data_6U5E
# 
_entry.id   6U5E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6U5E         
WWPDB D_1000243872 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6U5E 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.pdbx_ordinal 
_audit_author.name 
_audit_author.identifier_ORCID 
1  'Wolff, A.M.'    0000-0003-0474-7673 
2  'Nango, E.'      0000-0001-9851-7355 
3  'Nakane, T.'     0000-0003-2697-2767 
4  'Young, I.D.'    0000-0003-4713-9504 
5  'Brewster, A.S.' 0000-0002-0908-7822 
6  'Sugahara, M.'   ?                   
7  'Tanaka, R.'     ?                   
8  'Sauter, N.K.'   ?                   
9  'Tono, K.'       ?                   
10 'Iwata, S.'      ?                   
11 'Fraser, J.S.'   0000-0002-5080-2859 
12 'Thompson, M.C.' 0000-0002-6099-2027 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Iucrj 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2052-2525 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                306 
_citation.page_last                 323 
_citation.title                     
;Comparing serial X-ray crystallography and microcrystal electron diffraction (MicroED) as methods for routine structure determination from small macromolecular crystals
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S205225252000072X 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.ordinal 
_citation_author.name 
_citation_author.identifier_ORCID 
primary 1  'Wolff, A.M.'       0000-0003-0474-7673 
primary 2  'Young, I.D.'       0000-0003-4713-9504 
primary 3  'Sierra, R.G.'      0000-0002-6253-8282 
primary 4  'Brewster, A.S.'    0000-0002-0908-7822 
primary 5  'Martynowycz, M.W.' 0000-0003-0055-230X 
primary 6  'Nango, E.'         0000-0001-9851-7355 
primary 7  'Sugahara, M.'      ?                   
primary 8  'Nakane, T.'        0000-0003-2697-2767 
primary 9  'Ito, K.'           ?                   
primary 10 'Aquila, A.'        ?                   
primary 11 'Bhowmick, A.'      ?                   
primary 12 'Biel, J.T.'        0000-0002-0935-8362 
primary 13 'Carbajo, S.'       0000-0002-5292-4470 
primary 14 'Cohen, A.E.'       0000-0003-2414-9427 
primary 15 'Cortez, S.'        ?                   
primary 16 'Gonzalez, A.'      ?                   
primary 17 'Hino, T.'          0000-0002-8813-4622 
primary 18 'Im, D.'            ?                   
primary 19 'Koralek, J.D.'     0000-0001-8289-0497 
primary 20 'Kubo, M.'          0000-0001-8691-6252 
primary 21 'Lazarou, T.S.'     ?                   
primary 22 'Nomura, T.'        ?                   
primary 23 'Owada, S.'         ?                   
primary 24 'Samelson, A.'      ?                   
primary 25 'Tanaka, T.'        ?                   
primary 26 'Tanaka, R.'        ?                   
primary 27 'Thompson, E.M.'    ?                   
primary 28 'van den Bedem, H.' 0000-0003-2358-841X 
primary 29 'Woldeyes, R.A.'    0000-0003-0737-8383 
primary 30 'Yumoto, F.'        0000-0002-9592-397X 
primary 31 'Zhao, W.'          ?                   
primary 32 'Tono, K.'          ?                   
primary 33 'Boutet, S.'        ?                   
primary 34 'Iwata, S.'         ?                   
primary 35 'Gonen, T.'         0000-0002-9254-4069 
primary 36 'Sauter, N.K.'      ?                   
primary 37 'Fraser, J.S.'      0000-0002-5080-2859 
primary 38 'Thompson, M.C.'    0000-0002-6099-2027 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6U5E 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     43.000 
_cell.length_a_esd                 ? 
_cell.length_b                     52.600 
_cell.length_b_esd                 ? 
_cell.length_c                     89.200 
_cell.length_c_esd                 ? 
_cell.volume                       201752.560 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6U5E 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Peptidyl-prolyl cis-trans isomerase A' 18036.504 1   5.2.1.8 ? ? ? 
2 water   nat water                                   18.015    149 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPIase A,Cyclophilin A,Cyclosporin A-binding protein,Rotamase A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   ASN n 
1 4   PRO n 
1 5   THR n 
1 6   VAL n 
1 7   PHE n 
1 8   PHE n 
1 9   ASP n 
1 10  ILE n 
1 11  ALA n 
1 12  VAL n 
1 13  ASP n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  LEU n 
1 18  GLY n 
1 19  ARG n 
1 20  VAL n 
1 21  SER n 
1 22  PHE n 
1 23  GLU n 
1 24  LEU n 
1 25  PHE n 
1 26  ALA n 
1 27  ASP n 
1 28  LYS n 
1 29  VAL n 
1 30  PRO n 
1 31  LYS n 
1 32  THR n 
1 33  ALA n 
1 34  GLU n 
1 35  ASN n 
1 36  PHE n 
1 37  ARG n 
1 38  ALA n 
1 39  LEU n 
1 40  SER n 
1 41  THR n 
1 42  GLY n 
1 43  GLU n 
1 44  LYS n 
1 45  GLY n 
1 46  PHE n 
1 47  GLY n 
1 48  TYR n 
1 49  LYS n 
1 50  GLY n 
1 51  SER n 
1 52  CYS n 
1 53  PHE n 
1 54  HIS n 
1 55  ARG n 
1 56  ILE n 
1 57  ILE n 
1 58  PRO n 
1 59  GLY n 
1 60  PHE n 
1 61  MET n 
1 62  CYS n 
1 63  GLN n 
1 64  GLY n 
1 65  GLY n 
1 66  ASP n 
1 67  PHE n 
1 68  THR n 
1 69  ARG n 
1 70  HIS n 
1 71  ASN n 
1 72  GLY n 
1 73  THR n 
1 74  GLY n 
1 75  GLY n 
1 76  LYS n 
1 77  SER n 
1 78  ILE n 
1 79  TYR n 
1 80  GLY n 
1 81  GLU n 
1 82  LYS n 
1 83  PHE n 
1 84  GLU n 
1 85  ASP n 
1 86  GLU n 
1 87  ASN n 
1 88  PHE n 
1 89  ILE n 
1 90  LEU n 
1 91  LYS n 
1 92  HIS n 
1 93  THR n 
1 94  GLY n 
1 95  PRO n 
1 96  GLY n 
1 97  ILE n 
1 98  LEU n 
1 99  SER n 
1 100 MET n 
1 101 ALA n 
1 102 ASN n 
1 103 ALA n 
1 104 GLY n 
1 105 PRO n 
1 106 ASN n 
1 107 THR n 
1 108 ASN n 
1 109 GLY n 
1 110 SER n 
1 111 GLN n 
1 112 PHE n 
1 113 PHE n 
1 114 ILE n 
1 115 CYS n 
1 116 THR n 
1 117 ALA n 
1 118 LYS n 
1 119 THR n 
1 120 GLU n 
1 121 TRP n 
1 122 LEU n 
1 123 ASP n 
1 124 GLY n 
1 125 LYS n 
1 126 HIS n 
1 127 VAL n 
1 128 VAL n 
1 129 PHE n 
1 130 GLY n 
1 131 LYS n 
1 132 VAL n 
1 133 LYS n 
1 134 GLU n 
1 135 GLY n 
1 136 MET n 
1 137 ASN n 
1 138 ILE n 
1 139 VAL n 
1 140 GLU n 
1 141 ALA n 
1 142 MET n 
1 143 GLU n 
1 144 ARG n 
1 145 PHE n 
1 146 GLY n 
1 147 SER n 
1 148 ARG n 
1 149 ASN n 
1 150 GLY n 
1 151 LYS n 
1 152 THR n 
1 153 SER n 
1 154 LYS n 
1 155 LYS n 
1 156 ILE n 
1 157 THR n 
1 158 ILE n 
1 159 ALA n 
1 160 ASP n 
1 161 CYS n 
1 162 GLY n 
1 163 GLN n 
1 164 LEU n 
1 165 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   165 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PPIA, CYPA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPIA_HUMAN 
_struct_ref.pdbx_db_accession          P62937 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6U5E 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 165 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P62937 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  165 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       165 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6U5E 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.02 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'BATCH MODE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM HEPES, pH 7.5, 5 mM TCEP, 20% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     291 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   Y 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MPCCD 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-11-29 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.24 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'FREE ELECTRON LASER' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SACLA BEAMLINE BL3' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.24 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL3 
_diffrn_source.pdbx_synchrotron_site       SACLA 
# 
_reflns.B_iso_Wilson_estimate            24.82 
_reflns.entry_id                         6U5E 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.56 
_reflns.d_resolution_low                 20 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       29527 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  261 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.91 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.993 
_reflns.pdbx_R_split                     .0794 
# 
_reflns_shell.d_res_high                  1.56 
_reflns_shell.d_res_low                   1.58 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.46 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1477 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             40.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.586 
_reflns_shell.pdbx_R_split                .66 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               29.62 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6U5E 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.56 
_refine.ls_d_res_low                             19.90 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     29527 
_refine.ls_number_reflns_R_free                  929 
_refine.ls_number_reflns_R_work                  28598 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_percent_reflns_R_free                 3.15 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1353 
_refine.ls_R_factor_R_free                       0.1509 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1348 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4YUM 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 15.8797 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1496 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.56 
_refine_hist.d_res_low                        19.90 
_refine_hist.number_atoms_solvent             149 
_refine_hist.number_atoms_total               1398 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1249 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0151  ? 1446 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.2979  ? 1959 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0814  ? 198  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0093  ? 266  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 16.5416 ? 867  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.56 1.64  . . 132 4027 99.98  . . . 0.2804 . 0.2376 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.64 1.75  . . 128 4021 100.00 . . . 0.1746 . 0.1584 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.75 1.88  . . 131 4036 100.00 . . . 0.1592 . 0.1389 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.88 2.07  . . 133 4057 100.00 . . . 0.1355 . 0.1187 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.07 2.37  . . 133 4053 100.00 . . . 0.1466 . 0.1207 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.37 2.98  . . 133 4111 100.00 . . . 0.1513 . 0.1386 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.98 19.90 . . 139 4293 99.98  . . . 0.1441 . 0.1322 . . . . . . . . . . 
# 
_struct.entry_id                     6U5E 
_struct.title                        'RT XFEL structure of CypA solved using celloluse carrier media' 
_struct.pdbx_descriptor              'Peptidyl-prolyl cis-trans isomerase A (E.C.5.2.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6U5E 
_struct_keywords.text            'Peptidyl-prolyl, cis-trans, isomerase, cyclophilin' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 VAL A 29  ? GLY A 42  ? VAL A 29  GLY A 42  1 ? 14 
HELX_P HELX_P2 AA2 THR A 119 ? ASP A 123 ? THR A 119 ASP A 123 5 ? 5  
HELX_P HELX_P3 AA3 GLY A 135 ? ARG A 144 ? GLY A 135 ARG A 144 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 53  ? ILE A 57  ? PHE A 53  ILE A 57  
AA1 2 MET A 61  ? GLY A 64  ? MET A 61  GLY A 64  
AA1 3 PHE A 112 ? CYS A 115 ? PHE A 112 CYS A 115 
AA1 4 ILE A 97  ? MET A 100 ? ILE A 97  MET A 100 
AA1 5 VAL A 128 ? GLU A 134 ? VAL A 128 GLU A 134 
AA1 6 GLU A 15  ? LEU A 24  ? GLU A 15  LEU A 24  
AA1 7 THR A 5   ? VAL A 12  ? THR A 5   VAL A 12  
AA1 8 ILE A 156 ? GLN A 163 ? ILE A 156 GLN A 163 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 55  ? N ARG A 55  O GLN A 63  ? O GLN A 63  
AA1 2 3 N CYS A 62  ? N CYS A 62  O ILE A 114 ? O ILE A 114 
AA1 3 4 O CYS A 115 ? O CYS A 115 N ILE A 97  ? N ILE A 97  
AA1 4 5 N LEU A 98  ? N LEU A 98  O GLY A 130 ? O GLY A 130 
AA1 5 6 O LYS A 131 ? O LYS A 131 N GLU A 23  ? N GLU A 23  
AA1 6 7 O GLY A 18  ? O GLY A 18  N ILE A 10  ? N ILE A 10  
AA1 7 8 N ASP A 9   ? N ASP A 9   O ASP A 160 ? O ASP A 160 
# 
_atom_sites.entry_id                    6U5E 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.023256 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019011 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011211 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
H ? ? 0.51345 0.48472 24.73122 6.32584  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . VAL A 1 2   ? 18.92693  -3.35395 18.76061 1.000 73.26093  ? 2   VAL A N    1 
ATOM   2    C CA   . VAL A 1 2   ? 19.78674  -2.17771 18.76018 1.000 71.94962  ? 2   VAL A CA   1 
ATOM   3    C C    . VAL A 1 2   ? 18.98945  -0.95710 18.28141 1.000 56.23620  ? 2   VAL A C    1 
ATOM   4    O O    . VAL A 1 2   ? 19.27950  0.16610  18.69700 1.000 53.50387  ? 2   VAL A O    1 
ATOM   5    C CB   . VAL A 1 2   ? 21.05697  -2.37979 17.88157 1.000 77.64263  ? 2   VAL A CB   1 
ATOM   6    C CG1  . VAL A 1 2   ? 22.03861  -1.21900 18.06835 1.000 77.82661  ? 2   VAL A CG1  1 
ATOM   7    C CG2  . VAL A 1 2   ? 21.74705  -3.71774 18.18604 1.000 81.95639  ? 2   VAL A CG2  1 
ATOM   8    H HA   . VAL A 1 2   ? 20.09217  -2.02137 19.66747 1.000 86.34443  ? 2   VAL A HA   1 
ATOM   9    H HB   . VAL A 1 2   ? 20.77567  -2.39796 16.95343 1.000 93.17604  ? 2   VAL A HB   1 
ATOM   10   H HG11 . VAL A 1 2   ? 22.80989  -1.36276 17.49794 1.000 93.39681  ? 2   VAL A HG11 1 
ATOM   11   H HG12 . VAL A 1 2   ? 21.59738  -0.39006 17.82531 1.000 93.39681  ? 2   VAL A HG12 1 
ATOM   12   H HG13 . VAL A 1 2   ? 22.31577  -1.18617 18.99733 1.000 93.39681  ? 2   VAL A HG13 1 
ATOM   13   H HG21 . VAL A 1 2   ? 22.59571  -3.74922 17.71733 1.000 98.35255  ? 2   VAL A HG21 1 
ATOM   14   H HG22 . VAL A 1 2   ? 21.89455  -3.78658 19.14228 1.000 98.35255  ? 2   VAL A HG22 1 
ATOM   15   H HG23 . VAL A 1 2   ? 21.17655  -4.44272 17.88632 1.000 98.35255  ? 2   VAL A HG23 1 
ATOM   16   N N    . ASN A 1 3   ? 17.98305  -1.14663 17.42496 1.000 46.56945  ? 3   ASN A N    1 
ATOM   17   C CA   . ASN A 1 3   ? 17.14138  -0.00863 17.06534 1.000 33.45337  ? 3   ASN A CA   1 
ATOM   18   C C    . ASN A 1 3   ? 16.34652  0.43582  18.28371 1.000 32.62958  ? 3   ASN A C    1 
ATOM   19   O O    . ASN A 1 3   ? 15.85093  -0.40819 19.03279 1.000 36.77464  ? 3   ASN A O    1 
ATOM   20   C CB   . ASN A 1 3   ? 16.13845  -0.34337 15.96834 1.000 32.17945  ? 3   ASN A CB   1 
ATOM   21   C CG   . ASN A 1 3   ? 16.73393  -0.30328 14.57650 1.000 32.98734  ? 3   ASN A CG   1 
ATOM   22   O OD1  . ASN A 1 3   ? 17.72105  0.35348  14.31635 1.000 33.93889  ? 3   ASN A OD1  1 
ATOM   23   N ND2  . ASN A 1 3   ? 16.10593  -1.02585 13.67658 1.000 36.70481  ? 3   ASN A ND2  1 
ATOM   24   H H    . ASN A 1 3   ? 17.77597  -1.89426 17.05381 1.000 55.88822  ? 3   ASN A H    1 
ATOM   25   H HA   . ASN A 1 3   ? 17.72279  0.69751  16.74250 1.000 40.14892  ? 3   ASN A HA   1 
ATOM   26   H HB2  . ASN A 1 3   ? 15.79554  -1.23810 16.11926 1.000 38.59093  ? 3   ASN A HB2  1 
ATOM   27   H HB3  . ASN A 1 3   ? 15.41291  0.29968  15.99984 1.000 38.59093  ? 3   ASN A HB3  1 
ATOM   28   H HD21 . ASN A 1 3   ? 15.40844  -1.47753 13.89817 1.000 44.05065  ? 3   ASN A HD21 1 
ATOM   29   H HD22 . ASN A 1 3   ? 16.39236  -1.04712 12.86597 1.000 44.05065  ? 3   ASN A HD22 1 
ATOM   30   N N    . PRO A 1 4   ? 16.16834  1.73605  18.48153 1.000 30.38472  ? 4   PRO A N    1 
ATOM   31   C CA   . PRO A 1 4   ? 15.44384  2.20162  19.66005 1.000 29.29637  ? 4   PRO A CA   1 
ATOM   32   C C    . PRO A 1 4   ? 13.96169  1.92653  19.55994 1.000 32.33422  ? 4   PRO A C    1 
ATOM   33   O O    . PRO A 1 4   ? 13.38943  1.83757  18.46877 1.000 30.85745  ? 4   PRO A O    1 
ATOM   34   C CB   . PRO A 1 4   ? 15.71440  3.70927  19.68400 1.000 36.63406  ? 4   PRO A CB   1 
ATOM   35   C CG   . PRO A 1 4   ? 16.19040  4.04725  18.38147 1.000 39.66290  ? 4   PRO A CG   1 
ATOM   36   C CD   . PRO A 1 4   ? 16.79529  2.84919  17.75042 1.000 34.88047  ? 4   PRO A CD   1 
ATOM   37   H HA   . PRO A 1 4   ? 15.80333  1.78628  20.45952 1.000 35.13135  ? 4   PRO A HA   1 
ATOM   38   H HB2  . PRO A 1 4   ? 14.89246  4.18443  19.88283 1.000 43.96575  ? 4   PRO A HB2  1 
ATOM   39   H HB3  . PRO A 1 4   ? 16.38418  3.90919  20.35656 1.000 43.96575  ? 4   PRO A HB3  1 
ATOM   40   H HG2  . PRO A 1 4   ? 15.44349  4.36013  17.84749 1.000 47.60037  ? 4   PRO A HG2  1 
ATOM   41   H HG3  . PRO A 1 4   ? 16.85570  4.74826  18.46428 1.000 47.60037  ? 4   PRO A HG3  1 
ATOM   42   H HD2  . PRO A 1 4   ? 16.57837  2.80870  16.80585 1.000 41.86145  ? 4   PRO A HD2  1 
ATOM   43   H HD3  . PRO A 1 4   ? 17.75784  2.84353  17.87031 1.000 41.86145  ? 4   PRO A HD3  1 
ATOM   44   N N    . THR A 1 5   ? 13.33774  1.78698  20.72282 1.000 28.30830  ? 5   THR A N    1 
ATOM   45   C CA   . THR A 1 5   ? 11.89427  1.68413  20.84568 1.000 25.79162  ? 5   THR A CA   1 
ATOM   46   C C    . THR A 1 5   ? 11.38645  2.86726  21.65021 1.000 25.29951  ? 5   THR A C    1 
ATOM   47   O O    . THR A 1 5   ? 11.91623  3.14373  22.72676 1.000 29.88883  ? 5   THR A O    1 
ATOM   48   C CB   . THR A 1 5   ? 11.47382  0.39928  21.56826 1.000 29.40019  ? 5   THR A CB   1 
ATOM   49   O OG1  . THR A 1 5   ? 11.97401  -0.74482 20.86646 1.000 35.46249  ? 5   THR A OG1  1 
ATOM   50   C CG2  . THR A 1 5   ? 9.90225   0.33722  21.65457 1.000 34.32255  ? 5   THR A CG2  1 
ATOM   51   H H    . THR A 1 5   ? 13.74536  1.74825  21.47909 1.000 33.97484  ? 5   THR A H    1 
ATOM   52   H HA   . THR A 1 5   ? 11.50656  1.68904  19.95656 1.000 30.95483  ? 5   THR A HA   1 
ATOM   53   H HB   . THR A 1 5   ? 11.83696  0.38704  22.46764 1.000 35.28511  ? 5   THR A HB   1 
ATOM   54   H HG1  . THR A 1 5   ? 12.27650  -1.30709 21.41232 1.000 42.55987  ? 5   THR A HG1  1 
ATOM   55   H HG21 . THR A 1 5   ? 9.62632   -0.48095 22.09656 1.000 41.19194  ? 5   THR A HG21 1 
ATOM   56   H HG22 . THR A 1 5   ? 9.56746   1.09551  22.15837 1.000 41.19194  ? 5   THR A HG22 1 
ATOM   57   H HG23 . THR A 1 5   ? 9.51997   0.35789  20.76332 1.000 41.19194  ? 5   THR A HG23 1 
ATOM   58   N N    A VAL A 1 6   ? 10.38204  3.57290  21.14785 0.571 22.94219  ? 6   VAL A N    1 
ATOM   59   N N    B VAL A 1 6   ? 10.36593  3.53024  21.12342 0.429 22.96067  ? 6   VAL A N    1 
ATOM   60   C CA   A VAL A 1 6   ? 9.77408   4.63458  21.91791 0.571 22.44225  ? 6   VAL A CA   1 
ATOM   61   C CA   B VAL A 1 6   ? 9.71086   4.65974  21.73912 0.429 22.87450  ? 6   VAL A CA   1 
ATOM   62   C C    A VAL A 1 6   ? 8.28303   4.35762  22.05491 0.571 24.84580  ? 6   VAL A C    1 
ATOM   63   C C    B VAL A 1 6   ? 8.29971   4.22853  22.13068 0.429 23.31072  ? 6   VAL A C    1 
ATOM   64   O O    A VAL A 1 6   ? 7.65612   3.68974  21.21990 0.571 22.70266  ? 6   VAL A O    1 
ATOM   65   O O    B VAL A 1 6   ? 7.74602   3.27947  21.56892 0.429 22.82283  ? 6   VAL A O    1 
ATOM   66   C CB   A VAL A 1 6   ? 10.01190  6.02558  21.28904 0.571 29.52943  ? 6   VAL A CB   1 
ATOM   67   C CB   B VAL A 1 6   ? 9.70223   5.84551  20.74291 0.429 23.77153  ? 6   VAL A CB   1 
ATOM   68   C CG1  A VAL A 1 6   ? 11.48864  6.34849  21.31524 0.571 25.50383  ? 6   VAL A CG1  1 
ATOM   69   C CG1  B VAL A 1 6   ? 8.57276   6.81645  21.00950 0.429 25.26518  ? 6   VAL A CG1  1 
ATOM   70   C CG2  A VAL A 1 6   ? 9.45884   6.08111  19.87131 0.571 25.79210  ? 6   VAL A CG2  1 
ATOM   71   C CG2  B VAL A 1 6   ? 11.04182  6.52739  20.74591 0.429 25.22546  ? 6   VAL A CG2  1 
ATOM   72   H H    A VAL A 1 6   ? 10.04114  3.45217  20.36758 0.571 27.50623  ? 6   VAL A H    1 
ATOM   73   H H    B VAL A 1 6   ? 10.01808  3.32783  20.36339 0.429 27.55769  ? 6   VAL A H    1 
ATOM   74   H HA   A VAL A 1 6   ? 10.16136  4.63458  22.80724 0.571 26.93558  ? 6   VAL A HA   1 
ATOM   75   H HA   B VAL A 1 6   ? 10.15630  4.93763  22.55475 0.429 27.45428  ? 6   VAL A HA   1 
ATOM   76   H HB   A VAL A 1 6   ? 9.54171   6.69861  21.80562 0.571 35.44020  ? 6   VAL A HB   1 
ATOM   77   H HB   B VAL A 1 6   ? 9.54019   5.49579  19.85277 0.429 28.53072  ? 6   VAL A HB   1 
ATOM   78   H HG11 A VAL A 1 6   ? 11.61905  7.25630  20.99939 0.571 30.60948  ? 6   VAL A HG11 1 
ATOM   79   H HG11 B VAL A 1 6   ? 8.67457   7.58654  20.42856 0.429 30.32310  ? 6   VAL A HG11 1 
ATOM   80   H HG12 A VAL A 1 6   ? 11.81409  6.26489  22.22519 0.571 30.60948  ? 6   VAL A HG12 1 
ATOM   81   H HG12 B VAL A 1 6   ? 7.72791   6.37536  20.82903 0.429 30.32310  ? 6   VAL A HG12 1 
ATOM   82   H HG13 A VAL A 1 6   ? 11.95818  5.72661  20.73757 0.571 30.60948  ? 6   VAL A HG13 1 
ATOM   83   H HG13 B VAL A 1 6   ? 8.60860   7.09539  21.93784 0.429 30.32310  ? 6   VAL A HG13 1 
ATOM   84   H HG21 A VAL A 1 6   ? 9.87521   6.81871  19.39857 0.571 30.95540  ? 6   VAL A HG21 1 
ATOM   85   H HG21 B VAL A 1 6   ? 11.00793  7.29275  20.15095 0.429 30.27543  ? 6   VAL A HG21 1 
ATOM   86   H HG22 A VAL A 1 6   ? 9.65839   5.24518  19.42152 0.571 30.95540  ? 6   VAL A HG22 1 
ATOM   87   H HG22 B VAL A 1 6   ? 11.24586  6.81873  21.64834 0.429 30.27543  ? 6   VAL A HG22 1 
ATOM   88   H HG23 A VAL A 1 6   ? 8.49884   6.21398  19.91181 0.571 30.95540  ? 6   VAL A HG23 1 
ATOM   89   H HG23 B VAL A 1 6   ? 11.71598  5.90047  20.44033 0.429 30.27543  ? 6   VAL A HG23 1 
ATOM   90   N N    . PHE A 1 7   ? 7.70764   4.93168  23.10911 1.000 23.90991  ? 7   PHE A N    1 
ATOM   91   C CA   . PHE A 1 7   ? 6.28398   4.74008  23.40175 1.000 24.40737  ? 7   PHE A CA   1 
ATOM   92   C C    . PHE A 1 7   ? 5.54263   6.06366  23.47725 1.000 22.44993  ? 7   PHE A C    1 
ATOM   93   O O    . PHE A 1 7   ? 6.12404   7.10680  23.78613 1.000 22.97691  ? 7   PHE A O    1 
ATOM   94   C CB   . PHE A 1 7   ? 6.04492   3.99489  24.70721 1.000 26.53118  ? 7   PHE A CB   1 
ATOM   95   C CG   . PHE A 1 7   ? 6.31451   4.80220  25.91720 1.000 25.51192  ? 7   PHE A CG   1 
ATOM   96   C CD1  . PHE A 1 7   ? 7.58005   4.85282  26.49069 1.000 26.92161  ? 7   PHE A CD1  1 
ATOM   97   C CD2  . PHE A 1 7   ? 5.25995   5.53462  26.52550 1.000 25.37651  ? 7   PHE A CD2  1 
ATOM   98   C CE1  . PHE A 1 7   ? 7.81474   5.65552  27.63912 1.000 30.47508  ? 7   PHE A CE1  1 
ATOM   99   C CE2  . PHE A 1 7   ? 5.47211   6.30340  27.64192 1.000 27.08462  ? 7   PHE A CE2  1 
ATOM   100  C CZ   . PHE A 1 7   ? 6.72851   6.39206  28.20528 1.000 28.80967  ? 7   PHE A CZ   1 
ATOM   101  H H    . PHE A 1 7   ? 8.11767   5.43695  23.67142 1.000 28.69678  ? 7   PHE A H    1 
ATOM   102  H HA   . PHE A 1 7   ? 5.91934   4.22180  22.66736 1.000 29.29373  ? 7   PHE A HA   1 
ATOM   103  H HB2  . PHE A 1 7   ? 5.11691   3.71449  24.74003 1.000 31.84230  ? 7   PHE A HB2  1 
ATOM   104  H HB3  . PHE A 1 7   ? 6.62696   3.21938  24.73393 1.000 31.84230  ? 7   PHE A HB3  1 
ATOM   105  H HD1  . PHE A 1 7   ? 8.27599   4.35904  26.12089 1.000 32.31082  ? 7   PHE A HD1  1 
ATOM   106  H HD2  . PHE A 1 7   ? 4.40645   5.49197  26.15859 1.000 30.45669  ? 7   PHE A HD2  1 
ATOM   107  H HE1  . PHE A 1 7   ? 8.66320   5.70110  28.01719 1.000 36.57497  ? 7   PHE A HE1  1 
ATOM   108  H HE2  . PHE A 1 7   ? 4.76263   6.76898  28.02240 1.000 32.50643  ? 7   PHE A HE2  1 
ATOM   109  H HZ   . PHE A 1 7   ? 6.86819   6.92954  28.95128 1.000 34.57649  ? 7   PHE A HZ   1 
ATOM   110  N N    . PHE A 1 8   ? 4.26912   6.00433  23.07904 1.000 21.66049  ? 8   PHE A N    1 
ATOM   111  C CA   . PHE A 1 8   ? 3.28918   7.04615  23.32751 1.000 19.59202  ? 8   PHE A CA   1 
ATOM   112  C C    . PHE A 1 8   ? 2.18497   6.45673  24.19485 1.000 20.10864  ? 8   PHE A C    1 
ATOM   113  O O    . PHE A 1 8   ? 1.62277   5.40037  23.86219 1.000 23.02137  ? 8   PHE A O    1 
ATOM   114  C CB   . PHE A 1 8   ? 2.59135   7.51601  22.04475 1.000 20.63689  ? 8   PHE A CB   1 
ATOM   115  C CG   . PHE A 1 8   ? 3.42109   8.29414  21.06469 1.000 21.19588  ? 8   PHE A CG   1 
ATOM   116  C CD1  . PHE A 1 8   ? 4.70183   8.72955  21.29287 1.000 21.77755  ? 8   PHE A CD1  1 
ATOM   117  C CD2  . PHE A 1 8   ? 2.83630   8.56984  19.84507 1.000 22.48699  ? 8   PHE A CD2  1 
ATOM   118  C CE1  . PHE A 1 8   ? 5.39015   9.46694  20.32620 1.000 21.97437  ? 8   PHE A CE1  1 
ATOM   119  C CE2  . PHE A 1 8   ? 3.51425   9.32220  18.89965 1.000 21.31707  ? 8   PHE A CE2  1 
ATOM   120  C CZ   . PHE A 1 8   ? 4.76852   9.77528  19.15723 1.000 20.62223  ? 8   PHE A CZ   1 
ATOM   121  H H    . PHE A 1 8   ? 3.94189   5.33817  22.64459 1.000 25.99747  ? 8   PHE A H    1 
ATOM   122  H HA   . PHE A 1 8   ? 3.74701   7.78930  23.75062 1.000 23.51530  ? 8   PHE A HA   1 
ATOM   123  H HB2  . PHE A 1 8   ? 2.26407   6.73158  21.57737 1.000 24.76915  ? 8   PHE A HB2  1 
ATOM   124  H HB3  . PHE A 1 8   ? 1.84794   8.08470  22.29938 1.000 24.76915  ? 8   PHE A HB3  1 
ATOM   125  H HD1  . PHE A 1 8   ? 5.11707   8.53142  22.10109 1.000 26.13794  ? 8   PHE A HD1  1 
ATOM   126  H HD2  . PHE A 1 8   ? 1.98374   8.24926  19.65725 1.000 26.98927  ? 8   PHE A HD2  1 
ATOM   127  H HE1  . PHE A 1 8   ? 6.26438   9.74392  20.48082 1.000 26.37412  ? 8   PHE A HE1  1 
ATOM   128  H HE2  . PHE A 1 8   ? 3.10905   9.51771  18.08571 1.000 25.58536  ? 8   PHE A HE2  1 
ATOM   129  H HZ   . PHE A 1 8   ? 5.20633   10.30157 18.52775 1.000 24.75156  ? 8   PHE A HZ   1 
ATOM   130  N N    . ASP A 1 9   ? 1.82195   7.16786  25.25379 1.000 20.75737  ? 9   ASP A N    1 
ATOM   131  C CA   . ASP A 1 9   ? 0.61649   6.86628  26.03730 1.000 20.96765  ? 9   ASP A CA   1 
ATOM   132  C C    . ASP A 1 9   ? -0.45887  7.82884  25.50129 1.000 22.61077  ? 9   ASP A C    1 
ATOM   133  O O    . ASP A 1 9   ? -0.29951  9.05215  25.58541 1.000 24.46012  ? 9   ASP A O    1 
ATOM   134  C CB   . ASP A 1 9   ? 0.83522   7.04750  27.51097 1.000 21.92773  ? 9   ASP A CB   1 
ATOM   135  C CG   . ASP A 1 9   ? 1.57771   5.91299  28.15566 1.000 27.24153  ? 9   ASP A CG   1 
ATOM   136  O OD1  . ASP A 1 9   ? 1.65434   4.83545  27.54759 1.000 30.71462  ? 9   ASP A OD1  1 
ATOM   137  O OD2  . ASP A 1 9   ? 2.01032   6.10510  29.29963 1.000 31.72558  ? 9   ASP A OD2  1 
ATOM   138  H H    . ASP A 1 9   ? 2.26245   7.84487  25.54913 1.000 24.91373  ? 9   ASP A H    1 
ATOM   139  H HA   . ASP A 1 9   ? 0.34280   5.94210  25.92827 1.000 25.16606  ? 9   ASP A HA   1 
ATOM   140  H HB2  . ASP A 1 9   ? 1.35056   7.85691  27.65304 1.000 26.31816  ? 9   ASP A HB2  1 
ATOM   141  H HB3  . ASP A 1 9   ? -0.02755  7.12254  27.94789 1.000 26.31816  ? 9   ASP A HB3  1 
ATOM   142  N N    . ILE A 1 10  ? -1.52592  7.29178  24.96986 1.000 20.88931  ? 10  ILE A N    1 
ATOM   143  C CA   . ILE A 1 10  ? -2.57712  8.07923  24.28853 1.000 21.83638  ? 10  ILE A CA   1 
ATOM   144  C C    . ILE A 1 10  ? -3.73260  8.31870  25.24520 1.000 21.64581  ? 10  ILE A C    1 
ATOM   145  O O    . ILE A 1 10  ? -4.13861  7.41458  26.00134 1.000 23.63355  ? 10  ILE A O    1 
ATOM   146  C CB   . ILE A 1 10  ? -3.07281  7.34753  23.02235 1.000 22.87678  ? 10  ILE A CB   1 
ATOM   147  C CG1  . ILE A 1 10  ? -1.93772  7.01575  22.10209 1.000 23.41012  ? 10  ILE A CG1  1 
ATOM   148  C CG2  . ILE A 1 10  ? -4.19280  8.12178  22.30642 1.000 21.67924  ? 10  ILE A CG2  1 
ATOM   149  C CD1  . ILE A 1 10  ? -1.19733  8.16370  21.54469 1.000 27.17992  ? 10  ILE A CD1  1 
ATOM   150  H H    . ILE A 1 10  ? -1.68861  6.44737  24.98024 1.000 25.07205  ? 10  ILE A H    1 
ATOM   151  H HA   . ILE A 1 10  ? -2.20724  8.93987  24.03677 1.000 26.20854  ? 10  ILE A HA   1 
ATOM   152  H HB   . ILE A 1 10  ? -3.46072  6.50761  23.31383 1.000 27.45702  ? 10  ILE A HB   1 
ATOM   153  H HG12 . ILE A 1 10  ? -1.29920  6.47420  22.59190 1.000 28.09703  ? 10  ILE A HG12 1 
ATOM   154  H HG13 . ILE A 1 10  ? -2.29282  6.51314  21.35230 1.000 28.09703  ? 10  ILE A HG13 1 
ATOM   155  H HG21 . ILE A 1 10  ? -4.27229  7.79346  21.39715 1.000 26.01997  ? 10  ILE A HG21 1 
ATOM   156  H HG22 . ILE A 1 10  ? -5.02661  7.98308  22.78226 1.000 26.01997  ? 10  ILE A HG22 1 
ATOM   157  H HG23 . ILE A 1 10  ? -3.96927  9.06564  22.29894 1.000 26.01997  ? 10  ILE A HG23 1 
ATOM   158  H HD11 . ILE A 1 10  ? -0.59837  7.84635  20.85083 1.000 32.62079  ? 10  ILE A HD11 1 
ATOM   159  H HD12 . ILE A 1 10  ? -1.83047  8.79653  21.17111 1.000 32.62079  ? 10  ILE A HD12 1 
ATOM   160  H HD13 . ILE A 1 10  ? -0.68771  8.58538  22.25417 1.000 32.62079  ? 10  ILE A HD13 1 
ATOM   161  N N    . ALA A 1 11  ? -4.30844  9.51789  25.19712 1.000 22.60116  ? 11  ALA A N    1 
ATOM   162  C CA   . ALA A 1 11  ? -5.51050  9.83571  25.94187 1.000 23.84840  ? 11  ALA A CA   1 
ATOM   163  C C    . ALA A 1 11  ? -6.55520  10.41338 25.00401 1.000 24.07840  ? 11  ALA A C    1 
ATOM   164  O O    . ALA A 1 11  ? -6.22982  11.01173 23.98417 1.000 24.61062  ? 11  ALA A O    1 
ATOM   165  C CB   . ALA A 1 11  ? -5.22898  10.83739 27.02225 1.000 25.38646  ? 11  ALA A CB   1 
ATOM   166  H H    . ALA A 1 11  ? -4.01041  10.17429 24.72817 1.000 27.12627  ? 11  ALA A H    1 
ATOM   167  H HA   . ALA A 1 11  ? -5.86293  9.02538  26.34193 1.000 28.62296  ? 11  ALA A HA   1 
ATOM   168  H HB1  . ALA A 1 11  ? -6.06350  11.08034 27.45289 1.000 30.46864  ? 11  ALA A HB1  1 
ATOM   169  H HB2  . ALA A 1 11  ? -4.62531  10.44170 27.67026 1.000 30.46864  ? 11  ALA A HB2  1 
ATOM   170  H HB3  . ALA A 1 11  ? -4.82032  11.62281 26.62600 1.000 30.46864  ? 11  ALA A HB3  1 
ATOM   171  N N    . VAL A 1 12  ? -7.81772  10.23876 25.36208 1.000 24.88078  ? 12  VAL A N    1 
ATOM   172  C CA   . VAL A 1 12  ? -8.97558  10.67345 24.57782 1.000 26.04898  ? 12  VAL A CA   1 
ATOM   173  C C    . VAL A 1 12  ? -9.80633  11.55320 25.51000 1.000 27.87427  ? 12  VAL A C    1 
ATOM   174  O O    . VAL A 1 12  ? -10.37827 11.06369 26.50165 1.000 28.68848  ? 12  VAL A O    1 
ATOM   175  C CB   . VAL A 1 12  ? -9.80131  9.49564  24.05751 1.000 26.66234  ? 12  VAL A CB   1 
ATOM   176  C CG1  . VAL A 1 12  ? -11.05030 9.98139  23.29097 1.000 33.53502  ? 12  VAL A CG1  1 
ATOM   177  C CG2  . VAL A 1 12  ? -8.93792  8.56644  23.21191 1.000 27.86401  ? 12  VAL A CG2  1 
ATOM   178  H H    . VAL A 1 12  ? -8.04684  9.85032  26.09435 1.000 29.83253  ? 12  VAL A H    1 
ATOM   179  H HA   . VAL A 1 12  ? -8.68374  11.19277 23.81230 1.000 31.23437  ? 12  VAL A HA   1 
ATOM   180  H HB   . VAL A 1 12  ? -10.12290 8.98221  24.81505 1.000 31.99969  ? 12  VAL A HB   1 
ATOM   181  H HG11 . VAL A 1 12  ? -11.43921 9.23186  22.81363 1.000 40.24691  ? 12  VAL A HG11 1 
ATOM   182  H HG12 . VAL A 1 12  ? -11.69143 10.33800 23.92554 1.000 40.24691  ? 12  VAL A HG12 1 
ATOM   183  H HG13 . VAL A 1 12  ? -10.78672 10.67240 22.66333 1.000 40.24691  ? 12  VAL A HG13 1 
ATOM   184  H HG21 . VAL A 1 12  ? -9.50911  7.91626  22.77384 1.000 33.44169  ? 12  VAL A HG21 1 
ATOM   185  H HG22 . VAL A 1 12  ? -8.46512  9.09206  22.54776 1.000 33.44169  ? 12  VAL A HG22 1 
ATOM   186  H HG23 . VAL A 1 12  ? -8.30295  8.11353  23.78861 1.000 33.44169  ? 12  VAL A HG23 1 
ATOM   187  N N    . ASP A 1 13  ? -9.84949  12.85252 25.22085 1.000 28.78571  ? 13  ASP A N    1 
ATOM   188  C CA   . ASP A 1 13  ? -10.48430 13.82981 26.11975 1.000 30.82302  ? 13  ASP A CA   1 
ATOM   189  C C    . ASP A 1 13  ? -9.99399  13.63100 27.56214 1.000 30.72395  ? 13  ASP A C    1 
ATOM   190  O O    . ASP A 1 13  ? -10.75137 13.75734 28.53149 1.000 32.87622  ? 13  ASP A O    1 
ATOM   191  C CB   . ASP A 1 13  ? -12.00694 13.75074 26.03588 1.000 33.86993  ? 13  ASP A CB   1 
ATOM   192  C CG   . ASP A 1 13  ? -12.56933 14.51630 24.85939 1.000 41.25949  ? 13  ASP A CG   1 
ATOM   193  O OD1  . ASP A 1 13  ? -11.80522 15.23584 24.18063 1.000 35.82351  ? 13  ASP A OD1  1 
ATOM   194  O OD2  . ASP A 1 13  ? -13.78995 14.42108 24.63550 1.000 44.31817  ? 13  ASP A OD2  1 
ATOM   195  H H    . ASP A 1 13  ? -9.51777  13.19977 24.50742 1.000 34.51844  ? 13  ASP A H    1 
ATOM   196  H HA   . ASP A 1 13  ? -10.22668 14.72222 25.84022 1.000 36.96322  ? 13  ASP A HA   1 
ATOM   197  H HB2  . ASP A 1 13  ? -12.27044 12.82188 25.94274 1.000 40.64880  ? 13  ASP A HB2  1 
ATOM   198  H HB3  . ASP A 1 13  ? -12.38782 14.12399 26.84614 1.000 40.64880  ? 13  ASP A HB3  1 
ATOM   199  N N    . GLY A 1 14  ? -8.69723  13.37575 27.67765 1.000 31.06782  ? 14  GLY A N    1 
ATOM   200  C CA   . GLY A 1 14  ? -7.99528  13.22090 28.92157 1.000 36.52831  ? 14  GLY A CA   1 
ATOM   201  C C    . GLY A 1 14  ? -8.12293  11.86385 29.58252 1.000 40.17717  ? 14  GLY A C    1 
ATOM   202  O O    . GLY A 1 14  ? -7.49489  11.64739 30.63343 1.000 44.55914  ? 14  GLY A O    1 
ATOM   203  H H    . GLY A 1 14  ? -8.17623  13.28343 26.99969 1.000 37.28626  ? 14  GLY A H    1 
ATOM   204  H HA2  . GLY A 1 14  ? -7.05177  13.38181 28.76409 1.000 43.83885  ? 14  GLY A HA2  1 
ATOM   205  H HA3  . GLY A 1 14  ? -8.32852  13.88323 29.54700 1.000 43.83885  ? 14  GLY A HA3  1 
ATOM   206  N N    A GLU A 1 15  ? -8.95720  10.96084 29.04037 0.435 33.19879  ? 15  GLU A N    1 
ATOM   207  N N    B GLU A 1 15  ? -8.93297  10.95572 29.05121 0.565 32.77469  ? 15  GLU A N    1 
ATOM   208  C CA   A GLU A 1 15  ? -9.05910  9.60531  29.57557 0.435 33.80139  ? 15  GLU A CA   1 
ATOM   209  C CA   B GLU A 1 15  ? -9.09443  9.62564  29.66141 0.565 30.99333  ? 15  GLU A CA   1 
ATOM   210  C C    A GLU A 1 15  ? -7.95379  8.74389  28.97610 0.435 30.26798  ? 15  GLU A C    1 
ATOM   211  C C    B GLU A 1 15  ? -8.12449  8.64736  29.00362 0.565 28.45609  ? 15  GLU A C    1 
ATOM   212  O O    A GLU A 1 15  ? -7.65039  8.83873  27.77414 0.435 26.01886  ? 15  GLU A O    1 
ATOM   213  O O    B GLU A 1 15  ? -8.07447  8.58127  27.77015 0.565 27.47791  ? 15  GLU A O    1 
ATOM   214  C CB   A GLU A 1 15  ? -10.41484 8.98211  29.25139 0.435 36.12952  ? 15  GLU A CB   1 
ATOM   215  C CB   B GLU A 1 15  ? -10.51363 9.12876  29.48134 0.565 38.55294  ? 15  GLU A CB   1 
ATOM   216  C CG   A GLU A 1 15  ? -10.61476 7.55333  29.83382 0.435 39.79739  ? 15  GLU A CG   1 
ATOM   217  C CG   B GLU A 1 15  ? -11.58511 10.00292 30.12981 0.565 39.33019  ? 15  GLU A CG   1 
ATOM   218  C CD   A GLU A 1 15  ? -12.04459 7.06935  29.74312 0.435 45.91914  ? 15  GLU A CD   1 
ATOM   219  C CD   B GLU A 1 15  ? -11.62664 9.90426  31.64173 0.565 52.74412  ? 15  GLU A CD   1 
ATOM   220  O OE1  A GLU A 1 15  ? -12.44083 6.22345  30.58086 0.435 48.32878  ? 15  GLU A OE1  1 
ATOM   221  O OE1  B GLU A 1 15  ? -10.66823 9.40776  32.27867 0.565 52.10272  ? 15  GLU A OE1  1 
ATOM   222  O OE2  A GLU A 1 15  ? -12.77625 7.55537  28.85135 0.435 51.52610  ? 15  GLU A OE2  1 
ATOM   223  O OE2  B GLU A 1 15  ? -12.64462 10.33536 32.19420 0.565 53.40708  ? 15  GLU A OE2  1 
ATOM   224  H H    A GLU A 1 15  ? -9.46946  11.11252 28.36644 0.435 39.84343  ? 15  GLU A H    1 
ATOM   225  H H    B GLU A 1 15  ? -9.40177  11.07711 28.34051 0.565 39.33451  ? 15  GLU A H    1 
ATOM   226  H HA   A GLU A 1 15  ? -8.96688  9.63020  30.54086 0.435 40.56655  ? 15  GLU A HA   1 
ATOM   227  H HA   B GLU A 1 15  ? -8.90354  9.66755  30.61152 0.565 37.19688  ? 15  GLU A HA   1 
ATOM   228  H HB2  A GLU A 1 15  ? -11.11211 9.54906  29.61647 0.435 43.36030  ? 15  GLU A HB2  1 
ATOM   229  H HB2  B GLU A 1 15  ? -10.70684 9.08662  28.53172 0.565 46.26841  ? 15  GLU A HB2  1 
ATOM   230  H HB3  A GLU A 1 15  ? -10.50636 8.92258  28.28755 0.435 43.36030  ? 15  GLU A HB3  1 
ATOM   231  H HB3  B GLU A 1 15  ? -10.58213 8.24418  29.87342 0.565 46.26841  ? 15  GLU A HB3  1 
ATOM   232  H HG2  A GLU A 1 15  ? -10.05746 6.93152  29.34019 0.435 47.76175  ? 15  GLU A HG2  1 
ATOM   233  H HG2  B GLU A 1 15  ? -11.41305 10.92928 29.89927 0.565 47.20112  ? 15  GLU A HG2  1 
ATOM   234  H HG3  A GLU A 1 15  ? -10.35970 7.55652  30.76968 0.435 47.76175  ? 15  GLU A HG3  1 
ATOM   235  H HG3  B GLU A 1 15  ? -12.45362 9.73293  29.79262 0.565 47.20112  ? 15  GLU A HG3  1 
ATOM   236  N N    . PRO A 1 16  ? -7.31653  7.88586  29.75622 1.000 28.42597  ? 16  PRO A N    1 
ATOM   237  C CA   . PRO A 1 16  ? -6.30832  7.02081  29.14093 1.000 29.54736  ? 16  PRO A CA   1 
ATOM   238  C C    . PRO A 1 16  ? -6.96241  6.00008  28.23463 1.000 27.29115  ? 16  PRO A C    1 
ATOM   239  O O    . PRO A 1 16  ? -7.98158  5.41492  28.59816 1.000 33.02746  ? 16  PRO A O    1 
ATOM   240  C CB   . PRO A 1 16  ? -5.63402  6.33626  30.34287 1.000 36.06608  ? 16  PRO A CB   1 
ATOM   241  C CG   . PRO A 1 16  ? -5.93860  7.21163  31.46934 1.000 42.23495  ? 16  PRO A CG   1 
ATOM   242  C CD   . PRO A 1 16  ? -7.31444  7.75476  31.23014 1.000 34.52992  ? 16  PRO A CD   1 
ATOM   243  H HA   . PRO A 1 16  ? -5.65543  7.54470  28.65086 1.000 35.46171  ? 16  PRO A HA   1 
ATOM   244  H HB2  . PRO A 1 16  ? -6.00834  5.45134  30.47587 1.000 43.28418  ? 16  PRO A HB2  1 
ATOM   245  H HB3  . PRO A 1 16  ? -4.67710  6.27323  30.19712 1.000 43.28418  ? 16  PRO A HB3  1 
ATOM   246  H HG2  . PRO A 1 16  ? -5.91258  6.70039  32.29327 1.000 50.68682  ? 16  PRO A HG2  1 
ATOM   247  H HG3  . PRO A 1 16  ? -5.28952  7.93158  31.50499 1.000 50.68682  ? 16  PRO A HG3  1 
ATOM   248  H HD2  . PRO A 1 16  ? -7.99669  7.13427  31.53086 1.000 41.44078  ? 16  PRO A HD2  1 
ATOM   249  H HD3  . PRO A 1 16  ? -7.43491  8.61504  31.66177 1.000 41.44078  ? 16  PRO A HD3  1 
ATOM   250  N N    . LEU A 1 17  ? -6.36513  5.80746  27.06799 1.000 26.54584  ? 17  LEU A N    1 
ATOM   251  C CA   . LEU A 1 17  ? -6.76980  4.81917  26.06250 1.000 25.10695  ? 17  LEU A CA   1 
ATOM   252  C C    . LEU A 1 17  ? -5.81309  3.63902  26.06926 1.000 26.09056  ? 17  LEU A C    1 
ATOM   253  O O    . LEU A 1 17  ? -6.23007  2.51361  26.34092 1.000 29.31070  ? 17  LEU A O    1 
ATOM   254  C CB   . LEU A 1 17  ? -6.81138  5.43682  24.66333 1.000 27.90586  ? 17  LEU A CB   1 
ATOM   255  C CG   . LEU A 1 17  ? -7.23164  4.48623  23.52061 1.000 27.73143  ? 17  LEU A CG   1 
ATOM   256  C CD1  . LEU A 1 17  ? -8.60804  4.00119  23.66349 1.000 34.84086  ? 17  LEU A CD1  1 
ATOM   257  C CD2  . LEU A 1 17  ? -7.04362  5.25635  22.21664 1.000 33.11278  ? 17  LEU A CD2  1 
ATOM   258  H H    . LEU A 1 17  ? -5.68042  6.26179  26.81432 1.000 31.85988  ? 17  LEU A H    1 
ATOM   259  H HA   . LEU A 1 17  ? -7.67053  4.51642  26.25726 1.000 30.13322  ? 17  LEU A HA   1 
ATOM   260  H HB2  . LEU A 1 17  ? -7.44510  6.17110  24.67486 1.000 33.49192  ? 17  LEU A HB2  1 
ATOM   261  H HB3  . LEU A 1 17  ? -5.92441  5.76738  24.45143 1.000 33.49192  ? 17  LEU A HB3  1 
ATOM   262  H HG   . LEU A 1 17  ? -6.68647  3.68399  23.53043 1.000 33.28260  ? 17  LEU A HG   1 
ATOM   263  H HD11 . LEU A 1 17  ? -8.85875  3.52090  22.85890 1.000 41.81391  ? 17  LEU A HD11 1 
ATOM   264  H HD12 . LEU A 1 17  ? -8.65632  3.40943  24.43055 1.000 41.81391  ? 17  LEU A HD12 1 
ATOM   265  H HD13 . LEU A 1 17  ? -9.19835  4.75986  23.79334 1.000 41.81391  ? 17  LEU A HD13 1 
ATOM   266  H HD21 . LEU A 1 17  ? -7.41581  4.73711  21.48673 1.000 39.74022  ? 17  LEU A HD21 1 
ATOM   267  H HD22 . LEU A 1 17  ? -7.50240  6.10833  22.28408 1.000 39.74022  ? 17  LEU A HD22 1 
ATOM   268  H HD23 . LEU A 1 17  ? -6.09592  5.40172  22.06957 1.000 39.74022  ? 17  LEU A HD23 1 
ATOM   269  N N    . GLY A 1 18  ? -4.52886  3.88070  25.91553 1.000 24.36041  ? 18  GLY A N    1 
ATOM   270  C CA   . GLY A 1 18  ? -3.55727  2.80164  25.92789 1.000 22.41759  ? 18  GLY A CA   1 
ATOM   271  C C    . GLY A 1 18  ? -2.22822  3.29684  25.40257 1.000 22.51532  ? 18  GLY A C    1 
ATOM   272  O O    . GLY A 1 18  ? -2.03333  4.49018  25.12842 1.000 25.30447  ? 18  GLY A O    1 
ATOM   273  H H    . GLY A 1 18  ? -4.18867  4.66230  25.80165 1.000 29.23737  ? 18  GLY A H    1 
ATOM   274  H HA2  . GLY A 1 18  ? -3.43668  2.47534  26.83336 1.000 26.90599  ? 18  GLY A HA2  1 
ATOM   275  H HA3  . GLY A 1 18  ? -3.86575  2.07222  25.36781 1.000 26.90599  ? 18  GLY A HA3  1 
ATOM   276  N N    . ARG A 1 19  ? -1.31374  2.34933  25.26047 1.000 22.45468  ? 19  ARG A N    1 
ATOM   277  C CA   . ARG A 1 19  ? 0.05789   2.61290  24.83439 1.000 18.64604  ? 19  ARG A CA   1 
ATOM   278  C C    . ARG A 1 19  ? 0.36179   2.01548  23.47961 1.000 21.09168  ? 19  ARG A C    1 
ATOM   279  O O    . ARG A 1 19  ? -0.01762  0.86893  23.19464 1.000 22.92716  ? 19  ARG A O    1 
ATOM   280  C CB   . ARG A 1 19  ? 1.01066   2.03787  25.90779 1.000 22.21739  ? 19  ARG A CB   1 
ATOM   281  C CG   . ARG A 1 19  ? 2.49287   2.13676  25.54012 1.000 23.92978  ? 19  ARG A CG   1 
ATOM   282  C CD   . ARG A 1 19  ? 3.37318   1.71090  26.69667 1.000 23.71627  ? 19  ARG A CD   1 
ATOM   283  N NE   . ARG A 1 19  ? 3.40791   2.72630  27.72029 1.000 25.68455  ? 19  ARG A NE   1 
ATOM   284  C CZ   . ARG A 1 19  ? 4.21314   2.68531  28.77264 1.000 28.56580  ? 19  ARG A CZ   1 
ATOM   285  N NH1  . ARG A 1 19  ? 5.05246   1.65978  28.93605 1.000 31.25730  ? 19  ARG A NH1  1 
ATOM   286  N NH2  . ARG A 1 19  ? 4.21479   3.69636  29.65025 1.000 31.29125  ? 19  ARG A NH2  1 
ATOM   287  H H    . ARG A 1 19  ? -1.46642  1.51622  25.40949 1.000 26.95050  ? 19  ARG A H    1 
ATOM   288  H HA   . ARG A 1 19  ? 0.19740   3.56681  24.72719 1.000 22.38013  ? 19  ARG A HA   1 
ATOM   289  H HB2  . ARG A 1 19  ? 0.87838   2.52670  26.73510 1.000 26.66575  ? 19  ARG A HB2  1 
ATOM   290  H HB3  . ARG A 1 19  ? 0.80101   1.09999  26.03946 1.000 26.66575  ? 19  ARG A HB3  1 
ATOM   291  H HG2  . ARG A 1 19  ? 2.67729   1.55641  24.78508 1.000 28.72062  ? 19  ARG A HG2  1 
ATOM   292  H HG3  . ARG A 1 19  ? 2.70831   3.05491  25.31324 1.000 28.72062  ? 19  ARG A HG3  1 
ATOM   293  H HD2  . ARG A 1 19  ? 3.02290   0.89428  27.08569 1.000 28.46440  ? 19  ARG A HD2  1 
ATOM   294  H HD3  . ARG A 1 19  ? 4.27756   1.56510  26.37770 1.000 28.46440  ? 19  ARG A HD3  1 
ATOM   295  H HE   . ARG A 1 19  ? 2.87541   3.39723  27.64356 1.000 30.82634  ? 19  ARG A HE   1 
ATOM   296  H HH11 . ARG A 1 19  ? 5.07169   1.02351  28.35778 1.000 37.51364  ? 19  ARG A HH11 1 
ATOM   297  H HH12 . ARG A 1 19  ? 5.57381   1.63552  29.61957 1.000 37.51364  ? 19  ARG A HH12 1 
ATOM   298  H HH21 . ARG A 1 19  ? 3.69427   4.37042  29.53065 1.000 37.55438  ? 19  ARG A HH21 1 
ATOM   299  H HH22 . ARG A 1 19  ? 4.73637   3.67176  30.33358 1.000 37.55438  ? 19  ARG A HH22 1 
ATOM   300  N N    A VAL A 1 20  ? 1.02628   2.81803  22.64568 0.712 20.09396  ? 20  VAL A N    1 
ATOM   301  N N    B VAL A 1 20  ? 1.09096   2.76272  22.66546 0.288 21.29362  ? 20  VAL A N    1 
ATOM   302  C CA   A VAL A 1 20  ? 1.62057   2.37794  21.37895 0.712 21.24782  ? 20  VAL A CA   1 
ATOM   303  C CA   B VAL A 1 20  ? 1.56095   2.26962  21.37854 0.288 22.23054  ? 20  VAL A CA   1 
ATOM   304  C C    A VAL A 1 20  ? 3.12884   2.45507  21.52495 0.712 21.16322  ? 20  VAL A C    1 
ATOM   305  C C    B VAL A 1 20  ? 3.05300   2.52207  21.29475 0.288 20.31994  ? 20  VAL A C    1 
ATOM   306  O O    A VAL A 1 20  ? 3.64889   3.42734  22.08135 0.712 23.33218  ? 20  VAL A O    1 
ATOM   307  O O    B VAL A 1 20  ? 3.51543   3.64127  21.56446 0.288 22.49232  ? 20  VAL A O    1 
ATOM   308  C CB   A VAL A 1 20  ? 1.13328   3.26231  20.21362 0.712 22.12375  ? 20  VAL A CB   1 
ATOM   309  C CB   B VAL A 1 20  ? 0.80769   2.93273  20.21335 0.288 19.49378  ? 20  VAL A CB   1 
ATOM   310  C CG1  A VAL A 1 20  ? 1.56738   2.66319  18.82452 0.712 20.30494  ? 20  VAL A CG1  1 
ATOM   311  C CG1  B VAL A 1 20  ? -0.60989  2.49749  20.23343 0.288 28.40253  ? 20  VAL A CG1  1 
ATOM   312  C CG2  A VAL A 1 20  ? -0.34970  3.47934  20.26190 0.712 25.77702  ? 20  VAL A CG2  1 
ATOM   313  C CG2  B VAL A 1 20  ? 0.90472   4.45388  20.30071 0.288 20.00763  ? 20  VAL A CG2  1 
ATOM   314  H H    A VAL A 1 20  ? 1.15134   3.65524  22.79743 0.712 24.11763  ? 20  VAL A H    1 
ATOM   315  H H    B VAL A 1 20  ? 1.33020   3.57050  22.83824 0.288 25.55723  ? 20  VAL A H    1 
ATOM   316  H HA   A VAL A 1 20  ? 1.37298   1.45906  21.19119 0.712 25.50226  ? 20  VAL A HA   1 
ATOM   317  H HA   B VAL A 1 20  ? 1.41984   1.31198  21.31592 0.288 26.68153  ? 20  VAL A HA   1 
ATOM   318  H HB   A VAL A 1 20  ? 1.55488   4.13066  20.30916 0.712 26.55338  ? 20  VAL A HB   1 
ATOM   319  H HB   B VAL A 1 20  ? 1.20992   2.66194  19.37324 0.288 23.39742  ? 20  VAL A HB   1 
ATOM   320  H HG11 A VAL A 1 20  ? 1.16850   3.19038  18.11469 0.712 24.37081  ? 20  VAL A HG11 1 
ATOM   321  H HG11 B VAL A 1 20  ? -0.98653  2.60723  19.34630 0.288 34.08791  ? 20  VAL A HG11 1 
ATOM   322  H HG12 A VAL A 1 20  ? 2.53446   2.69373  18.75578 0.712 24.37081  ? 20  VAL A HG12 1 
ATOM   323  H HG12 B VAL A 1 20  ? -0.65018  1.56481  20.49684 0.288 34.08791  ? 20  VAL A HG12 1 
ATOM   324  H HG13 A VAL A 1 20  ? 1.26051   1.74482  18.76692 0.712 24.37081  ? 20  VAL A HG13 1 
ATOM   325  H HG13 B VAL A 1 20  ? -1.09855  3.04239  20.86998 0.288 34.08791  ? 20  VAL A HG13 1 
ATOM   326  H HG21 A VAL A 1 20  ? -0.62281  3.97098  19.47158 0.712 30.93731  ? 20  VAL A HG21 1 
ATOM   327  H HG21 B VAL A 1 20  ? 0.34875   4.84602  19.60931 0.288 24.01403  ? 20  VAL A HG21 1 
ATOM   328  H HG22 A VAL A 1 20  ? -0.79438  2.61759  20.28546 0.712 30.93731  ? 20  VAL A HG22 1 
ATOM   329  H HG22 B VAL A 1 20  ? 0.59681   4.74029  21.17482 0.288 24.01403  ? 20  VAL A HG22 1 
ATOM   330  H HG23 A VAL A 1 20  ? -0.56885  3.98656  21.05914 0.712 30.93731  ? 20  VAL A HG23 1 
ATOM   331  H HG23 B VAL A 1 20  ? 1.82882   4.71928  20.17221 0.288 24.01403  ? 20  VAL A HG23 1 
ATOM   332  N N    A SER A 1 21  ? 3.84058   1.42737  21.06530 0.712 21.39248  ? 21  SER A N    1 
ATOM   333  N N    B SER A 1 21  ? 3.80321   1.47478  20.94518 0.288 21.62851  ? 21  SER A N    1 
ATOM   334  C CA   A SER A 1 21  ? 5.28298   1.54479  20.94462 0.712 22.36827  ? 21  SER A CA   1 
ATOM   335  C CA   B SER A 1 21  ? 5.25623   1.50780  20.92851 0.288 22.43089  ? 21  SER A CA   1 
ATOM   336  C C    A SER A 1 21  ? 5.67502   1.38061  19.48903 0.712 22.37058  ? 21  SER A C    1 
ATOM   337  C C    B SER A 1 21  ? 5.78788   1.20979  19.53458 0.288 22.63715  ? 21  SER A C    1 
ATOM   338  O O    A SER A 1 21  ? 4.92622   0.82362  18.66885 0.712 21.67716  ? 21  SER A O    1 
ATOM   339  O O    B SER A 1 21  ? 5.29675   0.30771  18.83405 0.288 22.35766  ? 21  SER A O    1 
ATOM   340  C CB   A SER A 1 21  ? 6.03914   0.52791  21.78011 0.712 27.10844  ? 21  SER A CB   1 
ATOM   341  C CB   B SER A 1 21  ? 5.83756   0.51114  21.91285 0.288 27.02103  ? 21  SER A CB   1 
