A 1 144 ? -13.58898 1.83329  16.48181 1.000 73.59287  ? 144 ARG A CD   1 
ATOM   2415 N NE   . ARG A 1 144 ? -13.17565 1.53450  17.85066 1.000 86.81025  ? 144 ARG A NE   1 
ATOM   2416 C CZ   . ARG A 1 144 ? -12.39566 0.51304  18.20248 1.000 90.18314  ? 144 ARG A CZ   1 
ATOM   2417 N NH1  . ARG A 1 144 ? -12.08704 0.33200  19.47874 1.000 90.88775  ? 144 ARG A NH1  1 
ATOM   2418 N NH2  . ARG A 1 144 ? -11.92316 -0.32733 17.28983 1.000 87.57440  ? 144 ARG A NH2  1 
ATOM   2419 H H    . ARG A 1 144 ? -10.77250 4.76030  15.79435 1.000 31.05730  ? 144 ARG A H    1 
ATOM   2420 H HA   . ARG A 1 144 ? -12.97872 5.21628  14.42519 1.000 35.12178  ? 144 ARG A HA   1 
ATOM   2421 H HB2  . ARG A 1 144 ? -12.71241 4.48414  17.13699 1.000 49.40990  ? 144 ARG A HB2  1 
ATOM   2422 H HB3  . ARG A 1 144 ? -14.06409 4.39488  16.30608 1.000 49.40990  ? 144 ARG A HB3  1 
ATOM   2423 H HG2  . ARG A 1 144 ? -12.85382 2.83235  14.86095 1.000 65.45078  ? 144 ARG A HG2  1 
ATOM   2424 H HG3  . ARG A 1 144 ? -11.80748 2.73216  16.05281 1.000 65.45078  ? 144 ARG A HG3  1 
ATOM   2425 H HD2  . ARG A 1 144 ? -14.50995 2.13670  16.50766 1.000 88.32406  ? 144 ARG A HD2  1 
ATOM   2426 H HD3  . ARG A 1 144 ? -13.52364 1.01504  15.96500 1.000 88.32406  ? 144 ARG A HD3  1 
ATOM   2427 H HE   . ARG A 1 144 ? -13.45604 2.05561  18.47470 1.000 104.18491 ? 144 ARG A HE   1 
ATOM   2428 H HH11 . ARG A 1 144 ? -12.38989 0.87246  20.07522 1.000 109.07791 ? 144 ARG A HH11 1 
ATOM   2429 H HH12 . ARG A 1 144 ? -11.58394 -0.32592 19.71033 1.000 109.07791 ? 144 ARG A HH12 1 
ATOM   2430 H HH21 . ARG A 1 144 ? -12.11965 -0.21591 16.46002 1.000 105.10190 ? 144 ARG A HH21 1 
ATOM   2431 H HH22 . ARG A 1 144 ? -11.42059 -0.98315 17.52841 1.000 105.10190 ? 144 ARG A HH22 1 
ATOM   2432 N N    . PHE A 1 145 ? -12.08191 7.63674  16.13837 1.000 22.21842  ? 145 PHE A N    1 
ATOM   2433 C CA   . PHE A 1 145 ? -12.40624 9.01854  16.45738 1.000 19.36139  ? 145 PHE A CA   1 
ATOM   2434 C C    . PHE A 1 145 ? -12.09343 9.96915  15.31292 1.000 21.76851  ? 145 PHE A C    1 
ATOM   2435 O O    . PHE A 1 145 ? -12.22580 11.18457 15.47779 1.000 24.37090  ? 145 PHE A O    1 
ATOM   2436 C CB   . PHE A 1 145 ? -11.67053 9.44796  17.72474 1.000 19.67576  ? 145 PHE A CB   1 
ATOM   2437 C CG   . PHE A 1 145 ? -12.02881 8.62272  18.92331 1.000 21.67890  ? 145 PHE A CG   1 
ATOM   2438 C CD1  . PHE A 1 145 ? -13.26437 8.76084  19.52896 1.000 35.91000  ? 145 PHE A CD1  1 
ATOM   2439 C CD2  . PHE A 1 145 ? -11.14108 7.69315  19.43194 1.000 27.18524  ? 145 PHE A CD2  1 
ATOM   2440 C CE1  . PHE A 1 145 ? -13.60143 7.99087  20.62333 1.000 39.06536  ? 145 PHE A CE1  1 
ATOM   2441 C CE2  . PHE A 1 145 ? -11.47273 6.92438  20.53105 1.000 28.35436  ? 145 PHE A CE2  1 
ATOM   2442 C CZ   . PHE A 1 145 ? -12.70366 7.07143  21.12391 1.000 28.18058  ? 145 PHE A CZ   1 
ATOM   2443 H H    . PHE A 1 145 ? -11.25563 7.43298  16.26221 1.000 26.67472  ? 145 PHE A H    1 
ATOM   2444 H HA   . PHE A 1 145 ? -13.35764 9.08265  16.63519 1.000 23.24628  ? 145 PHE A HA   1 
ATOM   2445 H HB2  . PHE A 1 145 ? -10.71556 9.36212  17.57790 1.000 23.62353  ? 145 PHE A HB2  1 
ATOM   2446 H HB3  . PHE A 1 145 ? -11.89445 10.37127 17.92031 1.000 23.62353  ? 145 PHE A HB3  1 
ATOM   2447 H HD1  . PHE A 1 145 ? -13.87413 9.37876  19.19539 1.000 43.10461  ? 145 PHE A HD1  1 
ATOM   2448 H HD2  . PHE A 1 145 ? -10.30998 7.58381  19.02918 1.000 32.63490  ? 145 PHE A HD2  1 
ATOM   2449 H HE1  . PHE A 1 145 ? -14.43473 8.09204  21.02367 1.000 46.89104  ? 145 PHE A HE1  1 
ATOM   2450 H HE2  . PHE A 1 145 ? -10.86370 6.30822  20.86917 1.000 34.03784  ? 145 PHE A HE2  1 
ATOM   2451 H HZ   . PHE A 1 145 ? -12.93083 6.55204  21.86115 1.000 33.82931  ? 145 PHE A HZ   1 
ATOM   2452 N N    . GLY A 1 146 ? -11.69552 9.44580  14.15632 1.000 23.09184  ? 146 GLY A N    1 
ATOM   2453 C CA   . GLY A 1 146 ? -11.48334 10.25568 12.97840 1.000 20.11927  ? 146 GLY A CA   1 
ATOM   2454 C C    . GLY A 1 146 ? -12.75085 10.40802 12.15963 1.000 21.72407  ? 146 GLY A C    1 
ATOM   2455 O O    . GLY A 1 146 ? -13.83993 9.98339  12.54989 1.000 23.56629  ? 146 GLY A O    1 
ATOM   2456 H H    . GLY A 1 146 ? -11.54108 8.60864  14.03418 1.000 27.72282  ? 146 GLY A H    1 
ATOM   2457 H HA2  . GLY A 1 146 ? -11.18062 11.13823 13.24368 1.000 24.08006  ? 146 GLY A HA2  1 
ATOM   2458 H HA3  . GLY A 1 146 ? -10.80487 9.84339  12.42109 1.000 24.08006  ? 146 GLY A HA3  1 
ATOM   2459 N N    . SER A 1 147 ? -12.59238 11.02871 10.99348 1.000 21.27791  ? 147 SER A N    1 
ATOM   2460 C CA   . SER A 1 147 ? -13.70628 11.26815 10.08483 1.000 22.84977  ? 147 SER A CA   1 
ATOM   2461 C C    . SER A 1 147 ? -13.14028 11.43864 8.68221  1.000 21.90902  ? 147 SER A C    1 
ATOM   2462 O O    . SER A 1 147 ? -11.92748 11.53637 8.49192  1.000 20.26708  ? 147 SER A O    1 
ATOM   2463 C CB   . SER A 1 147 ? -14.51557 12.49869 10.49903 1.000 27.49167  ? 147 SER A CB   1 
ATOM   2464 O OG   . SER A 1 147 ? -13.73983 13.67684 10.37151 1.000 23.83935  ? 147 SER A OG   1 
ATOM   2465 H H    . SER A 1 147 ? -11.83885 11.32428 10.70291 1.000 25.47043  ? 147 SER A H    1 
ATOM   2466 H HA   . SER A 1 147 ? -14.29907 10.50041 10.09299 1.000 27.35666  ? 147 SER A HA   1 
ATOM   2467 H HB2  . SER A 1 147 ? -15.29590 12.57076 9.92737  1.000 33.00261  ? 147 SER A HB2  1 
ATOM   2468 H HB3  . SER A 1 147 ? -14.79002 12.39966 11.42410 1.000 33.00261  ? 147 SER A HB3  1 
ATOM   2469 H HG   . SER A 1 147 ? -12.98924 13.56706 10.73230 1.000 28.54418  ? 147 SER A HG   1 
ATOM   2470 N N    . ARG A 1 148 ? -14.03775 11.49053 7.69511  1.000 23.25127  ? 148 ARG A N    1 
ATOM   2471 C CA   . ARG A 1 148 ? -13.58003 11.54687 6.31038  1.000 22.69347  ? 148 ARG A CA   1 
ATOM   2472 C C    . ARG A 1 148 ? -12.71451 12.77297 6.04647  1.000 21.96558  ? 148 ARG A C    1 
ATOM   2473 O O    . ARG A 1 148 ? -11.77412 12.71150 5.24443  1.000 23.26251  ? 148 ARG A O    1 
ATOM   2474 C CB   . ARG A 1 148 ? -14.76289 11.56036 5.34621  1.000 24.59230  ? 148 ARG A CB   1 
ATOM   2475 C CG   . ARG A 1 148 ? -15.46705 10.24528 5.17962  1.000 29.85268  ? 148 ARG A CG   1 
ATOM   2476 C CD   . ARG A 1 148 ? -14.63426 9.25928  4.38833  1.000 32.85376  ? 148 ARG A CD   1 
ATOM   2477 N NE   . ARG A 1 148 ? -14.20884 9.76344  3.08281  1.000 32.81617  ? 148 ARG A NE   1 
ATOM   2478 C CZ   . ARG A 1 148 ? -14.95590 9.76967  1.98006  1.000 35.51706  ? 148 ARG A CZ   1 
ATOM   2479 N NH1  . ARG A 1 148 ? -16.20347 9.31227  1.99677  1.000 35.32614  ? 148 ARG A NH1  1 
ATOM   2480 N NH2  . ARG A 1 148 ? -14.44383 10.23935 0.84927  1.000 33.71412  ? 148 ARG A NH2  1 
ATOM   2481 H H    . ARG A 1 148 ? -14.89146 11.49416 7.79888  1.000 27.83846  ? 148 ARG A H    1 
ATOM   2482 H HA   . ARG A 1 148 ? -13.05344 10.74812 6.15036  1.000 27.16910  ? 148 ARG A HA   1 
ATOM   2483 H HB2  . ARG A 1 148 ? -15.41582 12.19965 5.67163  1.000 29.44769  ? 148 ARG A HB2  1 
ATOM   2484 H HB3  . ARG A 1 148 ? -14.44182 11.83014 4.47154  1.000 29.44769  ? 148 ARG A HB3  1 
ATOM   2485 H HG2  . ARG A 1 148 ? -15.64196 9.86258  6.05361  1.000 35.83582  ? 148 ARG A HG2  1 
ATOM   2486 H HG3  . ARG A 1 148 ? -16.30182 10.38658 4.70623  1.000 35.83582  ? 148 ARG A HG3  1 
ATOM   2487 H HD2  . ARG A 1 148 ? -13.83652 9.04495  4.89683  1.000 39.43713  ? 148 ARG A HD2  1 
ATOM   2488 H HD3  . ARG A 1 148 ? -15.15810 8.45666  4.23899  1.000 39.43713  ? 148 ARG A HD3  1 
ATOM   2489 H HE   . ARG A 1 148 ? -13.41211 10.08150 3.02235  1.000 39.39201  ? 148 ARG A HE   1 
ATOM   2490 H HH11 . ARG A 1 148 ? -16.53956 9.00638  2.72689  1.000 42.40398  ? 148 ARG A HH11 1 
ATOM   2491 H HH12 . ARG A 1 148 ? -16.67475 9.32215  1.27747  1.000 42.40398  ? 148 ARG A HH12 1 
ATOM   2492 H HH21 . ARG A 1 148 ? -13.63674 10.53593 0.83325  1.000 40.46956  ? 148 ARG A HH21 1 
ATOM   2493 H HH22 . ARG A 1 148 ? -14.91910 10.24712 0.13258  1.000 40.46956  ? 148 ARG A HH22 1 
ATOM   2494 N N    . ASN A 1 149 ? -13.04076 13.91239 6.65827  1.000 22.90022  ? 149 ASN A N    1 
ATOM   2495 C CA   . ASN A 1 149 ? -12.25223 15.11556 6.41720  1.000 22.72980  ? 149 ASN A CA   1 
ATOM   2496 C C    . ASN A 1 149 ? -11.10477 15.27243 7.40717  1.000 21.26881  ? 149 ASN A C    1 
ATOM   2497 O O    . ASN A 1 149 ? -10.37116 16.26237 7.33367  1.000 25.86341  ? 149 ASN A O    1 
ATOM   2498 C CB   . ASN A 1 149 ? -13.13544 16.37740 6.41451  1.000 25.04713  ? 149 ASN A CB   1 
ATOM   2499 C CG   . ASN A 1 149 ? -13.77178 16.68111 7.75628  1.000 29.94601  ? 149 ASN A CG   1 
ATOM   2500 O OD1  . ASN A 1 149 ? -13.34641 16.18839 8.79579  1.000 31.49910  ? 149 ASN A OD1  1 
ATOM   2501 N ND2  . ASN A 1 149 ? -14.79767 17.52552 7.73347  1.000 38.02764  ? 149 ASN A ND2  1 
ATOM   2502 H H    . ASN A 1 149 ? -13.69880 14.00857 7.20355  1.000 27.41720  ? 149 ASN A H    1 
ATOM   2503 H HA   . ASN A 1 149 ? -11.87083 15.05240 5.52757  1.000 27.21269  ? 149 ASN A HA   1 
ATOM   2504 H HB2  . ASN A 1 149 ? -12.58949 17.13999 6.16695  1.000 29.99350  ? 149 ASN A HB2  1 
ATOM   2505 H HB3  . ASN A 1 149 ? -13.84957 16.25716 5.76918  1.000 29.99350  ? 149 ASN A HB3  1 
ATOM   2506 H HD21 . ASN A 1 149 ? -15.19838 17.73517 8.46496  1.000 45.64577  ? 149 ASN A HD21 1 
ATOM   2507 H HD22 . ASN A 1 149 ? -15.06087 17.86232 6.98722  1.000 45.64577  ? 149 ASN A HD22 1 
ATOM   2508 N N    . GLY A 1 150 ? -10.91447 14.31566 8.30873  1.000 20.23681  ? 150 GLY A N    1 
ATOM   2509 C CA   . GLY A 1 150 ? -9.77181  14.29974 9.18548  1.000 19.25188  ? 150 GLY A CA   1 
ATOM   2510 C C    . GLY A 1 150 ? -10.00985 14.89264 10.55599 1.000 19.69209  ? 150 GLY A C    1 
ATOM   2511 O O    . GLY A 1 150 ? -9.20860  14.65228 11.46452 1.000 19.69753  ? 150 GLY A O    1 
ATOM   2512 H H    . GLY A 1 150 ? -11.45092 13.65397 8.42702  1.000 24.22111  ? 150 GLY A H    1 
ATOM   2513 H HA2  . GLY A 1 150 ? -9.48688  13.38053 9.30704  1.000 23.11487  ? 150 GLY A HA2  1 
ATOM   2514 H HA3  . GLY A 1 150 ? -9.05352  14.80043 8.76803  1.000 23.11487  ? 150 GLY A HA3  1 
ATOM   2515 N N    A LYS A 1 151 ? -11.08599 15.65071 10.73835 0.476 21.44209  ? 151 LYS A N    1 
ATOM   2516 N N    B LYS A 1 151 ? -11.07602 15.66653 10.72962 0.524 21.44189  ? 151 LYS A N    1 
ATOM   2517 C CA   A LYS A 1 151 ? -11.35702 16.24376 12.04129 0.476 22.50884  ? 151 LYS A CA   1 
ATOM   2518 C CA   B LYS A 1 151 ? -11.36573 16.22242 12.04220 0.524 22.50106  ? 151 LYS A CA   1 
ATOM   2519 C C    A LYS A 1 151 ? -11.75994 15.16121 13.03707 0.476 22.60275  ? 151 LYS A C    1 
ATOM   2520 C C    B LYS A 1 151 ? -11.68944 15.09861 13.01704 0.524 22.23570  ? 151 LYS A C    1 
ATOM   2521 O O    A LYS A 1 151 ? -12.59222 14.30230 12.73506 0.476 22.94560  ? 151 LYS A O    1 
ATOM   2522 O O    B LYS A 1 151 ? -12.38045 14.13445 12.67660 0.524 23.40045  ? 151 LYS A O    1 
ATOM   2523 C CB   A LYS A 1 151 ? -12.45394 17.30070 11.92199 0.476 25.14433  ? 151 LYS A CB   1 
ATOM   2524 C CB   B LYS A 1 151 ? -12.53037 17.20608 11.97057 0.524 25.16642  ? 151 LYS A CB   1 
ATOM   2525 C CG   A LYS A 1 151 ? -12.05986 18.48960 11.05483 0.476 25.84428  ? 151 LYS A CG   1 
ATOM   2526 C CG   B LYS A 1 151 ? -12.82188 17.90979 13.29278 0.524 37.13576  ? 151 LYS A CG   1 
ATOM   2527 C CD   A LYS A 1 151 ? -13.22572 19.44280 10.80521 0.476 42.95286  ? 151 LYS A CD   1 
ATOM   2528 C CD   B LYS A 1 151 ? -13.93870 18.93511 13.14212 0.524 49.62955  ? 151 LYS A CD   1 
ATOM   2529 C CE   A LYS A 1 151 ? -13.51231 20.32580 12.01422 0.476 45.28282  ? 151 LYS A CE   1 
ATOM   2530 C CE   B LYS A 1 151 ? -14.18906 19.69100 14.43913 0.524 52.07709  ? 151 LYS A CE   1 
ATOM   2531 N NZ   A LYS A 1 151 ? -14.53078 21.37924 11.71972 0.476 47.50570  ? 151 LYS A NZ   1 
ATOM   2532 N NZ   B LYS A 1 151 ? -15.22710 20.74563 14.26132 0.524 61.66863  ? 151 LYS A NZ   1 
ATOM   2533 H H    A LYS A 1 151 ? -11.66710 15.83444 10.13158 0.476 25.66745  ? 151 LYS A H    1 
ATOM   2534 H H    B LYS A 1 151 ? -11.63675 15.88036 10.11361 0.524 25.66721  ? 151 LYS A H    1 
ATOM   2535 H HA   A LYS A 1 151 ? -10.55633 16.67865 12.37396 0.476 26.94754  ? 151 LYS A HA   1 
ATOM   2536 H HA   B LYS A 1 151 ? -10.59173 16.70882 12.36661 0.524 26.93821  ? 151 LYS A HA   1 
ATOM   2537 H HB2  A LYS A 1 151 ? -13.24020 16.89236 11.52707 0.476 30.11013  ? 151 LYS A HB2  1 
ATOM   2538 H HB2  B LYS A 1 151 ? -12.32326 17.88725 11.31177 0.524 30.13665  ? 151 LYS A HB2  1 
ATOM   2539 H HB3  A LYS A 1 151 ? -12.66350 17.63545 12.80795 0.476 30.11013  ? 151 LYS A HB3  1 
ATOM   2540 H HB3  B LYS A 1 151 ? -13.33031 16.72384 11.70894 0.524 30.13665  ? 151 LYS A HB3  1 
ATOM   2541 H HG2  A LYS A 1 151 ? -11.35505 18.98658 11.49883 0.476 30.95008  ? 151 LYS A HG2  1 
ATOM   2542 H HG2  B LYS A 1 151 ? -13.09649 17.25394 13.95258 0.524 44.57553  ? 151 LYS A HG2  1 
ATOM   2543 H HG3  A LYS A 1 151 ? -11.74697 18.16595 10.19562 0.476 30.95008  ? 151 LYS A HG3  1 
ATOM   2544 H HG3  B LYS A 1 151 ? -12.02342 18.37023 13.59505 0.524 44.57553  ? 151 LYS A HG3  1 
ATOM   2545 H HD2  A LYS A 1 151 ? -13.01225 20.01831 10.05413 0.476 51.55605  ? 151 LYS A HD2  1 
ATOM   2546 H HD2  B LYS A 1 151 ? -13.69335 19.57792 12.45838 0.524 59.56808  ? 151 LYS A HD2  1 
ATOM   2547 H HD3  A LYS A 1 151 ? -14.02395 18.92686 10.61146 0.476 51.55605  ? 151 LYS A HD3  1 
ATOM   2548 H HD3  B LYS A 1 151 ? -14.75863 18.48126 12.89187 0.524 59.56808  ? 151 LYS A HD3  1 
ATOM   2549 H HE2  A LYS A 1 151 ? -13.84927 19.77456 12.73775 0.476 54.35200  ? 151 LYS A HE2  1 
ATOM   2550 H HE2  B LYS A 1 151 ? -14.49674 19.07084 15.11857 0.524 62.50512  ? 151 LYS A HE2  1 
ATOM   2551 H HE3  A LYS A 1 151 ? -12.69264 20.76685 12.28720 0.476 54.35200  ? 151 LYS A HE3  1 
ATOM   2552 H HE3  B LYS A 1 151 ? -13.36660 20.11717 14.72692 0.524 62.50512  ? 151 LYS A HE3  1 
ATOM   2553 H HZ1  A LYS A 1 151 ? -14.64622 21.89890 12.43297 0.476 57.01946  ? 151 LYS A HZ1  1 
ATOM   2554 H HZ1  B LYS A 1 151 ? -15.38997 21.14662 15.03900 0.524 74.01497  ? 151 LYS A HZ1  1 
ATOM   2555 H HZ2  A LYS A 1 151 ? -14.26015 21.88186 11.03691 0.476 57.01946  ? 151 LYS A HZ2  1 
ATOM   2556 H HZ2  B LYS A 1 151 ? -14.94568 21.35412 13.67596 0.524 74.01497  ? 151 LYS A HZ2  1 
ATOM   2557 H HZ3  A LYS A 1 151 ? -15.30827 21.00061 11.50933 0.476 57.01946  ? 151 LYS A HZ3  1 
ATOM   2558 H HZ3  B LYS A 1 151 ? -15.98166 20.38234 13.96006 0.524 74.01497  ? 151 LYS A HZ3  1 
ATOM   2559 N N    . THR A 1 152 ? -11.20300 15.22924 14.24101 1.000 23.39704  ? 152 THR A N    1 
ATOM   2560 C CA   . THR A 1 152 ? -11.44325 14.21615 15.25571 1.000 22.13413  ? 152 THR A CA   1 
ATOM   2561 C C    . THR A 1 152 ? -12.62120 14.65131 16.11928 1.000 25.54063  ? 152 THR A C    1 
ATOM   2562 O O    . THR A 1 152 ? -12.83264 15.84246 16.36422 1.000 28.54140  ? 152 THR A O    1 
ATOM   2563 C CB   . THR A 1 152 ? -10.20733 13.97300 16.11872 1.000 23.64094  ? 152 THR A CB   1 
ATOM   2564 O OG1  . THR A 1 152 ? -9.86304  15.16231 16.83206 1.000 24.23440  ? 152 THR A OG1  1 
ATOM   2565 C CG2  . THR A 1 152 ? -9.03094  13.56793 15.24595 1.000 26.37854  ? 152 THR A CG2  1 
ATOM   2566 H H    . THR A 1 152 ? -10.73039 15.89601 14.50869 1.000 28.08906  ? 152 THR A H    1 
ATOM   2567 H HA   . THR A 1 152 ? -11.65373 13.36895 14.83281 1.000 26.57357  ? 152 THR A HA   1 
ATOM   2568 H HB   . THR A 1 152 ? -10.39545 13.26225 16.75145 1.000 28.38174  ? 152 THR A HB   1 
ATOM   2569 H HG1  . THR A 1 152 ? -10.47707 15.36325 17.36889 1.000 29.09389  ? 152 THR A HG1  1 
ATOM   2570 H HG21 . THR A 1 152 ? -8.27402  13.32438 15.80153 1.000 31.66686  ? 152 THR A HG21 1 
ATOM   2571 H HG22 . THR A 1 152 ? -9.27357  12.80819 14.69384 1.000 31.66686  ? 152 THR A HG22 1 
ATOM   2572 H HG23 . THR A 1 152 ? -8.77483  14.30594 14.67093 1.000 31.66686  ? 152 THR A HG23 1 
ATOM   2573 N N    . SER A 1 153 ? -13.40753 13.67381 16.55445 1.000 25.87845  ? 153 SER A N    1 
ATOM   2574 C CA   . SER A 1 153 ? -14.59866 13.95159 17.34155 1.000 29.36038  ? 153 SER A CA   1 
ATOM   2575 C C    . SER A 1 153 ? -14.29384 14.11209 18.82063 1.000 29.07877  ? 153 SER A C    1 
ATOM   2576 O O    . SER A 1 153 ? -15.12107 14.66182 19.55689 1.000 31.69913  ? 153 SER A O    1 
ATOM   2577 C CB   . SER A 1 153 ? -15.63135 12.83776 17.13977 1.000 37.84647  ? 153 SER A CB   1 
ATOM   2578 O OG   . SER A 1 153 ? -15.11680 11.58106 17.53655 1.000 38.59858  ? 153 SER A OG   1 
ATOM   2579 H H    . SER A 1 153 ? -13.27110 12.83781 16.40581 1.000 31.06675  ? 153 SER A H    1 
ATOM   2580 H HA   . SER A 1 153 ? -15.00155 14.77840 17.03339 1.000 35.24507  ? 153 SER A HA   1 
ATOM   2581 H HB2  . SER A 1 153 ? -16.41679 13.03772 17.67270 1.000 45.42838  ? 153 SER A HB2  1 
ATOM   2582 H HB3  . SER A 1 153 ? -15.86944 12.79696 16.20033 1.000 45.42838  ? 153 SER A HB3  1 
ATOM   2583 H HG   . SER A 1 153 ? -15.67002 10.97473 17.35794 1.000 46.33091  ? 153 SER A HG   1 
ATOM   2584 N N    . LYS A 1 154 ? -13.12640 13.64967 19.25892 1.000 28.82744  ? 154 LYS A N    1 
ATOM   2585 C CA   . LYS A 1 154 ? -12.61267 13.88864 20.59803 1.000 31.51842  ? 154 LYS A CA   1 
ATOM   2586 C C    . LYS A 1 154 ? -11.14271 14.25798 20.47323 1.000 27.27665  ? 154 LYS A C    1 
ATOM   2587 O O    . LYS A 1 154 ? -10.51145 14.02074 19.44200 1.000 24.10439  ? 154 LYS A O    1 
ATOM   2588 C CB   . LYS A 1 154 ? -12.80484 12.66248 21.48981 1.000 30.89728  ? 154 LYS A CB   1 
ATOM   2589 C CG   . LYS A 1 154 ? -14.26856 12.38314 21.79333 1.000 40.94486  ? 154 LYS A CG   1 
ATOM   2590 C CD   . LYS A 1 154 ? -14.42580 11.27009 22.80500 1.000 51.50215  ? 154 LYS A CD   1 
ATOM   2591 C CE   . LYS A 1 154 ? -15.88862 11.06162 23.15515 1.000 65.05237  ? 154 LYS A CE   1 
ATOM   2592 N NZ   . LYS A 1 154 ? -16.04881 10.01103 24.19558 1.000 80.19421  ? 154 LYS A NZ   1 
ATOM   2593 H H    . LYS A 1 154 ? -12.59388 13.17583 18.77777 1.000 34.60555  ? 154 LYS A H    1 
ATOM   2594 H HA   . LYS A 1 154 ? -13.07615 14.62831 21.02108 1.000 37.83471  ? 154 LYS A HA   1 
ATOM   2595 H HB2  . LYS A 1 154 ? -12.43673 11.88490 21.04174 1.000 37.08935  ? 154 LYS A HB2  1 
ATOM   2596 H HB3  . LYS A 1 154 ? -12.34556 12.80870 22.33158 1.000 37.08935  ? 154 LYS A HB3  1 
ATOM   2597 H HG2  . LYS A 1 154 ? -14.67951 13.18370 22.15543 1.000 49.14644  ? 154 LYS A HG2  1 
ATOM   2598 H HG3  . LYS A 1 154 ? -14.72058 12.11837 20.97695 1.000 49.14644  ? 154 LYS A HG3  1 
ATOM   2599 H HD2  . LYS A 1 154 ? -14.07733 10.44410 22.43458 1.000 61.81520  ? 154 LYS A HD2  1 
ATOM   2600 H HD3  . LYS A 1 154 ? -13.94494 11.49897 23.61574 1.000 61.81520  ? 154 LYS A HD3  1 
ATOM   2601 H HE2  . LYS A 1 154 ? -16.25929 11.89022 23.49708 1.000 78.07545  ? 154 LYS A HE2  1 
ATOM   2602 H HE3  . LYS A 1 154 ? -16.37324 10.78367 22.36219 1.000 78.07545  ? 154 LYS A HE3  1 
ATOM   2603 H HZ1  . LYS A 1 154 ? -16.90793 9.92487  24.41141 1.000 96.24566  ? 154 LYS A HZ1  1 
ATOM   2604 H HZ2  . LYS A 1 154 ? -15.74827 9.23121  23.88954 1.000 96.24566  ? 154 LYS A HZ2  1 
ATOM   2605 H HZ3  . LYS A 1 154 ? -15.58859 10.23194 24.92462 1.000 96.24566  ? 154 LYS A HZ3  1 
ATOM   2606 N N    . LYS A 1 155 ? -10.60044 14.85645 21.52721 1.000 25.25754  ? 155 LYS A N    1 
ATOM   2607 C CA   . LYS A 1 155 ? -9.20811  15.29010 21.51190 1.000 23.45236  ? 155 LYS A CA   1 
ATOM   2608 C C    . LYS A 1 155 ? -8.31307  14.09300 21.81011 1.000 21.72306  ? 155 LYS A C    1 
ATOM   2609 O O    . LYS A 1 155 ? -8.42844  13.48041 22.87462 1.000 22.57563  ? 155 LYS A O    1 
ATOM   2610 C CB   . LYS A 1 155 ? -8.98619  16.39920 22.53447 1.000 27.56253  ? 155 LYS A CB   1 
ATOM   2611 C CG   . LYS A 1 155 ? -7.62719  17.06081 22.45208 1.000 39.92364  ? 155 LYS A CG   1 
ATOM   2612 C CD   . LYS A 1 155 ? -7.47326  17.76991 21.12808 1.000 54.85789  ? 155 LYS A CD   1 
ATOM   2613 C CE   . LYS A 1 155 ? -6.91837  19.15997 21.30933 1.000 62.02288  ? 155 LYS A CE   1 
ATOM   2614 N NZ   . LYS A 1 155 ? -6.92500  19.88039 20.01008 1.000 66.51004  ? 155 LYS A NZ   1 
ATOM   2615 H H    . LYS A 1 155 ? -11.01629 15.02263 22.26141 1.000 30.24598  ? 155 LYS A H    1 
ATOM   2616 H HA   . LYS A 1 155 ? -8.98221  15.63969 20.63574 1.000 28.07976  ? 155 LYS A HA   1 
ATOM   2617 H HB2  . LYS A 1 155 ? -9.65636  17.08663 22.39589 1.000 33.08765  ? 155 LYS A HB2  1 
ATOM   2618 H HB3  . LYS A 1 155 ? -9.07609  16.02272 23.42390 1.000 33.08765  ? 155 LYS A HB3  1 
ATOM   2619 H HG2  . LYS A 1 155 ? -7.53739  17.71201 23.16536 1.000 47.92098  ? 155 LYS A HG2  1 
ATOM   2620 H HG3  . LYS A 1 155 ? -6.93184  16.38867 22.52701 1.000 47.92098  ? 155 LYS A HG3  1 
ATOM   2621 H HD2  . LYS A 1 155 ? -6.86351  17.26904 20.56396 1.000 65.84208  ? 155 LYS A HD2  1 
ATOM   2622 H HD3  . LYS A 1 155 ? -8.34008  17.84091 20.69857 1.000 65.84208  ? 155 LYS A HD3  1 
ATOM   2623 H HE2  . LYS A 1 155 ? -7.46649  19.65130 21.94104 1.000 74.44007  ? 155 LYS A HE2  1 
ATOM   2624 H HE3  . LYS A 1 155 ? -6.00524  19.10823 21.63246 1.000 74.44007  ? 155 LYS A HE3  1 
ATOM   2625 H HZ1  . LYS A 1 155 ? -6.68315  20.72832 20.13095 1.000 79.82466  ? 155 LYS A HZ1  1 
ATOM   2626 H HZ2  . LYS A 1 155 ? -6.35499  19.49513 19.44548 1.000 79.82466  ? 155 LYS A HZ2  1 
ATOM   2627 H HZ3  . LYS A 1 155 ? -7.74093  19.86054 19.65517 1.000 79.82466  ? 155 LYS A HZ3  1 
ATOM   2628 N N    . ILE A 1 156 ? -7.43530  13.75445 20.86981 1.000 19.74651  ? 156 ILE A N    1 
ATOM   2629 C CA   . ILE A 1 156 ? -6.54547  12.60200 20.97053 1.000 19.33859  ? 156 ILE A CA   1 
ATOM   2630 C C    . ILE A 1 156 ? -5.16050  13.15852 21.26474 1.000 19.49165  ? 156 ILE A C    1 
ATOM   2631 O O    . ILE A 1 156 ? -4.58730  13.86754 20.42822 1.000 19.52989  ? 156 ILE A O    1 
ATOM   2632 C CB   . ILE A 1 156 ? -6.54446  11.76700 19.67976 1.000 17.73122  ? 156 ILE A CB   1 
ATOM   2633 C CG1  . ILE A 1 156 ? -7.96976  11.40542 19.24432 1.000 25.41035  ? 156 ILE A CG1  1 
ATOM   2634 C CG2  . ILE A 1 156 ? -5.65103  10.53378 19.83624 1.000 25.70416  ? 156 ILE A CG2  1 
ATOM   2635 C CD1  . ILE A 1 156 ? -8.76416  10.66349 20.25295 1.000 28.35477  ? 156 ILE A CD1  1 
ATOM   2636 H H    . ILE A 1 156 ? -7.33349  14.19372 20.13751 1.000 23.63276  ? 156 ILE A H    1 
ATOM   2637 H HA   . ILE A 1 156 ? -6.82388  12.02772 21.70101 1.000 23.21893  ? 156 ILE A HA   1 
ATOM   2638 H HB   . ILE A 1 156 ? -6.16960  12.30966 18.96849 1.000 21.29008  ? 156 ILE A HB   1 
ATOM   2639 H HG12 . ILE A 1 156 ? -8.44716  12.22580 19.04440 1.000 30.50504  ? 156 ILE A HG12 1 
ATOM   2640 H HG13 . ILE A 1 156 ? -7.91681  10.85052 18.45048 1.000 30.50504  ? 156 ILE A HG13 1 
ATOM   2641 H HG21 . ILE A 1 156 ? -5.81845  9.92683  19.09835 1.000 30.85760  ? 156 ILE A HG21 1 
ATOM   2642 H HG22 . ILE A 1 156 ? -4.72234  10.81377 19.83004 1.000 30.85760  ? 156 ILE A HG22 1 
ATOM   2643 H HG23 . ILE A 1 156 ? -5.85937  10.09752 20.67718 1.000 30.85760  ? 156 ILE A HG23 1 
ATOM   2644 H HD11 . ILE A 1 156 ? -9.66223  10.52986 19.91162 1.000 34.03834  ? 156 ILE A HD11 1 
ATOM   2645 H HD12 . ILE A 1 156 ? -8.34227  9.80591  20.41869 1.000 34.03834  ? 156 ILE A HD12 1 
ATOM   2646 H HD13 . ILE A 1 156 ? -8.79551  11.18069 21.07297 1.000 34.03834  ? 156 ILE A HD13 1 
ATOM   2647 N N    . THR A 1 157 ? -4.62405  12.87643 22.44999 1.000 17.67777  ? 157 THR A N    1 
ATOM   2648 C CA   . THR A 1 157 ? -3.36304  13.47568 22.84832 1.000 17.16819  ? 157 THR A CA   1 
ATOM   2649 C C    . THR A 1 157 ? -2.33104  12.42290 23.23308 1.000 18.35962  ? 157 THR A C    1 
ATOM   2650 O O    . THR A 1 157 ? -2.65689  11.29426 23.61403 1.000 17.78007  ? 157 THR A O    1 
ATOM   2651 C CB   . THR A 1 157 ? -3.52739  14.43056 24.04514 1.000 21.18709  ? 157 THR A CB   1 
ATOM   2652 O OG1  . THR A 1 157 ? -4.08723  13.70493 25.14827 1.000 24.22818  ? 157 THR A OG1  1 
ATOM   2653 C CG2  . THR A 1 157 ? -4.42576  15.60223 23.71364 1.000 22.78448  ? 157 THR A CG2  1 
ATOM   2654 H H    . THR A 1 157 ? -4.97183  12.34603 23.03080 1.000 21.15026  ? 157 THR A H    1 
ATOM   2655 H HA   . THR A 1 157 ? -3.03298  13.96681 22.07972 1.000 20.53876  ? 157 THR A HA   1 
ATOM   2656 H HB   . THR A 1 157 ? -2.65815  14.79014 24.28185 1.000 25.43712  ? 157 THR A HB   1 
ATOM   2657 H HG1  . THR A 1 157 ? -4.18125  14.21460 25.80932 1.000 29.08643  ? 157 THR A HG1  1 
ATOM   2658 H HG21 . THR A 1 157 ? -4.49567  16.19371 24.47925 1.000 27.35399  ? 157 THR A HG21 1 
ATOM   2659 H HG22 . THR A 1 157 ? -4.06065  16.09872 22.96458 1.000 27.35399  ? 157 THR A HG22 1 
ATOM   2660 H HG23 . THR A 1 157 ? -5.31186  15.28491 23.47905 1.000 27.35399  ? 157 THR A HG23 1 
ATOM   2661 N N    . ILE A 1 158 ? -1.06868  12.83216 23.13981 1.000 17.95011  ? 158 ILE A N    1 
ATOM   2662 C CA   . ILE A 1 158 ? 0.06062   12.05953 23.64236 1.000 18.10651  ? 158 ILE A CA   1 
ATOM   2663 C C    . ILE A 1 158 ? 0.25891   12.48371 25.09449 1.000 20.27306  ? 158 ILE A C    1 
ATOM   2664 O O    . ILE A 1 158 ? 0.90261   13.49405 25.37702 1.000 20.51077  ? 158 ILE A O    1 
ATOM   2665 C CB   . ILE A 1 158 ? 1.31388   12.28837 22.79537 1.000 16.19664  ? 158 ILE A CB   1 
ATOM   2666 C CG1  . ILE A 1 158 ? 1.03028   11.87852 21.34781 1.000 17.42548  ? 158 ILE A CG1  1 
ATOM   2667 C CG2  . ILE A 1 158 ? 2.49138   11.52189 23.37158 1.000 20.11056  ? 158 ILE A CG2  1 
ATOM   2668 C CD1  . ILE A 1 158 ? 2.06708   12.36003 20.36309 1.000 20.61591  ? 158 ILE A CD1  1 
ATOM   2669 H H    . ILE A 1 158 ? -0.83500  13.57672 22.77839 1.000 21.55275  ? 158 ILE A H    1 
ATOM   2670 H HA   . ILE A 1 158 ? -0.14635  11.11207 23.62287 1.000 21.74042  ? 158 ILE A HA   1 
ATOM   2671 H HB   . ILE A 1 158 ? 1.54484   13.23037 22.80897 1.000 19.44858  ? 158 ILE A HB   1 
ATOM   2672 H HG12 . ILE A 1 158 ? 1.00240   10.91020 21.29797 1.000 20.92318  ? 158 ILE A HG12 1 
ATOM   2673 H HG13 . ILE A 1 158 ? 0.17452   12.24922 21.08105 1.000 20.92318  ? 158 ILE A HG13 1 
ATOM   2674 H HG21 . ILE A 1 158 ? 3.22906   11.55669 22.74268 1.000 24.14528  ? 158 ILE A HG21 1 
ATOM   2675 H HG22 . ILE A 1 158 ? 2.75333   11.93012 24.21160 1.000 24.14528  ? 158 ILE A HG22 1 
ATOM   2676 H HG23 . ILE A 1 158 ? 2.22639   10.60066 23.51995 1.000 24.14528  ? 158 ILE A HG23 1 
ATOM   2677 H HD11 . ILE A 1 158 ? 1.80018   12.09550 19.46884 1.000 24.75170  ? 158 ILE A HD11 1 
ATOM   2678 H HD12 . ILE A 1 158 ? 2.12939   13.32650 20.41741 1.000 24.75170  ? 158 ILE A HD12 1 
ATOM   2679 H HD13 . ILE A 1 158 ? 2.92272   11.96043 20.58471 1.000 24.75170  ? 158 ILE A HD13 1 
ATOM   2680 N N    . ALA A 1 159 ? -0.31203  11.71313 26.02452 1.000 19.70727  ? 159 ALA A N    1 
ATOM   2681 C CA   . ALA A 1 159 ? -0.25988  12.10549 27.43026 1.000 20.79833  ? 159 ALA A CA   1 
ATOM   2682 C C    . ALA A 1 159 ? 1.13480   11.91615 28.01154 1.000 23.42074  ? 159 ALA A C    1 
ATOM   2683 O O    . ALA A 1 159 ? 1.54562   12.66719 28.90333 1.000 22.72379  ? 159 ALA A O    1 
ATOM   2684 C CB   . ALA A 1 159 ? -1.28751  11.31100 28.23589 1.000 21.13383  ? 159 ALA A CB   1 
ATOM   2685 H H    . ALA A 1 159 ? -0.72599  10.97536 25.86981 1.000 23.66134  ? 159 ALA A H    1 
ATOM   2686 H HA   . ALA A 1 159 ? -0.48864  13.04539 27.50208 1.000 24.97061  ? 159 ALA A HA   1 
ATOM   2687 H HB1  . ALA A 1 159 ? -1.25146  11.59622 29.16231 1.000 25.37320  ? 159 ALA A HB1  1 
ATOM   2688 H HB2  . ALA A 1 159 ? -2.17123  11.47803 27.87252 1.000 25.37320  ? 159 ALA A HB2  1 
ATOM   2689 H HB3  . ALA A 1 159 ? -1.07680  10.36631 28.17219 1.000 25.37320  ? 159 ALA A HB3  1 
ATOM   2690 N N    . ASP A 1 160 ? 1.87350   10.92918 27.51817 1.000 18.93433  ? 160 ASP A N    1 
ATOM   2691 C CA   . ASP A 1 160 ? 3.24007   10.68566 27.94749 1.000 18.22417  ? 160 ASP A CA   1 
ATOM   2692 C C    . ASP A 1 160 ? 3.95412   9.99590  26.79825 1.000 20.21035  ? 160 ASP A C    1 
ATOM   2693 O O    . ASP A 1 160 ? 3.32655   9.36174  25.94492 1.000 18.11575  ? 160 ASP A O    1 
ATOM   2694 C CB   . ASP A 1 160 ? 3.29427   9.83475  29.21896 1.000 20.78783  ? 160 ASP A CB   1 
ATOM   2695 C CG   . ASP A 1 160 ? 4.62146   9.95296  29.95039 1.000 29.20242  ? 160 ASP A CG   1 
ATOM   2696 O OD1  . ASP A 1 160 ? 5.45848   10.79338 29.56226 1.000 24.65561  ? 160 ASP A OD1  1 
ATOM   2697 O OD2  . ASP A 1 160 ? 4.82574   9.19854  30.92347 1.000 34.26510  ? 160 ASP A OD2  1 
ATOM   2698 H H    . ASP A 1 160 ? 1.59800   10.37560 26.92046 1.000 22.73381  ? 160 ASP A H    1 
ATOM   2699 H HA   . ASP A 1 160 ? 3.69285   11.51993 28.14723 1.000 21.88162  ? 160 ASP A HA   1 
ATOM   2700 H HB2  . ASP A 1 160 ? 2.59237   10.12389 29.82282 1.000 24.95800  ? 160 ASP A HB2  1 
ATOM   2701 H HB3  . ASP A 1 160 ? 3.16474   8.90323  28.98151 1.000 24.95800  ? 160 ASP A HB3  1 
ATOM   2702 N N    . CYS A 1 161 ? 5.26700   10.15014 26.76126 1.000 19.37446  ? 161 CYS A N    1 
ATOM   2703 C CA   . CYS A 1 161 ? 6.04680   9.48378  25.73490 1.000 18.90318  ? 161 CYS A CA   1 
ATOM   2704 C C    . CYS A 1 161 ? 7.48125   9.40859  26.21611 1.000 20.04408  ? 161 CYS A C    1 
ATOM   2705 O O    . CYS A 1 161 ? 7.89404   10.13839 27.12209 1.000 21.04233  ? 161 CYS A O    1 
ATOM   2706 C CB   . CYS A 1 161 ? 5.95239   10.19947 24.38374 1.000 17.07677  ? 161 CYS A CB   1 
ATOM   2707 S SG   . CYS A 1 161 ? 6.18810   11.97889 24.41449 1.000 20.29576  ? 161 CYS A SG   1 
ATOM   2708 H H    . CYS A 1 161 ? 5.72303   10.62862 27.31143 1.000 23.26197  ? 161 CYS A H    1 
ATOM   2709 H HA   . CYS A 1 161 ? 5.71437   8.58173  25.60573 1.000 22.69643  ? 161 CYS A HA   1 
ATOM   2710 H HB2  . CYS A 1 161 ? 6.63197   9.83083  23.79792 1.000 20.50474  ? 161 CYS A HB2  1 
ATOM   2711 H HB3  . CYS A 1 161 ? 5.07080   10.03389 24.01456 1.000 20.50474  ? 161 CYS A HB3  1 
ATOM   2712 H HG   . CYS A 1 161 ? 7.20364   12.22835 25.00309 1.000 24.36752  ? 161 CYS A HG   1 
ATOM   2713 N N    . GLY A 1 162 ? 8.23119   8.50491  25.60328 1.000 21.16758  ? 162 GLY A N    1 
ATOM   2714 C CA   . GLY A 1 162 ? 9.60757   8.30706  25.99438 1.000 24.18226  ? 162 GLY A CA   1 
ATOM   2715 C C    . GLY A 1 162 ? 10.19070  7.09904  25.29470 1.000 24.11140  ? 162 GLY A C    1 
ATOM   2716 O O    . GLY A 1 162 ? 9.60326   6.54670  24.36395 1.000 23.47166  ? 162 GLY A O    1 
ATOM   2717 H H    . GLY A 1 162 ? 7.96437   7.99812  24.96175 1.000 25.41371  ? 162 GLY A H    1 
ATOM   2718 H HA2  . GLY A 1 162 ? 10.13173  9.08845  25.75863 1.000 29.03132  ? 162 GLY A HA2  1 
ATOM   2719 H HA3  . GLY A 1 162 ? 9.66017   8.16900  26.95307 1.000 29.03132  ? 162 GLY A HA3  1 
ATOM   2720 N N    . GLN A 1 163 ? 11.36509  6.70637  25.76186 1.000 22.74465  ? 163 GLN A N    1 
ATOM   2721 C CA   . GLN A 1 163 ? 12.10986  5.60163  25.18044 1.000 25.85370  ? 163 GLN A CA   1 
ATOM   2722 C C    . GLN A 1 163 ? 12.02010  4.40182  26.11024 1.000 29.39472  ? 163 GLN A C    1 
ATOM   2723 O O    . GLN A 1 163 ? 12.18808  4.54513  27.32495 1.000 33.12006  ? 163 GLN A O    1 
ATOM   2724 C CB   . GLN A 1 163 ? 13.56320  6.01107  24.95464 1.000 29.12331  ? 163 GLN A CB   1 
ATOM   2725 C CG   . GLN A 1 163 ? 14.32565  5.07728  24.06494 1.000 31.61890  ? 163 GLN A CG   1 
ATOM   2726 C CD   . GLN A 1 163 ? 15.68855  5.61370  23.68671 1.000 34.56553  ? 163 GLN A CD   1 
ATOM   2727 O OE1  . GLN A 1 163 ? 15.98776  6.79504  23.87423 1.000 32.84954  ? 163 GLN A OE1  1 
ATOM   2728 N NE2  . GLN A 1 163 ? 16.52888  4.73984  23.14911 1.000 44.86877  ? 163 GLN A NE2  1 
ATOM   2729 H H    . GLN A 1 163 ? 11.76070  7.07349  26.43143 1.000 27.30619  ? 163 GLN A H    1 
ATOM   2730 H HA   . GLN A 1 163 ? 11.72989  5.34462  24.32577 1.000 31.03706  ? 163 GLN A HA   1 
ATOM   2731 H HB2  . GLN A 1 163 ? 13.57881  6.88957  24.54367 1.000 34.96059  ? 163 GLN A HB2  1 
ATOM   2732 H HB3  . GLN A 1 163 ? 14.01584  6.03785  25.81213 1.000 34.96059  ? 163 GLN A HB3  1 
ATOM   2733 H HG2  . GLN A 1 163 ? 14.45262  4.23365  24.52652 1.000 37.95529  ? 163 GLN A HG2  1 
ATOM   2734 H HG3  . GLN A 1 163 ? 13.82146  4.93608  23.24839 1.000 37.95529  ? 163 GLN A HG3  1 
ATOM   2735 H HE21 . GLN A 1 163 ? 16.28499  3.92313  23.03466 1.000 53.85514  ? 163 GLN A HE21 1 
ATOM   2736 H HE22 . GLN A 1 163 ? 17.31770  4.98988  22.91493 1.000 53.85514  ? 163 GLN A HE22 1 
ATOM   2737 N N    . LEU A 1 164 ? 11.74310  3.22916  25.54474 1.000 33.12600  ? 164 LEU A N    1 
ATOM   2738 C CA   . LEU A 1 164 ? 11.72910  1.99985  26.33198 1.000 33.78828  ? 164 LEU A CA   1 
ATOM   2739 C C    . LEU A 1 164 ? 13.07479  1.28445  26.26239 1.000 45.09202  ? 164 LEU A C    1 
ATOM   2740 O O    . LEU A 1 164 ? 13.54440  0.71109  27.24683 1.000 46.74921  ? 164 LEU A O    1 
ATOM   2741 C CB   . LEU A 1 164 ? 10.63349  1.05123  25.85404 1.000 33.53505  ? 164 LEU A CB   1 
ATOM   2742 C CG   . LEU A 1 164 ? 9.19493   1.50902  26.07573 1.000 33.85875  ? 164 LEU A CG   1 
ATOM   2743 C CD1  . LEU A 1 164 ? 8.24097   0.45633  25.52689 1.000 46.20504  ? 164 LEU A CD1  1 
ATOM   2744 C CD2  . LEU A 1 164 ? 8.92274   1.76998  27.54183 1.000 53.12262  ? 164 LEU A CD2  1 
ATOM   2745 H H    . LEU A 1 164 ? 11.56095  3.11999  24.71137 1.000 39.76381  ? 164 LEU A H    1 
ATOM   2746 H HA   . LEU A 1 164 ? 11.54720  2.23595  27.25505 1.000 40.55855  ? 164 LEU A HA   1 
ATOM   2747 H HB2  . LEU A 1 164 ? 10.74661  0.91744  24.90000 1.000 40.25467  ? 164 LEU A HB2  1 
ATOM   2748 H HB3  . LEU A 1 164 ? 10.74013  0.20839  26.32219 1.000 40.25467  ? 164 LEU A HB3  1 
ATOM   2749 H HG   . LEU A 1 164 ? 9.04624   2.34488  25.60655 1.000 40.64311  ? 164 LEU A HG   1 
ATOM   2750 H HD11 . LEU A 1 164 ? 7.32913   0.72542  25.71937 1.000 55.45866  ? 164 LEU A HD11 1 
ATOM   2751 H HD12 . LEU A 1 164 ? 8.36892   0.38335  24.56814 1.000 55.45866  ? 164 LEU A HD12 1 
ATOM   2752 H HD13 . LEU A 1 164 ? 8.43140   -0.39463 25.95174 1.000 55.45866  ? 164 LEU A HD13 1 
ATOM   2753 H HD21 . LEU A 1 164 ? 7.96627   1.86300  27.67377 1.000 63.75976  ? 164 LEU A HD21 1 
ATOM   2754 H HD22 . LEU A 1 164 ? 9.25748   1.02346  28.06293 1.000 63.75976  ? 164 LEU A HD22 1 
ATOM   2755 H HD23 . LEU A 1 164 ? 9.37412   2.58681  27.80632 1.000 63.75976  ? 164 LEU A HD23 1 
HETATM 2756 O O    . HOH B 2 .   ? 14.84306  -0.69906 28.72031 1.000 62.73721  ? 201 HOH A O    1 
HETATM 2757 O O    . HOH B 2 .   ? 1.75887   11.00265 -4.47576 1.000 61.84253  ? 202 HOH A O    1 
HETATM 2758 O O    . HOH B 2 .   ? 20.18684  14.07139 19.30492 1.000 42.32630  ? 203 HOH A O    1 
HETATM 2759 O O    . HOH B 2 .   ? 6.23643   1.89815  -4.58083 1.000 46.02498  ? 204 HOH A O    1 
HETATM 2760 O O    . HOH B 2 .   ? 3.49058   6.69397  31.16708 1.000 40.97882  ? 205 HOH A O    1 
HETATM 2761 O O    . HOH B 2 .   ? 4.97350   -1.03434 24.85293 1.000 48.14603  ? 206 HOH A O    1 
HETATM 2762 O O    . HOH B 2 .   ? 21.67234  8.72223  6.48554  1.000 43.97445  ? 207 HOH A O    1 
HETATM 2763 O O    . HOH B 2 .   ? -5.678    13.272   2.393    1.000 31.07760  ? 208 HOH A O    1 
HETATM 2764 O O    . HOH B 2 .   ? -3.02168  14.71959 27.26000 1.000 50.30551  ? 209 HOH A O    1 
HETATM 2765 O O    . HOH B 2 .   ? -2.10213  18.67341 26.13441 1.000 51.85706  ? 210 HOH A O    1 
HETATM 2766 O O    . HOH B 2 .   ? -7.68625  -0.14421 10.88749 1.000 59.65527  ? 211 HOH A O    1 
HETATM 2767 O O    . HOH B 2 .   ? 14.86768  23.31799 16.18813 1.000 41.12401  ? 212 HOH A O    1 
HETATM 2768 O O    . HOH B 2 .   ? -4.38634  -2.96314 11.47682 1.000 51.43956  ? 213 HOH A O    1 
HETATM 2769 O O    . HOH B 2 .   ? -3.54564  22.13215 8.73102  1.000 59.31023  ? 214 HOH A O    1 
HETATM 2770 O O    . HOH B 2 .   ? 3.49995   30.03500 15.43440 1.000 40.04774  ? 215 HOH A O    1 
HETATM 2771 O O    . HOH B 2 .   ? 7.32848   16.90398 9.14396  1.000 19.26056  ? 216 HOH A O    1 
HETATM 2772 O O    . HOH B 2 .   ? 10.99004  22.27202 -0.88828 1.000 39.48038  ? 217 HOH A O    1 
HETATM 2773 O O    . HOH B 2 .   ? 8.80822   22.37624 10.20943 1.000 50.86874  ? 218 HOH A O    1 
HETATM 2774 O O    . HOH B 2 .   ? 5.17420   8.78254  -4.83307 1.000 48.92312  ? 219 HOH A O    1 
HETATM 2775 O O    . HOH B 2 .   ? -7.35288  15.20518 18.31883 1.000 22.38735  ? 220 HOH A O    1 
HETATM 2776 O O    . HOH B 2 .   ? 19.83719  7.46338  14.80979 1.000 32.46728  ? 221 HOH A O    1 
HETATM 2777 O O    . HOH B 2 .   ? -4.91758  2.00611  0.79918  1.000 47.96716  ? 222 HOH A O    1 
HETATM 2778 O O    . HOH B 2 .   ? 1.18641   14.84828 18.10599 1.000 22.40186  ? 223 HOH A O    1 
HETATM 2779 O O    . HOH B 2 .   ? 20.94792  3.92330  5.15671  1.000 55.37316  ? 224 HOH A O    1 
HETATM 2780 O O    . HOH B 2 .   ? 4.34004   19.15611 23.24410 1.000 33.89201  ? 225 HOH A O    1 
HETATM 2781 O O    . HOH B 2 .   ? 17.10303  14.83108 -0.06094 1.000 25.60150  ? 226 HOH A O    1 
HETATM 2782 O O    . HOH B 2 .   ? -8.63480  2.27767  2.91792  1.000 47.01287  ? 227 HOH A O    1 
HETATM 2783 O O    . HOH B 2 .   ? -15.47090 10.10115 14.69901 1.000 41.73955  ? 228 HOH A O    1 
HETATM 2784 O O    . HOH B 2 .   ? 6.76745   20.41851 6.34830  1.000 50.67054  ? 229 HOH A O    1 
HETATM 2785 O O    . HOH B 2 .   ? 9.82177   14.71624 -0.42395 1.000 19.97531  ? 230 HOH A O    1 
HETATM 2786 O O    . HOH B 2 .   ? 7.56412   12.25331 30.44459 1.000 52.00870  ? 231 HOH A O    1 
HETATM 2787 O O    . HOH B 2 .   ? -0.31040  19.51910 19.38219 1.000 22.15650  ? 232 HOH A O    1 
HETATM 2788 O O    . HOH B 2 .   ? 9.61237   13.04603 4.04841  1.000 18.02470  ? 233 HOH A O    1 
HETATM 2789 O O    . HOH B 2 .   ? 13.76953  16.91381 22.36688 1.000 25.66685  ? 234 HOH A O    1 
HETATM 2790 O O    . HOH B 2 .   ? 20.02097  19.22267 8.76887  1.000 53.76715  ? 235 HOH A O    1 
HETATM 2791 O O    . HOH B 2 .   ? 4.72591   0.25327  -0.92177 1.000 27.54514  ? 236 HOH A O    1 
HETATM 2792 O O    . HOH B 2 .   ? 18.29531  21.43813 8.94968  1.000 41.00507  ? 237 HOH A O    1 
HETATM 2793 O O    . HOH B 2 .   ? -7.83080  18.12173 10.93750 1.000 44.57322  ? 238 HOH A O    1 
HETATM 2794 O O    . HOH B 2 .   ? 8.67127   -0.66974 4.97301  1.000 36.92353  ? 239 HOH A O    1 
HETATM 2795 O O    . HOH B 2 .   ? 20.64780  13.10206 5.43086  1.000 40.45893  ? 240 HOH A O    1 
HETATM 2796 O O    . HOH B 2 .   ? -11.75778 10.95711 3.07066  1.000 28.51817  ? 241 HOH A O    1 
HETATM 2797 O O    . HOH B 2 .   ? 3.36049   -2.59984 12.41199 1.000 49.84886  ? 242 HOH A O    1 
HETATM 2798 O O    . HOH B 2 .   ? 11.42932  5.96662  2.86304  1.000 18.79974  ? 243 HOH A O    1 
HETATM 2799 O O    . HOH B 2 .   ? -9.50455  4.30940  30.51110 1.000 56.01510  ? 244 HOH A O    1 
HETATM 2800 O O    . HOH B 2 .   ? -18.00880 8.19647  3.72369  1.000 49.21920  ? 245 HOH A O    1 
HETATM 2801 O O    . HOH B 2 .   ? -9.888    13.587   3.465    1.000 28.97186  ? 246 HOH A O    1 
HETATM 2802 O O    . HOH B 2 .   ? -7.86293  1.12308  8.66700  1.000 61.80977  ? 247 HOH A O    1 
HETATM 2803 O O    . HOH B 2 .   ? -10.17698 1.28065  13.32642 1.000 46.31873  ? 248 HOH A O    1 
HETATM 2804 O O    . HOH B 2 .   ? -0.32101  17.59968 15.74921 1.000 19.08431  ? 249 HOH A O    1 
HETATM 2805 O O    . HOH B 2 .   ? -0.05709  -4.61149 3.47824  1.000 48.46149  ? 250 HOH A O    1 
HETATM 2806 O O    . HOH B 2 .   ? -5.97361  21.71010 18.16441 1.000 49.26581  ? 251 HOH A O    1 
HETATM 2807 O O    . HOH B 2 .   ? 5.69225   26.94059 14.59454 1.000 48.10207  ? 252 HOH A O    1 
HETATM 2808 O O    . HOH B 2 .   ? 10.31307  16.65130 2.74778  1.000 17.30643  ? 253 HOH A O    1 
HETATM 2809 O O    . HOH B 2 .   ? -2.93974  18.76826 23.08579 1.000 49.48671  ? 254 HOH A O    1 
HETATM 2810 O O    . HOH B 2 .   ? 0.86371   15.35435 29.14829 1.000 44.37619  ? 255 HOH A O    1 
HETATM 2811 O O    . HOH B 2 .   ? -6.85714  13.91396 25.34867 1.000 27.79167  ? 256 HOH A O    1 
HETATM 2812 O O    . HOH B 2 .   ? 3.39028   26.88689 8.33975  1.000 51.53424  ? 257 HOH A O    1 
HETATM 2813 O O    . HOH B 2 .   ? 18.39562  7.26849  17.24955 1.000 32.24425  ? 258 HOH A O    1 
HETATM 2814 O O    . HOH B 2 .   ? -2.28337  18.38451 8.53017  1.000 36.00215  ? 259 HOH A O    1 
HETATM 2815 O O    . HOH B 2 .   ? -2.79440  6.34820  28.17358 1.000 26.82849  ? 260 HOH A O    1 
HETATM 2816 O O    . HOH B 2 .   ? -4.76206  25.11861 16.82466 1.000 23.16969  ? 261 HOH A O    1 
HETATM 2817 O O    . HOH B 2 .   ? -8.48240  0.76792  26.09589 1.000 40.40004  ? 262 HOH A O    1 
HETATM 2818 O O    . HOH B 2 .   ? 11.77062  12.36685 12.37596 1.000 21.94326  ? 263 HOH A O    1 
HETATM 2819 O O    . HOH B 2 .   ? -8.95784  17.38651 14.60183 1.000 33.66810  ? 264 HOH A O    1 
HETATM 2820 O O    . HOH B 2 .   ? 9.15206   6.27969  0.69028  1.000 20.64601  ? 265 HOH A O    1 
HETATM 2821 O O    . HOH B 2 .   ? 14.91379  21.01508 -1.85258 1.000 24.67714  ? 266 HOH A O    1 
HETATM 2822 O O    . HOH B 2 .   ? 13.21957  -1.58242 1.32490  1.000 50.01922  ? 267 HOH A O    1 
HETATM 2823 O O    . HOH B 2 .   ? 3.77634   16.88093 0.59200  1.000 33.19326  ? 268 HOH A O    1 
HETATM 2824 O O    . HOH B 2 .   ? 7.50898   23.94174 0.63364  1.000 61.43872  ? 269 HOH A O    1 
HETATM 2825 O O    . HOH B 2 .   ? 21.44868  12.86054 14.06072 1.000 38.75326  ? 270 HOH A O    1 
HETATM 2826 O O    . HOH B 2 .   ? 13.39604  14.64920 -2.08319 1.000 24.35398  ? 271 HOH A O    1 
HETATM 2827 O O    . HOH B 2 .   ? 14.33903  12.51822 6.18562  1.000 16.82620  ? 272 HOH A O    1 
HETATM 2828 O O    . HOH B 2 .   ? 20.50341  0.45756  14.88121 1.000 55.37702  ? 273 HOH A O    1 
HETATM 2829 O O    . HOH B 2 .   ? -4.20705  -1.59589 2.92985  1.000 44.33465  ? 274 HOH A O    1 
HETATM 2830 O O    . HOH B 2 .   ? -8.97194  -1.93805 18.91418 1.000 53.55198  ? 275 HOH A O    1 
HETATM 2831 O O    . HOH B 2 .   ? 7.47978   20.80278 23.57833 1.000 29.76140  ? 276 HOH A O    1 
HETATM 2832 O O    . HOH B 2 .   ? 20.91383  11.66378 3.46460  1.000 44.49829  ? 277 HOH A O    1 
HETATM 2833 O O    . HOH B 2 .   ? -9.23184  16.74117 4.70445  1.000 29.03254  ? 278 HOH A O    1 
HETATM 2834 O O    . HOH B 2 .   ? -15.31407 14.87319 13.48778 1.000 56.45723  ? 279 HOH A O    1 
HETATM 2835 O O    . HOH B 2 .   ? -6.15502  20.77588 11.25446 1.000 47.35641  ? 280 HOH A O    1 
HETATM 2836 O O    . HOH B 2 .   ? 10.99810  18.65531 26.88448 1.000 50.30077  ? 281 HOH A O    1 
HETATM 2837 O O    . HOH B 2 .   ? 16.83497  6.41310  -1.41740 1.000 28.91822  ? 282 HOH A O    1 
HETATM 2838 O O    . HOH B 2 .   ? -12.64191 7.50165  6.19890  1.000 40.21229  ? 283 HOH A O    1 
HETATM 2839 O O    . HOH B 2 .   ? -16.81143 10.91067 8.26586  1.000 35.54805  ? 284 HOH A O    1 
HETATM 2840 O O    . HOH B 2 .   ? 8.41891   14.95672 24.59737 1.000 22.43421  ? 285 HOH A O    1 
HETATM 2841 O O    . HOH B 2 .   ? 0.56346   17.15743 6.19426  1.000 47.70156  ? 286 HOH A O    1 
HETATM 2842 O O    . HOH B 2 .   ? -13.04074 9.93886  26.67900 1.000 41.17511  ? 287 HOH A O    1 
HETATM 2843 O O    . HOH B 2 .   ? 0.17150   -5.33985 20.90092 1.000 29.96280  ? 288 HOH A O    1 
HETATM 2844 O O    . HOH B 2 .   ? 15.71321  26.72824 11.04668 1.000 51.07189  ? 289 HOH A O    1 
HETATM 2845 O O    . HOH B 2 .   ? 0.70277   -4.39551 17.55332 1.000 38.23032  ? 290 HOH A O    1 
HETATM 2846 O O    . HOH B 2 .   ? -7.97601  17.67591 8.21624  1.000 55.19657  ? 291 HOH A O    1 
HETATM 2847 O O    . HOH B 2 .   ? -15.94391 15.58834 10.54776 1.000 44.36382  ? 292 HOH A O    1 
HETATM 2848 O O    . HOH B 2 .   ? 12.46421  8.33026  27.92989 1.000 31.70797  ? 293 HOH A O    1 
HETATM 2849 O O    . HOH B 2 .   ? -6.79029  -0.76142 6.01322  1.000 55.26364  ? 294 HOH A O    1 
HETATM 2850 O O    . HOH B 2 .   ? 19.41980  10.46687 -0.32591 1.000 52.95450  ? 295 HOH A O    1 
HETATM 2851 O O    . HOH B 2 .   ? 13.57434  5.10199  4.29226  1.000 19.65489  ? 296 HOH A O    1 
HETATM 2852 O O    . HOH B 2 .   ? 6.67363   19.86638 11.23699 1.000 24.49547  ? 297 HOH A O    1 
HETATM 2853 O O    . HOH B 2 .   ? 6.47032   18.80848 25.62588 1.000 45.73086  ? 298 HOH A O    1 
HETATM 2854 O O    . HOH B 2 .   ? 20.86230  7.78240  3.79725  1.000 35.07561  ? 299 HOH A O    1 
HETATM 2855 O O    . HOH B 2 .   ? -7.44994  18.11805 17.67750 1.000 45.16425  ? 300 HOH A O    1 
HETATM 2856 O O    . HOH B 2 .   ? 0.01970   19.33782 7.61850  1.000 38.79860  ? 301 HOH A O    1 
HETATM 2857 O O    . HOH B 2 .   ? 20.44041  15.31838 23.98219 1.000 54.63221  ? 302 HOH A O    1 
HETATM 2858 O O    . HOH B 2 .   ? -12.31520 3.54615  19.96829 1.000 41.99502  ? 303 HOH A O    1 
HETATM 2859 O O    . HOH B 2 .   ? -1.77858  11.25434 0.08926  1.000 26.70491  ? 304 HOH A O    1 
HETATM 2860 O O    . HOH B 2 .   ? 19.10193  5.62075  21.85450 1.000 47.56115  ? 305 HOH A O    1 
HETATM 2861 O O    . HOH B 2 .   ? 10.13887  -1.44421 2.55614  1.000 36.90361  ? 306 HOH A O    1 
HETATM 2862 O O    . HOH B 2 .   ? -5.28466  -0.82353 10.14942 1.000 48.07491  ? 307 HOH A O    1 
HETATM 2863 O O    . HOH B 2 .   ? 18.53488  20.51018 5.76837  1.000 49.09266  ? 308 HOH A O    1 
HETATM 2864 O O    . HOH B 2 .   ? 0.09316   12.44157 -1.87125 1.000 56.53717  ? 309 HOH A O    1 
HETATM 2865 O O    . HOH B 2 .   ? 2.28345   15.55812 4.36461  1.000 27.52108  ? 310 HOH A O    1 
HETATM 2866 O O    . HOH B 2 .   ? 1.75177   2.10502  4.40796  1.000 23.69289  ? 311 HOH A O    1 
HETATM 2867 O O    . HOH B 2 .   ? 8.64272   13.12790 26.98590 1.000 34.96757  ? 312 HOH A O    1 
HETATM 2868 O O    . HOH B 2 .   ? 4.989     -7.231   19.677   1.000 51.05014  ? 313 HOH A O    1 
HETATM 2869 O O    . HOH B 2 .   ? 16.20787  20.99541 4.23297  1.000 47.57606  ? 314 HOH A O    1 
HETATM 2870 O O    . HOH B 2 .   ? 15.17369  1.93423  23.11891 1.000 28.49692  ? 315 HOH A O    1 
HETATM 2871 O O    . HOH B 2 .   ? -6.76991  25.83366 14.10793 1.000 47.98043  ? 316 HOH A O    1 
HETATM 2872 O O    . HOH B 2 .   ? 3.389     20.020   27.053   1.000 53.88867  ? 317 HOH A O    1 
HETATM 2873 O O    . HOH B 2 .   ? -2.01950  -5.67525 22.18039 1.000 27.67716  ? 318 HOH A O    1 
HETATM 2874 O O    . HOH B 2 .   ? 16.15495  24.62225 9.15774  1.000 47.33056  ? 319 HOH A O    1 
HETATM 2875 O O    . HOH B 2 .   ? -1.42972  -5.11074 18.44355 1.000 51.70918  ? 320 HOH A O    1 
HETATM 2876 O O    . HOH B 2 .   ? -1.068    3.884    -6.008   1.000 48.76884  ? 321 HOH A O    1 
HETATM 2877 O O    . HOH B 2 .   ? 8.77552   17.43895 25.61548 1.000 37.63547  ? 322 HOH A O    1 
HETATM 2878 O O    . HOH B 2 .   ? 22.19079  11.61118 7.15907  1.000 42.42666  ? 323 HOH A O    1 
HETATM 2879 O O    . HOH B 2 .   ? -15.83836 17.03792 14.92467 1.000 56.93576  ? 324 HOH A O    1 
HETATM 2880 O O    . HOH B 2 .   ? 8.970     25.624   20.743   1.000 53.99599  ? 325 HOH A O    1 
HETATM 2881 O O    A HOH B 2 .   ? 0.85097   12.98469 5.66327  0.686 38.39835  ? 326 HOH A O    1 
HETATM 2882 O O    . HOH B 2 .   ? -7.20742  16.36431 26.08639 1.000 44.17735  ? 327 HOH A O    1 
HETATM 2883 O O    . HOH B 2 .   ? -4.64981  19.51497 8.41423  1.000 56.40381  ? 328 HOH A O    1 
HETATM 2884 O O    . HOH B 2 .   ? -14.87884 4.37597  19.81149 1.000 55.76669  ? 329 HOH A O    1 
HETATM 2885 O O    . HOH B 2 .   ? -12.00783 2.59714  11.74186 1.000 48.39982  ? 330 HOH A O    1 