ATOM   342  O OG   A SER A 1 21  ? 5.73812   -0.77261 21.37005 0.712 25.77227  ? 21  SER A OG   1 
ATOM   343  O OG   B SER A 1 21  ? 5.38200   0.79557  23.22779 0.288 29.10001  ? 21  SER A OG   1 
ATOM   344  H H    A SER A 1 21  ? 3.51263   0.67003  20.82346 0.712 25.67586  ? 21  SER A H    1 
ATOM   345  H H    B SER A 1 21  ? 3.47824   0.71475  20.70780 0.288 25.95910  ? 21  SER A H    1 
ATOM   346  H HA   A SER A 1 21  ? 5.54339   2.42388  21.26129 0.712 26.84680  ? 21  SER A HA   1 
ATOM   347  H HA   B SER A 1 21  ? 5.54785   2.39998  21.17319 0.288 26.92195  ? 21  SER A HA   1 
ATOM   348  H HB2  A SER A 1 21  ? 6.99161   0.67940  21.67651 0.712 32.53501  ? 21  SER A HB2  1 
ATOM   349  H HB2  B SER A 1 21  ? 5.55477   -0.38292 21.66469 0.288 32.43012  ? 21  SER A HB2  1 
ATOM   350  H HB3  A SER A 1 21  ? 5.78586   0.63243  22.71061 0.712 32.53501  ? 21  SER A HB3  1 
ATOM   351  H HB3  B SER A 1 21  ? 6.80549   0.57080  21.89170 0.288 32.43012  ? 21  SER A HB3  1 
ATOM   352  H HG   A SER A 1 21  ? 6.25270   -1.00399 20.74774 0.712 30.93161  ? 21  SER A HG   1 
ATOM   353  H HG   B SER A 1 21  ? 5.71746   0.25086  23.77217 0.288 34.92489  ? 21  SER A HG   1 
ATOM   354  N N    . PHE A 1 22  ? 6.84347   1.93612  19.18209 1.000 23.15623  ? 22  PHE A N    1 
ATOM   355  C CA   . PHE A 1 22  ? 7.38757   1.99919  17.81422 1.000 22.30182  ? 22  PHE A CA   1 
ATOM   356  C C    . PHE A 1 22  ? 8.84216   1.57652  17.83456 1.000 22.73287  ? 22  PHE A C    1 
ATOM   357  O O    . PHE A 1 22  ? 9.62214   2.02857  18.68235 1.000 27.47192  ? 22  PHE A O    1 
ATOM   358  C CB   . PHE A 1 22  ? 7.35341   3.42225  17.22274 1.000 22.19140  ? 22  PHE A CB   1 
ATOM   359  C CG   . PHE A 1 22  ? 6.03631   4.15607  17.36749 1.000 20.52791  ? 22  PHE A CG   1 
ATOM   360  C CD1  . PHE A 1 22  ? 5.03672   3.99862  16.43631 1.000 25.26698  ? 22  PHE A CD1  1 
ATOM   361  C CD2  . PHE A 1 22  ? 5.83940   5.00394  18.42144 1.000 24.48883  ? 22  PHE A CD2  1 
ATOM   362  C CE1  . PHE A 1 22  ? 3.81694   4.68861  16.54317 1.000 24.61900  ? 22  PHE A CE1  1 
ATOM   363  C CE2  . PHE A 1 22  ? 4.62476   5.71500  18.54523 1.000 27.53683  ? 22  PHE A CE2  1 
ATOM   364  C CZ   . PHE A 1 22  ? 3.62094   5.53643  17.57546 1.000 25.25131  ? 22  PHE A CZ   1 
ATOM   365  H H    . PHE A 1 22  ? 7.36508   2.29858  19.76188 1.000 27.79236  ? 22  PHE A H    1 
ATOM   366  H HA   . PHE A 1 22  ? 6.85517   1.40744  17.25990 1.000 26.76707  ? 22  PHE A HA   1 
ATOM   367  H HB2  . PHE A 1 22  ? 8.03095   3.95442  17.66842 1.000 26.63456  ? 22  PHE A HB2  1 
ATOM   368  H HB3  . PHE A 1 22  ? 7.54847   3.36342  16.27438 1.000 26.63456  ? 22  PHE A HB3  1 
ATOM   369  H HD1  . PHE A 1 22  ? 5.17098   3.42206  15.71906 1.000 30.32526  ? 22  PHE A HD1  1 
ATOM   370  H HD2  . PHE A 1 22  ? 6.50732   5.11316  19.05930 1.000 29.39147  ? 22  PHE A HD2  1 
ATOM   371  H HE1  . PHE A 1 22  ? 3.14987   4.56214  15.90762 1.000 29.54768  ? 22  PHE A HE1  1 
ATOM   372  H HE2  . PHE A 1 22  ? 4.49017   6.29474  19.25985 1.000 33.04908  ? 22  PHE A HE2  1 
ATOM   373  H HZ   . PHE A 1 22  ? 2.82002   6.00384  17.64580 1.000 30.30646  ? 22  PHE A HZ   1 
ATOM   374  N N    . GLU A 1 23  ? 9.21461   0.77406  16.86960 1.000 22.32375  ? 23  GLU A N    1 
ATOM   375  C CA   . GLU A 1 23  ? 10.59876  0.56334  16.54142 1.000 22.67727  ? 23  GLU A CA   1 
ATOM   376  C C    . GLU A 1 23  ? 11.00637  1.60996  15.52238 1.000 24.35094  ? 23  GLU A C    1 
ATOM   377  O O    . GLU A 1 23  ? 10.29376  1.83515  14.56058 1.000 25.33774  ? 23  GLU A O    1 
ATOM   378  C CB   . GLU A 1 23  ? 10.82006  -0.81659 15.95261 1.000 26.98034  ? 23  GLU A CB   1 
ATOM   379  C CG   . GLU A 1 23  ? 12.25966  -1.06066 15.47862 1.000 27.76550  ? 23  GLU A CG   1 
ATOM   380  C CD   . GLU A 1 23  ? 12.50861  -2.42491 14.85711 1.000 40.69962  ? 23  GLU A CD   1 
ATOM   381  O OE1  . GLU A 1 23  ? 13.64281  -2.63214 14.36090 1.000 37.16371  ? 23  GLU A OE1  1 
ATOM   382  O OE2  . GLU A 1 23  ? 11.60205  -3.26484 14.82321 1.000 38.68740  ? 23  GLU A OE2  1 
ATOM   383  H H    . GLU A 1 23  ? 8.66934   0.32771  16.37659 1.000 26.79338  ? 23  GLU A H    1 
ATOM   384  H HA   . GLU A 1 23  ? 11.14057  0.63922  17.34241 1.000 27.21760  ? 23  GLU A HA   1 
ATOM   385  H HB2  . GLU A 1 23  ? 10.61371  -1.48111 16.62843 1.000 32.38129  ? 23  GLU A HB2  1 
ATOM   386  H HB3  . GLU A 1 23  ? 10.23335  -0.92756 15.18818 1.000 32.38129  ? 23  GLU A HB3  1 
ATOM   387  H HG2  . GLU A 1 23  ? 12.48091  -0.39269 14.81097 1.000 33.32348  ? 23  GLU A HG2  1 
ATOM   388  H HG3  . GLU A 1 23  ? 12.85291  -0.97649 16.24142 1.000 33.32348  ? 23  GLU A HG3  1 
ATOM   389  N N    . LEU A 1 24  ? 12.11699  2.25948  15.75892 1.000 23.07919  ? 24  LEU A N    1 
ATOM   390  C CA   . LEU A 1 24  ? 12.64984  3.26505  14.85812 1.000 21.51992  ? 24  LEU A CA   1 
ATOM   391  C C    . LEU A 1 24  ? 13.84032  2.67184  14.12959 1.000 24.58700  ? 24  LEU A C    1 
ATOM   392  O O    . LEU A 1 24  ? 14.77580  2.11318  14.73521 1.000 26.64769  ? 24  LEU A O    1 
ATOM   393  C CB   . LEU A 1 24  ? 13.05404  4.51391  15.63265 1.000 23.23105  ? 24  LEU A CB   1 
ATOM   394  C CG   . LEU A 1 24  ? 12.01031  5.11336  16.56266 1.000 21.86823  ? 24  LEU A CG   1 
ATOM   395  C CD1  . LEU A 1 24  ? 12.61838  6.31205  17.32040 1.000 26.30155  ? 24  LEU A CD1  1 
ATOM   396  C CD2  . LEU A 1 24  ? 10.76009  5.47969  15.77564 1.000 23.77627  ? 24  LEU A CD2  1 
ATOM   397  H H    . LEU A 1 24  ? 12.60227  2.13567  16.45804 1.000 27.69990  ? 24  LEU A H    1 
ATOM   398  H HA   . LEU A 1 24  ? 11.98529  3.52423  14.20078 1.000 25.82879  ? 24  LEU A HA   1 
ATOM   399  H HB2  . LEU A 1 24  ? 13.82500  4.29136  16.17762 1.000 27.88214  ? 24  LEU A HB2  1 
ATOM   400  H HB3  . LEU A 1 24  ? 13.28935  5.20129  14.98997 1.000 27.88214  ? 24  LEU A HB3  1 
ATOM   401  H HG   . LEU A 1 24  ? 11.73361  4.46869  17.23253 1.000 26.24676  ? 24  LEU A HG   1 
ATOM   402  H HD11 . LEU A 1 24  ? 11.99998  6.59504  18.01206 1.000 31.56675  ? 24  LEU A HD11 1 
ATOM   403  H HD12 . LEU A 1 24  ? 13.45926  6.03950  17.71983 1.000 31.56675  ? 24  LEU A HD12 1 
ATOM   404  H HD13 . LEU A 1 24  ? 12.76927  7.03763  16.69456 1.000 31.56675  ? 24  LEU A HD13 1 
ATOM   405  H HD21 . LEU A 1 24  ? 10.20895  6.06856  16.31450 1.000 28.53641  ? 24  LEU A HD21 1 
ATOM   406  H HD22 . LEU A 1 24  ? 11.02258  5.92940  14.95725 1.000 28.53641  ? 24  LEU A HD22 1 
ATOM   407  H HD23 . LEU A 1 24  ? 10.27055  4.66914  15.56528 1.000 28.53641  ? 24  LEU A HD23 1 
ATOM   408  N N    . PHE A 1 25  ? 13.83658  2.79659  12.80127 1.000 24.05396  ? 25  PHE A N    1 
ATOM   409  C CA   . PHE A 1 25  ? 14.82821  2.13637  11.96449 1.000 23.67838  ? 25  PHE A CA   1 
ATOM   410  C C    . PHE A 1 25  ? 16.09165  2.98666  11.87067 1.000 27.73733  ? 25  PHE A C    1 
ATOM   411  O O    . PHE A 1 25  ? 16.50449  3.45451  10.81175 1.000 27.73130  ? 25  PHE A O    1 
ATOM   412  C CB   . PHE A 1 25  ? 14.25630  1.82732  10.57186 1.000 26.84905  ? 25  PHE A CB   1 
ATOM   413  C CG   . PHE A 1 25  ? 13.03052  1.00402  10.58754 1.000 31.76763  ? 25  PHE A CG   1 
ATOM   414  C CD1  . PHE A 1 25  ? 12.94654  -0.12468 11.38924 1.000 39.63827  ? 25  PHE A CD1  1 
ATOM   415  C CD2  . PHE A 1 25  ? 11.92635  1.36449  9.80380  1.000 31.48620  ? 25  PHE A CD2  1 
ATOM   416  C CE1  . PHE A 1 25  ? 11.78437  -0.88900 11.40886 1.000 39.07799  ? 25  PHE A CE1  1 
ATOM   417  C CE2  . PHE A 1 25  ? 10.78375  0.58369  9.80848  1.000 29.50496  ? 25  PHE A CE2  1 
ATOM   418  C CZ   . PHE A 1 25  ? 10.71370  -0.51585 10.62231 1.000 33.79684  ? 25  PHE A CZ   1 
ATOM   419  H H    . PHE A 1 25  ? 13.26336  3.26304  12.36144 1.000 28.86964  ? 25  PHE A H    1 
ATOM   420  H HA   . PHE A 1 25  ? 15.06415  1.29799  12.39151 1.000 28.41894  ? 25  PHE A HA   1 
ATOM   421  H HB2  . PHE A 1 25  ? 14.04199  2.66492  10.13209 1.000 32.22374  ? 25  PHE A HB2  1 
ATOM   422  H HB3  . PHE A 1 25  ? 14.92654  1.34659  10.06140 1.000 32.22374  ? 25  PHE A HB3  1 
ATOM   423  H HD1  . PHE A 1 25  ? 13.67143  -0.37197 11.91677 1.000 47.57080  ? 25  PHE A HD1  1 
ATOM   424  H HD2  . PHE A 1 25  ? 11.96146  2.13119  9.27860  1.000 37.78832  ? 25  PHE A HD2  1 
ATOM   425  H HE1  . PHE A 1 25  ? 11.72946  -1.64510 11.94756 1.000 46.89848  ? 25  PHE A HE1  1 
ATOM   426  H HE2  . PHE A 1 25  ? 10.06553  0.80490  9.26064  1.000 35.41084  ? 25  PHE A HE2  1 
ATOM   427  H HZ   . PHE A 1 25  ? 9.93193   -1.01905 10.64514 1.000 40.56109  ? 25  PHE A HZ   1 
ATOM   428  N N    . ALA A 1 26  ? 16.77578  3.11596  13.01110 1.000 28.86161  ? 26  ALA A N    1 
ATOM   429  C CA   . ALA A 1 26  ? 18.00585  3.88029  13.02855 1.000 28.51741  ? 26  ALA A CA   1 
ATOM   430  C C    . ALA A 1 26  ? 19.11540  3.24250  12.20505 1.000 29.76236  ? 26  ALA A C    1 
ATOM   431  O O    . ALA A 1 26  ? 20.07606  3.92267  11.83281 1.000 32.92311  ? 26  ALA A O    1 
ATOM   432  C CB   . ALA A 1 26  ? 18.47571  4.03085  14.47336 1.000 34.18762  ? 26  ALA A CB   1 
ATOM   433  H H    . ALA A 1 26  ? 16.54749  2.77548  13.76712 1.000 34.63881  ? 26  ALA A H    1 
ATOM   434  H HA   . ALA A 1 26  ? 17.83171  4.75695  12.65166 1.000 34.22577  ? 26  ALA A HA   1 
ATOM   435  H HB1  . ALA A 1 26  ? 19.35428  4.44192  14.47852 1.000 41.03003  ? 26  ALA A HB1  1 
ATOM   436  H HB2  . ALA A 1 26  ? 17.84575  4.59071  14.95359 1.000 41.03003  ? 26  ALA A HB2  1 
ATOM   437  H HB3  . ALA A 1 26  ? 18.51865  3.15337  14.88455 1.000 41.03003  ? 26  ALA A HB3  1 
ATOM   438  N N    . ASP A 1 27  ? 19.00933  1.94741  11.89661 1.000 29.93176  ? 27  ASP A N    1 
ATOM   439  C CA   . ASP A 1 27  ? 20.01129  1.32719  11.07001 1.000 31.31321  ? 27  ASP A CA   1 
ATOM   440  C C    . ASP A 1 27  ? 19.92893  1.74938  9.61481  1.000 36.02316  ? 27  ASP A C    1 
ATOM   441  O O    . ASP A 1 27  ? 20.92518  1.63128  8.90453  1.000 39.48835  ? 27  ASP A O    1 
ATOM   442  C CB   . ASP A 1 27  ? 19.92417  -0.20989 11.19313 1.000 37.98108  ? 27  ASP A CB   1 
ATOM   443  C CG   . ASP A 1 27  ? 18.51303  -0.78874 10.93582 1.000 41.70263  ? 27  ASP A CG   1 
ATOM   444  O OD1  . ASP A 1 27  ? 17.50460  -0.07185 10.90242 1.000 38.94850  ? 27  ASP A OD1  1 
ATOM   445  O OD2  . ASP A 1 27  ? 18.42829  -2.02921 10.74487 1.000 54.95517  ? 27  ASP A OD2  1 
ATOM   446  H H    . ASP A 1 27  ? 18.37511  1.42678  12.15411 1.000 35.92300  ? 27  ASP A H    1 
ATOM   447  H HA   . ASP A 1 27  ? 20.88395  1.60126  11.39290 1.000 37.58074  ? 27  ASP A HA   1 
ATOM   448  H HB2  . ASP A 1 27  ? 20.52722  -0.60777 10.54589 1.000 45.58218  ? 27  ASP A HB2  1 
ATOM   449  H HB3  . ASP A 1 27  ? 20.18667  -0.46466 12.09151 1.000 45.58218  ? 27  ASP A HB3  1 
ATOM   450  N N    A LYS A 1 28  ? 18.76588  2.22340  9.16891  0.492 29.52457  ? 28  LYS A N    1 
ATOM   451  N N    B LYS A 1 28  ? 18.77567  2.22694  9.15321  0.508 29.32211  ? 28  LYS A N    1 
ATOM   452  C CA   A LYS A 1 28  ? 18.53305  2.58531  7.77542  0.492 29.14601  ? 28  LYS A CA   1 
ATOM   453  C CA   B LYS A 1 28  ? 18.61594  2.61988  7.75653  0.508 28.91278  ? 28  LYS A CA   1 
ATOM   454  C C    A LYS A 1 28  ? 18.34866  4.08362  7.55865  0.492 26.29056  ? 28  LYS A C    1 
ATOM   455  C C    B LYS A 1 28  ? 18.38280  4.11276  7.56005  0.508 26.21386  ? 28  LYS A C    1 
ATOM   456  O O    A LYS A 1 28  ? 18.79928  4.59969  6.51989  0.492 29.23929  ? 28  LYS A O    1 
ATOM   457  O O    B LYS A 1 28  ? 18.83467  4.65706  6.53575  0.508 29.22045  ? 28  LYS A O    1 
ATOM   458  C CB   A LYS A 1 28  ? 17.30322  1.82991  7.24724  0.492 37.36887  ? 28  LYS A CB   1 
ATOM   459  C CB   B LYS A 1 28  ? 17.46572  1.82738  7.12015  0.508 38.75869  ? 28  LYS A CB   1 
ATOM   460  C CG   A LYS A 1 28  ? 17.45125  0.27261  7.32985  0.492 44.44223  ? 28  LYS A CG   1 
ATOM   461  C CG   B LYS A 1 28  ? 17.85997  0.35513  6.79094  0.508 43.33976  ? 28  LYS A CG   1 
ATOM   462  C CD   A LYS A 1 28  ? 17.72137  -0.38700 5.96779  0.492 45.47540  ? 28  LYS A CD   1 
ATOM   463  C CD   B LYS A 1 28  ? 16.67367  -0.59358 6.93342  0.508 45.88779  ? 28  LYS A CD   1 
ATOM   464  C CE   A LYS A 1 28  ? 17.68309  -1.93463 6.03607  0.492 52.80239  ? 28  LYS A CE   1 
ATOM   465  C CE   B LYS A 1 28  ? 17.09729  -2.08239 6.98128  0.508 48.91039  ? 28  LYS A CE   1 
ATOM   466  N NZ   A LYS A 1 28  ? 19.02306  -2.61295 6.19304  0.492 53.33649  ? 28  LYS A NZ   1 
ATOM   467  N NZ   B LYS A 1 28  ? 15.91952  -2.99463 7.08958  0.508 51.32741  ? 28  LYS A NZ   1 
ATOM   468  H H    A LYS A 1 28  ? 18.07809  2.34712  9.67014  0.492 35.43437  ? 28  LYS A H    1 
ATOM   469  H H    B LYS A 1 28  ? 18.06895  2.33290  9.63166  0.508 35.19142  ? 28  LYS A H    1 
ATOM   470  H HA   A LYS A 1 28  ? 19.29494  2.31571  7.23900  0.492 34.98010  ? 28  LYS A HA   1 
ATOM   471  H HA   B LYS A 1 28  ? 19.42518  2.39795  7.26994  0.508 34.70022  ? 28  LYS A HA   1 
ATOM   472  H HB2  A LYS A 1 28  ? 16.52900  2.08425  7.77335  0.492 44.84753  ? 28  LYS A HB2  1 
ATOM   473  H HB2  B LYS A 1 28  ? 16.71683  1.80755  7.73633  0.508 46.51531  ? 28  LYS A HB2  1 
ATOM   474  H HB3  A LYS A 1 28  ? 17.16479  2.06743  6.31702  0.492 44.84753  ? 28  LYS A HB3  1 
ATOM   475  H HB3  B LYS A 1 28  ? 17.20329  2.26058  6.29289  0.508 46.51531  ? 28  LYS A HB3  1 
ATOM   476  H HG2  A LYS A 1 28  ? 18.19371  0.05823  7.91610  0.492 53.33555  ? 28  LYS A HG2  1 
ATOM   477  H HG2  B LYS A 1 28  ? 18.18001  0.30607  5.87657  0.508 52.01259  ? 28  LYS A HG2  1 
ATOM   478  H HG3  A LYS A 1 28  ? 16.62987  -0.10273 7.68390  0.492 53.33555  ? 28  LYS A HG3  1 
ATOM   479  H HG3  B LYS A 1 28  ? 18.55554  0.06556  7.40187  0.508 52.01259  ? 28  LYS A HG3  1 
ATOM   480  H HD2  A LYS A 1 28  ? 17.04468  -0.09779 5.33585  0.492 54.57537  ? 28  LYS A HD2  1 
ATOM   481  H HD2  B LYS A 1 28  ? 16.20291  -0.38982 7.75669  0.508 55.07024  ? 28  LYS A HD2  1 
ATOM   482  H HD3  A LYS A 1 28  ? 18.60100  -0.12215 5.65631  0.492 54.57537  ? 28  LYS A HD3  1 
ATOM   483  H HD3  B LYS A 1 28  ? 16.08125  -0.47530 6.17450  0.508 55.07024  ? 28  LYS A HD3  1 
ATOM   484  H HE2  A LYS A 1 28  ? 17.13873  -2.19355 6.79603  0.492 63.36775  ? 28  LYS A HE2  1 
ATOM   485  H HE2  B LYS A 1 28  ? 17.57858  -2.30383 6.16873  0.508 58.69735  ? 28  LYS A HE2  1 
ATOM   486  H HE3  A LYS A 1 28  ? 17.28673  -2.26695 5.21549  0.492 63.36775  ? 28  LYS A HE3  1 
ATOM   487  H HE3  B LYS A 1 28  ? 17.66566  -2.22810 7.75369  0.508 58.69735  ? 28  LYS A HE3  1 
ATOM   488  H HZ1  A LYS A 1 28  ? 19.41020  -2.35059 6.95026  0.492 64.00867  ? 28  LYS A HZ1  1 
ATOM   489  H HZ1  B LYS A 1 28  ? 15.34522  -2.82991 6.42992  0.508 61.59777  ? 28  LYS A HZ1  1 
ATOM   490  H HZ2  A LYS A 1 28  ? 18.91647  -3.49629 6.21411  0.492 64.00867  ? 28  LYS A HZ2  1 
ATOM   491  H HZ2  B LYS A 1 28  ? 16.18519  -3.84238 7.03628  0.508 61.59777  ? 28  LYS A HZ2  1 
ATOM   492  H HZ3  A LYS A 1 28  ? 19.55285  -2.40217 5.50967  0.492 64.00867  ? 28  LYS A HZ3  1 
ATOM   493  H HZ3  B LYS A 1 28  ? 15.50807  -2.86934 7.86875  0.508 61.59777  ? 28  LYS A HZ3  1 
ATOM   494  N N    . VAL A 1 29  ? 17.76751  4.77877  8.52683  1.000 26.97211  ? 29  VAL A N    1 
ATOM   495  C CA   . VAL A 1 29  ? 17.52516  6.23951  8.46804  1.000 24.48991  ? 29  VAL A CA   1 
ATOM   496  C C    . VAL A 1 29  ? 17.89867  6.85793  9.81386  1.000 24.21487  ? 29  VAL A C    1 
ATOM   497  O O    . VAL A 1 29  ? 17.04131  7.31576  10.60072 1.000 25.16714  ? 29  VAL A O    1 
ATOM   498  C CB   . VAL A 1 29  ? 16.08189  6.60722  8.08744  1.000 26.46980  ? 29  VAL A CB   1 
ATOM   499  C CG1  . VAL A 1 29  ? 15.86730  6.55579  6.58279  1.000 32.11978  ? 29  VAL A CG1  1 
ATOM   500  C CG2  . VAL A 1 29  ? 15.06818  5.74921  8.79566  1.000 31.78526  ? 29  VAL A CG2  1 
ATOM   501  H H    . VAL A 1 29  ? 17.47002  4.41354  9.24635  1.000 32.37142  ? 29  VAL A H    1 
ATOM   502  H HA   . VAL A 1 29  ? 18.10258  6.59720  7.77555  1.000 29.39277  ? 29  VAL A HA   1 
ATOM   503  H HB   . VAL A 1 29  ? 15.94048  7.52143  8.37922  1.000 31.76864  ? 29  VAL A HB   1 
ATOM   504  H HG11 . VAL A 1 29  ? 14.92512  6.68757  6.39348  1.000 38.54862  ? 29  VAL A HG11 1 
ATOM   505  H HG12 . VAL A 1 29  ? 16.39000  7.25806  6.16506  1.000 38.54862  ? 29  VAL A HG12 1 
ATOM   506  H HG13 . VAL A 1 29  ? 16.15308  5.68971  6.25246  1.000 38.54862  ? 29  VAL A HG13 1 
ATOM   507  H HG21 . VAL A 1 29  ? 14.17904  6.08330  8.59888  1.000 38.14719  ? 29  VAL A HG21 1 
ATOM   508  H HG22 . VAL A 1 29  ? 15.15471  4.83503  8.48312  1.000 38.14719  ? 29  VAL A HG22 1 
ATOM   509  H HG23 . VAL A 1 29  ? 15.23270  5.78923  9.75077  1.000 38.14719  ? 29  VAL A HG23 1 
ATOM   510  N N    . PRO A 1 30  ? 19.19713  6.90570  10.09832 1.000 25.13155  ? 30  PRO A N    1 
ATOM   511  C CA   . PRO A 1 30  ? 19.59709  7.31100  11.45033 1.000 25.82693  ? 30  PRO A CA   1 
ATOM   512  C C    . PRO A 1 30  ? 19.22211  8.74222  11.78679 1.000 29.27757  ? 30  PRO A C    1 
ATOM   513  O O    . PRO A 1 30  ? 18.83691  9.01163  12.92723 1.000 26.74259  ? 30  PRO A O    1 
ATOM   514  C CB   . PRO A 1 30  ? 21.10652  7.11059  11.43494 1.000 30.40941  ? 30  PRO A CB   1 
ATOM   515  C CG   . PRO A 1 30  ? 21.49769  7.07317  9.97513  1.000 34.40664  ? 30  PRO A CG   1 
ATOM   516  C CD   . PRO A 1 30  ? 20.31383  6.41767  9.30140  1.000 28.39482  ? 30  PRO A CD   1 
ATOM   517  H HA   . PRO A 1 30  ? 19.19729  6.71490  12.10280 1.000 30.99719  ? 30  PRO A HA   1 
ATOM   518  H HB2  . PRO A 1 30  ? 21.53977  7.85009  11.88917 1.000 36.49617  ? 30  PRO A HB2  1 
ATOM   519  H HB3  . PRO A 1 30  ? 21.33047  6.27486  11.87347 1.000 36.49617  ? 30  PRO A HB3  1 
ATOM   520  H HG2  . PRO A 1 30  ? 21.63706  7.97344  9.64198  1.000 41.29285  ? 30  PRO A HG2  1 
ATOM   521  H HG3  . PRO A 1 30  ? 22.30419  6.54726  9.85730  1.000 41.29285  ? 30  PRO A HG3  1 
ATOM   522  H HD2  . PRO A 1 30  ? 20.23514  6.70340  8.37778  1.000 34.07866  ? 30  PRO A HD2  1 
ATOM   523  H HD3  . PRO A 1 30  ? 20.37813  5.45079  9.34523  1.000 34.07866  ? 30  PRO A HD3  1 
ATOM   524  N N    . LYS A 1 31  ? 19.36911  9.67082  10.84878 1.000 25.77903  ? 31  LYS A N    1 
ATOM   525  C CA   . LYS A 1 31  ? 19.08453  11.06553 11.15619 1.000 25.55601  ? 31  LYS A CA   1 
ATOM   526  C C    . LYS A 1 31  ? 17.59712  11.28054 11.42238 1.000 25.34642  ? 31  LYS A C    1 
ATOM   527  O O    . LYS A 1 31  ? 17.20874  12.02113 12.34783 1.000 25.38447  ? 31  LYS A O    1 
ATOM   528  C CB   . LYS A 1 31  ? 19.57190  11.95185 10.00968 1.000 27.52860  ? 31  LYS A CB   1 
ATOM   529  C CG   . LYS A 1 31  ? 19.40685  13.42205 10.30772 1.000 28.95848  ? 31  LYS A CG   1 
ATOM   530  C CD   . LYS A 1 31  ? 20.16844  14.27917 9.27904  1.000 33.62545  ? 31  LYS A CD   1 
ATOM   531  C CE   . LYS A 1 31  ? 19.91397  15.74483 9.48662  1.000 30.11182  ? 31  LYS A CE   1 
ATOM   532  N NZ   . LYS A 1 31  ? 20.85612  16.55069 8.67619  1.000 33.92667  ? 31  LYS A NZ   1 
ATOM   533  H H    . LYS A 1 31  ? 19.62728  9.52296  10.04189 1.000 30.93972  ? 31  LYS A H    1 
ATOM   534  H HA   . LYS A 1 31  ? 19.56492  11.32182 11.95896 1.000 30.67210  ? 31  LYS A HA   1 
ATOM   535  H HB2  . LYS A 1 31  ? 20.51370  11.77940 9.85417  1.000 33.03921  ? 31  LYS A HB2  1 
ATOM   536  H HB3  . LYS A 1 31  ? 19.06078  11.74663 9.21122  1.000 33.03921  ? 31  LYS A HB3  1 
ATOM   537  H HG2  . LYS A 1 31  ? 18.46656  13.65690 10.26778 1.000 34.75505  ? 31  LYS A HG2  1 
ATOM   538  H HG3  . LYS A 1 31  ? 19.75981  13.61505 11.19037 1.000 34.75505  ? 31  LYS A HG3  1 
ATOM   539  H HD2  . LYS A 1 31  ? 21.12085  14.11935 9.36999  1.000 40.35542  ? 31  LYS A HD2  1 
ATOM   540  H HD3  . LYS A 1 31  ? 19.87628  14.04280 8.38479  1.000 40.35542  ? 31  LYS A HD3  1 
ATOM   541  H HE2  . LYS A 1 31  ? 19.00826  15.95984 9.21391  1.000 36.13907  ? 31  LYS A HE2  1 
ATOM   542  H HE3  . LYS A 1 31  ? 20.04058  15.96795 10.42208 1.000 36.13907  ? 31  LYS A HE3  1 
ATOM   543  H HZ1  . LYS A 1 31  ? 20.79866  17.40856 8.90609  1.000 40.71689  ? 31  LYS A HZ1  1 
ATOM   544  H HZ2  . LYS A 1 31  ? 21.69012  16.27076 8.81107  1.000 40.71689  ? 31  LYS A HZ2  1 
ATOM   545  H HZ3  . LYS A 1 31  ? 20.66047  16.46958 7.81176  1.000 40.71689  ? 31  LYS A HZ3  1 
ATOM   546  N N    . THR A 1 32  ? 16.74371  10.63887 10.62332 1.000 22.03957  ? 32  THR A N    1 
ATOM   547  C CA   . THR A 1 32  ? 15.31172  10.78532 10.81501 1.000 21.41715  ? 32  THR A CA   1 
ATOM   548  C C    . THR A 1 32  ? 14.84415  10.07474 12.07203 1.000 22.30539  ? 32  THR A C    1 
ATOM   549  O O    . THR A 1 32  ? 13.97456  10.58337 12.79561 1.000 21.49497  ? 32  THR A O    1 
ATOM   550  C CB   . THR A 1 32  ? 14.59544  10.22752 9.56463  1.000 19.59082  ? 32  THR A CB   1 
ATOM   551  O OG1  . THR A 1 32  ? 15.14019  10.85273 8.39682  1.000 22.71437  ? 32  THR A OG1  1 
ATOM   552  C CG2  . THR A 1 32  ? 13.13338  10.49757 9.59022  1.000 19.73210  ? 32  THR A CG2  1 
ATOM   553  H H    . THR A 1 32  ? 16.96895  10.12174 9.97414  1.000 26.45237  ? 32  THR A H    1 
ATOM   554  H HA   . THR A 1 32  ? 15.08516  11.72285 10.91800 1.000 25.70547  ? 32  THR A HA   1 
ATOM   555  H HB   . THR A 1 32  ? 14.72358  9.26629  9.54222  1.000 23.51386  ? 32  THR A HB   1 
ATOM   556  H HG1  . THR A 1 32  ? 15.94171  10.62284 8.29526  1.000 27.26212  ? 32  THR A HG1  1 
ATOM   557  H HG21 . THR A 1 32  ? 12.73146  10.22800 8.74957  1.000 23.68340  ? 32  THR A HG21 1 
ATOM   558  H HG22 . THR A 1 32  ? 12.71686  10.00093 10.31185 1.000 23.68340  ? 32  THR A HG22 1 
ATOM   559  H HG23 . THR A 1 32  ? 12.97325  11.44452 9.72635  1.000 23.68340  ? 32  THR A HG23 1 
ATOM   560  N N    . ALA A 1 33  ? 15.41103  8.91092  12.34813 1.000 21.64659  ? 33  ALA A N    1 
ATOM   561  C CA   . ALA A 1 33  ? 15.03667  8.17112  13.54881 1.000 21.10449  ? 33  ALA A CA   1 
ATOM   562  C C    . ALA A 1 33  ? 15.43227  8.95302  14.80243 1.000 22.32909  ? 33  ALA A C    1 
ATOM   563  O O    . ALA A 1 33  ? 14.64312  9.02412  15.76171 1.000 22.30767  ? 33  ALA A O    1 
ATOM   564  C CB   . ALA A 1 33  ? 15.68306  6.79781  13.56297 1.000 25.13127  ? 33  ALA A CB   1 
ATOM   565  H H    . ALA A 1 33  ? 16.00974  8.52777  11.86404 1.000 25.98079  ? 33  ALA A H    1 
ATOM   566  H HA   . ALA A 1 33  ? 14.07556  8.04015  13.54496 1.000 25.33027  ? 33  ALA A HA   1 
ATOM   567  H HB1  . ALA A 1 33  ? 15.43367  6.33982  14.38087 1.000 30.16241  ? 33  ALA A HB1  1 
ATOM   568  H HB2  . ALA A 1 33  ? 15.37233  6.29458  12.79414 1.000 30.16241  ? 33  ALA A HB2  1 
ATOM   569  H HB3  . ALA A 1 33  ? 16.64662  6.90188  13.52276 1.000 30.16241  ? 33  ALA A HB3  1 
ATOM   570  N N    . GLU A 1 34  ? 16.60579  9.58493  14.78455 1.000 22.78071  ? 34  GLU A N    1 
ATOM   571  C CA   . GLU A 1 34  ? 17.08587  10.32204 15.94960 1.000 24.74441  ? 34  GLU A CA   1 
ATOM   572  C C    . GLU A 1 34  ? 16.20597  11.52295 16.25032 1.000 24.16890  ? 34  GLU A C    1 
ATOM   573  O O    . GLU A 1 34  ? 15.93453  11.80788 17.42085 1.000 25.20469  ? 34  GLU A O    1 
ATOM   574  C CB   . GLU A 1 34  ? 18.53170  10.77294 15.73080 1.000 26.38082  ? 34  GLU A CB   1 
ATOM   575  C CG   . GLU A 1 34  ? 19.10402  11.61859 16.87373 1.000 29.55909  ? 34  GLU A CG   1 
ATOM   576  C CD   . GLU A 1 34  ? 19.15010  10.92225 18.22361 1.000 29.72797  ? 34  GLU A CD   1 
ATOM   577  O OE1  . GLU A 1 34  ? 18.94913  9.68520  18.32510 1.000 32.15649  ? 34  GLU A OE1  1 
ATOM   578  O OE2  . GLU A 1 34  ? 19.42341  11.65752 19.19625 1.000 36.13773  ? 34  GLU A OE2  1 
ATOM   579  H H    . GLU A 1 34  ? 17.14152  9.60220  14.11202 1.000 27.34173  ? 34  GLU A H    1 
ATOM   580  H HA   . GLU A 1 34  ? 17.06296  9.72851  16.71648 1.000 29.69818  ? 34  GLU A HA   1 
ATOM   581  H HB2  . GLU A 1 34  ? 19.09142  9.98621  15.63763 1.000 31.66186  ? 34  GLU A HB2  1 
ATOM   582  H HB3  . GLU A 1 34  ? 18.57142  11.30609 14.92144 1.000 31.66186  ? 34  GLU A HB3  1 
ATOM   583  H HG2  . GLU A 1 34  ? 20.01247  11.87047 16.64527 1.000 35.47579  ? 34  GLU A HG2  1 
ATOM   584  H HG3  . GLU A 1 34  ? 18.55512  12.41199 16.97437 1.000 35.47579  ? 34  GLU A HG3  1 
ATOM   585  N N    . ASN A 1 35  ? 15.71354  12.22427 15.21279 1.000 23.85188  ? 35  ASN A N    1 
ATOM   586  C CA   . ASN A 1 35  ? 14.79519  13.33914 15.43907 1.000 20.56086  ? 35  ASN A CA   1 
ATOM   587  C C    . ASN A 1 35  ? 13.56991  12.87886 16.21951 1.000 21.46079  ? 35  ASN A C    1 
ATOM   588  O O    . ASN A 1 35  ? 13.16677  13.51036 17.19833 1.000 21.70906  ? 35  ASN A O    1 
ATOM   589  C CB   . ASN A 1 35  ? 14.42035  13.94163 14.08327 1.000 22.38851  ? 35  ASN A CB   1 
ATOM   590  C CG   . ASN A 1 35  ? 13.46476  15.10200 14.18170 1.000 22.49781  ? 35  ASN A CG   1 
ATOM   591  O OD1  . ASN A 1 35  ? 13.78903  16.14356 14.76330 1.000 25.21168  ? 35  ASN A OD1  1 
ATOM   592  N ND2  . ASN A 1 35  ? 12.36490  14.98167 13.52425 1.000 22.56490  ? 35  ASN A ND2  1 
ATOM   593  H H    . ASN A 1 35  ? 15.89566  12.07303 14.38602 1.000 28.62714  ? 35  ASN A H    1 
ATOM   594  H HA   . ASN A 1 35  ? 15.22223  14.03085 15.96829 1.000 24.67792  ? 35  ASN A HA   1 
ATOM   595  H HB2  . ASN A 1 35  ? 15.22723  14.25845 13.64799 1.000 26.87110  ? 35  ASN A HB2  1 
ATOM   596  H HB3  . ASN A 1 35  ? 13.99884  13.25583 13.54206 1.000 26.87110  ? 35  ASN A HB3  1 
ATOM   597  H HD21 . ASN A 1 35  ? 11.78123  15.61299 13.54337 1.000 27.08276  ? 35  ASN A HD21 1 
ATOM   598  H HD22 . ASN A 1 35  ? 12.21363  14.26995 13.06581 1.000 27.08276  ? 35  ASN A HD22 1 
ATOM   599  N N    . PHE A 1 36  ? 12.92876  11.80972 15.75387 1.000 20.97313  ? 36  PHE A N    1 
ATOM   600  C CA   . PHE A 1 36  ? 11.73655  11.31861 16.43853 1.000 19.31119  ? 36  PHE A CA   1 
ATOM   601  C C    . PHE A 1 36  ? 12.06308  10.82879 17.83365 1.000 21.20819  ? 36  PHE A C    1 
ATOM   602  O O    . PHE A 1 36  ? 11.27180  11.04193 18.75941 1.000 21.64235  ? 36  PHE A O    1 
ATOM   603  C CB   . PHE A 1 36  ? 11.10788  10.23636 15.59235 1.000 22.73283  ? 36  PHE A CB   1 
ATOM   604  C CG   . PHE A 1 36  ? 9.69939   9.81360  16.01875 1.000 20.22492  ? 36  PHE A CG   1 
ATOM   605  C CD1  . PHE A 1 36  ? 9.52965   8.79544  16.89413 1.000 21.59273  ? 36  PHE A CD1  1 
ATOM   606  C CD2  . PHE A 1 36  ? 8.57350   10.39771 15.44720 1.000 22.23565  ? 36  PHE A CD2  1 
ATOM   607  C CE1  . PHE A 1 36  ? 8.23611   8.34999  17.22015 1.000 23.85909  ? 36  PHE A CE1  1 
ATOM   608  C CE2  . PHE A 1 36  ? 7.31730   9.95317  15.76480 1.000 21.88978  ? 36  PHE A CE2  1 
ATOM   609  C CZ   . PHE A 1 36  ? 7.15973   8.95554  16.64419 1.000 22.66494  ? 36  PHE A CZ   1 
ATOM   610  H H    . PHE A 1 36  ? 13.15795  11.35936 15.05799 1.000 25.17263  ? 36  PHE A H    1 
ATOM   611  H HA   . PHE A 1 36  ? 11.09090  12.03492 16.54314 1.000 23.17832  ? 36  PHE A HA   1 
ATOM   612  H HB2  . PHE A 1 36  ? 11.05064  10.55623 14.67840 1.000 27.28427  ? 36  PHE A HB2  1 
ATOM   613  H HB3  . PHE A 1 36  ? 11.67223  9.44850  15.63337 1.000 27.28427  ? 36  PHE A HB3  1 
ATOM   614  H HD1  . PHE A 1 36  ? 10.27102  8.38893  17.28144 1.000 25.91616  ? 36  PHE A HD1  1 
ATOM   615  H HD2  . PHE A 1 36  ? 8.67478   11.09746 14.84306 1.000 26.68766  ? 36  PHE A HD2  1 
ATOM   616  H HE1  . PHE A 1 36  ? 8.11678   7.65067  17.82149 1.000 28.63579  ? 36  PHE A HE1  1 
ATOM   617  H HE2  . PHE A 1 36  ? 6.57248   10.34491 15.36897 1.000 26.27262  ? 36  PHE A HE2  1 
ATOM   618  H HZ   . PHE A 1 36  ? 6.30220   8.67153  16.86530 1.000 27.20281  ? 36  PHE A HZ   1 
ATOM   619  N N    . ARG A 1 37  ? 13.16652  10.12773 18.00424 1.000 22.24949  ? 37  ARG A N    1 
ATOM   620  C CA   . ARG A 1 37  ? 13.53950  9.63276  19.33055 1.000 22.76274  ? 37  ARG A CA   1 
ATOM   621  C C    . ARG A 1 37  ? 13.68176  10.78010 20.31624 1.000 24.15356  ? 37  ARG A C    1 
ATOM   622  O O    . ARG A 1 37  ? 13.12868  10.73933 21.44037 1.000 23.82077  ? 37  ARG A O    1 
ATOM   623  C CB   . ARG A 1 37  ? 14.83954  8.83116  19.24281 1.000 23.20555  ? 37  ARG A CB   1 
ATOM   624  C CG   . ARG A 1 37  ? 15.19916  8.16606  20.54995 1.000 25.06904  ? 37  ARG A CG   1 
ATOM   625  C CD   . ARG A 1 37  ? 16.63093  7.73493  20.67071 1.000 27.21405  ? 37  ARG A CD   1 
ATOM   626  N NE   . ARG A 1 37  ? 17.45662  8.92233  20.67515 1.000 28.83612  ? 37  ARG A NE   1 
ATOM   627  C CZ   . ARG A 1 37  ? 17.62717  9.70154  21.74241 1.000 30.12488  ? 37  ARG A CZ   1 
ATOM   628  N NH1  . ARG A 1 37  ? 17.06408  9.37135  22.91445 1.000 35.61182  ? 37  ARG A NH1  1 
ATOM   629  N NH2  . ARG A 1 37  ? 18.31695  10.81712 21.61185 1.000 32.68989  ? 37  ARG A NH2  1 
ATOM   630  H H    . ARG A 1 37  ? 13.71908  9.92132  17.37840 1.000 26.70427  ? 37  ARG A H    1 
ATOM   631  H HA   . ARG A 1 37  ? 12.84265  9.04035  19.65359 1.000 27.32017  ? 37  ARG A HA   1 
ATOM   632  H HB2  . ARG A 1 37  ? 14.73998  8.13938  18.57018 1.000 27.85154  ? 37  ARG A HB2  1 
ATOM   633  H HB3  . ARG A 1 37  ? 15.56391  9.42866  18.99952 1.000 27.85154  ? 37  ARG A HB3  1 
ATOM   634  H HG2  . ARG A 1 37  ? 15.02271  8.79002  21.27136 1.000 30.08773  ? 37  ARG A HG2  1 
ATOM   635  H HG3  . ARG A 1 37  ? 14.64849  7.37432  20.65397 1.000 30.08773  ? 37  ARG A HG3  1 
ATOM   636  H HD2  . ARG A 1 37  ? 16.76505  7.24931  21.49962 1.000 32.66174  ? 37  ARG A HD2  1 
ATOM   637  H HD3  . ARG A 1 37  ? 16.87696  7.17740  19.91604 1.000 32.66174  ? 37  ARG A HD3  1 
ATOM   638  H HE   . ARG A 1 37  ? 17.86068  9.13781  19.94720 1.000 34.60822  ? 37  ARG A HE   1 
ATOM   639  H HH11 . ARG A 1 37  ? 16.59184  8.65542  22.97807 1.000 42.73906  ? 37  ARG A HH11 1 
ATOM   640  H HH12 . ARG A 1 37  ? 17.17534  9.87560  23.60216 1.000 42.73906  ? 37  ARG A HH12 1 
ATOM   641  H HH21 . ARG A 1 37  ? 18.64789  11.03109 20.84746 1.000 39.23275  ? 37  ARG A HH21 1 
ATOM   642  H HH22 . ARG A 1 37  ? 18.43605  11.33102 22.29105 1.000 39.23275  ? 37  ARG A HH22 1 
ATOM   643  N N    . ALA A 1 38  ? 14.44505  11.80051 19.93572 1.000 22.01484  ? 38  ALA A N    1 
ATOM   644  C CA   . ALA A 1 38  ? 14.70935  12.92061 20.82432 1.000 24.60096  ? 38  ALA A CA   1 
ATOM   645  C C    . ALA A 1 38  ? 13.46001  13.73036 21.09747 1.000 23.29015  ? 38  ALA A C    1 
ATOM   646  O O    . ALA A 1 38  ? 13.30495  14.25626 22.19952 1.000 26.43789  ? 38  ALA A O    1 
ATOM   647  C CB   . ALA A 1 38  ? 15.79804  13.80192 20.24438 1.000 28.04198  ? 38  ALA A CB   1 
ATOM   648  H H    . ALA A 1 38  ? 14.82221  11.86738 19.16574 1.000 26.42270  ? 38  ALA A H    1 
ATOM   649  H HA   . ALA A 1 38  ? 15.02348  12.56894 21.67199 1.000 29.52603  ? 38  ALA A HA   1 
ATOM   650  H HB1  . ALA A 1 38  ? 15.95885  14.54384 20.84819 1.000 33.65526  ? 38  ALA A HB1  1 
ATOM   651  H HB2  . ALA A 1 38  ? 16.60760  13.27754 20.14171 1.000 33.65526  ? 38  ALA A HB2  1 
ATOM   652  H HB3  . ALA A 1 38  ? 15.50802  14.13514 19.38081 1.000 33.65526  ? 38  ALA A HB3  1 
ATOM   653  N N    . LEU A 1 39  ? 12.58976  13.90743 20.09999 1.000 21.51764  ? 39  LEU A N    1 
ATOM   654  C CA   . LEU A 1 39  ? 11.32599  14.60884 20.35666 1.000 21.25787  ? 39  LEU A CA   1 
ATOM   655  C C    . LEU A 1 39  ? 10.42077  13.80377 21.28945 1.000 22.20897  ? 39  LEU A C    1 
ATOM   656  O O    . LEU A 1 39  ? 9.63929   14.39389 22.04099 1.000 23.78995  ? 39  LEU A O    1 
ATOM   657  C CB   . LEU A 1 39  ? 10.59786  14.86947 19.03909 1.000 21.01255  ? 39  LEU A CB   1 
ATOM   658  C CG   . LEU A 1 39  ? 11.29622  15.91333 18.12042 1.000 23.96896  ? 39  LEU A CG   1 
ATOM   659  C CD1  . LEU A 1 39  ? 10.56689  15.92081 16.77263 1.000 22.78432  ? 39  LEU A CD1  1 
ATOM   660  C CD2  . LEU A 1 39  ? 11.35487  17.30838 18.68671 1.000 26.67402  ? 39  LEU A CD2  1 
ATOM   661  H H    . LEU A 1 39  ? 12.70134  13.64040 19.29014 1.000 25.82604  ? 39  LEU A H    1 
ATOM   662  H HA   . LEU A 1 39  ? 11.52291  15.46150 20.77512 1.000 25.51433  ? 39  LEU A HA   1 
ATOM   663  H HB2  . LEU A 1 39  ? 10.54014  14.03546 18.54715 1.000 25.21994  ? 39  LEU A HB2  1 
ATOM   664  H HB3  . LEU A 1 39  ? 9.70773   15.19990 19.23750 1.000 25.21994  ? 39  LEU A HB3  1 
ATOM   665  H HG   . LEU A 1 39  ? 12.22461  15.64945 18.02371 1.000 28.76764  ? 39  LEU A HG   1 
ATOM   666  H HD11 . LEU A 1 39  ? 11.01915  16.53390 16.17223 1.000 27.34607  ? 39  LEU A HD11 1 
ATOM   667  H HD12 . LEU A 1 39  ? 10.57975  15.02466 16.40163 1.000 27.34607  ? 39  LEU A HD12 1 
ATOM   668  H HD13 . LEU A 1 39  ? 9.65090   16.20849 16.91082 1.000 27.34607  ? 39  LEU A HD13 1 
ATOM   669  H HD21 . LEU A 1 39  ? 11.74348  17.90173 18.02503 1.000 32.01370  ? 39  LEU A HD21 1 
ATOM   670  H HD22 . LEU A 1 39  ? 10.45532  17.59909 18.90399 1.000 32.01370  ? 39  LEU A HD22 1 
ATOM   671  H HD23 . LEU A 1 39  ? 11.90268  17.30150 19.48718 1.000 32.01370  ? 39  LEU A HD23 1 
ATOM   672  N N    . SER A 1 40  ? 10.53127  12.47713 21.26934 1.000 21.47395  ? 40  SER A N    1 
ATOM   673  C CA   . SER A 1 40  ? 9.77254   11.62020 22.18704 1.000 21.23387  ? 40  SER A CA   1 
ATOM   674  C C    . SER A 1 40  ? 10.29729  11.66100 23.62058 1.000 26.38718  ? 40  SER A C    1 
ATOM   675  O O    . SER A 1 40  ? 9.50799   11.51238 24.56626 1.000 26.63272  ? 40  SER A O    1 
ATOM   676  C CB   . SER A 1 40  ? 9.79258   10.16087 21.69983 1.000 21.60994  ? 40  SER A CB   1 
ATOM   677  O OG   . SER A 1 40  ? 9.11868   10.06963 20.43089 1.000 24.63324  ? 40  SER A OG   1 
ATOM   678  H H    . SER A 1 40  ? 11.04133  12.04095 20.73158 1.000 25.77362  ? 40  SER A H    1 
ATOM   679  H HA   . SER A 1 40  ? 8.86021   11.94968 22.18825 1.000 25.48552  ? 40  SER A HA   1 
ATOM   680  H HB2  . SER A 1 40  ? 10.71192  9.86906  21.59708 1.000 25.93680  ? 40  SER A HB2  1 
ATOM   681  H HB3  . SER A 1 40  ? 9.33678   9.59990  22.34673 1.000 25.93680  ? 40  SER A HB3  1 
ATOM   682  H HG   . SER A 1 40  ? 9.33861   10.71607 19.94166 1.000 29.56477  ? 40  SER A HG   1 
ATOM   683  N N    . THR A 1 41  ? 11.60457  11.82741 23.83185 1.000 24.54559  ? 41  THR A N    1 
ATOM   684  C CA   . THR A 1 41  ? 12.08599  11.92950 25.19524 1.000 25.85078  ? 41  THR A CA   1 
ATOM   685  C C    . THR A 1 41  ? 12.02723  13.33352 25.73950 1.000 30.02324  ? 41  THR A C    1 
ATOM   686  O O    . THR A 1 41  ? 12.07837  13.51784 26.97053 1.000 33.15508  ? 41  THR A O    1 
ATOM   687  C CB   . THR A 1 41  ? 13.53327  11.45743 25.31921 1.000 28.00859  ? 41  THR A CB   1 
ATOM   688  O OG1  . THR A 1 41  ? 14.36977  12.35782 24.60635 1.000 28.73615  ? 41  THR A OG1  1 
ATOM   689  C CG2  . THR A 1 41  ? 13.66051  10.01082 24.81555 1.000 30.31860  ? 41  THR A CG2  1 
ATOM   690  H H    . THR A 1 41  ? 12.20569  11.88140 23.21920 1.000 29.45959  ? 41  THR A H    1 
ATOM   691  H HA   . THR A 1 41  ? 11.52876  11.34696 25.73472 1.000 31.02581  ? 41  THR A HA   1 
ATOM   692  H HB   . THR A 1 41  ? 13.82747  11.44986 26.24349 1.000 33.61519  ? 41  THR A HB   1 
ATOM   693  H HG1  . THR A 1 41  ? 14.47959  12.08592 23.81919 1.000 34.48826  ? 41  THR A HG1  1 
ATOM   694  H HG21 . THR A 1 41  ? 14.57129  9.69797  24.93175 1.000 36.38721  ? 41  THR A HG21 1 
ATOM   695  H HG22 . THR A 1 41  ? 13.06283  9.43210  25.31430 1.000 36.38721  ? 41  THR A HG22 1 
ATOM   696  H HG23 . THR A 1 41  ? 13.42981  9.96568  23.87447 1.000 36.38721  ? 41  THR A HG23 1 
ATOM   697  N N    . GLY A 1 42  ? 11.95768  14.31847 24.85813 1.000 26.44897  ? 42  GLY A N    1 
ATOM   698  C CA   . GLY A 1 42  ? 12.00915  15.70318 25.26559 1.000 28.44876  ? 42  GLY A CA   1 
ATOM   699  C C    . GLY A 1 42  ? 13.37381  16.20229 25.64599 1.000 33.00543  ? 42  GLY A C    1 
ATOM   700  O O    . GLY A 1 42  ? 13.46213  17.30431 26.18068 1.000 35.84319  ? 42  GLY A O    1 
ATOM   701  H H    . GLY A 1 42  ? 11.87954  14.20557 24.00916 1.000 31.74364  ? 42  GLY A H    1 
ATOM   702  H HA2  . GLY A 1 42  ? 11.68649  16.25357 24.53492 1.000 34.14340  ? 42  GLY A HA2  1 
ATOM   703  H HA3  . GLY A 1 42  ? 11.42676  15.82269 26.03203 1.000 34.14340  ? 42  GLY A HA3  1 
ATOM   704  N N    . GLU A 1 43  ? 14.43642  15.43903 25.36588 1.000 29.65180  ? 43  GLU A N    1 
ATOM   705  C CA   . GLU A 1 43  ? 15.74021  15.72947 25.92413 1.000 29.77695  ? 43  GLU A CA   1 
ATOM   706  C C    . GLU A 1 43  ? 16.35115  17.02789 25.43356 1.000 32.61404  ? 43  GLU A C    1 
ATOM   707  O O    . GLU A 1 43  ? 17.25603  17.53812 26.10883 1.000 36.40986  ? 43  GLU A O    1 
ATOM   708  C CB   . GLU A 1 43  ? 16.70952  14.56553 25.70194 1.000 36.35487  ? 43  GLU A CB   1 
ATOM   709  C CG   . GLU A 1 43  ? 17.03929  14.24845 24.27078 1.000 37.85364  ? 43  GLU A CG   1 
ATOM   710  C CD   . GLU A 1 43  ? 17.63549  12.86814 24.17319 1.000 40.52376  ? 43  GLU A CD   1 
ATOM   711  O OE1  . GLU A 1 43  ? 16.94715  11.87275 24.52984 1.000 36.46008  ? 43  GLU A OE1  1 
ATOM   712  O OE2  . GLU A 1 43  ? 18.79913  12.76599 23.77300 1.000 38.85980  ? 43  GLU A OE2  1 
ATOM   713  H H    . GLU A 1 43  ? 14.41939  14.74840 24.85368 1.000 35.58704  ? 43  GLU A H    1 
ATOM   714  H HA   . GLU A 1 43  ? 15.61814  15.82693 26.88148 1.000 35.73722  ? 43  GLU A HA   1 
ATOM   715  H HB2  . GLU A 1 43  ? 17.54432  14.77665 26.14852 1.000 43.63072  ? 43  GLU A HB2  1 
ATOM   716  H HB3  . GLU A 1 43  ? 16.31851  13.76703 26.08976 1.000 43.63072  ? 43  GLU A HB3  1 
ATOM   717  H HG2  . GLU A 1 43  ? 16.23106  14.27731 23.73521 1.000 45.42925  ? 43  GLU A HG2  1 
ATOM   718  H HG3  . GLU A 1 43  ? 17.68355  14.89064 23.93400 1.000 45.42925  ? 43  GLU A HG3  1 
ATOM   719  N N    A LYS A 1 44  ? 15.91643  17.56341 24.29686 0.648 34.61979  ? 44  LYS A N    1 
ATOM   720  N N    B LYS A 1 44  ? 15.92272  17.56082 24.29090 0.352 36.05622  ? 44  LYS A N    1 
ATOM   721  C CA   A LYS A 1 44  ? 16.43111  18.84511 23.82763 0.648 36.57496  ? 44  LYS A CA   1 
ATOM   722  C CA   B LYS A 1 44  ? 16.43200  18.84676 23.82754 0.352 37.82100  ? 44  LYS A CA   1 
ATOM   723  C C    A LYS A 1 44  ? 15.60266  20.01369 24.33306 0.648 37.40774  ? 44  LYS A C    1 
ATOM   724  C C    B LYS A 1 44  ? 15.65275  20.01907 24.40113 0.352 37.73599  ? 44  LYS A C    1 
ATOM   725  O O    A LYS A 1 44  ? 15.86714  21.15123 23.93886 0.648 42.64423  ? 44  LYS A O    1 
ATOM   726  O O    B LYS A 1 44  ? 16.02532  21.16872 24.15326 0.352 40.64650  ? 44  LYS A O    1 
ATOM   727  C CB   A LYS A 1 44  ? 16.47117  18.89453 22.29291 0.648 41.25961  ? 44  LYS A CB   1 
ATOM   728  C CB   B LYS A 1 44  ? 16.40417  18.93342 22.29332 0.352 41.50333  ? 44  LYS A CB   1 
ATOM   729  C CG   A LYS A 1 44  ? 16.79648  17.58352 21.59691 0.648 46.22596  ? 44  LYS A CG   1 
ATOM   730  C CG   B LYS A 1 44  ? 17.12715  17.81543 21.55480 0.352 45.19670  ? 44  LYS A CG   1 
ATOM   731  C CD   A LYS A 1 44  ? 18.18344  17.04560 21.94980 0.648 48.50645  ? 44  LYS A CD   1 
ATOM   732  C CD   B LYS A 1 44  ? 18.58239  17.66012 21.98513 0.352 49.96325  ? 44  LYS A CD   1 
ATOM   733  C CE   A LYS A 1 44  ? 19.19191  17.29023 20.84111 0.648 54.50120  ? 44  LYS A CE   1 
ATOM   734  C CE   B LYS A 1 44  ? 19.57422  17.87172 20.83517 0.352 54.25610  ? 44  LYS A CE   1 
ATOM   735  N NZ   A LYS A 1 44  ? 20.57922  16.81925 21.21649 0.648 51.16061  ? 44  LYS A NZ   1 
ATOM   736  N NZ   B LYS A 1 44  ? 19.93557  19.30355 20.58268 0.352 53.20800  ? 44  LYS A NZ   1 
ATOM   737  H H    A LYS A 1 44  ? 15.32710  17.20524 23.78305 0.648 41.54863  ? 44  LYS A H    1 
ATOM   738  H H    B LYS A 1 44  ? 15.34147  17.19807 23.77113 0.352 43.27235  ? 44  LYS A H    1 
ATOM   739  H HA   A LYS A 1 44  ? 17.34250  18.93970 24.14593 0.648 43.89483  ? 44  LYS A HA   1 
ATOM   740  H HA   B LYS A 1 44  ? 17.35853  18.91883 24.10549 0.352 45.39009  ? 44  LYS A HA   1 
ATOM   741  H HB2  A LYS A 1 44  ? 15.60024  19.18004 21.97532 0.648 49.51641  ? 44  LYS A HB2  1 
ATOM   742  H HB2  B LYS A 1 44  ? 15.47829  18.91715 22.00458 0.352 49.80888  ? 44  LYS A HB2  1 
ATOM   743  H HB3  A LYS A 1 44  ? 17.14802  19.53654 22.02721 0.648 49.51641  ? 44  LYS A HB3  1 
ATOM   744  H HB3  B LYS A 1 44  ? 16.81969  19.76891 22.02835 0.352 49.80888  ? 44  LYS A HB3  1 
ATOM   745  H HG2  A LYS A 1 44  ? 16.14254  16.91674 21.85896 0.648 55.47603  ? 44  LYS A HG2  1 
ATOM   746  H HG2  B LYS A 1 44  ? 16.67299  16.97639 21.72988 0.352 54.24092  ? 44  LYS A HG2  1 
ATOM   747  H HG3  A LYS A 1 44  ? 16.76492  17.71987 20.63706 0.648 55.47603  ? 44  LYS A HG3  1 
ATOM   748  H HG3  B LYS A 1 44  ? 17.11591  18.00663 20.60390 0.352 54.24092  ? 44  LYS A HG3  1 
ATOM   749  H HD2  A LYS A 1 44  ? 18.50263  17.48852 22.75157 0.648 58.21263  ? 44  LYS A HD2  1 
ATOM   750  H HD2  B LYS A 1 44  ? 18.77939  18.31480 22.67323 0.352 59.96078  ? 44  LYS A HD2  1 
ATOM   751  H HD3  A LYS A 1 44  ? 18.12566  16.08902 22.09987 0.648 58.21263  ? 44  LYS A HD3  1 
ATOM   752  H HD3  B LYS A 1 44  ? 18.71475  16.76403 22.33212 0.352 59.96078  ? 44  LYS A HD3  1 
ATOM   753  H HE2  A LYS A 1 44  ? 18.91424  16.80880 20.04612 0.648 65.40632  ? 44  LYS A HE2  1 
ATOM   754  H HE2  B LYS A 1 44  ? 20.39366  17.39537 21.04137 0.352 65.11220  ? 44  LYS A HE2  1 
ATOM   755  H HE3  A LYS A 1 44  ? 19.23584  18.24114 20.65471 0.648 65.40632  ? 44  LYS A HE3  1 
ATOM   756  H HE3  B LYS A 1 44  ? 19.18268  17.52088 20.02000 0.352 65.11220  ? 44  LYS A HE3  1 
ATOM   757  H HZ1  A LYS A 1 44  ? 21.16606  17.07884 20.59979 0.648 61.39762  ? 44  LYS A HZ1  1 
ATOM   758  H HZ1  B LYS A 1 44  ? 20.32223  19.65179 21.30471 0.352 63.85448  ? 44  LYS A HZ1  1 
ATOM   759  H HZ2  A LYS A 1 44  ? 20.81515  17.16332 22.00266 0.648 61.39762  ? 44  LYS A HZ2  1 
ATOM   760  H HZ2  B LYS A 1 44  ? 20.50082  19.35855 19.89743 0.352 63.85448  ? 44  LYS A HZ2  1 
ATOM   761  H HZ3  A LYS A 1 44  ? 20.59410  15.93122 21.27369 0.648 61.39762  ? 44  LYS A HZ3  1 
ATOM   762  H HZ3  B LYS A 1 44  ? 19.20394  19.77307 20.39201 0.352 63.85448  ? 44  LYS A HZ3  1 
ATOM   763  N N    . GLY A 1 45  ? 14.59135  19.76626 25.16369 1.000 34.44937  ? 45  GLY A N    1 
ATOM   764  C CA   . GLY A 1 45  ? 13.82465  20.82591 25.78189 1.000 38.50166  ? 45  GLY A CA   1 
ATOM   765  C C    . GLY A 1 45  ? 12.48392  21.08988 25.12705 1.000 38.11861  ? 45  GLY A C    1 
ATOM   766  O O    . GLY A 1 45  ? 11.76081  21.99185 25.56807 1.000 37.36904  ? 45  GLY A O    1 
ATOM   767  H H    . GLY A 1 45  ? 14.32983  18.97750 25.38519 1.000 41.34413  ? 45  GLY A H    1 
ATOM   768  H HA2  . GLY A 1 45  ? 13.66277  20.59436 26.70983 1.000 46.20687  ? 45  GLY A HA2  1 
ATOM   769  H HA3  . GLY A 1 45  ? 14.34044  21.64665 25.74656 1.000 46.20687  ? 45  GLY A HA3  1 
ATOM   770  N N    . PHE A 1 46  ? 12.13828  20.33846 24.08281 1.000 30.87761  ? 46  PHE A N    1 
ATOM   771  C CA   . PHE A 1 46  ? 10.85386  20.42672 23.41724 1.000 28.99959  ? 46  PHE A CA   1 
ATOM   772  C C    . PHE A 1 46  ? 10.55415  19.05453 22.81056 1.000 26.45114  ? 46  PHE A C    1 
ATOM   773  O O    . PHE A 1 46  ? 11.44575  18.23171 22.65420 1.000 29.06096  ? 46  PHE A O    1 
ATOM   774  C CB   . PHE A 1 46  ? 10.83254  21.49440 22.32716 1.000 30.68040  ? 46  PHE A CB   1 
ATOM   775  C CG   . PHE A 1 46  ? 11.95062  21.39714 21.29629 1.000 28.68139  ? 46  PHE A CG   1 
ATOM   776  C CD1  . PHE A 1 46  ? 13.18175  21.99928 21.54725 1.000 36.27155  ? 46  PHE A CD1  1 
ATOM   777  C CD2  . PHE A 1 46  ? 11.77373  20.78787 20.07277 1.000 29.06876  ? 46  PHE A CD2  1 
ATOM   778  C CE1  . PHE A 1 46  ? 14.19630  21.94370 20.62873 1.000 37.78950  ? 46  PHE A CE1  1 
ATOM   779  C CE2  . PHE A 1 46  ? 12.80182  20.74891 19.13312 1.000 33.63117  ? 46  PHE A CE2  1 
ATOM   780  C CZ   . PHE A 1 46  ? 14.01713  21.34033 19.42186 1.000 38.35833  ? 46  PHE A CZ   1 
ATOM   781  H H    . PHE A 1 46  ? 12.65525  19.74790 23.73127 1.000 37.05801  ? 46  PHE A H    1 
ATOM   782  H HA   . PHE A 1 46  ? 10.16979  20.65859 24.06469 1.000 34.80439  ? 46  PHE A HA   1 
ATOM   783  H HB2  . PHE A 1 46  ? 9.99145   21.42609 21.84883 1.000 36.82136  ? 46  PHE A HB2  1 
ATOM   784  H HB3  . PHE A 1 46  ? 10.90400  22.36443 22.75005 1.000 36.82136  ? 46  PHE A HB3  1 
ATOM   785  H HD1  . PHE A 1 46  ? 13.31686  22.44623 22.35154 1.000 43.53074  ? 46  PHE A HD1  1 
ATOM   786  H HD2  . PHE A 1 46  ? 10.95467  20.39629 19.87101 1.000 34.88740  ? 46  PHE A HD2  1 
ATOM   787  H HE1  . PHE A 1 46  ? 15.02010  22.32399 20.83277 1.000 45.35228  ? 46  PHE A HE1  1 
ATOM   788  H HE2  . PHE A 1 46  ? 12.67077  20.32664 18.31494 1.000 40.36229  ? 46  PHE A HE2  1 
ATOM   789  H HZ   . PHE A 1 46  ? 14.70611  21.32618 18.79735 1.000 46.03488  ? 46  PHE A HZ   1 
ATOM   790  N N    . GLY A 1 47  ? 9.30063   18.82554 22.43114 1.000 26.38531  ? 47  GLY A N    1 
ATOM   791  C CA   . GLY A 1 47  ? 8.94344   17.52001 21.87444 1.000 24.24558  ? 47  GLY A CA   1 
ATOM   792  C C    . GLY A 1 47  ? 7.45429   17.23827 21.97942 1.000 22.36410  ? 47  GLY A C    1 
ATOM   793  O O    . GLY A 1 47  ? 6.62266   18.14135 22.11062 1.000 23.71622  ? 47  GLY A O    1 
ATOM   794  H H    . GLY A 1 47  ? 8.65520   19.39152 22.48312 1.000 31.66726  ? 47  GLY A H    1 
ATOM   795  H HA2  . GLY A 1 47  ? 9.19516   17.48912 20.93818 1.000 29.09957  ? 47  GLY A HA2  1 
ATOM   796  H HA3  . GLY A 1 47  ? 9.42070   16.82416 22.35290 1.000 29.09957  ? 47  GLY A HA3  1 
ATOM   797  N N    . TYR A 1 48  ? 7.15265   15.97664 21.88940 1.000 21.35157  ? 48  TYR A N    1 
ATOM   798  C CA   . TYR A 1 48  ? 5.79584   15.55139 21.62340 1.000 20.10266  ? 48  TYR A CA   1 
ATOM   799  C C    . TYR A 1 48  ? 4.89324   15.49369 22.83456 1.000 20.07610  ? 48  TYR A C    1 
ATOM   800  O O    . TYR A 1 48  ? 3.68118   15.43175 22.66934 1.000 21.20182  ? 48  TYR A O    1 
ATOM   801  C CB   . TYR A 1 48  ? 5.80567   14.18158 20.97773 1.000 20.58565  ? 48  TYR A CB   1 
ATOM   802  C CG   . TYR A 1 48  ? 6.42014   14.10406 19.58719 1.000 18.95587  ? 48  TYR A CG   1 
ATOM   803  C CD1  . TYR A 1 48  ? 6.08175   15.04490 18.63784 1.000 19.60305  ? 48  TYR A CD1  1 
ATOM   804  C CD2  . TYR A 1 48  ? 7.22945   13.06045 19.24080 1.000 19.25718  ? 48  TYR A CD2  1 
ATOM   805  C CE1  . TYR A 1 48  ? 6.62514   14.97219 17.34653 1.000 20.53544  ? 48  TYR A CE1  1 
ATOM   806  C CE2  . TYR A 1 48  ? 7.77478   12.97185 17.92816 1.000 21.46873  ? 48  TYR A CE2  1 
ATOM   807  C CZ   . TYR A 1 48  ? 7.42828   13.93116 17.01802 1.000 19.46171  ? 48  TYR A CZ   1 
ATOM   808  O OH   . TYR A 1 48  ? 8.02209   13.76718 15.75663 1.000 21.43280  ? 48  TYR A OH   1 
ATOM   809  H H    . TYR A 1 48  ? 7.71522   15.33222 21.97797 1.000 25.62677  ? 48  TYR A H    1 