HETATM 2886 O O    . HOH B 2 .   ? 5.75753   19.19418 8.38204  1.000 57.86325  ? 331 HOH A O    1 
HETATM 2887 O O    . HOH B 2 .   ? -3.69487  10.06259 30.77550 1.000 56.68469  ? 332 HOH A O    1 
HETATM 2888 O O    . HOH B 2 .   ? -14.70739 7.56110  7.93035  1.000 43.20811  ? 333 HOH A O    1 
HETATM 2889 O O    . HOH B 2 .   ? 19.66057  5.74824  19.03149 1.000 45.73884  ? 334 HOH A O    1 
HETATM 2890 O O    . HOH B 2 .   ? -12.33592 3.38666  22.69216 1.000 56.95016  ? 335 HOH A O    1 
HETATM 2891 O O    . HOH B 2 .   ? -9.02629  19.54183 4.63241  1.000 51.09506  ? 336 HOH A O    1 
HETATM 2892 O O    . HOH B 2 .   ? -0.61715  12.52069 2.24709  1.000 39.61788  ? 337 HOH A O    1 
HETATM 2893 O O    . HOH B 2 .   ? -2.36137  8.13480  30.23212 1.000 42.19013  ? 338 HOH A O    1 
HETATM 2894 O O    . HOH B 2 .   ? 9.12830   -3.11326 0.50316  1.000 48.98930  ? 339 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 2   ? 0.79372 0.92506 0.88155 0.22108  -0.00256 0.11231  2   VAL A N   
2    C CA  . VAL A 2   ? 0.69886 0.77859 0.76863 0.21785  0.00944  0.09882  2   VAL A CA  
3    C C   . VAL A 2   ? 0.58073 0.66620 0.64523 0.19704  0.00100  0.08904  2   VAL A C   
4    O O   . VAL A 2   ? 0.56675 0.69263 0.64069 0.18448  -0.01342 0.09224  2   VAL A O   
5    C CB  . VAL A 2   ? 0.76264 0.78816 0.81015 0.22307  0.01570  0.10256  2   VAL A CB  
6    C CG1 . VAL A 2   ? 0.85191 0.87367 0.90487 0.24447  0.02286  0.11522  2   VAL A CG1 
7    C CG2 . VAL A 2   ? 0.77146 0.79582 0.80543 0.20957  0.00213  0.10872  2   VAL A CG2 
16   N N   . ASN A 3   ? 0.53335 0.57699 0.58160 0.19238  0.01006  0.07640  3   ASN A N   
17   C CA  . ASN A 3   ? 0.35726 0.40183 0.39808 0.16421  0.00319  0.06308  3   ASN A CA  
18   C C   . ASN A 3   ? 0.29833 0.33679 0.32657 0.14992  -0.00901 0.06733  3   ASN A C   
19   O O   . ASN A 3   ? 0.37726 0.38682 0.39203 0.15728  -0.00705 0.07477  3   ASN A O   
20   C CB  . ASN A 3   ? 0.31779 0.32134 0.34254 0.15586  0.01464  0.04611  3   ASN A CB  
21   C CG  . ASN A 3   ? 0.34515 0.36065 0.37790 0.16237  0.02528  0.03756  3   ASN A CG  
22   O OD1 . ASN A 3   ? 0.34614 0.40559 0.39839 0.16503  0.02271  0.04231  3   ASN A OD1 
23   N ND2 . ASN A 3   ? 0.45843 0.43587 0.47516 0.16322  0.03781  0.02409  3   ASN A ND2 
30   N N   . PRO A 4   ? 0.32146 0.38317 0.35196 0.12945  -0.01975 0.06258  4   PRO A N   
31   C CA  . PRO A 4   ? 0.28521 0.33935 0.30106 0.11633  -0.02918 0.06441  4   PRO A CA  
32   C C   . PRO A 4   ? 0.41874 0.42855 0.41574 0.10629  -0.02250 0.05563  4   PRO A C   
33   O O   . PRO A 4   ? 0.31443 0.30680 0.31031 0.10140  -0.01458 0.04456  4   PRO A O   
34   C CB  . PRO A 4   ? 0.46440 0.55134 0.48854 0.09735  -0.03927 0.05889  4   PRO A CB  
35   C CG  . PRO A 4   ? 0.47556 0.57171 0.51300 0.09500  -0.03237 0.05130  4   PRO A CG  
36   C CD  . PRO A 4   ? 0.37931 0.47303 0.42473 0.11761  -0.02206 0.05585  4   PRO A CD  
44   N N   . THR A 5   ? 0.31652 0.31207 0.29856 0.10292  -0.02598 0.06131  5   THR A N   
45   C CA  . THR A 5   ? 0.30580 0.26704 0.27237 0.09128  -0.02063 0.05500  5   THR A CA  
46   C C   . THR A 5   ? 0.30587 0.27873 0.26516 0.07529  -0.02864 0.05190  5   THR A C   
47   O O   . THR A 5   ? 0.33338 0.32505 0.28771 0.07642  -0.03720 0.05941  5   THR A O   
48   C CB  . THR A 5   ? 0.37481 0.30426 0.32828 0.10159  -0.01372 0.06541  5   THR A CB  
49   O OG1 . THR A 5   ? 0.47966 0.39185 0.43838 0.11786  -0.00407 0.06738  5   THR A OG1 
50   C CG2 . THR A 5   ? 0.54420 0.44325 0.48518 0.08659  -0.00750 0.05876  5   THR A CG2 
58   N N   A VAL A 6   ? 0.25253 0.21525 0.21034 0.06115  -0.02571 0.04080  6   VAL A N   
59   N N   B VAL A 6   ? 0.25399 0.21617 0.21177 0.06126  -0.02551 0.04077  6   VAL A N   
60   C CA  A VAL A 6   ? 0.23761 0.20453 0.18746 0.04803  -0.02973 0.03689  6   VAL A CA  
61   C CA  B VAL A 6   ? 0.28785 0.25396 0.23860 0.04755  -0.02916 0.03600  6   VAL A CA  
62   C C   A VAL A 6   ? 0.34126 0.28261 0.28179 0.04155  -0.02192 0.03404  6   VAL A C   
63   C C   B VAL A 6   ? 0.32236 0.26232 0.26211 0.04240  -0.02162 0.03491  6   VAL A C   
64   O O   A VAL A 6   ? 0.29127 0.21658 0.23557 0.04133  -0.01513 0.03065  6   VAL A O   
65   O O   B VAL A 6   ? 0.27620 0.19693 0.21724 0.04412  -0.01437 0.03397  6   VAL A O   
66   C CB  A VAL A 6   ? 0.47082 0.45461 0.43081 0.03785  -0.03304 0.02815  6   VAL A CB  
67   C CB  B VAL A 6   ? 0.22937 0.20804 0.19109 0.03795  -0.03046 0.02659  6   VAL A CB  
68   C CG1 A VAL A 6   ? 0.42161 0.43514 0.39317 0.04093  -0.04043 0.03131  6   VAL A CG1 
69   C CG1 B VAL A 6   ? 0.21367 0.18295 0.16874 0.02641  -0.02833 0.02041  6   VAL A CG1 
70   C CG2 A VAL A 6   ? 0.32693 0.30184 0.29480 0.03559  -0.02662 0.02153  6   VAL A CG2 
71   C CG2 B VAL A 6   ? 0.29865 0.30661 0.26971 0.03728  -0.03852 0.02813  6   VAL A CG2 
90   N N   . PHE A 7   ? 0.31560 0.25515 0.24365 0.03531  -0.02250 0.03471  7   PHE A N   
91   C CA  . PHE A 7   ? 0.29385 0.21531 0.21526 0.02898  -0.01412 0.03323  7   PHE A CA  
92   C C   . PHE A 7   ? 0.28890 0.21585 0.21120 0.01959  -0.01294 0.02474  7   PHE A C   
93   O O   . PHE A 7   ? 0.27568 0.21393 0.19505 0.01667  -0.01824 0.02087  7   PHE A O   
94   C CB  . PHE A 7   ? 0.31482 0.22523 0.21822 0.03236  -0.01117 0.04373  7   PHE A CB  
95   C CG  . PHE A 7   ? 0.33172 0.25451 0.21911 0.02974  -0.01633 0.04423  7   PHE A CG  
96   C CD1 . PHE A 7   ? 0.37622 0.31732 0.25764 0.03543  -0.02694 0.04966  7   PHE A CD1 
97   C CD2 . PHE A 7   ? 0.35034 0.26847 0.22834 0.02148  -0.01025 0.03859  7   PHE A CD2 
98   C CE1 . PHE A 7   ? 0.46654 0.42016 0.33002 0.03013  -0.03278 0.04758  7   PHE A CE1 
99   C CE2 . PHE A 7   ? 0.35499 0.28103 0.21404 0.01818  -0.01363 0.03611  7   PHE A CE2 
100  C CZ  . PHE A 7   ? 0.38928 0.33257 0.23947 0.02111  -0.02560 0.03968  7   PHE A CZ  
110  N N   . PHE A 8   ? 0.29041 0.20926 0.21816 0.01475  -0.00536 0.02181  8   PHE A N   
111  C CA  . PHE A 8   ? 0.25731 0.17851 0.18576 0.00942  -0.00057 0.01691  8   PHE A CA  
112  C C   . PHE A 8   ? 0.26522 0.17732 0.18573 0.00701  0.00861  0.02111  8   PHE A C   
113  O O   . PHE A 8   ? 0.27757 0.18240 0.20343 0.00486  0.01286  0.02450  8   PHE A O   
114  C CB  . PHE A 8   ? 0.23684 0.16498 0.18296 0.00700  0.00098  0.01231  8   PHE A CB  
115  C CG  . PHE A 8   ? 0.24673 0.18408 0.20078 0.00831  -0.00513 0.00913  8   PHE A CG  
116  C CD1 . PHE A 8   ? 0.28739 0.22868 0.23639 0.00935  -0.01125 0.00882  8   PHE A CD1 
117  C CD2 . PHE A 8   ? 0.26250 0.20791 0.22974 0.00756  -0.00462 0.00745  8   PHE A CD2 
118  C CE1 . PHE A 8   ? 0.28804 0.23864 0.24619 0.00863  -0.01492 0.00688  8   PHE A CE1 
119  C CE2 . PHE A 8   ? 0.24787 0.20114 0.22101 0.00864  -0.00847 0.00660  8   PHE A CE2 
120  C CZ  . PHE A 8   ? 0.25265 0.20722 0.22178 0.00869  -0.01270 0.00631  8   PHE A CZ  
130  N N   . ASP A 9   ? 0.28040 0.19196 0.18785 0.00604  0.01308  0.01997  9   ASP A N   
131  C CA  . ASP A 9   ? 0.29841 0.20574 0.20109 0.00342  0.02474  0.02324  9   ASP A CA  
132  C C   . ASP A 9   ? 0.31439 0.23071 0.23294 0.00230  0.03135  0.01751  9   ASP A C   
133  O O   . ASP A 9   ? 0.30597 0.22301 0.22144 0.00476  0.03153  0.01120  9   ASP A O   
134  C CB  . ASP A 9   ? 0.29715 0.19974 0.17311 0.00455  0.02775  0.02553  9   ASP A CB  
135  C CG  . ASP A 9   ? 0.36764 0.26372 0.22814 0.00769  0.02340  0.03646  9   ASP A CG  
136  O OD1 . ASP A 9   ? 0.40615 0.29515 0.27684 0.00898  0.02262  0.04287  9   ASP A OD1 
137  O OD2 . ASP A 9   ? 0.43678 0.33415 0.27321 0.00939  0.02120  0.03876  9   ASP A OD2 
142  N N   . ILE A 10  ? 0.25665 0.17999 0.19264 -0.00150 0.03693  0.02006  10  ILE A N   
143  C CA  . ILE A 10  ? 0.27869 0.21819 0.23530 -0.00070 0.04129  0.01751  10  ILE A CA  
144  C C   . ILE A 10  ? 0.26683 0.21189 0.22319 -0.00015 0.05557  0.01979  10  ILE A C   
145  O O   . ILE A 10  ? 0.28828 0.22982 0.23813 -0.00544 0.06256  0.02509  10  ILE A O   
146  C CB  . ILE A 10  ? 0.25581 0.20792 0.23367 -0.00673 0.03688  0.01812  10  ILE A CB  
147  C CG1 . ILE A 10  ? 0.33384 0.27936 0.30927 -0.00624 0.02523  0.01523  10  ILE A CG1 
148  C CG2 . ILE A 10  ? 0.25434 0.23078 0.25475 -0.00454 0.03985  0.01820  10  ILE A CG2 
149  C CD1 . ILE A 10  ? 0.31623 0.26605 0.29316 0.00030  0.01925  0.01215  10  ILE A CD1 
161  N N   . ALA A 11  ? 0.25408 0.20706 0.21805 0.00712  0.06175  0.01683  11  ALA A N   
162  C CA  . ALA A 11  ? 0.28422 0.24674 0.25255 0.01047  0.07757  0.01882  11  ALA A CA  
163  C C   . ALA A 11  ? 0.26123 0.24979 0.26105 0.01581  0.08050  0.02156  11  ALA A C   
164  O O   . ALA A 11  ? 0.24821 0.24044 0.25821 0.02049  0.07198  0.02061  11  ALA A O   
165  C CB  . ALA A 11  ? 0.32872 0.27391 0.27234 0.01766  0.08629  0.01240  11  ALA A CB  
171  N N   . VAL A 12  ? 0.25795 0.26771 0.27370 0.01543  0.09290  0.02656  12  VAL A N   
172  C CA  . VAL A 12  ? 0.24723 0.29098 0.29644 0.02158  0.09643  0.03163  12  VAL A CA  
173  C C   . VAL A 12  ? 0.26907 0.31663 0.31901 0.03499  0.11590  0.03246  12  VAL A C   
174  O O   . VAL A 12  ? 0.28056 0.33242 0.32595 0.03094  0.12906  0.03440  12  VAL A O   
175  C CB  . VAL A 12  ? 0.25366 0.32760 0.32740 0.00698  0.09359  0.03686  12  VAL A CB  
176  C CG1 . VAL A 12  ? 0.28152 0.40002 0.39202 0.01345  0.09604  0.04328  12  VAL A CG1 
177  C CG2 . VAL A 12  ? 0.28793 0.35106 0.35604 -0.00556 0.07674  0.03339  12  VAL A CG2 
187  N N   . ASP A 13  ? 0.27200 0.31585 0.32661 0.05154  0.11966  0.03146  13  ASP A N   
188  C CA  . ASP A 13  ? 0.29479 0.33336 0.34583 0.06735  0.14037  0.02988  13  ASP A CA  
189  C C   . ASP A 13  ? 0.32042 0.32895 0.33361 0.06215  0.14974  0.02108  13  ASP A C   
190  O O   . ASP A 13  ? 0.37204 0.38608 0.38120 0.06707  0.16853  0.02114  13  ASP A O   
191  C CB  . ASP A 13  ? 0.29258 0.37598 0.37956 0.07420  0.15294  0.04007  13  ASP A CB  
192  C CG  . ASP A 13  ? 0.32331 0.43461 0.44366 0.08950  0.14929  0.04909  13  ASP A CG  
193  O OD1 . ASP A 13  ? 0.31931 0.40968 0.43213 0.09601  0.13978  0.04766  13  ASP A OD1 
194  O OD2 . ASP A 13  ? 0.43107 0.58826 0.58618 0.09502  0.15610  0.05913  13  ASP A OD2 
199  N N   . GLY A 14  ? 0.35019 0.33049 0.33535 0.05224  0.13630  0.01428  14  GLY A N   
200  C CA  . GLY A 14  ? 0.45216 0.40686 0.39860 0.04683  0.14069  0.00663  14  GLY A CA  
201  C C   . GLY A 14  ? 0.41787 0.38024 0.35572 0.03428  0.14052  0.01324  14  GLY A C   
202  O O   . GLY A 14  ? 0.59093 0.53384 0.49421 0.02947  0.14029  0.00949  14  GLY A O   
206  N N   A GLU A 15  ? 0.33015 0.32074 0.29769 0.02817  0.14137  0.02355  15  GLU A N   
207  N N   B GLU A 15  ? 0.32929 0.31858 0.29601 0.02783  0.14007  0.02328  15  GLU A N   
208  C CA  A GLU A 15  ? 0.33655 0.32809 0.29587 0.01460  0.14239  0.03088  15  GLU A CA  
209  C CA  B GLU A 15  ? 0.33667 0.32821 0.29594 0.01471  0.14249  0.03083  15  GLU A CA  
210  C C   A GLU A 15  ? 0.35464 0.33208 0.30822 0.00473  0.12258  0.03182  15  GLU A C   
211  C C   B GLU A 15  ? 0.33727 0.31675 0.29297 0.00384  0.12339  0.03272  15  GLU A C   
212  O O   A GLU A 15  ? 0.29807 0.28279 0.27156 0.00414  0.10979  0.03022  15  GLU A O   
213  O O   B GLU A 15  ? 0.35638 0.34644 0.33529 0.00166  0.11149  0.03226  15  GLU A O   
214  C CB  A GLU A 15  ? 0.36107 0.38666 0.35439 0.00821  0.15250  0.04028  15  GLU A CB  
215  C CB  B GLU A 15  ? 0.40353 0.42976 0.39648 0.01032  0.15455  0.03973  15  GLU A CB  
216  C CG  A GLU A 15  ? 0.53609 0.55690 0.52074 -0.00797 0.15573  0.04883  15  GLU A CG  
217  C CG  B GLU A 15  ? 0.41147 0.45399 0.41149 0.02385  0.17633  0.03936  15  GLU A CG  
218  C CD  A GLU A 15  ? 0.56956 0.62453 0.58727 -0.01812 0.16824  0.05753  15  GLU A CD  
219  C CD  B GLU A 15  ? 0.60223 0.68754 0.64060 0.01903  0.18837  0.04943  15  GLU A CD  
220  O OE1 A GLU A 15  ? 0.46891 0.55465 0.52353 -0.02022 0.16258  0.05766  15  GLU A OE1 
221  O OE1 B GLU A 15  ? 0.67451 0.78593 0.73693 0.03332  0.20069  0.05072  15  GLU A OE1 
222  O OE2 A GLU A 15  ? 0.50491 0.55839 0.51145 -0.02497 0.18359  0.06500  15  GLU A OE2 
223  O OE2 B GLU A 15  ? 0.68471 0.77775 0.73027 0.00089  0.18620  0.05643  15  GLU A OE2 
236  N N   . PRO A 16  ? 0.36355 0.32190 0.28986 -0.00156 0.12062  0.03548  16  PRO A N   
237  C CA  . PRO A 16  ? 0.35697 0.30199 0.28005 -0.00808 0.10425  0.03774  16  PRO A CA  
238  C C   . PRO A 16  ? 0.36690 0.32418 0.31853 -0.01929 0.10257  0.04278  16  PRO A C   
239  O O   . PRO A 16  ? 0.40670 0.37566 0.36979 -0.02751 0.11491  0.04932  16  PRO A O   
240  C CB  . PRO A 16  ? 0.46947 0.39478 0.35791 -0.00959 0.10626  0.04426  16  PRO A CB  
241  C CG  . PRO A 16  ? 0.68600 0.61205 0.55264 -0.00359 0.11975  0.04100  16  PRO A CG  
242  C CD  . PRO A 16  ? 0.43249 0.38043 0.32723 -0.00094 0.13346  0.03858  16  PRO A CD  
250  N N   . LEU A 17  ? 0.29606 0.25138 0.25854 -0.02103 0.08773  0.03875  17  LEU A N   
251  C CA  . LEU A 17  ? 0.28903 0.25089 0.27257 -0.03355 0.08371  0.03988  17  LEU A CA  
252  C C   . LEU A 17  ? 0.36238 0.29500 0.32906 -0.03821 0.07801  0.04280  17  LEU A C   
253  O O   . LEU A 17  ? 0.38076 0.30297 0.34839 -0.04967 0.08508  0.04867  17  LEU A O   
254  C CB  . LEU A 17  ? 0.26312 0.24459 0.26897 -0.03161 0.07245  0.03292  17  LEU A CB  
255  C CG  . LEU A 17  ? 0.27707 0.26800 0.30192 -0.04597 0.06618  0.03046  17  LEU A CG  
256  C CD1 . LEU A 17  ? 0.40195 0.41649 0.44846 -0.05938 0.07658  0.03441  17  LEU A CD1 
257  C CD2 . LEU A 17  ? 0.35095 0.36077 0.38990 -0.04130 0.05365  0.02449  17  LEU A CD2 
269  N N   . GLY A 18  ? 0.29825 0.21689 0.25009 -0.02902 0.06672  0.03974  18  GLY A N   
270  C CA  . GLY A 18  ? 0.31087 0.20379 0.24798 -0.02882 0.06217  0.04407  18  GLY A CA  
271  C C   . GLY A 18  ? 0.31188 0.20202 0.24307 -0.01869 0.04855  0.03893  18  GLY A C   
272  O O   . GLY A 18  ? 0.32704 0.23155 0.26235 -0.01343 0.04332  0.03248  18  GLY A O   
276  N N   . ARG A 19  ? 0.30818 0.17880 0.23094 -0.01587 0.04443  0.04268  19  ARG A N   
277  C CA  . ARG A 19  ? 0.29895 0.16890 0.21652 -0.00557 0.03297  0.04039  19  ARG A CA  
278  C C   . ARG A 19  ? 0.29212 0.15686 0.22234 -0.00719 0.02864  0.03402  19  ARG A C   
279  O O   . ARG A 19  ? 0.30976 0.15642 0.24201 -0.01367 0.03447  0.03481  19  ARG A O   
280  C CB  . ARG A 19  ? 0.32202 0.17827 0.21804 0.00374  0.03184  0.05190  19  ARG A CB  
281  C CG  . ARG A 19  ? 0.31480 0.17557 0.20941 0.01458  0.02029  0.05145  19  ARG A CG  
282  C CD  . ARG A 19  ? 0.33787 0.19507 0.21230 0.02479  0.01738  0.06457  19  ARG A CD  
283  N NE  . ARG A 19  ? 0.36688 0.23965 0.22603 0.02352  0.01440  0.06358  19  ARG A NE  
284  C CZ  . ARG A 19  ? 0.42838 0.30789 0.26743 0.03052  0.00846  0.07253  19  ARG A CZ  
285  N NH1 . ARG A 19  ? 0.45869 0.33251 0.29347 0.04199  0.00501  0.08612  19  ARG A NH1 
286  N NH2 . ARG A 19  ? 0.42146 0.31368 0.24373 0.02666  0.00623  0.06785  19  ARG A NH2 
300  N N   A VAL A 20  ? 0.27062 0.14964 0.20756 -0.00231 0.01960  0.02708  20  VAL A N   
301  N N   B VAL A 20  ? 0.27084 0.14955 0.20786 -0.00237 0.01964  0.02705  20  VAL A N   
302  C CA  A VAL A 20  ? 0.26583 0.14225 0.21001 -0.00083 0.01518  0.02081  20  VAL A CA  
303  C CA  B VAL A 20  ? 0.26665 0.14233 0.21151 -0.00195 0.01580  0.02044  20  VAL A CA  
304  C C   A VAL A 20  ? 0.26939 0.14621 0.20692 0.01204  0.00877  0.02446  20  VAL A C   
305  C C   B VAL A 20  ? 0.26199 0.14099 0.20222 0.01048  0.00856  0.02235  20  VAL A C   
306  O O   A VAL A 20  ? 0.26081 0.15202 0.19498 0.01592  0.00338  0.02615  20  VAL A O   
307  O O   B VAL A 20  ? 0.39341 0.28936 0.33397 0.01344  0.00277  0.02182  20  VAL A O   
308  C CB  A VAL A 20  ? 0.27836 0.17628 0.23705 -0.00591 0.01089  0.01169  20  VAL A CB  
309  C CB  B VAL A 20  ? 0.24660 0.14237 0.20670 -0.00922 0.01279  0.01113  20  VAL A CB  
310  C CG1 A VAL A 20  ? 0.36173 0.25750 0.32385 -0.00551 0.00752  0.00425  20  VAL A CG1 
311  C CG1 B VAL A 20  ? 0.22649 0.14193 0.18991 -0.00462 0.00847  0.01114  20  VAL A CG1 
312  C CG2 A VAL A 20  ? 0.31902 0.22653 0.28789 -0.01715 0.01605  0.01025  20  VAL A CG2 
313  C CG2 B VAL A 20  ? 0.31957 0.21292 0.28255 -0.00884 0.00912  0.00337  20  VAL A CG2 
332  N N   A SER A 21  ? 0.27971 0.14137 0.21593 0.01828  0.01004  0.02518  21  SER A N   
333  N N   B SER A 21  ? 0.30330 0.16591 0.24009 0.01750  0.00998  0.02461  21  SER A N   
334  C CA  A SER A 21  ? 0.27845 0.14722 0.21408 0.03182  0.00445  0.02885  21  SER A CA  
335  C CA  B SER A 21  ? 0.28194 0.15204 0.21817 0.03083  0.00425  0.02809  21  SER A CA  
336  C C   A SER A 21  ? 0.27193 0.14350 0.21639 0.03353  0.00409  0.01936  21  SER A C   
337  C C   B SER A 21  ? 0.26990 0.14304 0.21490 0.03257  0.00377  0.01873  21  SER A C   
338  O O   A SER A 21  ? 0.30570 0.16171 0.25059 0.02687  0.00961  0.01149  21  SER A O   
339  O O   B SER A 21  ? 0.29085 0.15113 0.23708 0.02497  0.00865  0.01035  21  SER A O   
340  C CB  A SER A 21  ? 0.39434 0.24466 0.31963 0.04389  0.00784  0.04167  21  SER A CB  
341  C CB  B SER A 21  ? 0.36077 0.21263 0.28660 0.04269  0.00755  0.04078  21  SER A CB  
342  O OG  A SER A 21  ? 0.42065 0.24061 0.34469 0.04496  0.01716  0.04005  21  SER A OG  
343  O OG  B SER A 21  ? 0.44748 0.30021 0.36140 0.04137  0.00745  0.05030  21  SER A OG  
354  N N   . PHE A 22  ? 0.27728 0.17064 0.22790 0.04061  -0.00221 0.01939  22  PHE A N   
355  C CA  . PHE A 22  ? 0.28297 0.18432 0.24071 0.04339  -0.00192 0.01172  22  PHE A CA  
356  C C   . PHE A 22  ? 0.30449 0.21213 0.26577 0.05942  -0.00192 0.01767  22  PHE A C   
357  O O   . PHE A 22  ? 0.32135 0.24684 0.28541 0.06515  -0.00808 0.02659  22  PHE A O   
358  C CB  . PHE A 22  ? 0.24099 0.16780 0.20644 0.03662  -0.00768 0.00763  22  PHE A CB  
359  C CG  . PHE A 22  ? 0.24644 0.17449 0.21185 0.02491  -0.00832 0.00499  22  PHE A CG  
360  C CD1 . PHE A 22  ? 0.29872 0.22516 0.26586 0.01701  -0.00620 -0.00230 22  PHE A CD1 
361  C CD2 . PHE A 22  ? 0.30720 0.24061 0.27084 0.02217  -0.01086 0.00934  22  PHE A CD2 
362  C CE1 . PHE A 22  ? 0.27779 0.21175 0.24893 0.00850  -0.00674 -0.00275 22  PHE A CE1 
363  C CE2 . PHE A 22  ? 0.36861 0.30386 0.33396 0.01441  -0.00921 0.00745  22  PHE A CE2 
364  C CZ  . PHE A 22  ? 0.33234 0.26980 0.30349 0.00856  -0.00722 0.00262  22  PHE A CZ  
374  N N   . GLU A 23  ? 0.29261 0.18858 0.25406 0.06643  0.00506  0.01197  23  GLU A N   
375  C CA  . GLU A 23  ? 0.27930 0.18934 0.24873 0.08275  0.00659  0.01598  23  GLU A CA  
376  C C   . GLU A 23  ? 0.29144 0.23118 0.27006 0.07785  0.00331  0.00999  23  GLU A C   
377  O O   . GLU A 23  ? 0.28917 0.22539 0.26347 0.06804  0.00534  -0.00052 23  GLU A O   
378  C CB  . GLU A 23  ? 0.32129 0.20128 0.28489 0.09476  0.01881  0.01201  23  GLU A CB  
379  C CG  . GLU A 23  ? 0.35640 0.25419 0.33074 0.11462  0.02269  0.01645  23  GLU A CG  
380  C CD  . GLU A 23  ? 0.47998 0.34380 0.44709 0.12880  0.03779  0.01061  23  GLU A CD  
381  O OE1 . GLU A 23  ? 0.56981 0.39216 0.52241 0.12166  0.04488  0.00322  23  GLU A OE1 
382  O OE2 . GLU A 23  ? 0.47494 0.35335 0.45140 0.14668  0.04374  0.01285  23  GLU A OE2 
389  N N   . LEU A 24  ? 0.25544 0.22630 0.24658 0.08358  -0.00199 0.01762  24  LEU A N   
390  C CA  . LEU A 24  ? 0.24007 0.23931 0.24137 0.07879  -0.00349 0.01471  24  LEU A CA  
391  C C   . LEU A 24  ? 0.25044 0.26295 0.26093 0.09455  0.00414  0.01574  24  LEU A C   
392  O O   . LEU A 24  ? 0.26044 0.28257 0.27971 0.10949  0.00434  0.02500  24  LEU A O   
393  C CB  . LEU A 24  ? 0.26337 0.28901 0.27373 0.07033  -0.01347 0.02104  24  LEU A CB  
394  C CG  . LEU A 24  ? 0.27395 0.28623 0.27442 0.05753  -0.01912 0.02010  24  LEU A CG  
395  C CD1 . LEU A 24  ? 0.28909 0.32432 0.29600 0.04867  -0.02742 0.02333  24  LEU A CD1 
396  C CD2 . LEU A 24  ? 0.26982 0.26744 0.26358 0.04768  -0.01573 0.01201  24  LEU A CD2 
408  N N   . PHE A 25  ? 0.25212 0.26780 0.26035 0.09257  0.01085  0.00724  25  PHE A N   
409  C CA  . PHE A 25  ? 0.25496 0.27812 0.26803 0.10863  0.02193  0.00552  25  PHE A CA  
410  C C   . PHE A 25  ? 0.24914 0.31738 0.28382 0.11143  0.02023  0.01428  25  PHE A C   
411  O O   . PHE A 25  ? 0.26582 0.35228 0.30368 0.10929  0.02619  0.01126  25  PHE A O   
412  C CB  . PHE A 25  ? 0.27635 0.28320 0.27300 0.10453  0.03072  -0.00883 25  PHE A CB  
413  C CG  . PHE A 25  ? 0.39480 0.36085 0.37220 0.09854  0.03248  -0.01922 25  PHE A CG  
414  C CD1 . PHE A 25  ? 0.58892 0.52487 0.56278 0.10858  0.03677  -0.01728 25  PHE A CD1 
415  C CD2 . PHE A 25  ? 0.37611 0.33577 0.33985 0.08226  0.02988  -0.02960 25  PHE A CD2 
416  C CE1 . PHE A 25  ? 0.54821 0.44577 0.50562 0.09978  0.03956  -0.02692 25  PHE A CE1 
417  C CE2 . PHE A 25  ? 0.39627 0.32386 0.34528 0.07361  0.03083  -0.03969 25  PHE A CE2 
418  C CZ  . PHE A 25  ? 0.38189 0.27700 0.32788 0.08101  0.03625  -0.03909 25  PHE A CZ  
428  N N   . ALA A 26  ? 0.27329 0.36186 0.32267 0.11536  0.01198  0.02580  26  ALA A N   
429  C CA  . ALA A 26  ? 0.24030 0.37623 0.31342 0.11507  0.00885  0.03417  26  ALA A CA  
430  C C   . ALA A 26  ? 0.24167 0.39828 0.32830 0.13427  0.02183  0.03607  26  ALA A C   
431  O O   . ALA A 26  ? 0.26331 0.46058 0.36952 0.13115  0.02326  0.04060  26  ALA A O   
432  C CB  . ALA A 26  ? 0.29471 0.45090 0.37883 0.11550  -0.00404 0.04514  26  ALA A CB  
438  N N   . ASP A 27  ? 0.29284 0.42116 0.36963 0.15376  0.03298  0.03249  27  ASP A N   
439  C CA  . ASP A 27  ? 0.28318 0.42694 0.37077 0.17475  0.04845  0.03278  27  ASP A CA  
440  C C   . ASP A 27  ? 0.30001 0.44635 0.37836 0.16669  0.05903  0.02142  27  ASP A C   
441  O O   . ASP A 27  ? 0.32379 0.49786 0.41533 0.17936  0.07132  0.02311  27  ASP A O   
442  C CB  . ASP A 27  ? 0.44520 0.54924 0.52160 0.19838  0.05992  0.03081  27  ASP A CB  
443  C CG  . ASP A 27  ? 0.45519 0.50132 0.49964 0.18817  0.06351  0.01513  27  ASP A CG  
444  O OD1 . ASP A 27  ? 0.41940 0.45747 0.45243 0.16474  0.05303  0.00976  27  ASP A OD1 
445  O OD2 . ASP A 27  ? 0.75888 0.76732 0.79049 0.20381  0.07760  0.00812  27  ASP A OD2 
450  N N   . LYS A 28  ? 0.28053 0.40281 0.33715 0.14689  0.05482  0.01141  28  LYS A N   
451  C CA  . LYS A 28  ? 0.27213 0.39748 0.31581 0.13962  0.06368  0.00224  28  LYS A CA  
452  C C   . LYS A 28  ? 0.24981 0.39685 0.29723 0.11769  0.05493  0.00725  28  LYS A C   
453  O O   . LYS A 28  ? 0.24767 0.41616 0.29551 0.11476  0.06313  0.00771  28  LYS A O   
454  C CB  . LYS A 28  ? 0.39276 0.47228 0.40462 0.13722  0.06861  -0.01452 28  LYS A CB  
455  C CG  . LYS A 28  ? 0.64722 0.69884 0.65185 0.15902  0.08279  -0.02208 28  LYS A CG  
456  C CD  . LYS A 28  ? 0.78646 0.79762 0.75838 0.15392  0.09086  -0.04250 28  LYS A CD  
457  C CE  . LYS A 28  ? 0.92728 0.90342 0.89091 0.17564  0.10767  -0.05118 28  LYS A CE  
458  N NZ  . LYS A 28  ? 0.93522 0.88909 0.90945 0.18532  0.10333  -0.04069 28  LYS A NZ  
472  N N   . VAL A 29  ? 0.22472 0.36506 0.27385 0.10320  0.04043  0.01155  29  VAL A N   
473  C CA  . VAL A 29  ? 0.20564 0.36055 0.25889 0.08368  0.03359  0.01698  29  VAL A CA  
474  C C   . VAL A 29  ? 0.18988 0.35984 0.26171 0.07624  0.02167  0.02562  29  VAL A C   
475  O O   . VAL A 29  ? 0.18173 0.33234 0.24561 0.06523  0.01178  0.02466  29  VAL A O   
476  C CB  . VAL A 29  ? 0.22236 0.34881 0.25292 0.07142  0.02903  0.01069  29  VAL A CB  
477  C CG1 . VAL A 29  ? 0.29821 0.42563 0.31195 0.07192  0.03868  0.00513  29  VAL A CG1 
478  C CG2 . VAL A 29  ? 0.36177 0.45485 0.37964 0.07454  0.02413  0.00346  29  VAL A CG2 
488  N N   . PRO A 30  ? 0.18751 0.39458 0.28391 0.08130  0.02228  0.03361  30  PRO A N   
489  C CA  . PRO A 30  ? 0.17780 0.40142 0.28910 0.07415  0.00900  0.04004  30  PRO A CA  
490  C C   . PRO A 30  ? 0.22844 0.45061 0.33902 0.04955  0.00092  0.04031  30  PRO A C   
491  O O   . PRO A 30  ? 0.16393 0.37639 0.27048 0.04153  -0.01034 0.03960  30  PRO A O   
492  C CB  . PRO A 30  ? 0.17975 0.45240 0.32037 0.08454  0.01241  0.04879  30  PRO A CB  
493  C CG  . PRO A 30  ? 0.27272 0.55649 0.41514 0.08975  0.02878  0.04741  30  PRO A CG  
494  C CD  . PRO A 30  ? 0.22958 0.46724 0.34099 0.09565  0.03525  0.03664  30  PRO A CD  
502  N N   . LYS A 31  ? 0.16762 0.39696 0.28034 0.03780  0.00766  0.04167  31  LYS A N   
503  C CA  . LYS A 31  ? 0.17672 0.39948 0.28919 0.01529  0.00238  0.04269  31  LYS A CA  
504  C C   . LYS A 31  ? 0.19914 0.37876 0.28760 0.01158  -0.00153 0.03710  31  LYS A C   
505  O O   . LYS A 31  ? 0.18819 0.35466 0.27347 -0.00101 -0.00903 0.03528  31  LYS A O   
506  C CB  . LYS A 31  ? 0.17419 0.41291 0.29471 0.00509  0.01283  0.04848  31  LYS A CB  
507  C CG  . LYS A 31  ? 0.21178 0.43796 0.33201 -0.01786 0.01063  0.05059  31  LYS A CG  
508  C CD  . LYS A 31  ? 0.28207 0.52993 0.41526 -0.02874 0.02208  0.05931  31  LYS A CD  
509  C CE  . LYS A 31  ? 0.20405 0.43188 0.33603 -0.05200 0.02219  0.06196  31  LYS A CE  
510  N NZ  . LYS A 31  ? 0.23008 0.48012 0.37724 -0.06514 0.03421  0.07214  31  LYS A NZ  
524  N N   . THR A 32  ? 0.16445 0.32367 0.23596 0.02202  0.00386  0.03353  32  THR A N   
525  C CA  . THR A 32  ? 0.16375 0.28929 0.21628 0.01946  0.00022  0.02914  32  THR A CA  
526  C C   . THR A 32  ? 0.17885 0.28948 0.22659 0.02376  -0.00782 0.02483  32  THR A C   
527  O O   . THR A 32  ? 0.17943 0.27071 0.21923 0.01632  -0.01284 0.02297  32  THR A O   
528  C CB  . THR A 32  ? 0.16960 0.28499 0.20661 0.02753  0.00674  0.02575  32  THR A CB  
529  O OG1 . THR A 32  ? 0.17920 0.31221 0.21858 0.02507  0.01521  0.03140  32  THR A OG1 
530  C CG2 . THR A 32  ? 0.18187 0.27174 0.20372 0.02357  0.00273  0.02314  32  THR A CG2 
538  N N   . ALA A 33  ? 0.16525 0.28372 0.21706 0.03710  -0.00756 0.02432  33  ALA A N   
539  C CA  . ALA A 33  ? 0.17437 0.27854 0.22036 0.04223  -0.01408 0.02325  33  ALA A CA  
540  C C   . ALA A 33  ? 0.18988 0.30576 0.24216 0.03152  -0.02369 0.02618  33  ALA A C   
541  O O   . ALA A 33  ? 0.19469 0.29187 0.23529 0.02753  -0.02905 0.02403  33  ALA A O   
542  C CB  . ALA A 33  ? 0.21682 0.32629 0.26695 0.06089  -0.01023 0.02502  33  ALA A CB  
548  N N   . GLU A 34  ? 0.16311 0.31135 0.23313 0.02521  -0.02548 0.03023  34  GLU A N   
549  C CA  . GLU A 34  ? 0.19421 0.35732 0.26945 0.01225  -0.03576 0.03076  34  GLU A CA  
550  C C   . GLU A 34  ? 0.21052 0.34727 0.27283 -0.00513 -0.03677 0.02474  34  GLU A C   
551  O O   . GLU A 34  ? 0.21073 0.33980 0.26361 -0.01269 -0.04417 0.02102  34  GLU A O   
552  C CB  . GLU A 34  ? 0.17289 0.38038 0.27300 0.00614  -0.03702 0.03571  34  GLU A CB  
553  C CG  . GLU A 34  ? 0.20400 0.43167 0.31048 -0.01317 -0.04843 0.03392  34  GLU A CG  
554  C CD  . GLU A 34  ? 0.34554 0.57939 0.44387 -0.00705 -0.06056 0.03484  34  GLU A CD  
555  O OE1 . GLU A 34  ? 0.24883 0.47618 0.34195 0.01423  -0.05944 0.03998  34  GLU A OE1 
556  O OE2 . GLU A 34  ? 0.31616 0.55968 0.41120 -0.02436 -0.07070 0.03031  34  GLU A OE2 
563  N N   . ASN A 35  ? 0.19286 0.31521 0.25309 -0.01012 -0.02851 0.02436  35  ASN A N   
564  C CA  . ASN A 35  ? 0.18945 0.28319 0.23813 -0.02222 -0.02689 0.02059  35  ASN A CA  
565  C C   . ASN A 35  ? 0.18915 0.25585 0.22034 -0.01604 -0.02910 0.01621  35  ASN A C   
566  O O   . ASN A 35  ? 0.19515 0.24713 0.21696 -0.02459 -0.03203 0.01126  35  ASN A O   
567  C CB  . ASN A 35  ? 0.20305 0.28826 0.25209 -0.02290 -0.01719 0.02499  35  ASN A CB  
568  C CG  . ASN A 35  ? 0.21950 0.27418 0.25841 -0.03114 -0.01360 0.02409  35  ASN A CG  
569  O OD1 . ASN A 35  ? 0.22937 0.27606 0.26941 -0.04573 -0.01383 0.02138  35  ASN A OD1 
570  N ND2 . ASN A 35  ? 0.19083 0.22903 0.22029 -0.02186 -0.00966 0.02633  35  ASN A ND2 
577  N N   . PHE A 36  ? 0.16864 0.22849 0.19468 -0.00227 -0.02670 0.01710  36  PHE A N   
578  C CA  . PHE A 36  ? 0.19003 0.22724 0.20219 0.00224  -0.02752 0.01398  36  PHE A CA  
579  C C   . PHE A 36  ? 0.20163 0.24181 0.20834 0.00314  -0.03441 0.01335  36  PHE A C   
580  O O   . PHE A 36  ? 0.22478 0.24826 0.21895 -0.00031 -0.03532 0.01017  36  PHE A O   
581  C CB  . PHE A 36  ? 0.20229 0.23344 0.21140 0.01337  -0.02349 0.01402  36  PHE A CB  
582  C CG  . PHE A 36  ? 0.20488 0.21479 0.20303 0.01487  -0.02254 0.01128  36  PHE A CG  
583  C CD1 . PHE A 36  ? 0.22196 0.22304 0.21783 0.01189  -0.01934 0.01063  36  PHE A CD1 
584  C CD2 . PHE A 36  ? 0.22448 0.22582 0.21607 0.01996  -0.02412 0.01117  36  PHE A CD2 
585  C CE1 . PHE A 36  ? 0.22142 0.20986 0.21148 0.01263  -0.01811 0.00872  36  PHE A CE1 
586  C CE2 . PHE A 36  ? 0.29158 0.27551 0.27508 0.01933  -0.02171 0.00932  36  PHE A CE2 
587  C CZ  . PHE A 36  ? 0.22936 0.20904 0.21356 0.01507  -0.01886 0.00748  36  PHE A CZ  
597  N N   . ARG A 37  ? 0.18593 0.24925 0.20142 0.00936  -0.03869 0.01753  37  ARG A N   
598  C CA  . ARG A 37  ? 0.21163 0.28288 0.22126 0.01186  -0.04657 0.01994  37  ARG A CA  
599  C C   . ARG A 37  ? 0.24230 0.31675 0.24537 -0.00454 -0.05282 0.01455  37  ARG A C   
600  O O   . ARG A 37  ? 0.24375 0.30540 0.22969 -0.00661 -0.05562 0.01202  37  ARG A O   
601  C CB  . ARG A 37  ? 0.22252 0.32464 0.24702 0.02318  -0.05012 0.02769  37  ARG A CB  
602  C CG  . ARG A 37  ? 0.22692 0.33829 0.24450 0.03136  -0.05815 0.03441  37  ARG A CG  
603  C CD  . ARG A 37  ? 0.23123 0.38575 0.26794 0.03914  -0.06491 0.04319  37  ARG A CD  
604  N NE  . ARG A 37  ? 0.27028 0.45494 0.31982 0.02070  -0.07145 0.03897  37  ARG A NE  
605  C CZ  . ARG A 37  ? 0.23519 0.43038 0.27625 0.00456  -0.08198 0.03448  37  ARG A CZ  
606  N NH1 . ARG A 37  ? 0.32673 0.50719 0.34520 0.00654  -0.08703 0.03474  37  ARG A NH1 
607  N NH2 . ARG A 37  ? 0.27019 0.48957 0.32378 -0.01502 -0.08653 0.02907  37  ARG A NH2 
621  N N   . ALA A 38  ? 0.20810 0.29777 0.22301 -0.01762 -0.05378 0.01194  38  ALA A N   
622  C CA  . ALA A 38  ? 0.25038 0.34134 0.25837 -0.03625 -0.05935 0.00422  38  ALA A CA  
623  C C   . ALA A 38  ? 0.23837 0.29022 0.22798 -0.04255 -0.05242 -0.00392 38  ALA A C   
624  O O   . ALA A 38  ? 0.26890 0.31163 0.24204 -0.05227 -0.05578 -0.01193 38  ALA A O   
625  C CB  . ALA A 38  ? 0.25830 0.37183 0.28520 -0.05111 -0.05993 0.00347  38  ALA A CB  
631  N N   . LEU A 39  ? 0.22552 0.25612 0.21724 -0.03659 -0.04243 -0.00202 39  LEU A N   
632  C CA  . LEU A 39  ? 0.23884 0.23623 0.21662 -0.03815 -0.03485 -0.00726 39  LEU A CA  
633  C C   . LEU A 39  ? 0.27036 0.25756 0.23260 -0.02947 -0.03534 -0.00811 39  LEU A C   
634  O O   . LEU A 39  ? 0.30031 0.26624 0.24783 -0.03279 -0.03066 -0.01449 39  LEU A O   
635  C CB  . LEU A 39  ? 0.22086 0.20623 0.20663 -0.03182 -0.02580 -0.00207 39  LEU A CB  
636  C CG  . LEU A 39  ? 0.24146 0.22971 0.23878 -0.04110 -0.02195 0.00050  39  LEU A CG  
637  C CD1 . LEU A 39  ? 0.24373 0.22634 0.24647 -0.03184 -0.01458 0.00862  39  LEU A CD1 
638  C CD2 . LEU A 39  ? 0.31228 0.27788 0.30181 -0.05618 -0.01814 -0.00719 39  LEU A CD2 
650  N N   . SER A 40  ? 0.23961 0.23988 0.20437 -0.01814 -0.03919 -0.00145 40  SER A N   
651  C CA  . SER A 40  ? 0.26888 0.25880 0.21913 -0.01095 -0.03848 0.00003  40  SER A CA  
652  C C   . SER A 40  ? 0.30411 0.30224 0.23827 -0.01616 -0.04609 -0.00227 40  SER A C   
653  O O   . SER A 40  ? 0.32948 0.31366 0.24547 -0.01514 -0.04307 -0.00391 40  SER A O   
654  C CB  . SER A 40  ? 0.25624 0.25075 0.21310 0.00227  -0.03815 0.00823  40  SER A CB  
655  O OG  . SER A 40  ? 0.27599 0.26348 0.24291 0.00571  -0.03180 0.00842  40  SER A OG  
661  N N   . THR A 41  ? 0.25684 0.28111 0.19695 -0.02211 -0.05603 -0.00197 41  THR A N   
662  C CA  . THR A 41  ? 0.30265 0.33979 0.22543 -0.02889 -0.06539 -0.00480 41  THR A CA  
663  C C   . THR A 41  ? 0.30261 0.32845 0.21262 -0.04803 -0.06488 -0.01980 41  THR A C   
664  O O   . THR A 41  ? 0.33820 0.36644 0.22570 -0.05547 -0.07030 -0.02614 41  THR A O   
665  C CB  . THR A 41  ? 0.37315 0.45101 0.30872 -0.02681 -0.07829 0.00299  41  THR A CB  
666  O OG1 . THR A 41  ? 0.31092 0.40567 0.26577 -0.03970 -0.08052 -0.00193 41  THR A OG1 
667  C CG2 . THR A 41  ? 0.35687 0.44160 0.30469 -0.00592 -0.07666 0.01738  41  THR A CG2 
675  N N   . GLY A 42  ? 0.28652 0.36697 0.27894 -0.00523 -0.07477 -0.05278 42  GLY A N   
676  C CA  . GLY A 42  ? 0.29890 0.38009 0.27625 -0.02232 -0.06583 -0.06471 42  GLY A CA  
677  C C   . GLY A 42  ? 0.33498 0.45120 0.32902 -0.03060 -0.07667 -0.08111 42  GLY A C   
678  O O   . GLY A 42  ? 0.34978 0.46622 0.32882 -0.04594 -0.07283 -0.09229 42  GLY A O   
682  N N   . GLU A 43  ? 0.27905 0.42699 0.30738 -0.02084 -0.09013 -0.08574 43  GLU A N   
683  C CA  . GLU A 43  ? 0.28993 0.47932 0.33724 -0.02631 -0.10553 -0.10122 43  GLU A CA  
684  C C   . GLU A 43  ? 0.39232 0.59708 0.45162 -0.05018 -0.08950 -0.12184 43  GLU A C   
685  O O   . GLU A 43  ? 0.35523 0.59090 0.42273 -0.06150 -0.09939 -0.13670 43  GLU A O   
686  C CB  . GLU A 43  ? 0.32420 0.54738 0.41324 -0.00646 -0.12499 -0.10379 43  GLU A CB  
687  C CG  . GLU A 43  ? 0.40064 0.63685 0.52714 -0.00297 -0.11015 -0.11410 43  GLU A CG  
688  C CD  . GLU A 43  ? 0.37080 0.62943 0.53657 0.02347  -0.13003 -0.11565 43  GLU A CD  
689  O OE1 . GLU A 43  ? 0.29086 0.51805 0.44189 0.04190  -0.14345 -0.09585 43  GLU A OE1 
690  O OE2 . GLU A 43  ? 0.27916 0.58693 0.49207 0.02541  -0.13259 -0.13783 43  GLU A OE2 
697  N N   A LYS A 44  ? 0.34362 0.52637 0.40182 -0.06004 -0.06658 -0.12215 44  LYS A N   
698  N N   B LYS A 44  ? 0.34343 0.52611 0.40165 -0.05998 -0.06656 -0.12210 44  LYS A N   
699  C CA  A LYS A 44  ? 0.32492 0.51194 0.38754 -0.08641 -0.05134 -0.13747 44  LYS A CA  
700  C CA  B LYS A 44  ? 0.32572 0.51209 0.38810 -0.08632 -0.05108 -0.13723 44  LYS A CA  
701  C C   A LYS A 44  ? 0.41294 0.55898 0.43921 -0.10060 -0.04273 -0.13700 44  LYS A C   
702  C C   B LYS A 44  ? 0.41520 0.56190 0.44156 -0.10066 -0.04308 -0.13724 44  LYS A C   
703  O O   A LYS A 44  ? 0.51809 0.65503 0.54280 -0.12378 -0.03113 -0.14757 44  LYS A O   
704  O O   B LYS A 44  ? 0.52043 0.65967 0.54563 -0.12409 -0.03214 -0.14853 44  LYS A O   
705  C CB  A LYS A 44  ? 0.44079 0.62361 0.51678 -0.09286 -0.03268 -0.13685 44  LYS A CB  
706  C CB  B LYS A 44  ? 0.44443 0.62343 0.51794 -0.09260 -0.03203 -0.13564 44  LYS A CB  
707  C CG  A LYS A 44  ? 0.52365 0.73851 0.63355 -0.07459 -0.03746 -0.13846 44  LYS A CG  
708  C CG  B LYS A 44  ? 0.46263 0.68235 0.57500 -0.07979 -0.03544 -0.14189 44  LYS A CG  
709  C CD  A LYS A 44  ? 0.47188 0.74824 0.62459 -0.07414 -0.05005 -0.15891 44  LYS A CD  
710  C CD  B LYS A 44  ? 0.49540 0.77442 0.64565 -0.08461 -0.04694 -0.16321 44  LYS A CD  
711  C CE  A LYS A 44  ? 0.50715 0.81442 0.67888 -0.10340 -0.03242 -0.17815 44  LYS A CE  
712  C CE  B LYS A 44  ? 0.47618 0.80061 0.66926 -0.08576 -0.03788 -0.17951 44  LYS A CE  
713  N NZ  A LYS A 44  ? 0.49377 0.85372 0.70438 -0.09575 -0.03991 -0.19343 44  LYS A NZ  
714  N NZ  B LYS A 44  ? 0.49187 0.86074 0.71251 -0.08955 -0.04140 -0.19531 44  LYS A NZ  
741  N N   . GLY A 45  ? 0.38389 0.50420 0.38161 -0.08825 -0.04738 -0.12616 45  GLY A N   
742  C CA  . GLY A 45  ? 0.39140 0.47740 0.35924 -0.09804 -0.03929 -0.13066 45  GLY A CA  
743  C C   . GLY A 45  ? 0.36706 0.40856 0.31951 -0.09125 -0.02462 -0.11889 45  GLY A C   
744  O O   . GLY A 45  ? 0.43079 0.44313 0.36328 -0.09533 -0.01795 -0.12479 45  GLY A O   
748  N N   . PHE A 46  ? 0.35402 0.39176 0.31755 -0.08036 -0.02031 -0.10492 46  PHE A N   
749  C CA  . PHE A 46  ? 0.38002 0.38195 0.33233 -0.07243 -0.00947 -0.09282 46  PHE A CA  
750  C C   . PHE A 46  ? 0.33850 0.35051 0.30174 -0.05660 -0.01200 -0.07858 46  PHE A C   
751  O O   . PHE A 46  ? 0.31079 0.35267 0.29416 -0.05313 -0.01973 -0.08015 46  PHE A O   
752  C CB  . PHE A 46  ? 0.36705 0.34179 0.31906 -0.08714 0.00191  -0.09443 46  PHE A CB  
753  C CG  . PHE A 46  ? 0.32393 0.32159 0.29458 -0.10105 0.00489  -0.09713 46  PHE A CG  
754  C CD1 . PHE A 46  ? 0.45559 0.47557 0.43640 -0.12095 0.00363  -0.11268 46  PHE A CD1 
755  C CD2 . PHE A 46  ? 0.34474 0.34579 0.32319 -0.09646 0.01018  -0.08686 46  PHE A CD2 
756  C CE1 . PHE A 46  ? 0.42477 0.47346 0.42527 -0.13634 0.00906  -0.11826 46  PHE A CE1 
757  C CE2 . PHE A 46  ? 0.38865 0.41673 0.38385 -0.11138 0.01588  -0.09312 46  PHE A CE2 
758  C CZ  . PHE A 46  ? 0.52732 0.58074 0.53452 -0.13163 0.01613  -0.10899 46  PHE A CZ  
768  N N   . GLY A 47  ? 0.30674 0.29501 0.25988 -0.04645 -0.00616 -0.06699 47  GLY A N   
769  C CA  . GLY A 47  ? 0.27106 0.26507 0.23367 -0.03388 -0.00804 -0.05512 47  GLY A CA  
770  C C   . GLY A 47  ? 0.28362 0.25671 0.23289 -0.02424 -0.00356 -0.04428 47  GLY A C   
771  O O   . GLY A 47  ? 0.29365 0.24744 0.23186 -0.02587 0.00329  -0.04672 47  GLY A O   
775  N N   . TYR A 48  ? 0.25353 0.23172 0.20700 -0.01412 -0.00819 -0.03408 48  TYR A N   
776  C CA  . TYR A 48  ? 0.22758 0.19102 0.17457 -0.00787 -0.00257 -0.02434 48  TYR A CA  
777  C C   . TYR A 48  ? 0.24248 0.20307 0.17083 -0.00691 -0.00155 -0.02171 48  TYR A C   
778  O O   . TYR A 48  ? 0.25781 0.21077 0.18331 -0.00416 0.00597  -0.01814 48  TYR A O   
779  C CB  . TYR A 48  ? 0.22630 0.19339 0.18497 -0.00062 -0.00710 -0.01608 48  TYR A CB  
780  C CG  . TYR A 48  ? 0.21558 0.18870 0.19163 -0.00209 -0.00403 -0.02089 48  TYR A CG  
781  C CD1 . TYR A 48  ? 0.22375 0.18789 0.19677 -0.00938 0.00504  -0.02267 48  TYR A CD1 
782  C CD2 . TYR A 48  ? 0.21400 0.20153 0.20860 0.00362  -0.01076 -0.02417 48  TYR A CD2 
783  C CE1 . TYR A 48  ? 0.21021 0.18209 0.19250 -0.01489 0.00921  -0.02644 48  TYR A CE1 
784  C CE2 . TYR A 48  ? 0.21565 0.21464 0.22585 0.00050  -0.00504 -0.03262 48  TYR A CE2 
785  C CZ  . TYR A 48  ? 0.18613 0.17862 0.18726 -0.01079 0.00590  -0.03326 48  TYR A CZ  
786  O OH  . TYR A 48  ? 0.19287 0.19964 0.20369 -0.01780 0.01269  -0.04149 48  TYR A OH  
796  N N   . LYS A 49  ? 0.26992 0.24059 0.18532 -0.01035 -0.00890 -0.02407 49  LYS A N   
797  C CA  . LYS A 49  ? 0.27143 0.24309 0.16384 -0.01301 -0.00659 -0.02080 49  LYS A CA  
798  C C   . LYS A 49  ? 0.29817 0.26413 0.18709 -0.01454 0.00792  -0.03293 49  LYS A C   
799  O O   . LYS A 49  ? 0.29356 0.25474 0.18486 -0.01728 0.01086  -0.04727 49  LYS A O   
800  C CB  . LYS A 49  ? 0.29484 0.27924 0.16833 -0.01888 -0.01814 -0.02228 49  LYS A CB  
801  C CG  . LYS A 49  ? 0.32198 0.30952 0.16455 -0.02588 -0.01505 -0.01720 49  LYS A CG  
802  C CD  . LYS A 49  ? 0.39483 0.39478 0.21257 -0.03296 -0.03014 -0.01522 49  LYS A CD  
803  C CE  . LYS A 49  ? 0.51987 0.52346 0.29943 -0.04434 -0.02614 -0.00766 49  LYS A CE  
804  N NZ  . LYS A 49  ? 0.72145 0.73545 0.47003 -0.05240 -0.04467 -0.00103 49  LYS A NZ  
818  N N   . GLY A 50  ? 0.28916 0.25584 0.17481 -0.01287 0.01642  -0.02861 50  GLY A N   
819  C CA  . GLY A 50  ? 0.31236 0.27935 0.20153 -0.01066 0.02938  -0.04239 50  GLY A CA  
820  C C   . GLY A 50  ? 0.26658 0.22133 0.17930 -0.00105 0.03257  -0.04232 50  GLY A C   
821  O O   . GLY A 50  ? 0.34501 0.30090 0.26706 0.00491  0.04075  -0.05312 50  GLY A O   
825  N N   . SER A 51  ? 0.24624 0.19174 0.16912 0.00089  0.02562  -0.03164 51  SER A N   
826  C CA  . SER A 51  ? 0.26603 0.19897 0.20462 0.00729  0.02602  -0.02922 51  SER A CA  
827  C C   . SER A 51  ? 0.29876 0.24079 0.24581 0.01127  0.02823  -0.02088 51  SER A C   
828  O O   . SER A 51  ? 0.26337 0.21728 0.20387 0.00697  0.02961  -0.01508 51  SER A O   
829  C CB  . SER A 51  ? 0.28295 0.20691 0.22465 0.00318  0.01989  -0.02392 51  SER A CB  
830  O OG  . SER A 51  ? 0.26798 0.20246 0.21218 0.00207  0.01569  -0.01507 51  SER A OG  
836  N N   . CYS A 52  ? 0.24687 0.18179 0.20704 0.01792  0.02715  -0.01943 52  CYS A N   
837  C CA  . CYS A 52  ? 0.23372 0.18158 0.20523 0.02121  0.02881  -0.01505 52  CYS A CA  
838  C C   . CYS A 52  ? 0.27242 0.21491 0.24784 0.02012  0.02238  -0.00468 52  CYS A C   
839  O O   . CYS A 52  ? 0.26980 0.19903 0.24007 0.01758  0.01799  -0.00177 52  CYS A O   
840  C CB  . CYS A 52  ? 0.29664 0.24978 0.28457 0.03206  0.03136  -0.02513 52  CYS A CB  
841  S SG  . CYS A 52  ? 0.33260 0.26017 0.32943 0.04250  0.01988  -0.02150 52  CYS A SG  
847  N N   . PHE A 53  ? 0.20545 0.16120 0.18886 0.01912  0.02321  -0.00083 53  PHE A N   
848  C CA  . PHE A 53  ? 0.21036 0.16535 0.19889 0.01828  0.01758  0.00514  53  PHE A CA  
849  C C   . PHE A 53  ? 0.23993 0.19848 0.24089 0.02722  0.01311  0.00351  53  PHE A C   
850  O O   . PHE A 53  ? 0.26333 0.24119 0.27961 0.03122  0.01592  -0.00162 53  PHE A O   
851  C CB  . PHE A 53  ? 0.24150 0.20661 0.23297 0.01125  0.01925  0.00848  53  PHE A CB  
852  C CG  . PHE A 53  ? 0.20102 0.15606 0.18351 0.00611  0.01773  0.01175  53  PHE A CG  
853  C CD1 . PHE A 53  ? 0.26620 0.21857 0.23907 0.00349  0.01924  0.01375  53  PHE A CD1 
854  C CD2 . PHE A 53  ? 0.24305 0.19301 0.22715 0.00453  0.01367  0.01149  53  PHE A CD2 
855  C CE1 . PHE A 53  ? 0.27183 0.21439 0.24017 0.00231  0.01353  0.01724  53  PHE A CE1 
856  C CE2 . PHE A 53  ? 0.30361 0.24672 0.28679 0.00365  0.01099  0.01095  53  PHE A CE2 
857  C CZ  . PHE A 53  ? 0.34894 0.28721 0.32588 0.00404  0.00932  0.01470  53  PHE A CZ  
867  N N   . HIS A 54  ? 0.24235 0.18343 0.23719 0.02974  0.00535  0.00797  54  HIS A N   
868  C CA  . HIS A 54  ? 0.22908 0.16580 0.23433 0.04130  -0.00358 0.00856  54  HIS A CA  
869  C C   . HIS A 54  ? 0.24663 0.19487 0.25702 0.04150  -0.01311 0.01507  54  HIS A C   
870  O O   . HIS A 54  ? 0.26409 0.21602 0.28883 0.05358  -0.02341 0.01532  54  HIS A O   
871  C CB  . HIS A 54  ? 0.27036 0.17442 0.26185 0.04236  -0.00988 0.01307  54  HIS A CB  
872  C CG  . HIS A 54  ? 0.29832 0.18953 0.26800 0.02877  -0.01317 0.02377  54  HIS A CG  
873  N ND1 . HIS A 54  ? 0.32564 0.21734 0.28382 0.01612  -0.00480 0.02163  54  HIS A ND1 
874  C CD2 . HIS A 54  ? 0.33657 0.21839 0.29369 0.02481  -0.02366 0.03527  54  HIS A CD2 
875  C CE1 . HIS A 54  ? 0.33152 0.21778 0.27353 0.00440  -0.00721 0.02866  54  HIS A CE1 
876  N NE2 . HIS A 54  ? 0.32261 0.20138 0.25983 0.00784  -0.01832 0.03811  54  HIS A NE2 
884  N N   A ARG A 55  ? 0.21773 0.17260 0.21857 0.02949  -0.01130 0.01844  55  ARG A N   
885  N N   B ARG A 55  ? 0.22371 0.17918 0.22500 0.02955  -0.01124 0.01831  55  ARG A N   
886  C CA  A ARG A 55  ? 0.22958 0.19592 0.23080 0.02641  -0.02042 0.02262  55  ARG A CA  
887  C CA  B ARG A 55  ? 0.23379 0.20026 0.23538 0.02677  -0.02076 0.02269  55  ARG A CA  
888  C C   A ARG A 55  ? 0.20304 0.18599 0.20837 0.01596  -0.01301 0.01729  55  ARG A C   
889  C C   B ARG A 55  ? 0.20292 0.18570 0.20757 0.01585  -0.01378 0.01767  55  ARG A C   
890  O O   A ARG A 55  ? 0.23219 0.20664 0.22693 0.00796  -0.00633 0.01569  55  ARG A O   
891  O O   B ARG A 55  ? 0.25292 0.22715 0.24541 0.00719  -0.00812 0.01644  55  ARG A O   
892  C CB  A ARG A 55  ? 0.25433 0.20176 0.23026 0.01913  -0.02816 0.03222  55  ARG A CB  
893  C CB  B ARG A 55  ? 0.27706 0.22358 0.25363 0.02033  -0.02904 0.03266  55  ARG A CB  
894  C CG  A ARG A 55  ? 0.32632 0.28458 0.29609 0.01545  -0.04069 0.03766  55  ARG A CG  
895  C CG  B ARG A 55  ? 0.33322 0.29043 0.30254 0.01579  -0.04116 0.03814  55  ARG A CG  
896  C CD  A ARG A 55  ? 0.42884 0.36557 0.36637 0.00604  -0.04883 0.05003  55  ARG A CD  
897  C CD  B ARG A 55  ? 0.45426 0.38795 0.39276 0.00843  -0.05068 0.05146  55  ARG A CD  
898  N NE  A ARG A 55  ? 0.53736 0.48103 0.46586 0.00570  -0.06658 0.05898  55  ARG A NE  
899  N NE  B ARG A 55  ? 0.57409 0.51792 0.49043 -0.00871 -0.05017 0.05151  55  ARG A NE  
900  C CZ  A ARG A 55  ? 0.75798 0.71255 0.66436 -0.01008 -0.06858 0.05962  55  ARG A CZ  
901  C CZ  B ARG A 55  ? 0.67332 0.62727 0.57846 -0.01240 -0.06438 0.05760  55  ARG A CZ  
902  N NH1 A ARG A 55  ? 0.75384 0.71394 0.64887 -0.02529 -0.05263 0.04953  55  ARG A NH1 
903  N NH1 B ARG A 55  ? 0.68393 0.63989 0.60181 0.00212  -0.08262 0.06550  55  ARG A NH1 
904  N NH2 A ARG A 55  ? 0.61904 0.58119 0.51580 -0.00990 -0.08768 0.06862  55  ARG A NH2 
905  N NH2 B ARG A 55  ? 0.67518 0.64026 0.55770 -0.03023 -0.06101 0.05368  55  ARG A NH2 
932  N N   . ILE A 56  ? 0.18932 0.19560 0.21263 0.01612  -0.01498 0.01340  56  ILE A N   
933  C CA  . ILE A 56  ? 0.18503 0.20197 0.21237 0.00395  -0.00922 0.00862  56  ILE A CA  
934  C C   . ILE A 56  ? 0.18690 0.22532 0.22364 0.00047  -0.01901 0.00638  56  ILE A C   
935  O O   . ILE A 56  ? 0.18778 0.24920 0.24529 0.00744  -0.02438 0.00411  56  ILE A O   
936  C CB  . ILE A 56  ? 0.20429 0.22978 0.24304 0.00052  0.00188  0.00504  56  ILE A CB  
937  C CG1 . ILE A 56  ? 0.21538 0.22136 0.24127 0.00304  0.00897  0.00746  56  ILE A CG1 
938  C CG2 . ILE A 56  ? 0.20317 0.23159 0.24388 -0.01438 0.00504  0.00257  56  ILE A CG2 
939  C CD1 . ILE A 56  ? 0.29362 0.30627 0.32151 -0.00337 0.01926  0.00647  56  ILE A CD1 
951  N N   . ILE A 57  ? 0.19249 0.22719 0.21615 -0.01002 -0.02165 0.00437  57  ILE A N   
952  C CA  . ILE A 57  ? 0.20133 0.25718 0.22949 -0.01660 -0.03177 0.00049  57  ILE A CA  
953  C C   . ILE A 57  ? 0.19968 0.25802 0.23358 -0.03151 -0.02420 -0.00968 57  ILE A C   
954  O O   . ILE A 57  ? 0.20385 0.24433 0.22421 -0.03815 -0.01930 -0.01464 57  ILE A O   
955  C CB  . ILE A 57  ? 0.21928 0.26876 0.22203 -0.01913 -0.04230 0.00514  57  ILE A CB  
956  C CG1 . ILE A 57  ? 0.23062 0.26800 0.22579 -0.00576 -0.05159 0.01830  57  ILE A CG1 
957  C CG2 . ILE A 57  ? 0.23217 0.30628 0.23656 -0.02740 -0.05448 0.00031  57  ILE A CG2 
958  C CD1 . ILE A 57  ? 0.34861 0.37159 0.31013 -0.01242 -0.05973 0.02727  57  ILE A CD1 
970  N N   . PRO A 58  ? 0.19754 0.27719 0.25316 -0.03765 -0.02286 -0.01444 58  PRO A N   
971  C CA  . PRO A 58  ? 0.20418 0.27842 0.26355 -0.05472 -0.01630 -0.02269 58  PRO A CA  
972  C C   . PRO A 58  ? 0.22550 0.29763 0.27325 -0.06415 -0.02255 -0.03244 58  PRO A C   
973  O O   . PRO A 58  ? 0.25791 0.35084 0.30179 -0.06382 -0.03427 -0.03398 58  PRO A O   
974  C CB  . PRO A 58  ? 0.20356 0.31045 0.28879 -0.06254 -0.01532 -0.02646 58  PRO A CB  
975  C CG  . PRO A 58  ? 0.26309 0.38623 0.35998 -0.04577 -0.01537 -0.02093 58  PRO A CG  
976  C CD  . PRO A 58  ? 0.20603 0.31677 0.28653 -0.03020 -0.02678 -0.01439 58  PRO A CD  
984  N N   . GLY A 59  ? 0.23466 0.28125 0.27663 -0.07242 -0.01580 -0.03993 59  GLY A N   
985  C CA  . GLY A 59  ? 0.30360 0.34721 0.33559 -0.08136 -0.01877 -0.05463 59  GLY A CA  
986  C C   . GLY A 59  ? 0.27573 0.31487 0.28659 -0.07408 -0.01928 -0.05569 59  GLY A C   
987  O O   . GLY A 59  ? 0.28295 0.32865 0.28156 -0.08271 -0.02134 -0.06942 59  GLY A O   
991  N N   . PHE A 60  ? 0.23057 0.26077 0.23548 -0.06121 -0.01646 -0.04309 60  PHE A N   
992  C CA  . PHE A 60  ? 0.23429 0.26082 0.21882 -0.05816 -0.01490 -0.04337 60  PHE A CA  
993  C C   . PHE A 60  ? 0.24231 0.24891 0.22987 -0.04814 -0.00644 -0.03908 60  PHE A C   
994  O O   . PHE A 60  ? 0.22666 0.22297 0.21668 -0.04838 -0.00011 -0.05149 60  PHE A O   
995  C CB  . PHE A 60  ? 0.25383 0.29453 0.22295 -0.05580 -0.02559 -0.03013 60  PHE A CB  