ATOM   810  H HA   . TYR A 1 48  ? 5.41407   16.20390 21.01563 1.000 24.12807  ? 48  TYR A HA   1 
ATOM   811  H HB2  . TYR A 1 48  ? 6.31082   13.58120 21.54806 1.000 24.70767  ? 48  TYR A HB2  1 
ATOM   812  H HB3  . TYR A 1 48  ? 4.88843   13.87497 20.90315 1.000 24.70767  ? 48  TYR A HB3  1 
ATOM   813  H HD1  . TYR A 1 48  ? 5.49127   15.73004 18.85425 1.000 23.52854  ? 48  TYR A HD1  1 
ATOM   814  H HD2  . TYR A 1 48  ? 7.42627   12.40191 19.86728 1.000 23.11350  ? 48  TYR A HD2  1 
ATOM   815  H HE1  . TYR A 1 48  ? 6.43566   15.63341 16.72060 1.000 24.64741  ? 48  TYR A HE1  1 
ATOM   816  H HE2  . TYR A 1 48  ? 8.35122   12.27983 17.69637 1.000 25.76736  ? 48  TYR A HE2  1 
ATOM   817  H HH   . TYR A 1 48  ? 8.73144   14.21494 15.71263 1.000 25.72424  ? 48  TYR A HH   1 
ATOM   818  N N    . LYS A 1 49  ? 5.43897   15.45166 24.05276 1.000 20.51185  ? 49  LYS A N    1 
ATOM   819  C CA   . LYS A 1 49  ? 4.57514   15.23633 25.21632 1.000 20.51637  ? 49  LYS A CA   1 
ATOM   820  C C    . LYS A 1 49  ? 3.53787   16.35469 25.33918 1.000 22.84928  ? 49  LYS A C    1 
ATOM   821  O O    . LYS A 1 49  ? 3.88003   17.56108 25.32452 1.000 24.88098  ? 49  LYS A O    1 
ATOM   822  C CB   . LYS A 1 49  ? 5.40482   15.16031 26.49071 1.000 21.46841  ? 49  LYS A CB   1 
ATOM   823  C CG   . LYS A 1 49  ? 4.55136   14.88041 27.72827 1.000 24.13343  ? 49  LYS A CG   1 
ATOM   824  C CD   . LYS A 1 49  ? 5.41880   14.62412 28.96602 1.000 29.19930  ? 49  LYS A CD   1 
ATOM   825  C CE   . LYS A 1 49  ? 4.49373   14.24617 30.06598 1.000 37.52210  ? 49  LYS A CE   1 
ATOM   826  N NZ   . LYS A 1 49  ? 5.29446   13.96923 31.27560 1.000 48.02829  ? 49  LYS A NZ   1 
ATOM   827  H H    . LYS A 1 49  ? 6.27639   15.54172 24.22659 1.000 24.61910  ? 49  LYS A H    1 
ATOM   828  H HA   . LYS A 1 49  ? 4.10838   14.39360 25.10306 1.000 24.62453  ? 49  LYS A HA   1 
ATOM   829  H HB2  . LYS A 1 49  ? 6.05386   14.44470 26.40385 1.000 25.76697  ? 49  LYS A HB2  1 
ATOM   830  H HB3  . LYS A 1 49  ? 5.85987   16.00662 26.62333 1.000 25.76697  ? 49  LYS A HB3  1 
ATOM   831  H HG2  . LYS A 1 49  ? 3.98450   15.64693 27.90722 1.000 28.96500  ? 49  LYS A HG2  1 
ATOM   832  H HG3  . LYS A 1 49  ? 4.00585   14.09396 27.57071 1.000 28.96500  ? 49  LYS A HG3  1 
ATOM   833  H HD2  . LYS A 1 49  ? 6.04011   13.89786 28.80041 1.000 35.04404  ? 49  LYS A HD2  1 
ATOM   834  H HD3  . LYS A 1 49  ? 5.90470   15.42684 29.21189 1.000 35.04404  ? 49  LYS A HD3  1 
ATOM   835  H HE2  . LYS A 1 49  ? 3.88094   14.97509 30.25055 1.000 45.03140  ? 49  LYS A HE2  1 
ATOM   836  H HE3  . LYS A 1 49  ? 3.99738   13.44869 29.82400 1.000 45.03140  ? 49  LYS A HE3  1 
ATOM   837  H HZ1  . LYS A 1 49  ? 5.87780   13.31732 31.11184 1.000 57.63883  ? 49  LYS A HZ1  1 
ATOM   838  H HZ2  . LYS A 1 49  ? 5.73936   14.70024 31.52010 1.000 57.63883  ? 49  LYS A HZ2  1 
ATOM   839  H HZ3  . LYS A 1 49  ? 4.76133   13.71888 31.94284 1.000 57.63883  ? 49  LYS A HZ3  1 
ATOM   840  N N    . GLY A 1 50  ? 2.26107   15.97146 25.42081 1.000 21.03399  ? 50  GLY A N    1 
ATOM   841  C CA   . GLY A 1 50  ? 1.16468   16.93310 25.52604 1.000 25.64979  ? 50  GLY A CA   1 
ATOM   842  C C    . GLY A 1 50  ? 0.54215   17.34417 24.21748 1.000 24.21843  ? 50  GLY A C    1 
ATOM   843  O O    . GLY A 1 50  ? -0.53191  17.98725 24.23617 1.000 27.36074  ? 50  GLY A O    1 
ATOM   844  H H    . GLY A 1 50  ? 2.00327   15.15101 25.41706 1.000 25.24567  ? 50  GLY A H    1 
ATOM   845  H HA2  . GLY A 1 50  ? 0.46547   16.54554 26.07541 1.000 30.78463  ? 50  GLY A HA2  1 
ATOM   846  H HA3  . GLY A 1 50  ? 1.49765   17.73520 25.95808 1.000 30.78463  ? 50  GLY A HA3  1 
ATOM   847  N N    . SER A 1 51  ? 1.14628   16.96605 23.09275 1.000 20.33332  ? 51  SER A N    1 
ATOM   848  C CA   . SER A 1 51  ? 0.68565   17.36888 21.77880 1.000 19.79122  ? 51  SER A CA   1 
ATOM   849  C C    . SER A 1 51  ? -0.42823  16.45765 21.30037 1.000 22.75350  ? 51  SER A C    1 
ATOM   850  O O    . SER A 1 51  ? -0.69821  15.39991 21.89500 1.000 23.31105  ? 51  SER A O    1 
ATOM   851  C CB   . SER A 1 51  ? 1.86208   17.37779 20.79641 1.000 22.10414  ? 51  SER A CB   1 
ATOM   852  O OG   . SER A 1 51  ? 2.29409   16.09278 20.45158 1.000 22.49260  ? 51  SER A OG   1 
ATOM   853  H H    . SER A 1 51  ? 1.84318   16.46269 23.06888 1.000 24.40487  ? 51  SER A H    1 
ATOM   854  H HA   . SER A 1 51  ? 0.32284   18.26760 21.81848 1.000 23.75434  ? 51  SER A HA   1 
ATOM   855  H HB2  . SER A 1 51  ? 1.58386   17.83578 19.98787 1.000 26.52985  ? 51  SER A HB2  1 
ATOM   856  H HB3  . SER A 1 51  ? 2.60234   17.85086 21.20766 1.000 26.52985  ? 51  SER A HB3  1 
ATOM   857  H HG   . SER A 1 51  ? 2.89812   15.84169 20.97855 1.000 26.99600  ? 51  SER A HG   1 
ATOM   858  N N    . CYS A 1 52  ? -1.13825  16.88569 20.26867 1.000 21.13361  ? 52  CYS A N    1 
ATOM   859  C CA   . CYS A 1 52  ? -2.30494  16.14326 19.79756 1.000 23.00785  ? 52  CYS A CA   1 
ATOM   860  C C    . CYS A 1 52  ? -2.11608  15.55734 18.40800 1.000 23.18978  ? 52  CYS A C    1 
ATOM   861  O O    . CYS A 1 52  ? -1.21611  15.91946 17.64979 1.000 23.67721  ? 52  CYS A O    1 
ATOM   862  C CB   . CYS A 1 52  ? -3.54198  17.01041 19.75634 1.000 23.33121  ? 52  CYS A CB   1 
ATOM   863  S SG   . CYS A 1 52  ? -3.68170  18.18167 18.35295 1.000 32.74280  ? 52  CYS A SG   1 
ATOM   864  H H    . CYS A 1 52  ? -0.96689  17.60160 19.82402 1.000 25.36522  ? 52  CYS A H    1 
ATOM   865  H HA   . CYS A 1 52  ? -2.41899  15.41556 20.42872 1.000 27.61430  ? 52  CYS A HA   1 
ATOM   866  H HB2  . CYS A 1 52  ? -4.31608  16.42722 19.71693 1.000 28.00234  ? 52  CYS A HB2  1 
ATOM   867  H HB3  . CYS A 1 52  ? -3.56551  17.53849 20.56965 1.000 28.00234  ? 52  CYS A HB3  1 
ATOM   868  H HG   . CYS A 1 52  ? -2.69124  18.85766 18.30817 1.000 39.29624  ? 52  CYS A HG   1 
ATOM   869  N N    . PHE A 1 53  ? -3.02070  14.64323 18.09312 1.000 20.87101  ? 53  PHE A N    1 
ATOM   870  C CA   . PHE A 1 53  ? -3.18204  14.13036 16.73202 1.000 21.10392  ? 53  PHE A CA   1 
ATOM   871  C C    . PHE A 1 53  ? -4.27323  14.96515 16.09559 1.000 23.36902  ? 53  PHE A C    1 
ATOM   872  O O    . PHE A 1 53  ? -5.45597  14.81473 16.44038 1.000 27.55357  ? 53  PHE A O    1 
ATOM   873  C CB   . PHE A 1 53  ? -3.56447  12.64437 16.73387 1.000 21.75426  ? 53  PHE A CB   1 
ATOM   874  C CG   . PHE A 1 53  ? -2.42780  11.70916 16.96276 1.000 20.71292  ? 53  PHE A CG   1 
ATOM   875  C CD1  . PHE A 1 53  ? -1.93179  11.40702 18.24848 1.000 22.73290  ? 53  PHE A CD1  1 
ATOM   876  C CD2  . PHE A 1 53  ? -1.81074  11.12216 15.87083 1.000 22.27085  ? 53  PHE A CD2  1 
ATOM   877  C CE1  . PHE A 1 53  ? -0.87651  10.57117 18.40229 1.000 24.28769  ? 53  PHE A CE1  1 
ATOM   878  C CE2  . PHE A 1 53  ? -0.76590  10.27943 16.02439 1.000 24.30406  ? 53  PHE A CE2  1 
ATOM   879  C CZ   . PHE A 1 53  ? -0.26218  9.99452  17.27029 1.000 26.30806  ? 53  PHE A CZ   1 
ATOM   880  H H    . PHE A 1 53  ? -3.56653  14.29423 18.65869 1.000 25.05010  ? 53  PHE A H    1 
ATOM   881  H HA   . PHE A 1 53  ? -2.35185  14.21323 16.23724 1.000 25.32958  ? 53  PHE A HA   1 
ATOM   882  H HB2  . PHE A 1 53  ? -4.21297  12.49392 17.43936 1.000 26.10999  ? 53  PHE A HB2  1 
ATOM   883  H HB3  . PHE A 1 53  ? -3.95399  12.42532 15.87295 1.000 26.10999  ? 53  PHE A HB3  1 
ATOM   884  H HD1  . PHE A 1 53  ? -2.33292  11.78511 18.99751 1.000 27.28436  ? 53  PHE A HD1  1 
ATOM   885  H HD2  . PHE A 1 53  ? -2.12160  11.31173 15.01507 1.000 26.72991  ? 53  PHE A HD2  1 
ATOM   886  H HE1  . PHE A 1 53  ? -0.55704  10.37750 19.25395 1.000 29.15011  ? 53  PHE A HE1  1 
ATOM   887  H HE2  . PHE A 1 53  ? -0.38152  9.88588  15.27454 1.000 29.16975  ? 53  PHE A HE2  1 
ATOM   888  H HZ   . PHE A 1 53  ? 0.47144   9.43102  17.36612 1.000 31.57455  ? 53  PHE A HZ   1 
ATOM   889  N N    . HIS A 1 54  ? -3.90621  15.83390 15.15179 1.000 20.26890  ? 54  HIS A N    1 
ATOM   890  C CA   . HIS A 1 54  ? -4.84704  16.80167 14.63854 1.000 20.78331  ? 54  HIS A CA   1 
ATOM   891  C C    . HIS A 1 54  ? -5.62762  16.32678 13.41978 1.000 22.92253  ? 54  HIS A C    1 
ATOM   892  O O    . HIS A 1 54  ? -6.61751  16.97704 13.05633 1.000 25.02996  ? 54  HIS A O    1 
ATOM   893  C CB   . HIS A 1 54  ? -4.13175  18.10764 14.29406 1.000 25.13349  ? 54  HIS A CB   1 
ATOM   894  C CG   . HIS A 1 54  ? -3.15069  17.97114 13.17859 1.000 24.47996  ? 54  HIS A CG   1 
ATOM   895  N ND1  . HIS A 1 54  ? -1.86263  17.53595 13.38995 1.000 24.72582  ? 54  HIS A ND1  1 
ATOM   896  C CD2  . HIS A 1 54  ? -3.27120  18.19756 11.84446 1.000 24.80842  ? 54  HIS A CD2  1 
ATOM   897  C CE1  . HIS A 1 54  ? -1.23497  17.47139 12.22351 1.000 27.09702  ? 54  HIS A CE1  1 
ATOM   898  N NE2  . HIS A 1 54  ? -2.06730  17.86555 11.27404 1.000 25.76071  ? 54  HIS A NE2  1 
ATOM   899  H H    . HIS A 1 54  ? -3.12168  15.87439 14.80183 1.000 24.32756  ? 54  HIS A H    1 
ATOM   900  H HA   . HIS A 1 54  ? -5.49188  16.98292 15.34013 1.000 24.94485  ? 54  HIS A HA   1 
ATOM   901  H HB2  . HIS A 1 54  ? -4.79288  18.76631 14.02958 1.000 30.16508  ? 54  HIS A HB2  1 
ATOM   902  H HB3  . HIS A 1 54  ? -3.65026  18.41685 15.07729 1.000 30.16508  ? 54  HIS A HB3  1 
ATOM   903  H HD1  . HIS A 1 54  ? -1.52045  17.33811 14.15374 1.000 29.67587  ? 54  HIS A HD1  1 
ATOM   904  H HD2  . HIS A 1 54  ? -4.02473  18.51634 11.40234 1.000 29.77499  ? 54  HIS A HD2  1 
ATOM   905  H HE1  . HIS A 1 54  ? -0.35635  17.19513 12.09461 1.000 32.52130  ? 54  HIS A HE1  1 
ATOM   906  N N    A ARG A 1 55  ? -5.19988  15.23809 12.79265 0.727 20.70150  ? 55  ARG A N    1 
ATOM   907  N N    B ARG A 1 55  ? -5.23650  15.22723 12.77719 0.273 20.20936  ? 55  ARG A N    1 
ATOM   908  C CA   A ARG A 1 55  ? -5.81337  14.77564 11.55779 0.727 21.66736  ? 55  ARG A CA   1 
ATOM   909  C CA   B ARG A 1 55  ? -5.89195  14.82213 11.53212 0.273 21.83951  ? 55  ARG A CA   1 
ATOM   910  C C    A ARG A 1 55  ? -5.86714  13.25947 11.60696 0.727 19.86247  ? 55  ARG A C    1 
ATOM   911  C C    B ARG A 1 55  ? -5.88307  13.30116 11.43612 0.273 20.47634  ? 55  ARG A C    1 
ATOM   912  O O    A ARG A 1 55  ? -4.83290  12.59327 11.70220 0.727 21.30030  ? 55  ARG A O    1 
ATOM   913  O O    B ARG A 1 55  ? -4.82691  12.70260 11.17607 0.273 18.67616  ? 55  ARG A O    1 
ATOM   914  C CB   A ARG A 1 55  ? -5.02980  15.28458 10.30936 0.727 24.59545  ? 55  ARG A CB   1 
ATOM   915  C CB   B ARG A 1 55  ? -5.19745  15.46823 10.31762 0.273 24.41958  ? 55  ARG A CB   1 
ATOM   916  C CG   A ARG A 1 55  ? -5.69020  14.96098 8.98595  0.727 26.56417  ? 55  ARG A CG   1 
ATOM   917  C CG   B ARG A 1 55  ? -5.82275  15.17407 8.95205  0.273 28.83488  ? 55  ARG A CG   1 
ATOM   918  C CD   A ARG A 1 55  ? -4.93768  15.69983 7.83049  0.727 30.37640  ? 55  ARG A CD   1 
ATOM   919  C CD   B ARG A 1 55  ? -5.11221  16.00846 7.86993  0.273 33.33748  ? 55  ARG A CD   1 
ATOM   920  N NE   A ARG A 1 55  ? -5.77940  15.78180 6.62153  0.727 41.61880  ? 55  ARG A NE   1 
ATOM   921  N NE   B ARG A 1 55  ? -4.65455  15.22319 6.71640  0.273 43.64690  ? 55  ARG A NE   1 
ATOM   922  C CZ   A ARG A 1 55  ? -5.53138  15.20549 5.44821  0.727 52.96265  ? 55  ARG A CZ   1 
ATOM   923  C CZ   B ARG A 1 55  ? -5.25475  15.17717 5.52759  0.273 49.61819  ? 55  ARG A CZ   1 
ATOM   924  N NH1  A ARG A 1 55  ? -6.40395  15.39037 4.45922  0.727 45.82163  ? 55  ARG A NH1  1 
ATOM   925  N NH1  B ARG A 1 55  ? -4.73159  14.43461 4.55020  0.273 49.35950  ? 55  ARG A NH1  1 
ATOM   926  N NH2  A ARG A 1 55  ? -4.43759  14.46337 5.23873  0.727 49.04902  ? 55  ARG A NH2  1 
ATOM   927  N NH2  B ARG A 1 55  ? -6.37041  15.86680 5.30067  0.273 51.17062  ? 55  ARG A NH2  1 
ATOM   928  H H    A ARG A 1 55  ? -4.54949  14.74649 13.06636 0.727 24.84668  ? 55  ARG A H    1 
ATOM   929  H H    B ARG A 1 55  ? -4.60364  14.70610 13.03699 0.273 24.25611  ? 55  ARG A H    1 
ATOM   930  H HA   A ARG A 1 55  ? -6.72060  15.11109 11.48501 0.727 26.00571  ? 55  ARG A HA   1 
ATOM   931  H HA   B ARG A 1 55  ? -6.81946  15.10529 11.55312 0.273 26.21229  ? 55  ARG A HA   1 
ATOM   932  H HB2  A ARG A 1 55  ? -4.94614  16.24918 10.36809 0.727 29.51943  ? 55  ARG A HB2  1 
ATOM   933  H HB2  B ARG A 1 55  ? -5.21082  16.43070 10.43749 0.273 29.30837  ? 55  ARG A HB2  1 
ATOM   934  H HB3  A ARG A 1 55  ? -4.15059  14.87484 10.30715 0.727 29.51943  ? 55  ARG A HB3  1 
ATOM   935  H HB3  B ARG A 1 55  ? -4.28151  15.15033 10.28776 0.273 29.30837  ? 55  ARG A HB3  1 
ATOM   936  H HG2  A ARG A 1 55  ? -5.65107  14.00538 8.82410  0.727 31.88189  ? 55  ARG A HG2  1 
ATOM   937  H HG2  B ARG A 1 55  ? -5.72045  14.23322 8.73940  0.273 34.60673  ? 55  ARG A HG2  1 
ATOM   938  H HG3  A ARG A 1 55  ? -6.61357  15.25787 8.99815  0.727 31.88189  ? 55  ARG A HG3  1 
ATOM   939  H HG3  B ARG A 1 55  ? -6.76322  15.41135 8.96311  0.273 34.60673  ? 55  ARG A HG3  1 
ATOM   940  H HD2  A ARG A 1 55  ? -4.71667  16.60108 8.11300  0.727 36.45656  ? 55  ARG A HD2  1 
ATOM   941  H HD2  B ARG A 1 55  ? -5.72774  16.68258 7.54194  0.273 40.00986  ? 55  ARG A HD2  1 
ATOM   942  H HD3  A ARG A 1 55  ? -4.12806  15.21361 7.60913  0.727 36.45656  ? 55  ARG A HD3  1 
ATOM   943  H HD3  B ARG A 1 55  ? -4.33449  16.43318 8.26448  0.273 40.00986  ? 55  ARG A HD3  1 
ATOM   944  H HE   A ARG A 1 55  ? -6.50016  16.24717 6.68097  0.727 49.94745  ? 55  ARG A HE   1 
ATOM   945  H HE   B ARG A 1 55  ? -3.94046  14.75449 6.81636  0.273 52.38116  ? 55  ARG A HE   1 
ATOM   946  H HH11 A ARG A 1 55  ? -7.10490  15.87157 4.58856  0.727 54.99083  ? 55  ARG A HH11 1 
ATOM   947  H HH11 B ARG A 1 55  ? -4.00977  13.98811 4.68876  0.273 59.23629  ? 55  ARG A HH11 1 
ATOM   948  H HH12 A ARG A 1 55  ? -6.26647  15.02857 3.69124  0.727 54.99083  ? 55  ARG A HH12 1 
ATOM   949  H HH12 B ARG A 1 55  ? -5.11622  14.40253 3.78167  0.273 59.23629  ? 55  ARG A HH12 1 
ATOM   950  H HH21 A ARG A 1 55  ? -3.86891  14.34699 5.87328  0.727 58.86370  ? 55  ARG A HH21 1 
ATOM   951  H HH21 B ARG A 1 55  ? -6.71217  16.34935 5.92513  0.273 61.40963  ? 55  ARG A HH21 1 
ATOM   952  H HH22 A ARG A 1 55  ? -4.30339  14.10285 4.46956  0.727 58.86370  ? 55  ARG A HH22 1 
ATOM   953  H HH22 B ARG A 1 55  ? -6.74947  15.82981 4.52961  0.273 61.40963  ? 55  ARG A HH22 1 
ATOM   954  N N    . ILE A 1 56  ? -7.06315  12.68043 11.58176 1.000 20.20886  ? 56  ILE A N    1 
ATOM   955  C CA   . ILE A 1 56  ? -7.22059  11.22753 11.58864 1.000 20.18204  ? 56  ILE A CA   1 
ATOM   956  C C    . ILE A 1 56  ? -8.26093  10.87008 10.53948 1.000 20.25433  ? 56  ILE A C    1 
ATOM   957  O O    . ILE A 1 56  ? -9.41214  11.29384 10.64662 1.000 22.03949  ? 56  ILE A O    1 
ATOM   958  C CB   . ILE A 1 56  ? -7.64371  10.64971 12.95362 1.000 21.52130  ? 56  ILE A CB   1 
ATOM   959  C CG1  . ILE A 1 56  ? -6.57162  10.99939 13.98525 1.000 23.10465  ? 56  ILE A CG1  1 
ATOM   960  C CG2  . ILE A 1 56  ? -7.84480  9.14613  12.84895 1.000 24.37666  ? 56  ILE A CG2  1 
ATOM   961  C CD1  . ILE A 1 56  ? -6.94665  10.49280 15.41018 1.000 27.38675  ? 56  ILE A CD1  1 
ATOM   962  H H    . ILE A 1 56  ? -7.80828  13.10928 11.56021 1.000 24.25551  ? 56  ILE A H    1 
ATOM   963  H HA   . ILE A 1 56  ? -6.36504  10.83474 11.35486 1.000 24.22333  ? 56  ILE A HA   1 
ATOM   964  H HB   . ILE A 1 56  ? -8.48819  11.03773 13.23144 1.000 25.83044  ? 56  ILE A HB   1 
ATOM   965  H HG12 . ILE A 1 56  ? -5.73335  10.58544 13.72669 1.000 27.73046  ? 56  ILE A HG12 1 
ATOM   966  H HG13 . ILE A 1 56  ? -6.46795  11.96309 14.02314 1.000 27.73046  ? 56  ILE A HG13 1 
ATOM   967  H HG21 . ILE A 1 56  ? -8.10573  8.80121  13.71719 1.000 29.25687  ? 56  ILE A HG21 1 
ATOM   968  H HG22 . ILE A 1 56  ? -8.54105  8.96517  12.19827 1.000 29.25687  ? 56  ILE A HG22 1 
ATOM   969  H HG23 . ILE A 1 56  ? -7.01290  8.73518  12.56616 1.000 29.25687  ? 56  ILE A HG23 1 
ATOM   970  H HD11 . ILE A 1 56  ? -6.35594  10.90734 16.05834 1.000 32.86898  ? 56  ILE A HD11 1 
ATOM   971  H HD12 . ILE A 1 56  ? -7.86685  10.73446 15.59923 1.000 32.86898  ? 56  ILE A HD12 1 
ATOM   972  H HD13 . ILE A 1 56  ? -6.84520  9.52856  15.43939 1.000 32.86898  ? 56  ILE A HD13 1 
ATOM   973  N N    . ILE A 1 57  ? -7.83458  10.11135 9.53849  1.000 20.15381  ? 57  ILE A N    1 
ATOM   974  C CA   . ILE A 1 57  ? -8.72490  9.69620  8.46714  1.000 21.34626  ? 57  ILE A CA   1 
ATOM   975  C C    . ILE A 1 57  ? -8.81444  8.18853  8.47776  1.000 21.57113  ? 57  ILE A C    1 
ATOM   976  O O    . ILE A 1 57  ? -7.84835  7.51304  8.15209  1.000 21.04055  ? 57  ILE A O    1 
ATOM   977  C CB   . ILE A 1 57  ? -8.23596  10.19456 7.09775  1.000 21.59453  ? 57  ILE A CB   1 
ATOM   978  C CG1  . ILE A 1 57  ? -8.18076  11.71563 7.10362  1.000 24.02668  ? 57  ILE A CG1  1 
ATOM   979  C CG2  . ILE A 1 57  ? -9.18673  9.72868  5.99705  1.000 23.07650  ? 57  ILE A CG2  1 
ATOM   980  C CD1  . ILE A 1 57  ? -7.47260  12.32830 5.92443  1.000 28.83750  ? 57  ILE A CD1  1 
ATOM   981  H H    . ILE A 1 57  ? -7.02845  9.82279  9.45790  1.000 24.18796  ? 57  ILE A H    1 
ATOM   982  H HA   . ILE A 1 57  ? -9.60484  10.07006 8.63097  1.000 25.59110  ? 57  ILE A HA   1 
ATOM   983  H HB   . ILE A 1 57  ? -7.35180  9.83234  6.93055  1.000 25.88903  ? 57  ILE A HB   1 
ATOM   984  H HG12 . ILE A 1 57  ? -9.08895  12.05632 7.10715  1.000 28.83690  ? 57  ILE A HG12 1 
ATOM   985  H HG13 . ILE A 1 57  ? -7.71536  12.00340 7.90456  1.000 28.83690  ? 57  ILE A HG13 1 
ATOM   986  H HG21 . ILE A 1 57  ? -8.92218  10.13659 5.15770  1.000 27.66739  ? 57  ILE A HG21 1 
ATOM   987  H HG22 . ILE A 1 57  ? -9.13757  8.76259  5.92531  1.000 27.66739  ? 57  ILE A HG22 1 
ATOM   988  H HG23 . ILE A 1 57  ? -10.09023 9.99786  6.22536  1.000 27.66739  ? 57  ILE A HG23 1 
ATOM   989  H HD11 . ILE A 1 57  ? -7.54885  13.29387 5.97706  1.000 34.60988  ? 57  ILE A HD11 1 
ATOM   990  H HD12 . ILE A 1 57  ? -6.53831  12.06854 5.94728  1.000 34.60988  ? 57  ILE A HD12 1 
ATOM   991  H HD13 . ILE A 1 57  ? -7.88509  12.00799 5.10703  1.000 34.60988  ? 57  ILE A HD13 1 
ATOM   992  N N    . PRO A 1 58  ? -9.93179  7.62145  8.91509  1.000 22.60805  ? 58  PRO A N    1 
ATOM   993  C CA   . PRO A 1 58  ? -10.04929 6.17877  8.98173  1.000 23.16585  ? 58  PRO A CA   1 
ATOM   994  C C    . PRO A 1 58  ? -9.81262  5.52402  7.63272  1.000 24.11475  ? 58  PRO A C    1 
ATOM   995  O O    . PRO A 1 58  ? -10.29409 5.99671  6.58704  1.000 26.67761  ? 58  PRO A O    1 
ATOM   996  C CB   . PRO A 1 58  ? -11.48329 5.95329  9.48501  1.000 25.78558  ? 58  PRO A CB   1 
ATOM   997  C CG   . PRO A 1 58  ? -11.86553 7.21820  10.12510 1.000 30.81944  ? 58  PRO A CG   1 
ATOM   998  C CD   . PRO A 1 58  ? -11.15266 8.30584  9.37424  1.000 24.69036  ? 58  PRO A CD   1 
ATOM   999  H HA   . PRO A 1 58  ? -9.41791  5.82033  9.62499  1.000 27.77460  ? 58  PRO A HA   1 
ATOM   1000 H HB2  . PRO A 1 58  ? -12.06764 5.75225  8.73734  1.000 30.94757  ? 58  PRO A HB2  1 
ATOM   1001 H HB3  . PRO A 1 58  ? -11.49802 5.22304  10.12330 1.000 30.94757  ? 58  PRO A HB3  1 
ATOM   1002 H HG2  . PRO A 1 58  ? -12.82658 7.33523  10.06518 1.000 36.98821  ? 58  PRO A HG2  1 
ATOM   1003 H HG3  . PRO A 1 58  ? -11.58989 7.20804  11.05505 1.000 36.98821  ? 58  PRO A HG3  1 
ATOM   1004 H HD2  . PRO A 1 58  ? -11.68220 8.61634  8.62319  1.000 29.63332  ? 58  PRO A HD2  1 
ATOM   1005 H HD3  . PRO A 1 58  ? -10.93715 9.04970  9.95829  1.000 29.63332  ? 58  PRO A HD3  1 
ATOM   1006 N N    . GLY A 1 59  ? -9.04696  4.44395  7.68145  1.000 25.61203  ? 59  GLY A N    1 
ATOM   1007 C CA   . GLY A 1 59  ? -8.69597  3.73646  6.46709  1.000 28.48838  ? 59  GLY A CA   1 
ATOM   1008 C C    . GLY A 1 59  ? -7.57258  4.39413  5.70250  1.000 26.35091  ? 59  GLY A C    1 
ATOM   1009 O O    . GLY A 1 59  ? -7.34723  4.06303  4.53396  1.000 27.59827  ? 59  GLY A O    1 
ATOM   1010 H H    . GLY A 1 59  ? -8.72157  4.10511  8.40180  1.000 30.73932  ? 59  GLY A H    1 
ATOM   1011 H HA2  . GLY A 1 59  ? -8.42149  2.83405  6.69339  1.000 34.19094  ? 59  GLY A HA2  1 
ATOM   1012 H HA3  . GLY A 1 59  ? -9.47315  3.69435  5.88820  1.000 34.19094  ? 59  GLY A HA3  1 
ATOM   1013 N N    . PHE A 1 60  ? -6.88152  5.32715  6.32264  1.000 22.20643  ? 60  PHE A N    1 
ATOM   1014 C CA   . PHE A 1 60  ? -5.75285  5.99769  5.69446  1.000 21.52168  ? 60  PHE A CA   1 
ATOM   1015 C C    . PHE A 1 60  ? -4.61970  6.22156  6.68794  1.000 20.31715  ? 60  PHE A C    1 
ATOM   1016 O O    . PHE A 1 60  ? -3.59485  5.51952  6.61550  1.000 20.67006  ? 60  PHE A O    1 
ATOM   1017 C CB   . PHE A 1 60  ? -6.22656  7.30499  5.02424  1.000 22.62913  ? 60  PHE A CB   1 
ATOM   1018 C CG   . PHE A 1 60  ? -5.16769  8.10500  4.35776  1.000 21.77068  ? 60  PHE A CG   1 
ATOM   1019 C CD1  . PHE A 1 60  ? -3.96699  7.53793  3.94310  1.000 21.93472  ? 60  PHE A CD1  1 
ATOM   1020 C CD2  . PHE A 1 60  ? -5.38049  9.44340  4.09265  1.000 23.96057  ? 60  PHE A CD2  1 
ATOM   1021 C CE1  . PHE A 1 60  ? -2.99907  8.29649  3.30425  1.000 25.77251  ? 60  PHE A CE1  1 
ATOM   1022 C CE2  . PHE A 1 60  ? -4.41472  10.19668 3.47801  1.000 26.49633  ? 60  PHE A CE2  1 
ATOM   1023 C CZ   . PHE A 1 60  ? -3.24914  9.63607  3.06929  1.000 25.63660  ? 60  PHE A CZ   1 
ATOM   1024 H H    . PHE A 1 60  ? -7.04495  5.59851  7.12217  1.000 26.65260  ? 60  PHE A H    1 
ATOM   1025 H HA   . PHE A 1 60  ? -5.38290  5.43787  4.99401  1.000 25.80161  ? 60  PHE A HA   1 
ATOM   1026 H HB2  . PHE A 1 60  ? -6.88548  7.07976  4.34896  1.000 27.15983  ? 60  PHE A HB2  1 
ATOM   1027 H HB3  . PHE A 1 60  ? -6.62784  7.86809  5.70454  1.000 27.15983  ? 60  PHE A HB3  1 
ATOM   1028 H HD1  . PHE A 1 60  ? -3.81117  6.63413  4.09727  1.000 26.32654  ? 60  PHE A HD1  1 
ATOM   1029 H HD2  . PHE A 1 60  ? -6.18757  9.83764  4.33371  1.000 28.75757  ? 60  PHE A HD2  1 
ATOM   1030 H HE1  . PHE A 1 60  ? -2.19543  7.91141  3.03820  1.000 30.93189  ? 60  PHE A HE1  1 
ATOM   1031 H HE2  . PHE A 1 60  ? -4.56043  11.10465 3.33923  1.000 31.80048  ? 60  PHE A HE2  1 
ATOM   1032 H HZ   . PHE A 1 60  ? -2.61527  10.15499 2.62903  1.000 30.76880  ? 60  PHE A HZ   1 
ATOM   1033 N N    A MET A 1 61  ? -4.78104  7.17474  7.60944  0.442 19.51805  ? 61  MET A N    1 
ATOM   1034 N N    B MET A 1 61  ? -4.75833  7.17751  7.60459  0.558 19.50956  ? 61  MET A N    1 
ATOM   1035 C CA   A MET A 1 61  ? -3.67242  7.52272  8.49959  0.442 19.25924  ? 61  MET A CA   1 
ATOM   1036 C CA   B MET A 1 61  ? -3.62228  7.45925  8.49182  0.558 18.55504  ? 61  MET A CA   1 
ATOM   1037 C C    A MET A 1 61  ? -4.15171  8.23939  9.75952  0.442 18.01684  ? 61  MET A C    1 
ATOM   1038 C C    B MET A 1 61  ? -4.04597  8.35768  9.64798  0.558 19.21511  ? 61  MET A C    1 
ATOM   1039 O O    A MET A 1 61  ? -5.29804  8.68695  9.89150  0.442 18.66451  ? 61  MET A O    1 
ATOM   1040 O O    B MET A 1 61  ? -5.06150  9.06250  9.59398  0.558 19.09230  ? 61  MET A O    1 
ATOM   1041 C CB   A MET A 1 61  ? -2.63499  8.37743  7.77299  0.442 19.81660  ? 61  MET A CB   1 
ATOM   1042 C CB   B MET A 1 61  ? -2.46947  8.07888  7.70464  0.558 19.06648  ? 61  MET A CB   1 
ATOM   1043 C CG   A MET A 1 61  ? -3.16623  9.64269  7.11590  0.442 20.98070  ? 61  MET A CG   1 
ATOM   1044 C CG   B MET A 1 61  ? -2.79038  9.36795  6.97383  0.558 21.38429  ? 61  MET A CG   1 
ATOM   1045 S SD   A MET A 1 61  ? -1.80444  10.80924 6.86339  0.442 26.95576  ? 61  MET A SD   1 
ATOM   1046 S SD   B MET A 1 61  ? -2.68936  10.76500 8.09479  0.558 25.48137  ? 61  MET A SD   1 
ATOM   1047 C CE   A MET A 1 61  ? -2.71357  12.33543 7.03279  0.442 40.68184  ? 61  MET A CE   1 
ATOM   1048 C CE   B MET A 1 61  ? -3.87851  11.90644 7.37384  0.558 39.22533  ? 61  MET A CE   1 
ATOM   1049 H H    A MET A 1 61  ? -5.50450  7.62243  7.73506  0.442 23.39725  ? 61  MET A H    1 
ATOM   1050 H H    B MET A 1 61  ? -5.46294  7.65464  7.72894  0.558 23.39777  ? 61  MET A H    1 
ATOM   1051 H HA   A MET A 1 61  ? -3.27658  6.68388  8.78342  0.442 23.11598  ? 61  MET A HA   1 
ATOM   1052 H HA   B MET A 1 61  ? -3.32676  6.62402  8.88672  0.558 22.24167  ? 61  MET A HA   1 
ATOM   1053 H HB2  A MET A 1 61  ? -1.96013  8.64807  8.41504  0.442 23.78481  ? 61  MET A HB2  1 
ATOM   1054 H HB2  B MET A 1 61  ? -1.74725  8.27075  8.32308  0.558 22.88465  ? 61  MET A HB2  1 
ATOM   1055 H HB3  A MET A 1 61  ? -2.23146  7.83818  7.07494  0.442 23.78481  ? 61  MET A HB3  1 
ATOM   1056 H HB3  B MET A 1 61  ? -2.17519  7.43673  7.03986  0.558 22.88465  ? 61  MET A HB3  1 
ATOM   1057 H HG2  A MET A 1 61  ? -3.55777  9.42642  6.25519  0.442 25.18172  ? 61  MET A HG2  1 
ATOM   1058 H HG2  B MET A 1 61  ? -2.15320  9.50110  6.25469  0.558 25.66603  ? 61  MET A HG2  1 
ATOM   1059 H HG3  A MET A 1 61  ? -3.83127  10.05594 7.68848  0.442 25.18172  ? 61  MET A HG3  1 
ATOM   1060 H HG3  B MET A 1 61  ? -3.69058  9.32286  6.61537  0.558 25.66603  ? 61  MET A HG3  1 
ATOM   1061 H HE1  A MET A 1 61  ? -3.08204  12.38575 7.92867  0.442 48.82309  ? 61  MET A HE1  1 
ATOM   1062 H HE1  B MET A 1 61  ? -4.72772  11.45056 7.26471  0.558 47.07528  ? 61  MET A HE1  1 
ATOM   1063 H HE2  A MET A 1 61  ? -2.11126  13.08037 6.88052  0.442 48.82309  ? 61  MET A HE2  1 
ATOM   1064 H HE2  B MET A 1 61  ? -3.98518  12.66717 7.96614  0.558 47.07528  ? 61  MET A HE2  1 
ATOM   1065 H HE3  A MET A 1 61  ? -3.43008  12.35042 6.37911  0.442 48.82309  ? 61  MET A HE3  1 
ATOM   1066 H HE3  B MET A 1 61  ? -3.54883  12.20269 6.51103  0.558 47.07528  ? 61  MET A HE3  1 
ATOM   1067 N N    . CYS A 1 62  ? -3.21854  8.31439  10.71202 1.000 18.60651  ? 62  CYS A N    1 
ATOM   1068 C CA   . CYS A 1 62  ? -3.30721  9.21052  11.86198 1.000 19.18548  ? 62  CYS A CA   1 
ATOM   1069 C C    . CYS A 1 62  ? -2.11305  10.13845 11.80867 1.000 21.04497  ? 62  CYS A C    1 
ATOM   1070 O O    . CYS A 1 62  ? -0.97978  9.64051  11.76389 1.000 22.52552  ? 62  CYS A O    1 
ATOM   1071 C CB   . CYS A 1 62  ? -3.22829  8.43888  13.18296 1.000 19.68016  ? 62  CYS A CB   1 
ATOM   1072 S SG   . CYS A 1 62  ? -4.53808  7.25769  13.39500 1.000 24.59178  ? 62  CYS A SG   1 
ATOM   1073 H H    . CYS A 1 62  ? -2.57442  7.74954  10.78723 1.000 22.33269  ? 62  CYS A H    1 
ATOM   1074 H HA   . CYS A 1 62  ? -4.14380  9.70014  11.82600 1.000 23.02746  ? 62  CYS A HA   1 
ATOM   1075 H HB2  . CYS A 1 62  ? -2.38657  7.95779  13.21396 1.000 23.62107  ? 62  CYS A HB2  1 
ATOM   1076 H HB3  . CYS A 1 62  ? -3.27646  9.07082  13.91729 1.000 23.62107  ? 62  CYS A HB3  1 
ATOM   1077 H HG   . CYS A 1 62  ? -4.22638  6.47846  14.25270 1.000 29.51502  ? 62  CYS A HG   1 
ATOM   1078 N N    . GLN A 1 63  ? -2.33352  11.44983 11.82533 1.000 18.27888  ? 63  GLN A N    1 
ATOM   1079 C CA   . GLN A 1 63  ? -1.24837  12.43502 11.69836 1.000 17.63035  ? 63  GLN A CA   1 
ATOM   1080 C C    . GLN A 1 63  ? -1.13519  13.23956 12.99455 1.000 20.01664  ? 63  GLN A C    1 
ATOM   1081 O O    . GLN A 1 63  ? -2.11398  13.75660 13.51251 1.000 20.26472  ? 63  GLN A O    1 
ATOM   1082 C CB   . GLN A 1 63  ? -1.44070  13.38005 10.52907 1.000 21.44240  ? 63  GLN A CB   1 
ATOM   1083 C CG   . GLN A 1 63  ? -0.28914  14.39078 10.31741 1.000 20.88954  ? 63  GLN A CG   1 
ATOM   1084 C CD   . GLN A 1 63  ? -0.42563  15.17195 9.04176  1.000 27.10045  ? 63  GLN A CD   1 
ATOM   1085 O OE1  . GLN A 1 63  ? -1.22037  14.79746 8.18181  1.000 33.23502  ? 63  GLN A OE1  1 
ATOM   1086 N NE2  . GLN A 1 63  ? 0.35339   16.22385 8.89329  1.000 25.97681  ? 63  GLN A NE2  1 
ATOM   1087 H H    . GLN A 1 63  ? -3.11275  11.80370 11.91008 1.000 21.93953  ? 63  GLN A H    1 
ATOM   1088 H HA   . GLN A 1 63  ? -0.41889  11.95614 11.54493 1.000 21.16131  ? 63  GLN A HA   1 
ATOM   1089 H HB2  . GLN A 1 63  ? -1.52031  12.85414 9.71791  1.000 25.73577  ? 63  GLN A HB2  1 
ATOM   1090 H HB3  . GLN A 1 63  ? -2.25310  13.88950 10.67523 1.000 25.73577  ? 63  GLN A HB3  1 
ATOM   1091 H HG2  . GLN A 1 63  ? -0.28232  15.02064 11.05506 1.000 25.07233  ? 63  GLN A HG2  1 
ATOM   1092 H HG3  . GLN A 1 63  ? 0.55200   13.90879 10.28493 1.000 25.07233  ? 63  GLN A HG3  1 
ATOM   1093 H HE21 . GLN A 1 63  ? 0.91021   16.43745 9.51291  1.000 31.17705  ? 63  GLN A HE21 1 
ATOM   1094 H HE22 . GLN A 1 63  ? 0.30513   16.69697 8.17676  1.000 31.17705  ? 63  GLN A HE22 1 
ATOM   1095 N N    . GLY A 1 64  ? 0.09837   13.43178 13.44164 1.000 18.27248  ? 64  GLY A N    1 
ATOM   1096 C CA   . GLY A 1 64  ? 0.40415   14.25250 14.60095 1.000 18.86577  ? 64  GLY A CA   1 
ATOM   1097 C C    . GLY A 1 64  ? 1.76170   14.87000 14.52273 1.000 17.83249  ? 64  GLY A C    1 
ATOM   1098 O O    . GLY A 1 64  ? 2.34356   14.99103 13.41387 1.000 19.41253  ? 64  GLY A O    1 
ATOM   1099 H H    . GLY A 1 64  ? 0.79750   13.08645 13.07892 1.000 21.93186  ? 64  GLY A H    1 
ATOM   1100 H HA2  . GLY A 1 64  ? -0.25129  14.96406 14.67154 1.000 22.64381  ? 64  GLY A HA2  1 
ATOM   1101 H HA3  . GLY A 1 64  ? 0.36337   13.70510 15.40069 1.000 22.64381  ? 64  GLY A HA3  1 
ATOM   1102 N N    . GLY A 1 65  ? 2.22431   15.37683 15.68666 1.000 17.96850  ? 65  GLY A N    1 
ATOM   1103 C CA   . GLY A 1 65  ? 3.54349   15.94180 15.78205 1.000 18.93922  ? 65  GLY A CA   1 
ATOM   1104 C C    . GLY A 1 65  ? 3.62717   17.45676 15.66691 1.000 18.86686  ? 65  GLY A C    1 
ATOM   1105 O O    . GLY A 1 65  ? 4.75486   17.98954 15.74676 1.000 19.77613  ? 65  GLY A O    1 
ATOM   1106 H H    . GLY A 1 65  ? 1.77714   15.39470 16.42104 1.000 21.56708  ? 65  GLY A H    1 
ATOM   1107 H HA2  . GLY A 1 65  ? 3.92199   15.69340 16.63991 1.000 22.73195  ? 65  GLY A HA2  1 
ATOM   1108 H HA3  . GLY A 1 65  ? 4.09009   15.56516 15.07475 1.000 22.73195  ? 65  GLY A HA3  1 
ATOM   1109 N N    . ASP A 1 66  ? 2.52561   18.14667 15.46318 1.000 18.17344  ? 66  ASP A N    1 
ATOM   1110 C CA   . ASP A 1 66  ? 2.56752   19.60335 15.45705 1.000 18.30707  ? 66  ASP A CA   1 
ATOM   1111 C C    . ASP A 1 66  ? 2.42855   20.10341 16.87620 1.000 18.75615  ? 66  ASP A C    1 
ATOM   1112 O O    . ASP A 1 66  ? 1.33853   20.44412 17.30213 1.000 21.97999  ? 66  ASP A O    1 
ATOM   1113 C CB   . ASP A 1 66  ? 1.48791   20.19822 14.57797 1.000 19.06608  ? 66  ASP A CB   1 
ATOM   1114 C CG   . ASP A 1 66  ? 1.55635   21.69276 14.48313 1.000 20.66964  ? 66  ASP A CG   1 
ATOM   1115 O OD1  . ASP A 1 66  ? 2.38413   22.31013 15.19503 1.000 20.08599  ? 66  ASP A OD1  1 
ATOM   1116 O OD2  . ASP A 1 66  ? 0.73490   22.29869 13.77221 1.000 20.98837  ? 66  ASP A OD2  1 
ATOM   1117 H H    . ASP A 1 66  ? 1.74861   17.80404 15.32724 1.000 21.81301  ? 66  ASP A H    1 
ATOM   1118 H HA   . ASP A 1 66  ? 3.43307   19.86720 15.10762 1.000 21.94408  ? 66  ASP A HA   1 
ATOM   1119 H HB2  . ASP A 1 66  ? 1.57938   19.83871 13.68170 1.000 22.88418  ? 66  ASP A HB2  1 
ATOM   1120 H HB3  . ASP A 1 66  ? 0.62064   19.96265 14.94300 1.000 22.88418  ? 66  ASP A HB3  1 
ATOM   1121 N N    . PHE A 1 67  ? 3.56390   20.19992 17.57213 1.000 18.76979  ? 67  PHE A N    1 
ATOM   1122 C CA   . PHE A 1 67  ? 3.52021   20.60805 18.96335 1.000 20.42512  ? 67  PHE A CA   1 
ATOM   1123 C C    . PHE A 1 67  ? 3.60496   22.11467 19.12448 1.000 23.02387  ? 67  PHE A C    1 
ATOM   1124 O O    . PHE A 1 67  ? 3.59656   22.59222 20.28321 1.000 23.97783  ? 67  PHE A O    1 
ATOM   1125 C CB   . PHE A 1 67  ? 4.64346   19.89279 19.74705 1.000 20.53489  ? 67  PHE A CB   1 
ATOM   1126 C CG   . PHE A 1 67  ? 6.01839   20.13081 19.24306 1.000 21.07321  ? 67  PHE A CG   1 
ATOM   1127 C CD1  . PHE A 1 67  ? 6.73044   21.24679 19.60545 1.000 25.00093  ? 67  PHE A CD1  1 
ATOM   1128 C CD2  . PHE A 1 67  ? 6.63742   19.19641 18.43829 1.000 23.61439  ? 67  PHE A CD2  1 
ATOM   1129 C CE1  . PHE A 1 67  ? 8.03035   21.46754 19.10365 1.000 28.85125  ? 67  PHE A CE1  1 
ATOM   1130 C CE2  . PHE A 1 67  ? 7.92030   19.44374 17.96840 1.000 24.18474  ? 67  PHE A CE2  1 
ATOM   1131 C CZ   . PHE A 1 67  ? 8.60125   20.56622 18.30423 1.000 27.28932  ? 67  PHE A CZ   1 
ATOM   1132 H H    . PHE A 1 67  ? 4.34902   20.03664 17.26143 1.000 22.49933  ? 67  PHE A H    1 
ATOM   1133 H HA   . PHE A 1 67  ? 2.68109   20.33180 19.36395 1.000 24.51503  ? 67  PHE A HA   1 
ATOM   1134 H HB2  . PHE A 1 67  ? 4.61583   20.19718 20.66764 1.000 24.64675  ? 67  PHE A HB2  1 
ATOM   1135 H HB3  . PHE A 1 67  ? 4.48247   18.93702 19.70867 1.000 24.64675  ? 67  PHE A HB3  1 
ATOM   1136 H HD1  . PHE A 1 67  ? 6.35169   21.86450 20.18844 1.000 30.00599  ? 67  PHE A HD1  1 
ATOM   1137 H HD2  . PHE A 1 67  ? 6.19915   18.40782 18.21258 1.000 28.34215  ? 67  PHE A HD2  1 
ATOM   1138 H HE1  . PHE A 1 67  ? 8.48997   22.24340 19.33099 1.000 34.62639  ? 67  PHE A HE1  1 
ATOM   1139 H HE2  . PHE A 1 67  ? 8.32373   18.82142 17.40727 1.000 29.02657  ? 67  PHE A HE2  1 
ATOM   1140 H HZ   . PHE A 1 67  ? 9.46117   20.70687 17.97918 1.000 32.75207  ? 67  PHE A HZ   1 
ATOM   1141 N N    . THR A 1 68  ? 3.66146   22.92843 18.04335 1.000 20.58981  ? 68  THR A N    1 
ATOM   1142 C CA   . THR A 1 68  ? 3.69171   24.37478 18.23787 1.000 21.80760  ? 68  THR A CA   1 
ATOM   1143 C C    . THR A 1 68  ? 2.40929   25.05496 17.84414 1.000 22.38172  ? 68  THR A C    1 
ATOM   1144 O O    . THR A 1 68  ? 2.08064   26.07100 18.46469 1.000 23.32760  ? 68  THR A O    1 
ATOM   1145 C CB   . THR A 1 68  ? 4.84489   25.07068 17.51179 1.000 24.10978  ? 68  THR A CB   1 
ATOM   1146 O OG1  . THR A 1 68  ? 4.66941   24.96622 16.08871 1.000 25.21351  ? 68  THR A OG1  1 
ATOM   1147 C CG2  . THR A 1 68  ? 6.19638   24.48726 17.95218 1.000 26.50845  ? 68  THR A CG2  1 
ATOM   1148 H H    . THR A 1 68  ? 3.68190   22.66452 17.22510 1.000 24.68336  ? 68  THR A H    1 
ATOM   1149 H HA   . THR A 1 68  ? 3.85912   24.51815 19.18249 1.000 26.14473  ? 68  THR A HA   1 
ATOM   1150 H HB   . THR A 1 68  ? 4.85356   26.01317 17.74099 1.000 28.93662  ? 68  THR A HB   1 
ATOM   1151 H HG1  . THR A 1 68  ? 5.36700   24.65996 15.73493 1.000 30.26109  ? 68  THR A HG1  1 
ATOM   1152 H HG21 . THR A 1 68  ? 6.90852   25.11654 17.75787 1.000 31.81502  ? 68  THR A HG21 1 
ATOM   1153 H HG22 . THR A 1 68  ? 6.18571   24.30845 18.90550 1.000 31.81502  ? 68  THR A HG22 1 
ATOM   1154 H HG23 . THR A 1 68  ? 6.37033   23.65888 17.47845 1.000 31.81502  ? 68  THR A HG23 1 
ATOM   1155 N N    . ARG A 1 69  ? 1.64242   24.52678 16.87945 1.000 22.36657  ? 69  ARG A N    1 
ATOM   1156 C CA   . ARG A 1 69  ? 0.39990   25.15346 16.44742 1.000 22.02566  ? 69  ARG A CA   1 
ATOM   1157 C C    . ARG A 1 69  ? -0.80675  24.21424 16.48578 1.000 21.23037  ? 69  ARG A C    1 
ATOM   1158 O O    . ARG A 1 69  ? -1.93365  24.70360 16.35361 1.000 23.29063  ? 69  ARG A O    1 
ATOM   1159 C CB   . ARG A 1 69  ? 0.56932   25.76088 15.03906 1.000 22.74876  ? 69  ARG A CB   1 
ATOM   1160 C CG   . ARG A 1 69  ? 1.62839   26.84690 15.08511 1.000 27.94279  ? 69  ARG A CG   1 
ATOM   1161 C CD   . ARG A 1 69  ? 1.76236   27.56498 13.76702 1.000 33.37956  ? 69  ARG A CD   1 
ATOM   1162 N NE   . ARG A 1 69  ? 0.51430   28.24499 13.51272 1.000 34.85817  ? 69  ARG A NE   1 
ATOM   1163 C CZ   . ARG A 1 69  ? 0.11736   29.34935 14.16119 1.000 47.66160  ? 69  ARG A CZ   1 
ATOM   1164 N NH1  . ARG A 1 69  ? 0.90097   29.96194 15.08771 1.000 45.59326  ? 69  ARG A NH1  1 
ATOM   1165 N NH2  . ARG A 1 69  ? -1.07745  29.83944 13.87571 1.000 43.86299  ? 69  ARG A NH2  1 
ATOM   1166 H H    . ARG A 1 69  ? 1.82787   23.79916 16.46018 1.000 26.84477  ? 69  ARG A H    1 
ATOM   1167 H HA   . ARG A 1 69  ? 0.18981   25.89264 17.03934 1.000 26.40638  ? 69  ARG A HA   1 
ATOM   1168 H HB2  . ARG A 1 69  ? 0.85077   25.07289 14.41589 1.000 27.30339  ? 69  ARG A HB2  1 
ATOM   1169 H HB3  . ARG A 1 69  ? -0.26910  26.15097 14.74615 1.000 27.30339  ? 69  ARG A HB3  1 
ATOM   1170 H HG2  . ARG A 1 69  ? 1.38728   27.49907 15.76145 1.000 33.53623  ? 69  ARG A HG2  1 
ATOM   1171 H HG3  . ARG A 1 69  ? 2.48575   26.44741 15.30017 1.000 33.53623  ? 69  ARG A HG3  1 
ATOM   1172 H HD2  . ARG A 1 69  ? 2.48010   28.21602 13.81050 1.000 40.06036  ? 69  ARG A HD2  1 
ATOM   1173 H HD3  . ARG A 1 69  ? 1.93338   26.92975 13.05418 1.000 40.06036  ? 69  ARG A HD3  1 
ATOM   1174 H HE   . ARG A 1 69  ? -0.00593  27.92214 12.90880 1.000 41.83469  ? 69  ARG A HE   1 
ATOM   1175 H HH11 . ARG A 1 69  ? 1.67738   29.64208 15.27339 1.000 54.71679  ? 69  ARG A HH11 1 
ATOM   1176 H HH12 . ARG A 1 69  ? 0.62033   30.66936 15.48820 1.000 54.71679  ? 69  ARG A HH12 1 
ATOM   1177 H HH21 . ARG A 1 69  ? -1.57293  29.45075 13.29002 1.000 52.64047  ? 69  ARG A HH21 1 
ATOM   1178 H HH22 . ARG A 1 69  ? -1.35889  30.54679 14.27575 1.000 52.64047  ? 69  ARG A HH22 1 
ATOM   1179 N N    . HIS A 1 70  ? -0.60318  22.91615 16.71247 1.000 21.08405  ? 70  HIS A N    1 
ATOM   1180 C CA   . HIS A 1 70  ? -1.65109  21.94070 17.02304 1.000 21.43013  ? 70  HIS A CA   1 
ATOM   1181 C C    . HIS A 1 70  ? -2.61131  21.71974 15.89258 1.000 26.31665  ? 70  HIS A C    1 
ATOM   1182 O O    . HIS A 1 70  ? -3.72608  21.26908 16.11817 1.000 25.18579  ? 70  HIS A O    1 
ATOM   1183 C CB   . HIS A 1 70  ? -2.40471  22.37268 18.29157 1.000 20.02676  ? 70  HIS A CB   1 
ATOM   1184 C CG   . HIS A 1 70  ? -1.50845  23.05074 19.28392 1.000 20.46536  ? 70  HIS A CG   1 
ATOM   1185 N ND1  . HIS A 1 70  ? -0.45636  22.40282 19.91688 1.000 22.76031  ? 70  HIS A ND1  1 
ATOM   1186 C CD2  . HIS A 1 70  ? -1.46948  24.34545 19.68309 1.000 23.08130  ? 70  HIS A CD2  1 
ATOM   1187 C CE1  . HIS A 1 70  ? 0.18680   23.30121 20.65503 1.000 21.11153  ? 70  HIS A CE1  1 
ATOM   1188 N NE2  . HIS A 1 70  ? -0.37925  24.48548 20.48959 1.000 22.52757  ? 70  HIS A NE2  1 
ATOM   1189 H H    . HIS A 1 70  ? 0.17774   22.55657 16.69067 1.000 25.30575  ? 70  HIS A H    1 
ATOM   1190 H HA   . HIS A 1 70  ? -1.23400  21.07982 17.18375 1.000 25.72104  ? 70  HIS A HA   1 
ATOM   1191 H HB2  . HIS A 1 70  ? -3.10851  22.99361 18.04661 1.000 24.00773  ? 70  HIS A HB2  1 
ATOM   1192 H HB3  . HIS A 1 70  ? -2.78689  21.58870 18.71610 1.000 24.00773  ? 70  HIS A HB3  1 
ATOM   1193 H HD2  . HIS A 1 70  ? -2.07341  25.01328 19.45037 1.000 27.70244  ? 70  HIS A HD2  1 
ATOM   1194 H HE1  . HIS A 1 70  ? 0.91868   23.12541 21.20125 1.000 25.33871  ? 70  HIS A HE1  1 
ATOM   1195 H HE2  . HIS A 1 70  ? -0.10420  25.22362 20.83469 1.000 27.03796  ? 70  HIS A HE2  1 
ATOM   1196 N N    . ASN A 1 71  ? -2.24226  22.09334 14.66032 1.000 23.42231  ? 71  ASN A N    1 
ATOM   1197 C CA   . ASN A 1 71  ? -3.21715  22.02940 13.57160 1.000 22.06199  ? 71  ASN A CA   1 
ATOM   1198 C C    . ASN A 1 71  ? -2.62155  21.65847 12.22567 1.000 23.68469  ? 71  ASN A C    1 
ATOM   1199 O O    . ASN A 1 71  ? -3.34264  21.73315 11.20739 1.000 26.09252  ? 71  ASN A O    1 
ATOM   1200 C CB   . ASN A 1 71  ? -3.98850  23.35684 13.46574 1.000 24.61961  ? 71  ASN A CB   1 
ATOM   1201 C CG   . ASN A 1 71  ? -3.11230  24.52246 13.05580 1.000 27.18898  ? 71  ASN A CG   1 
ATOM   1202 O OD1  . ASN A 1 71  ? -1.94690  24.34527 12.76154 1.000 25.36668  ? 71  ASN A OD1  1 
ATOM   1203 N ND2  . ASN A 1 71  ? -3.69927  25.71928 12.96453 1.000 35.15921  ? 71  ASN A ND2  1 
ATOM   1204 H H    . ASN A 1 71  ? -1.46133  22.37702 14.43835 1.000 28.11165  ? 71  ASN A H    1 
ATOM   1205 H HA   . ASN A 1 71  ? -3.85572  21.33187 13.78742 1.000 26.47927  ? 71  ASN A HA   1 
ATOM   1206 H HB2  . ASN A 1 71  ? -4.68884  23.26180 12.80136 1.000 29.54841  ? 71  ASN A HB2  1 
ATOM   1207 H HB3  . ASN A 1 71  ? -4.37697  23.56491 14.32985 1.000 29.54841  ? 71  ASN A HB3  1 
ATOM   1208 H HD21 . ASN A 1 71  ? -3.23819  26.40795 12.73488 1.000 42.19593  ? 71  ASN A HD21 1 
ATOM   1209 H HD22 . ASN A 1 71  ? -4.53815  25.80094 13.13542 1.000 42.19593  ? 71  ASN A HD22 1 
ATOM   1210 N N    . GLY A 1 72  ? -1.35923  21.29840 12.16229 1.000 21.78168  ? 72  GLY A N    1 
ATOM   1211 C CA   . GLY A 1 72  ? -0.72826  20.89980 10.92153 1.000 23.33681  ? 72  GLY A CA   1 
ATOM   1212 C C    . GLY A 1 72  ? 0.10416   21.97341 10.28813 1.000 22.92783  ? 72  GLY A C    1 
ATOM   1213 O O    . GLY A 1 72  ? 0.79585   21.69365 9.29508  1.000 26.07067  ? 72  GLY A O    1 
ATOM   1214 H H    . GLY A 1 72  ? -0.83135  21.27531 12.84082 1.000 26.14290  ? 72  GLY A H    1 
ATOM   1215 H HA2  . GLY A 1 72  ? -0.15385  20.13707 11.09235 1.000 28.00905  ? 72  GLY A HA2  1 
ATOM   1216 H HA3  . GLY A 1 72  ? -1.41621  20.64151 10.28835 1.000 28.00905  ? 72  GLY A HA3  1 
ATOM   1217 N N    . THR A 1 73  ? 0.11097   23.18971 10.86182 1.000 24.54911  ? 73  THR A N    1 
ATOM   1218 C CA   . THR A 1 73  ? 0.93917   24.25402 10.31359 1.000 24.51378  ? 73  THR A CA   1 
ATOM   1219 C C    . THR A 1 73  ? 2.25772   24.48758 11.03018 1.000 30.30232  ? 73  THR A C    1 
ATOM   1220 O O    . THR A 1 73  ? 3.00730   25.37941 10.61939 1.000 32.45492  ? 73  THR A O    1 
ATOM   1221 C CB   . THR A 1 73  ? 0.18978   25.58486 10.28078 1.000 28.18851  ? 73  THR A CB   1 
ATOM   1222 O OG1  . THR A 1 73  ? -0.12184  26.04489 11.60680 1.000 29.65140  ? 73  THR A OG1  1 
ATOM   1223 C CG2  . THR A 1 73  ? -1.10181  25.45512 9.51583  1.000 29.96660  ? 73  THR A CG2  1 
ATOM   1224 H H    . THR A 1 73  ? -0.34946  23.40822 11.55454 1.000 29.46382  ? 73  THR A H    1 
ATOM   1225 H HA   . THR A 1 73  ? 1.13893   23.97635 9.40590  1.000 29.42142  ? 73  THR A HA   1 
ATOM   1226 H HB   . THR A 1 73  ? 0.76382   26.23371 9.84448  1.000 33.83109  ? 73  THR A HB   1 
ATOM   1227 H HG1  . THR A 1 73  ? -0.73405  25.57443 11.93764 1.000 35.58656  ? 73  THR A HG1  1 
ATOM   1228 H HG21 . THR A 1 73  ? -0.92162  25.16915 8.60662  1.000 35.96481  ? 73  THR A HG21 1 
ATOM   1229 H HG22 . THR A 1 73  ? -1.67643  24.80106 9.94352  1.000 35.96481  ? 73  THR A HG22 1 
ATOM   1230 H HG23 . THR A 1 73  ? -1.56056  26.30945 9.49205  1.000 35.96481  ? 73  THR A HG23 1 
ATOM   1231 N N    . GLY A 1 74  ? 2.54842   23.77041 12.08941 1.000 23.87926  ? 74  GLY A N    1 
ATOM   1232 C CA   . GLY A 1 74  ? 3.72867   24.04602 12.86855 1.000 24.90426  ? 74  GLY A CA   1 
ATOM   1233 C C    . GLY A 1 74  ? 4.60436   22.82823 13.04725 1.000 23.91384  ? 74  GLY A C    1 
ATOM   1234 O O    . GLY A 1 74  ? 4.61751   21.89672 12.24415 1.000 27.58598  ? 74  GLY A O    1 
ATOM   1235 H H    . GLY A 1 74  ? 2.07354   23.11421 12.37837 1.000 28.65999  ? 74  GLY A H    1 
ATOM   1236 H HA2  . GLY A 1 74  ? 4.25074   24.73407 12.42705 1.000 29.88999  ? 74  GLY A HA2  1 
ATOM   1237 H HA3  . GLY A 1 74  ? 3.46611   24.36351 13.74671 1.000 29.88999  ? 74  GLY A HA3  1 
ATOM   1238 N N    . GLY A 1 75  ? 5.36139   22.85782 14.12586 1.000 22.76935  ? 75  GLY A N    1 
ATOM   1239 C CA   . GLY A 1 75  ? 6.36990   21.88012 14.43893 1.000 23.13805  ? 75  GLY A CA   1 
ATOM   1240 C C    . GLY A 1 75  ? 7.76862   22.33637 14.02411 1.000 24.83448  ? 75  GLY A C    1 
ATOM   1241 O O    . GLY A 1 75  ? 7.95164   23.27920 13.25340 1.000 29.51056  ? 75  GLY A O    1 
ATOM   1242 H H    . GLY A 1 75  ? 5.30371   23.47212 14.72495 1.000 27.32810  ? 75  GLY A H    1 
ATOM   1243 H HA2  . GLY A 1 75  ? 6.37260   21.71586 15.39492 1.000 27.77054  ? 75  GLY A HA2  1 
ATOM   1244 H HA3  . GLY A 1 75  ? 6.16872   21.05142 13.97668 1.000 27.77054  ? 75  GLY A HA3  1 
ATOM   1245 N N    . LYS A 1 76  ? 8.77415   21.64122 14.56238 1.000 23.65585  ? 76  LYS A N    1 
ATOM   1246 C CA   . LYS A 1 76  ? 10.16353  21.90298 14.18398 1.000 23.81709  ? 76  LYS A CA   1 
ATOM   1247 C C    . LYS A 1 76  ? 10.95115  20.65397 14.54686 1.000 25.16593  ? 76  LYS A C    1 
ATOM   1248 O O    . LYS A 1 76  ? 10.55046  19.88534 15.42748 1.000 24.50419  ? 76  LYS A O    1 
ATOM   1249 C CB   . LYS A 1 76  ? 10.76896  23.13445 14.86609 1.000 31.14772  ? 76  LYS A CB   1 
ATOM   1250 C CG   . LYS A 1 76  ? 10.88127  23.03506 16.38058 1.000 35.61192  ? 76  LYS A CG   1 
ATOM   1251 C CD   . LYS A 1 76  ? 11.46399  24.34693 16.96233 1.000 49.98052  ? 76  LYS A CD   1 
ATOM   1252 C CE   . LYS A 1 76  ? 11.38935  24.37498 18.46077 1.000 58.84025  ? 76  LYS A CE   1 
ATOM   1253 N NZ   . LYS A 1 76  ? 12.08272  25.59389 18.97461 1.000 59.06839  ? 76  LYS A NZ   1 
ATOM   1254 H H    . LYS A 1 76  ? 8.67755   21.01653 15.14550 1.000 28.39190  ? 76  LYS A H    1 
ATOM   1255 H HA   . LYS A 1 76  ? 10.21246  22.07613 13.23081 1.000 28.58539  ? 76  LYS A HA   1 
ATOM   1256 H HB2  . LYS A 1 76  ? 11.66298  23.27187 14.51575 1.000 37.38215  ? 76  LYS A HB2  1 
ATOM   1257 H HB3  . LYS A 1 76  ? 10.21202  23.90268 14.66475 1.000 37.38215  ? 76  LYS A HB3  1 
ATOM   1258 H HG2  . LYS A 1 76  ? 10.00216  22.88951 16.76384 1.000 42.73919  ? 76  LYS A HG2  1 
ATOM   1259 H HG3  . LYS A 1 76  ? 11.47145  22.30226 16.61634 1.000 42.73919  ? 76  LYS A HG3  1 
ATOM   1260 H HD2  . LYS A 1 76  ? 12.39549  24.42573 16.70346 1.000 59.98150  ? 76  LYS A HD2  1 
ATOM   1261 H HD3  . LYS A 1 76  ? 10.95939  25.10097 16.61927 1.000 59.98150  ? 76  LYS A HD3  1 
ATOM   1262 H HE2  . LYS A 1 76  ? 10.46161  24.40041 18.74281 1.000 70.61318  ? 76  LYS A HE2  1 
ATOM   1263 H HE3  . LYS A 1 76  ? 11.82571  23.58940 18.82595 1.000 70.61318  ? 76  LYS A HE3  1 
ATOM   1264 H HZ1  . LYS A 1 76  ? 12.12264  25.56949 19.86338 1.000 70.88695  ? 76  LYS A HZ1  1 
ATOM   1265 H HZ2  . LYS A 1 76  ? 12.91020  25.63330 18.64930 1.000 70.88695  ? 76  LYS A HZ2  1 
ATOM   1266 H HZ3  . LYS A 1 76  ? 11.63929  26.32419 18.72535 1.000 70.88695  ? 76  LYS A HZ3  1 
ATOM   1267 N N    . SER A 1 77  ? 12.04068  20.43709 13.84655 1.000 25.40539  ? 77  SER A N    1 
ATOM   1268 C CA   . SER A 1 77  ? 12.92473  19.33066 14.15166 1.000 22.75695  ? 77  SER A CA   1 
ATOM   1269 C C    . SER A 1 77  ? 14.00957  19.73539 15.13778 1.000 23.84411  ? 77  SER A C    1 
ATOM   1270 O O    . SER A 1 77  ? 14.17694  20.91154 15.50829 1.000 27.02518  ? 77  SER A O    1 
ATOM   1271 C CB   . SER A 1 77  ? 13.58847  18.79991 12.88412 1.000 23.81907  ? 77  SER A CB   1 
ATOM   1272 O OG   . SER A 1 77  ? 14.77624  19.50897 12.51728 1.000 26.59685  ? 77  SER A OG   1 
ATOM   1273 H H    . SER A 1 77  ? 12.29541  20.91992 13.18203 1.000 30.49135  ? 77  SER A H    1 
ATOM   1274 H HA   . SER A 1 77  ? 12.38572  18.62988 14.55076 1.000 27.31322  ? 77  SER A HA   1 
ATOM   1275 H HB2  . SER A 1 77  ? 13.82196  17.86972 13.02946 1.000 28.58776  ? 77  SER A HB2  1 
ATOM   1276 H HB3  . SER A 1 77  ? 12.95320  18.87244 12.15469 1.000 28.58776  ? 77  SER A HB3  1 
ATOM   1277 H HG   . SER A 1 77  ? 14.61941  20.33346 12.48230 1.000 31.92110  ? 77  SER A HG   1 
ATOM   1278 N N    . ILE A 1 78  ? 14.78659  18.72574 15.54548 1.000 24.62115  ? 78  ILE A N    1 