996  C CG  . PHE A 60  ? 0.27551 0.31097 0.21788 -0.05833 -0.02378 -0.02712 60  PHE A CG  
997  C CD1 . PHE A 60  ? 0.29567 0.32835 0.23057 -0.06544 -0.01254 -0.04272 60  PHE A CD1 
998  C CD2 . PHE A 60  ? 0.26552 0.29884 0.19151 -0.05434 -0.03344 -0.00947 60  PHE A CD2 
999  C CE1 . PHE A 60  ? 0.33694 0.37095 0.24739 -0.07201 -0.00824 -0.04126 60  PHE A CE1 
1000 C CE2 . PHE A 60  ? 0.32677 0.35256 0.22426 -0.06160 -0.03108 -0.00442 60  PHE A CE2 
1001 C CZ  . PHE A 60  ? 0.32231 0.35153 0.21136 -0.07226 -0.01709 -0.02058 60  PHE A CZ  
1011 N N   . MET A 61  ? 0.21790 0.22069 0.20781 -0.03857 -0.00703 -0.02429 61  MET A N   
1012 C CA  A MET A 61  ? 0.20121 0.18872 0.19107 -0.03076 -0.00073 -0.02112 61  MET A CA  
1013 C CA  B MET A 61  ? 0.20121 0.18862 0.19128 -0.03079 -0.00069 -0.02123 61  MET A CA  
1014 C C   . MET A 61  ? 0.21408 0.19844 0.20930 -0.02224 -0.00095 -0.00834 61  MET A C   
1015 O O   . MET A 61  ? 0.20926 0.20520 0.20884 -0.01999 -0.00579 -0.00255 61  MET A O   
1016 C CB  A MET A 61  ? 0.20671 0.19591 0.17980 -0.03250 0.00156  -0.02284 61  MET A CB  
1017 C CB  B MET A 61  ? 0.20678 0.19584 0.18061 -0.03269 0.00193  -0.02392 61  MET A CB  
1018 C CG  A MET A 61  ? 0.27571 0.27008 0.23144 -0.03417 -0.00598 -0.01054 61  MET A CG  
1019 C CG  B MET A 61  ? 0.36416 0.35885 0.31944 -0.03524 -0.00488 -0.01258 61  MET A CG  
1020 S SD  A MET A 61  ? 0.31378 0.29901 0.24844 -0.03743 -0.00237 -0.00390 61  MET A SD  
1021 S SD  B MET A 61  ? 0.31213 0.29218 0.26721 -0.02445 -0.00549 0.00219  61  MET A SD  
1022 C CE  A MET A 61  ? 0.50483 0.50552 0.42522 -0.05345 0.00596  -0.02134 61  MET A CE  
1023 C CE  B MET A 61  ? 0.43486 0.41216 0.36819 -0.02669 -0.01822 0.01653  61  MET A CE  
1041 N N   . CYS A 62  ? 0.18705 0.15846 0.18359 -0.01691 0.00373  -0.00642 62  CYS A N   
1042 C CA  . CYS A 62  ? 0.18289 0.15094 0.17953 -0.00984 0.00529  0.00211  62  CYS A CA  
1043 C C   . CYS A 62  ? 0.22195 0.18338 0.20873 -0.00673 0.00651  0.00258  62  CYS A C   
1044 O O   . CYS A 62  ? 0.26201 0.22005 0.24927 -0.00768 0.00886  -0.00373 62  CYS A O   
1045 C CB  . CYS A 62  ? 0.23657 0.19577 0.23793 -0.00997 0.00843  0.00463  62  CYS A CB  
1046 S SG  . CYS A 62  ? 0.27517 0.23844 0.28555 -0.02008 0.00923  0.00505  62  CYS A SG  
1052 N N   . GLN A 63  ? 0.19744 0.15700 0.17814 -0.00304 0.00445  0.00859  63  GLN A N   
1053 C CA  . GLN A 63  ? 0.20320 0.15381 0.17255 -0.00450 0.00567  0.00964  63  GLN A CA  
1054 C C   . GLN A 63  ? 0.25251 0.19487 0.22346 0.00174  0.00745  0.01152  63  GLN A C   
1055 O O   . GLN A 63  ? 0.23707 0.17971 0.21372 0.00857  0.00600  0.01366  63  GLN A O   
1056 C CB  . GLN A 63  ? 0.25381 0.19979 0.20828 -0.00880 -0.00013 0.01616  63  GLN A CB  
1057 C CG  . GLN A 63  ? 0.27106 0.20477 0.21027 -0.01609 0.00230  0.01845  63  GLN A CG  
1058 C CD  . GLN A 63  ? 0.32939 0.25451 0.24580 -0.02570 -0.00405 0.02801  63  GLN A CD  
1059 O OE1 . GLN A 63  ? 0.44150 0.37468 0.35277 -0.02728 -0.01050 0.03083  63  GLN A OE1 
1060 N NE2 . GLN A 63  ? 0.36495 0.27266 0.26490 -0.03450 -0.00328 0.03390  63  GLN A NE2 
1069 N N   . GLY A 64  ? 0.21063 0.14960 0.17846 -0.00091 0.01067  0.00789  64  GLY A N   
1070 C CA  . GLY A 64  ? 0.21848 0.15056 0.18490 0.00248  0.01192  0.00728  64  GLY A CA  
1071 C C   . GLY A 64  ? 0.22145 0.14993 0.18180 -0.00471 0.01360  0.00352  64  GLY A C   
1072 O O   . GLY A 64  ? 0.23461 0.16489 0.18937 -0.01357 0.01488  0.00299  64  GLY A O   
1076 N N   . GLY A 65  ? 0.20663 0.12879 0.23565 0.00780  0.02199  -0.00453 65  GLY A N   
1077 C CA  . GLY A 65  ? 0.21428 0.14121 0.22511 0.00461  0.01554  0.00102  65  GLY A CA  
1078 C C   . GLY A 65  ? 0.23145 0.15160 0.21489 -0.00036 0.00755  -0.00243 65  GLY A C   
1079 O O   . GLY A 65  ? 0.23511 0.16008 0.21074 -0.00570 0.00524  -0.00240 65  GLY A O   
1083 N N   . ASP A 66  ? 0.22083 0.13044 0.19402 0.00146  0.00608  -0.00643 66  ASP A N   
1084 C CA  . ASP A 66  ? 0.24183 0.13900 0.19470 -0.00152 0.00473  -0.00724 66  ASP A CA  
1085 C C   . ASP A 66  ? 0.26450 0.16204 0.21185 -0.00291 0.00377  -0.00745 66  ASP A C   
1086 O O   . ASP A 66  ? 0.26791 0.15873 0.21008 0.00138  0.00373  -0.00783 66  ASP A O   
1087 C CB  . ASP A 66  ? 0.28509 0.17460 0.22833 0.00591  0.00555  -0.00862 66  ASP A CB  
1088 C CG  . ASP A 66  ? 0.29232 0.16229 0.21944 0.00566  0.01113  -0.00467 66  ASP A CG  
1089 O OD1 . ASP A 66  ? 0.26911 0.13214 0.19801 -0.00435 0.01430  -0.00727 66  ASP A OD1 
1090 O OD2 . ASP A 66  ? 0.29942 0.16419 0.21573 0.01672  0.01459  -0.00035 66  ASP A OD2 
1095 N N   . PHE A 67  ? 0.23870 0.15104 0.18767 -0.00789 0.00260  -0.01001 67  PHE A N   
1096 C CA  . PHE A 67  ? 0.24391 0.17255 0.18871 -0.00673 0.00050  -0.01499 67  PHE A CA  
1097 C C   . PHE A 67  ? 0.28916 0.20802 0.23040 -0.01665 0.00317  -0.03055 67  PHE A C   
1098 O O   . PHE A 67  ? 0.28474 0.22339 0.22546 -0.01714 0.00125  -0.04220 67  PHE A O   
1099 C CB  . PHE A 67  ? 0.24031 0.20577 0.19068 -0.00219 -0.00205 -0.01294 67  PHE A CB  
1100 C CG  . PHE A 67  ? 0.24068 0.21652 0.19760 -0.01195 -0.00282 -0.02215 67  PHE A CG  
1101 C CD1 . PHE A 67  ? 0.30098 0.28993 0.26152 -0.02347 -0.00277 -0.04341 67  PHE A CD1 
1102 C CD2 . PHE A 67  ? 0.24251 0.21731 0.20737 -0.01059 -0.00155 -0.01296 67  PHE A CD2 
1103 C CE1 . PHE A 67  ? 0.40936 0.40904 0.38156 -0.03405 -0.00087 -0.05429 67  PHE A CE1 
1104 C CE2 . PHE A 67  ? 0.25260 0.23827 0.22405 -0.01948 -0.00167 -0.02136 67  PHE A CE2 
1105 C CZ  . PHE A 67  ? 0.29926 0.29716 0.27451 -0.03139 -0.00108 -0.04144 67  PHE A CZ  
1115 N N   . THR A 68  ? 0.26864 0.15967 0.21013 -0.02265 0.01056  -0.03116 68  THR A N   
1116 C CA  . THR A 68  ? 0.28883 0.16286 0.23514 -0.03125 0.02066  -0.04413 68  THR A CA  
1117 C C   . THR A 68  ? 0.32530 0.16844 0.26209 -0.02334 0.02741  -0.03567 68  THR A C   
1118 O O   . THR A 68  ? 0.33687 0.16865 0.27880 -0.02733 0.03514  -0.04673 68  THR A O   
1119 C CB  . THR A 68  ? 0.33375 0.19706 0.29435 -0.04305 0.03303  -0.05021 68  THR A CB  
1120 O OG1 . THR A 68  ? 0.33014 0.17115 0.28248 -0.03538 0.03927  -0.03069 68  THR A OG1 
1121 C CG2 . THR A 68  ? 0.33688 0.23727 0.30898 -0.05089 0.02602  -0.06242 68  THR A CG2 
1129 N N   A ARG A 69  ? 0.31355 0.14885 0.23915 -0.01113 0.02505  -0.01952 69  ARG A N   
1130 N N   B ARG A 69  ? 0.31405 0.14881 0.23973 -0.01122 0.02541  -0.01940 69  ARG A N   
1131 C CA  A ARG A 69  ? 0.33298 0.14933 0.24819 0.00079  0.03043  -0.01146 69  ARG A CA  
1132 C CA  B ARG A 69  ? 0.32042 0.13661 0.23553 0.00095  0.03058  -0.01114 69  ARG A CA  
1133 C C   A ARG A 69  ? 0.29500 0.12607 0.20366 0.01188  0.01935  -0.00791 69  ARG A C   
1134 C C   B ARG A 69  ? 0.29927 0.13028 0.20812 0.01147  0.01929  -0.00834 69  ARG A C   
1135 O O   A ARG A 69  ? 0.35297 0.17687 0.25338 0.02316  0.02154  -0.00393 69  ARG A O   
1136 O O   B ARG A 69  ? 0.30500 0.12819 0.20610 0.02170  0.02132  -0.00533 69  ARG A O   
1137 C CB  A ARG A 69  ? 0.37344 0.17227 0.28371 0.00955  0.04417  0.00270  69  ARG A CB  
1138 C CB  B ARG A 69  ? 0.39199 0.19304 0.30098 0.01102  0.04294  0.00371  69  ARG A CB  
1139 C CG  A ARG A 69  ? 0.41249 0.19151 0.33812 -0.00325 0.06189  -0.00118 69  ARG A CG  
1140 C CG  B ARG A 69  ? 0.46178 0.23394 0.38220 0.00389  0.06499  0.00453  69  ARG A CG  
1141 C CD  A ARG A 69  ? 0.55255 0.30809 0.47474 0.00957  0.08366  0.01948  69  ARG A CD  
1142 C CD  B ARG A 69  ? 0.54369 0.29788 0.45480 0.02274  0.08369  0.02842  69  ARG A CD  
1143 N NE  A ARG A 69  ? 0.49130 0.23147 0.40117 0.02915  0.09256  0.03353  69  ARG A NE  
1144 N NE  B ARG A 69  ? 0.67715 0.43426 0.57011 0.04530  0.08167  0.04047  69  ARG A NE  
1145 C CZ  A ARG A 69  ? 0.52617 0.23772 0.44718 0.02681  0.10883  0.03005  69  ARG A CZ  
1146 C CZ  B ARG A 69  ? 0.56775 0.32061 0.44689 0.07079  0.09655  0.06425  69  ARG A CZ  
1147 N NH1 A ARG A 69  ? 0.62685 0.33276 0.53568 0.04790  0.11504  0.04522  69  ARG A NH1 
1148 N NH1 B ARG A 69  ? 0.43933 0.20542 0.30251 0.09245  0.09173  0.07132  69  ARG A NH1 
1149 N NH2 A ARG A 69  ? 0.50895 0.21349 0.45774 0.00368  0.11631  0.00757  69  ARG A NH2 
1150 N NH2 B ARG A 69  ? 0.68706 0.42751 0.56824 0.07739  0.11732  0.08217  69  ARG A NH2 
1177 N N   . HIS A 70  ? 0.28913 0.14092 0.20571 0.00942  0.01058  -0.00994 70  HIS A N   
1178 C CA  . HIS A 70  ? 0.28920 0.15363 0.21185 0.01575  0.00564  -0.01056 70  HIS A CA  
1179 C C   . HIS A 70  ? 0.30921 0.18067 0.23161 0.02660  0.00486  -0.01211 70  HIS A C   
1180 O O   . HIS A 70  ? 0.35988 0.24096 0.29065 0.03119  0.00329  -0.01757 70  HIS A O   
1181 C CB  . HIS A 70  ? 0.27805 0.14027 0.19715 0.01655  0.00539  -0.01268 70  HIS A CB  
1182 C CG  . HIS A 70  ? 0.27954 0.14297 0.19555 0.00857  0.00631  -0.01832 70  HIS A CG  
1183 N ND1 . HIS A 70  ? 0.32116 0.20645 0.24302 0.00482  0.00358  -0.01917 70  HIS A ND1 
1184 C CD2 . HIS A 70  ? 0.30960 0.16038 0.22196 0.00401  0.01133  -0.02722 70  HIS A CD2 
1185 C CE1 . HIS A 70  ? 0.30763 0.20151 0.22887 -0.00203 0.00419  -0.03224 70  HIS A CE1 
1186 N NE2 . HIS A 70  ? 0.32211 0.19256 0.24074 -0.00462 0.01007  -0.03912 70  HIS A NE2 
1194 N N   . ASN A 71  ? 0.33415 0.20822 0.24925 0.03232  0.00680  -0.00890 71  ASN A N   
1195 C CA  . ASN A 71  ? 0.33539 0.23132 0.24745 0.04791  0.00491  -0.01275 71  ASN A CA  
1196 C C   . ASN A 71  ? 0.31192 0.22957 0.22368 0.05407  0.00467  -0.01361 71  ASN A C   
1197 O O   . ASN A 71  ? 0.34560 0.29351 0.25152 0.07147  0.00288  -0.01789 71  ASN A O   
1198 C CB  . ASN A 71  ? 0.36133 0.24529 0.25369 0.06233  0.01051  -0.00275 71  ASN A CB  
1199 C CG  . ASN A 71  ? 0.39574 0.25361 0.27512 0.06480  0.02348  0.01387  71  ASN A CG  
1200 O OD1 . ASN A 71  ? 0.35428 0.20848 0.23739 0.05652  0.02651  0.01656  71  ASN A OD1 
1201 N ND2 . ASN A 71  ? 0.46825 0.30683 0.33633 0.07687  0.03453  0.02531  71  ASN A ND2 
1208 N N   . GLY A 72  ? 0.27070 0.18143 0.18823 0.04272  0.00601  -0.01111 72  GLY A N   
1209 C CA  . GLY A 72  ? 0.28488 0.21794 0.20299 0.04813  0.00603  -0.01282 72  GLY A CA  
1210 C C   . GLY A 72  ? 0.33934 0.25836 0.23835 0.05467  0.01621  0.00564  72  GLY A C   
1211 O O   . GLY A 72  ? 0.32854 0.26755 0.22573 0.06063  0.01757  0.00685  72  GLY A O   
1215 N N   . THR A 73  ? 0.35430 0.23973 0.24341 0.05364  0.02652  0.01896  73  THR A N   
1216 C CA  . THR A 73  ? 0.36981 0.23456 0.25020 0.05851  0.04412  0.03730  73  THR A CA  
1217 C C   . THR A 73  ? 0.40352 0.24298 0.29892 0.03508  0.05037  0.03358  73  THR A C   
1218 O O   . THR A 73  ? 0.44727 0.26728 0.34477 0.03451  0.06877  0.04519  73  THR A O   
1219 C CB  . THR A 73  ? 0.41469 0.25739 0.28273 0.07466  0.05943  0.05376  73  THR A CB  
1220 O OG1 . THR A 73  ? 0.40789 0.22487 0.28526 0.05953  0.05844  0.04406  73  THR A OG1 
1221 C CG2 . THR A 73  ? 0.51942 0.39772 0.37087 0.10255  0.05327  0.05742  73  THR A CG2 
1229 N N   . GLY A 74  ? 0.32358 0.16722 0.23164 0.01791  0.03795  0.01781  74  GLY A N   
1230 C CA  . GLY A 74  ? 0.33697 0.17114 0.25940 -0.00124 0.04178  0.00975  74  GLY A CA  
1231 C C   . GLY A 74  ? 0.34279 0.20023 0.27542 -0.01030 0.03026  0.00156  74  GLY A C   
1232 O O   . GLY A 74  ? 0.35653 0.23113 0.28866 -0.00380 0.02453  0.00366  74  GLY A O   
1236 N N   . GLY A 75  ? 0.29908 0.16232 0.24306 -0.02360 0.02791  -0.00965 75  GLY A N   
1237 C CA  . GLY A 75  ? 0.33844 0.22615 0.29237 -0.02916 0.01998  -0.01465 75  GLY A CA  
1238 C C   . GLY A 75  ? 0.34048 0.22987 0.30507 -0.03990 0.02829  -0.01924 75  GLY A C   
1239 O O   . GLY A 75  ? 0.36964 0.23804 0.33473 -0.04146 0.04291  -0.01431 75  GLY A O   
1243 N N   . LYS A 76  ? 0.27481 0.19140 0.24983 -0.04533 0.02144  -0.02710 76  LYS A N   
1244 C CA  . LYS A 76  ? 0.28168 0.20738 0.27029 -0.05595 0.02784  -0.03424 76  LYS A CA  
1245 C C   . LYS A 76  ? 0.26959 0.23004 0.26394 -0.05274 0.01669  -0.03540 76  LYS A C   
1246 O O   . LYS A 76  ? 0.28371 0.26241 0.27488 -0.04351 0.00775  -0.03246 76  LYS A O   
1247 C CB  . LYS A 76  ? 0.39169 0.31754 0.39799 -0.07143 0.03863  -0.05469 76  LYS A CB  
1248 C CG  . LYS A 76  ? 0.49708 0.45783 0.50901 -0.07350 0.02827  -0.07411 76  LYS A CG  
1249 C CD  . LYS A 76  ? 0.62905 0.59918 0.66868 -0.09205 0.04065  -0.10506 76  LYS A CD  
1250 C CE  . LYS A 76  ? 0.74343 0.76134 0.78790 -0.09142 0.02923  -0.12979 76  LYS A CE  
1251 N NZ  . LYS A 76  ? 0.82544 0.86312 0.90612 -0.11191 0.04182  -0.17082 76  LYS A NZ  
1265 N N   . SER A 77  ? 0.28187 0.25120 0.28560 -0.05807 0.02018  -0.03689 77  SER A N   
1266 C CA  . SER A 77  ? 0.23339 0.23603 0.24444 -0.05324 0.01209  -0.03664 77  SER A CA  
1267 C C   . SER A 77  ? 0.24557 0.28725 0.27021 -0.06076 0.00984  -0.05634 77  SER A C   
1268 O O   . SER A 77  ? 0.26473 0.30582 0.29933 -0.07405 0.01636  -0.07539 77  SER A O   
1269 C CB  . SER A 77  ? 0.22771 0.22653 0.24279 -0.05349 0.01584  -0.03009 77  SER A CB  
1270 O OG  . SER A 77  ? 0.27158 0.27643 0.29897 -0.06691 0.02424  -0.04102 77  SER A OG  
1276 N N   . ILE A 78  ? 0.22578 0.30626 0.25473 -0.05079 0.00233  -0.05380 78  ILE A N   
1277 C CA  . ILE A 78  ? 0.22951 0.36372 0.27178 -0.05381 -0.00177 -0.07512 78  ILE A CA  
1278 C C   . ILE A 78  ? 0.27116 0.40887 0.33349 -0.07232 0.00634  -0.09271 78  ILE A C   
1279 O O   . ILE A 78  ? 0.27403 0.45842 0.35527 -0.08029 0.00525  -0.11986 78  ILE A O   
1280 C CB  . ILE A 78  ? 0.24462 0.42567 0.28387 -0.03090 -0.01007 -0.06209 78  ILE A CB  
1281 C CG1 . ILE A 78  ? 0.22649 0.39584 0.27039 -0.02522 -0.00697 -0.04465 78  ILE A CG1 
1282 C CG2 . ILE A 78  ? 0.25848 0.43672 0.28244 -0.01126 -0.01243 -0.04255 78  ILE A CG2 
1283 C CD1 . ILE A 78  ? 0.23698 0.45500 0.28413 -0.00153 -0.01008 -0.03166 78  ILE A CD1 
1295 N N   . TYR A 79  ? 0.25166 0.34710 0.31220 -0.07806 0.01552  -0.07956 79  TYR A N   
1296 C CA  . TYR A 79  ? 0.25040 0.34260 0.32925 -0.09346 0.02759  -0.08961 79  TYR A CA  
1297 C C   . TYR A 79  ? 0.37489 0.42649 0.46373 -0.10936 0.04744  -0.09588 79  TYR A C   
1298 O O   . TYR A 79  ? 0.50549 0.54785 0.61321 -0.12204 0.06413  -0.10129 79  TYR A O   
1299 C CB  . TYR A 79  ? 0.28205 0.36002 0.35251 -0.08534 0.02790  -0.06878 79  TYR A CB  
1300 C CG  . TYR A 79  ? 0.29371 0.39889 0.35903 -0.06772 0.01483  -0.05784 79  TYR A CG  
1301 C CD1 . TYR A 79  ? 0.24672 0.40283 0.32407 -0.06334 0.00834  -0.06774 79  TYR A CD1 
1302 C CD2 . TYR A 79  ? 0.21931 0.30209 0.27247 -0.05411 0.01213  -0.03865 79  TYR A CD2 
1303 C CE1 . TYR A 79  ? 0.25412 0.43228 0.32900 -0.04286 0.00191  -0.05198 79  TYR A CE1 
1304 C CE2 . TYR A 79  ? 0.27379 0.37496 0.33122 -0.03805 0.00758  -0.02767 79  TYR A CE2 
1305 C CZ  . TYR A 79  ? 0.26242 0.40832 0.32939 -0.03095 0.00370  -0.03093 79  TYR A CZ  
1306 O OH  . TYR A 79  ? 0.22254 0.38439 0.29563 -0.01066 0.00435  -0.01442 79  TYR A OH  
1316 N N   . GLY A 80  ? 0.34790 0.37379 0.42672 -0.10738 0.04932  -0.09301 80  GLY A N   
1317 C CA  . GLY A 80  ? 0.44208 0.42267 0.52828 -0.11622 0.07161  -0.09082 80  GLY A CA  
1318 C C   . GLY A 80  ? 0.34111 0.28554 0.39718 -0.09970 0.06966  -0.06333 80  GLY A C   
1319 O O   . GLY A 80  ? 0.36172 0.31627 0.39687 -0.08551 0.05133  -0.05222 80  GLY A O   
1323 N N   A GLU A 81  ? 0.35195 0.25555 0.40942 -0.10006 0.09186  -0.05215 81  GLU A N   
1324 N N   B GLU A 81  ? 0.35310 0.25674 0.41075 -0.10017 0.09191  -0.05230 81  GLU A N   
1325 C CA  A GLU A 81  ? 0.38679 0.26421 0.41668 -0.08213 0.09062  -0.02909 81  GLU A CA  
1326 C CA  B GLU A 81  ? 0.39326 0.27051 0.42332 -0.08220 0.09089  -0.02902 81  GLU A CA  
1327 C C   A GLU A 81  ? 0.34154 0.23140 0.34755 -0.06508 0.07654  -0.01115 81  GLU A C   
1328 C C   B GLU A 81  ? 0.34170 0.23200 0.34795 -0.06528 0.07633  -0.01147 81  GLU A C   
1329 O O   A GLU A 81  ? 0.43729 0.32958 0.42502 -0.05229 0.06283  -0.00472 81  GLU A O   
1330 O O   B GLU A 81  ? 0.43979 0.33322 0.42812 -0.05284 0.06212  -0.00557 81  GLU A O   
1331 C CB  A GLU A 81  ? 0.55480 0.39068 0.59066 -0.07964 0.12153  -0.01435 81  GLU A CB  
1332 C CB  B GLU A 81  ? 0.54527 0.38125 0.58116 -0.07951 0.12194  -0.01378 81  GLU A CB  
1333 C CG  A GLU A 81  ? 0.55328 0.36972 0.61938 -0.09629 0.14030  -0.03481 81  GLU A CG  
1334 C CG  B GLU A 81  ? 0.56650 0.38304 0.57340 -0.05685 0.12220  0.01048  81  GLU A CG  
1335 C CD  A GLU A 81  ? 0.68939 0.49110 0.74058 -0.08738 0.13427  -0.03239 81  GLU A CD  
1336 C CD  B GLU A 81  ? 0.66223 0.43970 0.67461 -0.04787 0.15761  0.03221  81  GLU A CD  
1337 O OE1 A GLU A 81  ? 0.50819 0.33678 0.54723 -0.08660 0.10777  -0.04460 81  GLU A OE1 
1338 O OE1 B GLU A 81  ? 0.66522 0.43359 0.68998 -0.04840 0.18086  0.04381  81  GLU A OE1 
1339 O OE2 A GLU A 81  ? 0.85851 0.62364 0.91032 -0.07824 0.15766  -0.01567 81  GLU A OE2 
1340 O OE2 B GLU A 81  ? 0.70156 0.45683 0.70734 -0.03853 0.16498  0.03990  81  GLU A OE2 
1353 N N   . LYS A 82  ? 0.33798 0.23850 0.34837 -0.06559 0.08124  -0.00661 82  LYS A N   
1354 C CA  . LYS A 82  ? 0.30765 0.22497 0.30144 -0.05056 0.07020  0.00419  82  LYS A CA  
1355 C C   . LYS A 82  ? 0.31427 0.25539 0.32173 -0.05817 0.06691  -0.00327 82  LYS A C   
1356 O O   . LYS A 82  ? 0.34028 0.28237 0.36754 -0.07286 0.07802  -0.01211 82  LYS A O   
1357 C CB  . LYS A 82  ? 0.41125 0.31737 0.38685 -0.03240 0.08466  0.02566  82  LYS A CB  
1358 C CG  . LYS A 82  ? 0.63637 0.52474 0.62205 -0.03537 0.11315  0.03796  82  LYS A CG  
1359 C CD  . LYS A 82  ? 0.86245 0.74215 0.82598 -0.00950 0.13108  0.06637  82  LYS A CD  
1360 C CE  . LYS A 82  ? 0.98155 0.83779 0.95895 -0.00969 0.16747  0.08505  82  LYS A CE  
1361 N NZ  . LYS A 82  ? 1.01913 0.89544 1.00846 -0.01877 0.16855  0.07958  82  LYS A NZ  
1375 N N   . PHE A 83  ? 0.26344 0.22571 0.26520 -0.04871 0.05315  -0.00283 83  PHE A N   
1376 C CA  . PHE A 83  ? 0.25415 0.23879 0.26777 -0.05240 0.05119  -0.00765 83  PHE A CA  
1377 C C   . PHE A 83  ? 0.24910 0.24872 0.25375 -0.03788 0.04778  -0.00332 83  PHE A C   
1378 O O   . PHE A 83  ? 0.24955 0.24957 0.24136 -0.02523 0.04412  -0.00080 83  PHE A O   
1379 C CB  . PHE A 83  ? 0.23519 0.24070 0.26392 -0.05858 0.03825  -0.01968 83  PHE A CB  
1380 C CG  . PHE A 83  ? 0.21854 0.23046 0.24596 -0.04769 0.02578  -0.01860 83  PHE A CG  
1381 C CD1 . PHE A 83  ? 0.22873 0.22900 0.24909 -0.04439 0.02132  -0.01721 83  PHE A CD1 
1382 C CD2 . PHE A 83  ? 0.23211 0.26084 0.27103 -0.04128 0.02205  -0.01961 83  PHE A CD2 
1383 C CE1 . PHE A 83  ? 0.20585 0.20975 0.23135 -0.03480 0.01529  -0.01507 83  PHE A CE1 
1384 C CE2 . PHE A 83  ? 0.21685 0.24669 0.26457 -0.03208 0.01796  -0.01860 83  PHE A CE2 
1385 C CZ  . PHE A 83  ? 0.27299 0.29004 0.31460 -0.02896 0.01548  -0.01552 83  PHE A CZ  
1395 N N   . GLU A 84  ? 0.24532 0.26345 0.25942 -0.03981 0.04944  -0.00627 84  GLU A N   
1396 C CA  . GLU A 84  ? 0.24555 0.28492 0.25365 -0.02686 0.04965  -0.00597 84  GLU A CA  
1397 C C   . GLU A 84  ? 0.22536 0.28205 0.24434 -0.02072 0.03636  -0.02035 84  GLU A C   
1398 O O   . GLU A 84  ? 0.21325 0.26408 0.24679 -0.02589 0.02951  -0.02551 84  GLU A O   
1399 C CB  . GLU A 84  ? 0.24909 0.30268 0.26677 -0.03208 0.05734  -0.00583 84  GLU A CB  
1400 C CG  . GLU A 84  ? 0.22927 0.29706 0.26930 -0.04102 0.04803  -0.01806 84  GLU A CG  
1401 C CD  . GLU A 84  ? 0.35699 0.41930 0.40931 -0.05578 0.04862  -0.02130 84  GLU A CD  
1402 O OE1 . GLU A 84  ? 0.24000 0.28324 0.28834 -0.06260 0.05442  -0.01927 84  GLU A OE1 
1403 O OE2 . GLU A 84  ? 0.26188 0.34487 0.33037 -0.05930 0.04377  -0.02850 84  GLU A OE2 
1410 N N   . ASP A 85  ? 0.18109 0.24454 0.20595 -0.00577 0.01513  0.00336  85  ASP A N   
1411 C CA  . ASP A 85  ? 0.16209 0.22613 0.18509 0.00917  0.00947  0.00424  85  ASP A CA  
1412 C C   . ASP A 85  ? 0.18714 0.27866 0.21601 0.01597  0.00891  0.00410  85  ASP A C   
1413 O O   . ASP A 85  ? 0.20069 0.30753 0.23236 0.01538  0.01359  0.00419  85  ASP A O   
1414 C CB  . ASP A 85  ? 0.17250 0.22603 0.19028 0.01219  0.00853  0.00929  85  ASP A CB  
1415 C CG  . ASP A 85  ? 0.20072 0.23459 0.22504 0.00995  0.00749  0.01760  85  ASP A CG  
1416 O OD1 . ASP A 85  ? 0.19256 0.21364 0.22289 0.01285  0.00862  0.01440  85  ASP A OD1 
1417 O OD2 . ASP A 85  ? 0.18235 0.21659 0.20881 0.00501  0.00624  0.02995  85  ASP A OD2 
1422 N N   . GLU A 86  ? 0.16551 0.26504 0.20029 0.02280  0.00462  0.00660  86  GLU A N   
1423 C CA  . GLU A 86  ? 0.16262 0.29474 0.21588 0.03092  0.00422  0.01431  86  GLU A CA  
1424 C C   . GLU A 86  ? 0.18302 0.30950 0.24597 0.04729  0.01466  0.01216  86  GLU A C   
1425 O O   . GLU A 86  ? 0.20860 0.35768 0.28697 0.05067  0.02285  0.01315  86  GLU A O   
1426 C CB  . GLU A 86  ? 0.19903 0.34329 0.25809 0.03259  -0.00459 0.02439  86  GLU A CB  
1427 C CG  . GLU A 86  ? 0.18620 0.37382 0.27421 0.04091  -0.00800 0.04218  86  GLU A CG  
1428 C CD  . GLU A 86  ? 0.16889 0.38031 0.25866 0.03359  -0.02144 0.05849  86  GLU A CD  
1429 O OE1 . GLU A 86  ? 0.18864 0.37466 0.25524 0.02533  -0.02452 0.05199  86  GLU A OE1 
1430 O OE2 . GLU A 86  ? 0.16067 0.42100 0.27647 0.03438  -0.02902 0.08007  86  GLU A OE2 
1437 N N   . ASN A 87  ? 0.19384 0.29011 0.24757 0.05471  0.01759  0.00700  87  ASN A N   
1438 C CA  . ASN A 87  ? 0.17894 0.26026 0.23283 0.06288  0.03252  -0.00193 87  ASN A CA  
1439 C C   . ASN A 87  ? 0.22803 0.27613 0.26204 0.06038  0.03054  -0.00829 87  ASN A C   
1440 O O   . ASN A 87  ? 0.22799 0.26895 0.25671 0.05755  0.01876  -0.00320 87  ASN A O   
1441 C CB  . ASN A 87  ? 0.21838 0.31232 0.30601 0.08179  0.04481  0.00476  87  ASN A CB  
1442 C CG  . ASN A 87  ? 0.23219 0.32165 0.33475 0.09345  0.03757  0.01910  87  ASN A CG  
1443 O OD1 . ASN A 87  ? 0.24311 0.30027 0.33051 0.09362  0.03782  0.01367  87  ASN A OD1 
1444 N ND2 . ASN A 87  ? 0.21837 0.34493 0.35128 0.10086  0.03035  0.04022  87  ASN A ND2 
1451 N N   . PHE A 88  ? 0.23491 0.26423 0.25706 0.05816  0.04431  -0.02110 88  PHE A N   
1452 C CA  . PHE A 88  ? 0.25701 0.25895 0.25919 0.05121  0.04336  -0.02802 88  PHE A CA  
1453 C C   . PHE A 88  ? 0.26810 0.24474 0.27664 0.05978  0.06372  -0.03846 88  PHE A C   
1454 O O   . PHE A 88  ? 0.31964 0.27338 0.30452 0.04606  0.07397  -0.05403 88  PHE A O   
1455 C CB  . PHE A 88  ? 0.26680 0.26995 0.23996 0.02947  0.03938  -0.03359 88  PHE A CB  
1456 C CG  . PHE A 88  ? 0.24267 0.26355 0.21743 0.02355  0.02296  -0.01950 88  PHE A CG  
1457 C CD1 . PHE A 88  ? 0.24264 0.25902 0.22357 0.02475  0.01011  -0.00954 88  PHE A CD1 
1458 C CD2 . PHE A 88  ? 0.25442 0.29347 0.22732 0.01646  0.02429  -0.01663 88  PHE A CD2 
1459 C CE1 . PHE A 88  ? 0.22185 0.24724 0.21089 0.02061  0.00200  0.00236  88  PHE A CE1 
1460 C CE2 . PHE A 88  ? 0.25999 0.30823 0.23817 0.01123  0.01325  -0.00276 88  PHE A CE2 
1461 C CZ  . PHE A 88  ? 0.22784 0.26702 0.21607 0.01420  0.00370  0.00638  88  PHE A CZ  
1471 N N   . ILE A 89  ? 0.25583 0.23741 0.29864 0.08078  0.07046  -0.02784 89  ILE A N   
1472 C CA  . ILE A 89  ? 0.32802 0.28132 0.38935 0.09396  0.09437  -0.03301 89  ILE A CA  
1473 C C   . ILE A 89  ? 0.29250 0.21220 0.33635 0.08805  0.09171  -0.03656 89  ILE A C   
1474 O O   . ILE A 89  ? 0.34579 0.22959 0.37849 0.08153  0.11371  -0.05476 89  ILE A O   
1475 C CB  . ILE A 89  ? 0.33137 0.30636 0.44338 0.11986  0.09702  -0.00910 89  ILE A CB  
1476 C CG1 . ILE A 89  ? 0.38965 0.39949 0.52300 0.12413  0.10439  -0.00768 89  ILE A CG1 
1477 C CG2 . ILE A 89  ? 0.42040 0.36664 0.55039 0.12722  0.11143  -0.00706 89  ILE A CG2 
1478 C CD1 . ILE A 89  ? 0.48068 0.53241 0.65416 0.13663  0.08977  0.02173  89  ILE A CD1 