ATOM   1279 C CA   . ILE A 1 78  ? 15.90844  18.98267 16.44224 1.000 26.41381  ? 78  ILE A CA   1 
ATOM   1280 C C    . ILE A 1 78  ? 17.09455  19.60656 15.72188 1.000 28.10857  ? 78  ILE A C    1 
ATOM   1281 O O    . ILE A 1 78  ? 18.06782  20.01148 16.36484 1.000 31.31011  ? 78  ILE A O    1 
ATOM   1282 C CB   . ILE A 1 78  ? 16.37820  17.70611 17.17985 1.000 26.01159  ? 78  ILE A CB   1 
ATOM   1283 C CG1  . ILE A 1 78  ? 16.95275  16.64804 16.21220 1.000 28.79691  ? 78  ILE A CG1  1 
ATOM   1284 C CG2  . ILE A 1 78  ? 15.22556  17.13898 18.02796 1.000 28.23762  ? 78  ILE A CG2  1 
ATOM   1285 C CD1  . ILE A 1 78  ? 17.66831  15.44536 16.88710 1.000 30.47903  ? 78  ILE A CD1  1 
ATOM   1286 H H    . ILE A 1 78  ? 14.68425  17.90218 15.31989 1.000 29.55026  ? 78  ILE A H    1 
ATOM   1287 H HA   . ILE A 1 78  ? 15.59489  19.60425 17.11769 1.000 31.70145  ? 78  ILE A HA   1 
ATOM   1288 H HB   . ILE A 1 78  ? 17.10751  17.95351 17.76959 1.000 31.21879  ? 78  ILE A HB   1 
ATOM   1289 H HG12 . ILE A 1 78  ? 16.22298  16.29001 15.68290 1.000 34.56118  ? 78  ILE A HG12 1 
ATOM   1290 H HG13 . ILE A 1 78  ? 17.59986  17.08201 15.63443 1.000 34.56118  ? 78  ILE A HG13 1 
ATOM   1291 H HG21 . ILE A 1 78  ? 15.52800  16.33145 18.47218 1.000 33.89002  ? 78  ILE A HG21 1 
ATOM   1292 H HG22 . ILE A 1 78  ? 14.96321  17.80059 18.68701 1.000 33.89002  ? 78  ILE A HG22 1 
ATOM   1293 H HG23 . ILE A 1 78  ? 14.47606  16.93584 17.44668 1.000 33.89002  ? 78  ILE A HG23 1 
ATOM   1294 H HD11 . ILE A 1 78  ? 18.17217  14.96009 16.21514 1.000 36.57972  ? 78  ILE A HD11 1 
ATOM   1295 H HD12 . ILE A 1 78  ? 18.26756  15.77887 17.57308 1.000 36.57972  ? 78  ILE A HD12 1 
ATOM   1296 H HD13 . ILE A 1 78  ? 17.00152  14.86375 17.28463 1.000 36.57972  ? 78  ILE A HD13 1 
ATOM   1297 N N    . TYR A 1 79  ? 17.06922  19.63616 14.38639 1.000 26.45349  ? 79  TYR A N    1 
ATOM   1298 C CA   . TYR A 1 79  ? 18.11578  20.16538 13.51341 1.000 28.66285  ? 79  TYR A CA   1 
ATOM   1299 C C    . TYR A 1 79  ? 17.83309  21.57875 13.03060 1.000 39.33818  ? 79  TYR A C    1 
ATOM   1300 O O    . TYR A 1 79  ? 18.69838  22.18433 12.39801 1.000 42.92970  ? 79  TYR A O    1 
ATOM   1301 C CB   . TYR A 1 79  ? 18.28056  19.25437 12.31405 1.000 32.40208  ? 79  TYR A CB   1 
ATOM   1302 C CG   . TYR A 1 79  ? 18.41558  17.79540 12.66267 1.000 29.33047  ? 79  TYR A CG   1 
ATOM   1303 C CD1  . TYR A 1 79  ? 19.48077  17.35212 13.40216 1.000 27.88048  ? 79  TYR A CD1  1 
ATOM   1304 C CD2  . TYR A 1 79  ? 17.46589  16.86469 12.26114 1.000 26.69447  ? 79  TYR A CD2  1 
ATOM   1305 C CE1  . TYR A 1 79  ? 19.61283  15.99583 13.73562 1.000 28.97051  ? 79  TYR A CE1  1 
ATOM   1306 C CE2  . TYR A 1 79  ? 17.58041  15.52981 12.58744 1.000 27.19382  ? 79  TYR A CE2  1 
ATOM   1307 C CZ   . TYR A 1 79  ? 18.66814  15.10185 13.33346 1.000 28.24916  ? 79  TYR A CZ   1 
ATOM   1308 O OH   . TYR A 1 79  ? 18.82178  13.79300 13.68731 1.000 28.36184  ? 79  TYR A OH   1 
ATOM   1309 H H    . TYR A 1 79  ? 16.40615  19.33240 13.93068 1.000 31.74907  ? 79  TYR A H    1 
ATOM   1310 H HA   . TYR A 1 79  ? 18.95031  20.18496 14.00744 1.000 34.40030  ? 79  TYR A HA   1 
ATOM   1311 H HB2  . TYR A 1 79  ? 17.50257  19.34978 11.74262 1.000 38.88738  ? 79  TYR A HB2  1 
ATOM   1312 H HB3  . TYR A 1 79  ? 19.08034  19.51720 11.83222 1.000 38.88738  ? 79  TYR A HB3  1 
ATOM   1313 H HD1  . TYR A 1 79  ? 20.12530  17.95903 13.68701 1.000 33.46146  ? 79  TYR A HD1  1 
ATOM   1314 H HD2  . TYR A 1 79  ? 16.73546  17.14857 11.76035 1.000 32.03825  ? 79  TYR A HD2  1 
ATOM   1315 H HE1  . TYR A 1 79  ? 20.34521  15.70763 14.23106 1.000 34.76949  ? 79  TYR A HE1  1 
ATOM   1316 H HE2  . TYR A 1 79  ? 16.93379  14.92186 12.30961 1.000 32.63746  ? 79  TYR A HE2  1 
ATOM   1317 H HH   . TYR A 1 79  ? 18.35104  13.30435 13.19211 1.000 34.03910  ? 79  TYR A HH   1 
ATOM   1318 N N    . GLY A 1 80  ? 16.67838  22.13291 13.35542 1.000 32.20170  ? 80  GLY A N    1 
ATOM   1319 C CA   . GLY A 1 80  ? 16.21713  23.40714 12.83326 1.000 35.50691  ? 80  GLY A CA   1 
ATOM   1320 C C    . GLY A 1 80  ? 14.79381  23.26711 12.35489 1.000 30.34903  ? 80  GLY A C    1 
ATOM   1321 O O    . GLY A 1 80  ? 14.13627  22.24494 12.55164 1.000 31.17915  ? 80  GLY A O    1 
ATOM   1322 H H    . GLY A 1 80  ? 16.11958  21.77328 13.90132 1.000 38.64692  ? 80  GLY A H    1 
ATOM   1323 H HA2  . GLY A 1 80  ? 16.25418  24.08427 13.52682 1.000 42.61318  ? 80  GLY A HA2  1 
ATOM   1324 H HA3  . GLY A 1 80  ? 16.77615  23.68472 12.09073 1.000 42.61318  ? 80  GLY A HA3  1 
ATOM   1325 N N    A GLU A 1 81  ? 14.33885  24.28342 11.62812 0.559 30.75912  ? 81  GLU A N    1 
ATOM   1326 N N    B GLU A 1 81  ? 14.30348  24.29925 11.68948 0.441 31.90297  ? 81  GLU A N    1 
ATOM   1327 C CA   A GLU A 1 81  ? 12.94627  24.30759 11.20000 0.559 32.28445  ? 81  GLU A CA   1 
ATOM   1328 C CA   B GLU A 1 81  ? 12.89969  24.28507 11.31848 0.441 32.50942  ? 81  GLU A CA   1 
ATOM   1329 C C    A GLU A 1 81  ? 12.64807  23.19587 10.20126 0.559 29.67853  ? 81  GLU A C    1 
ATOM   1330 C C    B GLU A 1 81  ? 12.58158  23.05751 10.46596 0.441 29.24153  ? 81  GLU A C    1 
ATOM   1331 O O    A GLU A 1 81  ? 11.52568  22.67976 10.16764 0.559 32.50698  ? 81  GLU A O    1 
ATOM   1332 O O    B GLU A 1 81  ? 11.61346  22.33488 10.74716 0.441 32.20526  ? 81  GLU A O    1 
ATOM   1333 C CB   A GLU A 1 81  ? 12.59460  25.65855 10.57531 0.559 39.83620  ? 81  GLU A CB   1 
ATOM   1334 C CB   B GLU A 1 81  ? 12.53847  25.58814 10.60667 0.441 39.53503  ? 81  GLU A CB   1 
ATOM   1335 C CG   A GLU A 1 81  ? 11.10416  25.79481 10.22522 0.559 45.37404  ? 81  GLU A CG   1 
ATOM   1336 C CG   B GLU A 1 81  ? 12.74689  26.83430 11.48506 0.441 44.42845  ? 81  GLU A CG   1 
ATOM   1337 C CD   A GLU A 1 81  ? 10.82972  26.79252 9.09200  0.559 57.67550  ? 81  GLU A CD   1 
ATOM   1338 C CD   B GLU A 1 81  ? 12.03045  28.05772 10.93923 0.441 51.18865  ? 81  GLU A CD   1 
ATOM   1339 O OE1  A GLU A 1 81  ? 11.77028  27.49862 8.64687  0.559 59.83904  ? 81  GLU A OE1  1 
ATOM   1340 O OE1  B GLU A 1 81  ? 10.92188  27.89733 10.38150 0.441 53.74289  ? 81  GLU A OE1  1 
ATOM   1341 O OE2  A GLU A 1 81  ? 9.66272   26.85597 8.64157  0.559 59.96648  ? 81  GLU A OE2  1 
ATOM   1342 O OE2  B GLU A 1 81  ? 12.57845  29.17609 11.05996 0.441 59.77607  ? 81  GLU A OE2  1 
ATOM   1343 H H    A GLU A 1 81  ? 14.80705  24.95869 11.37433 0.559 36.91583  ? 81  GLU A H    1 
ATOM   1344 H H    B GLU A 1 81  ? 14.74596  24.99625 11.44863 0.441 38.28845  ? 81  GLU A H    1 
ATOM   1345 H HA   A GLU A 1 81  ? 12.38951  24.18314 11.98450 0.559 38.74622  ? 81  GLU A HA   1 
ATOM   1346 H HA   B GLU A 1 81  ? 12.34976  24.23460 12.11593 0.441 39.01618  ? 81  GLU A HA   1 
ATOM   1347 H HB2  A GLU A 1 81  ? 12.81919  26.36276 11.20344 0.559 47.80832  ? 81  GLU A HB2  1 
ATOM   1348 H HB2  B GLU A 1 81  ? 13.09669  25.68106 9.81885  0.441 47.44692  ? 81  GLU A HB2  1 
ATOM   1349 H HB3  A GLU A 1 81  ? 13.10449  25.76842 9.75749  0.559 47.80832  ? 81  GLU A HB3  1 
ATOM   1350 H HB3  B GLU A 1 81  ? 11.60379  25.55692 10.34919 0.441 47.44692  ? 81  GLU A HB3  1 
ATOM   1351 H HG2  A GLU A 1 81  ? 10.76765  24.92893 9.94607  0.559 54.45373  ? 81  GLU A HG2  1 
ATOM   1352 H HG2  B GLU A 1 81  ? 12.40324  26.65624 12.37449 0.441 53.31902  ? 81  GLU A HG2  1 
ATOM   1353 H HG3  A GLU A 1 81  ? 10.62445  26.09946 11.01132 0.559 54.45373  ? 81  GLU A HG3  1 
ATOM   1354 H HG3  B GLU A 1 81  ? 13.69471  27.03566 11.52978 0.441 53.31902  ? 81  GLU A HG3  1 
ATOM   1355 N N    A LYS A 1 82  ? 13.61072  22.85983 9.33824  0.559 28.28628  ? 82  LYS A N    1 
ATOM   1356 N N    B LYS A 1 82  ? 13.41695  22.77707 9.45198  0.441 28.20797  ? 82  LYS A N    1 
ATOM   1357 C CA   A LYS A 1 82  ? 13.40926  21.77021 8.39350  0.559 24.82346  ? 82  LYS A CA   1 
ATOM   1358 C CA   B LYS A 1 82  ? 13.22240  21.59709 8.61139  0.441 25.11968  ? 82  LYS A CA   1 
ATOM   1359 C C    A LYS A 1 82  ? 14.69127  20.96771 8.26500  0.559 24.34249  ? 82  LYS A C    1 
ATOM   1360 C C    B LYS A 1 82  ? 14.55276  21.04170 8.09569  0.441 25.75319  ? 82  LYS A C    1 
ATOM   1361 O O    A LYS A 1 82  ? 15.78413  21.43023 8.61279  0.559 24.22656  ? 82  LYS A O    1 
ATOM   1362 O O    B LYS A 1 82  ? 15.53724  21.77809 7.91843  0.441 29.20558  ? 82  LYS A O    1 
ATOM   1363 C CB   A LYS A 1 82  ? 12.93165  22.27628 7.03310  0.559 25.10426  ? 82  LYS A CB   1 
ATOM   1364 C CB   B LYS A 1 82  ? 12.29465  21.89098 7.41581  0.441 31.27524  ? 82  LYS A CB   1 
ATOM   1365 C CG   A LYS A 1 82  ? 13.56375  23.47912 6.48746  0.559 34.01332  ? 82  LYS A CG   1 
ATOM   1366 C CG   B LYS A 1 82  ? 10.93522  22.62383 7.70320  0.441 32.00435  ? 82  LYS A CG   1 
ATOM   1367 C CD   A LYS A 1 82  ? 12.74035  24.00631 5.29761  0.559 48.52776  ? 82  LYS A CD   1 
ATOM   1368 C CD   B LYS A 1 82  ? 9.82102   21.76779 8.36326  0.441 32.32058  ? 82  LYS A CD   1 
ATOM   1369 C CE   A LYS A 1 82  ? 11.35223  24.56165 5.70740  0.559 52.91632  ? 82  LYS A CE   1 
ATOM   1370 C CE   B LYS A 1 82  ? 8.72894   22.62495 8.96576  0.441 36.10749  ? 82  LYS A CE   1 
ATOM   1371 N NZ   A LYS A 1 82  ? 10.58262  25.10066 4.53559  0.559 57.08532  ? 82  LYS A NZ   1 
ATOM   1372 N NZ   B LYS A 1 82  ? 8.66969   22.40675 10.42682 0.441 34.91652  ? 82  LYS A NZ   1 
ATOM   1373 H H    A LYS A 1 82  ? 14.37741  23.24578 9.28498  0.559 33.94841  ? 82  LYS A H    1 
ATOM   1374 H H    B LYS A 1 82  ? 14.09824  23.25567 9.23660  0.441 33.85445  ? 82  LYS A H    1 
ATOM   1375 H HA   A LYS A 1 82  ? 12.72739  21.17052 8.73457  0.559 29.79303  ? 82  LYS A HA   1 
ATOM   1376 H HA   B LYS A 1 82  ? 12.82603  20.91083 9.17071  0.441 30.14850  ? 82  LYS A HA   1 
ATOM   1377 H HB2  A LYS A 1 82  ? 13.07755  21.56797 6.38664  0.559 30.13000  ? 82  LYS A HB2  1 
ATOM   1378 H HB2  B LYS A 1 82  ? 12.78474  22.44847 6.79139  0.441 37.53517  ? 82  LYS A HB2  1 
ATOM   1379 H HB3  A LYS A 1 82  ? 11.98378  22.46900 7.10583  0.559 30.13000  ? 82  LYS A HB3  1 
ATOM   1380 H HB3  B LYS A 1 82  ? 12.07146  21.04373 6.99957  0.441 37.53517  ? 82  LYS A HB3  1 
ATOM   1381 H HG2  A LYS A 1 82  ? 13.60225  24.16751 7.16976  0.559 40.82087  ? 82  LYS A HG2  1 
ATOM   1382 H HG2  B LYS A 1 82  ? 11.11236  23.36871 8.29875  0.441 38.41011  ? 82  LYS A HG2  1 
ATOM   1383 H HG3  A LYS A 1 82  ? 14.45862  23.26782 6.17850  0.559 40.82087  ? 82  LYS A HG3  1 
ATOM   1384 H HG3  B LYS A 1 82  ? 10.58233  22.94955 6.86042  0.441 38.41011  ? 82  LYS A HG3  1 
ATOM   1385 H HD2  A LYS A 1 82  ? 13.23226  24.72393 4.86871  0.559 58.23820  ? 82  LYS A HD2  1 
ATOM   1386 H HD2  B LYS A 1 82  ? 9.41968   21.19370 7.69226  0.441 38.78957  ? 82  LYS A HD2  1 
ATOM   1387 H HD3  A LYS A 1 82  ? 12.59632  23.28124 4.66957  0.559 58.23820  ? 82  LYS A HD3  1 
ATOM   1388 H HD3  B LYS A 1 82  ? 10.20879  21.22984 9.07118  0.441 38.78957  ? 82  LYS A HD3  1 
ATOM   1389 H HE2  A LYS A 1 82  ? 10.83059  23.84879 6.10818  0.559 63.50447  ? 82  LYS A HE2  1 
ATOM   1390 H HE2  B LYS A 1 82  ? 8.91718   23.56150 8.79739  0.441 43.33387  ? 82  LYS A HE2  1 
ATOM   1391 H HE3  A LYS A 1 82  ? 11.47405  25.28241 6.34502  0.559 63.50447  ? 82  LYS A HE3  1 
ATOM   1392 H HE3  B LYS A 1 82  ? 7.87256   22.38397 8.57917  0.441 43.33387  ? 82  LYS A HE3  1 
ATOM   1393 H HZ1  A LYS A 1 82  ? 11.07751  25.69340 4.09305  0.559 68.50726  ? 82  LYS A HZ1  1 
ATOM   1394 H HZ1  B LYS A 1 82  ? 8.33404   21.60107 10.60091 0.441 41.90470  ? 82  LYS A HZ1  1 
ATOM   1395 H HZ2  A LYS A 1 82  ? 10.36418  24.43740 3.98380  0.559 68.50726  ? 82  LYS A HZ2  1 
ATOM   1396 H HZ2  B LYS A 1 82  ? 9.48651   22.46098 10.77606 0.441 41.90470  ? 82  LYS A HZ2  1 
ATOM   1397 H HZ3  A LYS A 1 82  ? 9.83827   25.49888 4.81746  0.559 68.50726  ? 82  LYS A HZ3  1 
ATOM   1398 H HZ3  B LYS A 1 82  ? 8.15194   23.02344 10.80594 0.441 41.90470  ? 82  LYS A HZ3  1 
ATOM   1399 N N    . PHE A 1 83  ? 14.53869  19.73232 7.80680  1.000 22.99539  ? 83  PHE A N    1 
ATOM   1400 C CA   . PHE A 1 83  ? 15.70098  18.96525 7.38014  1.000 22.57126  ? 83  PHE A CA   1 
ATOM   1401 C C    . PHE A 1 83  ? 15.36522  18.10795 6.16106  1.000 22.29393  ? 83  PHE A C    1 
ATOM   1402 O O    . PHE A 1 83  ? 14.20912  17.94671 5.74167  1.000 22.06738  ? 83  PHE A O    1 
ATOM   1403 C CB   . PHE A 1 83  ? 16.32584  18.14659 8.49753  1.000 22.46540  ? 83  PHE A CB   1 
ATOM   1404 C CG   . PHE A 1 83  ? 15.52507  16.98029 8.99903  1.000 21.79860  ? 83  PHE A CG   1 
ATOM   1405 C CD1  . PHE A 1 83  ? 14.45398  17.15889 9.88992  1.000 22.02913  ? 83  PHE A CD1  1 
ATOM   1406 C CD2  . PHE A 1 83  ? 15.85012  15.67321 8.62685  1.000 23.71806  ? 83  PHE A CD2  1 
ATOM   1407 C CE1  . PHE A 1 83  ? 13.73501  16.07619 10.36399 1.000 23.55113  ? 83  PHE A CE1  1 
ATOM   1408 C CE2  . PHE A 1 83  ? 15.08684  14.55693 9.12781  1.000 23.33369  ? 83  PHE A CE2  1 
ATOM   1409 C CZ   . PHE A 1 83  ? 14.02973  14.78069 9.98240  1.000 23.51043  ? 83  PHE A CZ   1 
ATOM   1410 H H    . PHE A 1 83  ? 13.78699  19.32101 7.73351  1.000 27.59935  ? 83  PHE A H    1 
ATOM   1411 H HA   . PHE A 1 83  ? 16.38440  19.59104 7.09340  1.000 27.06110  ? 83  PHE A HA   1 
ATOM   1412 H HB2  . PHE A 1 83  ? 17.17109  17.79476 8.17713  1.000 26.96336  ? 83  PHE A HB2  1 
ATOM   1413 H HB3  . PHE A 1 83  ? 16.47665  18.73464 9.25407  1.000 26.96336  ? 83  PHE A HB3  1 
ATOM   1414 H HD1  . PHE A 1 83  ? 14.22484  18.01720 10.16502 1.000 26.43984  ? 83  PHE A HD1  1 
ATOM   1415 H HD2  . PHE A 1 83  ? 16.56472  15.52190 8.05122  1.000 28.46656  ? 83  PHE A HD2  1 
ATOM   1416 H HE1  . PHE A 1 83  ? 13.03344  16.22416 10.95628 1.000 28.26624  ? 83  PHE A HE1  1 
ATOM   1417 H HE2  . PHE A 1 83  ? 15.30733  13.68954 8.87500  1.000 28.00531  ? 83  PHE A HE2  1 
ATOM   1418 H HZ   . PHE A 1 83  ? 13.52093  14.06929 10.29851 1.000 28.21740  ? 83  PHE A HZ   1 
ATOM   1419 N N    . GLU A 1 84  ? 16.43232  17.65067 5.49637  1.000 22.74538  ? 84  GLU A N    1 
ATOM   1420 C CA   . GLU A 1 84  ? 16.31794  16.99168 4.20200  1.000 22.91454  ? 84  GLU A CA   1 
ATOM   1421 C C    . GLU A 1 84  ? 15.70216  15.60642 4.25424  1.000 21.98424  ? 84  GLU A C    1 
ATOM   1422 O O    . GLU A 1 84  ? 15.65369  14.93820 5.28950  1.000 21.22526  ? 84  GLU A O    1 
ATOM   1423 C CB   . GLU A 1 84  ? 17.72068  16.89487 3.56719  1.000 23.78482  ? 84  GLU A CB   1 
ATOM   1424 C CG   . GLU A 1 84  ? 18.67122  15.89981 4.27826  1.000 23.36605  ? 84  GLU A CG   1 
ATOM   1425 C CD   . GLU A 1 84  ? 19.44062  16.43917 5.47906  1.000 29.43185  ? 84  GLU A CD   1 
ATOM   1426 O OE1  . GLU A 1 84  ? 19.12918  17.52407 6.02788  1.000 26.73344  ? 84  GLU A OE1  1 
ATOM   1427 O OE2  . GLU A 1 84  ? 20.42227  15.76394 5.83740  1.000 30.47598  ? 84  GLU A OE2  1 
ATOM   1428 H H    . GLU A 1 84  ? 17.24155  17.71269 5.78080  1.000 27.27004  ? 84  GLU A H    1 
ATOM   1429 H HA   . GLU A 1 84  ? 15.71794  17.52278 3.65534  1.000 27.47304  ? 84  GLU A HA   1 
ATOM   1430 H HB2  . GLU A 1 84  ? 17.62522  16.60417 2.64671  1.000 28.51737  ? 84  GLU A HB2  1 
ATOM   1431 H HB3  . GLU A 1 84  ? 18.13582  17.77103 3.59704  1.000 28.51737  ? 84  GLU A HB3  1 
ATOM   1432 H HG2  . GLU A 1 84  ? 18.14296  15.14944 4.59256  1.000 28.01487  ? 84  GLU A HG2  1 
ATOM   1433 H HG3  . GLU A 1 84  ? 19.32822  15.59573 3.63266  1.000 28.01487  ? 84  GLU A HG3  1 
ATOM   1434 N N    . ASP A 1 85  ? 15.22031  15.17748 3.09413  1.000 20.56689  ? 85  ASP A N    1 
ATOM   1435 C CA   . ASP A 1 85  ? 14.80581  13.77890 2.91675  1.000 20.03192  ? 85  ASP A CA   1 
ATOM   1436 C C    . ASP A 1 85  ? 16.03484  12.88248 2.93723  1.000 21.16531  ? 85  ASP A C    1 
ATOM   1437 O O    . ASP A 1 85  ? 16.90564  12.96420 2.04469  1.000 23.54064  ? 85  ASP A O    1 
ATOM   1438 C CB   . ASP A 1 85  ? 14.02235  13.59696 1.62738  1.000 20.02966  ? 85  ASP A CB   1 
ATOM   1439 C CG   . ASP A 1 85  ? 12.75534  14.36998 1.58131  1.000 20.96960  ? 85  ASP A CG   1 
ATOM   1440 O OD1  . ASP A 1 85  ? 11.98473  14.30436 2.59404  1.000 21.59351  ? 85  ASP A OD1  1 
ATOM   1441 O OD2  . ASP A 1 85  ? 12.45683  15.01198 0.52985  1.000 20.52932  ? 85  ASP A OD2  1 
ATOM   1442 H H    . ASP A 1 85  ? 15.12165  15.66867 2.39514  1.000 24.68515  ? 85  ASP A H    1 
ATOM   1443 H HA   . ASP A 1 85  ? 14.22222  13.53267 3.65138  1.000 24.04319  ? 85  ASP A HA   1 
ATOM   1444 H HB2  . ASP A 1 85  ? 14.57318  13.88802 0.88388  1.000 24.04048  ? 85  ASP A HB2  1 
ATOM   1445 H HB3  . ASP A 1 85  ? 13.79945  12.65821 1.52756  1.000 24.04048  ? 85  ASP A HB3  1 
ATOM   1446 N N    . GLU A 1 86  ? 16.13893  12.04001 3.96707  1.000 21.02001  ? 86  GLU A N    1 
ATOM   1447 C CA   . GLU A 1 86  ? 17.37663  11.30411 4.18126  1.000 21.62123  ? 86  GLU A CA   1 
ATOM   1448 C C    . GLU A 1 86  ? 17.58795  10.22516 3.12431  1.000 23.55447  ? 86  GLU A C    1 
ATOM   1449 O O    . GLU A 1 86  ? 18.66512  10.14787 2.49909  1.000 26.82709  ? 86  GLU A O    1 
ATOM   1450 C CB   . GLU A 1 86  ? 17.35427  10.73899 5.60179  1.000 22.76119  ? 86  GLU A CB   1 
ATOM   1451 C CG   . GLU A 1 86  ? 18.57633  9.98598  6.00895  1.000 23.40328  ? 86  GLU A CG   1 
ATOM   1452 C CD   . GLU A 1 86  ? 18.60218  9.62062  7.50003  1.000 24.42094  ? 86  GLU A CD   1 
ATOM   1453 O OE1  . GLU A 1 86  ? 17.54602  9.67772  8.15217  1.000 23.56684  ? 86  GLU A OE1  1 
ATOM   1454 O OE2  . GLU A 1 86  ? 19.71201  9.28196  7.96183  1.000 26.27114  ? 86  GLU A OE2  1 
ATOM   1455 H H    . GLU A 1 86  ? 15.51913  11.88223 4.54201  1.000 25.22889  ? 86  GLU A H    1 
ATOM   1456 H HA   . GLU A 1 86  ? 18.13908  11.89831 4.10069  1.000 25.95035  ? 86  GLU A HA   1 
ATOM   1457 H HB2  . GLU A 1 86  ? 17.24881  11.47681 6.22259  1.000 27.31832  ? 86  GLU A HB2  1 
ATOM   1458 H HB3  . GLU A 1 86  ? 16.60167  10.13172 5.67730  1.000 27.31832  ? 86  GLU A HB3  1 
ATOM   1459 H HG2  . GLU A 1 86  ? 18.61983  9.16106  5.50050  1.000 28.08882  ? 86  GLU A HG2  1 
ATOM   1460 H HG3  . GLU A 1 86  ? 19.35666  10.53152 5.82353  1.000 28.08882  ? 86  GLU A HG3  1 
ATOM   1461 N N    . ASN A 1 87  ? 16.57880  9.39734  2.89101  1.000 21.41080  ? 87  ASN A N    1 
ATOM   1462 C CA   . ASN A 1 87  ? 16.60862  8.42203  1.80678  1.000 20.90097  ? 87  ASN A CA   1 
ATOM   1463 C C    . ASN A 1 87  ? 15.19878  7.87317  1.70736  1.000 22.45049  ? 87  ASN A C    1 
ATOM   1464 O O    . ASN A 1 87  ? 14.35316  8.16091  2.56262  1.000 22.43638  ? 87  ASN A O    1 
ATOM   1465 C CB   . ASN A 1 87  ? 17.63936  7.31135  2.01429  1.000 24.06938  ? 87  ASN A CB   1 
ATOM   1466 C CG   . ASN A 1 87  ? 17.34831  6.42964  3.23351  1.000 25.88353  ? 87  ASN A CG   1 
ATOM   1467 O OD1  . ASN A 1 87  ? 16.25419  5.85786  3.35012  1.000 25.75422  ? 87  ASN A OD1  1 
ATOM   1468 N ND2  . ASN A 1 87  ? 18.34052  6.33951  4.18633  1.000 27.61367  ? 87  ASN A ND2  1 
ATOM   1469 H H    . ASN A 1 87  ? 15.85368  9.37947  3.35305  1.000 25.69784  ? 87  ASN A H    1 
ATOM   1470 H HA   . ASN A 1 87  ? 16.85595  8.85733  0.97597  1.000 25.08604  ? 87  ASN A HA   1 
ATOM   1471 H HB2  . ASN A 1 87  ? 17.64732  6.74056  1.23005  1.000 28.88814  ? 87  ASN A HB2  1 
ATOM   1472 H HB3  . ASN A 1 87  ? 18.51283  7.71387  2.14053  1.000 28.88814  ? 87  ASN A HB3  1 
ATOM   1473 H HD21 . ASN A 1 87  ? 18.22084  5.85595  4.88736  1.000 33.14128  ? 87  ASN A HD21 1 
ATOM   1474 H HD22 . ASN A 1 87  ? 19.07918  6.76684  4.07970  1.000 33.14128  ? 87  ASN A HD22 1 
ATOM   1475 N N    . PHE A 1 88  ? 14.94573  7.08908  0.66713  1.000 24.50967  ? 88  PHE A N    1 
ATOM   1476 C CA   . PHE A 1 88  ? 13.66085  6.42394  0.46077  1.000 22.45648  ? 88  PHE A CA   1 
ATOM   1477 C C    . PHE A 1 88  ? 13.80852  4.91182  0.34309  1.000 23.67202  ? 88  PHE A C    1 
ATOM   1478 O O    . PHE A 1 88  ? 13.08604  4.23493  -0.41370 1.000 27.20044  ? 88  PHE A O    1 
ATOM   1479 C CB   . PHE A 1 88  ? 12.93759  7.00469  -0.72988 1.000 23.77395  ? 88  PHE A CB   1 
ATOM   1480 C CG   . PHE A 1 88  ? 12.64764  8.48933  -0.58696 1.000 21.72975  ? 88  PHE A CG   1 
ATOM   1481 C CD1  . PHE A 1 88  ? 11.63640  8.96915  0.23725  1.000 20.39065  ? 88  PHE A CD1  1 
ATOM   1482 C CD2  . PHE A 1 88  ? 13.42808  9.42185  -1.26973 1.000 23.47162  ? 88  PHE A CD2  1 
ATOM   1483 C CE1  . PHE A 1 88  ? 11.35856  10.32294 0.32555  1.000 22.13474  ? 88  PHE A CE1  1 
ATOM   1484 C CE2  . PHE A 1 88  ? 13.15997  10.77777 -1.16222 1.000 23.39996  ? 88  PHE A CE2  1 
ATOM   1485 C CZ   . PHE A 1 88  ? 12.15466  11.23423 -0.35356 1.000 22.50024  ? 88  PHE A CZ   1 
ATOM   1486 H H    . PHE A 1 88  ? 15.51857  6.92105  0.04808  1.000 29.41648  ? 88  PHE A H    1 
ATOM   1487 H HA   . PHE A 1 88  ? 13.11424  6.58370  1.24601  1.000 26.95266  ? 88  PHE A HA   1 
ATOM   1488 H HB2  . PHE A 1 88  ? 13.48562  6.88225  -1.52081 1.000 28.53362  ? 88  PHE A HB2  1 
ATOM   1489 H HB3  . PHE A 1 88  ? 12.09081  6.54416  -0.83845 1.000 28.53362  ? 88  PHE A HB3  1 
ATOM   1490 H HD1  . PHE A 1 88  ? 11.13568  8.36812  0.74019  1.000 24.47366  ? 88  PHE A HD1  1 
ATOM   1491 H HD2  . PHE A 1 88  ? 14.13392  9.13186  -1.80133 1.000 28.17083  ? 88  PHE A HD2  1 
ATOM   1492 H HE1  . PHE A 1 88  ? 10.64148  10.62006 0.83781  1.000 26.56657  ? 88  PHE A HE1  1 
ATOM   1493 H HE2  . PHE A 1 88  ? 13.67052  11.38581 -1.64650 1.000 28.08483  ? 88  PHE A HE2  1 
ATOM   1494 H HZ   . PHE A 1 88  ? 12.00630  12.14754 -0.25998 1.000 27.00517  ? 88  PHE A HZ   1 
ATOM   1495 N N    . ILE A 1 89  ? 14.68126  4.33385  1.18200  1.000 23.06298  ? 89  ILE A N    1 
ATOM   1496 C CA   . ILE A 1 89  ? 14.93049  2.89740  1.13600  1.000 25.91153  ? 89  ILE A CA   1 
ATOM   1497 C C    . ILE A 1 89  ? 13.67354  2.12863  1.50134  1.000 25.54453  ? 89  ILE A C    1 
ATOM   1498 O O    . ILE A 1 89  ? 13.34195  1.10922  0.87467  1.000 30.06887  ? 89  ILE A O    1 
ATOM   1499 C CB   . ILE A 1 89  ? 16.08642  2.53089  2.09045  1.000 30.34292  ? 89  ILE A CB   1 
ATOM   1500 C CG1  . ILE A 1 89  ? 17.37614  3.14236  1.58565  1.000 36.71931  ? 89  ILE A CG1  1 
ATOM   1501 C CG2  . ILE A 1 89  ? 16.18921  0.99969  2.28161  1.000 38.06768  ? 89  ILE A CG2  1 
ATOM   1502 C CD1  . ILE A 1 89  ? 18.43165  3.16757  2.68068  1.000 41.55829  ? 89  ILE A CD1  1 
ATOM   1503 H H    . ILE A 1 89  ? 15.13561  4.75240  1.78032  1.000 27.68045  ? 89  ILE A H    1 
ATOM   1504 H HA   . ILE A 1 89  ? 15.18400  2.66093  0.23006  1.000 31.09871  ? 89  ILE A HA   1 
ATOM   1505 H HB   . ILE A 1 89  ? 15.90475  2.90283  2.96769  1.000 36.41639  ? 89  ILE A HB   1 
ATOM   1506 H HG12 . ILE A 1 89  ? 17.71420  2.61608  0.84427  1.000 44.06806  ? 89  ILE A HG12 1 
ATOM   1507 H HG13 . ILE A 1 89  ? 17.20999  4.05346  1.29720  1.000 44.06806  ? 89  ILE A HG13 1 
ATOM   1508 H HG21 . ILE A 1 89  ? 17.03152  0.79142  2.71524  1.000 45.68610  ? 89  ILE A HG21 1 
ATOM   1509 H HG22 . ILE A 1 89  ? 15.45002  0.70003  2.83360  1.000 45.68610  ? 89  ILE A HG22 1 
ATOM   1510 H HG23 . ILE A 1 89  ? 16.14906  0.56961  1.41309  1.000 45.68610  ? 89  ILE A HG23 1 
ATOM   1511 H HD11 . ILE A 1 89  ? 19.23347  3.59147  2.33673  1.000 49.87483  ? 89  ILE A HD11 1 
ATOM   1512 H HD12 . ILE A 1 89  ? 18.09024  3.67003  3.43690  1.000 49.87483  ? 89  ILE A HD12 1 
ATOM   1513 H HD13 . ILE A 1 89  ? 18.62866  2.25690  2.95043  1.000 49.87483  ? 89  ILE A HD13 1 
ATOM   1514 N N    . LEU A 1 90  ? 12.97089  2.58717  2.53688  1.000 23.29453  ? 90  LEU A N    1 
ATOM   1515 C CA   . LEU A 1 90  ? 11.83131  1.85787  3.06513  1.000 26.57312  ? 90  LEU A CA   1 
ATOM   1516 C C    . LEU A 1 90  ? 10.53198  2.35961  2.44492  1.000 24.63914  ? 90  LEU A C    1 
ATOM   1517 O O    . LEU A 1 90  ? 10.40396  3.53741  2.07986  1.000 24.79881  ? 90  LEU A O    1 
ATOM   1518 C CB   . LEU A 1 90  ? 11.77233  1.96008  4.59190  1.000 26.75526  ? 90  LEU A CB   1 
ATOM   1519 C CG   . LEU A 1 90  ? 13.02363  1.40276  5.27094  1.000 27.68068  ? 90  LEU A CG   1 
ATOM   1520 C CD1  . LEU A 1 90  ? 12.97326  1.81985  6.70617  1.000 31.35059  ? 90  LEU A CD1  1 
ATOM   1521 C CD2  . LEU A 1 90  ? 13.10498  -0.08247 5.05887  1.000 35.02998  ? 90  LEU A CD2  1 
ATOM   1522 H H    . LEU A 1 90  ? 13.13934  3.32273  2.94942  1.000 27.95831  ? 90  LEU A H    1 
ATOM   1523 H HA   . LEU A 1 90  ? 11.92437  0.92005  2.83548  1.000 31.89263  ? 90  LEU A HA   1 
ATOM   1524 H HB2  . LEU A 1 90  ? 11.68446  2.89316  4.84199  1.000 32.11119  ? 90  LEU A HB2  1 
ATOM   1525 H HB3  . LEU A 1 90  ? 11.00700  1.45735  4.91194  1.000 32.11119  ? 90  LEU A HB3  1 
ATOM   1526 H HG   . LEU A 1 90  ? 13.84646  1.75111  4.89343  1.000 33.22170  ? 90  LEU A HG   1 
ATOM   1527 H HD11 . LEU A 1 90  ? 13.84718  1.68531  7.10499  1.000 37.62558  ? 90  LEU A HD11 1 
ATOM   1528 H HD12 . LEU A 1 90  ? 12.72850  2.75723  6.75423  1.000 37.62558  ? 90  LEU A HD12 1 
ATOM   1529 H HD13 . LEU A 1 90  ? 12.31219  1.28124  7.16855  1.000 37.62558  ? 90  LEU A HD13 1 
ATOM   1530 H HD21 . LEU A 1 90  ? 13.71751  -0.46118 5.70872  1.000 42.04086  ? 90  LEU A HD21 1 
ATOM   1531 H HD22 . LEU A 1 90  ? 12.22177  -0.46672 5.17370  1.000 42.04086  ? 90  LEU A HD22 1 
ATOM   1532 H HD23 . LEU A 1 90  ? 13.42697  -0.25603 4.16049  1.000 42.04086  ? 90  LEU A HD23 1 
ATOM   1533 N N    . LYS A 1 91  ? 9.60377   1.41522  2.23534  1.000 26.91285  ? 91  LYS A N    1 
ATOM   1534 C CA   . LYS A 1 91  ? 8.35067   1.72107  1.54816  1.000 23.08994  ? 91  LYS A CA   1 
ATOM   1535 C C    . LYS A 1 91  ? 7.16440   1.61906  2.49942  1.000 22.60316  ? 91  LYS A C    1 
ATOM   1536 O O    . LYS A 1 91  ? 7.24067   1.06929  3.60580  1.000 24.42604  ? 91  LYS A O    1 
ATOM   1537 C CB   . LYS A 1 91  ? 8.13995   0.81198  0.34362  1.000 29.11803  ? 91  LYS A CB   1 
ATOM   1538 C CG   . LYS A 1 91  ? 9.26388   0.93617  -0.72909 1.000 42.69671  ? 91  LYS A CG   1 
ATOM   1539 C CD   . LYS A 1 91  ? 8.89154   0.15494  -1.96618 1.000 71.02951  ? 91  LYS A CD   1 
ATOM   1540 C CE   . LYS A 1 91  ? 9.88754   0.38158  -3.10780 1.000 88.31235  ? 91  LYS A CE   1 
ATOM   1541 N NZ   . LYS A 1 91  ? 9.84110   1.78001  -3.63005 1.000 92.11035  ? 91  LYS A NZ   1 
ATOM   1542 H H    . LYS A 1 91  ? 9.68183   0.59534  2.48292  1.000 32.30031  ? 91  LYS A H    1 
ATOM   1543 H HA   . LYS A 1 91  ? 8.39954   2.63623  1.23035  1.000 27.71281  ? 91  LYS A HA   1 
ATOM   1544 H HB2  . LYS A 1 91  ? 8.11789   -0.10926 0.64649  1.000 34.94652  ? 91  LYS A HB2  1 
ATOM   1545 H HB3  . LYS A 1 91  ? 7.29795   1.04243  -0.07928 1.000 34.94652  ? 91  LYS A HB3  1 
ATOM   1546 H HG2  . LYS A 1 91  ? 9.38024   1.86763  -0.97351 1.000 51.24093  ? 91  LYS A HG2  1 
ATOM   1547 H HG3  . LYS A 1 91  ? 10.09372  0.57991  -0.37504 1.000 51.24093  ? 91  LYS A HG3  1 
ATOM   1548 H HD2  . LYS A 1 91  ? 8.88244   -0.79188 -1.75556 1.000 85.24029  ? 91  LYS A HD2  1 
ATOM   1549 H HD3  . LYS A 1 91  ? 8.01403   0.43579  -2.26947 1.000 85.24029  ? 91  LYS A HD3  1 
ATOM   1550 H HE2  . LYS A 1 91  ? 10.78598  0.20963  -2.78508 1.000 105.97971 ? 91  LYS A HE2  1 
ATOM   1551 H HE3  . LYS A 1 91  ? 9.67654   -0.22058 -3.83841 1.000 105.97971 ? 91  LYS A HE3  1 
ATOM   1552 H HZ1  . LYS A 1 91  ? 10.03910  2.35452  -2.97978 1.000 110.53730 ? 91  LYS A HZ1  1 
ATOM   1553 H HZ2  . LYS A 1 91  ? 10.42919  1.87785  -4.29087 1.000 110.53730 ? 91  LYS A HZ2  1 
ATOM   1554 H HZ3  . LYS A 1 91  ? 9.02663   1.96274  -3.93882 1.000 110.53730 ? 91  LYS A HZ3  1 
ATOM   1555 N N    . HIS A 1 92  ? 6.03284   2.16577  2.02978  1.000 21.82095  ? 92  HIS A N    1 
ATOM   1556 C CA   . HIS A 1 92  ? 4.76603   2.21190  2.76241  1.000 21.25108  ? 92  HIS A CA   1 
ATOM   1557 C C    . HIS A 1 92  ? 4.02859   0.91355  2.46258  1.000 23.96870  ? 92  HIS A C    1 
ATOM   1558 O O    . HIS A 1 92  ? 3.24330   0.80899  1.50741  1.000 26.71227  ? 92  HIS A O    1 
ATOM   1559 C CB   . HIS A 1 92  ? 3.95473   3.44572  2.36483  1.000 22.19867  ? 92  HIS A CB   1 
ATOM   1560 C CG   . HIS A 1 92  ? 4.60697   4.74190  2.66371  1.000 20.34292  ? 92  HIS A CG   1 
ATOM   1561 N ND1  . HIS A 1 92  ? 5.53402   5.31750  1.81942  1.000 19.75275  ? 92  HIS A ND1  1 
ATOM   1562 C CD2  . HIS A 1 92  ? 4.42554   5.62683  3.68769  1.000 20.47219  ? 92  HIS A CD2  1 
ATOM   1563 C CE1  . HIS A 1 92  ? 5.93338   6.46565  2.34509  1.000 20.55097  ? 92  HIS A CE1  1 
ATOM   1564 N NE2  . HIS A 1 92  ? 5.24995   6.69775  3.45576  1.000 20.58455  ? 92  HIS A NE2  1 
ATOM   1565 H H    . HIS A 1 92  ? 5.97487   2.53195  1.25380  1.000 26.19003  ? 92  HIS A H    1 
ATOM   1566 H HA   . HIS A 1 92  ? 4.93266   2.26420  3.71655  1.000 25.50618  ? 92  HIS A HA   1 
ATOM   1567 H HB2  . HIS A 1 92  ? 3.79451   3.41367  1.40869  1.000 26.64328  ? 92  HIS A HB2  1 
ATOM   1568 H HB3  . HIS A 1 92  ? 3.11122   3.42668  2.84339  1.000 26.64328  ? 92  HIS A HB3  1 
ATOM   1569 H HD1  . HIS A 1 92  ? 5.80744   4.98552  1.07468  1.000 23.70819  ? 92  HIS A HD1  1 
ATOM   1570 H HD2  . HIS A 1 92  ? 3.84880   5.52240  4.40975  1.000 24.57151  ? 92  HIS A HD2  1 
ATOM   1571 H HE1  . HIS A 1 92  ? 6.58973   7.02100  1.99055  1.000 24.66605  ? 92  HIS A HE1  1 
ATOM   1572 N N    . THR A 1 93  ? 4.33778   -0.13030 3.23617  1.000 23.57427  ? 93  THR A N    1 
ATOM   1573 C CA   . THR A 1 93  ? 3.92144   -1.46687 2.89166  1.000 25.95360  ? 93  THR A CA   1 
ATOM   1574 C C    . THR A 1 93  ? 2.58238   -1.89020 3.48639  1.000 26.23349  ? 93  THR A C    1 
ATOM   1575 O O    . THR A 1 93  ? 2.05774   -2.93492 3.08818  1.000 31.00313  ? 93  THR A O    1 
ATOM   1576 C CB   . THR A 1 93  ? 5.00756   -2.46713 3.32242  1.000 29.01659  ? 93  THR A CB   1 
ATOM   1577 O OG1  . THR A 1 93  ? 5.33951   -2.25767 4.69406  1.000 32.54883  ? 93  THR A OG1  1 
ATOM   1578 C CG2  . THR A 1 93  ? 6.22361   -2.29079 2.46692  1.000 33.72696  ? 93  THR A CG2  1 
ATOM   1579 H H    . THR A 1 93  ? 4.78987   -0.07767 3.96586  1.000 28.29401  ? 93  THR A H    1 
ATOM   1580 H HA   . THR A 1 93  ? 3.81732   -1.50816 1.92815  1.000 31.14921  ? 93  THR A HA   1 
ATOM   1581 H HB   . THR A 1 93  ? 4.68575   -3.37616 3.21758  1.000 34.82479  ? 93  THR A HB   1 
ATOM   1582 H HG1  . THR A 1 93  ? 6.06666   -1.84133 4.75334  1.000 39.06348  ? 93  THR A HG1  1 
ATOM   1583 H HG21 . THR A 1 93  ? 6.98299   -2.73647 2.87386  1.000 40.47724  ? 93  THR A HG21 1 
ATOM   1584 H HG22 . THR A 1 93  ? 6.06906   -2.67133 1.58817  1.000 40.47724  ? 93  THR A HG22 1 
ATOM   1585 H HG23 . THR A 1 93  ? 6.42712   -1.34734 2.37005  1.000 40.47724  ? 93  THR A HG23 1 
ATOM   1586 N N    . GLY A 1 94  ? 2.01956   -1.13171 4.41715  1.000 26.26965  ? 94  GLY A N    1 
ATOM   1587 C CA   . GLY A 1 94  ? 0.79733   -1.54978 5.05904  1.000 29.66234  ? 94  GLY A CA   1 
ATOM   1588 C C    . GLY A 1 94  ? 0.58643   -0.82905 6.36637  1.000 26.98202  ? 94  GLY A C    1 
ATOM   1589 O O    . GLY A 1 94  ? 1.31441   0.10707  6.73515  1.000 24.00574  ? 94  GLY A O    1 
ATOM   1590 H H    . GLY A 1 94  ? 2.32922   -0.37655 4.68816  1.000 31.52846  ? 94  GLY A H    1 
ATOM   1591 H HA2  . GLY A 1 94  ? 0.04432   -1.36214 4.47710  1.000 35.59969  ? 94  GLY A HA2  1 
ATOM   1592 H HA3  . GLY A 1 94  ? 0.83183   -2.50337 5.23331  1.000 35.59969  ? 94  GLY A HA3  1 
ATOM   1593 N N    . PRO A 1 95  ? -0.40218  -1.28458 7.14186  1.000 25.01909  ? 95  PRO A N    1 
ATOM   1594 C CA   . PRO A 1 95  ? -0.68572  -0.61239 8.40015  1.000 24.73407  ? 95  PRO A CA   1 
ATOM   1595 C C    . PRO A 1 95  ? 0.48198   -0.71101 9.36234  1.000 24.57353  ? 95  PRO A C    1 
ATOM   1596 O O    . PRO A 1 95  ? 1.18886   -1.73419 9.40923  1.000 29.10854  ? 95  PRO A O    1 
ATOM   1597 C CB   . PRO A 1 95  ? -1.89826  -1.36858 8.95208  1.000 29.21998  ? 95  PRO A CB   1 
ATOM   1598 C CG   . PRO A 1 95  ? -2.43241  -2.16051 7.86521  1.000 37.56986  ? 95  PRO A CG   1 
ATOM   1599 C CD   . PRO A 1 95  ? -1.37086  -2.35174 6.83325  1.000 31.15682  ? 95  PRO A CD   1 
ATOM   1600 H HA   . PRO A 1 95  ? -0.91182  0.31709  8.23940  1.000 29.68577  ? 95  PRO A HA   1 
ATOM   1601 H HB2  . PRO A 1 95  ? -1.61583  -1.94068 9.68271  1.000 35.06885  ? 95  PRO A HB2  1 
ATOM   1602 H HB3  . PRO A 1 95  ? -2.55947  -0.73193 9.26573  1.000 35.06885  ? 95  PRO A HB3  1 
ATOM   1603 H HG2  . PRO A 1 95  ? -2.71540  -3.02060 8.21314  1.000 45.08871  ? 95  PRO A HG2  1 
ATOM   1604 H HG3  . PRO A 1 95  ? -3.18979  -1.69332 7.47919  1.000 45.08871  ? 95  PRO A HG3  1 
ATOM   1605 H HD2  . PRO A 1 95  ? -0.95995  -3.22625 6.91858  1.000 37.39307  ? 95  PRO A HD2  1 
ATOM   1606 H HD3  . PRO A 1 95  ? -1.73344  -2.24124 5.94038  1.000 37.39307  ? 95  PRO A HD3  1 
ATOM   1607 N N    . GLY A 1 96  ? 0.64170   0.34569  10.14530 1.000 22.33986  ? 96  GLY A N    1 
ATOM   1608 C CA   . GLY A 1 96  ? 1.64426   0.42037  11.20375 1.000 24.05417  ? 96  GLY A CA   1 
ATOM   1609 C C    . GLY A 1 96  ? 2.92586   1.10740  10.81322 1.000 21.65292  ? 96  GLY A C    1 
ATOM   1610 O O    . GLY A 1 96  ? 3.74168   1.41256  11.69355 1.000 23.57418  ? 96  GLY A O    1 
ATOM   1611 H H    . GLY A 1 96  ? 0.16549   1.05908  10.08286 1.000 26.81271  ? 96  GLY A H    1 
ATOM   1612 H HA2  . GLY A 1 96  ? 1.26695   0.90318  11.95570 1.000 28.86988  ? 96  GLY A HA2  1 
ATOM   1613 H HA3  . GLY A 1 96  ? 1.86578   -0.48079 11.48614 1.000 28.86988  ? 96  GLY A HA3  1 
ATOM   1614 N N    . ILE A 1 97  ? 3.06520   1.47743  9.54282  1.000 20.57875  ? 97  ILE A N    1 
ATOM   1615 C CA   . ILE A 1 97  ? 4.24097   2.20245  9.09518  1.000 21.39382  ? 97  ILE A CA   1 
ATOM   1616 C C    . ILE A 1 97  ? 4.21557   3.64112  9.60706  1.000 20.46402  ? 97  ILE A C    1 
ATOM   1617 O O    . ILE A 1 97  ? 3.17535   4.32165  9.59149  1.000 20.38733  ? 97  ILE A O    1 
ATOM   1618 C CB   . ILE A 1 97  ? 4.29874   2.16228  7.55169  1.000 20.92263  ? 97  ILE A CB   1 
ATOM   1619 C CG1  . ILE A 1 97  ? 4.68028   0.79232  7.03181  1.000 25.66042  ? 97  ILE A CG1  1 
ATOM   1620 C CG2  . ILE A 1 97  ? 5.21181   3.28452  6.97893  1.000 22.71260  ? 97  ILE A CG2  1 
ATOM   1621 C CD1  . ILE A 1 97  ? 6.09713   0.34791  7.31360  1.000 33.13411  ? 97  ILE A CD1  1 
ATOM   1622 H H    . ILE A 1 97  ? 2.49094   1.31911  8.92252  1.000 24.67009  ? 97  ILE A H    1 
ATOM   1623 H HA   . ILE A 1 97  ? 5.03433   1.78110  9.46116  1.000 25.67747  ? 97  ILE A HA   1 
ATOM   1624 H HB   . ILE A 1 97  ? 3.39971   2.33794  7.23266  1.000 25.11203  ? 97  ILE A HB   1 
ATOM   1625 H HG12 . ILE A 1 97  ? 4.08911   0.13877  7.43713  1.000 30.79739  ? 97  ILE A HG12 1 
ATOM   1626 H HG13 . ILE A 1 97  ? 4.56583   0.79088  6.06859  1.000 30.79739  ? 97  ILE A HG13 1 
ATOM   1627 H HG21 . ILE A 1 97  ? 5.45659   3.05832  6.06799  1.000 27.26000  ? 97  ILE A HG21 1 
ATOM   1628 H HG22 . ILE A 1 97  ? 4.72630   4.12417  6.99220  1.000 27.26000  ? 97  ILE A HG22 1 
ATOM   1629 H HG23 . ILE A 1 97  ? 6.00848   3.35437  7.52788  1.000 27.26000  ? 97  ILE A HG23 1 
ATOM   1630 H HD11 . ILE A 1 97  ? 6.25357   -0.50411 6.87715  1.000 39.76581  ? 97  ILE A HD11 1 
ATOM   1631 H HD12 . ILE A 1 97  ? 6.71169   1.01423  6.96827  1.000 39.76581  ? 97  ILE A HD12 1 
ATOM   1632 H HD13 . ILE A 1 97  ? 6.21427   0.25504  8.27201  1.000 39.76581  ? 97  ILE A HD13 1 
ATOM   1633 N N    A LEU A 1 98  ? 5.37376   4.11909  10.05082 0.673 18.79984  ? 98  LEU A N    1 
ATOM   1634 N N    B LEU A 1 98  ? 5.37921   4.13398  10.06091 0.327 19.64297  ? 98  LEU A N    1 
ATOM   1635 C CA   A LEU A 1 98  ? 5.58946   5.44551  10.59281 0.673 18.40912  ? 98  LEU A CA   1 
ATOM   1636 C CA   B LEU A 1 98  ? 5.59083   5.53814  10.41248 0.327 19.12969  ? 98  LEU A CA   1 
ATOM   1637 C C    A LEU A 1 98  ? 6.42398   6.22003  9.57826  0.673 18.45488  ? 98  LEU A C    1 
ATOM   1638 C C    B LEU A 1 98  ? 6.31996   6.24988  9.28426  0.327 18.42361  ? 98  LEU A C    1 
ATOM   1639 O O    A LEU A 1 98  ? 7.50960   5.75635  9.18737  0.673 19.80357  ? 98  LEU A O    1 
ATOM   1640 O O    B LEU A 1 98  ? 7.39045   5.79554  8.83590  0.327 20.03682  ? 98  LEU A O    1 
ATOM   1641 C CB   A LEU A 1 98  ? 6.30066   5.29134  11.93205 0.673 22.68534  ? 98  LEU A CB   1 
ATOM   1642 C CB   B LEU A 1 98  ? 6.43164   5.69381  11.67922 0.327 18.22649  ? 98  LEU A CB   1 
ATOM   1643 C CG   A LEU A 1 98  ? 6.63794   6.54520  12.68876 0.673 22.75969  ? 98  LEU A CG   1 
ATOM   1644 C CG   B LEU A 1 98  ? 5.79463   5.49417  13.04521 0.327 22.37464  ? 98  LEU A CG   1 
ATOM   1645 C CD1  A LEU A 1 98  ? 5.38708   7.34578  13.07575 0.673 24.00774  ? 98  LEU A CD1  1 
ATOM   1646 C CD1  B LEU A 1 98  ? 6.86681   5.46243  14.13094 0.327 25.80053  ? 98  LEU A CD1  1 
ATOM   1647 C CD2  A LEU A 1 98  ? 7.43575   6.14145  13.92742 0.673 24.14606  ? 98  LEU A CD2  1 
ATOM   1648 C CD2  B LEU A 1 98  ? 4.84092   6.58405  13.35382 0.327 25.59742  ? 98  LEU A CD2  1 
ATOM   1649 H H    A LEU A 1 98  ? 6.09846   3.65608  10.04558 0.673 22.56469  ? 98  LEU A H    1 
ATOM   1650 H H    B LEU A 1 98  ? 6.08283   3.65305  10.17591 0.327 23.57645  ? 98  LEU A H    1 
ATOM   1651 H HA   A LEU A 1 98  ? 4.76687   5.94116  10.72908 0.673 22.09582  ? 98  LEU A HA   1 
ATOM   1652 H HA   B LEU A 1 98  ? 4.71875   5.93796  10.55574 0.327 22.96051  ? 98  LEU A HA   1 
ATOM   1653 H HB2  A LEU A 1 98  ? 5.73163   4.75942  12.51013 0.673 27.22729  ? 98  LEU A HB2  1 
ATOM   1654 H HB2  B LEU A 1 98  ? 7.15582   5.05092  11.62300 0.327 21.87667  ? 98  LEU A HB2  1 
ATOM   1655 H HB3  A LEU A 1 98  ? 7.13710   4.82711  11.77155 0.673 27.22729  ? 98  LEU A HB3  1 
ATOM   1656 H HB3  B LEU A 1 98  ? 6.78801   6.59597  11.67728 0.327 21.87667  ? 98  LEU A HB3  1 
ATOM   1657 H HG   A LEU A 1 98  ? 7.16334   7.13730  12.12816 0.673 27.31651  ? 98  LEU A HG   1 
ATOM   1658 H HG   B LEU A 1 98  ? 5.31553   4.65083  13.03309 0.327 26.85446  ? 98  LEU A HG   1 
ATOM   1659 H HD11 A LEU A 1 98  ? 5.66065   8.19919  13.44690 0.673 28.81417  ? 98  LEU A HD11 1 
ATOM   1660 H HD11 B LEU A 1 98  ? 6.49083   5.80659  14.95623 0.327 30.96552  ? 98  LEU A HD11 1 
ATOM   1661 H HD12 A LEU A 1 98  ? 4.84553   7.48790  12.28365 0.673 28.81417  ? 98  LEU A HD12 1 
ATOM   1662 H HD12 B LEU A 1 98  ? 7.16070   4.54678  14.25789 0.327 30.96552  ? 98  LEU A HD12 1 
ATOM   1663 H HD13 A LEU A 1 98  ? 4.88290   6.84446  13.73558 0.673 28.81417  ? 98  LEU A HD13 1 
ATOM   1664 H HD13 B LEU A 1 98  ? 7.61447   6.01423  13.85267 0.327 30.96552  ? 98  LEU A HD13 1 
ATOM   1665 H HD21 A LEU A 1 98  ? 7.82424   6.93603  14.32569 0.673 28.98016  ? 98  LEU A HD21 1 
ATOM   1666 H HD21 B LEU A 1 98  ? 4.45479   6.42722  14.22972 0.327 30.72179  ? 98  LEU A HD21 1 
ATOM   1667 H HD22 A LEU A 1 98  ? 6.83980   5.71162  14.56065 0.673 28.98016  ? 98  LEU A HD22 1 
ATOM   1668 H HD22 B LEU A 1 98  ? 5.31551   7.43000  13.34820 0.327 30.72179  ? 98  LEU A HD22 1 
ATOM   1669 H HD23 A LEU A 1 98  ? 8.13800   5.52631  13.66408 0.673 28.98016  ? 98  LEU A HD23 1 
ATOM   1670 H HD23 B LEU A 1 98  ? 4.14225   6.59226  12.68098 0.327 30.72179  ? 98  LEU A HD23 1 
ATOM   1671 N N    A SER A 1 99  ? 5.89836   7.35289  9.11822  0.673 16.76641  ? 99  SER A N    1 
ATOM   1672 N N    B SER A 1 99  ? 5.77018   7.36767  8.83200  0.327 16.72995  ? 99  SER A N    1 
ATOM   1673 C CA   A SER A 1 99  ? 6.46907   8.08849  8.00321  0.673 17.71058  ? 99  SER A CA   1 
ATOM   1674 C CA   B SER A 1 99  ? 6.54698   8.13748  7.88217  0.327 19.73195  ? 99  SER A CA   1 
ATOM   1675 C C    A SER A 1 99  ? 6.41746   9.59836  8.27954  0.673 17.78806  ? 99  SER A C    1 
ATOM   1676 C C    B SER A 1 99  ? 6.30796   9.62492  8.07846  0.327 18.11846  ? 99  SER A C    1 
ATOM   1677 O O    A SER A 1 99  ? 5.62104   10.06315 9.07400  0.673 17.74965  ? 99  SER A O    1 
ATOM   1678 O O    B SER A 1 99  ? 5.28975   10.07058 8.61329  0.327 17.91459  ? 99  SER A O    1 
ATOM   1679 C CB   A SER A 1 99  ? 5.69924   7.74746  6.71172  0.673 19.24619  ? 99  SER A CB   1 
ATOM   1680 C CB   B SER A 1 99  ? 6.26157   7.73393  6.42673  0.327 24.78782  ? 99  SER A CB   1 
ATOM   1681 O OG   A SER A 1 99  ? 6.29459   8.35516  5.56277  0.673 19.14324  ? 99  SER A OG   1 
ATOM   1682 O OG   B SER A 1 99  ? 5.06858   8.31507  5.91590  0.327 22.74925  ? 99  SER A OG   1 
ATOM   1683 H H    A SER A 1 99  ? 5.19388   7.72154  9.44595  0.673 20.12458  ? 99  SER A H    1 
ATOM   1684 H H    B SER A 1 99  ? 4.99814   7.67898  9.04800  0.327 20.08082  ? 99  SER A H    1 
ATOM   1685 H HA   A SER A 1 99  ? 7.40577   7.86024  7.89647  0.673 21.25758  ? 99  SER A HA   1 
ATOM   1686 H HA   B SER A 1 99  ? 7.48458   7.96834  8.06438  0.327 23.68322  ? 99  SER A HA   1 
ATOM   1687 H HB2  A SER A 1 99  ? 5.70172   6.78488  6.59203  0.673 23.10032  ? 99  SER A HB2  1 
ATOM   1688 H HB2  B SER A 1 99  ? 7.00536   8.02376  5.87566  0.327 29.75027  ? 99  SER A HB2  1 
ATOM   1689 H HB3  A SER A 1 99  ? 4.78803   8.06874  6.79764  0.673 23.10032  ? 99  SER A HB3  1 
ATOM   1690 H HB3  B SER A 1 99  ? 6.17522   6.76862  6.38646  0.327 29.75027  ? 99  SER A HB3  1 
ATOM   1691 H HG   A SER A 1 99  ? 5.70069   8.70458  5.08236  0.673 22.97677  ? 99  SER A HG   1 
ATOM   1692 H HG   B SER A 1 99  ? 4.40232   8.01359  6.32919  0.327 27.30398  ? 99  SER A HG   1 
ATOM   1693 N N    . MET A 1 100 ? 7.29800   10.38395 7.63258  1.000 18.26612  ? 100 MET A N    1 
ATOM   1694 C CA   . MET A 1 100 ? 7.32486   11.82611 7.87354  1.000 17.59507  ? 100 MET A CA   1 
ATOM   1695 C C    . MET A 1 100 ? 6.36795   12.57672 6.97480  1.000 18.17302  ? 100 MET A C    1 
ATOM   1696 O O    . MET A 1 100 ? 6.33912   12.38433 5.75423  1.000 20.39929  ? 100 MET A O    1 
ATOM   1697 C CB   . MET A 1 100 ? 8.71799   12.37108 7.62868  1.000 20.80379  ? 100 MET A CB   1 
ATOM   1698 C CG   . MET A 1 100 ? 9.78608   11.97336 8.68137  1.000 21.92312  ? 100 MET A CG   1 
ATOM   1699 S SD   . MET A 1 100 ? 9.36548   12.40484 10.30692 1.000 21.69435  ? 100 MET A SD   1 
ATOM   1700 C CE   . MET A 1 100 ? 9.60366   14.20103 10.23193 1.000 27.69591  ? 100 MET A CE   1 
ATOM   1701 H H    . MET A 1 100 ? 7.87573   10.10172 7.06146  1.000 21.92422  ? 100 MET A H    1 
ATOM   1702 H HA   . MET A 1 100 ? 7.06171   11.96176 8.79726  1.000 21.11897  ? 100 MET A HA   1 
ATOM   1703 H HB2  . MET A 1 100 ? 9.02576   12.04580 6.76823  1.000 24.96943  ? 100 MET A HB2  1 
ATOM   1704 H HB3  . MET A 1 100 ? 8.66910   13.33979 7.61898  1.000 24.96943  ? 100 MET A HB3  1 
ATOM   1705 H HG2  . MET A 1 100 ? 9.90793   11.01144 8.65358  1.000 26.31262  ? 100 MET A HG2  1 
ATOM   1706 H HG3  . MET A 1 100 ? 10.61934  12.41974 8.46384  1.000 26.31262  ? 100 MET A HG3  1 
ATOM   1707 H HE1  . MET A 1 100 ? 9.32619   14.59187 11.07523 1.000 33.23997  ? 100 MET A HE1  1 
ATOM   1708 H HE2  . MET A 1 100 ? 10.54197  14.38882 10.07316 1.000 33.23997  ? 100 MET A HE2  1 
ATOM   1709 H HE3  . MET A 1 100 ? 9.06725   14.56079 9.50823  1.000 33.23997  ? 100 MET A HE3  1 
ATOM   1710 N N    . ALA A 1 101 ? 5.57884   13.45622 7.55397  1.000 17.31715  ? 101 ALA A N    1 
ATOM   1711 C CA   . ALA A 1 101 ? 4.83115   14.42633 6.79824  1.000 16.25718  ? 101 ALA A CA   1 
ATOM   1712 C C    . ALA A 1 101 ? 5.76224   15.50646 6.28129  1.000 19.54530  ? 101 ALA A C    1 
ATOM   1713 O O    . ALA A 1 101 ? 6.84259   15.74259 6.84662  1.000 21.90717  ? 101 ALA A O    1 
ATOM   1714 C CB   . ALA A 1 101 ? 3.76214   15.03606 7.69127  1.000 21.43985  ? 101 ALA A CB   1 
ATOM   1715 H H    . ALA A 1 101 ? 5.45746   13.51176 8.40355  1.000 20.78547  ? 101 ALA A H    1 
ATOM   1716 H HA   . ALA A 1 101 ? 4.39774   14.01129 6.03614  1.000 19.51349  ? 101 ALA A HA   1 
ATOM   1717 H HB1  . ALA A 1 101 ? 3.24611   15.67492 7.17506  1.000 25.73270  ? 101 ALA A HB1  1 
ATOM   1718 H HB2  . ALA A 1 101 ? 3.18291   14.32982 8.01780  1.000 25.73270  ? 101 ALA A HB2  1 
ATOM   1719 H HB3  . ALA A 1 101 ? 4.19132   15.48334 8.43736  1.000 25.73270  ? 101 ALA A HB3  1 
ATOM   1720 N N    . ASN A 1 102 ? 5.38409   16.15454 5.18277  1.000 20.89412  ? 102 ASN A N    1 
ATOM   1721 C CA   . ASN A 1 102 ? 6.19475   17.23241 4.65419  1.000 20.13986  ? 102 ASN A CA   1 
ATOM   1722 C C    . ASN A 1 102 ? 5.34171   18.11564 3.77398  1.000 23.96820  ? 102 ASN A C    1 
ATOM   1723 O O    . ASN A 1 102 ? 4.14846   17.84990 3.53970  1.000 26.67570  ? 102 ASN A O    1 
ATOM   1724 C CB   . ASN A 1 102 ? 7.41406   16.64186 3.90534  1.000 20.21449  ? 102 ASN A CB   1 
ATOM   1725 C CG   . ASN A 1 102 ? 7.05166   15.87892 2.68918  1.000 22.23528  ? 102 ASN A CG   1 
ATOM   1726 O OD1  . ASN A 1 102 ? 6.33629   16.36639 1.81689  1.000 23.79270  ? 102 ASN A OD1  1 
ATOM   1727 N ND2  . ASN A 1 102 ? 7.59132   14.67522 2.57062  1.000 21.73064  ? 102 ASN A ND2  1 
ATOM   1728 H H    . ASN A 1 102 ? 4.66945   15.98621 4.73493  1.000 25.07782  ? 102 ASN A H    1 
ATOM   1729 H HA   . ASN A 1 102 ? 6.50939   17.79480 5.37918  1.000 24.17272  ? 102 ASN A HA   1 
ATOM   1730 H HB2  . ASN A 1 102 ? 7.99761   17.36845 3.63619  1.000 24.26227  ? 102 ASN A HB2  1 
ATOM   1731 H HB3  . ASN A 1 102 ? 7.88645   16.04068 4.50227  1.000 24.26227  ? 102 ASN A HB3  1 
ATOM   1732 H HD21 . ASN A 1 102 ? 7.41374   14.19020 1.88300  1.000 26.08165  ? 102 ASN A HD21 1 
ATOM   1733 H HD22 . ASN A 1 102 ? 8.11931   14.37865 3.18125  1.000 26.08165  ? 102 ASN A HD22 1 
ATOM   1734 N N    . ALA A 1 103 ? 5.95811   19.19236 3.31532  1.000 21.61469  ? 103 ALA A N    1 
ATOM   1735 C CA   . ALA A 1 103 ? 5.32425   20.16014 2.42183  1.000 24.56578  ? 103 ALA A CA   1 
ATOM   1736 C C    . ALA A 1 103 ? 6.10933   20.39245 1.14174  1.000 24.57712  ? 103 ALA A C    1 
ATOM   1737 O O    . ALA A 1 103 ? 6.07784   21.49261 0.57602  1.000 31.82979  ? 103 ALA A O    1 
ATOM   1738 C CB   . ALA A 1 103 ? 5.13582   21.47073 3.16201  1.000 30.02766  ? 103 ALA A CB   1 
ATOM   1739 H H    . ALA A 1 103 ? 6.77061   19.39514 3.51107  1.000 25.94251  ? 103 ALA A H    1 
ATOM   1740 H HA   . ALA A 1 103 ? 4.46477   19.80358 2.14785  1.000 29.48381  ? 103 ALA A HA   1 
ATOM   1741 H HB1  . ALA A 1 103 ? 4.77724   22.13111 2.54865  1.000 36.03807  ? 103 ALA A HB1  1 
ATOM   1742 H HB2  . ALA A 1 103 ? 4.51827   21.33230 3.89711  1.000 36.03807  ? 103 ALA A HB2  1 
ATOM   1743 H HB3  . ALA A 1 103 ? 5.99428   21.76733 3.50258  1.000 36.03807  ? 103 ALA A HB3  1 
ATOM   1744 N N    . GLY A 1 104 ? 6.76887   19.36076 0.63650  1.000 21.73056  ? 104 GLY A N    1 
ATOM   1745 C CA   . GLY A 1 104 ? 7.62586   19.47560 -0.51619 1.000 23.50867  ? 104 GLY A CA   1 
ATOM   1746 C C    . GLY A 1 104 ? 8.93625   18.80680 -0.23750 1.000 21.77320  ? 104 GLY A C    1 
ATOM   1747 O O    . GLY A 1 104 ? 9.17165   18.32131 0.85247  1.000 21.69817  ? 104 GLY A O    1 
ATOM   1748 H H    . GLY A 1 104 ? 6.73131   18.56363 0.95707  1.000 26.08155  ? 104 GLY A H    1 
ATOM   1749 H HA2  . GLY A 1 104 ? 7.20963   19.05109 -1.28264 1.000 28.21528  ? 104 GLY A HA2  1 
ATOM   1750 H HA3  . GLY A 1 104 ? 7.78391   20.41063 -0.72023 1.000 28.21528  ? 104 GLY A HA3  1 
ATOM   1751 N N    A PRO A 1 105 ? 9.82059   18.70875 -1.23293 0.613 21.82777  ? 105 PRO A N    1 
ATOM   1752 N N    B PRO A 1 105 ? 9.81150   18.78074 -1.23274 0.387 22.22545  ? 105 PRO A N    1 
ATOM   1753 C CA   A PRO A 1 105 ? 11.09961  18.03885 -0.98573 0.613 20.51452  ? 105 PRO A CA   1 
ATOM   1754 C CA   B PRO A 1 105 ? 11.14100  18.18556 -1.06164 0.387 22.36548  ? 105 PRO A CA   1 
ATOM   1755 C C    A PRO A 1 105 ? 11.89844  18.75428 0.08650  0.613 19.41107  ? 105 PRO A C    1 
ATOM   1756 C C    B PRO A 1 105 ? 11.89408  18.80542 0.10855  0.387 20.43606  ? 105 PRO A C    1 
ATOM   1757 O O    A PRO A 1 105 ? 11.92995  19.99165 0.14661  0.613 25.17567  ? 105 PRO A O    1 
ATOM   1758 O O    B PRO A 1 105 ? 11.90727  20.03266 0.26281  0.387 21.62252  ? 105 PRO A O    1 
ATOM   1759 C CB   A PRO A 1 105 ? 11.81073  18.10218 -2.34459 0.613 25.62314  ? 105 PRO A CB   1 
ATOM   1760 C CB   B PRO A 1 105 ? 11.82300  18.50313 -2.39784 0.387 23.35752  ? 105 PRO A CB   1 
ATOM   1761 C CG   A PRO A 1 105 ? 11.19695  19.29802 -3.04368 0.613 27.69301  ? 105 PRO A CG   1 
ATOM   1762 C CG   B PRO A 1 105 ? 10.64364  18.66864 -3.38237 0.387 20.00690  ? 105 PRO A CG   1 
ATOM   1763 C CD   A PRO A 1 105 ? 9.75317   19.35582 -2.55423 0.613 27.37490  ? 105 PRO A CD   1 
ATOM   1764 C CD   B PRO A 1 105 ? 9.54939   19.27780 -2.59207 0.387 24.53073  ? 105 PRO A CD   1 
ATOM   1765 H HA   A PRO A 1 105 ? 10.95583  17.11386 -0.73152 0.613 24.62231  ? 105 PRO A HA   1 
ATOM   1766 H HA   B PRO A 1 105 ? 11.07709  17.22679 -0.92910 0.387 26.84346  ? 105 PRO A HA   1 
ATOM   1767 H HB2  A PRO A 1 105 ? 12.76392  18.22623 -2.21440 0.613 30.75265  ? 105 PRO A HB2  1 
ATOM   1768 H HB2  B PRO A 1 105 ? 12.33783  19.32201 -2.32504 0.387 28.03391  ? 105 PRO A HB2  1 
ATOM   1769 H HB3  A PRO A 1 105 ? 11.64736  17.28593 -2.84254 0.613 30.75265  ? 105 PRO A HB3  1 
ATOM   1770 H HB3  B PRO A 1 105 ? 12.40103  17.77019 -2.66161 0.387 28.03391  ? 105 PRO A HB3  1 
ATOM   1771 H HG2  A PRO A 1 105 ? 11.67707  20.10451 -2.79882 0.613 33.23650  ? 105 PRO A HG2  1 
ATOM   1772 H HG2  B PRO A 1 105 ? 10.90539  19.24967 -4.11366 0.387 24.01316  ? 105 PRO A HG2  1 
ATOM   1773 H HG3  A PRO A 1 105 ? 11.23089  19.17056 -4.00467 0.613 33.23650  ? 105 PRO A HG3  1 
ATOM   1774 H HG3  B PRO A 1 105 ? 10.37877  17.80120 -3.72632 0.387 24.01316  ? 105 PRO A HG3  1 
ATOM   1775 H HD2  A PRO A 1 105 ? 9.45173   20.27432 -2.47436 0.613 32.85477  ? 105 PRO A HD2  1 
ATOM   1776 H HD2  B PRO A 1 105 ? 9.59700   20.24615 -2.62253 0.387 29.44176  ? 105 PRO A HD2  1 
ATOM   1777 H HD3  A PRO A 1 105 ? 9.16620   18.86464 -3.15014 0.613 32.85477  ? 105 PRO A HD3  1 
ATOM   1778 H HD3  B PRO A 1 105 ? 8.68340   18.97805 -2.91006 0.387 29.44176  ? 105 PRO A HD3  1 
ATOM   1779 N N    . ASN A 1 106 ? 12.52151  17.95316 0.93222  1.000 21.17776  ? 106 ASN A N    1 
ATOM   1780 C CA   . ASN A 1 106 ? 13.45183  18.42768 1.96732  1.000 20.67167  ? 106 ASN A CA   1 
ATOM   1781 C C    . ASN A 1 106 ? 12.81344  19.46471 2.89508  1.000 20.27137  ? 106 ASN A C    1 
ATOM   1782 O O    . ASN A 1 106 ? 13.40729  20.49990 3.23038  1.000 22.52941  ? 106 ASN A O    1 
ATOM   1783 C CB   . ASN A 1 106 ? 14.69651  18.98968 1.27356  1.000 20.91246  ? 106 ASN A CB   1 
ATOM   1784 C CG   . ASN A 1 106 ? 15.29608  17.96678 0.35697  1.000 21.67999  ? 106 ASN A CG   1 
ATOM   1785 O OD1  . ASN A 1 106 ? 15.63065  16.87446 0.76773  1.000 22.09752  ? 106 ASN A OD1  1 
ATOM   1786 N ND2  . ASN A 1 106 ? 15.46570  18.34569 -0.93112 1.000 23.08502  ? 106 ASN A ND2  1 
ATOM   1787 H H    . ASN A 1 106 ? 12.42633  17.09846 0.93618  1.000 25.41819  ? 106 ASN A H    1 
ATOM   1788 H HA   . ASN A 1 106 ? 13.69793  17.68627 2.54236  1.000 24.81088  ? 106 ASN A HA   1 
ATOM   1789 H HB2  . ASN A 1 106 ? 14.45203  19.76860 0.74970  1.000 25.09983  ? 106 ASN A HB2  1 
ATOM   1790 H HB3  . ASN A 1 106 ? 15.35775  19.23255 1.94039  1.000 25.09983  ? 106 ASN A HB3  1 
ATOM   1791 H HD21 . ASN A 1 106 ? 15.80574  17.79712 -1.49950 1.000 27.70691  ? 106 ASN A HD21 1 
ATOM   1792 H HD22 . ASN A 1 106 ? 15.23346  19.13505 -1.18128 1.000 27.70691  ? 106 ASN A HD22 1 
ATOM   1793 N N    . THR A 1 107 ? 11.63577  19.10818 3.42228  1.000 20.68819  ? 107 THR A N    1 
ATOM   1794 C CA   . THR A 1 107 ? 10.91618  19.96907 4.35275  1.000 21.38687  ? 107 THR A CA   1 
ATOM   1795 C C    . THR A 1 107 ? 10.43989  19.20092 5.56551  1.000 22.11292  ? 107 THR A C    1 
ATOM   1796 O O    . THR A 1 107 ? 9.37830   19.51559 6.14593  1.000 26.91354  ? 107 THR A O    1 
ATOM   1797 C CB   . THR A 1 107 ? 9.74816   20.68558 3.68760  1.000 22.20140  ? 107 THR A CB   1 
ATOM   1798 O OG1  . THR A 1 107 ? 8.81470   19.73922 3.18679  1.000 23.17807  ? 107 THR A OG1  1 
ATOM   1799 C CG2  . THR A 1 107 ? 10.21097  21.58064 2.62728  1.000 26.14441  ? 107 THR A CG2  1 
ATOM   1800 H H    . THR A 1 107 ? 11.23533  18.36648 3.25163  1.000 24.83072  ? 107 THR A H    1 
ATOM   1801 H HA   . THR A 1 107 ? 11.53761  20.64998 4.65455  1.000 25.66912  ? 107 THR A HA   1 
ATOM   1802 H HB   . THR A 1 107 ? 9.29520   21.23755 4.34416  1.000 26.64657  ? 107 THR A HB   1 
ATOM   1803 H HG1  . THR A 1 107 ? 9.09538   18.95925 3.32263  1.000 27.81856  ? 107 THR A HG1  1 
ATOM   1804 H HG21 . THR A 1 107 ? 9.47281   22.11957 2.30234  1.000 31.37818  ? 107 THR A HG21 1 
ATOM   1805 H HG22 . THR A 1 107 ? 10.90363  22.16812 2.96785  1.000 31.37818  ? 107 THR A HG22 1 
ATOM   1806 H HG23 . THR A 1 107 ? 10.57137  21.06326 1.89017  1.000 31.37818  ? 107 THR A HG23 1 
ATOM   1807 N N    . ASN A 1 108 ? 11.19361  18.20790 6.01342  1.000 20.47308  ? 108 ASN A N    1 
ATOM   1808 C CA   . ASN A 1 108 ? 10.78357  17.46323 7.21272  1.000 20.27415  ? 108 ASN A CA   1 
ATOM   1809 C C    . ASN A 1 108 ? 10.94113  18.31329 8.46935  1.000 20.31106  ? 108 ASN A C    1 
ATOM   1810 O O    . ASN A 1 108 ? 11.92634  19.04326 8.62106  1.000 22.49770  ? 108 ASN A O    1 
ATOM   1811 C CB   . ASN A 1 108 ? 11.67015  16.23227 7.36988  1.000 19.35308  ? 108 ASN A CB   1 
ATOM   1812 C CG   . ASN A 1 108 ? 11.51027  15.27684 6.22010  1.000 21.66683  ? 108 ASN A CG   1 
ATOM   1813 O OD1  . ASN A 1 108 ? 10.47053  14.64186 6.07430  1.000 22.79901  ? 108 ASN A OD1  1 
ATOM   1814 N ND2  . ASN A 1 108 ? 12.49220  15.25881 5.31682  1.000 19.94044  ? 108 ASN A ND2  1 
ATOM   1815 H H    . ASN A 1 108 ? 11.93040  17.94548 5.65584  1.000 24.57258  ? 108 ASN A H    1 
ATOM   1816 H HA   . ASN A 1 108 ? 9.85328   17.20525 7.11839  1.000 24.33387  ? 108 ASN A HA   1 
ATOM   1817 H HB2  . ASN A 1 108 ? 12.59881  16.50997 7.40716  1.000 23.22858  ? 108 ASN A HB2  1 
ATOM   1818 H HB3  . ASN A 1 108 ? 11.42980  15.76752 8.18666  1.000 23.22858  ? 108 ASN A HB3  1 
ATOM   1819 H HD21 . ASN A 1 108 ? 12.44537  14.72864 4.64130  1.000 23.93340  ? 108 ASN A HD21 1 
ATOM   1820 H HD22 . ASN A 1 108 ? 13.17189  15.77737 5.41015  1.000 23.93340  ? 108 ASN A HD22 1 
ATOM   1821 N N    . GLY A 1 109 ? 9.98195   18.18618 9.39811  1.000 19.98302  ? 109 GLY A N    1 
ATOM   1822 C CA   . GLY A 1 109 ? 10.06323  18.90494 10.67350 1.000 20.82093  ? 109 GLY A CA   1 
ATOM   1823 C C    . GLY A 1 109 ? 9.83507   17.91280 11.79683 1.000 21.07308  ? 109 GLY A C    1 
ATOM   1824 O O    . GLY A 1 109 ? 10.69583  17.10152 12.10310 1.000 23.10289  ? 109 GLY A O    1 
ATOM   1825 H H    . GLY A 1 109 ? 9.28182   17.69416 9.31247  1.000 23.98450  ? 109 GLY A H    1 
ATOM   1826 H HA2  . GLY A 1 109 ? 10.93784  19.31193 10.77505 1.000 24.98999  ? 109 GLY A HA2  1 
ATOM   1827 H HA3  . GLY A 1 109 ? 9.38586   19.59816 10.71264 1.000 24.98999  ? 109 GLY A HA3  1 
ATOM   1828 N N    . SER A 1 110 ? 8.68409   17.99700 12.43792 1.000 19.27827  ? 110 SER A N    1 
ATOM   1829 C CA   . SER A 1 110 ? 8.29945   17.06307 13.48848 1.000 17.75449  ? 110 SER A CA   1 
ATOM   1830 C C    . SER A 1 110 ? 7.04533   16.28094 13.18575 1.000 17.59164  ? 110 SER A C    1 
ATOM   1831 O O    . SER A 1 110 ? 6.69125   15.36571 13.94853 1.000 20.01292  ? 110 SER A O    1 
ATOM   1832 C CB   . SER A 1 110 ? 8.12334   17.84649 14.79534 1.000 18.76647  ? 110 SER A CB   1 
ATOM   1833 O OG   . SER A 1 110 ? 7.15031   18.88564 14.67541 1.000 21.23099  ? 110 SER A OG   1 
ATOM   1834 H H    . SER A 1 110 ? 8.09129   18.60010 12.28153 1.000 23.13880  ? 110 SER A H    1 
ATOM   1835 H HA   . SER A 1 110 ? 9.00052   16.40508 13.61671 1.000 21.28098  ? 110 SER A HA   1 
ATOM   1836 H HB2  . SER A 1 110 ? 7.83711   17.23206 15.48920 1.000 22.52465  ? 110 SER A HB2  1 
ATOM   1837 H HB3  . SER A 1 110 ? 8.97459   18.24478 15.03539 1.000 22.52465  ? 110 SER A HB3  1 
ATOM   1838 H HG   . SER A 1 110 ? 6.39193   18.59529 14.89024 1.000 25.48208  ? 110 SER A HG   1 
ATOM   1839 N N    . GLN A 1 111 ? 6.27867   16.66165 12.15335 1.000 18.61365  ? 111 GLN A N    1 
ATOM   1840 C CA   . GLN A 1 111 ? 5.01161   15.99138 11.90228 1.000 17.26609  ? 111 GLN A CA   1 
ATOM   1841 C C    . GLN A 1 111 ? 5.23171   14.65042 11.22352 1.000 17.61566  ? 111 GLN A C    1 
ATOM   1842 O O    . GLN A 1 111 ? 6.13609   14.46250 10.39546 1.000 18.84506  ? 111 GLN A O    1 
ATOM   1843 C CB   . GLN A 1 111 ? 4.09352   16.85605 11.04188 1.000 18.14403  ? 111 GLN A CB   1 
ATOM   1844 C CG   . GLN A 1 111 ? 3.55537   18.08726 11.79765 1.000 19.85805  ? 111 GLN A CG   1 
ATOM   1845 C CD   . GLN A 1 111 ? 2.60700   18.86367 10.94438 1.000 21.91792  ? 111 GLN A CD   1 
ATOM   1846 O OE1  . GLN A 1 111 ? 1.61512   18.30934 10.43489 1.000 25.79961  ? 111 GLN A OE1  1 
ATOM   1847 N NE2  . GLN A 1 111 ? 2.91615   20.12554 10.70493 1.000 24.51431  ? 111 GLN A NE2  1 
ATOM   1848 H H    . GLN A 1 111 ? 6.47230   17.29167 11.60092 1.000 22.34126  ? 111 GLN A H    1 
ATOM   1849 H HA   . GLN A 1 111 ? 4.56871   15.83564 12.75110 1.000 20.72419  ? 111 GLN A HA   1 
ATOM   1850 H HB2  . GLN A 1 111 ? 4.58846   17.17033 10.26912 1.000 21.77772  ? 111 GLN A HB2  1 
ATOM   1851 H HB3  . GLN A 1 111 ? 3.33485   16.32360 10.75585 1.000 21.77772  ? 111 GLN A HB3  1 
ATOM   1852 H HG2  . GLN A 1 111 ? 3.08514   17.79704 12.59487 1.000 23.83454  ? 111 GLN A HG2  1 
ATOM   1853 H HG3  . GLN A 1 111 ? 4.29491   18.66590 12.04086 1.000 23.83454  ? 111 GLN A HG3  1 
ATOM   1854 H HE21 . GLN A 1 111 ? 3.63506   20.46233 11.03559 1.000 29.42205  ? 111 GLN A HE21 1 
ATOM   1855 H HE22 . GLN A 1 111 ? 2.39850   20.61021 10.21838 1.000 29.42205  ? 111 GLN A HE22 1 
ATOM   1856 N N    . PHE A 1 112 ? 4.37084   13.70776 11.58348 1.000 18.21548  ? 112 PHE A N    1 
ATOM   1857 C CA   . PHE A 1 112 ? 4.49900   12.32468 11.12830 1.000 17.87486  ? 112 PHE A CA   1 
ATOM   1858 C C    . PHE A 1 112 ? 3.11508   11.75209 10.94214 1.000 18.75795  ? 112 PHE A C    1 
ATOM   1859 O O    . PHE A 1 112 ? 2.12723   12.27332 11.47027 1.000 18.50396  ? 112 PHE A O    1 
ATOM   1860 C CB   . PHE A 1 112 ? 5.27167   11.48018 12.17005 1.000 19.06956  ? 112 PHE A CB   1 
ATOM   1861 C CG   . PHE A 1 112 ? 4.59471   11.41564 13.52093 1.000 19.04741  ? 112 PHE A CG   1 
ATOM   1862 C CD1  . PHE A 1 112 ? 3.65425   10.45772 13.80529 1.000 22.92034  ? 112 PHE A CD1  1 
ATOM   1863 C CD2  . PHE A 1 112 ? 4.85998   12.40038 14.45954 1.000 20.63379  ? 112 PHE A CD2  1 
ATOM   1864 C CE1  . PHE A 1 112 ? 2.96551   10.47446 15.01277 1.000 25.12021  ? 112 PHE A CE1  1 
ATOM   1865 C CE2  . PHE A 1 112 ? 4.21752   12.43474 15.64767 1.000 21.31177  ? 112 PHE A CE2  1 
ATOM   1866 C CZ   . PHE A 1 112 ? 3.25090   11.47778 15.95101 1.000 24.15132  ? 112 PHE A CZ   1 
ATOM   1867 H H    . PHE A 1 112 ? 3.69441   13.84265 12.09713 1.000 21.86346  ? 112 PHE A H    1 
ATOM   1868 H HA   . PHE A 1 112 ? 4.96738   12.29755 10.27931 1.000 21.45471  ? 112 PHE A HA   1 
ATOM   1869 H HB2  . PHE A 1 112 ? 5.35537   10.57312 11.83667 1.000 22.88836  ? 112 PHE A HB2  1 
ATOM   1870 H HB3  . PHE A 1 112 ? 6.15102   11.86933 12.29732 1.000 22.88836  ? 112 PHE A HB3  1 
ATOM   1871 H HD1  . PHE A 1 112 ? 3.47560   9.78982  13.18328 1.000 27.50929  ? 112 PHE A HD1  1 
ATOM   1872 H HD2  . PHE A 1 112 ? 5.49466   13.05234 14.26714 1.000 24.76543  ? 112 PHE A HD2  1 
ATOM   1873 H HE1  . PHE A 1 112 ? 2.32282   9.82787  15.19655 1.000 30.14913  ? 112 PHE A HE1  1 
ATOM   1874 H HE2  . PHE A 1 112 ? 4.42113   13.09950 16.26535 1.000 25.57901  ? 112 PHE A HE2  1 
ATOM   1875 H HZ   . PHE A 1 112 ? 2.80102   11.50389 16.76453 1.000 28.98647  ? 112 PHE A HZ   1 
ATOM   1876 N N    A PHE A 1 113 ? 3.06826   10.57947 10.35488 0.597 18.49077  ? 113 PHE A N    1 
ATOM   1877 N N    B PHE A 1 113 ? 3.05412   10.67301 10.11046 0.403 18.33403  ? 113 PHE A N    1 
ATOM   1878 C CA   A PHE A 1 113 ? 1.81408   9.88560  10.34933 0.597 16.48910  ? 113 PHE A CA   1 
ATOM   1879 C CA   B PHE A 1 113 ? 1.91275   9.77463  9.86783  0.403 19.68339  ? 113 PHE A CA   1 
ATOM   1880 C C    A PHE A 1 113 ? 2.02733   8.39737  10.47736 0.597 17.06647  ? 113 PHE A C    1 
ATOM   1881 C C    B PHE A 1 113 ? 2.13001   8.41763  10.56887 0.403 17.25058  ? 113 PHE A C    1 
ATOM   1882 O O    A PHE A 1 113 ? 3.04378   7.82121  10.06762 0.597 16.87367  ? 113 PHE A O    1 
ATOM   1883 O O    B PHE A 1 113 ? 3.27208   7.92024  10.60866 0.403 17.33387  ? 113 PHE A O    1 
ATOM   1884 C CB   A PHE A 1 113 ? 1.00194   10.18471 9.10234  0.597 14.69087  ? 113 PHE A CB   1 
ATOM   1885 C CB   B PHE A 1 113 ? 1.71985   9.45679  8.35305  0.403 17.64566  ? 113 PHE A CB   1 
ATOM   1886 C CG   A PHE A 1 113 ? 1.75990   9.93341  7.78175  0.597 17.47368  ? 113 PHE A CG   1 
ATOM   1887 C CG   B PHE A 1 113 ? 1.66206   10.66589 7.40303  0.403 22.82434  ? 113 PHE A CG   1 
ATOM   1888 C CD1  A PHE A 1 113 ? 2.58170   10.90790 7.20742  0.597 19.54663  ? 113 PHE A CD1  1 
ATOM   1889 C CD1  B PHE A 1 113 ? 0.98248   11.82243 7.72108  0.403 26.41568  ? 113 PHE A CD1  1 
ATOM   1890 C CD2  A PHE A 1 113 ? 1.58011   8.74521  7.10214  0.597 17.15178  ? 113 PHE A CD2  1 
ATOM   1891 C CD2  B PHE A 1 113 ? 2.27830   10.59032 6.14889  0.403 27.07009  ? 113 PHE A CD2  1 
ATOM   1892 C CE1  A PHE A 1 113 ? 3.21809   10.63970 5.95293  0.597 20.86991  ? 113 PHE A CE1  1 
ATOM   1893 C CE1  B PHE A 1 113 ? 0.94437   12.88642 6.83923  0.403 38.04232  ? 113 PHE A CE1  1 
ATOM   1894 C CE2  A PHE A 1 113 ? 2.18901   8.49531  5.88394  0.597 20.11818  ? 113 PHE A CE2  1 
ATOM   1895 C CE2  B PHE A 1 113 ? 2.24373   11.65173 5.27345  0.403 27.16928  ? 113 PHE A CE2  1 
ATOM   1896 C CZ   A PHE A 1 113 ? 3.02209   9.44689  5.32617  0.597 20.83466  ? 113 PHE A CZ   1 
ATOM   1897 C CZ   B PHE A 1 113 ? 1.57252   12.79552 5.60981  0.403 42.22483  ? 113 PHE A CZ   1 
ATOM   1898 H H    A PHE A 1 113 ? 3.72657   10.18330 9.96852  0.597 22.19381  ? 113 PHE A H    1 
ATOM   1899 H H    B PHE A 1 113 ? 3.72960   10.42844 9.63769  0.403 22.00572  ? 113 PHE A H    1 
ATOM   1900 H HA   A PHE A 1 113 ? 1.30490   10.17354 11.12310 0.597 19.79181  ? 113 PHE A HA   1 
ATOM   1901 H HA   B PHE A 1 113 ? 1.12500   10.21953 10.21770 0.403 23.62495  ? 113 PHE A HA   1 
ATOM   1902 H HB2  A PHE A 1 113 ? 0.21381   9.61924  9.10191  0.597 17.63392  ? 113 PHE A HB2  1 
ATOM   1903 H HB2  B PHE A 1 113 ? 2.46179   8.90276  8.06414  0.403 21.17968  ? 113 PHE A HB2  1 
ATOM   1904 H HB3  A PHE A 1 113 ? 0.74021   11.11859 9.11872  0.597 17.63392  ? 113 PHE A HB3  1 
ATOM   1905 H HB3  B PHE A 1 113 ? 0.88514   8.97351  8.25008  0.403 21.17968  ? 113 PHE A HB3  1 
ATOM   1906 H HD1  A PHE A 1 113 ? 2.71380   11.72258 7.63606  0.597 23.46084  ? 113 PHE A HD1  1 
ATOM   1907 H HD1  B PHE A 1 113 ? 0.54436   11.88766 8.53882  0.403 31.70370  ? 113 PHE A HD1  1 
ATOM   1908 H HD2  A PHE A 1 113 ? 1.03270   8.09197  7.47433  0.597 20.58702  ? 113 PHE A HD2  1 
ATOM   1909 H HD2  B PHE A 1 113 ? 2.71891   9.80921  5.90268  0.403 32.48899  ? 113 PHE A HD2  1 
ATOM   1910 H HE1  A PHE A 1 113 ? 3.76708   11.28236 5.56500  0.597 25.04877  ? 113 PHE A HE1  1 
ATOM   1911 H HE1  B PHE A 1 113 ? 0.49483   13.66619 7.07324  0.403 45.65566  ? 113 PHE A HE1  1 
ATOM   1912 H HE2  A PHE A 1 113 ? 2.03810   7.69060  5.44285  0.597 24.14670  ? 113 PHE A HE2  1 
ATOM   1913 H HE2  B PHE A 1 113 ? 2.67690   11.59143 4.45270  0.403 32.60802  ? 113 PHE A HE2  1 
ATOM   1914 H HZ   A PHE A 1 113 ? 3.45048   9.27171  4.51951  0.597 25.00648  ? 113 PHE A HZ   1 
ATOM   1915 H HZ   B PHE A 1 113 ? 1.53864   13.50913 5.01439  0.403 50.67468  ? 113 PHE A HZ   1 
ATOM   1916 N N    . ILE A 1 114 ? 1.04618   7.80972  11.13047 1.000 16.58148  ? 114 ILE A N    1 
ATOM   1917 C CA   . ILE A 1 114 ? 0.93555   6.35643  11.31853 1.000 17.15182  ? 114 ILE A CA   1 
ATOM   1918 C C    . ILE A 1 114 ? -0.04060  5.87234  10.26049 1.000 18.56923  ? 114 ILE A C    1 
ATOM   1919 O O    . ILE A 1 114 ? -1.22202  6.22596  10.27278 1.000 19.55627  ? 114 ILE A O    1 
ATOM   1920 C CB   . ILE A 1 114 ? 0.46012   5.98986  12.72899 1.000 18.71528  ? 114 ILE A CB   1 
ATOM   1921 C CG1  . ILE A 1 114 ? 1.34767   6.67455  13.77993 1.000 21.93690  ? 114 ILE A CG1  1 
ATOM   1922 C CG2  . ILE A 1 114 ? 0.44640   4.46149  12.83979 1.000 23.44179  ? 114 ILE A CG2  1 
ATOM   1923 C CD1  . ILE A 1 114 ? 0.67820   6.56332  15.13665 1.000 23.95021  ? 114 ILE A CD1  1 
ATOM   1924 H H    . ILE A 1 114 ? 0.39595   8.23788  11.49583 1.000 19.90266  ? 114 ILE A H    1 
ATOM   1925 H HA   . ILE A 1 114 ? 1.79862   5.93485  11.18336 1.000 20.58707  ? 114 ILE A HA   1 
ATOM   1926 H HB   . ILE A 1 114 ? -0.43970  6.31205  12.89454 1.000 22.46322  ? 114 ILE A HB   1 
ATOM   1927 H HG12 . ILE A 1 114 ? 2.21278   6.23740  13.81722 1.000 26.32916  ? 114 ILE A HG12 1 
ATOM   1928 H HG13 . ILE A 1 114 ? 1.45908   7.61224  13.55803 1.000 26.32916  ? 114 ILE A HG13 1 
ATOM   1929 H HG21 . ILE A 1 114 ? 0.14199   4.21185  13.72631 1.000 28.13502  ? 114 ILE A HG21 1 
ATOM   1930 H HG22 . ILE A 1 114 ? -0.15572  4.10168  12.16979 1.000 28.13502  ? 114 ILE A HG22 1 
ATOM   1931 H HG23 . ILE A 1 114 ? 1.34444   4.12605  12.69177 1.000 28.13502  ? 114 ILE A HG23 1 
ATOM   1932 H HD11 . ILE A 1 114 ? 1.18169   7.08508  15.78098 1.000 28.74513  ? 114 ILE A HD11 1 
ATOM   1933 H HD12 . ILE A 1 114 ? -0.22763  6.90393  15.07070 1.000 28.74513  ? 114 ILE A HD12 1 
ATOM   1934 H HD13 . ILE A 1 114 ? 0.66244   5.63148  15.40558 1.000 28.74513  ? 114 ILE A HD13 1 
ATOM   1935 N N    . CYS A 1 115 ? 0.43382   5.06861  9.31839  1.000 20.38130  ? 115 CYS A N    1 
ATOM   1936 C CA   . CYS A 1 115 ? -0.45495  4.53940  8.29705  1.000 20.96986  ? 115 CYS A CA   1 
ATOM   1937 C C    . CYS A 1 115 ? -1.35447  3.48084  8.89175  1.000 21.76950  ? 115 CYS A C    1 
ATOM   1938 O O    . CYS A 1 115 ? -0.92184  2.62972  9.67886  1.000 24.24392  ? 115 CYS A O    1 
ATOM   1939 C CB   . CYS A 1 115 ? 0.34347   3.92313  7.17692  1.000 22.54129  ? 115 CYS A CB   1 
ATOM   1940 S SG   . CYS A 1 115 ? 1.38527   5.07018  6.33678  1.000 25.84747  ? 115 CYS A SG   1 
ATOM   1941 H H    . CYS A 1 115 ? 1.25379   4.81853  9.24974  1.000 24.46245  ? 115 CYS A H    1 
ATOM   1942 H HA   . CYS A 1 115 ? -0.99561  5.26056  7.93856  1.000 25.16871  ? 115 CYS A HA   1 
ATOM   1943 H HB2  . CYS A 1 115 ? 0.90701   3.22382  7.54338  1.000 27.05443  ? 115 CYS A HB2  1 
ATOM   1944 H HB3  . CYS A 1 115 ? -0.27009  3.54782  6.52609  1.000 27.05443  ? 115 CYS A HB3  1 
ATOM   1945 H HG   . CYS A 1 115 ? 0.82172   6.12691  6.26106  1.000 31.02185  ? 115 CYS A HG   1 
ATOM   1946 N N    . THR A 1 116 ? -2.62248  3.45310  8.45851  1.000 19.96331  ? 116 THR A N    1 
ATOM   1947 C CA   . THR A 1 116 ? -3.54138  2.40421  8.83532  1.000 21.85304  ? 116 THR A CA   1 
ATOM   1948 C C    . THR A 1 116 ? -4.02867  1.63685  7.61434  1.000 22.55248  ? 116 THR A C    1 
ATOM   1949 O O    . THR A 1 116 ? -4.96288  0.82675  7.70016  1.000 28.01861  ? 116 THR A O    1 
ATOM   1950 C CB   . THR A 1 116 ? -4.71614  2.94076  9.63565  1.000 26.58372  ? 116 THR A CB   1 
ATOM   1951 O OG1  . THR A 1 116 ? -5.40907  3.91903  8.86735  1.000 26.46384  ? 116 THR A OG1  1 
ATOM   1952 C CG2  . THR A 1 116 ? -4.24486  3.54940  10.92484 1.000 24.96003  ? 116 THR A CG2  1 
ATOM   1953 H H    . THR A 1 116 ? -2.96637  4.04532  7.93831  1.000 23.96085  ? 116 THR A H    1 
ATOM   1954 H HA   . THR A 1 116 ? -3.07341  1.78685  9.41907  1.000 26.22853  ? 116 THR A HA   1 
ATOM   1955 H HB   . THR A 1 116 ? -5.32181  2.21412  9.85027  1.000 31.90535  ? 116 THR A HB   1 
ATOM   1956 H HG1  . THR A 1 116 ? -5.84490  4.42706  9.37485  1.000 31.76149  ? 116 THR A HG1  1 
ATOM   1957 H HG21 . THR A 1 116 ? -5.00540  3.77126  11.48452 1.000 29.95692  ? 116 THR A HG21 1 
ATOM   1958 H HG22 . THR A 1 116 ? -3.67689  2.92253  11.39956 1.000 29.95692  ? 116 THR A HG22 1 
ATOM   1959 H HG23 . THR A 1 116 ? -3.73989  4.35782  10.74497 1.000 29.95692  ? 116 THR A HG23 1 
ATOM   1960 N N    . ALA A 1 117 ? -3.33352  1.81392  6.50618  1.000 26.10665  ? 117 ALA A N    1 
ATOM   1961 C CA   . ALA A 1 117 ? -3.54390  1.10108  5.25562  1.000 26.86815  ? 117 ALA A CA   1 
ATOM   1962 C C    . ALA A 1 117 ? -2.22231  1.11915  4.50789  1.000 23.89414  ? 117 ALA A C    1 
ATOM   1963 O O    . ALA A 1 117 ? -1.32006  1.88488  4.84261  1.000 23.79869  ? 117 ALA A O    1 
ATOM   1964 C CB   . ALA A 1 117 ? -4.60747  1.78736  4.41237  1.000 33.05057  ? 117 ALA A CB   1 
ATOM   1965 H H    . ALA A 1 117 ? -2.68896  2.38002  6.44555  1.000 31.33286  ? 117 ALA A H    1 
ATOM   1966 H HA   . ALA A 1 117 ? -3.82054  0.18848  5.43323  1.000 32.24666  ? 117 ALA A HA   1 
ATOM   1967 H HB1  . ALA A 1 117 ? -4.70837  1.30457  3.57712  1.000 39.66557  ? 117 ALA A HB1  1 
ATOM   1968 H HB2  . ALA A 1 117 ? -5.44647  1.78512  4.89916  1.000 39.66557  ? 117 ALA A HB2  1 
ATOM   1969 H HB3  . ALA A 1 117 ? -4.33007  2.69987  4.23555  1.000 39.66557  ? 117 ALA A HB3  1 
ATOM   1970 N N    . LYS A 1 118 ? -2.13454  0.31266  3.44793  1.000 25.81864  ? 118 LYS A N    1 
ATOM   1971 C CA   . LYS A 1 118 ? -1.01656  0.42669  2.50537  1.000 23.25403  ? 118 LYS A CA   1 
ATOM   1972 C C    . LYS A 1 118 ? -1.18083  1.70272  1.69067  1.000 27.38404  ? 118 LYS A C    1 
ATOM   1973 O O    . LYS A 1 118 ? -2.26025  1.96778  1.16893  1.000 29.47630  ? 118 LYS A O    1 
ATOM   1974 C CB   . LYS A 1 118 ? -0.96061  -0.78662 1.57408  1.000 26.36380  ? 118 LYS A CB   1 
ATOM   1975 C CG   . LYS A 1 118 ? 0.14478   -0.74158 0.58243  1.000 28.88995  ? 118 LYS A CG   1 
ATOM   1976 C CD   . LYS A 1 118 ? 0.23051   -2.03120 -0.29992 1.000 42.88957  ? 118 LYS A CD   1 
ATOM   1977 C CE   . LYS A 1 118 ? 1.11220   -1.80867 -1.52185 1.000 63.52725  ? 118 LYS A CE   1 
ATOM   1978 N NZ   . LYS A 1 118 ? 1.47309   -3.08751 -2.19047 1.000 74.55398  ? 118 LYS A NZ   1 
ATOM   1979 H H    . LYS A 1 118 ? -2.70258  -0.30282 3.25272  1.000 30.98726  ? 118 LYS A H    1 
ATOM   1980 H HA   . LYS A 1 118 ? -0.17976  0.45882  2.99488  1.000 27.90971  ? 118 LYS A HA   1 
ATOM   1981 H HB2  . LYS A 1 118 ? -0.84145  -1.58514 2.11173  1.000 31.64144  ? 118 LYS A HB2  1 
ATOM   1982 H HB3  . LYS A 1 118 ? -1.79517  -0.83914 1.08251  1.000 31.64144  ? 118 LYS A HB3  1 
ATOM   1983 H HG2  . LYS A 1 118 ? 0.00755   0.01534  -0.00845 1.000 34.67282  ? 118 LYS A HG2  1 
ATOM   1984 H HG3  . LYS A 1 118 ? 0.98728   -0.64617 1.05360  1.000 34.67282  ? 118 LYS A HG3  1 
ATOM   1985 H HD2  . LYS A 1 118 ? 0.61006   -2.75455 0.22315  1.000 51.47237  ? 118 LYS A HD2  1 
ATOM   1986 H HD3  . LYS A 1 118 ? -0.65826  -2.27275 -0.60428 1.000 51.47237  ? 118 LYS A HD3  1 
ATOM   1987 H HE2  . LYS A 1 118 ? 0.63687   -1.25608 -2.16186 1.000 76.23758  ? 118 LYS A HE2  1 
ATOM   1988 H HE3  . LYS A 1 118 ? 1.93199   -1.36849 -1.24783 1.000 76.23758  ? 118 LYS A HE3  1 
ATOM   1989 H HZ1  . LYS A 1 118 ? 2.00455   -2.92781 -2.88628 1.000 89.46966  ? 118 LYS A HZ1  1 
ATOM   1990 H HZ2  . LYS A 1 118 ? 1.89834   -3.62059 -1.61856 1.000 89.46966  ? 118 LYS A HZ2  1 
ATOM   1991 H HZ3  . LYS A 1 118 ? 0.73792   -3.49921 -2.47705 1.000 89.46966  ? 118 LYS A HZ3  1 
ATOM   1992 N N    . THR A 1 119 ? -0.15383  2.54353  1.69483  1.000 22.82460  ? 119 THR A N    1 
ATOM   1993 C CA   . THR A 1 119 ? -0.18698  3.85264  0.99116  1.000 22.01355  ? 119 THR A CA   1 
ATOM   1994 C C    . THR A 1 119 ? 0.96288   3.95706  -0.00873 1.000 21.73950  ? 119 THR A C    1 
ATOM   1995 O O    . THR A 1 119 ? 1.84852   4.81832  0.14601  1.000 22.85631  ? 119 THR A O    1 
ATOM   1996 C CB   . THR A 1 119 ? -0.17796  4.99675  1.99788  1.000 21.92226  ? 119 THR A CB   1 
ATOM   1997 O OG1  . THR A 1 119 ? 0.99921   4.95808  2.80878  1.000 21.27049  ? 119 THR A OG1  1 
ATOM   1998 C CG2  . THR A 1 119 ? -1.30650  4.92748  2.97413  1.000 27.13230  ? 119 THR A CG2  1 
ATOM   1999 H H    . THR A 1 119 ? 0.58909   2.38888  2.09950  1.000 27.39440  ? 119 THR A H    1 
ATOM   2000 H HA   . THR A 1 119 ? -1.00576  3.89560  0.47285  1.000 26.42114  ? 119 THR A HA   1 
ATOM   2001 H HB   . THR A 1 119 ? -0.23873  5.80551  1.46580  1.000 26.31159  ? 119 THR A HB   1 
ATOM   2002 H HG1  . THR A 1 119 ? 1.63512   5.33542  2.41025  1.000 25.52947  ? 119 THR A HG1  1 
ATOM   2003 H HG21 . THR A 1 119 ? -1.22458  5.64015  3.62704  1.000 32.56364  ? 119 THR A HG21 1 
ATOM   2004 H HG22 . THR A 1 119 ? -2.15299  5.02161  2.50991  1.000 32.56364  ? 119 THR A HG22 1 
ATOM   2005 H HG23 . THR A 1 119 ? -1.29385  4.07453  3.43588  1.000 32.56364  ? 119 THR A HG23 1 
ATOM   2006 N N    . GLU A 1 120 ? 0.93449   3.13964  -1.04655 1.000 24.53888  ? 120 GLU A N    1 
ATOM   2007 C CA   . GLU A 1 120 ? 2.10543   3.00712  -1.91047 1.000 24.46959  ? 120 GLU A CA   1 
ATOM   2008 C C    . GLU A 1 120 ? 2.36286   4.25716  -2.72734 1.000 22.01811  ? 120 GLU A C    1 
ATOM   2009 O O    . GLU A 1 120 ? 3.50850   4.47741  -3.17933 1.000 24.17513  ? 120 GLU A O    1 
ATOM   2010 C CB   . GLU A 1 120 ? 1.95780   1.77527  -2.80999 1.000 28.27266  ? 120 GLU A CB   1 
ATOM   2011 C CG   . GLU A 1 120 ? 0.87649   1.84654  -3.84642 1.000 39.49411  ? 120 GLU A CG   1 
ATOM   2012 C CD   . GLU A 1 120 ? -0.58057  1.58490  -3.34550 1.000 51.46433  ? 120 GLU A CD   1 
ATOM   2013 O OE1  . GLU A 1 120 ? -0.89723  1.37458  -2.12116 1.000 43.27972  ? 120 GLU A OE1  1 
ATOM   2014 O OE2  . GLU A 1 120 ? -1.44840  1.58226  -4.25414 1.000 53.96960  ? 120 GLU A OE2  1 
ATOM   2015 H H    . GLU A 1 120 ? 0.26170   2.65469  -1.27408 1.000 29.45154  ? 120 GLU A H    1 
ATOM   2016 H HA   . GLU A 1 120 ? 2.89180   2.86372  -1.36097 1.000 29.36839  ? 120 GLU A HA   1 
ATOM   2017 H HB2  . GLU A 1 120 ? 2.79609   1.63972  -3.27882 1.000 33.93207  ? 120 GLU A HB2  1 
ATOM   2018 H HB3  . GLU A 1 120 ? 1.76517   1.00952  -2.24660 1.000 33.93207  ? 120 GLU A HB3  1 
ATOM   2019 H HG2  . GLU A 1 120 ? 0.88864   2.73498  -4.23556 1.000 47.39782  ? 120 GLU A HG2  1 
ATOM   2020 H HG3  . GLU A 1 120 ? 1.06673   1.18317  -4.52807 1.000 47.39782  ? 120 GLU A HG3  1 
ATOM   2021 N N    . TRP A 1 121 ? 1.32740   5.10088  -2.91577 1.000 22.96866  ? 121 TRP A N    1 
ATOM   2022 C CA   . TRP A 1 121 ? 1.53429   6.33763  -3.66851 1.000 22.87929  ? 121 TRP A CA   1 
ATOM   2023 C C    . TRP A 1 121 ? 2.40292   7.35997  -2.93243 1.000 23.21823  ? 121 TRP A C    1 
ATOM   2024 O O    . TRP A 1 121 ? 2.84489   8.35014  -3.55950 1.000 26.90302  ? 121 TRP A O    1 
ATOM   2025 C CB   . TRP A 1 121 ? 0.17735   6.99447  -4.01987 1.000 26.37745  ? 121 TRP A CB   1 
ATOM   2026 C CG   . TRP A 1 121 ? -0.61626  7.36525  -2.85409 1.000 24.12479  ? 121 TRP A CG   1 
ATOM   2027 C CD1  . TRP A 1 121 ? -0.62129  8.56970  -2.22882 1.000 24.44048  ? 121 TRP A CD1  1 
ATOM   2028 C CD2  . TRP A 1 121 ? -1.53067  6.53979  -2.11511 1.000 21.79955  ? 121 TRP A CD2  1 
ATOM   2029 N NE1  . TRP A 1 121 ? -1.46765  8.55601  -1.19079 1.000 26.18617  ? 121 TRP A NE1  1 
ATOM   2030 C CE2  . TRP A 1 121 ? -2.04244  7.32134  -1.07469 1.000 25.04930  ? 121 TRP A CE2  1 
ATOM   2031 C CE3  . TRP A 1 121 ? -2.00809  5.22152  -2.27385 1.000 25.53134  ? 121 TRP A CE3  1 
ATOM   2032 C CZ2  . TRP A 1 121 ? -2.98149  6.83796  -0.18988 1.000 26.77461  ? 121 TRP A CZ2  1 
ATOM   2033 C CZ3  . TRP A 1 121 ? -2.94864  4.74026  -1.36974 1.000 32.01287  ? 121 TRP A CZ3  1 
ATOM   2034 C CH2  . TRP A 1 121 ? -3.43117  5.54987  -0.36422 1.000 29.99472  ? 121 TRP A CH2  1 
ATOM   2035 H H    . TRP A 1 121 ? 0.52746   4.97727  -2.62523 1.000 27.56728  ? 121 TRP A H    1 
ATOM   2036 H HA   . TRP A 1 121 ? 1.98273   6.10204  -4.49573 1.000 27.46003  ? 121 TRP A HA   1 
ATOM   2037 H HB2  . TRP A 1 121 ? 0.34471   7.80081  -4.53241 1.000 31.65782  ? 121 TRP A HB2  1 
ATOM   2038 H HB3  . TRP A 1 121 ? -0.34473  6.36907  -4.54637 1.000 31.65782  ? 121 TRP A HB3  1 
ATOM   2039 H HD1  . TRP A 1 121 ? -0.10877  9.30215  -2.48520 1.000 29.33346  ? 121 TRP A HD1  1 
ATOM   2040 H HE1  . TRP A 1 121 ? -1.62596  9.22490  -0.67396 1.000 31.42829  ? 121 TRP A HE1  1 
ATOM   2041 H HE3  . TRP A 1 121 ? -1.70011  4.68562  -2.96873 1.000 30.64249  ? 121 TRP A HE3  1 
ATOM   2042 H HZ2  . TRP A 1 121 ? -3.30181  7.36699  0.50468  1.000 32.13442  ? 121 TRP A HZ2  1 
ATOM   2043 H HZ3  . TRP A 1 121 ? -3.25447  3.86514  -1.44420 1.000 38.42032  ? 121 TRP A HZ3  1 
ATOM   2044 H HH2  . TRP A 1 121 ? -4.07936  5.21569  0.21292  1.000 35.99855  ? 121 TRP A HH2  1 
ATOM   2045 N N    . LEU A 1 122 ? 2.72201   7.13167  -1.66351 1.000 19.99085  ? 122 LEU A N    1 
ATOM   2046 C CA   . LEU A 1 122 ? 3.63998   7.97760  -0.91675 1.000 20.24230  ? 122 LEU A CA   1 
ATOM   2047 C C    . LEU A 1 122 ? 5.08995   7.54358  -1.03834 1.000 21.09239  ? 122 LEU A C    1 
ATOM   2048 O O    . LEU A 1 122 ? 5.97044   8.28619  -0.58748 1.000 20.36270  ? 122 LEU A O    1 
ATOM   2049 C CB   . LEU A 1 122 ? 3.21288   8.03708  0.52840  1.000 20.82632  ? 122 LEU A CB   1 
ATOM   2050 C CG   . LEU A 1 122 ? 1.76793   8.54001  0.76499  1.000 23.05815  ? 122 LEU A CG   1 
ATOM   2051 C CD1  . LEU A 1 122 ? 1.53606   8.42999  2.24705  1.000 28.46454  ? 122 LEU A CD1  1 
ATOM   2052 C CD2  . LEU A 1 122 ? 1.60385   9.93660  0.21052  1.000 25.33274  ? 122 LEU A CD2  1 
ATOM   2053 H H    . LEU A 1 122 ? 2.41115   6.47569  -1.20237 1.000 23.99390  ? 122 LEU A H    1 
ATOM   2054 H HA   . LEU A 1 122 ? 3.59798   8.88244  -1.26375 1.000 24.29564  ? 122 LEU A HA   1 
ATOM   2055 H HB2  . LEU A 1 122 ? 3.27561   7.14457  0.90308  1.000 24.99646  ? 122 LEU A HB2  1 
ATOM   2056 H HB3  . LEU A 1 122 ? 3.81114   8.63764  0.99990  1.000 24.99646  ? 122 LEU A HB3  1 
ATOM   2057 H HG   . LEU A 1 122 ? 1.09146   8.02021  0.30337  1.000 27.67466  ? 122 LEU A HG   1 
ATOM   2058 H HD11 . LEU A 1 122 ? 0.68442   8.84011  2.46476  1.000 34.16232  ? 122 LEU A HD11 1 
ATOM   2059 H HD12 . LEU A 1 122 ? 1.52509   7.49261  2.49624  1.000 34.16232  ? 122 LEU A HD12 1 
ATOM   2060 H HD13 . LEU A 1 122 ? 2.25262   8.88794  2.71365  1.000 34.16232  ? 122 LEU A HD13 1 
ATOM   2061 H HD21 . LEU A 1 122 ? 0.75340   10.29639 0.50749  1.000 30.40417  ? 122 LEU A HD21 1 
ATOM   2062 H HD22 . LEU A 1 122 ? 2.32957   10.49246 0.53494  1.000 30.40417  ? 122 LEU A HD22 1 
ATOM   2063 H HD23 . LEU A 1 122 ? 1.62574   9.89630  -0.75839 1.000 30.40417  ? 122 LEU A HD23 1 
ATOM   2064 N N    . ASP A 1 123 ? 5.35755   6.37453  -1.61780 1.000 20.68105  ? 123 ASP A N    1 
ATOM   2065 C CA   . ASP A 1 123 ? 6.72245   5.87697  -1.76973 1.000 19.48353  ? 123 ASP A CA   1 
ATOM   2066 C C    . ASP A 1 123 ? 7.54674   6.85108  -2.58545 1.000 21.31852  ? 123 ASP A C    1 
ATOM   2067 O O    . ASP A 1 123 ? 7.10905   7.34971  -3.64150 1.000 24.15807  ? 123 ASP A O    1 
ATOM   2068 C CB   . ASP A 1 123 ? 6.73992   4.51801  -2.43624 1.000 23.63382  ? 123 ASP A CB   1 
ATOM   2069 C CG   . ASP A 1 123 ? 6.21985   3.40761  -1.56895 1.000 24.91047  ? 123 ASP A CG   1 
ATOM   2070 O OD1  . ASP A 1 123 ? 5.97445   3.59692  -0.37956 1.000 24.16483  ? 123 ASP A OD1  1 
ATOM   2071 O OD2  . ASP A 1 123 ? 6.00296   2.27497  -2.11601 1.000 27.85474  ? 123 ASP A OD2  1 
ATOM   2072 H H    . ASP A 1 123 ? 4.75974   5.84398  -1.93521 1.000 24.82214  ? 123 ASP A H    1 
ATOM   2073 H HA   . ASP A 1 123 ? 7.11445   5.78208  -0.88756 1.000 23.38511  ? 123 ASP A HA   1 
ATOM   2074 H HB2  . ASP A 1 123 ? 6.18686   4.55424  -3.23230 1.000 28.36546  ? 123 ASP A HB2  1 
ATOM   2075 H HB3  . ASP A 1 123 ? 7.65410   4.30075  -2.67700 1.000 28.36546  ? 123 ASP A HB3  1 
ATOM   2076 N N    . GLY A 1 124 ? 8.73018   7.14229  -2.07295 1.000 20.75629  ? 124 GLY A N    1 
ATOM   2077 C CA   . GLY A 1 124 ? 9.64656   8.03798  -2.72134 1.000 21.52848  ? 124 GLY A CA   1 
ATOM   2078 C C    . GLY A 1 124 ? 9.38371   9.50012  -2.51138 1.000 21.47140  ? 124 GLY A C    1 
ATOM   2079 O O    . GLY A 1 124 ? 10.11010  10.33487 -3.07867 1.000 24.18427  ? 124 GLY A O    1 
ATOM   2080 H H    . GLY A 1 124 ? 9.02610   6.82200  -1.33171 1.000 24.91243  ? 124 GLY A H    1 
ATOM   2081 H HA2  . GLY A 1 124 ? 10.54095  7.85185  -2.39526 1.000 25.83906  ? 124 GLY A HA2  1 
ATOM   2082 H HA3  . GLY A 1 124 ? 9.61717   7.86971  -3.67618 1.000 25.83906  ? 124 GLY A HA3  1 
ATOM   2083 N N    A LYS A 1 125 ? 8.33902   9.85426  -1.76193 0.483 20.01756  ? 125 LYS A N    1 
ATOM   2084 N N    B LYS A 1 125 ? 8.34243   9.84415  -1.75217 0.517 19.94273  ? 125 LYS A N    1 
ATOM   2085 C CA   A LYS A 1 125 ? 7.97667   11.22275 -1.41317 0.483 21.25231  ? 125 LYS A CA   1 
ATOM   2086 C CA   B LYS A 1 125 ? 7.95161   11.21158 -1.45385 0.517 21.14110  ? 125 LYS A CA   1 
ATOM   2087 C C    A LYS A 1 125 ? 8.07396   11.47992 0.08276  0.483 20.02714  ? 125 LYS A C    1 
ATOM   2088 C C    B LYS A 1 125 ? 7.95741   11.51194 0.04254  0.517 21.06982  ? 125 LYS A C    1 
ATOM   2089 O O    A LYS A 1 125 ? 8.41385   12.57819 0.50106  0.483 20.23799  ? 125 LYS A O    1 
ATOM   2090 O O    B LYS A 1 125 ? 8.11508   12.68436 0.40908  0.517 20.45778  ? 125 LYS A O    1 
ATOM   2091 C CB   A LYS A 1 125 ? 6.50799   11.52333 -1.87604 0.483 28.52305  ? 125 LYS A CB   1 
ATOM   2092 C CB   B LYS A 1 125 ? 6.52479   11.49538 -2.04307 0.517 28.27100  ? 125 LYS A CB   1 
ATOM   2093 C CG   A LYS A 1 125 ? 6.27579   11.50579 -3.35339 0.483 45.37764  ? 125 LYS A CG   1 
ATOM   2094 C CG   B LYS A 1 125 ? 5.98283   12.91355 -1.79428 0.517 41.68831  ? 125 LYS A CG   1 
ATOM   2095 C CD   A LYS A 1 125 ? 4.77896   11.64780 -3.69395 0.483 58.52153  ? 125 LYS A CD   1 
ATOM   2096 C CD   B LYS A 1 125 ? 4.53866   13.09132 -2.27527 0.517 59.06672  ? 125 LYS A CD   1 
ATOM   2097 C CE   A LYS A 1 125 ? 4.05611   12.68852 -2.82250 0.483 63.34758  ? 125 LYS A CE   1 
ATOM   2098 C CE   B LYS A 1 125 ? 4.30293   12.45644 -3.63740 0.517 61.46550  ? 125 LYS A CE   1 
ATOM   2099 N NZ   A LYS A 1 125 ? 2.61187   12.86636 -3.18672 0.483 65.53771  ? 125 LYS A NZ   1 
ATOM   2100 N NZ   B LYS A 1 125 ? 2.97004   12.82786 -4.22085 0.517 68.42182  ? 125 LYS A NZ   1 
ATOM   2101 H H    A LYS A 1 125 ? 7.79291   9.28218  -1.42415 0.483 24.02596  ? 125 LYS A H    1 
ATOM   2102 H H    B LYS A 1 125 ? 7.82225   9.26862  -1.38097 0.517 23.93616  ? 125 LYS A H    1 
ATOM   2103 H HA   A LYS A 1 125 ? 8.57043   11.83498 -1.87526 0.483 25.50765  ? 125 LYS A HA   1 
ATOM   2104 H HA   B LYS A 1 125 ? 8.56574   11.83099 -1.87820 0.517 25.37420  ? 125 LYS A HA   1 
ATOM   2105 H HB2  A LYS A 1 125 ? 5.92330   10.85536 -1.48508 0.483 34.23255  ? 125 LYS A HB2  1 
ATOM   2106 H HB2  B LYS A 1 125 ? 6.55813   11.36215 -3.00330 0.517 33.93008  ? 125 LYS A HB2  1 
ATOM   2107 H HB3  A LYS A 1 125 ? 6.26330   12.40605 -1.55694 0.483 34.23255  ? 125 LYS A HB3  1 
ATOM   2108 H HB3  B LYS A 1 125 ? 5.89885   10.87158 -1.64312 0.517 33.93008  ? 125 LYS A HB3  1 
ATOM   2109 H HG2  A LYS A 1 125 ? 6.75252   12.24513 -3.76204 0.483 54.45805  ? 125 LYS A HG2  1 
ATOM   2110 H HG2  B LYS A 1 125 ? 6.00601   13.09841 -0.84234 0.517 50.03086  ? 125 LYS A HG2  1 
ATOM   2111 H HG3  A LYS A 1 125 ? 6.59259   10.66466 -3.71814 0.483 54.45805  ? 125 LYS A HG3  1 
ATOM   2112 H HG3  B LYS A 1 125 ? 6.53725   13.55185 -2.26978 0.517 50.03086  ? 125 LYS A HG3  1 
ATOM   2113 H HD2  A LYS A 1 125 ? 4.69141   11.92253 -4.62010 0.483 70.23072  ? 125 LYS A HD2  1 
ATOM   2114 H HD2  B LYS A 1 125 ? 3.93744   12.67297 -1.63933 0.517 70.88495  ? 125 LYS A HD2  1 
ATOM   2115 H HD3  A LYS A 1 125 ? 4.34276   10.79196 -3.55913 0.483 70.23072  ? 125 LYS A HD3  1 
ATOM   2116 H HD3  B LYS A 1 125 ? 4.34069   14.03830 -2.34549 0.517 70.88495  ? 125 LYS A HD3  1 
ATOM   2117 H HE2  A LYS A 1 125 ? 4.09647   12.40500 -1.89574 0.483 76.02198  ? 125 LYS A HE2  1 
ATOM   2118 H HE2  B LYS A 1 125 ? 4.99325   12.75443 -4.25023 0.517 73.76348  ? 125 LYS A HE2  1 
ATOM   2119 H HE3  A LYS A 1 125 ? 4.49695   13.54627 -2.92653 0.483 76.02198  ? 125 LYS A HE3  1 
ATOM   2120 H HE3  B LYS A 1 125 ? 4.33350   11.49112 -3.54724 0.517 73.76348  ? 125 LYS A HE3  1 
ATOM   2121 H HZ1  A LYS A 1 125 ? 2.24196   13.48906 -2.66951 0.483 78.65013  ? 125 LYS A HZ1  1 
ATOM   2122 H HZ1  B LYS A 1 125 ? 2.95325   13.69674 -4.41282 0.517 82.11106  ? 125 LYS A HZ1  1 
ATOM   2123 H HZ2  A LYS A 1 125 ? 2.17317   12.10010 -3.07495 0.483 78.65013  ? 125 LYS A HZ2  1 
ATOM   2124 H HZ2  B LYS A 1 125 ? 2.82439   12.36443 -4.96658 0.517 82.11106  ? 125 LYS A HZ2  1 
ATOM   2125 H HZ3  A LYS A 1 125 ? 2.54126   13.11818 -4.03742 0.483 78.65013  ? 125 LYS A HZ3  1 
ATOM   2126 H HZ3  B LYS A 1 125 ? 2.32191   12.64827 -3.63795 0.517 82.11106  ? 125 LYS A HZ3  1 
ATOM   2127 N N    . HIS A 1 126 ? 7.74182   10.49232 0.89682  1.000 19.74997  ? 126 HIS A N    1 
ATOM   2128 C CA   . HIS A 1 126 ? 7.74519   10.60593 2.34757  1.000 18.89107  ? 126 HIS A CA   1 
ATOM   2129 C C    . HIS A 1 126 ? 8.70180   9.57592  2.89333  1.000 18.73007  ? 126 HIS A C    1 
ATOM   2130 O O    . HIS A 1 126 ? 8.69885   8.41618  2.44427  1.000 20.77249  ? 126 HIS A O    1 
ATOM   2131 C CB   . HIS A 1 126 ? 6.31417   10.37387 2.93450  1.000 18.55309  ? 126 HIS A CB   1 
ATOM   2132 C CG   . HIS A 1 126 ? 5.35978   11.41991 2.50924  1.000 18.85038  ? 126 HIS A CG   1 
ATOM   2133 N ND1  . HIS A 1 126 ? 5.11997   12.56982 3.25499  1.000 19.59290  ? 126 HIS A ND1  1 
ATOM   2134 C CD2  . HIS A 1 126 ? 4.63746   11.57788 1.36104  1.000 20.84948  ? 126 HIS A CD2  1 
ATOM   2135 C CE1  . HIS A 1 126 ? 4.27180   13.34389 2.60615  1.000 22.93137  ? 126 HIS A CE1  1 
ATOM   2136 N NE2  . HIS A 1 126 ? 3.97218   12.77173 1.44294  1.000 24.69898  ? 126 HIS A NE2  1 
ATOM   2137 H H    . HIS A 1 126 ? 7.58406   9.68725  0.63882  1.000 23.70484  ? 126 HIS A H    1 
ATOM   2138 H HA   . HIS A 1 126 ? 8.04003   11.49062 2.61459  1.000 22.67416  ? 126 HIS A HA   1 
ATOM   2139 H HB2  . HIS A 1 126 ? 5.97997   9.51645  2.62784  1.000 22.26859  ? 126 HIS A HB2  1 
ATOM   2140 H HB3  . HIS A 1 126 ? 6.36241   10.38390 3.90325  1.000 22.26859  ? 126 HIS A HB3  1 
ATOM   2141 H HD1  . HIS A 1 126 ? 5.47025   12.74808 4.01993  1.000 23.51636  ? 126 HIS A HD1  1 
ATOM   2142 H HD2  . HIS A 1 126 ? 4.60347   10.98019 0.64934  1.000 25.02426  ? 126 HIS A HD2  1 
ATOM   2143 H HE1  . HIS A 1 126 ? 3.93793   14.15637 2.91162  1.000 27.52252  ? 126 HIS A HE1  1 
ATOM   2144 N N    . VAL A 1 127 ? 9.53529   9.99192  3.83987  1.000 18.50986  ? 127 VAL A N    1 
ATOM   2145 C CA   . VAL A 1 127 ? 10.55487  9.11725  4.40815  1.000 17.88460  ? 127 VAL A CA   1 
ATOM   2146 C C    . VAL A 1 127 ? 9.93177   8.21046  5.47611  1.000 18.10811  ? 127 VAL A C    1 
ATOM   2147 O O    . VAL A 1 127 ? 9.46146   8.71009  6.50710  1.000 19.79595  ? 127 VAL A O    1 
ATOM   2148 C CB   . VAL A 1 127 ? 11.69999  9.91754  4.98676  1.000 18.52972  ? 127 VAL A CB   1 
ATOM   2149 C CG1  . VAL A 1 127 ? 12.73459  8.99466  5.55820  1.000 21.21958  ? 127 VAL A CG1  1 
ATOM   2150 C CG2  . VAL A 1 127 ? 12.39230  10.75217 3.89590  1.000 20.45571  ? 127 VAL A CG2  1 
ATOM   2151 H H    . VAL A 1 127 ? 9.53100   10.78448 4.17367  1.000 22.21671  ? 127 VAL A H    1 
ATOM   2152 H HA   . VAL A 1 127 ? 10.89358  8.54837  3.69924  1.000 21.46640  ? 127 VAL A HA   1 
ATOM   2153 H HB   . VAL A 1 127 ? 11.33705  10.49974 5.67249  1.000 22.24054  ? 127 VAL A HB   1 
ATOM   2154 H HG11 . VAL A 1 127 ? 13.53090  9.50603  5.77105  1.000 25.46838  ? 127 VAL A HG11 1 
ATOM   2155 H HG12 . VAL A 1 127 ? 12.38106  8.58307  6.36225  1.000 25.46838  ? 127 VAL A HG12 1 
ATOM   2156 H HG13 . VAL A 1 127 ? 12.94547  8.31183  4.90233  1.000 25.46838  ? 127 VAL A HG13 1 
ATOM   2157 H HG21 . VAL A 1 127 ? 13.17236  11.18497 4.27681  1.000 24.55173  ? 127 VAL A HG21 1 
ATOM   2158 H HG22 . VAL A 1 127 ? 12.66030  10.16523 3.17162  1.000 24.55173  ? 127 VAL A HG22 1 
ATOM   2159 H HG23 . VAL A 1 127 ? 11.77066  11.42040 3.56736  1.000 24.55173  ? 127 VAL A HG23 1 
ATOM   2160 N N    . VAL A 1 128 ? 10.00651  6.91386  5.25206  1.000 18.82337  ? 128 VAL A N    1 
ATOM   2161 C CA   . VAL A 1 128 ? 9.59442   5.87747  6.20181  1.000 17.39671  ? 128 VAL A CA   1 
ATOM   2162 C C    . VAL A 1 128 ? 10.72430  5.63397  7.16327  1.000 20.29575  ? 128 VAL A C    1 
ATOM   2163 O O    . VAL A 1 128 ? 11.87052  5.47810  6.76405  1.000 22.20973  ? 128 VAL A O    1 
ATOM   2164 C CB   . VAL A 1 128 ? 9.20295   4.58853  5.47631  1.000 18.60041  ? 128 VAL A CB   1 
ATOM   2165 C CG1  . VAL A 1 128 ? 8.93726   3.46129  6.47787  1.000 21.45562  ? 128 VAL A CG1  1 
ATOM   2166 C CG2  . VAL A 1 128 ? 7.98242   4.86206  4.61077  1.000 21.66149  ? 128 VAL A CG2  1 
ATOM   2167 H H    . VAL A 1 128 ? 10.30806  6.58029  4.51898  1.000 22.59292  ? 128 VAL A H    1 
ATOM   2168 H HA   . VAL A 1 128 ? 8.82071   6.18864  6.69724  1.000 20.88093  ? 128 VAL A HA   1 
ATOM   2169 H HB   . VAL A 1 128 ? 9.93035   4.29304  4.90669  1.000 22.32537  ? 128 VAL A HB   1 
ATOM   2170 H HG11 . VAL A 1 128 ? 8.51625   2.72017  6.01485  1.000 25.75162  ? 128 VAL A HG11 1 
ATOM   2171 H HG12 . VAL A 1 128 ? 9.78062   3.17502  6.86219  1.000 25.75162  ? 128 VAL A HG12 1 
ATOM   2172 H HG13 . VAL A 1 128 ? 8.35051   3.79118  7.17630  1.000 25.75162  ? 128 VAL A HG13 1 
ATOM   2173 H HG21 . VAL A 1 128 ? 7.77191   4.06440  4.10056  1.000 25.99867  ? 128 VAL A HG21 1 
ATOM   2174 H HG22 . VAL A 1 128 ? 7.23503   5.09527  5.18342  1.000 25.99867  ? 128 VAL A HG22 1 
ATOM   2175 H HG23 . VAL A 1 128 ? 8.18012   5.59689  4.00924  1.000 25.99867  ? 128 VAL A HG23 1 
ATOM   2176 N N    . PHE A 1 129 ? 10.41417  5.64572  8.46678  1.000 18.44576  ? 129 PHE A N    1 
ATOM   2177 C CA   . PHE A 1 129 ? 11.46003  5.55075  9.47243  1.000 19.50628  ? 129 PHE A CA   1 
ATOM   2178 C C    . PHE A 1 129 ? 11.11635  4.68716  10.69179 1.000 19.20071  ? 129 PHE A C    1 
ATOM   2179 O O    . PHE A 1 129 ? 11.97830  4.51220  11.57013 1.000 22.12722  ? 129 PHE A O    1 
ATOM   2180 C CB   . PHE A 1 129 ? 11.87910  6.95637  9.96772  1.000 20.63499  ? 129 PHE A CB   1 
ATOM   2181 C CG   . PHE A 1 129 ? 10.81348  7.70026  10.70658 1.000 20.65769  ? 129 PHE A CG   1 
ATOM   2182 C CD1  . PHE A 1 129 ? 9.80488   8.40463  10.06520 1.000 19.03186  ? 129 PHE A CD1  1 
ATOM   2183 C CD2  . PHE A 1 129 ? 10.82221  7.65528  12.09713 1.000 22.50436  ? 129 PHE A CD2  1 
ATOM   2184 C CE1  . PHE A 1 129 ? 8.80773   9.04579  10.76819 1.000 21.68273  ? 129 PHE A CE1  1 
ATOM   2185 C CE2  . PHE A 1 129 ? 9.84597   8.30904  12.83091 1.000 23.18291  ? 129 PHE A CE2  1 
ATOM   2186 C CZ   . PHE A 1 129 ? 8.83246   9.00634  12.19956 1.000 23.12671  ? 129 PHE A CZ   1 
ATOM   2187 H H    . PHE A 1 129 ? 9.61620   5.70710  8.78154  1.000 22.13979  ? 129 PHE A H    1 
ATOM   2188 H HA   . PHE A 1 129 ? 12.22430  5.13869  9.03998  1.000 23.41242  ? 129 PHE A HA   1 
ATOM   2189 H HB2  . PHE A 1 129 ? 12.63636  6.85947  10.56611 1.000 24.76687  ? 129 PHE A HB2  1 
ATOM   2190 H HB3  . PHE A 1 129 ? 12.13011  7.49211  9.19903  1.000 24.76687  ? 129 PHE A HB3  1 
ATOM   2191 H HD1  . PHE A 1 129 ? 9.80153   8.44525  9.13610  1.000 22.84312  ? 129 PHE A HD1  1 
ATOM   2192 H HD2  . PHE A 1 129 ? 11.49000  7.18166  12.53832 1.000 27.01012  ? 129 PHE A HD2  1 
ATOM   2193 H HE1  . PHE A 1 129 ? 8.12928   9.49710  10.31994 1.000 26.02416  ? 129 PHE A HE1  1 
ATOM   2194 H HE2  . PHE A 1 129 ? 9.87255   8.27859  13.76003 1.000 27.82437  ? 129 PHE A HE2  1 
ATOM   2195 H HZ   . PHE A 1 129 ? 8.17797   9.44230  12.69602 1.000 27.75694  ? 129 PHE A HZ   1 
ATOM   2196 N N    . GLY A 1 130 ? 9.94400   4.07948  10.75330 1.000 20.33598  ? 130 GLY A N    1 
ATOM   2197 C CA   . GLY A 1 130 ? 9.68526   3.18423  11.85810 1.000 23.04379  ? 130 GLY A CA   1 
ATOM   2198 C C    . GLY A 1 130 ? 8.40378   2.41725  11.61916 1.000 22.45292  ? 130 GLY A C    1 
ATOM   2199 O O    . GLY A 1 130 ? 7.76370   2.51315  10.56081 1.000 22.13545  ? 130 GLY A O    1 
ATOM   2200 H H    . GLY A 1 130 ? 9.30395   4.16710  10.18562 1.000 24.40806  ? 130 GLY A H    1 
ATOM   2201 H HA2  . GLY A 1 130 ? 10.41668  2.55381  11.95028 1.000 27.65743  ? 130 GLY A HA2  1 
ATOM   2202 H HA3  . GLY A 1 130 ? 9.59976   3.69121  12.68063 1.000 27.65743  ? 130 GLY A HA3  1 
ATOM   2203 N N    A LYS A 1 131 ? 8.02102   1.64767  12.64205 0.239 21.97883  ? 131 LYS A N    1 
ATOM   2204 N N    B LYS A 1 131 ? 8.06417   1.59622  12.60176 0.550 22.08679  ? 131 LYS A N    1 
ATOM   2205 N N    C LYS A 1 131 ? 8.01666   1.64648  12.63254 0.211 21.91485  ? 131 LYS A N    1 
ATOM   2206 C CA   A LYS A 1 131 ? 6.87621   0.74717  12.55758 0.239 21.42316  ? 131 LYS A CA   1 
ATOM   2207 C CA   B LYS A 1 131 ? 6.80715   0.86661  12.55555 0.550 24.06545  ? 131 LYS A CA   1 
ATOM   2208 C CA   C LYS A 1 131 ? 6.80426   0.84926  12.52621 0.211 21.98655  ? 131 LYS A CA   1 
ATOM   2209 C C    A LYS A 1 131 ? 6.31260   0.47205  13.95183 0.239 21.47130  ? 131 LYS A C    1 
ATOM   2210 C C    B LYS A 1 131 ? 6.27829   0.72326  13.98230 0.550 18.28274  ? 131 LYS A C    1 
ATOM   2211 C C    C LYS A 1 131 ? 6.30238   0.48155  13.91845 0.211 21.72068  ? 131 LYS A C    1 
ATOM   2212 O O    A LYS A 1 131 ? 7.07367   0.19537  14.88973 0.239 19.94908  ? 131 LYS A O    1 
ATOM   2213 O O    B LYS A 1 131 ? 7.02368   0.80516  14.95434 0.550 22.30944  ? 131 LYS A O    1 
ATOM   2214 O O    C LYS A 1 131 ? 7.09425   0.16669  14.81685 0.211 19.93263  ? 131 LYS A O    1 
ATOM   2215 C CB   A LYS A 1 131 ? 7.28668   -0.56528 11.89004 0.239 23.16610  ? 131 LYS A CB   1 
ATOM   2216 C CB   B LYS A 1 131 ? 6.99841   -0.49062 11.86661 0.550 23.93904  ? 131 LYS A CB   1 