1490 N N   . LEU A 90  ? 0.27416 0.20396 0.31479 0.08756  0.06797  -0.02129 90  LEU A N   
1491 C CA  . LEU A 90  ? 0.33228 0.23492 0.36145 0.08309  0.06518  -0.02136 90  LEU A CA  
1492 C C   . LEU A 90  ? 0.31583 0.21516 0.30973 0.05935  0.05523  -0.03424 90  LEU A C   
1493 O O   . LEU A 90  ? 0.29480 0.21842 0.27927 0.05036  0.04235  -0.03290 90  LEU A O   
1494 C CB  . LEU A 90  ? 0.26932 0.18718 0.31366 0.09233  0.04772  0.00218  90  LEU A CB  
1495 C CG  . LEU A 90  ? 0.28572 0.21726 0.37012 0.11417  0.05325  0.02445  90  LEU A CG  
1496 C CD1 . LEU A 90  ? 0.41448 0.37333 0.50395 0.11368  0.03149  0.04886  90  LEU A CD1 
1497 C CD2 . LEU A 90  ? 0.38375 0.28289 0.48144 0.11940  0.07251  0.02176  90  LEU A CD2 
1509 N N   . LYS A 91  ? 0.35573 0.22641 0.33394 0.04847  0.06209  -0.04400 91  LYS A N   
1510 C CA  . LYS A 91  ? 0.32702 0.20067 0.27552 0.02301  0.05355  -0.05353 91  LYS A CA  
1511 C C   . LYS A 91  ? 0.34056 0.21179 0.28905 0.01979  0.04009  -0.04413 91  LYS A C   
1512 O O   . LYS A 91  ? 0.30262 0.16101 0.26596 0.03344  0.04127  -0.03459 91  LYS A O   
1513 C CB  . LYS A 91  ? 0.47010 0.31777 0.39273 0.00207  0.07519  -0.07784 91  LYS A CB  
1514 C CG  . LYS A 91  ? 0.65234 0.50436 0.56960 -0.00090 0.09204  -0.09131 91  LYS A CG  
1515 C CD  . LYS A 91  ? 0.92997 0.75748 0.81131 -0.03165 0.11564  -0.12045 91  LYS A CD  
1516 C CE  . LYS A 91  ? 1.17332 1.00824 1.04645 -0.03872 0.13454  -0.13532 91  LYS A CE  
1517 N NZ  . LYS A 91  ? 1.15384 1.03438 1.01560 -0.04758 0.11077  -0.12237 91  LYS A NZ  
1531 N N   . HIS A 92  ? 0.29931 0.18810 0.23376 0.00066  0.02696  -0.04358 92  HIS A N   
1532 C CA  . HIS A 92  ? 0.26562 0.15825 0.20375 -0.00460 0.01594  -0.03522 92  HIS A CA  
1533 C C   . HIS A 92  ? 0.35880 0.22488 0.27750 -0.02279 0.02654  -0.04855 92  HIS A C   
1534 O O   . HIS A 92  ? 0.38819 0.26613 0.28772 -0.04884 0.02250  -0.05468 92  HIS A O   
1535 C CB  . HIS A 92  ? 0.27588 0.20412 0.22014 -0.01417 -0.00087 -0.02345 92  HIS A CB  
1536 C CG  . HIS A 92  ? 0.23963 0.18625 0.20282 0.00070  -0.00675 -0.01256 92  HIS A CG  
1537 N ND1 . HIS A 92  ? 0.24282 0.19896 0.20191 0.00161  -0.00542 -0.01377 92  HIS A ND1 
1538 C CD2 . HIS A 92  ? 0.22427 0.17913 0.20842 0.01144  -0.01077 -0.00279 92  HIS A CD2 
1539 C CE1 . HIS A 92  ? 0.22215 0.19066 0.19972 0.01276  -0.00968 -0.00400 92  HIS A CE1 
1540 N NE2 . HIS A 92  ? 0.22409 0.19053 0.21622 0.01796  -0.01164 0.00126  92  HIS A NE2 
1548 N N   . THR A 93  ? 0.32321 0.15498 0.24752 -0.01161 0.04010  -0.05067 93  THR A N   
1549 C CA  . THR A 93  ? 0.37438 0.16801 0.28118 -0.02793 0.05841  -0.06687 93  THR A CA  
1550 C C   . THR A 93  ? 0.43560 0.22625 0.33709 -0.04220 0.05125  -0.06291 93  THR A C   
1551 O O   . THR A 93  ? 0.46633 0.22859 0.34822 -0.06393 0.06505  -0.07825 93  THR A O   
1552 C CB  . THR A 93  ? 0.49110 0.24430 0.41512 -0.00639 0.08133  -0.06719 93  THR A CB  
1553 O OG1 . THR A 93  ? 0.46468 0.22934 0.41482 0.01778  0.06924  -0.04208 93  THR A OG1 
1554 C CG2 . THR A 93  ? 0.56263 0.31364 0.49146 0.00200  0.09705  -0.07757 93  THR A CG2 
1562 N N   . GLY A 94  ? 0.38920 0.20650 0.30677 -0.03345 0.03363  -0.04531 94  GLY A N   
1563 C CA  . GLY A 94  ? 0.46217 0.28035 0.37801 -0.04695 0.02896  -0.04152 94  GLY A CA  
1564 C C   . GLY A 94  ? 0.34917 0.18595 0.28503 -0.03197 0.01870  -0.02454 94  GLY A C   
1565 O O   . GLY A 94  ? 0.31254 0.16642 0.26150 -0.01512 0.01300  -0.01665 94  GLY A O   
1569 N N   A PRO A 95  ? 0.36569 0.19965 0.30154 -0.04206 0.01843  -0.02091 95  PRO A N   
1570 N N   B PRO A 95  ? 0.35685 0.18961 0.29252 -0.04168 0.01878  -0.02088 95  PRO A N   
1571 C CA  A PRO A 95  ? 0.33717 0.18783 0.28726 -0.03346 0.01336  -0.00878 95  PRO A CA  
1572 C CA  B PRO A 95  ? 0.33519 0.18604 0.28531 -0.03356 0.01332  -0.00882 95  PRO A CA  
1573 C C   A PRO A 95  ? 0.29012 0.12877 0.24179 -0.01520 0.01550  0.00086  95  PRO A C   
1574 C C   B PRO A 95  ? 0.30941 0.14770 0.26086 -0.01578 0.01561  0.00108  95  PRO A C   
1575 O O   A PRO A 95  ? 0.37554 0.18545 0.32347 -0.00789 0.02303  0.00407  95  PRO A O   
1576 O O   B PRO A 95  ? 0.36075 0.16937 0.30791 -0.00949 0.02323  0.00492  95  PRO A O   
1577 C CB  A PRO A 95  ? 0.39189 0.23378 0.33657 -0.05061 0.01710  -0.00853 95  PRO A CB  
1578 C CB  B PRO A 95  ? 0.39625 0.24078 0.34170 -0.05140 0.01652  -0.00882 95  PRO A CB  
1579 C CG  A PRO A 95  ? 0.41699 0.25642 0.34983 -0.07234 0.01810  -0.02001 95  PRO A CG  
1580 C CG  B PRO A 95  ? 0.50482 0.31089 0.43087 -0.06303 0.02692  -0.01869 95  PRO A CG  
1581 C CD  A PRO A 95  ? 0.42754 0.24568 0.34795 -0.06692 0.02434  -0.02997 95  PRO A CD  
1582 C CD  B PRO A 95  ? 0.39478 0.20285 0.31409 -0.06369 0.02743  -0.02988 95  PRO A CD  
1597 N N   . GLY A 96  ? 0.29031 0.15304 0.25027 -0.00982 0.01049  0.00687  96  GLY A N   
1598 C CA  . GLY A 96  ? 0.30519 0.16975 0.26348 -0.00050 0.00892  0.01859  96  GLY A CA  
1599 C C   . GLY A 96  ? 0.29496 0.17330 0.26012 0.01227  0.00500  0.01954  96  GLY A C   
1600 O O   . GLY A 96  ? 0.30658 0.19795 0.27105 0.01556  0.00115  0.03058  96  GLY A O   
1604 N N   . ILE A 97  ? 0.27377 0.15404 0.24362 0.01569  0.00507  0.00969  97  ILE A N   
1605 C CA  . ILE A 97  ? 0.26580 0.15886 0.24198 0.02631  0.00270  0.00994  97  ILE A CA  
1606 C C   . ILE A 97  ? 0.22365 0.14074 0.20474 0.02317  -0.00062 0.00895  97  ILE A C   
1607 O O   . ILE A 97  ? 0.24893 0.17270 0.23640 0.01605  0.00127  0.00387  97  ILE A O   
1608 C CB  . ILE A 97  ? 0.26497 0.15340 0.23966 0.02570  0.00523  -0.00065 97  ILE A CB  
1609 C CG1 . ILE A 97  ? 0.32872 0.18659 0.29772 0.02788  0.01654  -0.00493 97  ILE A CG1 
1610 C CG2 . ILE A 97  ? 0.25602 0.16441 0.23753 0.03234  0.00195  -0.00104 97  ILE A CG2 
1611 C CD1 . ILE A 97  ? 0.40363 0.25535 0.38658 0.04601  0.02271  0.00494  97  ILE A CD1 
1623 N N   A LEU A 98  ? 0.23097 0.16169 0.21311 0.02778  -0.00322 0.01393  98  LEU A N   
1624 N N   B LEU A 98  ? 0.20331 0.13387 0.18468 0.02721  -0.00328 0.01473  98  LEU A N   
1625 C CA  A LEU A 98  ? 0.19651 0.14477 0.17938 0.02054  -0.00211 0.00941  98  LEU A CA  
1626 C CA  B LEU A 98  ? 0.21247 0.16054 0.19568 0.02112  -0.00226 0.00947  98  LEU A CA  
1627 C C   A LEU A 98  ? 0.20341 0.16007 0.19450 0.02726  -0.00328 0.00642  98  LEU A C   
1628 C C   B LEU A 98  ? 0.17581 0.12984 0.16778 0.02851  -0.00328 0.00604  98  LEU A C   
1629 O O   A LEU A 98  ? 0.18959 0.15202 0.18252 0.03555  -0.00659 0.01225  98  LEU A O   
1630 O O   B LEU A 98  ? 0.22821 0.18265 0.22197 0.03778  -0.00547 0.00997  98  LEU A O   
1631 C CB  A LEU A 98  ? 0.23438 0.19727 0.20530 0.01148  -0.00520 0.01801  98  LEU A CB  
1632 C CB  B LEU A 98  ? 0.23390 0.19955 0.20687 0.01289  -0.00549 0.01701  98  LEU A CB  
1633 C CG  A LEU A 98  ? 0.40701 0.38632 0.36768 -0.00636 -0.00043 0.00989  98  LEU A CG  
1634 C CG  B LEU A 98  ? 0.35219 0.31743 0.31109 0.00098  -0.00574 0.02409  98  LEU A CG  
1635 C CD1 A LEU A 98  ? 0.34548 0.31320 0.30535 -0.01778 0.01380  -0.00470 98  LEU A CD1 
1636 C CD1 B LEU A 98  ? 0.46883 0.46159 0.41647 -0.00950 -0.01427 0.03927  98  LEU A CD1 
1637 C CD2 A LEU A 98  ? 0.30974 0.31255 0.25422 -0.01869 -0.00956 0.02554  98  LEU A CD2 
1638 C CD2 B LEU A 98  ? 0.44340 0.40320 0.39772 -0.01339 0.00634  0.00843  98  LEU A CD2 
1659 N N   . SER A 99  ? 0.18033 0.13842 0.18101 0.02445  0.00100  -0.00005 99  SER A N   
1660 C CA  A SER A 99  ? 0.21266 0.17705 0.22092 0.02891  -0.00019 -0.00025 99  SER A CA  
1661 C CA  B SER A 99  ? 0.21794 0.18237 0.22629 0.02892  -0.00018 -0.00026 99  SER A CA  
1662 C C   . SER A 99  ? 0.18433 0.15153 0.20356 0.02286  0.00821  -0.00425 99  SER A C   
1663 O O   . SER A 99  ? 0.20519 0.16604 0.23164 0.01678  0.01806  -0.00879 99  SER A O   
1664 C CB  A SER A 99  ? 0.28936 0.25046 0.30109 0.03075  -0.00370 0.00191  99  SER A CB  
1665 C CB  B SER A 99  ? 0.24710 0.20884 0.25927 0.03084  -0.00374 0.00201  99  SER A CB  
1666 O OG  A SER A 99  ? 0.25529 0.22530 0.27014 0.03176  -0.00560 0.00401  99  SER A OG  
1667 O OG  B SER A 99  ? 0.23771 0.20106 0.26442 0.02667  -0.00218 0.00541  99  SER A OG  
1677 N N   . MET A 100 ? 0.18715 0.16120 0.20890 0.02359  0.00798  -0.00381 100 MET A N   
1678 C CA  . MET A 100 ? 0.16703 0.13720 0.19963 0.01647  0.01975  -0.00850 100 MET A CA  
1679 C C   . MET A 100 ? 0.23308 0.19731 0.29282 0.02234  0.02430  0.00060  100 MET A C   
1680 O O   . MET A 100 ? 0.20272 0.17594 0.26580 0.02772  0.01386  0.01193  100 MET A O   
1681 C CB  . MET A 100 ? 0.20792 0.18906 0.23325 0.01224  0.01809  -0.00995 100 MET A CB  
1682 C CG  . MET A 100 ? 0.23690 0.23457 0.24402 0.00276  0.01388  -0.01338 100 MET A CG  
1683 S SD  . MET A 100 ? 0.23772 0.23061 0.23024 -0.02011 0.02653  -0.02671 100 MET A SD  
1684 C CE  . MET A 100 ? 0.26283 0.23899 0.26344 -0.03461 0.04786  -0.04099 100 MET A CE  
1694 N N   . ALA A 101 ? 0.14860 0.14713 0.17874 0.03202  0.00117  0.00625  101 ALA A N   
1695 C CA  . ALA A 101 ? 0.13025 0.12387 0.16199 0.03769  0.00584  0.00982  101 ALA A CA  
1696 C C   . ALA A 101 ? 0.20118 0.18521 0.22882 0.03579  0.01142  0.01081  101 ALA A C   
1697 O O   . ALA A 101 ? 0.23464 0.21724 0.25843 0.02685  0.01320  0.00602  101 ALA A O   
1698 C CB  . ALA A 101 ? 0.21172 0.20033 0.24500 0.03969  0.01175  0.00906  101 ALA A CB  
1704 N N   . ASN A 102 ? 0.20448 0.18527 0.23213 0.04307  0.01442  0.01785  102 ASN A N   
1705 C CA  . ASN A 102 ? 0.21480 0.18163 0.23623 0.04028  0.02197  0.02019  102 ASN A CA  
1706 C C   . ASN A 102 ? 0.24136 0.20022 0.26217 0.05257  0.02811  0.03184  102 ASN A C   
1707 O O   . ASN A 102 ? 0.27655 0.24867 0.30353 0.06324  0.02492  0.03779  102 ASN A O   
1708 C CB  . ASN A 102 ? 0.21445 0.19351 0.23463 0.03469  0.01670  0.01862  102 ASN A CB  
1709 C CG  . ASN A 102 ? 0.21437 0.20920 0.23717 0.04178  0.00981  0.02329  102 ASN A CG  
1710 O OD1 . ASN A 102 ? 0.23853 0.23482 0.26056 0.04929  0.01139  0.03188  102 ASN A OD1 
1711 N ND2 . ASN A 102 ? 0.19894 0.20656 0.22384 0.03972  0.00327  0.01797  102 ASN A ND2 
1718 N N   . ALA A 103 ? 0.24476 0.18392 0.25754 0.05075  0.03776  0.03619  103 ALA A N   
1719 C CA  . ALA A 103 ? 0.27608 0.20293 0.28592 0.06457  0.04619  0.05101  103 ALA A CA  
1720 C C   . ALA A 103 ? 0.31436 0.24402 0.31765 0.06242  0.04588  0.05866  103 ALA A C   
1721 O O   . ALA A 103 ? 0.37684 0.28407 0.37182 0.06805  0.05748  0.07025  103 ALA A O   
1722 C CB  . ALA A 103 ? 0.38974 0.27752 0.39217 0.06613  0.06429  0.05115  103 ALA A CB  
1728 N N   . GLY A 104 ? 0.26726 0.22225 0.27312 0.05498  0.03439  0.05282  104 GLY A N   
1729 C CA  . GLY A 104 ? 0.25708 0.21851 0.25666 0.05074  0.03425  0.05736  104 GLY A CA  
1730 C C   . GLY A 104 ? 0.22407 0.19560 0.22427 0.03612  0.03023  0.04412  104 GLY A C   
1731 O O   . GLY A 104 ? 0.23704 0.21023 0.24186 0.03019  0.02760  0.03347  104 GLY A O   
1735 N N   . PRO A 105 ? 0.23860 0.22102 0.23444 0.03106  0.03000  0.04572  105 PRO A N   
1736 C CA  A PRO A 105 ? 0.24263 0.24124 0.24120 0.02003  0.02698  0.03451  105 PRO A CA  
1737 C CA  B PRO A 105 ? 0.25559 0.25421 0.25421 0.02006  0.02695  0.03447  105 PRO A CA  
1738 C C   . PRO A 105 ? 0.22095 0.20773 0.21725 0.00634  0.03390  0.02695  105 PRO A C   
1739 O O   . PRO A 105 ? 0.26472 0.22544 0.25138 -0.00079 0.04558  0.02992  105 PRO A O   
1740 C CB  A PRO A 105 ? 0.23627 0.24588 0.22857 0.01682  0.02916  0.03945  105 PRO A CB  
1741 C CB  B PRO A 105 ? 0.23938 0.24947 0.23189 0.01692  0.02893  0.03926  105 PRO A CB  
1742 C CG  A PRO A 105 ? 0.23224 0.24126 0.22029 0.02847  0.02812  0.05255  105 PRO A CG  
1743 C CG  B PRO A 105 ? 0.31365 0.30412 0.29664 0.02222  0.03631  0.05417  105 PRO A CG  
1744 C CD  A PRO A 105 ? 0.28641 0.27208 0.27495 0.03652  0.03244  0.05914  105 PRO A CD  
1745 C CD  B PRO A 105 ? 0.32033 0.30392 0.30825 0.03576  0.03339  0.05920  105 PRO A CD  
1759 N N   . ASN A 106 ? 0.22288 0.22911 0.22673 0.00228  0.02779  0.01736  106 ASN A N   
1760 C CA  . ASN A 106 ? 0.18804 0.19849 0.19008 -0.01377 0.03226  0.00895  106 ASN A CA  
1761 C C   . ASN A 106 ? 0.25475 0.23460 0.24903 -0.02051 0.04155  0.00650  106 ASN A C   
1762 O O   . ASN A 106 ? 0.24467 0.21088 0.22885 -0.03801 0.05282  0.00129  106 ASN A O   
1763 C CB  . ASN A 106 ? 0.19612 0.21806 0.19307 -0.02778 0.03824  0.00767  106 ASN A CB  
1764 C CG  . ASN A 106 ? 0.22726 0.27992 0.23193 -0.01983 0.03107  0.00898  106 ASN A CG  
1765 O OD1 . ASN A 106 ? 0.20468 0.28173 0.21973 -0.01228 0.02324  0.00547  106 ASN A OD1 
1766 N ND2 . ASN A 106 ? 0.21692 0.26663 0.21545 -0.02011 0.03505  0.01478  106 ASN A ND2 
1773 N N   . THR A 107 ? 0.22922 0.19873 0.22748 -0.00814 0.03817  0.00859  107 THR A N   
1774 C CA  . THR A 107 ? 0.23500 0.17656 0.22701 -0.01163 0.04793  0.00531  107 THR A CA  
1775 C C   . THR A 107 ? 0.24969 0.20323 0.24813 -0.00956 0.04090  -0.00068 107 THR A C   
1776 O O   . THR A 107 ? 0.28763 0.22290 0.28509 -0.00383 0.04564  -0.00068 107 THR A O   
1777 C CB  . THR A 107 ? 0.27790 0.19096 0.26678 0.00342  0.05538  0.01673  107 THR A CB  
1778 O OG1 . THR A 107 ? 0.24707 0.17884 0.24633 0.02062  0.04353  0.02402  107 THR A OG1 
1779 C CG2 . THR A 107 ? 0.37365 0.26957 0.35269 0.00082  0.06498  0.02503  107 THR A CG2 
1787 N N   . ASN A 108 ? 0.19739 0.18208 0.20204 -0.01314 0.03084  -0.00461 108 ASN A N   
1788 C CA  . ASN A 108 ? 0.16546 0.16170 0.17417 -0.01150 0.02468  -0.00789 108 ASN A CA  
1789 C C   . ASN A 108 ? 0.21983 0.20951 0.21970 -0.02826 0.03317  -0.01792 108 ASN A C   
1790 O O   . ASN A 108 ? 0.22771 0.22221 0.22021 -0.04619 0.03962  -0.02500 108 ASN A O   
1791 C CB  . ASN A 108 ? 0.17426 0.20406 0.19053 -0.00857 0.01389  -0.00641 108 ASN A CB  
1792 C CG  . ASN A 108 ? 0.19767 0.23037 0.22036 0.00634  0.00789  0.00019  108 ASN A CG  
1793 O OD1 . ASN A 108 ? 0.20018 0.22386 0.22538 0.01657  0.00442  0.00320  108 ASN A OD1 
1794 N ND2 . ASN A 108 ? 0.17878 0.22514 0.20302 0.00551  0.00787  0.00108  108 ASN A ND2 
1801 N N   . GLY A 109 ? 0.20583 0.18717 0.20541 -0.02481 0.03388  -0.01998 109 GLY A N   
1802 C CA  . GLY A 109 ? 0.20331 0.18107 0.19326 -0.04148 0.04213  -0.03144 109 GLY A CA  
1803 C C   . GLY A 109 ? 0.24184 0.24480 0.23514 -0.04073 0.03279  -0.03176 109 GLY A C   
1804 O O   . GLY A 109 ? 0.23612 0.27309 0.23318 -0.04285 0.02277  -0.02882 109 GLY A O   
1808 N N   . SER A 110 ? 0.19079 0.17853 0.18275 -0.03621 0.03687  -0.03374 110 SER A N   
1809 C CA  . SER A 110 ? 0.17983 0.18776 0.17338 -0.03530 0.02926  -0.03258 110 SER A CA  
1810 C C   . SER A 110 ? 0.20350 0.20379 0.20559 -0.01774 0.02442  -0.02419 110 SER A C   
1811 O O   . SER A 110 ? 0.20154 0.21675 0.20476 -0.01616 0.01764  -0.02076 110 SER A O   
1812 C CB  . SER A 110 ? 0.21280 0.21782 0.19441 -0.05211 0.03947  -0.04574 110 SER A CB  
1813 O OG  . SER A 110 ? 0.23796 0.20649 0.21605 -0.04846 0.05423  -0.05143 110 SER A OG  
1819 N N   . GLN A 111 ? 0.18644 0.16685 0.19354 -0.00579 0.02815  -0.02016 111 GLN A N   
1820 C CA  . GLN A 111 ? 0.16549 0.14577 0.18023 0.00711  0.02448  -0.01402 111 GLN A CA  
1821 C C   . GLN A 111 ? 0.18397 0.17769 0.20441 0.01344  0.01255  -0.00638 111 GLN A C   
1822 O O   . GLN A 111 ? 0.17618 0.17326 0.19759 0.01466  0.00902  -0.00381 111 GLN A O   
1823 C CB  . GLN A 111 ? 0.19156 0.15446 0.21002 0.01862  0.03260  -0.01064 111 GLN A CB  
1824 C CG  . GLN A 111 ? 0.18859 0.13117 0.20158 0.01720  0.04803  -0.01739 111 GLN A CG  
1825 C CD  . GLN A 111 ? 0.24142 0.17014 0.25999 0.03472  0.05635  -0.00940 111 GLN A CD  
1826 O OE1 . GLN A 111 ? 0.28695 0.23287 0.31576 0.04690  0.04999  -0.00129 111 GLN A OE1 
1827 N NE2 . GLN A 111 ? 0.27746 0.17631 0.28847 0.03571  0.07152  -0.01081 111 GLN A NE2 
1836 N N   . PHE A 112 ? 0.16263 0.16224 0.18559 0.01639  0.00829  -0.00373 112 PHE A N   
1837 C CA  . PHE A 112 ? 0.14903 0.15406 0.17369 0.02000  0.00046  0.00158  112 PHE A CA  
1838 C C   . PHE A 112 ? 0.18032 0.18571 0.20803 0.02223  -0.00002 0.00268  112 PHE A C   
1839 O O   . PHE A 112 ? 0.17251 0.18022 0.20220 0.02170  0.00440  0.00050  112 PHE A O   
1840 C CB  . PHE A 112 ? 0.19151 0.20515 0.21132 0.01619  -0.00335 0.00430  112 PHE A CB  
1841 C CG  . PHE A 112 ? 0.16993 0.18747 0.18532 0.00982  -0.00133 0.00285  112 PHE A CG  
1842 C CD1 . PHE A 112 ? 0.21837 0.23288 0.23276 0.01012  -0.00234 0.00617  112 PHE A CD1 
1843 C CD2 . PHE A 112 ? 0.18475 0.20846 0.19537 0.00100  0.00324  -0.00349 112 PHE A CD2 
1844 C CE1 . PHE A 112 ? 0.26914 0.28909 0.27899 0.00338  0.00018  0.00496  112 PHE A CE1 
1845 C CE2 . PHE A 112 ? 0.22422 0.25325 0.22965 -0.00574 0.00610  -0.00609 112 PHE A CE2 
1846 C CZ  . PHE A 112 ? 0.25923 0.28750 0.26490 -0.00371 0.00412  -0.00103 112 PHE A CZ  
1856 N N   A PHE A 113 ? 0.16216 0.16657 0.18950 0.02338  -0.00398 0.00501  113 PHE A N   
1857 N N   B PHE A 113 ? 0.11931 0.12368 0.14695 0.02383  -0.00405 0.00501  113 PHE A N   
1858 C CA  A PHE A 113 ? 0.18757 0.19540 0.21533 0.01976  -0.00379 0.00430  113 PHE A CA  
1859 C CA  B PHE A 113 ? 0.12163 0.12857 0.14944 0.02063  -0.00450 0.00442  113 PHE A CA  
1860 C C   A PHE A 113 ? 0.13154 0.12869 0.15199 0.01575  -0.00487 0.00600  113 PHE A C   
1861 C C   B PHE A 113 ? 0.13184 0.12842 0.15185 0.01591  -0.00489 0.00643  113 PHE A C   
1862 O O   A PHE A 113 ? 0.13582 0.12358 0.15316 0.01997  -0.00579 0.00823  113 PHE A O   
1863 O O   B PHE A 113 ? 0.16829 0.15660 0.18459 0.02000  -0.00586 0.01004  113 PHE A O   
1864 C CB  A PHE A 113 ? 0.20825 0.22686 0.24168 0.02233  -0.00418 0.00360  113 PHE A CB  
1865 C CB  B PHE A 113 ? 0.23188 0.24294 0.26150 0.02209  -0.00621 0.00337  113 PHE A CB  
1866 C CG  A PHE A 113 ? 0.26118 0.27711 0.29329 0.02502  -0.00663 0.00377  113 PHE A CG  
1867 C CG  B PHE A 113 ? 0.27431 0.29381 0.30961 0.02928  -0.00583 0.00538  113 PHE A CG  
1868 C CD1 A PHE A 113 ? 0.28871 0.30365 0.32300 0.03156  -0.00619 0.00602  113 PHE A CD1 
1869 C CD1 B PHE A 113 ? 0.27062 0.29642 0.31137 0.03430  -0.00203 0.00754  113 PHE A CD1 
1870 C CD2 A PHE A 113 ? 0.31828 0.33124 0.34525 0.01925  -0.00752 0.00055  113 PHE A CD2 
1871 C CD2 B PHE A 113 ? 0.35900 0.37836 0.39303 0.03193  -0.00758 0.00593  113 PHE A CD2 
1872 C CE1 A PHE A 113 ? 0.32498 0.34038 0.35759 0.03335  -0.00794 0.00605  113 PHE A CE1 
1873 C CE1 B PHE A 113 ? 0.29600 0.32408 0.34009 0.04309  0.00050  0.01231  113 PHE A CE1 
1874 C CE2 A PHE A 113 ? 0.41115 0.42260 0.43582 0.02107  -0.00831 -0.00111 113 PHE A CE2 
1875 C CE2 B PHE A 113 ? 0.32028 0.34604 0.35746 0.03846  -0.00651 0.01020  113 PHE A CE2 
1876 C CZ  A PHE A 113 ? 0.38528 0.40027 0.41345 0.02866  -0.00920 0.00214  113 PHE A CZ  
1877 C CZ  B PHE A 113 ? 0.36643 0.39481 0.40829 0.04466  -0.00223 0.01445  113 PHE A CZ  
1896 N N   . ILE A 114 ? 0.16034 0.15798 0.17759 0.00814  -0.00296 0.00549  114 ILE A N   
1897 C CA  . ILE A 114 ? 0.16557 0.14671 0.17314 0.00195  -0.00060 0.00710  114 ILE A CA  
1898 C C   . ILE A 114 ? 0.16428 0.14875 0.17134 -0.00692 0.00103  0.00033  114 ILE A C   
1899 O O   . ILE A 114 ? 0.18499 0.19021 0.19722 -0.01346 0.00107  -0.00295 114 ILE A O   
1900 C CB  . ILE A 114 ? 0.20541 0.18544 0.20697 -0.00473 0.00177  0.01084  114 ILE A CB  
1901 C CG1 . ILE A 114 ? 0.23638 0.22373 0.23802 0.00077  -0.00033 0.01573  114 ILE A CG1 
1902 C CG2 . ILE A 114 ? 0.29334 0.24787 0.28189 -0.01021 0.00670  0.01497  114 ILE A CG2 
1903 C CD1 . ILE A 114 ? 0.27485 0.26871 0.27072 -0.00711 0.00195  0.01810  114 ILE A CD1 
1915 N N   . CYS A 115 ? 0.22118 0.18938 0.22197 -0.00767 0.00313  -0.00243 115 CYS A N   
1916 C CA  . CYS A 115 ? 0.22726 0.20146 0.22453 -0.02059 0.00545  -0.01132 115 CYS A CA  
1917 C C   . CYS A 115 ? 0.27817 0.24032 0.26466 -0.03743 0.01197  -0.01445 115 CYS A C   
1918 O O   . CYS A 115 ? 0.30208 0.23373 0.27811 -0.03703 0.01750  -0.00931 115 CYS A O   
1919 C CB  . CYS A 115 ? 0.25291 0.21043 0.24366 -0.01898 0.00831  -0.01617 115 CYS A CB  
1920 S SG  . CYS A 115 ? 0.29091 0.26293 0.29213 -0.00271 0.00201  -0.01284 115 CYS A SG  
1926 N N   . THR A 116 ? 0.21707 0.20548 0.20549 -0.05260 0.01199  -0.02179 116 THR A N   
1927 C CA  . THR A 116 ? 0.23790 0.21765 0.21438 -0.07439 0.01958  -0.02755 116 THR A CA  
1928 C C   . THR A 116 ? 0.28494 0.26570 0.25142 -0.09366 0.02453  -0.04102 116 THR A C   
1929 O O   . THR A 116 ? 0.35124 0.33640 0.30847 -0.11764 0.03082  -0.04942 116 THR A O   
1930 C CB  . THR A 116 ? 0.26336 0.27937 0.24940 -0.08075 0.01712  -0.02626 116 THR A CB  
1931 O OG1 . THR A 116 ? 0.27255 0.33610 0.27417 -0.07652 0.01040  -0.02813 116 THR A OG1 
1932 C CG2 . THR A 116 ? 0.29924 0.30791 0.28992 -0.06592 0.01511  -0.01574 116 THR A CG2 
1940 N N   . ALA A 117 ? 0.29481 0.27314 0.26165 -0.08583 0.02261  -0.04430 117 ALA A N   
1941 C CA  . ALA A 117 ? 0.40630 0.38485 0.36136 -0.10416 0.02806  -0.05884 117 ALA A CA  
1942 C C   . ALA A 117 ? 0.29356 0.25126 0.24703 -0.08816 0.02834  -0.05860 117 ALA A C   
1943 O O   . ALA A 117 ? 0.27220 0.22743 0.23658 -0.06489 0.02227  -0.04709 117 ALA A O   
1944 C CB  . ALA A 117 ? 0.39556 0.43609 0.36001 -0.11644 0.02068  -0.06425 117 ALA A CB  
1950 N N   . LYS A 118 ? 0.32824 0.27206 0.26690 -0.10294 0.03672  -0.07288 118 LYS A N   
1951 C CA  . LYS A 118 ? 0.34600 0.27970 0.28365 -0.08997 0.03731  -0.07490 118 LYS A CA  
1952 C C   . LYS A 118 ? 0.30562 0.29364 0.25853 -0.08273 0.02371  -0.07072 118 LYS A C   
1953 O O   . LYS A 118 ? 0.32306 0.35492 0.27767 -0.09825 0.01915  -0.07588 118 LYS A O   
1954 C CB  . LYS A 118 ? 0.41385 0.31809 0.32931 -0.11016 0.05229  -0.09384 118 LYS A CB  
1955 C CG  . LYS A 118 ? 0.45107 0.34381 0.36382 -0.09786 0.05545  -0.09800 118 LYS A CG  
1956 C CD  . LYS A 118 ? 0.60949 0.46768 0.49747 -0.11958 0.07379  -0.11960 118 LYS A CD  
1957 C CE  . LYS A 118 ? 0.72734 0.58809 0.61305 -0.11099 0.07612  -0.12659 118 LYS A CE  
1958 N NZ  . LYS A 118 ? 0.81834 0.64542 0.68420 -0.12547 0.09502  -0.14186 118 LYS A NZ  
1972 N N   . THR A 119 ? 0.30261 0.29020 0.26637 -0.05913 0.01779  -0.05993 119 THR A N   
1973 C CA  . THR A 119 ? 0.25501 0.28529 0.23199 -0.04916 0.00685  -0.05233 119 THR A CA  
1974 C C   . THR A 119 ? 0.21975 0.24223 0.19371 -0.03999 0.00816  -0.05402 119 THR A C   
1975 O O   . THR A 119 ? 0.24764 0.26907 0.23114 -0.02177 0.00390  -0.04351 119 THR A O   
1976 C CB  . THR A 119 ? 0.19872 0.23782 0.19169 -0.03174 -0.00036 -0.03709 119 THR A CB  
1977 O OG1 . THR A 119 ? 0.24606 0.25142 0.23985 -0.01754 0.00197  -0.03148 119 THR A OG1 
1978 C CG2 . THR A 119 ? 0.23549 0.28534 0.23171 -0.04039 -0.00066 -0.03608 119 THR A CG2 
1986 N N   . GLU A 120 ? 0.26703 0.28614 0.22644 -0.05527 0.01519  -0.06885 120 GLU A N   
1987 C CA  . GLU A 120 ? 0.26688 0.27375 0.22105 -0.04797 0.01962  -0.07316 120 GLU A CA  
1988 C C   . GLU A 120 ? 0.22486 0.26980 0.18864 -0.03785 0.00964  -0.06347 120 GLU A C   
1989 O O   . GLU A 120 ? 0.23983 0.27633 0.20394 -0.02687 0.01155  -0.06208 120 GLU A O   
1990 C CB  . GLU A 120 ? 0.37731 0.37175 0.31101 -0.06976 0.03170  -0.09412 120 GLU A CB  
1991 C CG  . GLU A 120 ? 0.54501 0.58902 0.47286 -0.09255 0.02679  -0.10276 120 GLU A CG  
1992 C CD  . GLU A 120 ? 0.75392 0.80904 0.67745 -0.11458 0.02773  -0.10909 120 GLU A CD  
1993 O OE1 . GLU A 120 ? 0.65057 0.68376 0.58035 -0.10877 0.02809  -0.10157 120 GLU A OE1 
1994 O OE2 . GLU A 120 ? 0.75585 0.84694 0.66905 -0.13973 0.02815  -0.12204 120 GLU A OE2 