ATOM   2217 C CB   C LYS A 1 131 ? 7.06249   -0.40675 11.69408 0.211 22.40179  ? 131 LYS A CB   1 
ATOM   2218 C CG   A LYS A 1 131 ? 6.20454   -1.61270 11.88788 0.239 21.85208  ? 131 LYS A CG   1 
ATOM   2219 C CG   B LYS A 1 131 ? 7.77939   -1.51989 12.68347 0.550 22.27163  ? 131 LYS A CG   1 
ATOM   2220 C CG   C LYS A 1 131 ? 5.81018   -1.10847 11.21281 0.211 25.13829  ? 131 LYS A CG   1 
ATOM   2221 C CD   A LYS A 1 131 ? 6.40751   -2.62613 10.76149 0.239 28.32111  ? 131 LYS A CD   1 
ATOM   2222 C CD   B LYS A 1 131 ? 7.82266   -2.90564 12.03228 0.550 28.11232  ? 131 LYS A CD   1 
ATOM   2223 C CD   C LYS A 1 131 ? 6.16575   -2.19626 10.23457 0.211 27.15121  ? 131 LYS A CD   1 
ATOM   2224 C CE   A LYS A 1 131 ? 5.09862   -3.28552 10.32316 0.239 28.62252  ? 131 LYS A CE   1 
ATOM   2225 C CE   B LYS A 1 131 ? 8.82568   -3.79694 12.68836 0.550 39.27377  ? 131 LYS A CE   1 
ATOM   2226 C CE   C LYS A 1 131 ? 4.94624   -2.82542 9.59555  0.211 29.48570  ? 131 LYS A CE   1 
ATOM   2227 N NZ   A LYS A 1 131 ? 4.00743   -2.26249 10.08322 0.239 28.49212  ? 131 LYS A NZ   1 
ATOM   2228 N NZ   B LYS A 1 131 ? 8.87396   -5.06527 11.91250 0.550 46.69021  ? 131 LYS A NZ   1 
ATOM   2229 N NZ   C LYS A 1 131 ? 5.34187   -3.77532 8.54371  0.211 31.49930  ? 131 LYS A NZ   1 
ATOM   2230 H H    A LYS A 1 131 ? 8.41604   1.63097  13.40578 0.239 26.37948  ? 131 LYS A H    1 
ATOM   2231 H H    B LYS A 1 131 ? 8.54120   1.44550  13.30128 0.550 26.50903  ? 131 LYS A H    1 
ATOM   2232 H H    C LYS A 1 131 ? 8.43466   1.57085  13.38031 0.211 26.30271  ? 131 LYS A H    1 
ATOM   2233 H HA   A LYS A 1 131 ? 6.17216   1.17241  12.04341 0.239 25.71268  ? 131 LYS A HA   1 
ATOM   2234 H HA   B LYS A 1 131 ? 6.13785   1.35767  12.05376 0.550 28.88342  ? 131 LYS A HA   1 
ATOM   2235 H HA   C LYS A 1 131 ? 6.10667   1.37232  12.10115 0.211 26.38874  ? 131 LYS A HA   1 
ATOM   2236 H HB2  A LYS A 1 131 ? 7.52459   -0.38413 10.96728 0.239 27.80420  ? 131 LYS A HB2  1 
ATOM   2237 H HB2  B LYS A 1 131 ? 6.12409   -0.86772 11.68155 0.550 28.73173  ? 131 LYS A HB2  1 
ATOM   2238 H HB2  C LYS A 1 131 ? 7.57842   -0.15813 10.91120 0.211 26.88703  ? 131 LYS A HB2  1 
ATOM   2239 H HB3  A LYS A 1 131 ? 8.05029   -0.93014 12.36404 0.239 27.80420  ? 131 LYS A HB3  1 
ATOM   2240 H HB3  B LYS A 1 131 ? 7.48113   -0.34941 11.03719 0.550 28.73173  ? 131 LYS A HB3  1 
ATOM   2241 H HB3  C LYS A 1 131 ? 7.56291   -1.03800 12.23446 0.211 26.88703  ? 131 LYS A HB3  1 
ATOM   2242 H HG2  A LYS A 1 131 ? 6.21707   -2.08931 12.73262 0.239 26.22738  ? 131 LYS A HG2  1 
ATOM   2243 H HG2  B LYS A 1 131 ? 8.69327   -1.21144 12.78637 0.550 26.73084  ? 131 LYS A HG2  1 
ATOM   2244 H HG2  C LYS A 1 131 ? 5.34999   -1.50823 11.96734 0.211 30.17083  ? 131 LYS A HG2  1 
ATOM   2245 H HG3  A LYS A 1 131 ? 5.34336   -1.18464 11.76123 0.239 26.22738  ? 131 LYS A HG3  1 
ATOM   2246 H HG3  B LYS A 1 131 ? 7.36091   -1.61355 13.55353 0.550 26.73084  ? 131 LYS A HG3  1 
ATOM   2247 H HG3  C LYS A 1 131 ? 5.22892   -0.47075 10.76968 0.211 30.17083  ? 131 LYS A HG3  1 
ATOM   2248 H HD2  A LYS A 1 131 ? 6.78836   -2.17387 9.99252  0.239 33.99022  ? 131 LYS A HD2  1 
ATOM   2249 H HD2  B LYS A 1 131 ? 6.95021   -3.32261 12.10893 0.550 33.73967  ? 131 LYS A HD2  1 
ATOM   2250 H HD2  C LYS A 1 131 ? 6.71462   -1.82070 9.52845  0.211 32.58633  ? 131 LYS A HD2  1 
ATOM   2251 H HD3  A LYS A 1 131 ? 7.00798   -3.32403 11.06691 0.239 33.99022  ? 131 LYS A HD3  1 
ATOM   2252 H HD3  B LYS A 1 131 ? 8.06492   -2.81258 11.09764 0.550 33.73967  ? 131 LYS A HD3  1 
ATOM   2253 H HD3  C LYS A 1 131 ? 6.65446   -2.89340 10.69940 0.211 32.58633  ? 131 LYS A HD3  1 
ATOM   2254 H HE2  A LYS A 1 131 ? 5.24618   -3.77200 9.49705  0.239 34.35190  ? 131 LYS A HE2  1 
ATOM   2255 H HE2  B LYS A 1 131 ? 9.70187   -3.38089 12.67912 0.550 47.13341  ? 131 LYS A HE2  1 
ATOM   2256 H HE2  C LYS A 1 131 ? 4.43835   -3.30470 10.26878 0.211 35.38773  ? 131 LYS A HE2  1 
ATOM   2257 H HE3  A LYS A 1 131 ? 4.79827   -3.89326 11.01695 0.239 34.35190  ? 131 LYS A HE3  1 
ATOM   2258 H HE3  B LYS A 1 131 ? 8.55895   -3.98839 13.60111 0.550 47.13341  ? 131 LYS A HE3  1 
ATOM   2259 H HE3  C LYS A 1 131 ? 4.39658   -2.13356 9.19542  0.211 35.38773  ? 131 LYS A HE3  1 
ATOM   2260 H HZ1  A LYS A 1 131 ? 4.31961   -1.59620 9.58251  0.239 34.19542  ? 131 LYS A HZ1  1 
ATOM   2261 H HZ1  B LYS A 1 131 ? 9.43803   -5.63616 12.29722 0.550 56.03314  ? 131 LYS A HZ1  1 
ATOM   2262 H HZ1  C LYS A 1 131 ? 5.79016   -3.35052 7.90286  0.211 37.80404  ? 131 LYS A HZ1  1 
ATOM   2263 H HZ2  A LYS A 1 131 ? 3.32101   -2.64246 9.66303  0.239 34.19542  ? 131 LYS A HZ2  1 
ATOM   2264 H HZ2  B LYS A 1 131 ? 8.06481   -5.43471 11.88245 0.550 56.03314  ? 131 LYS A HZ2  1 
ATOM   2265 H HZ2  C LYS A 1 131 ? 5.86174   -4.41077 8.88728  0.211 37.80404  ? 131 LYS A HZ2  1 
ATOM   2266 H HZ3  A LYS A 1 131 ? 3.72388   -1.93212 10.85946 0.239 34.19542  ? 131 LYS A HZ3  1 
ATOM   2267 H HZ3  B LYS A 1 131 ? 9.14867   -4.90352 11.08155 0.550 56.03314  ? 131 LYS A HZ3  1 
ATOM   2268 H HZ3  C LYS A 1 131 ? 4.61925   -4.15418 8.18821  0.211 37.80404  ? 131 LYS A HZ3  1 
ATOM   2269 N N    . VAL A 1 132 ? 4.97686   0.49532  14.06318 1.000 21.38380  ? 132 VAL A N    1 
ATOM   2270 C CA   . VAL A 1 132 ? 4.34410   0.08059  15.30814 1.000 21.54020  ? 132 VAL A CA   1 
ATOM   2271 C C    . VAL A 1 132 ? 4.83412   -1.31301 15.67470 1.000 23.54158  ? 132 VAL A C    1 
ATOM   2272 O O    . VAL A 1 132 ? 4.82169   -2.27223 14.87403 1.000 25.67384  ? 132 VAL A O    1 
ATOM   2273 C CB   . VAL A 1 132 ? 2.81691   0.10068  15.15918 1.000 21.58250  ? 132 VAL A CB   1 
ATOM   2274 C CG1  . VAL A 1 132 ? 2.15973   -0.47789 16.44284 1.000 23.73027  ? 132 VAL A CG1  1 
ATOM   2275 C CG2  . VAL A 1 132 ? 2.24491   1.47187  14.92212 1.000 23.96681  ? 132 VAL A CG2  1 
ATOM   2276 H H    . VAL A 1 132 ? 4.43298   0.57530  13.40181 1.000 25.66545  ? 132 VAL A H    1 
ATOM   2277 H HA   . VAL A 1 132 ? 4.59590   0.69931  16.01148 1.000 25.85312  ? 132 VAL A HA   1 
ATOM   2278 H HB   . VAL A 1 132 ? 2.61394   -0.43603 14.37710 1.000 25.90388  ? 132 VAL A HB   1 
ATOM   2279 H HG11 . VAL A 1 132 ? 1.19513   -0.42656 16.35442 1.000 28.48121  ? 132 VAL A HG11 1 
ATOM   2280 H HG12 . VAL A 1 132 ? 2.43347   -1.40244 16.54854 1.000 28.48121  ? 132 VAL A HG12 1 
ATOM   2281 H HG13 . VAL A 1 132 ? 2.44989   0.04256  17.20824 1.000 28.48121  ? 132 VAL A HG13 1 
ATOM   2282 H HG21 . VAL A 1 132 ? 1.33574   1.38273  14.59598 1.000 28.76506  ? 132 VAL A HG21 1 
ATOM   2283 H HG22 . VAL A 1 132 ? 2.24981   1.96485  15.75749 1.000 28.76506  ? 132 VAL A HG22 1 
ATOM   2284 H HG23 . VAL A 1 132 ? 2.78897   1.93149  14.26360 1.000 28.76506  ? 132 VAL A HG23 1 
ATOM   2285 N N    . LYS A 1 133 ? 5.27569   -1.44827 16.92313 1.000 21.65737  ? 133 LYS A N    1 
ATOM   2286 C CA   . LYS A 1 133 ? 5.68163   -2.72712 17.46825 1.000 27.67164  ? 133 LYS A CA   1 
ATOM   2287 C C    . LYS A 1 133 ? 4.58662   -3.30453 18.36116 1.000 26.35634  ? 133 LYS A C    1 
ATOM   2288 O O    . LYS A 1 133 ? 4.28540   -4.49048 18.25559 1.000 34.18727  ? 133 LYS A O    1 
ATOM   2289 C CB   . LYS A 1 133 ? 7.01775   -2.56279 18.20365 1.000 33.38848  ? 133 LYS A CB   1 
ATOM   2290 C CG   . LYS A 1 133 ? 7.52343   -3.77077 18.92893 1.000 45.19843  ? 133 LYS A CG   1 
ATOM   2291 C CD   . LYS A 1 133 ? 8.84626   -3.40874 19.60930 1.000 62.55294  ? 133 LYS A CD   1 
ATOM   2292 C CE   . LYS A 1 133 ? 9.56100   -4.61005 20.20279 1.000 72.41082  ? 133 LYS A CE   1 
ATOM   2293 N NZ   . LYS A 1 133 ? 10.65967  -4.15500 21.10229 1.000 77.34859  ? 133 LYS A NZ   1 
ATOM   2294 H H    . LYS A 1 133 ? 5.34835   -0.79703 17.48009 1.000 25.99373  ? 133 LYS A H    1 
ATOM   2295 H HA   . LYS A 1 133 ? 5.83405   -3.36968 16.75777 1.000 33.21085  ? 133 LYS A HA   1 
ATOM   2296 H HB2  . LYS A 1 133 ? 7.69326   -2.31645 17.55257 1.000 40.07106  ? 133 LYS A HB2  1 
ATOM   2297 H HB3  . LYS A 1 133 ? 6.91677   -1.85621 18.86049 1.000 40.07106  ? 133 LYS A HB3  1 
ATOM   2298 H HG2  . LYS A 1 133 ? 6.88370   -4.04558 19.60429 1.000 54.24299  ? 133 LYS A HG2  1 
ATOM   2299 H HG3  . LYS A 1 133 ? 7.67637   -4.49538 18.30246 1.000 54.24299  ? 133 LYS A HG3  1 
ATOM   2300 H HD2  . LYS A 1 133 ? 9.43681   -3.00434 18.95463 1.000 75.06841  ? 133 LYS A HD2  1 
ATOM   2301 H HD3  . LYS A 1 133 ? 8.66945   -2.78220 20.32839 1.000 75.06841  ? 133 LYS A HD3  1 
ATOM   2302 H HE2  . LYS A 1 133 ? 8.93478   -5.14069 20.71968 1.000 86.89787  ? 133 LYS A HE2  1 
ATOM   2303 H HE3  . LYS A 1 133 ? 9.94317   -5.14751 19.49147 1.000 86.89787  ? 133 LYS A HE3  1 
ATOM   2304 H HZ1  . LYS A 1 133 ? 11.24086  -3.65888 20.64601 1.000 92.82320  ? 133 LYS A HZ1  1 
ATOM   2305 H HZ2  . LYS A 1 133 ? 10.32573  -3.66891 21.76885 1.000 92.82320  ? 133 LYS A HZ2  1 
ATOM   2306 H HZ3  . LYS A 1 133 ? 11.08530  -4.85850 21.44290 1.000 92.82320  ? 133 LYS A HZ3  1 
ATOM   2307 N N    . GLU A 1 134 ? 4.15208   -2.57292 19.35639 1.000 25.33016  ? 134 GLU A N    1 
ATOM   2308 C CA   . GLU A 1 134 ? 3.08857   -3.00490 20.24784 1.000 24.08901  ? 134 GLU A CA   1 
ATOM   2309 C C    . GLU A 1 134 ? 1.97266   -1.99043 20.18891 1.000 22.27036  ? 134 GLU A C    1 
ATOM   2310 O O    . GLU A 1 134 ? 2.21987   -0.80690 20.00303 1.000 22.96366  ? 134 GLU A O    1 
ATOM   2311 C CB   . GLU A 1 134 ? 3.50611   -3.09060 21.69858 1.000 30.97028  ? 134 GLU A CB   1 
ATOM   2312 C CG   . GLU A 1 134 ? 4.65722   -3.99315 21.89148 1.000 43.22432  ? 134 GLU A CG   1 
ATOM   2313 C CD   . GLU A 1 134 ? 5.10970   -3.96953 23.30793 1.000 52.33302  ? 134 GLU A CD   1 
ATOM   2314 O OE1  . GLU A 1 134 ? 5.63261   -2.91638 23.72943 1.000 53.36293  ? 134 GLU A OE1  1 
ATOM   2315 O OE2  . GLU A 1 134 ? 4.92087   -4.99774 23.96233 1.000 52.65319  ? 134 GLU A OE2  1 
ATOM   2316 H H    . GLU A 1 134 ? 4.46351   -1.79459 19.54825 1.000 30.40108  ? 134 GLU A H    1 
ATOM   2317 H HA   . GLU A 1 134 ? 2.80385   -3.88580 19.95830 1.000 28.91169  ? 134 GLU A HA   1 
ATOM   2318 H HB2  . GLU A 1 134 ? 3.75779   -2.20715 22.01014 1.000 37.16921  ? 134 GLU A HB2  1 
ATOM   2319 H HB3  . GLU A 1 134 ? 2.76413   -3.42876 22.22396 1.000 37.16921  ? 134 GLU A HB3  1 
ATOM   2320 H HG2  . GLU A 1 134 ? 4.39956   -4.90035 21.66456 1.000 51.87407  ? 134 GLU A HG2  1 
ATOM   2321 H HG3  . GLU A 1 134 ? 5.39237   -3.70615 21.32750 1.000 51.87407  ? 134 GLU A HG3  1 
ATOM   2322 N N    . GLY A 1 135 ? 0.74417   -2.46942 20.37811 1.000 24.26369  ? 135 GLY A N    1 
ATOM   2323 C CA   . GLY A 1 135 ? -0.37346  -1.54393 20.44537 1.000 22.31286  ? 135 GLY A CA   1 
ATOM   2324 C C    . GLY A 1 135 ? -0.98046  -1.12973 19.12875 1.000 21.74546  ? 135 GLY A C    1 
ATOM   2325 O O    . GLY A 1 135 ? -1.59493  -0.05487 19.07884 1.000 21.52918  ? 135 GLY A O    1 
ATOM   2326 H H    . GLY A 1 135 ? 0.54264   -3.30072 20.46713 1.000 29.12132  ? 135 GLY A H    1 
ATOM   2327 H HA2  . GLY A 1 135 ? -1.07722  -1.95413 20.97203 1.000 26.78031  ? 135 GLY A HA2  1 
ATOM   2328 H HA3  . GLY A 1 135 ? -0.07402  -0.73688 20.89246 1.000 26.78031  ? 135 GLY A HA3  1 
ATOM   2329 N N    . MET A 1 136 ? -0.85111  -1.93484 18.06483 1.000 22.55186  ? 136 MET A N    1 
ATOM   2330 C CA   . MET A 1 136 ? -1.58526  -1.57983 16.84386 1.000 24.57223  ? 136 MET A CA   1 
ATOM   2331 C C    . MET A 1 136 ? -3.08769  -1.49900 17.11260 1.000 23.04093  ? 136 MET A C    1 
ATOM   2332 O O    . MET A 1 136 ? -3.78969  -0.69008 16.47045 1.000 23.68990  ? 136 MET A O    1 
ATOM   2333 C CB   . MET A 1 136 ? -1.30850  -2.58939 15.70068 1.000 28.32034  ? 136 MET A CB   1 
ATOM   2334 C CG   . MET A 1 136 ? -1.82695  -2.07791 14.37460 1.000 29.39566  ? 136 MET A CG   1 
ATOM   2335 S SD   . MET A 1 136 ? -1.00132  -0.61788 13.75592 1.000 29.97845  ? 136 MET A SD   1 
ATOM   2336 C CE   . MET A 1 136 ? -2.33019  -0.00641 12.68404 1.000 33.59225  ? 136 MET A CE   1 
ATOM   2337 H H    . MET A 1 136 ? -0.37360  -2.64906 18.02650 1.000 27.06712  ? 136 MET A H    1 
ATOM   2338 H HA   . MET A 1 136 ? -1.25775  -0.71788 16.54274 1.000 29.49156  ? 136 MET A HA   1 
ATOM   2339 H HB2  . MET A 1 136 ? -0.35204  -2.73022 15.62159 1.000 33.98929  ? 136 MET A HB2  1 
ATOM   2340 H HB3  . MET A 1 136 ? -1.75210  -3.42877 15.89954 1.000 33.98929  ? 136 MET A HB3  1 
ATOM   2341 H HG2  . MET A 1 136 ? -1.71757  -2.77697 13.71108 1.000 35.27968  ? 136 MET A HG2  1 
ATOM   2342 H HG3  . MET A 1 136 ? -2.76680  -1.85993 14.47501 1.000 35.27968  ? 136 MET A HG3  1 
ATOM   2343 H HE1  . MET A 1 136 ? -2.16519  0.92689  12.47758 1.000 40.31558  ? 136 MET A HE1  1 
ATOM   2344 H HE2  . MET A 1 136 ? -2.34236  -0.52882 11.86682 1.000 40.31558  ? 136 MET A HE2  1 
ATOM   2345 H HE3  . MET A 1 136 ? -3.17726  -0.09786 13.14773 1.000 40.31558  ? 136 MET A HE3  1 
ATOM   2346 N N    . ASN A 1 137 ? -3.58827  -2.27112 18.09273 1.000 23.39305  ? 137 ASN A N    1 
ATOM   2347 C CA   . ASN A 1 137 ? -4.98705  -2.20851 18.49165 1.000 26.40498  ? 137 ASN A CA   1 
ATOM   2348 C C    . ASN A 1 137 ? -5.36273  -0.82992 19.03943 1.000 22.56761  ? 137 ASN A C    1 
ATOM   2349 O O    . ASN A 1 137 ? -6.53630  -0.41187 18.89717 1.000 24.63265  ? 137 ASN A O    1 
ATOM   2350 C CB   . ASN A 1 137 ? -5.29100  -3.29978 19.51950 1.000 25.39884  ? 137 ASN A CB   1 
ATOM   2351 C CG   . ASN A 1 137 ? -4.39957  -3.21876 20.73821 1.000 23.28939  ? 137 ASN A CG   1 
ATOM   2352 O OD1  . ASN A 1 137 ? -3.17875  -3.18233 20.63795 1.000 26.73164  ? 137 ASN A OD1  1 
ATOM   2353 N ND2  . ASN A 1 137 ? -5.02192  -3.20061 21.92168 1.000 26.86697  ? 137 ASN A ND2  1 
ATOM   2354 H H    . ASN A 1 137 ? -3.12814  -2.84229 18.54178 1.000 28.07654  ? 137 ASN A H    1 
ATOM   2355 H HA   . ASN A 1 137 ? -5.53937  -2.37362 17.71153 1.000 31.69086  ? 137 ASN A HA   1 
ATOM   2356 H HB2  . ASN A 1 137 ? -6.21081  -3.20952 19.81395 1.000 30.48349  ? 137 ASN A HB2  1 
ATOM   2357 H HB3  . ASN A 1 137 ? -5.15815  -4.16793 19.10770 1.000 30.48349  ? 137 ASN A HB3  1 
ATOM   2358 H HD21 . ASN A 1 137 ? -4.56353  -3.15529 22.64792 1.000 32.24524  ? 137 ASN A HD21 1 
ATOM   2359 H HD22 . ASN A 1 137 ? -5.88056  -3.23425 21.95655 1.000 32.24524  ? 137 ASN A HD22 1 
ATOM   2360 N N    . ILE A 1 138 ? -4.40676  -0.13788 19.64193 1.000 21.04732  ? 138 ILE A N    1 
ATOM   2361 C CA   . ILE A 1 138 ? -4.65291  1.19573  20.17221 1.000 21.54327  ? 138 ILE A CA   1 
ATOM   2362 C C    . ILE A 1 138 ? -4.72863  2.20857  19.03340 1.000 23.00747  ? 138 ILE A C    1 
ATOM   2363 O O    . ILE A 1 138 ? -5.55938  3.13221  19.04808 1.000 22.59210  ? 138 ILE A O    1 
ATOM   2364 C CB   . ILE A 1 138 ? -3.59947  1.56664  21.22222 1.000 20.61316  ? 138 ILE A CB   1 
ATOM   2365 C CG1  . ILE A 1 138 ? -3.60659  0.60415  22.40797 1.000 23.74890  ? 138 ILE A CG1  1 
ATOM   2366 C CG2  . ILE A 1 138 ? -3.80786  3.04296  21.72558 1.000 25.37969  ? 138 ILE A CG2  1 
ATOM   2367 C CD1  . ILE A 1 138 ? -4.89820  0.49743  23.14785 1.000 24.50114  ? 138 ILE A CD1  1 
ATOM   2368 H H    . ILE A 1 138 ? -3.60188  -0.41761 19.75822 1.000 25.26166  ? 138 ILE A H    1 
ATOM   2369 H HA   . ILE A 1 138 ? -5.51125  1.19770  20.62404 1.000 25.85681  ? 138 ILE A HA   1 
ATOM   2370 H HB   . ILE A 1 138 ? -2.73503  1.49551  20.78795 1.000 24.74067  ? 138 ILE A HB   1 
ATOM   2371 H HG12 . ILE A 1 138 ? -3.38815  -0.28267 22.08128 1.000 28.50356  ? 138 ILE A HG12 1 
ATOM   2372 H HG13 . ILE A 1 138 ? -2.93493  0.89860  23.04285 1.000 28.50356  ? 138 ILE A HG13 1 
ATOM   2373 H HG21 . ILE A 1 138 ? -3.21457  3.20778  22.47508 1.000 30.46051  ? 138 ILE A HG21 1 
ATOM   2374 H HG22 . ILE A 1 138 ? -3.60394  3.65527  21.00143 1.000 30.46051  ? 138 ILE A HG22 1 
ATOM   2375 H HG23 . ILE A 1 138 ? -4.73052  3.15466  22.00328 1.000 30.46051  ? 138 ILE A HG23 1 
ATOM   2376 H HD11 . ILE A 1 138 ? -4.74100  0.05174  23.99494 1.000 29.40625  ? 138 ILE A HD11 1 
ATOM   2377 H HD12 . ILE A 1 138 ? -5.24788  1.38881  23.30296 1.000 29.40625  ? 138 ILE A HD12 1 
ATOM   2378 H HD13 . ILE A 1 138 ? -5.52568  -0.01603 22.61538 1.000 29.40625  ? 138 ILE A HD13 1 
ATOM   2379 N N    . VAL A 1 139 ? -3.88460  2.05038  18.01065 1.000 20.87580  ? 139 VAL A N    1 
ATOM   2380 C CA   . VAL A 1 139 ? -4.02577  2.85291  16.79754 1.000 20.11317  ? 139 VAL A CA   1 
ATOM   2381 C C    . VAL A 1 139 ? -5.37702  2.62927  16.15056 1.000 23.25891  ? 139 VAL A C    1 
ATOM   2382 O O    . VAL A 1 139 ? -6.02072  3.58478  15.70645 1.000 24.30145  ? 139 VAL A O    1 
ATOM   2383 C CB   . VAL A 1 139 ? -2.87811  2.55478  15.82174 1.000 21.78683  ? 139 VAL A CB   1 
ATOM   2384 C CG1  . VAL A 1 139 ? -3.00530  3.35939  14.51087 1.000 23.90952  ? 139 VAL A CG1  1 
ATOM   2385 C CG2  . VAL A 1 139 ? -1.55870  2.88320  16.43144 1.000 25.33228  ? 139 VAL A CG2  1 
ATOM   2386 H H    . VAL A 1 139 ? -3.23056  1.49218  17.99508 1.000 25.05584  ? 139 VAL A H    1 
ATOM   2387 H HA   . VAL A 1 139 ? -3.97333  3.78798  17.05011 1.000 24.11143  ? 139 VAL A HA   1 
ATOM   2388 H HB   . VAL A 1 139 ? -2.92925  1.60738  15.61998 1.000 26.14908  ? 139 VAL A HB   1 
ATOM   2389 H HG11 . VAL A 1 139 ? -2.33375  3.04912  13.88346 1.000 28.69631  ? 139 VAL A HG11 1 
ATOM   2390 H HG12 . VAL A 1 139 ? -3.89161  3.22273  14.14117 1.000 28.69631  ? 139 VAL A HG12 1 
ATOM   2391 H HG13 . VAL A 1 139 ? -2.86862  4.30024  14.70329 1.000 28.69631  ? 139 VAL A HG13 1 
ATOM   2392 H HG21 . VAL A 1 139 ? -0.85993  2.72084  15.77856 1.000 30.40362  ? 139 VAL A HG21 1 
ATOM   2393 H HG22 . VAL A 1 139 ? -1.55573  3.81703  16.69383 1.000 30.40362  ? 139 VAL A HG22 1 
ATOM   2394 H HG23 . VAL A 1 139 ? -1.42157  2.32053  17.20958 1.000 30.40362  ? 139 VAL A HG23 1 
ATOM   2395 N N    . GLU A 1 140 ? -5.82557  1.37117  16.07141 1.000 22.60628  ? 140 GLU A N    1 
ATOM   2396 C CA   . GLU A 1 140 ? -7.14459  1.09315  15.49845 1.000 23.73701  ? 140 GLU A CA   1 
ATOM   2397 C C    . GLU A 1 140 ? -8.25571  1.78583  16.31026 1.000 25.99447  ? 140 GLU A C    1 
ATOM   2398 O O    . GLU A 1 140 ? -9.22984  2.30291  15.74532 1.000 27.05352  ? 140 GLU A O    1 
ATOM   2399 C CB   . GLU A 1 140 ? -7.37597  -0.40470 15.41526 1.000 25.77230  ? 140 GLU A CB   1 
ATOM   2400 C CG   . GLU A 1 140 ? -6.42432  -1.09074 14.42872 1.000 30.79675  ? 140 GLU A CG   1 
ATOM   2401 C CD   . GLU A 1 140 ? -6.44809  -2.64116 14.51648 1.000 49.16117  ? 140 GLU A CD   1 
ATOM   2402 O OE1  . GLU A 1 140 ? -6.90996  -3.22646 15.53207 1.000 46.72308  ? 140 GLU A OE1  1 
ATOM   2403 O OE2  . GLU A 1 140 ? -5.96006  -3.26671 13.55890 1.000 44.30322  ? 140 GLU A OE2  1 
ATOM   2404 H H    . GLU A 1 140 ? -5.39463  0.67585  16.33676 1.000 27.13242  ? 140 GLU A H    1 
ATOM   2405 H HA   . GLU A 1 140 ? -7.17744  1.44142  14.59372 1.000 28.48929  ? 140 GLU A HA   1 
ATOM   2406 H HB2  . GLU A 1 140 ? -7.23540  -0.79607 16.29159 1.000 30.93165  ? 140 GLU A HB2  1 
ATOM   2407 H HB3  . GLU A 1 140 ? -8.28546  -0.56882 15.12063 1.000 30.93165  ? 140 GLU A HB3  1 
ATOM   2408 H HG2  . GLU A 1 140 ? -6.67666  -0.84128 13.52595 1.000 36.96098  ? 140 GLU A HG2  1 
ATOM   2409 H HG3  . GLU A 1 140 ? -5.51825  -0.79751 14.61296 1.000 36.96098  ? 140 GLU A HG3  1 
ATOM   2410 N N    . ALA A 1 141 ? -8.10076  1.84221  17.63098 1.000 23.91959  ? 141 ALA A N    1 
ATOM   2411 C CA   . ALA A 1 141 ? -9.09752  2.49804  18.47958 1.000 24.71098  ? 141 ALA A CA   1 
ATOM   2412 C C    . ALA A 1 141 ? -9.10133  3.99537  18.25070 1.000 27.12873  ? 141 ALA A C    1 
ATOM   2413 O O    . ALA A 1 141 ? -10.17394 4.60876  18.20188 1.000 29.72387  ? 141 ALA A O    1 
ATOM   2414 C CB   . ALA A 1 141 ? -8.81546  2.18652  19.94607 1.000 25.63013  ? 141 ALA A CB   1 
ATOM   2415 H H    . ALA A 1 141 ? -7.43305  1.51165  18.06050 1.000 28.70839  ? 141 ALA A H    1 
ATOM   2416 H HA   . ALA A 1 141 ? -9.97703  2.15292  18.25990 1.000 29.65806  ? 141 ALA A HA   1 
ATOM   2417 H HB1  . ALA A 1 141 ? -9.57344  2.47039  20.48066 1.000 30.76104  ? 141 ALA A HB1  1 
ATOM   2418 H HB2  . ALA A 1 141 ? -8.67976  1.23123  20.04555 1.000 30.76104  ? 141 ALA A HB2  1 
ATOM   2419 H HB3  . ALA A 1 141 ? -8.01802  2.66448  20.22273 1.000 30.76104  ? 141 ALA A HB3  1 
ATOM   2420 N N    . MET A 1 142 ? -7.90936  4.60135  18.09666 1.000 26.10914  ? 142 MET A N    1 
ATOM   2421 C CA   . MET A 1 142 ? -7.79140  6.03761  17.77240 1.000 23.54390  ? 142 MET A CA   1 
ATOM   2422 C C    . MET A 1 142 ? -8.51595  6.36562  16.49373 1.000 27.24551  ? 142 MET A C    1 
ATOM   2423 O O    . MET A 1 142 ? -9.12337  7.43062  16.35950 1.000 25.97689  ? 142 MET A O    1 
ATOM   2424 C CB   . MET A 1 142 ? -6.31856  6.45812  17.61362 1.000 26.23164  ? 142 MET A CB   1 
ATOM   2425 C CG   . MET A 1 142 ? -5.63316  6.37880  18.85122 1.000 29.50302  ? 142 MET A CG   1 
ATOM   2426 S SD   . MET A 1 142 ? -3.83868  6.54423  18.51464 1.000 34.21538  ? 142 MET A SD   1 
ATOM   2427 C CE   . MET A 1 142 ? -3.84635  8.07161  17.86273 1.000 28.03189  ? 142 MET A CE   1 
ATOM   2428 H H    . MET A 1 142 ? -7.15079  4.20372  18.17450 1.000 31.33585  ? 142 MET A H    1 
ATOM   2429 H HA   . MET A 1 142 ? -8.17143  6.52733  18.51849 1.000 28.25756  ? 142 MET A HA   1 
ATOM   2430 H HB2  . MET A 1 142 ? -5.88086  5.86761  16.98068 1.000 31.48285  ? 142 MET A HB2  1 
ATOM   2431 H HB3  . MET A 1 142 ? -6.27686  7.37387  17.29652 1.000 31.48285  ? 142 MET A HB3  1 
ATOM   2432 H HG2  . MET A 1 142 ? -5.91655  7.09809  19.43707 1.000 35.40851  ? 142 MET A HG2  1 
ATOM   2433 H HG3  . MET A 1 142 ? -5.80207  5.52161  19.27264 1.000 35.40851  ? 142 MET A HG3  1 
ATOM   2434 H HE1  . MET A 1 142 ? -2.93068  8.36370  17.73182 1.000 33.64314  ? 142 MET A HE1  1 
ATOM   2435 H HE2  . MET A 1 142 ? -4.31134  8.04943  17.01173 1.000 33.64314  ? 142 MET A HE2  1 
ATOM   2436 H HE3  . MET A 1 142 ? -4.30140  8.67305  18.47273 1.000 33.64314  ? 142 MET A HE3  1 
ATOM   2437 N N    . GLU A 1 143 ? -8.40810  5.46614  15.50850 1.000 26.93277  ? 143 GLU A N    1 
ATOM   2438 C CA   . GLU A 1 143 ? -8.93953  5.70440  14.18918 1.000 30.37216  ? 143 GLU A CA   1 
ATOM   2439 C C    . GLU A 1 143 ? -10.42005 5.96480  14.24119 1.000 31.60976  ? 143 GLU A C    1 
ATOM   2440 O O    . GLU A 1 143 ? -10.93954 6.74171  13.43813 1.000 35.43543  ? 143 GLU A O    1 
ATOM   2441 C CB   . GLU A 1 143 ? -8.58778  4.48847  13.30210 1.000 34.66720  ? 143 GLU A CB   1 
ATOM   2442 C CG   . GLU A 1 143 ? -8.38134  4.78156  11.92404 1.000 45.38550  ? 143 GLU A CG   1 
ATOM   2443 C CD   . GLU A 1 143 ? -8.11711  3.53440  11.08503 1.000 32.45239  ? 143 GLU A CD   1 
ATOM   2444 O OE1  . GLU A 1 143 ? -8.12206  2.39583  11.59257 1.000 37.59549  ? 143 GLU A OE1  1 
ATOM   2445 O OE2  . GLU A 1 143 ? -7.86979  3.70343  9.93641  1.000 34.43445  ? 143 GLU A OE2  1 
ATOM   2446 H H    . GLU A 1 143 ? -8.02355  4.70136  15.59113 1.000 32.32421  ? 143 GLU A H    1 
ATOM   2447 H HA   . GLU A 1 143 ? -8.53850  6.49095  13.78742 1.000 36.45147  ? 143 GLU A HA   1 
ATOM   2448 H HB2  . GLU A 1 143 ? -7.77019  4.09002  13.63925 1.000 41.60553  ? 143 GLU A HB2  1 
ATOM   2449 H HB3  . GLU A 1 143 ? -9.31535  3.84927  13.35656 1.000 41.60553  ? 143 GLU A HB3  1 
ATOM   2450 H HG2  . GLU A 1 143 ? -9.17335  5.21701  11.57190 1.000 54.46748  ? 143 GLU A HG2  1 
ATOM   2451 H HG3  . GLU A 1 143 ? -7.61393  5.36854  11.83774 1.000 54.46748  ? 143 GLU A HG3  1 
ATOM   2452 N N    . ARG A 1 144 ? -11.13050 5.35330  15.19274 1.000 29.79907  ? 144 ARG A N    1 
ATOM   2453 C CA   . ARG A 1 144 ? -12.55862 5.51216  15.30812 1.000 32.98794  ? 144 ARG A CA   1 
ATOM   2454 C C    . ARG A 1 144 ? -12.98086 6.91073  15.72243 1.000 34.57542  ? 144 ARG A C    1 
ATOM   2455 O O    . ARG A 1 144 ? -14.15104 7.24887  15.56179 1.000 39.24667  ? 144 ARG A O    1 
ATOM   2456 C CB   . ARG A 1 144 ? -13.07335 4.44507  16.25729 1.000 44.99111  ? 144 ARG A CB   1 
ATOM   2457 C CG   . ARG A 1 144 ? -12.69244 3.04453  15.73585 1.000 65.35094  ? 144 ARG A CG   1 
ATOM   2458 C CD   . ARG A 1 144 ? -13.39374 1.91842  16.45033 1.000 80.57595  ? 144 ARG A CD   1 
ATOM   2459 N NE   . ARG A 1 144 ? -12.58880 0.69382  16.42863 1.000 87.59978  ? 144 ARG A NE   1 
ATOM   2460 C CZ   . ARG A 1 144 ? -12.06932 0.10010  17.50512 1.000 87.93297  ? 144 ARG A CZ   1 
ATOM   2461 N NH1  . ARG A 1 144 ? -11.35130 -1.01013 17.36080 1.000 90.84393  ? 144 ARG A NH1  1 
ATOM   2462 N NH2  . ARG A 1 144 ? -12.27112 0.59542  18.72560 1.000 81.03843  ? 144 ARG A NH2  1 
ATOM   2463 H H    . ARG A 1 144 ? -10.79232 4.83405  15.78908 1.000 35.76377  ? 144 ARG A H    1 
ATOM   2464 H HA   . ARG A 1 144 ? -12.98629 5.37307  14.44867 1.000 39.59041  ? 144 ARG A HA   1 
ATOM   2465 H HB2  . ARG A 1 144 ? -12.67692 4.56976  17.13375 1.000 53.99421  ? 144 ARG A HB2  1 
ATOM   2466 H HB3  . ARG A 1 144 ? -14.03969 4.50244  16.31904 1.000 53.99421  ? 144 ARG A HB3  1 
ATOM   2467 H HG2  . ARG A 1 144 ? -12.92435 2.98733  14.79572 1.000 78.42601  ? 144 ARG A HG2  1 
ATOM   2468 H HG3  . ARG A 1 144 ? -11.73764 2.91744  15.85036 1.000 78.42601  ? 144 ARG A HG3  1 
ATOM   2469 H HD2  . ARG A 1 144 ? -13.54573 2.16869  17.37509 1.000 96.69602  ? 144 ARG A HD2  1 
ATOM   2470 H HD3  . ARG A 1 144 ? -14.23997 1.73651  16.01249 1.000 96.69602  ? 144 ARG A HD3  1 
ATOM   2471 H HE   . ARG A 1 144 ? -12.43982 0.33001  15.66374 1.000 105.12461 ? 144 ARG A HE   1 
ATOM   2472 H HH11 . ARG A 1 144 ? -11.22415 -1.34118 16.57732 1.000 109.01760 ? 144 ARG A HH11 1 
ATOM   2473 H HH12 . ARG A 1 144 ? -11.01416 -1.39694 18.05096 1.000 109.01760 ? 144 ARG A HH12 1 
ATOM   2474 H HH21 . ARG A 1 144 ? -12.74197 1.30773  18.82814 1.000 97.25100  ? 144 ARG A HH21 1 
ATOM   2475 H HH22 . ARG A 1 144 ? -11.93051 0.20279  19.41075 1.000 97.25100  ? 144 ARG A HH22 1 
ATOM   2476 N N    . PHE A 1 145 ? -12.06629 7.74955  16.18587 1.000 27.87774  ? 145 PHE A N    1 
ATOM   2477 C CA   . PHE A 1 145 ? -12.37970 9.13080  16.49025 1.000 25.66617  ? 145 PHE A CA   1 
ATOM   2478 C C    . PHE A 1 145 ? -12.06774 10.06414 15.34462 1.000 26.99929  ? 145 PHE A C    1 
ATOM   2479 O O    . PHE A 1 145 ? -12.20004 11.28152 15.49534 1.000 28.47617  ? 145 PHE A O    1 
ATOM   2480 C CB   . PHE A 1 145 ? -11.64927 9.57339  17.76742 1.000 26.83172  ? 145 PHE A CB   1 
ATOM   2481 C CG   . PHE A 1 145 ? -12.03018 8.75394  18.96090 1.000 29.20974  ? 145 PHE A CG   1 
ATOM   2482 C CD1  . PHE A 1 145 ? -13.24733 8.91272  19.56002 1.000 33.81921  ? 145 PHE A CD1  1 
ATOM   2483 C CD2  . PHE A 1 145 ? -11.19438 7.80329  19.42461 1.000 28.35051  ? 145 PHE A CD2  1 
ATOM   2484 C CE1  . PHE A 1 145 ? -13.60282 8.12195  20.64465 1.000 37.80719  ? 145 PHE A CE1  1 
ATOM   2485 C CE2  . PHE A 1 145 ? -11.54261 7.00853  20.54067 1.000 31.54218  ? 145 PHE A CE2  1 
ATOM   2486 C CZ   . PHE A 1 145 ? -12.71715 7.17632  21.10971 1.000 34.30423  ? 145 PHE A CZ   1 
ATOM   2487 H H    . PHE A 1 145 ? -11.24632 7.53633  16.33344 1.000 33.45817  ? 145 PHE A H    1 
ATOM   2488 H HA   . PHE A 1 145 ? -13.33061 9.20235  16.66783 1.000 30.80429  ? 145 PHE A HA   1 
ATOM   2489 H HB2  . PHE A 1 145 ? -10.69299 9.48249  17.63263 1.000 32.20294  ? 145 PHE A HB2  1 
ATOM   2490 H HB3  . PHE A 1 145 ? -11.87146 10.49890 17.95439 1.000 32.20294  ? 145 PHE A HB3  1 
ATOM   2491 H HD1  . PHE A 1 145 ? -13.84069 9.55338  19.24006 1.000 40.58793  ? 145 PHE A HD1  1 
ATOM   2492 H HD2  . PHE A 1 145 ? -10.37609 7.66823  19.00382 1.000 34.02549  ? 145 PHE A HD2  1 
ATOM   2493 H HE1  . PHE A 1 145 ? -14.43134 8.23016  21.05299 1.000 45.37351  ? 145 PHE A HE1  1 
ATOM   2494 H HE2  . PHE A 1 145 ? -10.94775 6.37367  20.86930 1.000 37.85549  ? 145 PHE A HE2  1 
ATOM   2495 H HZ   . PHE A 1 145 ? -12.95266 6.64762  21.83766 1.000 41.16995  ? 145 PHE A HZ   1 
ATOM   2496 N N    . GLY A 1 146 ? -11.68347 9.54027  14.18460 1.000 27.88197  ? 146 GLY A N    1 
ATOM   2497 C CA   . GLY A 1 146 ? -11.47985 10.36930 13.01984 1.000 24.49418  ? 146 GLY A CA   1 
ATOM   2498 C C    . GLY A 1 146 ? -12.72931 10.51957 12.18815 1.000 26.64009  ? 146 GLY A C    1 
ATOM   2499 O O    . GLY A 1 146 ? -13.82350 10.08782 12.55432 1.000 29.55386  ? 146 GLY A O    1 
ATOM   2500 H H    . GLY A 1 146 ? -11.53564 8.70315  14.05427 1.000 33.46325  ? 146 GLY A H    1 
ATOM   2501 H HA2  . GLY A 1 146 ? -11.19351 11.25223 13.30153 1.000 29.39789  ? 146 GLY A HA2  1 
ATOM   2502 H HA3  . GLY A 1 146 ? -10.78934 9.97584  12.46371 1.000 29.39789  ? 146 GLY A HA3  1 
ATOM   2503 N N    . SER A 1 147 ? -12.53127 11.09511 11.00155 1.000 25.24920  ? 147 SER A N    1 
ATOM   2504 C CA   . SER A 1 147 ? -13.62725 11.34685 10.08261 1.000 26.81183  ? 147 SER A CA   1 
ATOM   2505 C C    . SER A 1 147 ? -13.07001 11.51726 8.68984  1.000 26.08550  ? 147 SER A C    1 
ATOM   2506 O O    . SER A 1 147 ? -11.86834 11.59935 8.48396  1.000 24.54766  ? 147 SER A O    1 
ATOM   2507 C CB   . SER A 1 147 ? -14.41565 12.58383 10.49561 1.000 28.78676  ? 147 SER A CB   1 
ATOM   2508 O OG   . SER A 1 147 ? -13.64496 13.73388 10.32719 1.000 28.26748  ? 147 SER A OG   1 
ATOM   2509 H H    . SER A 1 147 ? -11.76367 11.34891 10.70835 1.000 30.27463  ? 147 SER A H    1 
ATOM   2510 H HA   . SER A 1 147 ? -14.22003 10.57905 10.08218 1.000 32.14978  ? 147 SER A HA   1 
ATOM   2511 H HB2  . SER A 1 147 ? -15.21087 12.65159 9.94431  1.000 34.54900  ? 147 SER A HB2  1 
ATOM   2512 H HB3  . SER A 1 147 ? -14.66526 12.50346 11.42950 1.000 34.54900  ? 147 SER A HB3  1 
ATOM   2513 H HG   . SER A 1 147 ? -12.88012 13.61766 10.65448 1.000 33.92586  ? 147 SER A HG   1 
ATOM   2514 N N    . ARG A 1 148 ? -13.96824 11.58599 7.70743  1.000 27.49158  ? 148 ARG A N    1 
ATOM   2515 C CA   . ARG A 1 148 ? -13.48284 11.62092 6.32724  1.000 27.09600  ? 148 ARG A CA   1 
ATOM   2516 C C    . ARG A 1 148 ? -12.64273 12.84443 6.02783  1.000 26.52594  ? 148 ARG A C    1 
ATOM   2517 O O    . ARG A 1 148 ? -11.71552 12.75227 5.20719  1.000 26.85558  ? 148 ARG A O    1 
ATOM   2518 C CB   . ARG A 1 148 ? -14.63278 11.62806 5.32932  1.000 29.00965  ? 148 ARG A CB   1 
ATOM   2519 C CG   . ARG A 1 148 ? -15.42397 10.33741 5.15423  1.000 30.76286  ? 148 ARG A CG   1 
ATOM   2520 C CD   . ARG A 1 148 ? -14.65842 9.29181  4.39101  1.000 35.38802  ? 148 ARG A CD   1 
ATOM   2521 N NE   . ARG A 1 148 ? -14.18288 9.78381  3.10460  1.000 32.97297  ? 148 ARG A NE   1 
ATOM   2522 C CZ   . ARG A 1 148 ? -14.89063 9.79833  1.97153  1.000 33.75691  ? 148 ARG A CZ   1 
ATOM   2523 N NH1  . ARG A 1 148 ? -16.14598 9.35879  1.90820  1.000 35.29318  ? 148 ARG A NH1  1 
ATOM   2524 N NH2  . ARG A 1 148 ? -14.29244 10.28139 0.86299  1.000 30.53270  ? 148 ARG A NH2  1 
ATOM   2525 H H    . ARG A 1 148 ? -14.82207 11.61236 7.80682  1.000 32.96549  ? 148 ARG A H    1 
ATOM   2526 H HA   . ARG A 1 148 ? -12.95033 10.81681 6.22362  1.000 32.49079  ? 148 ARG A HA   1 
ATOM   2527 H HB2  . ARG A 1 148 ? -15.26526 12.30771 5.61027  1.000 34.78717  ? 148 ARG A HB2  1 
ATOM   2528 H HB3  . ARG A 1 148 ? -14.26884 11.85310 4.45880  1.000 34.78717  ? 148 ARG A HB3  1 
ATOM   2529 H HG2  . ARG A 1 148 ? -15.63789 9.97515  6.02824  1.000 36.92032  ? 148 ARG A HG2  1 
ATOM   2530 H HG3  . ARG A 1 148 ? -16.23981 10.52898 4.66575  1.000 36.92032  ? 148 ARG A HG3  1 
ATOM   2531 H HD2  . ARG A 1 148 ? -13.88798 9.01764  4.91268  1.000 42.47051  ? 148 ARG A HD2  1 
ATOM   2532 H HD3  . ARG A 1 148 ? -15.23657 8.53023  4.22774  1.000 42.47051  ? 148 ARG A HD3  1 
ATOM   2533 H HE   . ARG A 1 148 ? -13.38001 10.09030 3.07199  1.000 39.57245  ? 148 ARG A HE   1 
ATOM   2534 H HH11 . ARG A 1 148 ? -16.52995 9.05112  2.61354  1.000 42.35670  ? 148 ARG A HH11 1 
ATOM   2535 H HH12 . ARG A 1 148 ? -16.57277 9.38259  1.16195  1.000 42.35670  ? 148 ARG A HH12 1 
ATOM   2536 H HH21 . ARG A 1 148 ? -13.48202 10.56662 0.90130  1.000 36.64412  ? 148 ARG A HH21 1 
ATOM   2537 H HH22 . ARG A 1 148 ? -14.72153 10.30409 0.11803  1.000 36.64412  ? 148 ARG A HH22 1 
ATOM   2538 N N    . ASN A 1 149 ? -12.96573 14.00525 6.62250  1.000 27.40966  ? 149 ASN A N    1 
ATOM   2539 C CA   . ASN A 1 149 ? -12.16087 15.20827 6.38233  1.000 27.32036  ? 149 ASN A CA   1 
ATOM   2540 C C    . ASN A 1 149 ? -10.99508 15.35109 7.36655  1.000 25.73807  ? 149 ASN A C    1 
ATOM   2541 O O    . ASN A 1 149 ? -10.24052 16.32652 7.27323  1.000 30.44723  ? 149 ASN A O    1 
ATOM   2542 C CB   . ASN A 1 149 ? -13.04033 16.47732 6.35942  1.000 29.65054  ? 149 ASN A CB   1 
ATOM   2543 C CG   . ASN A 1 149 ? -13.67785 16.81499 7.68951  1.000 36.60457  ? 149 ASN A CG   1 
ATOM   2544 O OD1  . ASN A 1 149 ? -13.22068 16.39213 8.73223  1.000 31.74786  ? 149 ASN A OD1  1 
ATOM   2545 N ND2  . ASN A 1 149 ? -14.75092 17.61578 7.64910  1.000 42.35879  ? 149 ASN A ND2  1 
ATOM   2546 H H    . ASN A 1 149 ? -13.63132 14.11490 7.15596  1.000 32.86719  ? 149 ASN A H    1 
ATOM   2547 H HA   . ASN A 1 149 ? -11.77380 15.14605 5.49508  1.000 32.76002  ? 149 ASN A HA   1 
ATOM   2548 H HB2  . ASN A 1 149 ? -12.48982 17.23184 6.09765  1.000 35.55628  ? 149 ASN A HB2  1 
ATOM   2549 H HB3  . ASN A 1 149 ? -13.75446 16.34854 5.71574  1.000 35.55628  ? 149 ASN A HB3  1 
ATOM   2550 H HD21 . ASN A 1 149 ? -15.14970 17.83750 8.37808  1.000 50.83543  ? 149 ASN A HD21 1 
ATOM   2551 H HD22 . ASN A 1 149 ? -15.04106 17.90817 6.89416  1.000 50.83543  ? 149 ASN A HD22 1 
ATOM   2552 N N    . GLY A 1 150 ? -10.83117 14.40604 8.26944  1.000 24.62005  ? 150 GLY A N    1 
ATOM   2553 C CA   . GLY A 1 150 ? -9.71713  14.37475 9.19519  1.000 23.76685  ? 150 GLY A CA   1 
ATOM   2554 C C    . GLY A 1 150 ? -9.95751  14.98314 10.55317 1.000 23.72735  ? 150 GLY A C    1 
ATOM   2555 O O    . GLY A 1 150 ? -9.17735  14.70601 11.47071 1.000 23.46001  ? 150 GLY A O    1 
ATOM   2556 H H    . GLY A 1 150 ? -11.37255 13.74551 8.37044  1.000 29.51966  ? 150 GLY A H    1 
ATOM   2557 H HA2  . GLY A 1 150 ? -9.46238  13.44915 9.33399  1.000 28.52510  ? 150 GLY A HA2  1 
ATOM   2558 H HA3  . GLY A 1 150 ? -8.97340  14.85007 8.79291  1.000 28.52510  ? 150 GLY A HA3  1 
ATOM   2559 N N    A LYS A 1 151 ? -11.00978 15.77061 10.72527 0.466 25.60124  ? 151 LYS A N    1 
ATOM   2560 N N    B LYS A 1 151 ? -11.01169 15.78060 10.73505 0.534 25.61209  ? 151 LYS A N    1 
ATOM   2561 C CA   A LYS A 1 151 ? -11.29743 16.32264 12.03876 0.466 26.51434  ? 151 LYS A CA   1 
ATOM   2562 C CA   B LYS A 1 151 ? -11.28599 16.37617 12.04317 0.534 26.55032  ? 151 LYS A CA   1 
ATOM   2563 C C    A LYS A 1 151 ? -11.61175 15.20310 13.02423 0.466 27.31546  ? 151 LYS A C    1 
ATOM   2564 C C    B LYS A 1 151 ? -11.69778 15.29703 13.03917 0.534 27.42481  ? 151 LYS A C    1 
ATOM   2565 O O    A LYS A 1 151 ? -12.22974 14.19047 12.68310 0.466 26.96332  ? 151 LYS A O    1 
ATOM   2566 O O    B LYS A 1 151 ? -12.52075 14.43184 12.72809 0.534 30.04527  ? 151 LYS A O    1 
ATOM   2567 C CB   A LYS A 1 151 ? -12.45858 17.32032 11.93923 0.466 29.14782  ? 151 LYS A CB   1 
ATOM   2568 C CB   B LYS A 1 151 ? -12.38281 17.45407 11.92038 0.534 29.18546  ? 151 LYS A CB   1 
ATOM   2569 C CG   A LYS A 1 151 ? -12.14061 18.53592 11.06952 0.466 31.72573  ? 151 LYS A CG   1 
ATOM   2570 C CG   B LYS A 1 151 ? -12.60224 18.33383 13.18474 0.534 35.31068  ? 151 LYS A CG   1 
ATOM   2571 C CD   A LYS A 1 151 ? -13.38161 19.42895 10.91268 0.466 43.59690  ? 151 LYS A CD   1 
ATOM   2572 C CD   B LYS A 1 151 ? -13.66992 19.44576 12.96929 0.534 46.23522  ? 151 LYS A CD   1 
ATOM   2573 C CE   A LYS A 1 151 ? -13.17711 20.57481 9.92146  0.466 48.42783  ? 151 LYS A CE   1 
ATOM   2574 C CE   B LYS A 1 151 ? -13.69961 20.46506 14.12061 0.534 47.57490  ? 151 LYS A CE   1 
ATOM   2575 N NZ   A LYS A 1 151 ? -14.39342 21.41731 9.76731  0.466 55.69258  ? 151 LYS A NZ   1 
ATOM   2576 N NZ   B LYS A 1 151 ? -14.59428 21.61858 13.82764 0.534 57.62662  ? 151 LYS A NZ   1 
ATOM   2577 H H    A LYS A 1 151 ? -11.56389 15.99699 10.10777 0.466 30.69708  ? 151 LYS A H    1 
ATOM   2578 H H    B LYS A 1 151 ? -11.57812 15.99063 10.12297 0.534 30.71010  ? 151 LYS A H    1 
ATOM   2579 H HA   A LYS A 1 151 ? -10.52582 16.80274 12.37792 0.466 31.79282  ? 151 LYS A HA   1 
ATOM   2580 H HA   B LYS A 1 151 ? -10.48301 16.80434 12.37902 0.534 31.83598  ? 151 LYS A HA   1 
ATOM   2581 H HB2  A LYS A 1 151 ? -13.22605 16.87027 11.55278 0.466 34.95302  ? 151 LYS A HB2  1 
ATOM   2582 H HB2  B LYS A 1 151 ? -12.14529 18.04931 11.19226 0.534 34.99820  ? 151 LYS A HB2  1 
ATOM   2583 H HB3  A LYS A 1 151 ? -12.67462 17.63940 12.82941 0.466 34.95302  ? 151 LYS A HB3  1 
ATOM   2584 H HB3  B LYS A 1 151 ? -13.22431 17.01221 11.72662 0.534 34.99820  ? 151 LYS A HB3  1 
ATOM   2585 H HG2  A LYS A 1 151 ? -11.43600 19.05711 11.48520 0.466 38.07575  ? 151 LYS A HG2  1 
ATOM   2586 H HG2  B LYS A 1 151 ? -12.90129 17.76934 13.91469 0.534 42.37770  ? 151 LYS A HG2  1 
ATOM   2587 H HG3  A LYS A 1 151 ? -11.85968 18.24074 10.18926 0.466 38.07575  ? 151 LYS A HG3  1 
ATOM   2588 H HG3  B LYS A 1 151 ? -11.76528 18.76421 13.41960 0.534 42.37770  ? 151 LYS A HG3  1 
ATOM   2589 H HD2  A LYS A 1 151 ? -14.12071 18.88774 10.59374 0.466 52.32116  ? 151 LYS A HD2  1 
ATOM   2590 H HD2  B LYS A 1 151 ? -13.46914 19.92401 12.14962 0.534 55.48714  ? 151 LYS A HD2  1 
ATOM   2591 H HD3  A LYS A 1 151 ? -13.60168 19.81634 11.77430 0.466 52.32116  ? 151 LYS A HD3  1 
ATOM   2592 H HD3  B LYS A 1 151 ? -14.54698 19.03601 12.90799 0.534 55.48714  ? 151 LYS A HD3  1 
ATOM   2593 H HE2  A LYS A 1 151 ? -12.45608 21.14208 10.23644 0.466 58.11828  ? 151 LYS A HE2  1 
ATOM   2594 H HE2  B LYS A 1 151 ? -14.02291 20.02848 14.92421 0.534 57.09476  ? 151 LYS A HE2  1 
ATOM   2595 H HE3  A LYS A 1 151 ? -12.95400 20.20656 9.05226  0.466 58.11828  ? 151 LYS A HE3  1 
ATOM   2596 H HE3  B LYS A 1 151 ? -12.80368 20.80704 14.26638 0.534 57.09476  ? 151 LYS A HE3  1 
ATOM   2597 H HZ1  A LYS A 1 151 ? -14.23275 22.08268 9.19847  0.466 66.83598  ? 151 LYS A HZ1  1 
ATOM   2598 H HZ1  B LYS A 1 151 ? -14.62290 22.16714 14.52789 0.534 69.15682  ? 151 LYS A HZ1  1 
ATOM   2599 H HZ2  A LYS A 1 151 ? -14.62781 21.76042 10.55435 0.466 66.83598  ? 151 LYS A HZ2  1 
ATOM   2600 H HZ2  B LYS A 1 151 ? -15.41765 21.32876 13.65392 0.534 69.15682  ? 151 LYS A HZ2  1 
ATOM   2601 H HZ3  A LYS A 1 151 ? -15.06637 20.92601 9.45446  0.466 66.83598  ? 151 LYS A HZ3  1 
ATOM   2602 H HZ3  B LYS A 1 151 ? -14.29102 22.06731 13.12140 0.534 69.15682  ? 151 LYS A HZ3  1 
ATOM   2603 N N    . THR A 1 152 ? -11.12248 15.35633 14.24232 1.000 28.16222  ? 152 THR A N    1 
ATOM   2604 C CA   . THR A 1 152 ? -11.39112 14.36279 15.26830 1.000 25.83489  ? 152 THR A CA   1 
ATOM   2605 C C    . THR A 1 152 ? -12.56984 14.78209 16.12065 1.000 30.15587  ? 152 THR A C    1 
ATOM   2606 O O    . THR A 1 152 ? -12.80148 15.96380 16.37787 1.000 33.63893  ? 152 THR A O    1 
ATOM   2607 C CB   . THR A 1 152 ? -10.16717 14.12729 16.15634 1.000 26.63116  ? 152 THR A CB   1 
ATOM   2608 O OG1  . THR A 1 152 ? -9.79251  15.31420 16.80932 1.000 29.22448  ? 152 THR A OG1  1 
ATOM   2609 C CG2  . THR A 1 152 ? -8.99864  13.64834 15.30648 1.000 29.82538  ? 152 THR A CG2  1 
ATOM   2610 H H    . THR A 1 152 ? -10.56946 15.96737 14.48809 1.000 33.79955  ? 152 THR A H    1 
ATOM   2611 H HA   . THR A 1 152 ? -11.60902 13.52193 14.83658 1.000 30.97750  ? 152 THR A HA   1 
ATOM   2612 H HB   . THR A 1 152 ? -10.38379 13.45649 16.82266 1.000 31.96228  ? 152 THR A HB   1 
ATOM   2613 H HG1  . THR A 1 152 ? -10.45558 15.64700 17.20326 1.000 35.07425  ? 152 THR A HG1  1 
ATOM   2614 H HG21 . THR A 1 152 ? -8.23907  13.44151 15.87320 1.000 35.79534  ? 152 THR A HG21 1 
ATOM   2615 H HG22 . THR A 1 152 ? -9.25085  12.85116 14.81475 1.000 35.79534  ? 152 THR A HG22 1 
ATOM   2616 H HG23 . THR A 1 152 ? -8.74198  14.33920 14.67581 1.000 35.79534  ? 152 THR A HG23 1 
ATOM   2617 N N    . SER A 1 153 ? -13.32226 13.79495 16.56030 1.000 29.19403  ? 153 SER A N    1 
ATOM   2618 C CA   . SER A 1 153 ? -14.51308 14.05711 17.34937 1.000 31.69497  ? 153 SER A CA   1 
ATOM   2619 C C    . SER A 1 153 ? -14.24083 14.20328 18.83484 1.000 35.14393  ? 153 SER A C    1 
ATOM   2620 O O    . SER A 1 153 ? -15.08982 14.73237 19.55320 1.000 36.35469  ? 153 SER A O    1 
ATOM   2621 C CB   . SER A 1 153 ? -15.54278 12.95887 17.08576 1.000 43.74692  ? 153 SER A CB   1 
ATOM   2622 O OG   . SER A 1 153 ? -15.06862 11.68561 17.48071 1.000 39.44132  ? 153 SER A OG   1 
ATOM   2623 H H    . SER A 1 153 ? -13.16707 12.96136 16.41660 1.000 35.03771  ? 153 SER A H    1 
ATOM   2624 H HA   . SER A 1 153 ? -14.90659 14.89891 17.07112 1.000 38.00969  ? 153 SER A HA   1 
ATOM   2625 H HB2  . SER A 1 153 ? -16.34854 13.16047 17.58677 1.000 52.50119  ? 153 SER A HB2  1 
ATOM   2626 H HB3  . SER A 1 153 ? -15.73924 12.93739 16.13611 1.000 52.50119  ? 153 SER A HB3  1 
ATOM   2627 H HG   . SER A 1 153 ? -15.56380 11.08438 17.16620 1.000 47.33447  ? 153 SER A HG   1 
ATOM   2628 N N    . LYS A 1 154 ? -13.07960 13.76868 19.29157 1.000 32.60168  ? 154 LYS A N    1 
ATOM   2629 C CA   . LYS A 1 154 ? -12.56901 13.99946 20.62150 1.000 35.82444  ? 154 LYS A CA   1 
ATOM   2630 C C    . LYS A 1 154 ? -11.10016 14.37507 20.49687 1.000 30.28643  ? 154 LYS A C    1 
ATOM   2631 O O    . LYS A 1 154 ? -10.47712 14.16493 19.45691 1.000 28.64023  ? 154 LYS A O    1 
ATOM   2632 C CB   . LYS A 1 154 ? -12.74780 12.74350 21.46724 1.000 34.93168  ? 154 LYS A CB   1 
ATOM   2633 C CG   . LYS A 1 154 ? -14.22220 12.47771 21.80049 1.000 41.80664  ? 154 LYS A CG   1 
ATOM   2634 C CD   . LYS A 1 154 ? -14.42973 11.30589 22.70566 1.000 59.16173  ? 154 LYS A CD   1 
ATOM   2635 C CE   . LYS A 1 154 ? -15.91969 11.15247 22.98719 1.000 74.78038  ? 154 LYS A CE   1 
ATOM   2636 N NZ   . LYS A 1 154 ? -16.22628 9.81477  23.54287 1.000 86.21891  ? 154 LYS A NZ   1 
ATOM   2637 H H    . LYS A 1 154 ? -12.53396 13.30596 18.81432 1.000 39.12690  ? 154 LYS A H    1 
ATOM   2638 H HA   . LYS A 1 154 ? -13.02701 14.73226 21.06210 1.000 42.99421  ? 154 LYS A HA   1 
ATOM   2639 H HB2  . LYS A 1 154 ? -12.40478 11.97911 20.97842 1.000 41.92289  ? 154 LYS A HB2  1 
ATOM   2640 H HB3  . LYS A 1 154 ? -12.26279 12.84922 22.30060 1.000 41.92289  ? 154 LYS A HB3  1 
ATOM   2641 H HG2  . LYS A 1 154 ? -14.58987 13.26015 22.24037 1.000 50.17285  ? 154 LYS A HG2  1 
ATOM   2642 H HG3  . LYS A 1 154 ? -14.70318 12.30377 20.97629 1.000 50.17285  ? 154 LYS A HG3  1 
ATOM   2643 H HD2  . LYS A 1 154 ? -14.10468 10.49739 22.27956 1.000 70.99896  ? 154 LYS A HD2  1 
ATOM   2644 H HD3  . LYS A 1 154 ? -13.96375 11.44932 23.54422 1.000 70.99896  ? 154 LYS A HD3  1 
ATOM   2645 H HE2  . LYS A 1 154 ? -16.19624 11.82237 23.63189 1.000 89.74133  ? 154 LYS A HE2  1 
ATOM   2646 H HE3  . LYS A 1 154 ? -16.41641 11.26192 22.16124 1.000 89.74133  ? 154 LYS A HE3  1 
ATOM   2647 H HZ1  . LYS A 1 154 ? -17.09566 9.75177  23.72262 1.000 103.46757 ? 154 LYS A HZ1  1 
ATOM   2648 H HZ2  . LYS A 1 154 ? -16.00631 9.18341  22.95542 1.000 103.46757 ? 154 LYS A HZ2  1 
ATOM   2649 H HZ3  . LYS A 1 154 ? -15.76597 9.68408  24.29329 1.000 103.46757 ? 154 LYS A HZ3  1 
ATOM   2650 N N    . LYS A 1 155 ? -10.55190 14.95337 21.54806 1.000 30.76154  ? 155 LYS A N    1 
ATOM   2651 C CA   . LYS A 1 155 ? -9.16851  15.40231 21.53107 1.000 27.01544  ? 155 LYS A CA   1 
ATOM   2652 C C    . LYS A 1 155 ? -8.26152  14.21712 21.83811 1.000 25.35556  ? 155 LYS A C    1 
ATOM   2653 O O    . LYS A 1 155 ? -8.36734  13.62092 22.90547 1.000 27.40836  ? 155 LYS A O    1 
ATOM   2654 C CB   . LYS A 1 155 ? -8.98095  16.51272 22.55748 1.000 31.92040  ? 155 LYS A CB   1 
ATOM   2655 C CG   . LYS A 1 155 ? -7.62700  17.18349 22.58964 1.000 48.48092  ? 155 LYS A CG   1 
ATOM   2656 C CD   . LYS A 1 155 ? -7.29664  17.78930 21.23092 1.000 66.10511  ? 155 LYS A CD   1 
ATOM   2657 C CE   . LYS A 1 155 ? -6.98901  19.27103 21.29185 1.000 80.13505  ? 155 LYS A CE   1 
ATOM   2658 N NZ   . LYS A 1 155 ? -6.75868  19.78850 19.90644 1.000 82.62019  ? 155 LYS A NZ   1 
ATOM   2659 H H    . LYS A 1 155 ? -10.96055 15.09981 22.29046 1.000 36.91873  ? 155 LYS A H    1 
ATOM   2660 H HA   . LYS A 1 155 ? -8.93473  15.74983 20.65616 1.000 32.39416  ? 155 LYS A HA   1 
ATOM   2661 H HB2  . LYS A 1 155 ? -9.63611  17.20441 22.37521 1.000 38.30937  ? 155 LYS A HB2  1 
ATOM   2662 H HB3  . LYS A 1 155 ? -9.13224  16.13636 23.43859 1.000 38.30937  ? 155 LYS A HB3  1 
ATOM   2663 H HG2  . LYS A 1 155 ? -7.63169  17.89300 23.25105 1.000 58.18199  ? 155 LYS A HG2  1 
ATOM   2664 H HG3  . LYS A 1 155 ? -6.94557  16.52920 22.80980 1.000 58.18199  ? 155 LYS A HG3  1 
ATOM   2665 H HD2  . LYS A 1 155 ? -6.51809  17.33923 20.86733 1.000 79.33101  ? 155 LYS A HD2  1 
ATOM   2666 H HD3  . LYS A 1 155 ? -8.05617  17.66791 20.63991 1.000 79.33101  ? 155 LYS A HD3  1 
ATOM   2667 H HE2  . LYS A 1 155 ? -7.73786  19.74675 21.68404 1.000 96.16694  ? 155 LYS A HE2  1 
ATOM   2668 H HE3  . LYS A 1 155 ? -6.18866  19.41954 21.81938 1.000 96.16694  ? 155 LYS A HE3  1 
ATOM   2669 H HZ1  . LYS A 1 155 ? -7.42200  19.53183 19.37144 1.000 99.14911  ? 155 LYS A HZ1  1 
ATOM   2670 H HZ2  . LYS A 1 155 ? -6.72270  20.67773 19.91571 1.000 99.14911  ? 155 LYS A HZ2  1 
ATOM   2671 H HZ3  . LYS A 1 155 ? -5.99082  19.47167 19.58691 1.000 99.14911  ? 155 LYS A HZ3  1 
ATOM   2672 N N    . ILE A 1 156 ? -7.37405  13.88879 20.91994 1.000 23.46331  ? 156 ILE A N    1 
ATOM   2673 C CA   . ILE A 1 156 ? -6.51154  12.70900 21.01475 1.000 22.17703  ? 156 ILE A CA   1 
ATOM   2674 C C    . ILE A 1 156 ? -5.13689  13.23726 21.31674 1.000 24.12425  ? 156 ILE A C    1 
ATOM   2675 O O    . ILE A 1 156 ? -4.53631  13.88451 20.45003 1.000 23.80864  ? 156 ILE A O    1 
ATOM   2676 C CB   . ILE A 1 156 ? -6.50884  11.90306 19.70719 1.000 24.48667  ? 156 ILE A CB   1 
ATOM   2677 C CG1  . ILE A 1 156 ? -7.94143  11.52367 19.24542 1.000 29.83664  ? 156 ILE A CG1  1 
ATOM   2678 C CG2  . ILE A 1 156 ? -5.60676  10.68265 19.85313 1.000 24.76631  ? 156 ILE A CG2  1 
ATOM   2679 C CD1  . ILE A 1 156 ? -8.77715  10.77836 20.22138 1.000 34.16921  ? 156 ILE A CD1  1 
ATOM   2680 H H    . ILE A 1 156 ? -7.24216  14.34575 20.20343 1.000 28.13157  ? 156 ILE A H    1 
ATOM   2681 H HA   . ILE A 1 156 ? -6.80911  12.12633 21.73088 1.000 26.58809  ? 156 ILE A HA   1 
ATOM   2682 H HB   . ILE A 1 156 ? -6.14910  12.46868 19.00607 1.000 29.38889  ? 156 ILE A HB   1 
ATOM   2683 H HG12 . ILE A 1 156 ? -8.41575  12.34242 19.03198 1.000 35.80885  ? 156 ILE A HG12 1 
ATOM   2684 H HG13 . ILE A 1 156 ? -7.86546  10.96827 18.45380 1.000 35.80885  ? 156 ILE A HG13 1 
ATOM   2685 H HG21 . ILE A 1 156 ? -5.54507  10.23132 18.99675 1.000 29.72445  ? 156 ILE A HG21 1 