2001 N N   . TRP A 121 ? 0.23227 0.31935 0.20356 -0.04042 0.00026  -0.05557 121 TRP A N   
2002 C CA  . TRP A 121 ? 0.21529 0.33413 0.19373 -0.02917 -0.00728 -0.04319 121 TRP A CA  
2003 C C   . TRP A 121 ? 0.23307 0.33430 0.22360 -0.00805 -0.00965 -0.02872 121 TRP A C   
2004 O O   . TRP A 121 ? 0.23826 0.35344 0.23195 0.00126  -0.01266 -0.01887 121 TRP A O   
2005 C CB  . TRP A 121 ? 0.26767 0.43735 0.25130 -0.03393 -0.01506 -0.03568 121 TRP A CB  
2006 C CG  . TRP A 121 ? 0.21085 0.38293 0.20670 -0.02780 -0.01794 -0.02719 121 TRP A CG  
2007 C CD1 . TRP A 121 ? 0.20162 0.37402 0.21097 -0.00814 -0.02130 -0.01069 121 TRP A CD1 
2008 C CD2 . TRP A 121 ? 0.18152 0.35445 0.17573 -0.04279 -0.01574 -0.03592 121 TRP A CD2 
2009 N NE1 . TRP A 121 ? 0.20619 0.38137 0.22324 -0.00849 -0.02155 -0.00900 121 TRP A NE1 
2010 C CE2 . TRP A 121 ? 0.19179 0.36937 0.20030 -0.02972 -0.01887 -0.02354 121 TRP A CE2 
2011 C CE3 . TRP A 121 ? 0.21906 0.38672 0.19933 -0.06775 -0.00956 -0.05396 121 TRP A CE3 
2012 C CZ2 . TRP A 121 ? 0.23885 0.42103 0.24964 -0.03992 -0.01742 -0.02757 121 TRP A CZ2 
2013 C CZ3 . TRP A 121 ? 0.28175 0.45106 0.26327 -0.07942 -0.00772 -0.05758 121 TRP A CZ3 
2014 C CH2 . TRP A 121 ? 0.27972 0.45878 0.27715 -0.06510 -0.01235 -0.04394 121 TRP A CH2 
2025 N N   . LEU A 122 ? 0.18633 0.25797 0.18165 -0.00235 -0.00746 -0.02753 122 LEU A N   
2026 C CA  . LEU A 122 ? 0.16156 0.21866 0.16583 0.01294  -0.00861 -0.01719 122 LEU A CA  
2027 C C   . LEU A 122 ? 0.18116 0.21670 0.18242 0.01835  -0.00372 -0.02108 122 LEU A C   
2028 O O   . LEU A 122 ? 0.18046 0.21172 0.18820 0.02801  -0.00464 -0.01378 122 LEU A O   
2029 C CB  . LEU A 122 ? 0.20976 0.25454 0.22032 0.01550  -0.00923 -0.01338 122 LEU A CB  
2030 C CG  . LEU A 122 ? 0.19773 0.26691 0.21386 0.01281  -0.01286 -0.00888 122 LEU A CG  
2031 C CD1 . LEU A 122 ? 0.31087 0.36497 0.33127 0.01396  -0.01176 -0.00738 122 LEU A CD1 
2032 C CD2 . LEU A 122 ? 0.21046 0.30105 0.23342 0.02352  -0.01586 0.00317  122 LEU A CD2 
2044 N N   . ASP A 123 ? 0.17552 0.24499 0.17548 -0.00710 0.00213  -0.00953 123 ASP A N   
2045 C CA  . ASP A 123 ? 0.20447 0.24990 0.20457 -0.01079 0.01363  -0.01976 123 ASP A CA  
2046 C C   . ASP A 123 ? 0.23500 0.27767 0.22895 -0.01019 0.01395  -0.01234 123 ASP A C   
2047 O O   . ASP A 123 ? 0.22562 0.28646 0.20324 -0.01766 0.01023  -0.00475 123 ASP A O   
2048 C CB  . ASP A 123 ? 0.23036 0.27461 0.21902 -0.03015 0.02768  -0.03695 123 ASP A CB  
2049 C CG  . ASP A 123 ? 0.28667 0.32004 0.28067 -0.03116 0.03503  -0.04676 123 ASP A CG  
2050 O OD1 . ASP A 123 ? 0.24852 0.27462 0.25566 -0.01603 0.02803  -0.04015 123 ASP A OD1 
2051 O OD2 . ASP A 123 ? 0.27287 0.30175 0.25451 -0.04983 0.05100  -0.06240 123 ASP A OD2 
2056 N N   . GLY A 124 ? 0.19761 0.22078 0.20365 -0.00297 0.01877  -0.01398 124 GLY A N   
2057 C CA  . GLY A 124 ? 0.23140 0.24800 0.23242 -0.00461 0.02271  -0.01019 124 GLY A CA  
2058 C C   . GLY A 124 ? 0.25728 0.26916 0.25545 0.00514  0.01760  0.00480  124 GLY A C   
2059 O O   . GLY A 124 ? 0.25758 0.25851 0.24905 0.00296  0.02393  0.00798  124 GLY A O   
2063 N N   A LYS A 125 ? 0.18788 0.20417 0.19077 0.01530  0.01039  0.01365  125 LYS A N   
2064 N N   B LYS A 125 ? 0.18030 0.19608 0.18362 0.01536  0.01050  0.01334  125 LYS A N   
2065 C CA  A LYS A 125 ? 0.22104 0.22530 0.22433 0.02663  0.01225  0.02787  125 LYS A CA  
2066 C CA  B LYS A 125 ? 0.23728 0.24245 0.24050 0.02683  0.01191  0.02827  125 LYS A CA  
2067 C C   A LYS A 125 ? 0.19258 0.18096 0.20845 0.03187  0.01439  0.02259  125 LYS A C   
2068 C C   B LYS A 125 ? 0.23625 0.22545 0.25205 0.03263  0.01408  0.02366  125 LYS A C   
2069 O O   A LYS A 125 ? 0.19279 0.15990 0.20723 0.03422  0.02374  0.02585  125 LYS A O   
2070 O O   B LYS A 125 ? 0.24754 0.21571 0.26196 0.03625  0.02337  0.02842  125 LYS A O   
2071 C CB  A LYS A 125 ? 0.31060 0.33572 0.31123 0.03582  0.00588  0.04659  125 LYS A CB  
2072 C CB  B LYS A 125 ? 0.25892 0.28785 0.25845 0.03442  0.00480  0.04616  125 LYS A CB  
2073 C CG  A LYS A 125 ? 0.35823 0.40990 0.34175 0.02778  0.00059  0.05536  125 LYS A CG  
2074 C CG  B LYS A 125 ? 0.42307 0.44073 0.42794 0.05208  0.01048  0.06675  125 LYS A CG  
2075 C CD  A LYS A 125 ? 0.31816 0.40067 0.30433 0.04038  -0.00763 0.08049  125 LYS A CD  
2076 C CD  B LYS A 125 ? 0.38027 0.43588 0.38903 0.06224  0.00107  0.08847  125 LYS A CD  
2077 C CE  A LYS A 125 ? 0.54443 0.66551 0.50983 0.02816  -0.01650 0.09075  125 LYS A CE  
2078 C CE  B LYS A 125 ? 0.54211 0.58631 0.56598 0.08552  0.01065  0.11092  125 LYS A CE  
2079 N NZ  A LYS A 125 ? 0.47418 0.63335 0.44481 0.04430  -0.02574 0.12343  125 LYS A NZ  
2080 N NZ  B LYS A 125 ? 0.37573 0.43162 0.42170 0.09313  0.00888  0.10803  125 LYS A NZ  
2105 N N   . HIS A 126 ? 0.18055 0.17659 0.20499 0.03135  0.00847  0.01416  126 HIS A N   
2106 C CA  . HIS A 126 ? 0.16581 0.15034 0.19738 0.03289  0.00920  0.00892  126 HIS A CA  
2107 C C   . HIS A 126 ? 0.18146 0.17045 0.21949 0.02739  0.00612  -0.00155 126 HIS A C   
2108 O O   . HIS A 126 ? 0.21045 0.20816 0.25065 0.02635  0.00472  -0.00519 126 HIS A O   
2109 C CB  . HIS A 126 ? 0.16711 0.15718 0.20281 0.03942  0.00608  0.01254  126 HIS A CB  
2110 C CG  . HIS A 126 ? 0.19116 0.18267 0.22854 0.04981  0.01024  0.02766  126 HIS A CG  
2111 N ND1 . HIS A 126 ? 0.20897 0.17770 0.24924 0.05621  0.02229  0.03256  126 HIS A ND1 
2112 C CD2 . HIS A 126 ? 0.20248 0.21704 0.23963 0.05533  0.00589  0.04126  126 HIS A CD2 
2113 C CE1 . HIS A 126 ? 0.23001 0.20484 0.27606 0.06999  0.02675  0.05108  126 HIS A CE1 
2114 N NE2 . HIS A 126 ? 0.22945 0.23696 0.27391 0.06996  0.01424  0.05823  126 HIS A NE2 
2122 N N   . VAL A 127 ? 0.18371 0.16828 0.22478 0.02311  0.00710  -0.00544 127 VAL A N   
2123 C CA  . VAL A 127 ? 0.15877 0.15656 0.21057 0.02108  0.00284  -0.00927 127 VAL A CA  
2124 C C   . VAL A 127 ? 0.16164 0.16040 0.21413 0.02530  -0.00272 -0.00802 127 VAL A C   
2125 O O   . VAL A 127 ? 0.17265 0.16510 0.21774 0.02203  -0.00406 -0.00857 127 VAL A O   
2126 C CB  . VAL A 127 ? 0.16290 0.16795 0.21735 0.01104  0.00395  -0.01295 127 VAL A CB  
2127 C CG1 . VAL A 127 ? 0.18765 0.21877 0.25861 0.01203  -0.00319 -0.01122 127 VAL A CG1 
2128 C CG2 . VAL A 127 ? 0.20761 0.20694 0.25935 0.00545  0.01288  -0.01535 127 VAL A CG2 
2138 N N   . VAL A 128 ? 0.17083 0.17318 0.23020 0.03096  -0.00214 -0.00718 128 VAL A N   
2139 C CA  . VAL A 128 ? 0.17233 0.17133 0.23121 0.03562  -0.00402 -0.00449 128 VAL A CA  
2140 C C   . VAL A 128 ? 0.16642 0.18102 0.23506 0.03807  -0.00974 0.00286  128 VAL A C   
2141 O O   . VAL A 128 ? 0.18112 0.21110 0.26635 0.04158  -0.00832 0.00628  128 VAL A O   
2142 C CB  . VAL A 128 ? 0.19497 0.18549 0.25516 0.03899  0.00523  -0.00714 128 VAL A CB  
2143 C CG1 . VAL A 128 ? 0.20230 0.18325 0.26163 0.04492  0.00789  -0.00266 128 VAL A CG1 
2144 C CG2 . VAL A 128 ? 0.20096 0.18943 0.24999 0.03244  0.00714  -0.01348 128 VAL A CG2 
2154 N N   . PHE A 129 ? 0.14699 0.16214 0.20616 0.03571  -0.01604 0.00646  129 PHE A N   
2155 C CA  . PHE A 129 ? 0.15860 0.19941 0.22404 0.03510  -0.02507 0.01626  129 PHE A CA  
2156 C C   . PHE A 129 ? 0.16450 0.20369 0.22111 0.03994  -0.02928 0.02697  129 PHE A C   
2157 O O   . PHE A 129 ? 0.18154 0.24947 0.24192 0.03973  -0.03932 0.03948  129 PHE A O   
2158 C CB  . PHE A 129 ? 0.21066 0.26485 0.26683 0.01683  -0.02989 0.00897  129 PHE A CB  
2159 C CG  . PHE A 129 ? 0.20713 0.23962 0.23976 0.00525  -0.02690 0.00069  129 PHE A CG  
2160 C CD1 . PHE A 129 ? 0.18520 0.19070 0.21207 0.00520  -0.01659 -0.00783 129 PHE A CD1 
2161 C CD2 . PHE A 129 ? 0.22054 0.26179 0.23759 -0.00520 -0.03311 0.00322  129 PHE A CD2 
2162 C CE1 . PHE A 129 ? 0.21551 0.20065 0.22668 -0.00267 -0.00963 -0.01423 129 PHE A CE1 
2163 C CE2 . PHE A 129 ? 0.23438 0.25200 0.22990 -0.01737 -0.02587 -0.00648 129 PHE A CE2 
2164 C CZ  . PHE A 129 ? 0.25600 0.24427 0.25118 -0.01495 -0.01263 -0.01555 129 PHE A CZ  
2174 N N   . GLY A 130 ? 0.18251 0.19330 0.22730 0.04332  -0.02199 0.02378  130 GLY A N   
2175 C CA  . GLY A 130 ? 0.23553 0.24001 0.26955 0.04802  -0.02307 0.03497  130 GLY A CA  
2176 C C   . GLY A 130 ? 0.20632 0.17729 0.23029 0.05022  -0.01006 0.02761  130 GLY A C   
2177 O O   . GLY A 130 ? 0.23071 0.19120 0.25799 0.04774  -0.00234 0.01496  130 GLY A O   
2181 N N   A LYS A 131 ? 0.22680 0.18448 0.23645 0.05266  -0.00772 0.03613  131 LYS A N   
2182 N N   B LYS A 131 ? 0.22661 0.18429 0.23665 0.05296  -0.00757 0.03629  131 LYS A N   
2183 C CA  A LYS A 131 ? 0.21948 0.14514 0.21787 0.05192  0.00736  0.02832  131 LYS A CA  
2184 C CA  B LYS A 131 ? 0.23911 0.16529 0.23703 0.05090  0.00683  0.02726  131 LYS A CA  
2185 C C   A LYS A 131 ? 0.29213 0.20538 0.26676 0.04672  0.00636  0.03381  131 LYS A C   
2186 C C   B LYS A 131 ? 0.23987 0.15459 0.21421 0.04551  0.00534  0.03279  131 LYS A C   
2187 O O   A LYS A 131 ? 0.28819 0.21502 0.25643 0.05071  -0.00315 0.05196  131 LYS A O   
2188 O O   B LYS A 131 ? 0.26766 0.19806 0.23496 0.04745  -0.00550 0.04930  131 LYS A O   
2189 C CB  A LYS A 131 ? 0.23463 0.14219 0.24363 0.06504  0.02464  0.03434  131 LYS A CB  
2190 C CB  B LYS A 131 ? 0.30168 0.20778 0.30866 0.06255  0.02490  0.03110  131 LYS A CB  
2191 C CG  A LYS A 131 ? 0.41388 0.28892 0.41012 0.05762  0.04458  0.02003  131 LYS A CG  
2192 C CG  B LYS A 131 ? 0.39450 0.29289 0.40269 0.07936  0.03015  0.05528  131 LYS A CG  
2193 C CD  A LYS A 131 ? 0.45202 0.30469 0.45711 0.06486  0.06805  0.01989  131 LYS A CD  
2194 C CD  B LYS A 131 ? 0.46152 0.32460 0.47464 0.08830  0.05832  0.05469  131 LYS A CD  
2195 C CE  A LYS A 131 ? 0.56111 0.38449 0.54970 0.04976  0.09026  0.00094  131 LYS A CE  
2196 C CE  B LYS A 131 ? 0.54852 0.41197 0.57110 0.10687  0.06468  0.08053  131 LYS A CE  
2197 N NZ  A LYS A 131 ? 0.50204 0.34575 0.48624 0.03092  0.08068  -0.01959 131 LYS A NZ  
2198 N NZ  B LYS A 131 ? 0.64244 0.48610 0.67418 0.10746  0.09124  0.07364  131 LYS A NZ  
2225 N N   . VAL A 132 ? 0.27712 0.16846 0.23879 0.03694  0.01654  0.01907  132 VAL A N   
2226 C CA  . VAL A 132 ? 0.30777 0.18091 0.24449 0.03042  0.02024  0.02208  132 VAL A CA  
2227 C C   . VAL A 132 ? 0.32629 0.18028 0.25662 0.04444  0.02978  0.04172  132 VAL A C   
2228 O O   . VAL A 132 ? 0.34182 0.17609 0.28147 0.05246  0.04683  0.03995  132 VAL A O   
2229 C CB  . VAL A 132 ? 0.32072 0.17654 0.25081 0.01792  0.03282  0.00143  132 VAL A CB  
2230 C CG1 . VAL A 132 ? 0.32888 0.15921 0.23133 0.01059  0.04162  0.00362  132 VAL A CG1 
2231 C CG2 . VAL A 132 ? 0.30747 0.18128 0.24695 0.00908  0.02617  -0.01182 132 VAL A CG2 
2241 N N   . LYS A 133 ? 0.32724 0.18608 0.23994 0.04649  0.02125  0.06140  133 LYS A N   
2242 C CA  . LYS A 133 ? 0.38532 0.22590 0.28987 0.06320  0.03055  0.08736  133 LYS A CA  
2243 C C   . LYS A 133 ? 0.42658 0.22916 0.29802 0.05406  0.04483  0.08520  133 LYS A C   
2244 O O   . LYS A 133 ? 0.50686 0.27057 0.37252 0.06324  0.06811  0.09071  133 LYS A O   
2245 C CB  . LYS A 133 ? 0.42705 0.30918 0.33463 0.07263  0.00884  0.11675  133 LYS A CB  
2246 C CG  . LYS A 133 ? 0.65643 0.53199 0.56472 0.09750  0.01547  0.15334  133 LYS A CG  
2247 C CD  . LYS A 133 ? 0.80284 0.73987 0.72374 0.10533  -0.01096 0.18153  133 LYS A CD  
2248 C CE  . LYS A 133 ? 0.93873 0.88149 0.86408 0.12098  -0.00927 0.20794  133 LYS A CE  
2249 N NZ  . LYS A 133 ? 0.99954 1.00907 0.93720 0.12134  -0.03607 0.22690  133 LYS A NZ  
2263 N N   . GLU A 134 ? 0.40218 0.21144 0.25003 0.03439  0.03512  0.07626  134 GLU A N   
2264 C CA  . GLU A 134 ? 0.43448 0.20844 0.24976 0.02184  0.04956  0.07050  134 GLU A CA  
2265 C C   . GLU A 134 ? 0.41081 0.18584 0.22414 -0.00100 0.05131  0.03870  134 GLU A C   
2266 O O   . GLU A 134 ? 0.38377 0.18767 0.20796 -0.00859 0.03715  0.02998  134 GLU A O   
2267 C CB  . GLU A 134 ? 0.47485 0.25414 0.25659 0.01890  0.03923  0.09544  134 GLU A CB  
2268 C CG  . GLU A 134 ? 0.68254 0.46852 0.46739 0.04469  0.03583  0.13469  134 GLU A CG  
2269 C CD  . GLU A 134 ? 0.68351 0.48339 0.43167 0.03885  0.02260  0.16112  134 GLU A CD  
2270 O OE1 . GLU A 134 ? 0.73156 0.57619 0.47117 0.02164  -0.00095 0.16013  134 GLU A OE1 
2271 O OE2 . GLU A 134 ? 0.70661 0.47103 0.43086 0.04828  0.03784  0.18147  134 GLU A OE2 
2278 N N   . GLY A 135 ? 0.42670 0.16988 0.22715 -0.01184 0.07139  0.02228  135 GLY A N   
2279 C CA  . GLY A 135 ? 0.44092 0.18739 0.24282 -0.03098 0.07568  -0.00408 135 GLY A CA  
2280 C C   . GLY A 135 ? 0.39348 0.15719 0.23077 -0.03024 0.07870  -0.02440 135 GLY A C   
2281 O O   . GLY A 135 ? 0.39257 0.17189 0.24207 -0.03891 0.07699  -0.03913 135 GLY A O   
2285 N N   . MET A 136 ? 0.34040 0.21320 0.19434 -0.02729 0.03946  0.02525  136 MET A N   
2286 C CA  . MET A 136 ? 0.34361 0.20160 0.18030 -0.02740 0.03736  0.02903  136 MET A CA  
2287 C C   . MET A 136 ? 0.33063 0.19191 0.17361 -0.04301 0.02259  0.02905  136 MET A C   
2288 O O   . MET A 136 ? 0.37976 0.24166 0.22632 -0.04633 0.01955  0.03088  136 MET A O   
2289 C CB  . MET A 136 ? 0.43779 0.25514 0.22156 -0.01052 0.03525  0.02981  136 MET A CB  
2290 C CG  . MET A 136 ? 0.50760 0.30189 0.26140 0.00078  0.03281  0.03249  136 MET A CG  
2291 S SD  . MET A 136 ? 0.48436 0.30998 0.26900 0.01421  0.06279  0.04920  136 MET A SD  
2292 C CE  . MET A 136 ? 0.63352 0.43487 0.38776 0.01692  0.05117  0.04733  136 MET A CE  
2302 N N   . ASN A 137 ? 0.32193 0.18969 0.17210 -0.05082 0.01551  0.03205  137 ASN A N   
2303 C CA  . ASN A 137 ? 0.35398 0.23754 0.22625 -0.06271 0.00700  0.04364  137 ASN A CA  
2304 C C   . ASN A 137 ? 0.29043 0.20804 0.18554 -0.05841 0.01694  0.04303  137 ASN A C   
2305 O O   . ASN A 137 ? 0.31660 0.24821 0.22848 -0.06415 0.01314  0.05303  137 ASN A O   
2306 C CB  . ASN A 137 ? 0.38836 0.28048 0.27231 -0.06667 0.00447  0.05722  137 ASN A CB  
2307 C CG  . ASN A 137 ? 0.36906 0.27982 0.24968 -0.05214 0.01984  0.05097  137 ASN A CG  
2308 O OD1 . ASN A 137 ? 0.36161 0.26075 0.22753 -0.04426 0.02351  0.03594  137 ASN A OD1 
2309 N ND2 . ASN A 137 ? 0.35646 0.29588 0.25128 -0.04429 0.02826  0.06586  137 ASN A ND2 
2316 N N   . ILE A 138 ? 0.29394 0.22166 0.19189 -0.04644 0.02465  0.03178  138 ILE A N   
2317 C CA  . ILE A 138 ? 0.26508 0.21180 0.17708 -0.03712 0.02434  0.02651  138 ILE A CA  
2318 C C   . ILE A 138 ? 0.27912 0.22014 0.20033 -0.04361 0.02231  0.02445  138 ILE A C   
2319 O O   . ILE A 138 ? 0.27398 0.22673 0.20335 -0.04204 0.01931  0.02505  138 ILE A O   
2320 C CB  . ILE A 138 ? 0.28802 0.23445 0.20222 -0.02085 0.01959  0.01319  138 ILE A CB  
2321 C CG1 . ILE A 138 ? 0.29631 0.24660 0.19246 -0.00890 0.02334  0.01600  138 ILE A CG1 
2322 C CG2 . ILE A 138 ? 0.34622 0.29770 0.26759 -0.00605 0.00778  0.00339  138 ILE A CG2 
2323 C CD1 . ILE A 138 ? 0.34908 0.32206 0.23781 0.00321  0.03187  0.03197  138 ILE A CD1 
2335 N N   . VAL A 139 ? 0.26270 0.18651 0.17956 -0.04634 0.02650  0.02525  139 VAL A N   
2336 C CA  . VAL A 139 ? 0.26622 0.18371 0.18578 -0.04775 0.02907  0.02948  139 VAL A CA  
2337 C C   . VAL A 139 ? 0.29466 0.20286 0.19642 -0.05502 0.02130  0.03242  139 VAL A C   
2338 O O   . VAL A 139 ? 0.30044 0.21410 0.21053 -0.05705 0.01867  0.03321  139 VAL A O   
2339 C CB  . VAL A 139 ? 0.29370 0.19692 0.20424 -0.03851 0.04179  0.03779  139 VAL A CB  
2340 C CG1 . VAL A 139 ? 0.33097 0.22650 0.23529 -0.03239 0.04917  0.04765  139 VAL A CG1 
2341 C CG2 . VAL A 139 ? 0.34659 0.26576 0.29712 -0.03437 0.04608  0.04157  139 VAL A CG2 
2351 N N   . GLU A 140 ? 0.31791 0.20976 0.20116 -0.05983 0.01238  0.03523  140 GLU A N   
2352 C CA  . GLU A 140 ? 0.36151 0.24139 0.24270 -0.06921 -0.00515 0.04111  140 GLU A CA  
2353 C C   . GLU A 140 ? 0.36815 0.28576 0.28556 -0.07538 -0.00406 0.05003  140 GLU A C   
2354 O O   . GLU A 140 ? 0.33169 0.25067 0.25862 -0.08045 -0.01310 0.05442  140 GLU A O   
2355 C CB  . GLU A 140 ? 0.43699 0.28848 0.30525 -0.07488 -0.02434 0.04554  140 GLU A CB  
2356 C CG  . GLU A 140 ? 0.52580 0.32884 0.34093 -0.05903 -0.03008 0.03528  140 GLU A CG  
2357 C CD  . GLU A 140 ? 0.76668 0.53473 0.56447 -0.06110 -0.05346 0.03571  140 GLU A CD  
2358 O OE1 . GLU A 140 ? 0.67679 0.46602 0.51403 -0.07793 -0.05962 0.04819  140 GLU A OE1 
2359 O OE2 . GLU A 140 ? 0.74871 0.46607 0.49065 -0.04138 -0.06574 0.02589  140 GLU A OE2 
2366 N N   . ALA A 141 ? 0.32413 0.27108 0.25636 -0.06893 0.00734  0.05343  141 ALA A N   
2367 C CA  . ALA A 141 ? 0.31544 0.29869 0.26975 -0.06142 0.01334  0.06443  141 ALA A CA  
2368 C C   . ALA A 141 ? 0.30489 0.29176 0.25662 -0.05309 0.01397  0.05170  141 ALA A C   
2369 O O   . ALA A 141 ? 0.33148 0.33661 0.29642 -0.05075 0.01312  0.06008  141 ALA A O   
2370 C CB  . ALA A 141 ? 0.32233 0.32736 0.27444 -0.04355 0.02566  0.06936  141 ALA A CB  
2376 N N   . MET A 142 ? 0.28272 0.25357 0.22533 -0.04867 0.01377  0.03528  142 MET A N   
2377 C CA  . MET A 142 ? 0.25084 0.22056 0.20069 -0.04343 0.00887  0.02654  142 MET A CA  
2378 C C   . MET A 142 ? 0.29714 0.25851 0.24667 -0.05438 0.00667  0.03165  142 MET A C   
2379 O O   . MET A 142 ? 0.30393 0.27220 0.26039 -0.05074 0.00237  0.02978  142 MET A O   
2380 C CB  . MET A 142 ? 0.33468 0.28990 0.29548 -0.04196 0.00611  0.01862  142 MET A CB  
2381 C CG  . MET A 142 ? 0.42474 0.38011 0.38847 -0.02905 -0.00142 0.00918  142 MET A CG  
2382 S SD  . MET A 142 ? 0.41274 0.35572 0.40991 -0.03450 -0.00467 0.01137  142 MET A SD  
2383 C CE  . MET A 142 ? 0.32230 0.26238 0.35570 -0.03938 -0.01353 0.01798  142 MET A CE  
2393 N N   . GLU A 143 ? 0.34073 0.28017 0.27485 -0.06307 0.00625  0.03584  143 GLU A N   
2394 C CA  . GLU A 143 ? 0.38665 0.30598 0.30700 -0.06635 -0.00046 0.03782  143 GLU A CA  
2395 C C   . GLU A 143 ? 0.36582 0.30097 0.30277 -0.07236 -0.01123 0.04392  143 GLU A C   
2396 O O   . GLU A 143 ? 0.44281 0.37059 0.37641 -0.07215 -0.01680 0.04266  143 GLU A O   
2397 C CB  . GLU A 143 ? 0.53282 0.41570 0.41978 -0.06528 -0.00784 0.03843  143 GLU A CB  
2398 C CG  . GLU A 143 ? 0.68363 0.53550 0.53490 -0.05034 -0.00282 0.03782  143 GLU A CG  
2399 C CD  . GLU A 143 ? 0.45331 0.25735 0.25324 -0.03817 -0.01723 0.03464  143 GLU A CD  
2400 O OE1 . GLU A 143 ? 0.58203 0.37729 0.38223 -0.04591 -0.03133 0.03278  143 GLU A OE1 
2401 O OE2 . GLU A 143 ? 0.52046 0.29106 0.27487 -0.01623 -0.01637 0.03471  143 GLU A OE2 
2408 N N   . ARG A 144 ? 0.35452 0.31479 0.31366 -0.07555 -0.01223 0.05539  144 ARG A N   
2409 C CA  . ARG A 144 ? 0.37925 0.36373 0.36868 -0.07990 -0.01963 0.07199  144 ARG A CA  
2410 C C   . ARG A 144 ? 0.38479 0.39525 0.37982 -0.06588 -0.01073 0.06916  144 ARG A C   
2411 O O   . ARG A 144 ? 0.43253 0.46330 0.45125 -0.06659 -0.01526 0.08296  144 ARG A O   
2412 C CB  . ARG A 144 ? 0.50991 0.52233 0.53181 -0.08286 -0.01684 0.09624  144 ARG A CB  
2413 C CG  . ARG A 144 ? 0.69196 0.67044 0.70956 -0.09765 -0.03416 0.09835  144 ARG A CG  
2414 C CD  . ARG A 144 ? 0.90739 0.91107 0.97773 -0.10794 -0.04101 0.13231  144 ARG A CD  
2415 N NE  . ARG A 144 ? 1.06232 1.09947 1.13661 -0.09419 -0.01469 0.14380  144 ARG A NE  
2416 C CZ  . ARG A 144 ? 1.11489 1.13513 1.17653 -0.09694 -0.01517 0.14181  144 ARG A CZ  
2417 N NH1 . ARG A 144 ? 1.11392 1.16439 1.17501 -0.07978 0.00892  0.15255  144 ARG A NH1 
2418 N NH2 . ARG A 144 ? 1.10556 1.07469 1.14718 -0.11103 -0.04079 0.12830  144 ARG A NH2 
2432 N N   . PHE A 145 ? 0.28682 0.29332 0.26406 -0.05242 -0.00346 0.05236  145 PHE A N   
2433 C CA  . PHE A 145 ? 0.24772 0.26473 0.22320 -0.03613 -0.00448 0.04497  145 PHE A CA  
2434 C C   . PHE A 145 ? 0.28834 0.28006 0.25870 -0.04363 -0.01250 0.03421  145 PHE A C   
2435 O O   . PHE A 145 ? 0.32119 0.31341 0.29139 -0.03210 -0.01854 0.02628  145 PHE A O   
2436 C CB  . PHE A 145 ? 0.25572 0.27464 0.21722 -0.01250 -0.00369 0.03306  145 PHE A CB  
2437 C CG  . PHE A 145 ? 0.27352 0.31885 0.23133 0.00477  0.00879  0.04691  145 PHE A CG  
2438 C CD1 . PHE A 145 ? 0.43989 0.52130 0.40322 0.02598  0.01998  0.06722  145 PHE A CD1 
2439 C CD2 . PHE A 145 ? 0.34796 0.38569 0.29926 0.00293  0.01257  0.04496  145 PHE A CD2 
2440 C CE1 . PHE A 145 ? 0.46968 0.58130 0.43332 0.04716  0.03783  0.08965  145 PHE A CE1 
2441 C CE2 . PHE A 145 ? 0.35589 0.41834 0.30311 0.02139  0.02651  0.06178  145 PHE A CE2 
2442 C CZ  . PHE A 145 ? 0.33869 0.43924 0.29280 0.04444  0.04074  0.08641  145 PHE A CZ  
2452 N N   . GLY A 146 ? 0.22471 0.36248 0.29019 -0.03037 0.01729  0.03622  146 GLY A N   
2453 C CA  . GLY A 146 ? 0.19416 0.31224 0.25804 -0.01262 0.01303  0.02991  146 GLY A CA  
2454 C C   . GLY A 146 ? 0.19354 0.36063 0.27124 -0.00841 0.00963  0.03111  146 GLY A C   
2455 O O   . GLY A 146 ? 0.19334 0.41784 0.28424 -0.01790 0.01172  0.03561  146 GLY A O   
2459 N N   . SER A 147 ? 0.19544 0.34377 0.26925 0.00438  0.00368  0.02804  147 SER A N   
2460 C CA  . SER A 147 ? 0.19730 0.38863 0.28226 0.01170  -0.00187 0.02913  147 SER A CA  
2461 C C   . SER A 147 ? 0.20054 0.35614 0.27577 0.01136  -0.00977 0.02868  147 SER A C   
2462 O O   . SER A 147 ? 0.20165 0.30607 0.26234 0.00864  -0.00957 0.02675  147 SER A O   
2463 C CB  . SER A 147 ? 0.24404 0.46848 0.33204 0.04612  -0.00080 0.02469  147 SER A CB  
2464 O OG  . SER A 147 ? 0.22267 0.39221 0.29091 0.06992  -0.00405 0.02033  147 SER A OG  
2470 N N   . ARG A 148 ? 0.20333 0.39355 0.28656 0.01371  -0.01680 0.03058  148 ARG A N   
2471 C CA  . ARG A 148 ? 0.20842 0.37274 0.28110 0.00998  -0.02448 0.03092  148 ARG A CA  
2472 C C   . ARG A 148 ? 0.22206 0.33839 0.27414 0.02946  -0.02628 0.03134  148 ARG A C   
2473 O O   . ARG A 148 ? 0.25423 0.33705 0.29258 0.01954  -0.02847 0.03151  148 ARG A O   
2474 C CB  . ARG A 148 ? 0.21263 0.42596 0.29581 0.01247  -0.03300 0.03359  148 ARG A CB  
2475 C CG  . ARG A 148 ? 0.26107 0.51408 0.35912 -0.01674 -0.03520 0.03406  148 ARG A CG  
2476 C CD  . ARG A 148 ? 0.31587 0.52991 0.40251 -0.04114 -0.03927 0.02997  148 ARG A CD  
2477 N NE  . ARG A 148 ? 0.32606 0.52178 0.39903 -0.03292 -0.04538 0.02844  148 ARG A NE  
2478 C CZ  . ARG A 148 ? 0.34887 0.57667 0.42395 -0.03462 -0.05455 0.02970  148 ARG A CZ  
2479 N NH1 . ARG A 148 ? 0.32194 0.60561 0.41469 -0.04422 -0.05909 0.03179  148 ARG A NH1 
2480 N NH2 . ARG A 148 ? 0.33799 0.54649 0.39650 -0.02882 -0.05956 0.02969  148 ARG A NH2 
2494 N N   . ASN A 149 ? 0.23637 0.35005 0.28368 0.05665  -0.02689 0.03115  149 ASN A N   
2495 C CA  . ASN A 149 ? 0.26070 0.31991 0.28301 0.07128  -0.03211 0.03325  149 ASN A CA  
2496 C C   . ASN A 149 ? 0.26003 0.27683 0.27126 0.06632  -0.02491 0.02970  149 ASN A C   
2497 O O   . ASN A 149 ? 0.34173 0.31081 0.33015 0.07314  -0.02967 0.03180  149 ASN A O   
2498 C CB  . ASN A 149 ? 0.29124 0.35421 0.30622 0.10645  -0.04192 0.03381  149 ASN A CB  
2499 C CG  . ASN A 149 ? 0.34186 0.42978 0.36617 0.12896  -0.03668 0.02501  149 ASN A CG  
2500 O OD1 . ASN A 149 ? 0.35957 0.44798 0.38927 0.11772  -0.02576 0.02050  149 ASN A OD1 
2501 N ND2 . ASN A 149 ? 0.43640 0.54743 0.46104 0.16355  -0.04548 0.02179  149 ASN A ND2 
2508 N N   . GLY A 150 ? 0.23768 0.26916 0.26207 0.05214  -0.01534 0.02573  150 GLY A N   
2509 C CA  . GLY A 150 ? 0.23994 0.23639 0.25516 0.04506  -0.00934 0.02270  150 GLY A CA  
2510 C C   . GLY A 150 ? 0.24609 0.24324 0.25888 0.06235  -0.00513 0.01764  150 GLY A C   
2511 O O   . GLY A 150 ? 0.25334 0.23289 0.26219 0.05412  0.00065  0.01497  150 GLY A O   
2515 N N   A LYS A 151 ? 0.25999 0.28032 0.27439 0.08826  -0.00854 0.01477  151 LYS A N   