ATOM   2686 H HG22 . ILE A 1 156 ? -4.72624  10.97307 20.13817 1.000 29.72445  ? 156 ILE A HG22 1 
ATOM   2687 H HG23 . ILE A 1 156 ? -5.98841  10.08520 20.51517 1.000 29.72445  ? 156 ILE A HG23 1 
ATOM   2688 H HD11 . ILE A 1 156 ? -9.70106  10.79904 19.92667 1.000 41.00794  ? 156 ILE A HD11 1 
ATOM   2689 H HD12 . ILE A 1 156 ? -8.46541  9.86103  20.26844 1.000 41.00794  ? 156 ILE A HD12 1 
ATOM   2690 H HD13 . ILE A 1 156 ? -8.69800  11.19966 21.09152 1.000 41.00794  ? 156 ILE A HD13 1 
ATOM   2691 N N    . THR A 1 157 ? -4.60879  12.97002 22.48777 1.000 21.51875  ? 157 THR A N    1 
ATOM   2692 C CA   . THR A 1 157 ? -3.35813  13.55978 22.93563 1.000 21.04509  ? 157 THR A CA   1 
ATOM   2693 C C    . THR A 1 157 ? -2.33051  12.50024 23.32725 1.000 22.96766  ? 157 THR A C    1 
ATOM   2694 O O    . THR A 1 157 ? -2.64943  11.35228 23.69500 1.000 24.00018  ? 157 THR A O    1 
ATOM   2695 C CB   . THR A 1 157 ? -3.51371  14.50874 24.09017 1.000 30.44336  ? 157 THR A CB   1 
ATOM   2696 O OG1  . THR A 1 157 ? -4.10368  13.84989 25.18376 1.000 32.66488  ? 157 THR A OG1  1 
ATOM   2697 C CG2  . THR A 1 157 ? -4.47802  15.60940 23.75277 1.000 31.61764  ? 157 THR A CG2  1 
ATOM   2698 H H    . THR A 1 157 ? -4.96187  12.43541 23.06146 1.000 25.79810  ? 157 THR A H    1 
ATOM   2699 H HA   . THR A 1 157 ? -3.01810  14.05715 22.17542 1.000 25.22981  ? 157 THR A HA   1 
ATOM   2700 H HB   . THR A 1 157 ? -2.63265  14.85663 24.29899 1.000 36.53691  ? 157 THR A HB   1 
ATOM   2701 H HG1  . THR A 1 157 ? -4.93510  13.80020 25.07477 1.000 39.20274  ? 157 THR A HG1  1 
ATOM   2702 H HG21 . THR A 1 157 ? -4.53544  16.23762 24.48961 1.000 37.94605  ? 157 THR A HG21 1 
ATOM   2703 H HG22 . THR A 1 157 ? -4.17893  16.08096 22.95962 1.000 37.94605  ? 157 THR A HG22 1 
ATOM   2704 H HG23 . THR A 1 157 ? -5.35880  15.23909 23.58545 1.000 37.94605  ? 157 THR A HG23 1 
ATOM   2705 N N    . ILE A 1 158 ? -1.07670  12.91457 23.18247 1.000 22.59177  ? 158 ILE A N    1 
ATOM   2706 C CA   . ILE A 1 158 ? 0.05638   12.14221 23.67570 1.000 20.78124  ? 158 ILE A CA   1 
ATOM   2707 C C    . ILE A 1 158 ? 0.28134   12.56592 25.12122 1.000 21.42323  ? 158 ILE A C    1 
ATOM   2708 O O    . ILE A 1 158 ? 0.93044   13.57231 25.39735 1.000 25.04790  ? 158 ILE A O    1 
ATOM   2709 C CB   . ILE A 1 158 ? 1.28865   12.36984 22.82256 1.000 20.94600  ? 158 ILE A CB   1 
ATOM   2710 C CG1  . ILE A 1 158 ? 1.01001   11.91873 21.40117 1.000 23.42313  ? 158 ILE A CG1  1 
ATOM   2711 C CG2  . ILE A 1 158 ? 2.47595   11.53123 23.36511 1.000 24.93967  ? 158 ILE A CG2  1 
ATOM   2712 C CD1  . ILE A 1 158 ? 2.11327   12.39853 20.41202 1.000 24.71242  ? 158 ILE A CD1  1 
ATOM   2713 H H    . ILE A 1 158 ? -0.85413  13.65015 22.79649 1.000 27.11501  ? 158 ILE A H    1 
ATOM   2714 H HA   . ILE A 1 158 ? -0.15810  11.19632 23.66202 1.000 24.94237  ? 158 ILE A HA   1 
ATOM   2715 H HB   . ILE A 1 158 ? 1.50699   13.31463 22.84687 1.000 25.14009  ? 158 ILE A HB   1 
ATOM   2716 H HG12 . ILE A 1 158 ? 0.97862   10.94960 21.37447 1.000 28.11264  ? 158 ILE A HG12 1 
ATOM   2717 H HG13 . ILE A 1 158 ? 0.16070   12.28631 21.11057 1.000 28.11264  ? 158 ILE A HG13 1 
ATOM   2718 H HG21 . ILE A 1 158 ? 3.17381   11.49960 22.69213 1.000 29.93249  ? 158 ILE A HG21 1 
ATOM   2719 H HG22 . ILE A 1 158 ? 2.81410   11.94833 24.17293 1.000 29.93249  ? 158 ILE A HG22 1 
ATOM   2720 H HG23 . ILE A 1 158 ? 2.16493   10.63369 23.56154 1.000 29.93249  ? 158 ILE A HG23 1 
ATOM   2721 H HD11 . ILE A 1 158 ? 1.80084   12.26812 19.50303 1.000 29.65979  ? 158 ILE A HD11 1 
ATOM   2722 H HD12 . ILE A 1 158 ? 2.29081   13.33913 20.56904 1.000 29.65979  ? 158 ILE A HD12 1 
ATOM   2723 H HD13 . ILE A 1 158 ? 2.91927   11.88019 20.56232 1.000 29.65979  ? 158 ILE A HD13 1 
ATOM   2724 N N    . ALA A 1 159 ? -0.29238  11.79580 26.05420 1.000 21.63278  ? 159 ALA A N    1 
ATOM   2725 C CA   . ALA A 1 159 ? -0.25946  12.17650 27.46555 1.000 23.87203  ? 159 ALA A CA   1 
ATOM   2726 C C    . ALA A 1 159 ? 1.12923   11.97693 28.05444 1.000 24.35419  ? 159 ALA A C    1 
ATOM   2727 O O    . ALA A 1 159 ? 1.54969   12.72892 28.95055 1.000 27.50902  ? 159 ALA A O    1 
ATOM   2728 C CB   . ALA A 1 159 ? -1.29134  11.37445 28.25557 1.000 26.00968  ? 159 ALA A CB   1 
ATOM   2729 H H    . ALA A 1 159 ? -0.70207  11.05643 25.89582 1.000 25.96422  ? 159 ALA A H    1 
ATOM   2730 H HA   . ALA A 1 159 ? -0.49380  13.11449 27.54411 1.000 28.65132  ? 159 ALA A HA   1 
ATOM   2731 H HB1  . ALA A 1 159 ? -1.30282  11.69098 29.17239 1.000 31.21650  ? 159 ALA A HB1  1 
ATOM   2732 H HB2  . ALA A 1 159 ? -2.16449  11.49874 27.85176 1.000 31.21650  ? 159 ALA A HB2  1 
ATOM   2733 H HB3  . ALA A 1 159 ? -1.04686  10.43604 28.23265 1.000 31.21650  ? 159 ALA A HB3  1 
ATOM   2734 N N    . ASP A 1 160 ? 1.86085   10.96925 27.58087 1.000 23.46309  ? 160 ASP A N    1 
ATOM   2735 C CA   . ASP A 1 160 ? 3.24000   10.75782 27.99583 1.000 22.76278  ? 160 ASP A CA   1 
ATOM   2736 C C    . ASP A 1 160 ? 3.93742   10.06365 26.84216 1.000 23.61987  ? 160 ASP A C    1 
ATOM   2737 O O    . ASP A 1 160 ? 3.29154   9.45477  25.99160 1.000 23.62308  ? 160 ASP A O    1 
ATOM   2738 C CB   . ASP A 1 160 ? 3.34880   9.90285  29.26903 1.000 25.41049  ? 160 ASP A CB   1 
ATOM   2739 C CG   . ASP A 1 160 ? 4.67512   10.05983 30.00270 1.000 29.48338  ? 160 ASP A CG   1 
ATOM   2740 O OD1  . ASP A 1 160 ? 5.52930   10.88487 29.63237 1.000 29.67107  ? 160 ASP A OD1  1 
ATOM   2741 O OD2  . ASP A 1 160 ? 4.83750   9.28295  30.98176 1.000 36.25835  ? 160 ASP A OD2  1 
ATOM   2742 H H    . ASP A 1 160 ? 1.57575   10.39011 27.01261 1.000 28.16059  ? 160 ASP A H    1 
ATOM   2743 H HA   . ASP A 1 160 ? 3.66417   11.60885 28.18748 1.000 27.32022  ? 160 ASP A HA   1 
ATOM   2744 H HB2  . ASP A 1 160 ? 2.64076   10.16083 29.87979 1.000 30.49746  ? 160 ASP A HB2  1 
ATOM   2745 H HB3  . ASP A 1 160 ? 3.25380   8.96843  29.02669 1.000 30.49746  ? 160 ASP A HB3  1 
ATOM   2746 N N    . CYS A 1 161 ? 5.25458   10.18433 26.81152 1.000 24.31959  ? 161 CYS A N    1 
ATOM   2747 C CA   . CYS A 1 161 ? 6.05437   9.55164  25.77911 1.000 21.21498  ? 161 CYS A CA   1 
ATOM   2748 C C    . CYS A 1 161 ? 7.48266   9.47364  26.27031 1.000 22.46497  ? 161 CYS A C    1 
ATOM   2749 O O    . CYS A 1 161 ? 7.90769   10.22118 27.18700 1.000 26.55094  ? 161 CYS A O    1 
ATOM   2750 C CB   . CYS A 1 161 ? 5.94702   10.26905 24.42862 1.000 22.83185  ? 161 CYS A CB   1 
ATOM   2751 S SG   . CYS A 1 161 ? 6.19786   12.02587 24.44608 1.000 24.62728  ? 161 CYS A SG   1 
ATOM   2752 H H    . CYS A 1 161 ? 5.71375   10.63256 27.38410 1.000 29.18839  ? 161 CYS A H    1 
ATOM   2753 H HA   . CYS A 1 161 ? 5.73742   8.64660  25.63303 1.000 25.46286  ? 161 CYS A HA   1 
ATOM   2754 H HB2  . CYS A 1 161 ? 6.61357   9.89203  23.83325 1.000 27.40310  ? 161 CYS A HB2  1 
ATOM   2755 H HB3  . CYS A 1 161 ? 5.05814   10.11173 24.07360 1.000 27.40310  ? 161 CYS A HB3  1 
ATOM   2756 H HG   . CYS A 1 161 ? 7.22234   12.26853 25.02188 1.000 29.55762  ? 161 CYS A HG   1 
ATOM   2757 N N    . GLY A 1 162 ? 8.21462   8.55647  25.66056 1.000 24.97611  ? 162 GLY A N    1 
ATOM   2758 C CA   . GLY A 1 162 ? 9.59930   8.36262  26.01163 1.000 27.74568  ? 162 GLY A CA   1 
ATOM   2759 C C    . GLY A 1 162 ? 10.18406  7.13370  25.35856 1.000 26.64304  ? 162 GLY A C    1 
ATOM   2760 O O    . GLY A 1 162 ? 9.62718   6.56168  24.41646 1.000 27.39935  ? 162 GLY A O    1 
ATOM   2761 H H    . GLY A 1 162 ? 7.92860   8.03473  25.03962 1.000 29.97621  ? 162 GLY A H    1 
ATOM   2762 H HA2  . GLY A 1 162 ? 10.11486  9.13425  25.72936 1.000 33.29970  ? 162 GLY A HA2  1 
ATOM   2763 H HA3  . GLY A 1 162 ? 9.67774   8.26509  26.97352 1.000 33.29970  ? 162 GLY A HA3  1 
ATOM   2764 N N    . GLN A 1 163 ? 11.36402  6.75527  25.85728 1.000 26.10780  ? 163 GLN A N    1 
ATOM   2765 C CA   . GLN A 1 163 ? 12.10755  5.67863  25.26392 1.000 29.40646  ? 163 GLN A CA   1 
ATOM   2766 C C    . GLN A 1 163 ? 12.02424  4.47097  26.18361 1.000 32.73102  ? 163 GLN A C    1 
ATOM   2767 O O    . GLN A 1 163 ? 12.15374  4.63309  27.39746 1.000 37.28306  ? 163 GLN A O    1 
ATOM   2768 C CB   . GLN A 1 163 ? 13.54335  6.12708  25.02859 1.000 29.81379  ? 163 GLN A CB   1 
ATOM   2769 C CG   . GLN A 1 163 ? 14.33536  5.12351  24.25224 1.000 34.91223  ? 163 GLN A CG   1 
ATOM   2770 C CD   . GLN A 1 163 ? 15.67799  5.65093  23.75902 1.000 36.48803  ? 163 GLN A CD   1 
ATOM   2771 O OE1  . GLN A 1 163 ? 16.01801  6.81914  23.96237 1.000 36.57785  ? 163 GLN A OE1  1 
ATOM   2772 N NE2  . GLN A 1 163 ? 16.46084  4.76306  23.15217 1.000 40.13480  ? 163 GLN A NE2  1 
ATOM   2773 H H    . GLN A 1 163 ? 11.74202  7.11688  26.53989 1.000 31.33424  ? 163 GLN A H    1 
ATOM   2774 H HA   . GLN A 1 163 ? 11.73718  5.41081  24.40835 1.000 35.29263  ? 163 GLN A HA   1 
ATOM   2775 H HB2  . GLN A 1 163 ? 13.53772  6.95860  24.52915 1.000 35.78144  ? 163 GLN A HB2  1 
ATOM   2776 H HB3  . GLN A 1 163 ? 13.97895  6.25764  25.88539 1.000 35.78144  ? 163 GLN A HB3  1 
ATOM   2777 H HG2  . GLN A 1 163 ? 14.50925  4.35621  24.81961 1.000 41.89956  ? 163 GLN A HG2  1 
ATOM   2778 H HG3  . GLN A 1 163 ? 13.82079  4.85230  23.47598 1.000 41.89956  ? 163 GLN A HG3  1 
ATOM   2779 H HE21 . GLN A 1 163 ? 17.23062  5.00236  22.85254 1.000 48.16665  ? 163 GLN A HE21 1 
ATOM   2780 H HE22 . GLN A 1 163 ? 16.19719  3.94974  23.05945 1.000 48.16665  ? 163 GLN A HE22 1 
ATOM   2781 N N    . LEU A 1 164 ? 11.74224  3.28656  25.62607 1.000 30.92965  ? 164 LEU A N    1 
ATOM   2782 C CA   . LEU A 1 164 ? 11.75288  2.02451  26.40693 1.000 34.82947  ? 164 LEU A CA   1 
ATOM   2783 C C    . LEU A 1 164 ? 13.06614  1.25936  26.30233 1.000 41.02250  ? 164 LEU A C    1 
ATOM   2784 O O    . LEU A 1 164 ? 13.56172  0.66541  27.28585 1.000 48.97963  ? 164 LEU A O    1 
ATOM   2785 C CB   . LEU A 1 164 ? 10.61184  1.10569  25.95724 1.000 37.49632  ? 164 LEU A CB   1 
ATOM   2786 C CG   . LEU A 1 164 ? 9.17707   1.57385  26.16391 1.000 42.96853  ? 164 LEU A CG   1 
ATOM   2787 C CD1  . LEU A 1 164 ? 8.19988   0.49966  25.64176 1.000 51.24406  ? 164 LEU A CD1  1 
ATOM   2788 C CD2  . LEU A 1 164 ? 8.91186   1.85170  27.62008 1.000 47.36502  ? 164 LEU A CD2  1 
ATOM   2789 H H    . LEU A 1 164 ? 11.54050  3.17921  24.79699 1.000 37.12046  ? 164 LEU A H    1 
ATOM   2790 H HA   . LEU A 1 164 ? 11.63347  2.26842  27.33813 1.000 41.80024  ? 164 LEU A HA   1 
ATOM   2791 H HB2  . LEU A 1 164 ? 10.71794  0.95194  25.00539 1.000 45.00046  ? 164 LEU A HB2  1 
ATOM   2792 H HB3  . LEU A 1 164 ? 10.70195  0.26945  26.44044 1.000 45.00046  ? 164 LEU A HB3  1 
ATOM   2793 H HG   . LEU A 1 164 ? 9.03467   2.39736  25.67152 1.000 51.56711  ? 164 LEU A HG   1 
ATOM   2794 H HD11 . LEU A 1 164 ? 7.29033   0.79090  25.81147 1.000 61.49775  ? 164 LEU A HD11 1 
ATOM   2795 H HD12 . LEU A 1 164 ? 8.33773   0.38389  24.68861 1.000 61.49775  ? 164 LEU A HD12 1 
ATOM   2796 H HD13 . LEU A 1 164 ? 8.37166   -0.33528 26.10464 1.000 61.49775  ? 164 LEU A HD13 1 
ATOM   2797 H HD21 . LEU A 1 164 ? 7.96719   2.03684  27.73931 1.000 56.84290  ? 164 LEU A HD21 1 
ATOM   2798 H HD22 . LEU A 1 164 ? 9.16479   1.07366  28.14121 1.000 56.84290  ? 164 LEU A HD22 1 
ATOM   2799 H HD23 . LEU A 1 164 ? 9.43676   2.61940  27.89580 1.000 56.84290  ? 164 LEU A HD23 1 
HETATM 2800 O O    . HOH B 2 .   ? 3.36751   -2.70874 12.39974 1.000 44.25498  ? 201 HOH A O    1 
HETATM 2801 O O    . HOH B 2 .   ? 4.99313   -0.90224 25.03148 1.000 53.02861  ? 202 HOH A O    1 
HETATM 2802 O O    . HOH B 2 .   ? 8.02059   -5.02039 9.58146  1.000 65.26064  ? 203 HOH A O    1 
HETATM 2803 O O    . HOH B 2 .   ? 15.06094  -0.81629 28.60294 1.000 63.46759  ? 204 HOH A O    1 
HETATM 2804 O O    . HOH B 2 .   ? 20.35908  13.96177 19.30729 1.000 46.29318  ? 205 HOH A O    1 
HETATM 2805 O O    . HOH B 2 .   ? 4.12222   -3.80956 6.36555  1.000 53.76131  ? 206 HOH A O    1 
HETATM 2806 O O    . HOH B 2 .   ? 3.50043   6.84328  31.17139 1.000 43.78638  ? 207 HOH A O    1 
HETATM 2807 O O    . HOH B 2 .   ? 7.57087   12.03639 30.58242 1.000 52.04653  ? 208 HOH A O    1 
HETATM 2808 O O    . HOH B 2 .   ? 6.21861   1.69663  -4.58055 1.000 50.23243  ? 209 HOH A O    1 
HETATM 2809 O O    . HOH B 2 .   ? 18.30674  21.38166 9.00421  1.000 43.75173  ? 210 HOH A O    1 
HETATM 2810 O O    . HOH B 2 .   ? 1.45654   10.79818 -4.58681 1.000 51.88318  ? 211 HOH A O    1 
HETATM 2811 O O    . HOH B 2 .   ? -1.94571  18.90067 26.20105 1.000 64.18879  ? 212 HOH A O    1 
HETATM 2812 O O    . HOH B 2 .   ? 20.98797  4.02315  5.24181  1.000 49.71285  ? 213 HOH A O    1 
HETATM 2813 O O    . HOH B 2 .   ? 1.99418   -3.82554 8.10623  1.000 60.49374  ? 214 HOH A O    1 
HETATM 2814 O O    . HOH B 2 .   ? 11.01934  22.19241 -0.92583 1.000 41.65738  ? 215 HOH A O    1 
HETATM 2815 O O    . HOH B 2 .   ? -8.75921  2.56501  2.92227  1.000 46.46783  ? 216 HOH A O    1 
HETATM 2816 O O    . HOH B 2 .   ? -7.74272  18.13638 10.99906 1.000 48.68019  ? 217 HOH A O    1 
HETATM 2817 O O    . HOH B 2 .   ? -7.46136  -0.03585 10.83477 1.000 55.95453  ? 218 HOH A O    1 
HETATM 2818 O O    . HOH B 2 .   ? 21.74723  8.52351  6.44897  1.000 43.60506  ? 219 HOH A O    1 
HETATM 2819 O O    . HOH B 2 .   ? 8.71006   -0.64484 4.98885  1.000 40.24293  ? 220 HOH A O    1 
HETATM 2820 O O    . HOH B 2 .   ? 5.42840   27.21236 14.87873 1.000 58.57612  ? 221 HOH A O    1 
HETATM 2821 O O    . HOH B 2 .   ? 1.22450   14.97115 18.15266 1.000 26.40135  ? 222 HOH A O    1 
HETATM 2822 O O    . HOH B 2 .   ? 5.33756   8.97900  -4.79187 1.000 44.73867  ? 223 HOH A O    1 
HETATM 2823 O O    . HOH B 2 .   ? 14.95645  23.39332 16.10316 1.000 46.77562  ? 224 HOH A O    1 
HETATM 2824 O O    . HOH B 2 .   ? -5.64382  13.33951 2.29192  1.000 33.02458  ? 225 HOH A O    1 
HETATM 2825 O O    . HOH B 2 .   ? 4.73208   0.22439  -0.96462 1.000 32.27729  ? 226 HOH A O    1 
HETATM 2826 O O    . HOH B 2 .   ? 7.33971   16.92022 9.20291  1.000 22.76135  ? 227 HOH A O    1 
HETATM 2827 O O    . HOH B 2 .   ? -4.89739  1.87084  0.64721  1.000 54.97048  ? 228 HOH A O    1 
HETATM 2828 O O    . HOH B 2 .   ? 13.80252  16.94794 22.44411 1.000 30.39025  ? 229 HOH A O    1 
HETATM 2829 O O    . HOH B 2 .   ? 18.42432  7.25871  17.28042 1.000 34.97770  ? 230 HOH A O    1 
HETATM 2830 O O    . HOH B 2 .   ? 11.45738  5.88900  2.87337  1.000 22.48491  ? 231 HOH A O    1 
HETATM 2831 O O    . HOH B 2 .   ? -7.33686  15.32196 18.30623 1.000 28.28849  ? 232 HOH A O    1 
HETATM 2832 O O    . HOH B 2 .   ? 0.26628   12.40739 -1.92720 1.000 48.72911  ? 233 HOH A O    1 
HETATM 2833 O O    . HOH B 2 .   ? 4.47169   19.28441 23.29770 1.000 37.60478  ? 234 HOH A O    1 
HETATM 2834 O O    . HOH B 2 .   ? -4.24559  -3.11395 11.46308 1.000 52.17568  ? 235 HOH A O    1 
HETATM 2835 O O    . HOH B 2 .   ? 9.68705   13.04964 4.01912  1.000 22.04954  ? 236 HOH A O    1 
HETATM 2836 O O    . HOH B 2 .   ? 13.14280  -1.56417 1.35926  1.000 49.71486  ? 237 HOH A O    1 
HETATM 2837 O O    . HOH B 2 .   ? 9.83955   14.72163 -0.40742 1.000 23.88307  ? 238 HOH A O    1 
HETATM 2838 O O    . HOH B 2 .   ? -9.86408  13.52632 3.35405  1.000 33.30876  ? 239 HOH A O    1 
HETATM 2839 O O    . HOH B 2 .   ? -0.25072  17.60044 15.72247 1.000 22.39787  ? 240 HOH A O    1 
HETATM 2840 O O    . HOH B 2 .   ? -7.89487  17.51988 8.02770  1.000 55.07945  ? 241 HOH A O    1 
HETATM 2841 O O    . HOH B 2 .   ? 17.14091  14.73571 -0.03316 1.000 26.87600  ? 242 HOH A O    1 
HETATM 2842 O O    . HOH B 2 .   ? 2.19849   13.88068 -0.33226 1.000 43.77089  ? 243 HOH A O    1 
HETATM 2843 O O    . HOH B 2 .   ? -10.23080 1.41929  13.34209 1.000 45.63611  ? 244 HOH A O    1 
HETATM 2844 O O    . HOH B 2 .   ? -9.63708  4.29760  30.49211 1.000 61.49045  ? 245 HOH A O    1 
HETATM 2845 O O    . HOH B 2 .   ? 19.80809  7.29821  14.85133 1.000 38.29274  ? 246 HOH A O    1 
HETATM 2846 O O    . HOH B 2 .   ? 11.17675  18.79401 26.59044 1.000 56.69772  ? 247 HOH A O    1 
HETATM 2847 O O    . HOH B 2 .   ? -11.67511 10.93434 3.11202  1.000 28.95958  ? 248 HOH A O    1 
HETATM 2848 O O    . HOH B 2 .   ? -8.91451  -1.72378 19.38353 1.000 44.25038  ? 249 HOH A O    1 
HETATM 2849 O O    . HOH B 2 .   ? 3.65542   30.06257 15.34474 1.000 42.49016  ? 250 HOH A O    1 
HETATM 2850 O O    . HOH B 2 .   ? -12.65342 7.40821  6.23464  1.000 43.85816  ? 251 HOH A O    1 
HETATM 2851 O O    . HOH B 2 .   ? -0.35208  19.55585 19.31628 1.000 24.08332  ? 252 HOH A O    1 
HETATM 2852 O O    . HOH B 2 .   ? 3.17440   26.44181 8.05542  1.000 50.70644  ? 253 HOH A O    1 
HETATM 2853 O O    . HOH B 2 .   ? 22.71429  3.67904  10.96340 1.000 55.42148  ? 254 HOH A O    1 
HETATM 2854 O O    . HOH B 2 .   ? 17.68092  -3.48150 15.92950 1.000 56.27134  ? 255 HOH A O    1 
HETATM 2855 O O    . HOH B 2 .   ? 11.84095  12.34821 12.40579 1.000 25.01554  ? 256 HOH A O    1 
HETATM 2856 O O    . HOH B 2 .   ? 13.44648  14.60120 -2.05500 1.000 28.71233  ? 257 HOH A O    1 
HETATM 2857 O O    . HOH B 2 .   ? 20.66785  12.99989 5.46613  1.000 41.13806  ? 258 HOH A O    1 
HETATM 2858 O O    . HOH B 2 .   ? 14.35157  12.45293 6.23638  1.000 22.58788  ? 259 HOH A O    1 
HETATM 2859 O O    . HOH B 2 .   ? 10.36551  16.58514 2.76417  1.000 20.36241  ? 260 HOH A O    1 
HETATM 2860 O O    . HOH B 2 .   ? -13.36738 17.11582 22.80324 1.000 56.38116  ? 261 HOH A O    1 
HETATM 2861 O O    . HOH B 2 .   ? -15.51123 10.09486 14.80245 1.000 45.67960  ? 262 HOH A O    1 
HETATM 2862 O O    . HOH B 2 .   ? -15.16570 14.87766 13.57381 1.000 50.05294  ? 263 HOH A O    1 
HETATM 2863 O O    . HOH B 2 .   ? -6.90876  13.95689 25.36219 1.000 31.64563  ? 264 HOH A O    1 
HETATM 2864 O O    . HOH B 2 .   ? 20.18192  19.27103 8.94395  1.000 49.48514  ? 265 HOH A O    1 
HETATM 2865 O O    . HOH B 2 .   ? -2.80614  6.41678  28.27324 1.000 30.61531  ? 266 HOH A O    1 
HETATM 2866 O O    . HOH B 2 .   ? 17.05891  7.67553  26.43540 1.000 51.95296  ? 267 HOH A O    1 
HETATM 2867 O O    . HOH B 2 .   ? -9.23280  16.90448 4.69143  1.000 33.82691  ? 268 HOH A O    1 
HETATM 2868 O O    . HOH B 2 .   ? -12.19887 3.58771  19.90465 1.000 41.03902  ? 269 HOH A O    1 
HETATM 2869 O O    . HOH B 2 .   ? 21.46250  12.76020 13.95930 1.000 41.74826  ? 270 HOH A O    1 
HETATM 2870 O O    . HOH B 2 .   ? -4.03284  -1.79905 3.20392  1.000 45.56033  ? 271 HOH A O    1 
HETATM 2871 O O    . HOH B 2 .   ? 20.49767  0.32334  15.00003 1.000 52.77089  ? 272 HOH A O    1 
HETATM 2872 O O    . HOH B 2 .   ? -4.72749  25.16904 16.75943 1.000 29.44979  ? 273 HOH A O    1 
HETATM 2873 O O    . HOH B 2 .   ? -8.97825  17.50365 14.59005 1.000 35.26192  ? 274 HOH A O    1 
HETATM 2874 O O    . HOH B 2 .   ? 0.76649   15.47908 29.12286 1.000 49.62780  ? 275 HOH A O    1 
HETATM 2875 O O    . HOH B 2 .   ? 20.46557  15.09321 23.60829 1.000 57.71180  ? 276 HOH A O    1 
HETATM 2876 O O    . HOH B 2 .   ? 12.38213  8.35365  28.00904 1.000 37.82160  ? 277 HOH A O    1 
HETATM 2877 O O    . HOH B 2 .   ? 3.78950   16.87419 0.59260  1.000 33.09651  ? 278 HOH A O    1 
HETATM 2878 O O    . HOH B 2 .   ? -7.45069  18.16039 17.63964 1.000 51.34713  ? 279 HOH A O    1 
HETATM 2879 O O    . HOH B 2 .   ? 0.29891   -5.24172 21.03384 1.000 32.26484  ? 280 HOH A O    1 
HETATM 2880 O O    A HOH B 2 .   ? 3.14363   13.38053 -5.97911 1.000 54.26841  ? 281 HOH A O    1 
HETATM 2881 O O    . HOH B 2 .   ? -2.20325  18.58885 8.47673  1.000 34.83726  ? 282 HOH A O    1 
HETATM 2882 O O    . HOH B 2 .   ? 18.56667  20.36126 5.95395  1.000 66.68396  ? 283 HOH A O    1 
HETATM 2883 O O    . HOH B 2 .   ? -6.14029  21.00265 11.32926 1.000 50.07741  ? 284 HOH A O    1 
HETATM 2884 O O    . HOH B 2 .   ? 9.15239   6.14508  0.70563  1.000 24.42795  ? 285 HOH A O    1 
HETATM 2885 O O    . HOH B 2 .   ? 20.92016  7.61484  3.84341  1.000 41.56928  ? 286 HOH A O    1 
HETATM 2886 O O    . HOH B 2 .   ? 6.45419   18.84323 25.73204 1.000 43.58367  ? 287 HOH A O    1 
HETATM 2887 O O    . HOH B 2 .   ? 7.55871   20.89662 23.51743 1.000 31.85862  ? 288 HOH A O    1 
HETATM 2888 O O    . HOH B 2 .   ? -18.00140 8.12479  3.78972  1.000 47.56109  ? 289 HOH A O    1 
HETATM 2889 O O    . HOH B 2 .   ? 16.02950  26.63461 11.24634 1.000 52.82665  ? 290 HOH A O    1 
HETATM 2890 O O    . HOH B 2 .   ? 8.44070   14.93061 24.65469 1.000 26.11268  ? 291 HOH A O    1 
HETATM 2891 O O    . HOH B 2 .   ? 15.03387  21.06825 -1.91667 1.000 28.25115  ? 292 HOH A O    1 
HETATM 2892 O O    . HOH B 2 .   ? -7.93876  1.09785  8.59142  1.000 55.41224  ? 293 HOH A O    1 
HETATM 2893 O O    . HOH B 2 .   ? -13.01773 9.78141  26.55240 1.000 50.69564  ? 294 HOH A O    1 
HETATM 2894 O O    . HOH B 2 .   ? 20.99480  11.68303 3.41029  1.000 44.81515  ? 295 HOH A O    1 
HETATM 2895 O O    . HOH B 2 .   ? 0.89891   17.31911 6.22175  1.000 52.59601  ? 296 HOH A O    1 
HETATM 2896 O O    . HOH B 2 .   ? -8.70095  0.91427  26.30015 1.000 49.63152  ? 297 HOH A O    1 
HETATM 2897 O O    . HOH B 2 .   ? -1.299    3.874    -6.097   1.000 49.98793  ? 298 HOH A O    1 
HETATM 2898 O O    . HOH B 2 .   ? 13.63029  5.00464  4.38477  1.000 24.24034  ? 299 HOH A O    1 
HETATM 2899 O O    . HOH B 2 .   ? 0.83974   -4.30480 17.58148 1.000 41.37769  ? 300 HOH A O    1 
HETATM 2900 O O    . HOH B 2 .   ? -5.14382  -0.56768 10.30270 1.000 53.29214  ? 301 HOH A O    1 
HETATM 2901 O O    . HOH B 2 .   ? -1.73846  11.21800 0.07083  1.000 29.08893  ? 302 HOH A O    1 
HETATM 2902 O O    . HOH B 2 .   ? 19.08077  5.47692  21.94037 1.000 50.64511  ? 303 HOH A O    1 
HETATM 2903 O O    . HOH B 2 .   ? -15.90573 15.67201 10.41464 1.000 48.28365  ? 304 HOH A O    1 
HETATM 2904 O O    . HOH B 2 .   ? 10.27744  -1.47114 2.56723  1.000 37.45936  ? 305 HOH A O    1 
HETATM 2905 O O    . HOH B 2 .   ? 16.94998  6.48759  -1.45831 1.000 35.60105  ? 306 HOH A O    1 
HETATM 2906 O O    . HOH B 2 .   ? -2.65403  28.28771 11.84830 1.000 43.41231  ? 307 HOH A O    1 
HETATM 2907 O O    . HOH B 2 .   ? 6.322     -3.098   26.633   1.000 50.80600  ? 308 HOH A O    1 
HETATM 2908 O O    . HOH B 2 .   ? 15.96909  24.67794 8.90612  1.000 53.05776  ? 309 HOH A O    1 
HETATM 2909 O O    . HOH B 2 .   ? 6.68310   19.87852 11.20901 1.000 28.06120  ? 310 HOH A O    1 
HETATM 2910 O O    . HOH B 2 .   ? -16.82201 10.82714 8.32093  1.000 38.00307  ? 311 HOH A O    1 
HETATM 2911 O O    . HOH B 2 .   ? -0.46749  -4.54049 3.46766  1.000 66.72333  ? 312 HOH A O    1 
HETATM 2912 O O    . HOH B 2 .   ? 0.19677   19.27028 7.59558  1.000 45.01713  ? 313 HOH A O    1 
HETATM 2913 O O    . HOH B 2 .   ? 15.21451  2.01013  23.14457 1.000 32.42917  ? 314 HOH A O    1 
HETATM 2914 O O    . HOH B 2 .   ? 8.72796   13.20285 26.94781 1.000 36.02366  ? 315 HOH A O    1 
HETATM 2915 O O    . HOH B 2 .   ? 16.22323  20.92299 4.27590  1.000 58.66655  ? 316 HOH A O    1 
HETATM 2916 O O    . HOH B 2 .   ? 3.45185   -4.24323 0.72982  1.000 55.48577  ? 317 HOH A O    1 
HETATM 2917 O O    . HOH B 2 .   ? 19.40639  9.98702  -0.44191 1.000 54.17701  ? 318 HOH A O    1 
HETATM 2918 O O    . HOH B 2 .   ? -2.17415  -5.64008 22.11646 1.000 31.04972  ? 319 HOH A O    1 
HETATM 2919 O O    . HOH B 2 .   ? -8.03200  -2.74367 21.99643 1.000 48.46013  ? 320 HOH A O    1 
HETATM 2920 O O    . HOH B 2 .   ? 21.26375  8.81501  20.11155 1.000 59.74195  ? 321 HOH A O    1 
HETATM 2921 O O    . HOH B 2 .   ? 2.35484   15.54981 4.44761  1.000 31.88293  ? 322 HOH A O    1 
HETATM 2922 O O    . HOH B 2 .   ? -6.67221  26.12450 13.57441 1.000 50.78305  ? 323 HOH A O    1 
HETATM 2923 O O    . HOH B 2 .   ? 1.71127   2.09604  4.41968  1.000 26.30727  ? 324 HOH A O    1 
HETATM 2924 O O    . HOH B 2 .   ? -11.02225 -0.92873 21.08975 1.000 62.33988  ? 325 HOH A O    1 
HETATM 2925 O O    . HOH B 2 .   ? -15.82874 14.36591 7.77269  1.000 68.53680  ? 326 HOH A O    1 
HETATM 2926 O O    A HOH B 2 .   ? -1.99586  -5.12936 18.47090 0.559 36.72422  ? 327 HOH A O    1 
HETATM 2927 O O    B HOH B 2 .   ? -3.18793  -6.07835 17.64416 0.441 37.43138  ? 327 HOH A O    1 
HETATM 2928 O O    . HOH B 2 .   ? 8.697     22.011   26.354   1.000 59.77498  ? 328 HOH A O    1 
HETATM 2929 O O    . HOH B 2 .   ? -2.75724  19.16817 22.31642 1.000 48.81491  ? 329 HOH A O    1 
HETATM 2930 O O    . HOH B 2 .   ? 10.88346  26.75892 21.80967 1.000 68.53667  ? 330 HOH A O    1 
HETATM 2931 O O    . HOH B 2 .   ? 22.21151  11.32788 7.19808  1.000 47.74512  ? 331 HOH A O    1 
HETATM 2932 O O    . HOH B 2 .   ? 9.24638   25.18681 20.73679 1.000 53.92889  ? 332 HOH A O    1 
HETATM 2933 O O    . HOH B 2 .   ? 5.117     -7.358   19.904   1.000 54.64569  ? 333 HOH A O    1 
HETATM 2934 O O    . HOH B 2 .   ? -0.24920  29.29214 10.31071 1.000 55.77942  ? 334 HOH A O    1 
HETATM 2935 O O    . HOH B 2 .   ? 22.00654  10.01512 13.87615 1.000 62.45509  ? 335 HOH A O    1 
HETATM 2936 O O    . HOH B 2 .   ? 8.74110   17.71189 25.67906 1.000 38.86226  ? 336 HOH A O    1 
HETATM 2937 O O    A HOH B 2 .   ? 0.90803   13.05631 5.72466  0.536 39.25920  ? 337 HOH A O    1 
HETATM 2938 O O    . HOH B 2 .   ? -7.36036  16.46558 26.06695 1.000 51.83192  ? 338 HOH A O    1 
HETATM 2939 O O    . HOH B 2 .   ? 2.26953   17.71472 28.85245 1.000 58.08907  ? 339 HOH A O    1 
HETATM 2940 O O    . HOH B 2 .   ? 5.95494   19.34860 8.36178  1.000 47.86483  ? 340 HOH A O    1 
HETATM 2941 O O    . HOH B 2 .   ? -3.83429  10.27224 30.84125 1.000 59.09267  ? 341 HOH A O    1 
HETATM 2942 O O    . HOH B 2 .   ? -14.65184 7.69676  7.92661  1.000 47.64626  ? 342 HOH A O    1 
HETATM 2943 O O    . HOH B 2 .   ? -12.07694 2.75280  11.73939 1.000 51.87677  ? 343 HOH A O    1 
HETATM 2944 O O    . HOH B 2 .   ? 19.80638  5.67919  19.08216 1.000 43.23526  ? 344 HOH A O    1 
HETATM 2945 O O    . HOH B 2 .   ? 12.373    6.389    -4.685   1.000 48.90427  ? 345 HOH A O    1 
HETATM 2946 O O    . HOH B 2 .   ? -0.56265  12.50244 2.21625  1.000 42.24239  ? 346 HOH A O    1 
HETATM 2947 O O    . HOH B 2 .   ? -2.27469  8.29579  30.29989 1.000 45.40577  ? 347 HOH A O    1 
HETATM 2948 O O    . HOH B 2 .   ? 9.14686   -3.15164 0.54677  1.000 51.15568  ? 348 HOH A O    1 
HETATM 2949 O O    . HOH B 2 .   ? 21.92974  6.01342  22.84320 1.000 65.65135  ? 349 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 2   ? 0.85489 0.97517 0.95351 0.27811  0.00889  0.07760  2   VAL A N   
2    C CA  . VAL A 2   ? 0.80415 1.00314 0.92647 0.26363  -0.00144 0.07512  2   VAL A CA  
3    C C   . VAL A 2   ? 0.61180 0.80426 0.72066 0.22174  -0.00267 0.05982  2   VAL A C   
4    O O   . VAL A 2   ? 0.56011 0.79698 0.67581 0.19992  -0.01407 0.06019  2   VAL A O   
5    C CB  . VAL A 2   ? 0.84797 1.09887 1.00323 0.28534  0.00858  0.06897  2   VAL A CB  
6    C CG1 . VAL A 2   ? 0.81229 1.15108 0.99368 0.26910  -0.00319 0.06925  2   VAL A CG1 
7    C CG2 . VAL A 2   ? 0.90267 1.14334 1.06796 0.32592  0.01384  0.08160  2   VAL A CG2 
16   N N   . ASN A 3   ? 0.51409 0.65209 0.60324 0.20988  0.00907  0.04668  3   ASN A N   
17   C CA  . ASN A 3   ? 0.35477 0.48567 0.43064 0.17431  0.00671  0.03676  3   ASN A CA  
18   C C   . ASN A 3   ? 0.35568 0.46969 0.41440 0.15935  -0.00614 0.04602  3   ASN A C   
19   O O   . ASN A 3   ? 0.42498 0.50274 0.46955 0.17134  -0.00767 0.05570  3   ASN A O   
20   C CB  . ASN A 3   ? 0.36118 0.44302 0.41848 0.16490  0.01972  0.02273  3   ASN A CB  
21   C CG  . ASN A 3   ? 0.36035 0.46422 0.42880 0.16631  0.03260  0.00882  3   ASN A CG  
22   O OD1 . ASN A 3   ? 0.34762 0.50517 0.43673 0.16453  0.03162  0.00835  3   ASN A OD1 
23   N ND2 . ASN A 3   ? 0.42624 0.48925 0.47912 0.16709  0.04555  -0.00359 3   ASN A ND2 
30   N N   . PRO A 4   ? 0.32071 0.45566 0.37811 0.13269  -0.01341 0.04276  4   PRO A N   
31   C CA  . PRO A 4   ? 0.31722 0.43800 0.35791 0.11877  -0.02364 0.04900  4   PRO A CA  
32   C C   . PRO A 4   ? 0.38271 0.44596 0.39988 0.11020  -0.01832 0.04594  4   PRO A C   
33   O O   . PRO A 4   ? 0.37287 0.41365 0.38592 0.10477  -0.00874 0.03623  4   PRO A O   
34   C CB  . PRO A 4   ? 0.39706 0.55139 0.44348 0.09238  -0.02858 0.04256  4   PRO A CB  
35   C CG  . PRO A 4   ? 0.42517 0.59675 0.48509 0.08820  -0.01960 0.03368  4   PRO A CG  
36   C CD  . PRO A 4   ? 0.35901 0.53523 0.43105 0.11519  -0.01191 0.03427  4   PRO A CD  
44   N N   . THR A 5   ? 0.34327 0.38776 0.34456 0.10778  -0.02473 0.05436  5   THR A N   
45   C CA  . THR A 5   ? 0.33332 0.33279 0.31384 0.09583  -0.02078 0.05208  5   THR A CA  
46   C C   . THR A 5   ? 0.32682 0.33521 0.29924 0.07534  -0.02734 0.05073  5   THR A C   
47   O O   . THR A 5   ? 0.37747 0.40962 0.34855 0.07504  -0.03643 0.05715  5   THR A O   
48   C CB  . THR A 5   ? 0.39609 0.35947 0.36151 0.10992  -0.01922 0.06331  5   THR A CB  
49   O OG1 . THR A 5   ? 0.47626 0.42345 0.44771 0.13104  -0.01075 0.06376  5   THR A OG1 
50   C CG2 . THR A 5   ? 0.47867 0.40122 0.42421 0.09293  -0.01398 0.05935  5   THR A CG2 
58   N N   A VAL A 6   ? 0.30450 0.29604 0.27116 0.05902  -0.02249 0.04228  6   VAL A N   
59   N N   B VAL A 6   ? 0.30511 0.29563 0.27165 0.05942  -0.02224 0.04230  6   VAL A N   
60   C CA  A VAL A 6   ? 0.30107 0.29278 0.25886 0.04259  -0.02544 0.03999  6   VAL A CA  
61   C CA  B VAL A 6   ? 0.30679 0.29694 0.26540 0.04211  -0.02440 0.03904  6   VAL A CA  
62   C C   A VAL A 6   ? 0.34753 0.30552 0.29097 0.03727  -0.02009 0.03949  6   VAL A C   
63   C C   B VAL A 6   ? 0.32873 0.28566 0.27132 0.03852  -0.02033 0.04043  6   VAL A C   
64   O O   A VAL A 6   ? 0.32724 0.26557 0.26979 0.03961  -0.01388 0.03739  6   VAL A O   
65   O O   B VAL A 6   ? 0.33124 0.26547 0.27045 0.04358  -0.01478 0.04075  6   VAL A O   
66   C CB  A VAL A 6   ? 0.38250 0.39017 0.34931 0.02822  -0.02386 0.03167  6   VAL A CB  
67   C CB  B VAL A 6   ? 0.31232 0.31109 0.27981 0.02970  -0.02045 0.03063  6   VAL A CB  
68   C CG1 A VAL A 6   ? 0.31369 0.36055 0.29479 0.02857  -0.02903 0.03154  6   VAL A CG1 
69   C CG1 B VAL A 6   ? 0.34004 0.32161 0.29831 0.01643  -0.01748 0.02701  6   VAL A CG1 
70   C CG2 A VAL A 6   ? 0.33808 0.33297 0.30894 0.02695  -0.01608 0.02742  6   VAL A CG2 
71   C CG2 B VAL A 6   ? 0.31447 0.34907 0.29491 0.02568  -0.02459 0.02897  6   VAL A CG2 
90   N N   . PHE A 7   ? 0.34037 0.29556 0.27254 0.02793  -0.02183 0.03965  7   PHE A N   
91   C CA  . PHE A 7   ? 0.35864 0.28975 0.27898 0.02207  -0.01620 0.03932  7   PHE A CA  
92   C C   . PHE A 7   ? 0.33336 0.26575 0.25388 0.01034  -0.01257 0.03170  7   PHE A C   
93   O O   . PHE A 7   ? 0.33515 0.28030 0.25756 0.00433  -0.01468 0.02710  7   PHE A O   
94   C CB  . PHE A 7   ? 0.39433 0.31616 0.29758 0.02401  -0.01816 0.04803  7   PHE A CB  
95   C CG  . PHE A 7   ? 0.37893 0.31756 0.27285 0.01684  -0.02299 0.04714  7   PHE A CG  
96   C CD1 . PHE A 7   ? 0.38789 0.35259 0.28242 0.02098  -0.03252 0.05148  7   PHE A CD1 
97   C CD2 . PHE A 7   ? 0.38281 0.31456 0.26682 0.00517  -0.01731 0.04064  7   PHE A CD2 
98   C CE1 . PHE A 7   ? 0.43060 0.41408 0.31323 0.00989  -0.03718 0.04764  7   PHE A CE1 
99   C CE2 . PHE A 7   ? 0.40413 0.34878 0.27618 -0.00343 -0.01969 0.03621  7   PHE A CE2 
100  C CZ  . PHE A 7   ? 0.41842 0.38816 0.28806 -0.00313 -0.02979 0.03866  7   PHE A CZ  
110  N N   . PHE A 8   ? 0.32789 0.24728 0.24783 0.00731  -0.00614 0.02999  8   PHE A N   
111  C CA  . PHE A 8   ? 0.30235 0.22014 0.22191 0.00094  -0.00069 0.02521  8   PHE A CA  
112  C C   . PHE A 8   ? 0.31530 0.22496 0.22378 -0.00217 0.00364  0.02712  8   PHE A C   
113  O O   . PHE A 8   ? 0.35517 0.25729 0.26224 -0.00236 0.00546  0.03059  8   PHE A O   
114  C CB  . PHE A 8   ? 0.31098 0.23037 0.24276 0.00162  0.00334  0.02379  8   PHE A CB  
115  C CG  . PHE A 8   ? 0.31256 0.23882 0.25397 0.00256  0.00188  0.02307  8   PHE A CG  
116  C CD1 . PHE A 8   ? 0.31749 0.25028 0.25967 0.00044  -0.00172 0.02142  8   PHE A CD1 
117  C CD2 . PHE A 8   ? 0.32489 0.25513 0.27438 0.00412  0.00433  0.02496  8   PHE A CD2 
118  C CE1 . PHE A 8   ? 0.31486 0.25441 0.26566 -0.00157 -0.00109 0.02128  8   PHE A CE1 
119  C CE2 . PHE A 8   ? 0.30617 0.24180 0.26198 0.00394  0.00431  0.02648  8   PHE A CE2 
120  C CZ  . PHE A 8   ? 0.29636 0.23456 0.25262 0.00039  0.00250  0.02445  8   PHE A CZ  
130  N N   . ASP A 9   ? 0.32603 0.23670 0.22595 -0.00669 0.00706  0.02331  9   ASP A N   
131  C CA  . ASP A 9   ? 0.33258 0.24044 0.22365 -0.01102 0.01412  0.02359  9   ASP A CA  
132  C C   . ASP A 9   ? 0.34714 0.26017 0.25181 -0.00962 0.02218  0.01798  9   ASP A C   
133  O O   . ASP A 9   ? 0.37007 0.28157 0.27774 -0.00785 0.02537  0.01177  9   ASP A O   
134  C CB  . ASP A 9   ? 0.35063 0.25982 0.22270 -0.01595 0.01452  0.02212  9   ASP A CB  
135  C CG  . ASP A 9   ? 0.42363 0.33068 0.28075 -0.01502 0.00712  0.03274  9   ASP A CG  
136  O OD1 . ASP A 9   ? 0.46973 0.36704 0.33025 -0.01044 0.00510  0.04087  9   ASP A OD1 
137  O OD2 . ASP A 9   ? 0.48359 0.39791 0.32393 -0.01884 0.00438  0.03290  9   ASP A OD2 
142  N N   . ILE A 10  ? 0.32059 0.23988 0.23322 -0.01045 0.02585  0.02046  10  ILE A N   
143  C CA  . ILE A 10  ? 0.32245 0.25523 0.25200 -0.00577 0.03166  0.01866  10  ILE A CA  
144  C C   . ILE A 10  ? 0.31740 0.25948 0.24556 -0.00732 0.04195  0.01536  10  ILE A C   
145  O O   . ILE A 10  ? 0.34586 0.28917 0.26294 -0.01619 0.04457  0.01674  10  ILE A O   
146  C CB  . ILE A 10  ? 0.32779 0.27271 0.26871 -0.00746 0.02841  0.02251  10  ILE A CB  
147  C CG1 . ILE A 10  ? 0.33752 0.27403 0.27793 -0.00606 0.02048  0.02408  10  ILE A CG1 
148  C CG2 . ILE A 10  ? 0.29862 0.26695 0.25815 -0.00104 0.03234  0.02381  10  ILE A CG2 
149  C CD1 . ILE A 10  ? 0.38350 0.31879 0.33043 0.00120  0.01842  0.02430  10  ILE A CD1 
161  N N   . ALA A 11  ? 0.32376 0.27184 0.26314 0.00195  0.04944  0.01175  11  ALA A N   
162  C CA  . ALA A 11  ? 0.33343 0.29592 0.27677 0.00415  0.06148  0.00778  11  ALA A CA  
163  C C   . ALA A 11  ? 0.32005 0.30608 0.28874 0.01656  0.06529  0.01183  11  ALA A C   
164  O O   . ALA A 11  ? 0.32451 0.30722 0.30336 0.02580  0.06063  0.01671  11  ALA A O   
165  C CB  . ALA A 11  ? 0.36243 0.30868 0.29346 0.00688  0.07023  -0.00221 11  ALA A CB  
171  N N   . VAL A 12  ? 0.31750 0.33130 0.29656 0.01692  0.07391  0.01115  12  VAL A N   
172  C CA  . VAL A 12  ? 0.31144 0.36061 0.31769 0.02958  0.07723  0.01658  12  VAL A CA  
173  C C   . VAL A 12  ? 0.32940 0.38705 0.34265 0.04224  0.09378  0.01023  12  VAL A C   
174  O O   . VAL A 12  ? 0.33742 0.40816 0.34445 0.03258  0.10238  0.00435  12  VAL A O   
175  C CB  . VAL A 12  ? 0.30372 0.38957 0.31975 0.01573  0.07249  0.02067  12  VAL A CB  
176  C CG1 . VAL A 12  ? 0.36420 0.49922 0.41077 0.02895  0.07464  0.02696  12  VAL A CG1 
177  C CG2 . VAL A 12  ? 0.32761 0.39824 0.33286 0.00277  0.05905  0.02349  12  VAL A CG2 
187  N N   . ASP A 13  ? 0.34088 0.38774 0.36510 0.06385  0.10002  0.01130  13  ASP A N   
188  C CA  . ASP A 13  ? 0.36630 0.41008 0.39476 0.07916  0.11867  0.00261  13  ASP A CA  
189  C C   . ASP A 13  ? 0.38268 0.40235 0.38234 0.06361  0.12611  -0.01246 13  ASP A C   
190  O O   . ASP A 13  ? 0.40560 0.43913 0.40441 0.06528  0.14114  -0.02148 13  ASP A O   
191  C CB  . ASP A 13  ? 0.37728 0.47539 0.43423 0.09051  0.12696  0.00693  13  ASP A CB  
192  C CG  . ASP A 13  ? 0.45393 0.57386 0.53988 0.11618  0.12492  0.02114  13  ASP A CG  
193  O OD1 . ASP A 13  ? 0.39803 0.48351 0.47959 0.12626  0.12001  0.02740  13  ASP A OD1 
194  O OD2 . ASP A 13  ? 0.46539 0.63985 0.57865 0.12637  0.12870  0.02712  13  ASP A OD2 
199  N N   . GLY A 14  ? 0.40577 0.39271 0.38195 0.04943  0.11568  -0.01476 14  GLY A N   
200  C CA  . GLY A 14  ? 0.49201 0.45754 0.43836 0.03433  0.11834  -0.02648 14  GLY A CA  
201  C C   . GLY A 14  ? 0.53726 0.52013 0.46916 0.01541  0.11396  -0.02369 14  GLY A C   
202  O O   . GLY A 14  ? 0.60664 0.57531 0.51109 0.00284  0.11418  -0.03021 14  GLY A O   
206  N N   A GLU A 15  ? 0.42037 0.42402 0.41701 0.05623  0.20635  0.05177  15  GLU A N   
207  N N   B GLU A 15  ? 0.41553 0.41853 0.41123 0.05605  0.20612  0.05154  15  GLU A N   
208  C CA  A GLU A 15  ? 0.42972 0.44052 0.41406 0.04088  0.20276  0.05935  15  GLU A CA  
209  C CA  B GLU A 15  ? 0.39475 0.40512 0.37774 0.04118  0.20456  0.05915  15  GLU A CA  
210  C C   A GLU A 15  ? 0.39305 0.39262 0.36437 0.02839  0.17379  0.05902  15  GLU A C   
211  C C   B GLU A 15  ? 0.36771 0.37101 0.34248 0.02781  0.17555  0.06082  15  GLU A C   
212  O O   A GLU A 15  ? 0.32947 0.33647 0.32267 0.02891  0.15629  0.05965  15  GLU A O   
213  O O   B GLU A 15  ? 0.34118 0.35837 0.34448 0.02712  0.15929  0.06421  15  GLU A O   
214  C CB  A GLU A 15  ? 0.43034 0.48229 0.46013 0.03793  0.21078  0.07593  15  GLU A CB  
215  C CB  B GLU A 15  ? 0.46248 0.51305 0.48931 0.04013  0.21663  0.07500  15  GLU A CB  
216  C CG  A GLU A 15  ? 0.47911 0.53522 0.49778 0.02007  0.21006  0.08532  15  GLU A CG  
217  C CG  B GLU A 15  ? 0.46359 0.52576 0.50502 0.05453  0.24319  0.07434  15  GLU A CG  
218  C CD  A GLU A 15  ? 0.52818 0.62589 0.59064 0.01522  0.22338  0.10077  15  GLU A CD  
219  C CD  B GLU A 15  ? 0.65393 0.69661 0.65350 0.05106  0.25871  0.06640  15  GLU A CD  
220  O OE1 A GLU A 15  ? 0.56259 0.66086 0.61282 0.00357  0.23020  0.10625  15  GLU A OE1 
221  O OE1 B GLU A 15  ? 0.67028 0.68636 0.62303 0.04082  0.25278  0.06085  15  GLU A OE1 
222  O OE2 A GLU A 15  ? 0.57346 0.70308 0.68122 0.02208  0.22053  0.10578  15  GLU A OE2 
223  O OE2 B GLU A 15  ? 0.65297 0.70934 0.66692 0.05887  0.27633  0.06681  15  GLU A OE2 
236  N N   . PRO A 16  ? 0.38721 0.36950 0.32335 0.01807  0.16860  0.05920  16  PRO A N   
237  C CA  . PRO A 16  ? 0.40672 0.37945 0.33649 0.00932  0.14346  0.06056  16  PRO A CA  
238  C C   . PRO A 16  ? 0.35960 0.35302 0.32432 0.00020  0.13568  0.07157  16  PRO A C   
239  O O   . PRO A 16  ? 0.42228 0.43150 0.40110 -0.00626 0.14808  0.08159  16  PRO A O   
240  C CB  . PRO A 16  ? 0.51066 0.46285 0.39683 0.00270  0.14306  0.06241  16  PRO A CB  
241  C CG  . PRO A 16  ? 0.59970 0.54518 0.45986 0.00806  0.16379  0.05522  16  PRO A CG  
242  C CD  . PRO A 16  ? 0.48269 0.45061 0.37868 0.01545  0.18455  0.05778  16  PRO A CD  
250  N N   . LEU A 17  ? 0.34616 0.33939 0.32308 -0.00187 0.11604  0.06877  17  LEU A N   
251  C CA  . LEU A 17  ? 0.31454 0.32177 0.31764 -0.01337 0.10513  0.07472  17  LEU A CA  
252  C C   . LEU A 17  ? 0.34251 0.32424 0.32457 -0.02155 0.09247  0.07469  17  LEU A C   
253  O O   . LEU A 17  ? 0.38431 0.36170 0.36766 -0.03307 0.09547  0.08275  17  LEU A O   
254  C CB  . LEU A 17  ? 0.33523 0.36055 0.36451 -0.00983 0.09341  0.07119  17  LEU A CB  
255  C CG  . LEU A 17  ? 0.32005 0.36138 0.37223 -0.02431 0.08072  0.07429  17  LEU A CG  
256  C CD1 . LEU A 17  ? 0.39179 0.46091 0.47109 -0.03491 0.08995  0.08452  17  LEU A CD1 
257  C CD2 . LEU A 17  ? 0.37782 0.43476 0.44556 -0.01900 0.06832  0.07068  17  LEU A CD2 
269  N N   . GLY A 18  ? 0.33322 0.29672 0.29564 -0.01513 0.08069  0.06726  18  GLY A N   
270  C CA  . GLY A 18  ? 0.32163 0.26243 0.26771 -0.01875 0.07000  0.06886  18  GLY A CA  
271  C C   . GLY A 18  ? 0.32850 0.26141 0.26557 -0.01054 0.05645  0.06007  18  GLY A C   
272  O O   . GLY A 18  ? 0.36010 0.30161 0.29974 -0.00387 0.05555  0.05280  18  GLY A O   
276  N N   . ARG A 19  ? 0.33634 0.25208 0.26476 -0.01085 0.04728  0.06189  19  ARG A N   
277  C CA  . ARG A 19  ? 0.29200 0.20256 0.21390 -0.00310 0.03514  0.05592  19  ARG A CA  
278  C C   . ARG A 19  ? 0.31859 0.22670 0.25610 -0.00496 0.02765  0.05053  19  ARG A C   
279  O O   . ARG A 19  ? 0.34408 0.24019 0.28686 -0.01198 0.02947  0.05324  19  ARG A O   
280  C CB  . ARG A 19  ? 0.34994 0.24572 0.24850 0.00144  0.03159  0.06438  19  ARG A CB  
281  C CG  . ARG A 19  ? 0.37248 0.26779 0.26896 0.00961  0.01880  0.06130  19  ARG A CG  
282  C CD  . ARG A 19  ? 0.37879 0.26812 0.25420 0.01455  0.01361  0.07263  19  ARG A CD  
283  N NE  . ARG A 19  ? 0.40808 0.30624 0.26158 0.01246  0.01436  0.07045  19  ARG A NE  
284  C CZ  . ARG A 19  ? 0.45154 0.35190 0.28193 0.01422  0.00717  0.07823  19  ARG A CZ  
285  N NH1 . ARG A 19  ? 0.48672 0.38325 0.31766 0.02104  -0.00143 0.09214  19  ARG A NH1 
286  N NH2 . ARG A 19  ? 0.49201 0.39865 0.29826 0.00933  0.00842  0.07201  19  ARG A NH2 
300  N N   A VAL A 20  ? 0.30089 0.21871 0.24388 -0.00005 0.02062  0.04220  20  VAL A N   
301  N N   B VAL A 20  ? 0.31667 0.23343 0.25896 0.00021  0.02033  0.04239  20  VAL A N   
302  C CA  A VAL A 20  ? 0.31336 0.22909 0.26486 0.00014  0.01394  0.03552  20  VAL A CA  
303  C CA  B VAL A 20  ? 0.32612 0.24073 0.27782 -0.00051 0.01430  0.03580  20  VAL A CA  
304  C C   A VAL A 20  ? 0.31636 0.22768 0.26006 0.01017  0.00745  0.03506  20  VAL A C   
305  C C   B VAL A 20  ? 0.30428 0.21748 0.25031 0.00938  0.00734  0.03354  20  VAL A C   
306  O O   A VAL A 20  ? 0.34322 0.26313 0.28017 0.01417  0.00481  0.03515  20  VAL A O   
307  O O   B VAL A 20  ? 0.32925 0.25349 0.27187 0.01304  0.00464  0.03194  20  VAL A O   
308  C CB  A VAL A 20  ? 0.31314 0.24894 0.27852 -0.00291 0.01174  0.02898  20  VAL A CB  
309  C CB  B VAL A 20  ? 0.27987 0.21398 0.24682 -0.00602 0.01307  0.02982  20  VAL A CB  
310  C CG1 A VAL A 20  ? 0.28939 0.22319 0.25891 -0.00591 0.00653  0.02093  20  VAL A CG1 
311  C CG1 B VAL A 20  ? 0.38691 0.32786 0.36440 -0.01699 0.01832  0.03348  20  VAL A CG1 
312  C CG2 A VAL A 20  ? 0.35058 0.30073 0.32811 -0.01036 0.01742  0.03277  20  VAL A CG2 
313  C CG2 B VAL A 20  ? 0.28076 0.22990 0.24954 0.00018  0.01298  0.02914  20  VAL A CG2 
332  N N   A SER A 21  ? 0.32315 0.22115 0.26851 0.01390  0.00567  0.03453  21  SER A N   
333  N N   B SER A 21  ? 0.32544 0.22454 0.27180 0.01340  0.00562  0.03354  21  SER A N   
334  C CA  A SER A 21  ? 0.33401 0.23595 0.27993 0.02448  -0.00013 0.03435  21  SER A CA  
335  C CA  B SER A 21  ? 0.33497 0.23632 0.28098 0.02431  0.00007  0.03430  21  SER A CA  
336  C C   A SER A 21  ? 0.33021 0.23404 0.28573 0.02524  0.00002  0.02404  21  SER A C   
337  C C   B SER A 21  ? 0.33449 0.23575 0.28987 0.02650  0.00023  0.02475  21  SER A C   
338  O O   A SER A 21  ? 0.32360 0.21895 0.28108 0.01739  0.00383  0.01732  21  SER A O   
339  O O   B SER A 21  ? 0.33570 0.22153 0.29227 0.02150  0.00498  0.01921  21  SER A O   
340  C CB  A SER A 21  ? 0.40051 0.28806 0.34143 0.03355  -0.00096 0.04556  21  SER A CB  
341  C CB  B SER A 21  ? 0.40040 0.28658 0.33970 0.03207  -0.00021 0.04638  21  SER A CB  
342  O OG  A SER A 21  ? 0.39087 0.25362 0.33474 0.03311  0.00547  0.04571  21  SER A OG  
343  O OG  B SER A 21  ? 0.43094 0.31849 0.35624 0.02905  0.00000  0.05537  21  SER A OG  
354  N N   . PHE A 22  ? 0.33394 0.25170 0.29420 0.03274  -0.00418 0.02246  22  PHE A N   
355  C CA  . PHE A 22  ? 0.31844 0.24306 0.28587 0.03429  -0.00278 0.01309  22  PHE A CA  
356  C C   . PHE A 22  ? 0.32024 0.24803 0.29548 0.04760  -0.00300 0.01626  22  PHE A C   
357  O O   . PHE A 22  ? 0.37459 0.31634 0.35288 0.05280  -0.00925 0.02465  22  PHE A O   
358  C CB  . PHE A 22  ? 0.30876 0.25543 0.27898 0.02928  -0.00599 0.00939  22  PHE A CB  
359  C CG  . PHE A 22  ? 0.28727 0.23769 0.25501 0.02022  -0.00603 0.01014  22  PHE A CG  
360  C CD1 . PHE A 22  ? 0.34609 0.29865 0.31529 0.01227  -0.00451 0.00580  22  PHE A CD1 
361  C CD2 . PHE A 22  ? 0.33754 0.29112 0.30180 0.01992  -0.00720 0.01509  22  PHE A CD2 
362  C CE1 . PHE A 22  ? 0.33343 0.29557 0.30642 0.00622  -0.00438 0.00933  22  PHE A CE1 
363  C CE2 . PHE A 22  ? 0.37453 0.33187 0.33987 0.01474  -0.00416 0.01628  22  PHE A CE2 
364  C CZ  . PHE A 22  ? 0.34100 0.30475 0.31368 0.00906  -0.00292 0.01479  22  PHE A CZ  
374  N N   . GLU A 23  ? 0.31724 0.23491 0.29605 0.05243  0.00400  0.00901  23  GLU A N   
375  C CA  . GLU A 23  ? 0.31424 0.24193 0.30546 0.06612  0.00665  0.01021  23  GLU A CA  
376  C C   . GLU A 23  ? 0.32592 0.27833 0.32098 0.06177  0.00645  0.00299  23  GLU A C   
377  O O   . GLU A 23  ? 0.34219 0.29225 0.32828 0.05193  0.00923  -0.00674 23  GLU A O   
378  C CB  . GLU A 23  ? 0.37747 0.27814 0.36951 0.07500  0.01845  0.00430  23  GLU A CB  
379  C CG  . GLU A 23  ? 0.37775 0.29084 0.38637 0.09212  0.02504  0.00502  23  GLU A CG  
380  C CD  . GLU A 23  ? 0.55224 0.43310 0.56106 0.10332  0.04074  -0.00286 23  GLU A CD  
381  O OE1 . GLU A 23  ? 0.49889 0.39044 0.52272 0.11889  0.04954  -0.00351 23  GLU A OE1 
382  O OE2 . GLU A 23  ? 0.54332 0.38837 0.53826 0.09621  0.04582  -0.00920 23  GLU A OE2 
389  N N   . LEU A 24  ? 0.29697 0.27480 0.30513 0.06750  0.00237  0.00933  24  LEU A N   
390  C CA  . LEU A 24  ? 0.26735 0.26911 0.28119 0.06309  0.00327  0.00522  24  LEU A CA  
391  C C   . LEU A 24  ? 0.29808 0.30983 0.32629 0.07604  0.01286  0.00334  24  LEU A C   
392  O O   . LEU A 24  ? 0.31605 0.33564 0.36081 0.08979  0.01277  0.01212  24  LEU A O   
393  C CB  . LEU A 24  ? 0.27985 0.30357 0.29926 0.05679  -0.00699 0.01277  24  LEU A CB  
394  C CG  . LEU A 24  ? 0.27080 0.28363 0.27646 0.04694  -0.01390 0.01468  24  LEU A CG  
395  C CD1 . LEU A 24  ? 0.31991 0.35075 0.32868 0.04004  -0.02230 0.01902  24  LEU A CD1 
396  C CD2 . LEU A 24  ? 0.30214 0.30417 0.29708 0.03819  -0.01012 0.00802  24  LEU A CD2 
408  N N   . PHE A 25  ? 0.29240 0.30667 0.31487 0.07265  0.02197  -0.00704 25  PHE A N   
409  C CA  . PHE A 25  ? 0.28270 0.30216 0.31481 0.08528  0.03588  -0.01213 25  PHE A CA  
410  C C   . PHE A 25  ? 0.31358 0.37229 0.36802 0.08835  0.03547  -0.00406 25  PHE A C   
411  O O   . PHE A 25  ? 0.30809 0.38303 0.36254 0.08515  0.04387  -0.00880 25  PHE A O   
412  C CB  . PHE A 25  ? 0.33509 0.33952 0.34554 0.07846  0.04697  -0.02838 25  PHE A CB  
413  C CG  . PHE A 25  ? 0.41578 0.38533 0.40591 0.07137  0.04666  -0.03729 25  PHE A CG  
414  C CD1 . PHE A 25  ? 0.52341 0.46536 0.51730 0.08080  0.04901  -0.03528 25  PHE A CD1 
415  C CD2 . PHE A 25  ? 0.42063 0.38675 0.38895 0.05407  0.04335  -0.04577 25  PHE A CD2 
416  C CE1 . PHE A 25  ? 0.53323 0.44224 0.50932 0.07101  0.04928  -0.04329 25  PHE A CE1 
417  C CE2 . PHE A 25  ? 0.41010 0.34855 0.36241 0.04461  0.04219  -0.05392 25  PHE A CE2 
418  C CZ  . PHE A 25  ? 0.47278 0.38216 0.42918 0.05197  0.04547  -0.05321 25  PHE A CZ  
428  N N   . ALA A 26  ? 0.31537 0.39168 0.38956 0.09416  0.02576  0.00923  26  ALA A N   
429  C CA  . ALA A 26  ? 0.28906 0.40645 0.38803 0.09445  0.02354  0.01771  26  ALA A CA  
430  C C   . ALA A 26  ? 0.29189 0.42697 0.41198 0.11092  0.04005  0.01689  26  ALA A C   
431  O O   . ALA A 26  ? 0.31296 0.48475 0.45322 0.10877  0.04267  0.02165  26  ALA A O   