2516 N N   B LYS A 151 ? 0.26037 0.27990 0.27443 0.08840  -0.00867 0.01478  151 LYS A N   
2517 C CA  A LYS A 151 ? 0.27304 0.29893 0.28327 0.10885  -0.00470 0.00620  151 LYS A CA  
2518 C CA  B LYS A 151 ? 0.27250 0.29929 0.28315 0.10853  -0.00457 0.00626  151 LYS A CA  
2519 C C   A LYS A 151 ? 0.25104 0.32740 0.28036 0.09450  0.00666  0.00574  151 LYS A C   
2520 C C   B LYS A 151 ? 0.24706 0.32145 0.27634 0.09235  0.00681  0.00622  151 LYS A C   
2521 O O   A LYS A 151 ? 0.23193 0.35906 0.28084 0.08211  0.00855  0.01058  151 LYS A O   
2522 O O   B LYS A 151 ? 0.24042 0.36009 0.28860 0.07629  0.00873  0.01177  151 LYS A O   
2523 C CB  A LYS A 151 ? 0.30175 0.34491 0.30871 0.14578  -0.01283 0.00036  151 LYS A CB  
2524 C CB  B LYS A 151 ? 0.29897 0.34878 0.30845 0.14500  -0.01186 0.00028  151 LYS A CB  
2525 C CG  A LYS A 151 ? 0.34035 0.32116 0.32046 0.16072  -0.02776 0.00301  151 LYS A CG  
2526 C CG  B LYS A 151 ? 0.45088 0.50734 0.45277 0.17230  -0.00890 -0.01308 151 LYS A CG  
2527 C CD  A LYS A 151 ? 0.55324 0.54937 0.52941 0.20121  -0.03969 -0.00229 151 LYS A CD  
2528 C CD  B LYS A 151 ? 0.60358 0.68001 0.60211 0.21580  -0.01893 -0.02227 151 LYS A CD  
2529 C CE  A LYS A 151 ? 0.58972 0.57753 0.55329 0.23596  -0.04117 -0.01848 151 LYS A CE  
2530 C CE  B LYS A 151 ? 0.63696 0.71763 0.62411 0.24792  -0.01720 -0.04007 151 LYS A CE  
2531 N NZ  A LYS A 151 ? 0.62002 0.61123 0.57375 0.26603  -0.05368 -0.02521 151 LYS A NZ  
2532 N NZ  B LYS A 151 ? 0.75936 0.84747 0.73629 0.27728  -0.02863 -0.04920 151 LYS A NZ  
2559 N N   . THR A 152 ? 0.26832 0.33125 0.28941 0.09421  0.01286  0.00096  152 THR A N   
2560 C CA  . THR A 152 ? 0.23475 0.33835 0.26789 0.07693  0.02243  0.00357  152 THR A CA  
2561 C C   . THR A 152 ? 0.25550 0.41951 0.29542 0.09950  0.02751  -0.00407 152 THR A C   
2562 O O   . THR A 152 ? 0.30068 0.45502 0.32874 0.13291  0.02415  -0.01612 152 THR A O   
2563 C CB  . THR A 152 ? 0.27136 0.33529 0.29160 0.06372  0.02595  0.00341  152 THR A CB  
2564 O OG1 . THR A 152 ? 0.29402 0.33113 0.29564 0.08690  0.02518  -0.00757 152 THR A OG1 
2565 C CG2 . THR A 152 ? 0.32370 0.33949 0.33908 0.04546  0.02107  0.00833  152 THR A CG2 
2573 N N   . SER A 153 ? 0.23277 0.46047 0.29003 0.08089  0.03432  0.00257  153 SER A N   
2574 C CA  . SER A 153 ? 0.24763 0.55300 0.31492 0.09862  0.04088  -0.00414 153 SER A CA  
2575 C C   . SER A 153 ? 0.24561 0.55845 0.30080 0.10296  0.04952  -0.01057 153 SER A C   
2576 O O   . SER A 153 ? 0.25852 0.62980 0.31610 0.12786  0.05499  -0.02215 153 SER A O   
2577 C CB  . SER A 153 ? 0.32261 0.70256 0.41282 0.07055  0.04393  0.00796  153 SER A CB  
2578 O OG  . SER A 153 ? 0.33781 0.70317 0.42559 0.02882  0.04626  0.02223  153 SER A OG  
2584 N N   . LYS A 154 ? 0.26468 0.52404 0.30659 0.08137  0.05029  -0.00460 154 LYS A N   
2585 C CA  . LYS A 154 ? 0.30625 0.55923 0.33208 0.08562  0.05627  -0.01089 154 LYS A CA  
2586 C C   . LYS A 154 ? 0.28771 0.45411 0.29456 0.08446  0.05004  -0.01324 154 LYS A C   
2587 O O   . LYS A 154 ? 0.26185 0.38363 0.27037 0.07264  0.04329  -0.00668 154 LYS A O   
2588 C CB  . LYS A 154 ? 0.28234 0.57897 0.31265 0.05171  0.06371  0.00361  154 LYS A CB  
2589 C CG  . LYS A 154 ? 0.37092 0.76660 0.41819 0.04928  0.07116  0.00605  154 LYS A CG  
2590 C CD  . LYS A 154 ? 0.49180 0.92837 0.53667 0.01214  0.07755  0.02267  154 LYS A CD  
2591 C CE  . LYS A 154 ? 0.62705 1.15939 0.68525 0.00642  0.08160  0.02484  154 LYS A CE  
2592 N NZ  . LYS A 154 ? 0.81541 1.36819 0.86342 -0.03218 0.08095  0.04202  154 LYS A NZ  
2606 N N   . LYS A 155 ? 0.27427 0.42287 0.26253 0.09624  0.05222  -0.02358 155 LYS A N   
2607 C CA  . LYS A 155 ? 0.28223 0.35692 0.25194 0.09350  0.04592  -0.02656 155 LYS A CA  
2608 C C   . LYS A 155 ? 0.26392 0.32567 0.23579 0.06063  0.04718  -0.01225 155 LYS A C   
2609 O O   . LYS A 155 ? 0.26510 0.35778 0.23489 0.04919  0.05300  -0.00735 155 LYS A O   
2610 C CB  . LYS A 155 ? 0.34722 0.40628 0.29375 0.11784  0.04554  -0.04456 155 LYS A CB  
2611 C CG  . LYS A 155 ? 0.53589 0.51986 0.46117 0.11467  0.03684  -0.04887 155 LYS A CG  
2612 C CD  . LYS A 155 ? 0.74171 0.67931 0.66333 0.12192  0.02631  -0.04850 155 LYS A CD  
2613 C CE  . LYS A 155 ? 0.86331 0.73922 0.75406 0.13892  0.01532  -0.06243 155 LYS A CE  
2614 N NZ  . LYS A 155 ? 0.93723 0.76923 0.82062 0.14515  0.00338  -0.05902 155 LYS A NZ  
2628 N N   . ILE A 156 ? 0.25252 0.27085 0.22690 0.04688  0.04077  -0.00573 156 ILE A N   
2629 C CA  . ILE A 156 ? 0.25226 0.25382 0.22869 0.02177  0.03876  0.00548  156 ILE A CA  
2630 C C   . ILE A 156 ? 0.27422 0.23102 0.23536 0.02352  0.03477  -0.00089 156 ILE A C   
2631 O O   . ILE A 156 ? 0.28708 0.21098 0.24399 0.02835  0.02982  -0.00575 156 ILE A O   
2632 C CB  . ILE A 156 ? 0.23018 0.22303 0.22049 0.00783  0.03384  0.01381  156 ILE A CB  
2633 C CG1 . ILE A 156 ? 0.30727 0.34583 0.31238 0.00547  0.03615  0.01880  156 ILE A CG1 
2634 C CG2 . ILE A 156 ? 0.33833 0.31042 0.32789 -0.01232 0.02909  0.02250  156 ILE A CG2 
2635 C CD1 . ILE A 156 ? 0.32821 0.41307 0.33607 -0.00816 0.04130  0.02746  156 ILE A CD1 
2647 N N   . THR A 157 ? 0.25394 0.21245 0.20528 0.01750  0.03615  0.00009  157 THR A N   
2648 C CA  . THR A 157 ? 0.26376 0.18818 0.20037 0.01846  0.03196  -0.00698 157 THR A CA  
2649 C C   . THR A 157 ? 0.28104 0.19783 0.21871 0.00219  0.02798  0.00179  157 THR A C   
2650 O O   . THR A 157 ? 0.26645 0.20028 0.20883 -0.00861 0.02808  0.01330  157 THR A O   
2651 C CB  . THR A 157 ? 0.31928 0.24880 0.23694 0.03239  0.03470  -0.01917 157 THR A CB  
2652 O OG1 . THR A 157 ? 0.34437 0.31464 0.26156 0.02727  0.04089  -0.01317 157 THR A OG1 
2653 C CG2 . THR A 157 ? 0.34184 0.27017 0.25369 0.05572  0.03506  -0.03179 157 THR A CG2 
2661 N N   . ILE A 158 ? 0.28671 0.17738 0.21793 0.00017  0.02272  -0.00344 158 ILE A N   
2662 C CA  . ILE A 158 ? 0.29049 0.17682 0.22066 -0.00910 0.01728  0.00117  158 ILE A CA  
2663 C C   . ILE A 158 ? 0.32154 0.21453 0.23422 -0.00731 0.01829  -0.00275 158 ILE A C   
2664 O O   . ILE A 158 ? 0.33353 0.21221 0.23357 -0.00484 0.01617  -0.01335 158 ILE A O   
2665 C CB  . ILE A 158 ? 0.27049 0.14015 0.20476 -0.01280 0.01161  -0.00334 158 ILE A CB  
2666 C CG1 . ILE A 158 ? 0.28164 0.14960 0.23085 -0.01361 0.01136  -0.00090 158 ILE A CG1 
2667 C CG2 . ILE A 158 ? 0.31882 0.19196 0.25333 -0.01727 0.00489  -0.00081 158 ILE A CG2 
2668 C CD1 . ILE A 158 ? 0.32361 0.18453 0.27517 -0.01787 0.00818  -0.00614 158 ILE A CD1 
2680 N N   . ALA A 159 ? 0.30830 0.22309 0.21740 -0.01115 0.02060  0.00638  159 ALA A N   
2681 C CA  . ALA A 159 ? 0.32384 0.25217 0.21424 -0.00923 0.02262  0.00240  159 ALA A CA  
2682 C C   . ALA A 159 ? 0.36381 0.27980 0.24627 -0.01490 0.01404  0.00279  159 ALA A C   
2683 O O   . ALA A 159 ? 0.36032 0.27720 0.22588 -0.01241 0.01349  -0.00682 159 ALA A O   
2684 C CB  . ALA A 159 ? 0.31774 0.28043 0.20482 -0.01579 0.02776  0.01476  159 ALA A CB  
2690 N N   . ASP A 160 ? 0.30660 0.21265 0.20017 -0.02065 0.00609  0.01201  160 ASP A N   
2691 C CA  . ASP A 160 ? 0.30035 0.20182 0.19027 -0.02253 -0.00356 0.01174  160 ASP A CA  
2692 C C   . ASP A 160 ? 0.32302 0.21410 0.23078 -0.02101 -0.01052 0.01327  160 ASP A C   
2693 O O   . ASP A 160 ? 0.29516 0.17935 0.21380 -0.02073 -0.00972 0.01851  160 ASP A O   
2694 C CB  . ASP A 160 ? 0.33406 0.24561 0.21017 -0.02692 -0.00892 0.02436  160 ASP A CB  
2695 C CG  . ASP A 160 ? 0.44239 0.35700 0.31017 -0.02630 -0.01822 0.02070  160 ASP A CG  
2696 O OD1 . ASP A 160 ? 0.38389 0.29702 0.25589 -0.02528 -0.01927 0.00747  160 ASP A OD1 
2697 O OD2 . ASP A 160 ? 0.50875 0.42889 0.36428 -0.02891 -0.02562 0.03247  160 ASP A OD2 
2702 N N   . CYS A 161 ? 0.31024 0.20520 0.22071 -0.01988 -0.01750 0.00697  161 CYS A N   
2703 C CA  . CYS A 161 ? 0.29842 0.19421 0.22560 -0.01478 -0.02416 0.00527  161 CYS A CA  
2704 C C   . CYS A 161 ? 0.30675 0.22048 0.23435 -0.01197 -0.03377 0.00092  161 CYS A C   
2705 O O   . CYS A 161 ? 0.32018 0.24337 0.23596 -0.01803 -0.03401 -0.00244 161 CYS A O   
2706 C CB  . CYS A 161 ? 0.27184 0.16681 0.21019 -0.01718 -0.01755 -0.00303 161 CYS A CB  
2707 S SG  . CYS A 161 ? 0.31691 0.21024 0.24399 -0.02778 -0.01207 -0.01311 161 CYS A SG  
2713 N N   . GLY A 162 ? 0.31424 0.23505 0.25498 -0.00113 -0.04274 -0.00058 162 GLY A N   
2714 C CA  . GLY A 162 ? 0.34231 0.28955 0.28696 0.00590  -0.05330 -0.00553 162 GLY A CA  
2715 C C   . GLY A 162 ? 0.33584 0.28675 0.29353 0.02571  -0.06468 -0.00851 162 GLY A C   
2716 O O   . GLY A 162 ? 0.33206 0.26414 0.29562 0.03107  -0.06349 -0.00893 162 GLY A O   
2720 N N   . GLN A 163 ? 0.30884 0.28546 0.26989 0.03837  -0.07706 -0.01232 163 GLN A N   
2721 C CA  . GLN A 163 ? 0.34144 0.32701 0.31388 0.06428  -0.09078 -0.01959 163 GLN A CA  
2722 C C   . GLN A 163 ? 0.40346 0.35397 0.35943 0.07992  -0.10911 -0.00732 163 GLN A C   
2723 O O   . GLN A 163 ? 0.45444 0.40708 0.39689 0.07441  -0.11391 0.00215  163 GLN A O   
2724 C CB  . GLN A 163 ? 0.35605 0.40494 0.34556 0.07063  -0.09345 -0.03408 163 GLN A CB  
2725 C CG  . GLN A 163 ? 0.37454 0.44693 0.37991 0.10021  -0.10390 -0.04803 163 GLN A CG  
2726 C CD  . GLN A 163 ? 0.37853 0.53055 0.40425 0.10213  -0.10268 -0.06330 163 GLN A CD  
2727 O OE1 . GLN A 163 ? 0.34555 0.52957 0.37301 0.07438  -0.09250 -0.06250 163 GLN A OE1 
2728 N NE2 . GLN A 163 ? 0.49313 0.67886 0.53282 0.13485  -0.11439 -0.07809 163 GLN A NE2 
2737 N N   . LEU A 164 ? 0.46359 0.37806 0.41698 0.09786  -0.12090 -0.00698 164 LEU A N   
2738 C CA  . LEU A 164 ? 0.49328 0.36428 0.42625 0.11298  -0.14325 0.00596  164 LEU A CA  
2739 C C   . LEU A 164 ? 0.62694 0.51915 0.56720 0.14890  -0.16366 -0.00701 164 LEU A C   
2740 O O   . LEU A 164 ? 0.65674 0.53727 0.58225 0.16197  -0.18233 0.00236  164 LEU A O   
2741 C CB  . LEU A 164 ? 0.51563 0.32379 0.43476 0.11055  -0.14963 0.01509  164 LEU A CB  
2742 C CG  . LEU A 164 ? 0.52954 0.31790 0.43903 0.07754  -0.13350 0.03085  164 LEU A CG  
2743 C CD1 . LEU A 164 ? 0.70907 0.44069 0.60582 0.07400  -0.14317 0.03909  164 LEU A CD1 
2744 C CD2 . LEU A 164 ? 0.77972 0.56863 0.67007 0.06078  -0.13292 0.04957  164 LEU A CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  CYS 52  52  52  CYS CYS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 CYS 115 115 115 CYS CYS A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 TRP 121 121 121 TRP TRP A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 MET 136 136 136 MET MET A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 MET 142 142 142 MET MET A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLU 165 165 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   201 118 HOH HOH A . 
B 2 HOH 2   202 127 HOH HOH A . 
B 2 HOH 3   203 48  HOH HOH A . 
B 2 HOH 4   204 65  HOH HOH A . 
B 2 HOH 5   205 81  HOH HOH A . 
B 2 HOH 6   206 106 HOH HOH A . 
B 2 HOH 7   207 55  HOH HOH A . 
B 2 HOH 8   208 71  HOH HOH A . 
B 2 HOH 9   209 69  HOH HOH A . 
B 2 HOH 10  210 114 HOH HOH A . 
B 2 HOH 11  211 133 HOH HOH A . 
B 2 HOH 12  212 66  HOH HOH A . 
B 2 HOH 13  213 90  HOH HOH A . 
B 2 HOH 14  214 142 HOH HOH A . 
B 2 HOH 15  215 136 HOH HOH A . 
B 2 HOH 16  216 7   HOH HOH A . 
B 2 HOH 17  217 111 HOH HOH A . 
B 2 HOH 18  218 123 HOH HOH A . 
B 2 HOH 19  219 86  HOH HOH A . 
B 2 HOH 20  220 10  HOH HOH A . 
B 2 HOH 21  221 34  HOH HOH A . 
B 2 HOH 22  222 108 HOH HOH A . 
B 2 HOH 23  223 12  HOH HOH A . 
B 2 HOH 24  224 97  HOH HOH A . 
B 2 HOH 25  225 45  HOH HOH A . 
B 2 HOH 26  226 24  HOH HOH A . 
B 2 HOH 27  227 54  HOH HOH A . 
B 2 HOH 28  228 64  HOH HOH A . 
B 2 HOH 29  229 129 HOH HOH A . 
B 2 HOH 30  230 6   HOH HOH A . 
B 2 HOH 31  231 122 HOH HOH A . 
B 2 HOH 32  232 5   HOH HOH A . 
B 2 HOH 33  233 4   HOH HOH A . 
B 2 HOH 34  234 17  HOH HOH A . 
B 2 HOH 35  235 95  HOH HOH A . 
B 2 HOH 36  236 22  HOH HOH A . 
B 2 HOH 37  237 56  HOH HOH A . 
B 2 HOH 38  238 59  HOH HOH A . 
B 2 HOH 39  239 41  HOH HOH A . 
B 2 HOH 40  240 43  HOH HOH A . 
B 2 HOH 41  241 27  HOH HOH A . 
B 2 HOH 42  242 67  HOH HOH A . 
B 2 HOH 43  243 9   HOH HOH A . 
B 2 HOH 44  244 128 HOH HOH A . 
B 2 HOH 45  245 63  HOH HOH A . 
B 2 HOH 46  246 38  HOH HOH A . 
B 2 HOH 47  247 125 HOH HOH A . 
B 2 HOH 48  248 58  HOH HOH A . 
B 2 HOH 49  249 2   HOH HOH A . 
B 2 HOH 50  250 62  HOH HOH A . 
B 2 HOH 51  251 89  HOH HOH A . 
B 2 HOH 52  252 80  HOH HOH A . 
B 2 HOH 53  253 1   HOH HOH A . 
B 2 HOH 54  254 42  HOH HOH A . 
B 2 HOH 55  255 57  HOH HOH A . 
B 2 HOH 56  256 18  HOH HOH A . 
B 2 HOH 57  257 126 HOH HOH A . 
B 2 HOH 58  258 30  HOH HOH A . 
B 2 HOH 59  259 26  HOH HOH A . 
B 2 HOH 60  260 28  HOH HOH A . 
B 2 HOH 61  261 14  HOH HOH A . 
B 2 HOH 62  262 85  HOH HOH A . 
B 2 HOH 63  263 13  HOH HOH A . 
B 2 HOH 64  264 36  HOH HOH A . 
B 2 HOH 65  265 8   HOH HOH A . 
B 2 HOH 66  266 20  HOH HOH A . 
B 2 HOH 67  267 99  HOH HOH A . 
B 2 HOH 68  268 29  HOH HOH A . 
B 2 HOH 69  269 130 HOH HOH A . 
B 2 HOH 70  270 46  HOH HOH A . 
B 2 HOH 71  271 25  HOH HOH A . 
B 2 HOH 72  272 3   HOH HOH A . 
B 2 HOH 73  273 103 HOH HOH A . 
B 2 HOH 74  274 77  HOH HOH A . 
B 2 HOH 75  275 53  HOH HOH A . 
B 2 HOH 76  276 37  HOH HOH A . 
B 2 HOH 77  277 72  HOH HOH A . 
B 2 HOH 78  278 33  HOH HOH A . 
B 2 HOH 79  279 100 HOH HOH A . 
B 2 HOH 80  280 87  HOH HOH A . 
B 2 HOH 81  281 94  HOH HOH A . 
B 2 HOH 82  282 75  HOH HOH A . 
B 2 HOH 83  283 52  HOH HOH A . 
B 2 HOH 84  284 76  HOH HOH A . 
B 2 HOH 85  285 15  HOH HOH A . 
B 2 HOH 86  286 116 HOH HOH A . 
B 2 HOH 87  287 61  HOH HOH A . 
B 2 HOH 88  288 23  HOH HOH A . 
B 2 HOH 89  289 73  HOH HOH A . 
B 2 HOH 90  290 82  HOH HOH A . 
B 2 HOH 91  291 88  HOH HOH A . 
B 2 HOH 92  292 44  HOH HOH A . 
B 2 HOH 93  293 35  HOH HOH A . 
B 2 HOH 94  294 132 HOH HOH A . 
B 2 HOH 95  295 91  HOH HOH A . 
B 2 HOH 96  296 11  HOH HOH A . 
B 2 HOH 97  297 19  HOH HOH A . 
B 2 HOH 98  298 102 HOH HOH A . 
B 2 HOH 99  299 47  HOH HOH A . 
B 2 HOH 100 300 120 HOH HOH A . 
B 2 HOH 101 301 49  HOH HOH A . 
B 2 HOH 102 302 131 HOH HOH A . 
B 2 HOH 103 303 84  HOH HOH A . 
B 2 HOH 104 304 21  HOH HOH A . 
B 2 HOH 105 305 92  HOH HOH A . 
B 2 HOH 106 306 51  HOH HOH A . 
B 2 HOH 107 307 112 HOH HOH A . 
B 2 HOH 108 308 83  HOH HOH A . 
B 2 HOH 109 309 105 HOH HOH A . 
B 2 HOH 110 310 31  HOH HOH A . 
B 2 HOH 111 311 16  HOH HOH A . 
B 2 HOH 112 312 40  HOH HOH A . 
B 2 HOH 113 313 107 HOH HOH A . 
B 2 HOH 114 314 70  HOH HOH A . 
B 2 HOH 115 315 74  HOH HOH A . 
B 2 HOH 116 316 121 HOH HOH A . 
B 2 HOH 117 317 141 HOH HOH A . 
B 2 HOH 118 318 32  HOH HOH A . 
B 2 HOH 119 319 117 HOH HOH A . 
B 2 HOH 120 320 115 HOH HOH A . 
B 2 HOH 121 321 110 HOH HOH A . 
B 2 HOH 122 322 39  HOH HOH A . 
B 2 HOH 123 323 68  HOH HOH A . 
B 2 HOH 124 324 140 HOH HOH A . 
B 2 HOH 125 325 139 HOH HOH A . 
B 2 HOH 126 326 137 HOH HOH A . 
B 2 HOH 127 327 60  HOH HOH A . 
B 2 HOH 128 328 119 HOH HOH A . 
B 2 HOH 129 329 96  HOH HOH A . 
B 2 HOH 130 330 98  HOH HOH A . 
B 2 HOH 131 331 124 HOH HOH A . 
B 2 HOH 132 332 138 HOH HOH A . 
B 2 HOH 133 333 93  HOH HOH A . 
B 2 HOH 134 334 109 HOH HOH A . 
B 2 HOH 135 335 134 HOH HOH A . 
B 2 HOH 136 336 113 HOH HOH A . 
B 2 HOH 137 337 50  HOH HOH A . 
B 2 HOH 138 338 79  HOH HOH A . 
B 2 HOH 139 339 101 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  7590 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-01-29 
2 'Structure model' 1 1 2020-02-12 
3 'Structure model' 1 2 2020-03-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation_author 
2 3 'Structure model' citation        
3 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.country'              
2  3 'Structure model' '_citation.journal_abbrev'       
3  3 'Structure model' '_citation.journal_id_CSD'       
4  3 'Structure model' '_citation.journal_id_ISSN'      
5  3 'Structure model' '_citation.journal_volume'       
6  3 'Structure model' '_citation.page_first'           
7  3 'Structure model' '_citation.page_last'            
8  3 'Structure model' '_citation.pdbx_database_id_DOI' 
9  3 'Structure model' '_citation.title'                
10 3 'Structure model' '_citation.year'                 
11 3 'Structure model' '_citation_author.name'          
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 7.54474474991  6.37270416848 19.6621306567 0.202325421897 ? 0.0257931562743  ? -0.0206951866952  ? 
0.158647953507 ? 0.0156035342547   ? 0.164635869458 ? 3.12035330651 ? 0.0859110169689 ? -1.15968648816 ? 2.19380795644 ? 
-0.54000417077  ? 3.74343292372 ? -0.0366727704786   ? -0.13480701681   ? -0.170569421092  ? 0.209407400189   ? -0.0446768099485 ? 
-0.0790865856341 ? 0.231104921633  ? 0.289914281494  ? 0.0820504990173  ? 
2 'X-RAY DIFFRACTION' ? refined 1.40870915752  13.8993433602 15.5471388797 0.183812825601 ? 0.00175472137552 ? 0.0132780330245   ? 
0.11958238034  ? 0.0025388097199   ? 0.151814597922 ? 4.25828510651 ? 1.55306216606   ? 0.873467718535 ? 3.18289047599 ? 
1.57226782454   ? 4.19909141222 ? -0.0445411093519   ? 0.00881259156988 ? 0.0404728513324  ? -0.0107485233479 ? 0.125113816347   ? 
0.00306765538934 ? -0.192714064238 ? 0.0676612003241 ? -0.0535631163452 ? 
3 'X-RAY DIFFRACTION' ? refined 7.80967707634  22.0336211003 13.2304467706 0.269568503104 ? -0.0362293899221 ? 0.0297776614853   ? 
0.157758273493 ? -0.0126434571634  ? 0.231706486052 ? 7.22518087918 ? -2.36433885584  ? -3.43096621923 ? 1.37146579799 ? 
1.43623877891   ? 2.75399678338 ? 0.275472915363     ? -0.0671890709847 ? 0.468383542462   ? -0.126424593544  ? 0.00324262586437 ? 
-0.269399272501  ? -0.455598610031 ? 0.232609818592  ? -0.311190091111  ? 
4 'X-RAY DIFFRACTION' ? refined 8.40936422522  4.98799604931 5.27845581531 0.18904182697  ? 0.0495448409757  ? 0.00428415971402  ? 
0.132917451469 ? -0.00317180679427 ? 0.183922118554 ? 5.95083724951 ? 3.53621177718   ? -2.57943985868 ? 3.65398158923 ? 
-1.61283992855  ? 3.97956976291 ? -0.158226020404    ? 0.0728594491175  ? -0.372378776399  ? -0.144143667004  ? 0.0154094404187  ? 
-0.184946162724  ? 0.417163508782  ? 0.18926905738   ? 0.151706621697   ? 
5 'X-RAY DIFFRACTION' ? refined 4.02169262758  11.0886660584 4.96331102917 0.113906997477 ? 0.0368388096974  ? -0.00815333786258 ? 
0.129236758672 ? 0.00729875528328  ? 0.145579007425 ? 3.12234438748 ? 0.764157784148  ? -1.89560559346 ? 0.93261957342 ? 
-0.234358936839 ? 4.59759778942 ? 0.0492501044964    ? 0.179603121539   ? 0.0236391586741  ? -0.0161938508288 ? -0.0136983065809 ? 
0.0453663222856  ? 0.045852147746  ? -0.175070681111 ? -0.0435381696286 ? 
6 'X-RAY DIFFRACTION' ? refined 6.95759324809  4.37533484127 8.36477480139 0.146498540877 ? 0.0367432152449  ? -0.00179419384944 ? 
0.116422949282 ? -0.00540443384653 ? 0.181262056711 ? 3.9138491623  ? 1.99487051495   ? -3.55092173997 ? 2.88332224004 ? 
-0.373265062338 ? 4.66055274369 ? -0.0797166267549   ? -0.0706738283171 ? -0.180534262542  ? 0.153865870733   ? -0.100962617753  ? 
-0.175729373386  ? 0.168441171128  ? 0.191501402394  ? 0.0920965476547  ? 
7 'X-RAY DIFFRACTION' ? refined -7.36525637661 2.74023548941 16.9595070135 0.264531340463 ? -0.0638079059532 ? 0.0109641103675   ? 
0.200825943857 ? 0.0400967821748   ? 0.186926793101 ? 4.42650334056 ? -5.62617229024  ? 3.40924270489  ? 7.66224907607 ? 
-3.7133608437   ? 3.41526310811 ? -0.0249651374362   ? -0.243842749525  ? -0.0588921983129 ? -0.298356179926  ? 0.218899699331   ? 
0.235926912658   ? 0.274668780049  ? -0.244203216591 ? -0.207615868343  ? 
8 'X-RAY DIFFRACTION' ? refined -5.01101333712 12.0318310601 18.4219818821 0.21996118056  ? 0.00577506715642 ? 0.025858012403    ? 
0.157044319125 ? 0.00991090093025  ? 0.206359926017 ? 3.31548331328 ? 0.39143721393   ? 2.08133149281  ? 1.24449886871 ? 
0.324092082938  ? 6.40464985482 ? -0.000698359565864 ? -0.355770040405  ? 0.0129243853455  ? 0.148784089199   ? 0.0452810624755  ? 
0.160042051318   ? -0.209902791672 ? -0.68968680662  ? -0.0446554991818 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 2 through 41 )
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 42 through 64 )
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 65 through 84 )
;
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 85 through 100 )
;
5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 101 through 122 )
;
6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 123 through 135 )
;
7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 136 through 145 )
;
8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 146 through 164 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? DIALS  ? ? ? .         2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DIALS  ? ? ? .         3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? DIALS  ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .         5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    PHE 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     60 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -138.58 
_pdbx_validate_torsion.psi             -74.28 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A GLU 165 ? A GLU 165 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM123159    1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM124149    2 
'National Science Foundation (NSF, United States)'                                         'United States' STC-1231306 3 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM117126    4 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_serial_crystallography_data_reduction.diffrn_id             1 
_pdbx_serial_crystallography_data_reduction.frames_total          ? 
_pdbx_serial_crystallography_data_reduction.xfel_pulse_events     ? 
_pdbx_serial_crystallography_data_reduction.frame_hits            ? 
_pdbx_serial_crystallography_data_reduction.crystal_hits          ? 
_pdbx_serial_crystallography_data_reduction.droplet_hits          ? 
_pdbx_serial_crystallography_data_reduction.frames_failed_index   ? 
_pdbx_serial_crystallography_data_reduction.frames_indexed        18358 
_pdbx_serial_crystallography_data_reduction.lattices_indexed      ? 
_pdbx_serial_crystallography_data_reduction.xfel_run_numbers      ? 
# 
_pdbx_serial_crystallography_measurement.diffrn_id                    1 
_pdbx_serial_crystallography_measurement.pulse_energy                 ? 
_pdbx_serial_crystallography_measurement.pulse_duration               50 
_pdbx_serial_crystallography_measurement.xfel_pulse_repetition_rate   10 
_pdbx_serial_crystallography_measurement.pulse_photon_energy          ? 
_pdbx_serial_crystallography_measurement.photons_per_pulse            ? 
_pdbx_serial_crystallography_measurement.source_size                  ? 
_pdbx_serial_crystallography_measurement.source_distance              ? 
_pdbx_serial_crystallography_measurement.focal_spot_size              ? 
_pdbx_serial_crystallography_measurement.collimation                  ? 
_pdbx_serial_crystallography_measurement.collection_time_total        ? 
# 
_pdbx_serial_crystallography_sample_delivery.diffrn_id     1 
_pdbx_serial_crystallography_sample_delivery.description   'MESH (Sierra et al, 2012)' 
_pdbx_serial_crystallography_sample_delivery.method        injection 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 21 21 21' 
_space_group.name_Hall        'P 2ac 2ab' 
_space_group.IT_number        19 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z           
2 x+1/2,-y+1/2,-z 
3 -x,y+1/2,-z+1/2 
4 -x+1/2,-y,z+1/2 
#