432  C CB  . ALA A 26  ? 0.35032 0.48481 0.46384 0.09572  0.00766  0.03183  26  ALA A CB  
438  N N   . ASP A 27  ? 0.30415 0.41255 0.42057 0.12710  0.05329  0.01053  27  ASP A N   
439  C CA  . ASP A 27  ? 0.31138 0.43222 0.44615 0.14465  0.07301  0.00759  27  ASP A CA  
440  C C   . ASP A 27  ? 0.37599 0.49907 0.49365 0.13546  0.08746  -0.00684 27  ASP A C   
441  O O   . ASP A 27  ? 0.40618 0.55268 0.54152 0.14636  0.10390  -0.00759 27  ASP A O   
442  C CB  . ASP A 27  ? 0.40828 0.49221 0.54262 0.16556  0.08550  0.00401  27  ASP A CB  
443  C CG  . ASP A 27  ? 0.48584 0.51675 0.58192 0.15500  0.08727  -0.01184 27  ASP A CG  
444  O OD1 . ASP A 27  ? 0.46081 0.48546 0.53359 0.13376  0.07553  -0.01658 27  ASP A OD1 
445  O OD2 . ASP A 27  ? 0.66747 0.66185 0.75872 0.16869  0.10194  -0.01949 27  ASP A OD2 
450  N N   A LYS A 28  ? 0.31179 0.41380 0.39621 0.11640  0.08201  -0.01664 28  LYS A N   
451  N N   B LYS A 28  ? 0.30912 0.41141 0.39358 0.11642  0.08222  -0.01671 28  LYS A N   
452  C CA  A LYS A 28  ? 0.31443 0.41699 0.37599 0.10616  0.09352  -0.02890 28  LYS A CA  
453  C CA  B LYS A 28  ? 0.31005 0.41520 0.37330 0.10655  0.09402  -0.02837 28  LYS A CA  
454  C C   A LYS A 28  ? 0.27169 0.39811 0.32912 0.08685  0.08276  -0.02131 28  LYS A C   
455  C C   B LYS A 28  ? 0.27002 0.39771 0.32828 0.08682  0.08276  -0.02093 28  LYS A C   
456  O O   A LYS A 28  ? 0.30368 0.44986 0.35742 0.08214  0.09361  -0.02285 28  LYS A O   
457  O O   B LYS A 28  ? 0.30247 0.45039 0.35738 0.08183  0.09327  -0.02211 28  LYS A O   
458  C CB  A LYS A 28  ? 0.44492 0.50493 0.46999 0.09950  0.09675  -0.04587 28  LYS A CB  
459  C CB  B LYS A 28  ? 0.46096 0.52419 0.48750 0.10086  0.09937  -0.04631 28  LYS A CB  
460  C CG  A LYS A 28  ? 0.54587 0.57172 0.57101 0.11728  0.11133  -0.05614 28  LYS A CG  
461  C CG  B LYS A 28  ? 0.52841 0.56432 0.55399 0.11944  0.11990  -0.05930 28  LYS A CG  
462  C CD  A LYS A 28  ? 0.57000 0.58252 0.57534 0.12150  0.13553  -0.07602 28  LYS A CD  
463  C CD  B LYS A 28  ? 0.58565 0.57309 0.58478 0.11359  0.11769  -0.07191 28  LYS A CD  
464  C CE  A LYS A 28  ? 0.67990 0.64626 0.68010 0.13679  0.15136  -0.08913 28  LYS A CE  
465  C CE  B LYS A 28  ? 0.63410 0.58610 0.63818 0.13408  0.13676  -0.08102 28  LYS A CE  
466  N NZ  A LYS A 28  ? 0.67287 0.64693 0.70674 0.16615  0.17061  -0.08375 28  LYS A NZ  
467  N NZ  B LYS A 28  ? 0.69031 0.59218 0.66771 0.12422  0.13519  -0.09394 28  LYS A NZ  
494  N N   . VAL A 29  ? 0.28078 0.40478 0.33926 0.07668  0.06396  -0.01255 29  VAL A N   
495  C CA  . VAL A 29  ? 0.24548 0.38413 0.30090 0.05921  0.05422  -0.00472 29  VAL A CA  
496  C C   . VAL A 29  ? 0.23087 0.38209 0.30709 0.05608  0.03938  0.00685  29  VAL A C   
497  O O   . VAL A 29  ? 0.25181 0.38671 0.31772 0.04761  0.02656  0.00883  29  VAL A O   
498  C CB  . VAL A 29  ? 0.28812 0.40385 0.31377 0.04645  0.04782  -0.00904 29  VAL A CB  
499  C CG1 . VAL A 29  ? 0.36677 0.48371 0.36992 0.04188  0.05939  -0.01676 29  VAL A CG1 
500  C CG2 . VAL A 29  ? 0.36909 0.45488 0.38372 0.04921  0.04096  -0.01459 29  VAL A CG2 
510  N N   . PRO A 30  ? 0.22202 0.40508 0.32778 0.06198  0.04126  0.01446  30  PRO A N   
511  C CA  . PRO A 30  ? 0.22047 0.41727 0.34357 0.05815  0.02534  0.02420  30  PRO A CA  
512  C C   . PRO A 30  ? 0.26740 0.46278 0.38224 0.03715  0.01455  0.02707  30  PRO A C   
513  O O   . PRO A 30  ? 0.24058 0.42550 0.35002 0.03132  0.00110  0.02881  30  PRO A O   
514  C CB  . PRO A 30  ? 0.25224 0.49157 0.41161 0.06726  0.03048  0.03257  30  PRO A CB  
515  C CG  . PRO A 30  ? 0.29916 0.54903 0.45911 0.07048  0.05062  0.02757  30  PRO A CG  
516  C CD  . PRO A 30  ? 0.24858 0.45684 0.37346 0.07401  0.05799  0.01421  30  PRO A CD  
524  N N   . LYS A 31  ? 0.22067 0.42501 0.33380 0.02587  0.02145  0.02812  31  LYS A N   
525  C CA  . LYS A 31  ? 0.22177 0.42008 0.32916 0.00676  0.01357  0.03176  31  LYS A CA  
526  C C   . LYS A 31  ? 0.24085 0.40132 0.32088 0.00396  0.00825  0.02735  31  LYS A C   
527  O O   . LYS A 31  ? 0.24771 0.39440 0.32238 -0.00565 -0.00106 0.02787  31  LYS A O   
528  C CB  . LYS A 31  ? 0.23996 0.45411 0.35189 -0.00350 0.02420  0.03674  31  LYS A CB  
529  C CG  . LYS A 31  ? 0.26233 0.46667 0.37129 -0.02329 0.01833  0.04170  31  LYS A CG  
530  C CD  . LYS A 31  ? 0.31105 0.53598 0.43058 -0.03481 0.02931  0.05010  31  LYS A CD  
531  C CE  . LYS A 31  ? 0.27458 0.48051 0.38902 -0.05431 0.02590  0.05544  31  LYS A CE  
532  N NZ  . LYS A 31  ? 0.31018 0.53899 0.43989 -0.06803 0.03601  0.06545  31  LYS A NZ  
546  N N   . THR A 32  ? 0.21010 0.35464 0.27266 0.01158  0.01471  0.02239  32  THR A N   
547  C CA  . THR A 32  ? 0.21867 0.33462 0.26047 0.00937  0.00984  0.02000  32  THR A CA  
548  C C   . THR A 32  ? 0.23590 0.33659 0.27501 0.01516  0.00163  0.01657  32  THR A C   
549  O O   . THR A 32  ? 0.23476 0.31759 0.26436 0.01014  -0.00433 0.01691  32  THR A O   
550  C CB  . THR A 32  ? 0.20334 0.31306 0.22796 0.01303  0.01732  0.01571  32  THR A CB  
551  O OG1 . THR A 32  ? 0.23722 0.36405 0.26177 0.00775  0.02583  0.02042  32  THR A OG1 
552  C CG2 . THR A 32  ? 0.21723 0.30691 0.22559 0.00938  0.01195  0.01629  32  THR A CG2 
560  N N   . ALA A 33  ? 0.22272 0.32954 0.27022 0.02662  0.00283  0.01446  33  ALA A N   
561  C CA  . ALA A 33  ? 0.22160 0.31435 0.26592 0.03253  -0.00445 0.01430  33  ALA A CA  
562  C C   . ALA A 33  ? 0.23294 0.33327 0.28220 0.02443  -0.01552 0.01926  33  ALA A C   
563  O O   . ALA A 33  ? 0.24324 0.32538 0.27897 0.02157  -0.02155 0.01851  33  ALA A O   
564  C CB  . ALA A 33  ? 0.26774 0.36453 0.32260 0.04820  0.00025  0.01411  33  ALA A CB  
570  N N   . GLU A 34  ? 0.22379 0.35118 0.29059 0.01855  -0.01757 0.02347  34  GLU A N   
571  C CA  . GLU A 34  ? 0.24453 0.38141 0.31423 0.00703  -0.02930 0.02620  34  GLU A CA  
572  C C   . GLU A 34  ? 0.25187 0.36371 0.30273 -0.00725 -0.03056 0.02154  34  GLU A C   
573  O O   . GLU A 34  ? 0.27275 0.37374 0.31118 -0.01369 -0.03835 0.01919  34  GLU A O   
574  C CB  . GLU A 34  ? 0.24394 0.41886 0.33955 0.00054  -0.03094 0.03164  34  GLU A CB  
575  C CG  . GLU A 34  ? 0.27922 0.46702 0.37687 -0.01678 -0.04469 0.03280  34  GLU A CG  
576  C CD  . GLU A 34  ? 0.28202 0.47376 0.37375 -0.01193 -0.05779 0.03587  34  GLU A CD  
577  O OE1 . GLU A 34  ? 0.31344 0.50205 0.40631 0.00696  -0.05626 0.04022  34  GLU A OE1 
578  O OE2 . GLU A 34  ? 0.36389 0.56104 0.44814 -0.02885 -0.06955 0.03405  34  GLU A OE2 
585  N N   . ASN A 35  ? 0.25270 0.35386 0.29970 -0.01123 -0.02188 0.02077  35  ASN A N   
586  C CA  . ASN A 35  ? 0.22496 0.29926 0.25700 -0.02060 -0.02054 0.01840  35  ASN A CA  
587  C C   . ASN A 35  ? 0.24998 0.30054 0.26489 -0.01402 -0.02200 0.01467  35  ASN A C   
588  O O   . ASN A 35  ? 0.26289 0.29618 0.26578 -0.02077 -0.02418 0.01077  35  ASN A O   
589  C CB  . ASN A 35  ? 0.24931 0.31952 0.28182 -0.02148 -0.01119 0.02270  35  ASN A CB  
590  C CG  . ASN A 35  ? 0.26352 0.30603 0.28527 -0.02727 -0.00779 0.02375  35  ASN A CG  
591  O OD1 . ASN A 35  ? 0.30186 0.33318 0.32289 -0.03946 -0.00831 0.02200  35  ASN A OD1 
592  N ND2 . ASN A 35  ? 0.26986 0.30256 0.28494 -0.01943 -0.00357 0.02716  35  ASN A ND2 
599  N N   . PHE A 36  ? 0.24540 0.29353 0.25795 -0.00221 -0.01914 0.01501  36  PHE A N   
600  C CA  . PHE A 36  ? 0.23530 0.26389 0.23455 0.00258  -0.01942 0.01288  36  PHE A CA  
601  C C   . PHE A 36  ? 0.26146 0.28963 0.25473 0.00295  -0.02656 0.01213  36  PHE A C   
602  O O   . PHE A 36  ? 0.27735 0.28871 0.25625 0.00075  -0.02653 0.00987  36  PHE A O   
603  C CB  . PHE A 36  ? 0.27910 0.30659 0.27805 0.01126  -0.01552 0.01271  36  PHE A CB  
604  C CG  . PHE A 36  ? 0.25643 0.26673 0.24529 0.01354  -0.01429 0.01186  36  PHE A CG  
605  C CD1 . PHE A 36  ? 0.27784 0.28083 0.26176 0.01785  -0.01635 0.01148  36  PHE A CD1 
606  C CD2 . PHE A 36  ? 0.28422 0.28928 0.27135 0.01170  -0.01066 0.01373  36  PHE A CD2 
607  C CE1 . PHE A 36  ? 0.31324 0.30309 0.29021 0.01829  -0.01379 0.01159  36  PHE A CE1 
608  C CE2 . PHE A 36  ? 0.28401 0.28050 0.26721 0.01329  -0.00923 0.01414  36  PHE A CE2 
609  C CZ  . PHE A 36  ? 0.29809 0.28687 0.27620 0.01553  -0.01028 0.01241  36  PHE A CZ  
619  N N   . ARG A 37  ? 0.26458 0.31236 0.26845 0.00698  -0.03190 0.01536  37  ARG A N   
620  C CA  . ARG A 37  ? 0.27161 0.32366 0.26961 0.00787  -0.04080 0.01839  37  ARG A CA  
621  C C   . ARG A 37  ? 0.29451 0.34361 0.27961 -0.00707 -0.04665 0.01417  37  ARG A C   
622  O O   . ARG A 37  ? 0.30153 0.33702 0.26653 -0.00959 -0.04919 0.01237  37  ARG A O   
623  C CB  . ARG A 37  ? 0.26123 0.34127 0.27921 0.01608  -0.04582 0.02572  37  ARG A CB  
624  C CG  . ARG A 37  ? 0.28398 0.37154 0.29699 0.01978  -0.05627 0.03334  37  ARG A CG  
625  C CD  . ARG A 37  ? 0.29115 0.41485 0.32801 0.02580  -0.06423 0.04342  37  ARG A CD  
626  N NE  . ARG A 37  ? 0.30098 0.44838 0.34627 0.00932  -0.07072 0.04071  37  ARG A NE  
627  C CZ  . ARG A 37  ? 0.32060 0.47290 0.35111 -0.00731 -0.08233 0.03838  37  ARG A CZ  
628  N NH1 . ARG A 37  ? 0.40305 0.54139 0.40865 -0.00757 -0.08853 0.03976  37  ARG A NH1 
629  N NH2 . ARG A 37  ? 0.34517 0.51369 0.38320 -0.02523 -0.08634 0.03379  37  ARG A NH2 
643  N N   . ALA A 38  ? 0.26051 0.32103 0.25492 -0.01860 -0.04788 0.01189  38  ALA A N   
644  C CA  . ALA A 38  ? 0.29946 0.35452 0.28074 -0.03624 -0.05309 0.00529  38  ALA A CA  
645  C C   . ALA A 38  ? 0.30213 0.32049 0.26230 -0.03985 -0.04355 -0.00293 38  ALA A C   
646  O O   . ALA A 38  ? 0.35381 0.35820 0.29251 -0.05005 -0.04572 -0.01058 38  ALA A O   
647  C CB  . ALA A 38  ? 0.33097 0.40472 0.32978 -0.04957 -0.05497 0.00525  38  ALA A CB  
653  N N   . LEU A 39  ? 0.28261 0.28655 0.24842 -0.03205 -0.03252 -0.00141 39  LEU A N   
654  C CA  . LEU A 39  ? 0.29450 0.26735 0.24585 -0.03138 -0.02225 -0.00625 39  LEU A CA  
655  C C   . LEU A 39  ? 0.31474 0.27859 0.25051 -0.02372 -0.02116 -0.00716 39  LEU A C   
656  O O   . LEU A 39  ? 0.34790 0.28919 0.26683 -0.02599 -0.01372 -0.01350 39  LEU A O   
657  C CB  . LEU A 39  ? 0.28876 0.25660 0.25302 -0.02343 -0.01320 -0.00026 39  LEU A CB  
658  C CG  . LEU A 39  ? 0.32162 0.29154 0.29756 -0.03191 -0.01067 0.00248  39  LEU A CG  
659  C CD1 . LEU A 39  ? 0.30267 0.27425 0.28878 -0.02235 -0.00406 0.01175  39  LEU A CD1 
660  C CD2 . LEU A 39  ? 0.36780 0.31152 0.33417 -0.04461 -0.00555 -0.00428 39  LEU A CD2 
672  N N   . SER A 40  ? 0.29861 0.27780 0.23950 -0.01477 -0.02657 -0.00081 40  SER A N   
673  C CA  . SER A 40  ? 0.30301 0.27433 0.22945 -0.00908 -0.02563 0.00078  40  SER A CA  
674  C C   . SER A 40  ? 0.37507 0.34762 0.27991 -0.01718 -0.03323 -0.00191 40  SER A C   
675  O O   . SER A 40  ? 0.38966 0.34825 0.27401 -0.01688 -0.02847 -0.00364 40  SER A O   
676  C CB  . SER A 40  ? 0.30023 0.28237 0.23849 0.00206  -0.02816 0.00899  40  SER A CB  
677  O OG  . SER A 40  ? 0.33475 0.31478 0.28642 0.00706  -0.02129 0.00961  40  SER A OG  
683  N N   . THR A 41  ? 0.34397 0.33639 0.25226 -0.02523 -0.04522 -0.00142 41  THR A N   
684  C CA  . THR A 41  ? 0.36669 0.36404 0.25148 -0.03564 -0.05481 -0.00381 41  THR A CA  
685  C C   . THR A 41  ? 0.43279 0.41136 0.29659 -0.05282 -0.05121 -0.01885 41  THR A C   
686  O O   . THR A 41  ? 0.48392 0.45792 0.31790 -0.06321 -0.05552 -0.02496 41  THR A O   
687  C CB  . THR A 41  ? 0.37741 0.41065 0.27614 -0.03804 -0.07163 0.00493  41  THR A CB  
688  O OG1 . THR A 41  ? 0.37668 0.42201 0.29315 -0.04865 -0.07391 0.00030  41  THR A OG1 
689  C CG2 . THR A 41  ? 0.39514 0.44211 0.31471 -0.01873 -0.07279 0.01956  41  THR A CG2 
697  N N   . GLY A 42  ? 0.31965 0.36746 0.31783 -0.01488 -0.05260 -0.02917 42  GLY A N   
698  C CA  . GLY A 42  ? 0.35219 0.39574 0.33299 -0.02959 -0.04662 -0.03710 42  GLY A CA  
699  C C   . GLY A 42  ? 0.39612 0.46768 0.39026 -0.03881 -0.05605 -0.04969 42  GLY A C   
700  O O   . GLY A 42  ? 0.43994 0.50536 0.41658 -0.05217 -0.05387 -0.05685 42  GLY A O   
704  N N   . GLU A 43  ? 0.33222 0.43561 0.35881 -0.03192 -0.06660 -0.05460 43  GLU A N   
705  C CA  . GLU A 43  ? 0.31675 0.45475 0.35989 -0.03828 -0.07979 -0.06658 43  GLU A CA  
706  C C   . GLU A 43  ? 0.34697 0.49692 0.39529 -0.06119 -0.06823 -0.08140 43  GLU A C   
707  O O   . GLU A 43  ? 0.38539 0.55916 0.43886 -0.07194 -0.07822 -0.09186 43  GLU A O   
708  C CB  . GLU A 43  ? 0.37539 0.54829 0.45764 -0.02189 -0.09472 -0.07044 43  GLU A CB  
709  C CG  . GLU A 43  ? 0.37746 0.56851 0.49230 -0.01969 -0.08210 -0.07943 43  GLU A CG  
710  C CD  . GLU A 43  ? 0.39280 0.60582 0.54110 0.00406  -0.09801 -0.08134 43  GLU A CD  
711  O OE1 . GLU A 43  ? 0.35519 0.53945 0.49068 0.02116  -0.10774 -0.06638 43  GLU A OE1 
712  O OE2 . GLU A 43  ? 0.34326 0.60212 0.53111 0.00562  -0.10152 -0.09843 43  GLU A OE2 
719  N N   A LYS A 44  ? 0.37874 0.51241 0.42425 -0.07049 -0.04916 -0.08209 44  LYS A N   
720  N N   B LYS A 44  ? 0.39678 0.53068 0.44252 -0.07050 -0.04915 -0.08215 44  LYS A N   
721  C CA  A LYS A 44  ? 0.40369 0.53928 0.44671 -0.09569 -0.03828 -0.09318 44  LYS A CA  
722  C CA  B LYS A 44  ? 0.41947 0.55507 0.46248 -0.09573 -0.03827 -0.09319 44  LYS A CA  
723  C C   A LYS A 44  ? 0.44207 0.53347 0.44578 -0.10627 -0.03270 -0.09048 44  LYS A C   
724  C C   B LYS A 44  ? 0.44565 0.53851 0.44963 -0.10653 -0.03357 -0.09099 44  LYS A C   
725  O O   A LYS A 44  ? 0.51550 0.59472 0.51006 -0.12771 -0.02407 -0.09745 44  LYS A O   
726  O O   B LYS A 44  ? 0.48825 0.57226 0.48387 -0.12867 -0.02669 -0.09928 44  LYS A O   
727  C CB  A LYS A 44  ? 0.45788 0.59639 0.51341 -0.10310 -0.02156 -0.09473 44  LYS A CB  
728  C CB  B LYS A 44  ? 0.46260 0.59828 0.51606 -0.10325 -0.02111 -0.09414 44  LYS A CB  
729  C CG  A LYS A 44  ? 0.49953 0.66866 0.58819 -0.08603 -0.02290 -0.09619 44  LYS A CG  
730  C CG  B LYS A 44  ? 0.48214 0.66018 0.57495 -0.09242 -0.02202 -0.10042 44  LYS A CG  
731  C CD  A LYS A 44  ? 0.49658 0.72141 0.62504 -0.08243 -0.03580 -0.11057 44  LYS A CD  
732  C CD  B LYS A 44  ? 0.51235 0.74546 0.64056 -0.09642 -0.03331 -0.11648 44  LYS A CD  
733  C CE  A LYS A 44  ? 0.54864 0.81543 0.70673 -0.09909 -0.02282 -0.12685 44  LYS A CE  
734  C CE  B LYS A 44  ? 0.54274 0.81808 0.70066 -0.11371 -0.01965 -0.13224 44  LYS A CE  
735  N NZ  A LYS A 44  ? 0.47021 0.79995 0.67371 -0.09459 -0.03595 -0.14435 44  LYS A NZ  
736  N NZ  B LYS A 44  ? 0.53683 0.80658 0.67825 -0.14874 -0.00748 -0.13796 44  LYS A NZ  
763  N N   . GLY A 45  ? 0.42100 0.48705 0.40086 -0.09237 -0.03677 -0.08128 45  GLY A N   
764  C CA  . GLY A 45  ? 0.49597 0.52527 0.44165 -0.09889 -0.03231 -0.08285 45  GLY A CA  
765  C C   . GLY A 45  ? 0.50947 0.50047 0.43839 -0.09145 -0.01919 -0.07432 45  GLY A C   
766  O O   . GLY A 45  ? 0.51902 0.47845 0.42239 -0.09334 -0.01506 -0.07748 45  GLY A O   
770  N N   . PHE A 46  ? 0.41172 0.40599 0.35550 -0.08222 -0.01345 -0.06544 46  PHE A N   
771  C CA  . PHE A 46  ? 0.40186 0.36637 0.33363 -0.07336 -0.00369 -0.05673 46  PHE A CA  
772  C C   . PHE A 46  ? 0.35823 0.33832 0.30847 -0.05910 -0.00385 -0.04722 46  PHE A C   
773  O O   . PHE A 46  ? 0.37387 0.38325 0.34707 -0.05746 -0.00966 -0.04915 46  PHE A O   
774  C CB  . PHE A 46  ? 0.43401 0.37398 0.35772 -0.08661 0.00559  -0.05827 46  PHE A CB  
775  C CG  . PHE A 46  ? 0.39456 0.35788 0.33733 -0.10147 0.00909  -0.06155 46  PHE A CG  
776  C CD1 . PHE A 46  ? 0.48289 0.46352 0.43174 -0.12163 0.00691  -0.07277 46  PHE A CD1 
777  C CD2 . PHE A 46  ? 0.39370 0.36359 0.34720 -0.09793 0.01563  -0.05550 46  PHE A CD2 
778  C CE1 . PHE A 46  ? 0.48661 0.49488 0.45434 -0.13744 0.01240  -0.07794 46  PHE A CE1 
779  C CE2 . PHE A 46  ? 0.43782 0.43288 0.40713 -0.11339 0.02140  -0.06117 46  PHE A CE2 
780  C CZ  . PHE A 46  ? 0.48812 0.50395 0.46537 -0.13357 0.02052  -0.07257 46  PHE A CZ  
790  N N   . GLY A 47  ? 0.36655 0.32741 0.30856 -0.04856 0.00202  -0.03867 47  GLY A N   
791  C CA  . GLY A 47  ? 0.33075 0.30246 0.28802 -0.03692 0.00156  -0.03054 47  GLY A CA  
792  C C   . GLY A 47  ? 0.31633 0.27121 0.26220 -0.02629 0.00556  -0.02201 47  GLY A C   
793  O O   . GLY A 47  ? 0.34525 0.28055 0.27531 -0.02590 0.01080  -0.02319 47  GLY A O   
797  N N   . TYR A 48  ? 0.29725 0.26068 0.25332 -0.01774 0.00259  -0.01479 48  TYR A N   
798  C CA  . TYR A 48  ? 0.28609 0.23967 0.23806 -0.01068 0.00759  -0.00727 48  TYR A CA  
799  C C   . TYR A 48  ? 0.29212 0.24235 0.22834 -0.00779 0.00811  -0.00361 48  TYR A C   
800  O O   . TYR A 48  ? 0.30871 0.25468 0.24219 -0.00376 0.01432  -0.00038 48  TYR A O   
801  C CB  . TYR A 48  ? 0.28433 0.24539 0.25244 -0.00542 0.00459  -0.00190 48  TYR A CB  
802  C CG  . TYR A 48  ? 0.25657 0.22386 0.23980 -0.00766 0.00750  -0.00710 48  TYR A CG  
803  C CD1 . TYR A 48  ? 0.27032 0.22801 0.24650 -0.01298 0.01515  -0.00897 48  TYR A CD1 
804  C CD2 . TYR A 48  ? 0.24946 0.23056 0.25167 -0.00377 0.00227  -0.01000 48  TYR A CD2 
805  C CE1 . TYR A 48  ? 0.27710 0.24153 0.26163 -0.01815 0.01911  -0.01324 48  TYR A CE1 
806  C CE2 . TYR A 48  ? 0.26960 0.26100 0.28511 -0.00674 0.00747  -0.01774 48  TYR A CE2 
807  C CZ  . TYR A 48  ? 0.25066 0.23400 0.25480 -0.01542 0.01659  -0.01848 48  TYR A CZ  
808  O OH  . TYR A 48  ? 0.26829 0.26429 0.28177 -0.02084 0.02238  -0.02608 48  TYR A OH  
818  N N   . LYS A 49  ? 0.29925 0.25504 0.22507 -0.01054 0.00163  -0.00446 49  LYS A N   
819  C CA  . LYS A 49  ? 0.30560 0.26120 0.21273 -0.01031 0.00339  -0.00032 49  LYS A CA  
820  C C   . LYS A 49  ? 0.34096 0.28945 0.23776 -0.00885 0.01469  -0.00851 49  LYS A C   
821  O O   . LYS A 49  ? 0.37159 0.31060 0.26318 -0.01064 0.01624  -0.01921 49  LYS A O   
822  C CB  . LYS A 49  ? 0.32048 0.28237 0.21285 -0.01494 -0.00664 -0.00065 49  LYS A CB  
823  C CG  . LYS A 49  ? 0.36227 0.32526 0.22944 -0.01800 -0.00395 0.00440  49  LYS A CG  
824  C CD  . LYS A 49  ? 0.43098 0.39925 0.27921 -0.02319 -0.01732 0.00721  49  LYS A CD  
825  C CE  . LYS A 49  ? 0.54568 0.51478 0.36521 -0.02904 -0.01270 0.01411  49  LYS A CE  
826  N NZ  . LYS A 49  ? 0.68579 0.65797 0.48110 -0.03490 -0.02757 0.01897  49  LYS A NZ  
840  N N   . GLY A 50  ? 0.31695 0.26970 0.21254 -0.00548 0.02220  -0.00468 50  GLY A N   
841  C CA  . GLY A 50  ? 0.37712 0.32861 0.26884 -0.00013 0.03239  -0.01444 50  GLY A CA  
842  C C   . GLY A 50  ? 0.35605 0.30023 0.26391 0.00786  0.03527  -0.01561 50  GLY A C   
843  O O   . GLY A 50  ? 0.39467 0.34057 0.30434 0.01598  0.04184  -0.02308 50  GLY A O   
847  N N   . SER A 51  ? 0.30485 0.24326 0.22446 0.00651  0.03011  -0.00929 51  SER A N   
848  C CA  . SER A 51  ? 0.29770 0.22714 0.22714 0.01193  0.03081  -0.00891 51  SER A CA  
849  C C   . SER A 51  ? 0.32637 0.26979 0.26837 0.01573  0.03320  -0.00283 51  SER A C   
850  O O   . SER A 51  ? 0.32845 0.28556 0.27171 0.01155  0.03445  0.00258  51  SER A O   
851  C CB  . SER A 51  ? 0.32865 0.24943 0.26177 0.00559  0.02609  -0.00658 51  SER A CB  
852  O OG  . SER A 51  ? 0.32575 0.25877 0.27009 0.00276  0.02320  -0.00027 51  SER A OG  
858  N N   . CYS A 52  ? 0.30486 0.24386 0.25426 0.02254  0.03288  -0.00334 52  CYS A N   
859  C CA  . CYS A 52  ? 0.31839 0.27426 0.28154 0.02571  0.03436  0.00018  52  CYS A CA  
860  C C   . CYS A 52  ? 0.31948 0.27185 0.28978 0.02308  0.02945  0.00620  52  CYS A C   
861  O O   . CYS A 52  ? 0.33263 0.26994 0.29705 0.02018  0.02610  0.00699  52  CYS A O   
862  C CB  . CYS A 52  ? 0.31840 0.28014 0.28794 0.03814  0.03629  -0.00707 52  CYS A CB  
863  S SG  . CYS A 52  ? 0.44634 0.38345 0.41429 0.04880  0.02732  -0.00714 52  CYS A SG  
869  N N   . PHE A 53  ? 0.28067 0.24938 0.26295 0.02215  0.03000  0.00923  53  PHE A N   
870  C CA  . PHE A 53  ? 0.28141 0.25003 0.27041 0.02062  0.02536  0.01232  53  PHE A CA  
871  C C   . PHE A 53  ? 0.30704 0.27985 0.30102 0.03083  0.02207  0.00985  53  PHE A C   
872  O O   . PHE A 53  ? 0.34836 0.34298 0.35557 0.03507  0.02411  0.00698  53  PHE A O   
873  C CB  . PHE A 53  ? 0.28216 0.26352 0.28088 0.01255  0.02596  0.01598  53  PHE A CB  
874  C CG  . PHE A 53  ? 0.27354 0.24471 0.26874 0.00569  0.02442  0.01896  53  PHE A CG  
875  C CD1 . PHE A 53  ? 0.30221 0.27092 0.29062 0.00260  0.02553  0.02193  53  PHE A CD1 
876  C CD2 . PHE A 53  ? 0.29445 0.25899 0.29274 0.00336  0.02071  0.01775  53  PHE A CD2 
877  C CE1 . PHE A 53  ? 0.32552 0.28434 0.31296 -0.00020 0.02061  0.02452  53  PHE A CE1 
878  C CE2 . PHE A 53  ? 0.32225 0.27929 0.32190 0.00086  0.01813  0.01765  53  PHE A CE2 
879  C CZ  . PHE A 53  ? 0.35021 0.30355 0.34583 0.00027  0.01678  0.02143  53  PHE A CZ  
889  N N   . HIS A 54  ? 0.27775 0.23107 0.26131 0.03434  0.01625  0.01107  54  HIS A N   
890  C CA  . HIS A 54  ? 0.28503 0.23482 0.26982 0.04712  0.00946  0.00994  54  HIS A CA  
891  C C   . HIS A 54  ? 0.30586 0.26731 0.29778 0.04798  0.00173  0.01324  54  HIS A C   
892  O O   . HIS A 54  ? 0.32905 0.29475 0.32722 0.06100  -0.00637 0.01208  54  HIS A O   
893  C CB  . HIS A 54  ? 0.35850 0.27383 0.32263 0.04957  0.00481  0.01171  54  HIS A CB  
894  C CG  . HIS A 54  ? 0.36082 0.26044 0.30886 0.03691  0.00262  0.01820  54  HIS A CG  
895  N ND1 . HIS A 54  ? 0.36602 0.26421 0.30924 0.02369  0.00936  0.01737  54  HIS A ND1 
896  C CD2 . HIS A 54  ? 0.37294 0.26120 0.30846 0.03495  -0.00528 0.02452  54  HIS A CD2 
897  C CE1 . HIS A 54  ? 0.40281 0.29302 0.33373 0.01369  0.00797  0.02104  54  HIS A CE1 
898  N NE2 . HIS A 54  ? 0.39105 0.27359 0.31415 0.01900  -0.00054 0.02620  54  HIS A NE2 
906  N N   A ARG A 55  ? 0.27620 0.24272 0.26765 0.03571  0.00275  0.01587  55  ARG A N   
907  N N   B ARG A 55  ? 0.26963 0.23675 0.26148 0.03584  0.00258  0.01586  55  ARG A N   
908  C CA  A ARG A 55  ? 0.28460 0.26024 0.27842 0.03391  -0.00505 0.01765  55  ARG A CA  
909  C CA  B ARG A 55  ? 0.28648 0.26264 0.28068 0.03472  -0.00567 0.01767  55  ARG A CA  
910  C C   A ARG A 55  ? 0.25198 0.24485 0.25786 0.02240  -0.00050 0.01541  55  ARG A C   
911  C C   B ARG A 55  ? 0.26042 0.25253 0.26506 0.02253  -0.00161 0.01562  55  ARG A C   
912  O O   A ARG A 55  ? 0.27510 0.25856 0.27565 0.01363  0.00459  0.01498  55  ARG A O   
913  O O   B ARG A 55  ? 0.24401 0.22517 0.24044 0.01335  0.00200  0.01524  55  ARG A O   
914  C CB  A ARG A 55  ? 0.33780 0.28953 0.30719 0.02900  -0.01059 0.02255  55  ARG A CB  
915  C CB  B ARG A 55  ? 0.33566 0.28690 0.30527 0.03150  -0.01207 0.02292  55  ARG A CB  
916  C CG  A ARG A 55  ? 0.36135 0.32097 0.32700 0.02723  -0.02052 0.02449  55  ARG A CG  
917  C CG  B ARG A 55  ? 0.39092 0.34903 0.35565 0.02961  -0.02242 0.02531  55  ARG A CG  
918  C CD  A ARG A 55  ? 0.42904 0.36219 0.36293 0.02098  -0.02549 0.03103  55  ARG A CD  
919  C CD  B ARG A 55  ? 0.46800 0.39784 0.40083 0.02453  -0.02798 0.03246  55  ARG A CD  
920  N NE  A ARG A 55  ? 0.57342 0.51011 0.49779 0.02302  -0.03950 0.03526  55  ARG A NE  
921  N NE  B ARG A 55  ? 0.60151 0.53555 0.52132 0.01024  -0.02716 0.03122  55  ARG A NE  
922  C CZ  A ARG A 55  ? 0.72148 0.66089 0.62996 0.01067  -0.04146 0.03494  55  ARG A CZ  
923  C CZ  B ARG A 55  ? 0.68039 0.61744 0.58744 0.00850  -0.03841 0.03435  55  ARG A CZ  
924  N NH1 A ARG A 55  ? 0.63311 0.57619 0.53171 0.01397  -0.05687 0.03951  55  ARG A NH1 
925  N NH1 B ARG A 55  ? 0.68014 0.62176 0.57353 -0.00590 -0.03514 0.03019  55  ARG A NH1 
926  N NH2 A ARG A 55  ? 0.67360 0.61382 0.57622 -0.00382 -0.02923 0.02877  55  ARG A NH2 
927  N NH2 B ARG A 55  ? 0.69974 0.63673 0.60778 0.02194  -0.05375 0.04022  55  ARG A NH2 
954  N N   . ILE A 56  ? 0.24205 0.26009 0.26570 0.02222  -0.00286 0.01309  56  ILE A N   
955  C CA  . ILE A 56  ? 0.23482 0.26397 0.26803 0.00895  0.00015  0.01132  56  ILE A CA  
956  C C   . ILE A 56  ? 0.22635 0.27461 0.26861 0.00665  -0.00877 0.00866  56  ILE A C   
957  O O   . ILE A 56  ? 0.23553 0.30835 0.29352 0.01387  -0.01290 0.00668  56  ILE A O   
958  C CB  . ILE A 56  ? 0.24297 0.28612 0.28863 0.00369  0.00876  0.01126  56  ILE A CB  
959  C CG1 . ILE A 56  ? 0.27321 0.29773 0.30693 0.00568  0.01527  0.01388  56  ILE A CG1 
960  C CG2 . ILE A 56  ? 0.27599 0.32245 0.32776 -0.01209 0.00957  0.01119  56  ILE A CG2 
961  C CD1 . ILE A 56  ? 0.32192 0.35820 0.36045 -0.00106 0.02356  0.01547  56  ILE A CD1 
973  N N   . ILE A 57  ? 0.23098 0.27040 0.26437 -0.00269 -0.01200 0.00670  57  ILE A N   
974  C CA  . ILE A 57  ? 0.23880 0.29517 0.27710 -0.00732 -0.02162 0.00300  57  ILE A CA  
975  C C   . ILE A 57  ? 0.23811 0.29700 0.28450 -0.02333 -0.01845 -0.00229 57  ILE A C   
976  O O   . ILE A 57  ? 0.24214 0.27998 0.27732 -0.02947 -0.01549 -0.00546 57  ILE A O   
977  C CB  . ILE A 57  ? 0.25448 0.29669 0.26932 -0.00591 -0.02975 0.00382  57  ILE A CB  
978  C CG1 . ILE A 57  ? 0.29271 0.32421 0.29599 0.00852  -0.03480 0.01125  57  ILE A CG1 
979  C CG2 . ILE A 57  ? 0.26596 0.32736 0.28349 -0.01155 -0.04158 -0.00053 57  ILE A CG2 
980  C CD1 . ILE A 57  ? 0.37125 0.38099 0.34346 0.00645  -0.04048 0.01556  57  ILE A CD1 
992  N N   . PRO A 58  ? 0.23624 0.31985 0.30291 -0.03083 -0.01845 -0.00423 58  PRO A N   
993  C CA  . PRO A 58  ? 0.24301 0.32237 0.31481 -0.04882 -0.01612 -0.00809 58  PRO A CA  
994  C C   . PRO A 58  ? 0.26190 0.33118 0.32317 -0.05606 -0.02354 -0.01612 58  PRO A C   
995  O O   . PRO A 58  ? 0.29054 0.37477 0.34832 -0.05284 -0.03327 -0.01919 58  PRO A O   
996  C CB  . PRO A 58  ? 0.25595 0.37211 0.35167 -0.05734 -0.01575 -0.00936 58  PRO A CB  
997  C CG  . PRO A 58  ? 0.31003 0.44637 0.41460 -0.04090 -0.01351 -0.00646 58  PRO A CG  
998  C CD  . PRO A 58  ? 0.24438 0.36228 0.33146 -0.02348 -0.02044 -0.00426 58  PRO A CD  
1006 N N   . GLY A 59  ? 0.29194 0.33447 0.34674 -0.06482 -0.01982 -0.02003 59  GLY A N   
1007 C CA  . GLY A 59  ? 0.33595 0.36645 0.38003 -0.07132 -0.02476 -0.03139 59  GLY A CA  
1008 C C   . GLY A 59  ? 0.31936 0.33781 0.34404 -0.06096 -0.02357 -0.03427 59  GLY A C   
1009 O O   . GLY A 59  ? 0.34024 0.35594 0.35243 -0.06564 -0.02710 -0.04492 59  GLY A O   
1013 N N   . PHE A 60  ? 0.27011 0.28301 0.29062 -0.04928 -0.01810 -0.02600 60  PHE A N   
1014 C CA  . PHE A 60  ? 0.27092 0.27371 0.27309 -0.04301 -0.01505 -0.02800 60  PHE A CA  
1015 C C   . PHE A 60  ? 0.25984 0.24810 0.26402 -0.03577 -0.00656 -0.02423 60  PHE A C   
1016 O O   . PHE A 60  ? 0.26858 0.24393 0.27286 -0.03611 -0.00232 -0.03288 60  PHE A O   
1017 C CB  . PHE A 60  ? 0.28562 0.29992 0.27426 -0.03774 -0.02170 -0.02099 60  PHE A CB  
1018 C CG  . PHE A 60  ? 0.28641 0.28941 0.25136 -0.03597 -0.01836 -0.02036 60  PHE A CG  
1019 C CD1 . PHE A 60  ? 0.29403 0.28803 0.25136 -0.04100 -0.00994 -0.03129 60  PHE A CD1 
1020 C CD2 . PHE A 60  ? 0.31973 0.32124 0.26942 -0.02998 -0.02397 -0.00961 60  PHE A CD2 
1021 C CE1 . PHE A 60  ? 0.35148 0.34081 0.28695 -0.04321 -0.00475 -0.03156 60  PHE A CE1 
1022 C CE2 . PHE A 60  ? 0.36470 0.35327 0.28878 -0.03287 -0.02035 -0.00736 60  PHE A CE2 
1023 C CZ  . PHE A 60  ? 0.35732 0.34267 0.27408 -0.04111 -0.00988 -0.01824 60  PHE A CZ  
1033 N N   A MET A 61  ? 0.24764 0.23926 0.25470 -0.02836 -0.00491 -0.01339 61  MET A N   
1034 N N   B MET A 61  ? 0.24767 0.23906 0.25455 -0.02832 -0.00483 -0.01346 61  MET A N   
1035 C CA  A MET A 61  ? 0.24849 0.22841 0.25486 -0.02241 0.00168  -0.01036 61  MET A CA  
1036 C CA  B MET A 61  ? 0.23973 0.21903 0.24625 -0.02263 0.00183  -0.01086 61  MET A CA  
1037 C C   A MET A 61  ? 0.22927 0.21362 0.24166 -0.01665 0.00324  -0.00053 61  MET A C   
1038 C C   B MET A 61  ? 0.24534 0.22896 0.25579 -0.01615 0.00326  -0.00078 61  MET A C   
1039 O O   A MET A 61  ? 0.23080 0.22960 0.24877 -0.01473 0.00022  0.00325  61  MET A O   
1040 O O   B MET A 61  ? 0.23907 0.23509 0.25126 -0.01272 -0.00036 0.00323  61  MET A O   
1041 C CB  A MET A 61  ? 0.26237 0.23792 0.25264 -0.02072 0.00476  -0.01278 61  MET A CB  
1042 C CB  B MET A 61  ? 0.25273 0.22728 0.24442 -0.02174 0.00539  -0.01544 61  MET A CB  
1043 C CG  A MET A 61  ? 0.28145 0.25983 0.25589 -0.01905 0.00015  -0.00592 61  MET A CG  
1044 C CG  B MET A 61  ? 0.28721 0.26421 0.26108 -0.02106 0.00220  -0.00939 61  MET A CG  
1045 S SD  A MET A 61  ? 0.36782 0.33425 0.32213 -0.02048 0.00629  -0.00402 61  MET A SD  
1046 S SD  B MET A 61  ? 0.34208 0.31193 0.31417 -0.01230 0.00368  0.00169  61  MET A SD  
1047 C CE  A MET A 61  ? 0.54809 0.50632 0.49131 -0.01258 -0.00186 0.00936  61  MET A CE  
1048 C CE  B MET A 61  ? 0.52005 0.49073 0.47960 -0.00713 -0.00719 0.00991  61  MET A CE  
1067 N N   . CYS A 62  ? 0.24007 0.21437 0.25252 -0.01334 0.00782  0.00161  62  CYS A N   
1068 C CA  . CYS A 62  ? 0.24704 0.22292 0.25900 -0.00760 0.01065  0.00835  62  CYS A CA  
1069 C C   . CYS A 62  ? 0.27727 0.24372 0.27862 -0.00381 0.01309  0.00747  62  CYS A C   
1070 O O   . CYS A 62  ? 0.29759 0.25838 0.29990 -0.00539 0.01474  0.00287  62  CYS A O   
1071 C CB  . CYS A 62  ? 0.25267 0.22474 0.27034 -0.01026 0.01280  0.01235  62  CYS A CB  
1072 S SG  . CYS A 62  ? 0.30876 0.28919 0.33642 -0.02100 0.01168  0.01463  62  CYS A SG  
1078 N N   . GLN A 63  ? 0.24572 0.21034 0.23845 0.00101  0.01278  0.01076  63  GLN A N   
1079 C CA  . GLN A 63  ? 0.24572 0.19863 0.22552 0.00058  0.01503  0.01041  63  GLN A CA  
1080 C C   . GLN A 63  ? 0.27793 0.22598 0.25663 0.00548  0.01713  0.01273  63  GLN A C   
1081 O O   . GLN A 63  ? 0.27944 0.23031 0.26021 0.01218  0.01602  0.01471  63  GLN A O   
1082 C CB  . GLN A 63  ? 0.30225 0.24700 0.26547 -0.00051 0.01140  0.01289  63  GLN A CB  
1083 C CG  . GLN A 63  ? 0.30585 0.23580 0.25206 -0.00643 0.01465  0.01347  63  GLN A CG  
1084 C CD  . GLN A 63  ? 0.39639 0.31362 0.31969 -0.01150 0.01039  0.01836  63  GLN A CD  
1085 O OE1 . GLN A 63  ? 0.47309 0.39593 0.39375 -0.01062 0.00463  0.01968  63  GLN A OE1 
1086 N NE2 . GLN A 63  ? 0.39439 0.29377 0.29884 -0.01888 0.01237  0.02151  63  GLN A NE2 
1095 N N   . GLY A 64  ? 0.25858 0.20154 0.23415 0.00211  0.02005  0.01034  64  GLY A N   
1096 C CA  . GLY A 64  ? 0.26959 0.20666 0.24056 0.00441  0.02149  0.01056  64  GLY A CA  
1097 C C   . GLY A 64  ? 0.26101 0.19168 0.22486 -0.00245 0.02331  0.00710  64  GLY A C   
1098 O O   . GLY A 64  ? 0.28318 0.21255 0.24186 -0.00962 0.02480  0.00533  64  GLY A O   
1102 N N   . GLY A 65  ? 0.23952 0.19631 0.24690 0.01166  0.00156  -0.01697 65  GLY A N   
1103 C CA  . GLY A 65  ? 0.25552 0.21007 0.25401 0.00631  0.00099  -0.01558 65  GLY A CA  
1104 C C   . GLY A 65  ? 0.26355 0.20481 0.24850 0.00422  0.00065  -0.01646 65  GLY A C   
1105 O O   . GLY A 65  ? 0.27711 0.21664 0.25766 -0.00233 0.00136  -0.01712 65  GLY A O   
1109 N N   . ASP A 66  ? 0.25937 0.19165 0.23949 0.00949  0.00069  -0.01666 66  ASP A N   
1110 C CA  . ASP A 66  ? 0.27049 0.18592 0.23917 0.00867  0.00296  -0.01651 66  ASP A CA  
1111 C C   . ASP A 66  ? 0.27811 0.18998 0.24456 0.00714  0.00395  -0.02079 66  ASP A C   
1112 O O   . ASP A 66  ? 0.32112 0.22846 0.28557 0.01345  0.00445  -0.02153 66  ASP A O   
1113 C CB  . ASP A 66  ? 0.28446 0.19236 0.24760 0.01773  0.00348  -0.01342 66  ASP A CB  
1114 C CG  . ASP A 66  ? 0.31555 0.20187 0.26794 0.01845  0.00862  -0.01090 66  ASP A CG  
1115 O OD1 . ASP A 66  ? 0.31181 0.18832 0.26305 0.00978  0.01178  -0.01459 66  ASP A OD1 
1116 O OD2 . ASP A 66  ? 0.32400 0.20340 0.27006 0.02829  0.01035  -0.00594 66  ASP A OD2 
1121 N N   . PHE A 67  ? 0.27661 0.19331 0.24325 -0.00079 0.00415  -0.02471 67  PHE A N   
1122 C CA  . PHE A 67  ? 0.29735 0.21722 0.26149 -0.00169 0.00431  -0.03117 67  PHE A CA  
1123 C C   . PHE A 67  ? 0.33867 0.23956 0.29657 -0.00607 0.00806  -0.03818 67  PHE A C   
1124 O O   . PHE A 67  ? 0.35044 0.25447 0.30615 -0.00746 0.00829  -0.04710 67  PHE A O   
1125 C CB  . PHE A 67  ? 0.29017 0.23180 0.25826 -0.00595 0.00213  -0.03343 67  PHE A CB  
1126 C CG  . PHE A 67  ? 0.29532 0.23990 0.26547 -0.01552 0.00221  -0.03621 67  PHE A CG  
1127 C CD1 . PHE A 67  ? 0.34696 0.28732 0.31564 -0.02470 0.00397  -0.04641 67  PHE A CD1 
1128 C CD2 . PHE A 67  ? 0.32274 0.27603 0.29847 -0.01591 0.00130  -0.03003 67  PHE A CD2 
1129 C CE1 . PHE A 67  ? 0.39258 0.33741 0.36623 -0.03496 0.00520  -0.04945 67  PHE A CE1 
1130 C CE2 . PHE A 67  ? 0.32759 0.28545 0.30588 -0.02465 0.00198  -0.03248 67  PHE A CE2 
1131 C CZ  . PHE A 67  ? 0.36829 0.32257 0.34601 -0.03434 0.00401  -0.04172 67  PHE A CZ  
1141 N N   . THR A 68  ? 0.31544 0.19630 0.27058 -0.00749 0.01236  -0.03478 68  THR A N   
1142 C CA  . THR A 68  ? 0.33961 0.19765 0.29133 -0.01125 0.01896  -0.04078 68  THR A CA  
1143 C C   . THR A 68  ? 0.35546 0.19398 0.30096 0.00005  0.02273  -0.03514 68  THR A C   
1144 O O   . THR A 68  ? 0.37367 0.19577 0.31690 0.00026  0.02767  -0.04193 68  THR A O   
1145 C CB  . THR A 68  ? 0.37189 0.21760 0.32657 -0.02194 0.02519  -0.04106 68  THR A CB  
1146 O OG1 . THR A 68  ? 0.38960 0.22752 0.34087 -0.01597 0.02763  -0.02755 68  THR A OG1 
1147 C CG2 . THR A 68  ? 0.39210 0.26076 0.35433 -0.03337 0.02144  -0.04837 68  THR A CG2 
1155 N N   . ARG A 69  ? 0.35471 0.19703 0.29809 0.01027  0.02050  -0.02452 69  ARG A N   
1156 C CA  . ARG A 69  ? 0.35667 0.18612 0.29408 0.02340  0.02344  -0.01855 69  ARG A CA  
1157 C C   . ARG A 69  ? 0.33916 0.18828 0.27922 0.03361  0.01694  -0.01662 69  ARG A C   
1158 O O   . ARG A 69  ? 0.36824 0.21206 0.30464 0.04522  0.01844  -0.01369 69  ARG A O   
1159 C CB  . ARG A 69  ? 0.37244 0.18771 0.30421 0.02825  0.02931  -0.00729 69  ARG A CB  
1160 C CG  . ARG A 69  ? 0.44611 0.23724 0.37835 0.01763  0.03918  -0.00922 69  ARG A CG  
1161 C CD  . ARG A 69  ? 0.52277 0.29653 0.44897 0.02402  0.04836  0.00488  69  ARG A CD  
1162 N NE  . ARG A 69  ? 0.54836 0.30938 0.46671 0.04110  0.05237  0.01280  69  ARG A NE  
1163 C CZ  . ARG A 69  ? 0.71940 0.45433 0.63720 0.04331  0.06092  0.00956  69  ARG A CZ  
1164 N NH1 . ARG A 69  ? 0.69615 0.41455 0.62164 0.02791  0.06670  -0.00359 69  ARG A NH1 
1165 N NH2 . ARG A 69  ? 0.67616 0.40384 0.58659 0.06156  0.06372  0.01810  69  ARG A NH2 
1179 N N   . HIS A 70  ? 0.32731 0.19845 0.27535 0.02965  0.01112  -0.01853 70  HIS A N   
1180 C CA  . HIS A 70  ? 0.32306 0.21247 0.27872 0.03575  0.00719  -0.01907 70  HIS A CA  
1181 C C   . HIS A 70  ? 0.38159 0.27922 0.33910 0.04558  0.00509  -0.01515 70  HIS A C   
1182 O O   . HIS A 70  ? 0.36070 0.27099 0.32525 0.05177  0.00335  -0.01696 70  HIS A O   
1183 C CB  . HIS A 70  ? 0.30669 0.19342 0.26082 0.03945  0.00899  -0.02342 70  HIS A CB  
1184 C CG  . HIS A 70  ? 0.31708 0.19448 0.26604 0.03165  0.01148  -0.03005 70  HIS A CG  
1185 N ND1 . HIS A 70  ? 0.34078 0.23102 0.29299 0.02296  0.00947  -0.03332 70  HIS A ND1 
1186 C CD2 . HIS A 70  ? 0.35903 0.21693 0.30102 0.03134  0.01620  -0.03544 70  HIS A CD2 
1187 C CE1 . HIS A 70  ? 0.32409 0.20656 0.27149 0.01710  0.01171  -0.04206 70  HIS A CE1 
1188 N NE2 . HIS A 70  ? 0.35099 0.21181 0.29315 0.02086  0.01633  -0.04417 70  HIS A NE2 
1196 N N   . ASN A 71  ? 0.34850 0.24163 0.29980 0.04814  0.00572  -0.01000 71  ASN A N   
1197 C CA  . ASN A 71  ? 0.32726 0.23313 0.27787 0.06047  0.00324  -0.00697 71  ASN A CA  
1198 C C   . ASN A 71  ? 0.34519 0.26102 0.29370 0.06105  0.00143  -0.00386 71  ASN A C   
1199 O O   . ASN A 71  ? 0.37214 0.30194 0.31731 0.07311  -0.00076 -0.00141 71  ASN A O   
1200 C CB  . ASN A 71  ? 0.36845 0.25905 0.30794 0.07316  0.00777  -0.00100 71  ASN A CB  
1201 C CG  . ASN A 71  ? 0.41388 0.27778 0.34139 0.07244  0.01565  0.00702  71  ASN A CG  
1202 O OD1 . ASN A 71  ? 0.39209 0.25214 0.31959 0.06234  0.01690  0.00781  71  ASN A OD1 
1203 N ND2 . ASN A 71  ? 0.52395 0.36943 0.44251 0.08409  0.02231  0.01375  71  ASN A ND2 
1210 N N   . GLY A 72  ? 0.32185 0.23427 0.27148 0.05008  0.00223  -0.00408 72  GLY A N   
1211 C CA  . GLY A 72  ? 0.33860 0.26183 0.28626 0.05051  0.00102  -0.00174 72  GLY A CA  
1212 C C   . GLY A 72  ? 0.34375 0.24904 0.27837 0.05121  0.00785  0.00829  72  GLY A C   
1213 O O   . GLY A 72  ? 0.38163 0.29548 0.31346 0.05101  0.00814  0.01139  72  GLY A O   
1217 N N   . THR A 73  ? 0.37502 0.25470 0.30304 0.05126  0.01481  0.01291  73  THR A N   
1218 C CA  . THR A 73  ? 0.38462 0.24296 0.30383 0.05017  0.02453  0.02269  73  THR A CA  
1219 C C   . THR A 73  ? 0.46076 0.30493 0.38566 0.03268  0.02898  0.01809  73  THR A C   
1220 O O   . THR A 73  ? 0.49542 0.32091 0.41681 0.02913  0.03881  0.02491  73  THR A O   
1221 C CB  . THR A 73  ? 0.44183 0.27742 0.35178 0.06206  0.03285  0.03146  73  THR A CB  
1222 O OG1 . THR A 73  ? 0.46418 0.28391 0.37853 0.05680  0.03427  0.02346  73  THR A OG1 
1223 C CG2 . THR A 73  ? 0.46027 0.31440 0.36392 0.08165  0.02850  0.03671  73  THR A CG2 
1231 N N   . GLY A 74  ? 0.37323 0.22669 0.30738 0.02247  0.02321  0.00718  74  GLY A N   
1232 C CA  . GLY A 74  ? 0.38685 0.23282 0.32658 0.00738  0.02636  0.00077  74  GLY A CA  
1233 C C   . GLY A 74  ? 0.36406 0.23258 0.31198 -0.00086 0.02005  -0.00432 74  GLY A C   
1234 O O   . GLY A 74  ? 0.40476 0.28939 0.35399 0.00308  0.01603  -0.00142 74  GLY A O   
1238 N N   . GLY A 75  ? 0.34675 0.21779 0.30059 -0.01163 0.01962  -0.01287 75  GLY A N   
1239 C CA  . GLY A 75  ? 0.34193 0.23379 0.30342 -0.01889 0.01528  -0.01691 75  GLY A CA  
1240 C C   . GLY A 75  ? 0.36264 0.25335 0.32761 -0.03008 0.02036  -0.01753 75  GLY A C   
1241 O O   . GLY A 75  ? 0.42885 0.30184 0.39058 -0.03174 0.02833  -0.01234 75  GLY A O   
1245 N N   . LYS A 76  ? 0.33832 0.24958 0.31091 -0.03704 0.01669  -0.02307 76  LYS A N   
1246 C CA  . LYS A 76  ? 0.33641 0.25338 0.31515 -0.04803 0.02078  -0.02475 76  LYS A CA  
1247 C C   . LYS A 76  ? 0.34165 0.28738 0.32715 -0.04844 0.01444  -0.02697 76  LYS A C   
1248 O O   . LYS A 76  ? 0.32891 0.28706 0.31508 -0.04271 0.00877  -0.02893 76  LYS A O   
1249 C CB  . LYS A 76  ? 0.43059 0.33811 0.41477 -0.06081 0.02666  -0.03508 76  LYS A CB  
1250 C CG  . LYS A 76  ? 0.48032 0.40442 0.46835 -0.06417 0.02087  -0.04855 76  LYS A CG  
1251 C CD  . LYS A 76  ? 0.66269 0.57786 0.65848 -0.07833 0.02742  -0.06304 76  LYS A CD  
1252 C CE  . LYS A 76  ? 0.76855 0.70152 0.76559 -0.07948 0.02144  -0.07826 76  LYS A CE  
1253 N NZ  . LYS A 76  ? 0.76920 0.69783 0.77731 -0.09530 0.02775  -0.09675 76  LYS A NZ  
1267 N N   . SER A 77  ? 0.33959 0.29558 0.33012 -0.05368 0.01669  -0.02507 77  SER A N   
1268 C CA  . SER A 77  ? 0.29449 0.27795 0.29222 -0.05332 0.01206  -0.02663 77  SER A CA  
1269 C C   . SER A 77  ? 0.29934 0.30129 0.30533 -0.06371 0.01141  -0.03735 77  SER A C   
1270 O O   . SER A 77  ? 0.34195 0.33451 0.35037 -0.07395 0.01535  -0.04587 77  SER A O   
1271 C CB  . SER A 77  ? 0.30519 0.29499 0.30484 -0.05242 0.01452  -0.02016 77  SER A CB  
1272 O OG  . SER A 77  ? 0.33696 0.33097 0.34262 -0.06398 0.02035  -0.02234 77  SER A OG  
1278 N N   . ILE A 78  ? 0.29776 0.32822 0.30952 -0.06057 0.00693  -0.03780 78  ILE A N   
1279 C CA  . ILE A 78  ? 0.30852 0.36623 0.32886 -0.06862 0.00497  -0.04879 78  ILE A CA  
1280 C C   . ILE A 78  ? 0.32494 0.38792 0.35514 -0.08204 0.01056  -0.05298 78  ILE A C   
1281 O O   . ILE A 78  ? 0.35417 0.44076 0.39471 -0.09185 0.00983  -0.06524 78  ILE A O   
1282 C CB  . ILE A 78  ? 0.29176 0.38197 0.31460 -0.05793 -0.00096 -0.04609 78  ILE A CB  
1283 C CG1 . ILE A 78  ? 0.32317 0.42096 0.35003 -0.05213 0.00041  -0.03640 78  ILE A CG1 
1284 C CG2 . ILE A 78  ? 0.32415 0.40969 0.33906 -0.04526 -0.00414 -0.04127 78  ILE A CG2 
1285 C CD1 . ILE A 78  ? 0.33185 0.46263 0.36358 -0.04114 -0.00305 -0.03275 78  ILE A CD1 
1297 N N   . TYR A 79  ? 0.31044 0.35612 0.33855 -0.08212 0.01637  -0.04338 79  TYR A N   
1298 C CA  . TYR A 79  ? 0.33474 0.38284 0.37148 -0.09327 0.02407  -0.04345 79  TYR A CA  
1299 C C   . TYR A 79  ? 0.48035 0.49729 0.51703 -0.10339 0.03456  -0.04356 79  TYR A C   
1300 O O   . TYR A 79  ? 0.52295 0.53926 0.56893 -0.11445 0.04371  -0.04357 79  TYR A O   
1301 C CB  . TYR A 79  ? 0.38229 0.43340 0.41544 -0.08452 0.02509  -0.03153 79  TYR A CB  
1302 C CG  . TYR A 79  ? 0.33547 0.40975 0.36920 -0.07245 0.01735  -0.02940 79  TYR A CG  
1303 C CD1 . TYR A 79  ? 0.30276 0.40999 0.34658 -0.07398 0.01380  -0.03535 79  TYR A CD1 
1304 C CD2 . TYR A 79  ? 0.30822 0.37208 0.33397 -0.05903 0.01463  -0.02179 79  TYR A CD2 
1305 C CE1 . TYR A 79  ? 0.30992 0.43634 0.35449 -0.06048 0.00887  -0.03076 79  TYR A CE1 
1306 C CE2 . TYR A 79  ? 0.30790 0.38841 0.33693 -0.04824 0.01046  -0.01940 79  TYR A CE2 
1307 C CZ  . TYR A 79  ? 0.30839 0.41876 0.34619 -0.04818 0.00819  -0.02249 79  TYR A CZ  
1308 O OH  . TYR A 79  ? 0.30359 0.42911 0.34492 -0.03546 0.00612  -0.01774 79  TYR A OH  
1318 N N   . GLY A 80  ? 0.40140 0.39284 0.42928 -0.09968 0.03483  -0.04328 80  GLY A N   
1319 C CA  . GLY A 80  ? 0.45546 0.41245 0.48119 -0.10471 0.04613  -0.03976 80  GLY A CA  
1320 C C   . GLY A 80  ? 0.40310 0.33767 0.41235 -0.08931 0.04460  -0.02786 80  GLY A C   
1321 O O   . GLY A 80  ? 0.41254 0.35748 0.41465 -0.07750 0.03495  -0.02538 80  GLY A O   
1325 N N   A GLU A 81  ? 0.41989 0.32451 0.42431 -0.08875 0.05557  -0.01940 81  GLU A N   
1326 N N   B GLU A 81  ? 0.43450 0.33876 0.43890 -0.08878 0.05532  -0.01994 81  GLU A N   
1327 C CA  A GLU A 81  ? 0.45050 0.33644 0.43972 -0.07329 0.05438  -0.00902 81  GLU A CA  
1328 C CA  B GLU A 81  ? 0.45313 0.33959 0.44248 -0.07330 0.05353  -0.01012 81  GLU A CA  
1329 C C   A GLU A 81  ? 0.41566 0.31623 0.39577 -0.05999 0.04848  0.00123  81  GLU A C   
1330 C C   B GLU A 81  ? 0.40898 0.31220 0.38986 -0.06008 0.04612  -0.00124 81  GLU A C   
1331 O O   A GLU A 81  ? 0.45445 0.35487 0.42580 -0.04746 0.04159  0.00374  81  GLU A O   
1332 O O   B GLU A 81  ? 0.44678 0.35504 0.42184 -0.04968 0.03722  -0.00191 81  GLU A O   
1333 C CB  A GLU A 81  ? 0.55861 0.41077 0.54421 -0.07294 0.06907  0.00029  81  GLU A CB  
1334 C CB  B GLU A 81  ? 0.55461 0.40787 0.53967 -0.07219 0.06805  0.00008  81  GLU A CB  
1335 C CG  A GLU A 81  ? 0.63940 0.47521 0.60939 -0.05526 0.06765  0.01039  81  GLU A CG  
1336 C CG  B GLU A 81  ? 0.61998 0.45199 0.61611 -0.08577 0.07713  -0.01131 81  GLU A CG  
1337 C CD  A GLU A 81  ? 0.80646 0.61656 0.76839 -0.04751 0.08252  0.02776  81  GLU A CD  
1338 C CD  B GLU A 81  ? 0.72037 0.51396 0.71061 -0.07980 0.09173  0.00030  81  GLU A CD  
1339 O OE1 A GLU A 81  ? 0.83496 0.63396 0.80470 -0.05745 0.09632  0.03235  81  GLU A OE1 
1340 O OE1 B GLU A 81  ? 0.76033 0.54687 0.73479 -0.06178 0.08922  0.01319  81  GLU A OE1 
1341 O OE2 A GLU A 81  ? 0.84243 0.64530 0.79072 -0.03050 0.08110  0.03755  81  GLU A OE2 
1342 O OE2 B GLU A 81  ? 0.83238 0.60373 0.83511 -0.09273 0.10653  -0.00368 81  GLU A OE2 
1355 N N   A LYS A 82  ? 0.39261 0.30638 0.37576 -0.06267 0.05198  0.00607  82  LYS A N   
1356 N N   B LYS A 82  ? 0.39200 0.30566 0.37412 -0.06113 0.05027  0.00540  82  LYS A N   
1357 C CA  A LYS A 82  ? 0.34568 0.27587 0.32163 -0.05069 0.04653  0.01235  82  LYS A CA  
1358 C CA  B LYS A 82  ? 0.34896 0.28056 0.32491 -0.04956 0.04385  0.01046  82  LYS A CA  
1359 C C   A LYS A 82  ? 0.32790 0.28342 0.31358 -0.05694 0.04487  0.00861  82  LYS A C   
1360 C C   B LYS A 82  ? 0.34738 0.30021 0.33092 -0.05529 0.04567  0.01041  82  LYS A C   
1361 O O   A LYS A 82  ? 0.32104 0.28146 0.31800 -0.07023 0.05002  0.00416  82  LYS A O   
1362 O O   B LYS A 82  ? 0.38948 0.33994 0.38027 -0.06641 0.05512  0.01165  82  LYS A O   
1363 C CB  A LYS A 82  ? 0.35733 0.27613 0.32039 -0.04001 0.05432  0.02663  82  LYS A CB  
1364 C CB  B LYS A 82  ? 0.43542 0.35609 0.39681 -0.03555 0.04758  0.02272  82  LYS A CB  
1365 C CG  A LYS A 82  ? 0.47562 0.37711 0.43962 -0.04638 0.06978  0.03611  82  LYS A CG  
1366 C CG  B LYS A 82  ? 0.45476 0.35382 0.40744 -0.02728 0.04799  0.02566  82  LYS A CG  
1367 C CD  A LYS A 82  ? 0.66909 0.55843 0.61632 -0.03007 0.07700  0.05285  82  LYS A CD  
1368 C CD  B LYS A 82  ? 0.45620 0.36369 0.40815 -0.01968 0.03583  0.01807  82  LYS A CD  
1369 C CE  A LYS A 82  ? 0.73411 0.60360 0.67287 -0.02022 0.07521  0.05461  82  LYS A CE  
1370 C CE  B LYS A 82  ? 0.51269 0.39944 0.45979 -0.01535 0.03721  0.01855  82  LYS A CE  
1371 N NZ  A LYS A 82  ? 0.79500 0.65717 0.71681 -0.00168 0.08247  0.07223  82  LYS A NZ  
1372 N NZ  B LYS A 82  ? 0.49441 0.38254 0.44971 -0.02283 0.03154  0.00683  82  LYS A NZ  
1399 N N   . PHE A 83  ? 0.30581 0.27887 0.28904 -0.04735 0.03778  0.00873  83  PHE A N   
1400 C CA  . PHE A 83  ? 0.29042 0.28634 0.28085 -0.04974 0.03795  0.00763  83  PHE A CA  
1401 C C   . PHE A 83  ? 0.28616 0.29203 0.26887 -0.03708 0.03617  0.01158  83  PHE A C   
1402 O O   . PHE A 83  ? 0.28842 0.28817 0.26187 -0.02651 0.03286  0.01298  83  PHE A O   
1403 C CB  . PHE A 83  ? 0.27880 0.29364 0.28114 -0.05392 0.03106  -0.00155 83  PHE A CB  
1404 C CG  . PHE A 83  ? 0.26879 0.28856 0.27090 -0.04383 0.02238  -0.00479 83  PHE A CG  
1405 C CD1 . PHE A 83  ? 0.27695 0.28402 0.27604 -0.04146 0.01833  -0.00715 83  PHE A CD1 
1406 C CD2 . PHE A 83  ? 0.28591 0.32249 0.29277 -0.03673 0.01969  -0.00573 83  PHE A CD2 
1407 C CE1 . PHE A 83  ? 0.29406 0.30528 0.29549 -0.03298 0.01267  -0.00911 83  PHE A CE1 
1408 C CE2 . PHE A 83  ? 0.27950 0.31734 0.28974 -0.02810 0.01442  -0.00849 83  PHE A CE2 
1409 C CZ  . PHE A 83  ? 0.28679 0.31194 0.29456 -0.02667 0.01135  -0.00956 83  PHE A CZ  
1419 N N   . GLU A 84  ? 0.28449 0.30831 0.27142 -0.03831 0.03927  0.01253  84  GLU A N   
1420 C CA  . GLU A 84  ? 0.28507 0.32104 0.26454 -0.02721 0.03954  0.01502  84  GLU A CA  
1421 C C   . GLU A 84  ? 0.26878 0.31519 0.25133 -0.01811 0.03052  0.00588  84  GLU A C   
1422 O O   . GLU A 84  ? 0.25549 0.30299 0.24799 -0.02013 0.02526  -0.00039 84  GLU A O   
1423 C CB  . GLU A 84  ? 0.28853 0.34196 0.27323 -0.03165 0.04630  0.01776  84  GLU A CB  
1424 C CG  . GLU A 84  ? 0.27179 0.34447 0.27154 -0.03574 0.04185  0.00944  84  GLU A CG  
1425 C CD  . GLU A 84  ? 0.34400 0.41826 0.35602 -0.04919 0.04252  0.00638  84  GLU A CD  
1426 O OE1 . GLU A 84  ? 0.31585 0.37277 0.32712 -0.05729 0.04515  0.00727  84  GLU A OE1 
1427 O OE2 . GLU A 84  ? 0.34628 0.44211 0.36956 -0.05109 0.04081  0.00204  84  GLU A OE2 
1434 N N   . ASP A 85  ? 0.23197 0.29375 0.25573 0.00904  0.01591  0.00287  85  ASP A N   
1435 C CA  . ASP A 85  ? 0.22562 0.28629 0.24921 0.02033  0.01260  0.00254  85  ASP A CA  
1436 C C   . ASP A 85  ? 0.22999 0.31086 0.26333 0.02633  0.01397  0.00231  85  ASP A C   
1437 O O   . ASP A 85  ? 0.25525 0.34755 0.29163 0.02602  0.01975  0.00163  85  ASP A O   
1438 C CB  . ASP A 85  ? 0.23252 0.28171 0.24680 0.02275  0.01343  0.00357  85  ASP A CB  
1439 C CG  . ASP A 85  ? 0.25021 0.28512 0.26142 0.02035  0.01094  0.00780  85  ASP A CG  
1440 O OD1 . ASP A 85  ? 0.25901 0.28695 0.27449 0.02168  0.00872  0.00680  85  ASP A OD1 
1441 O OD2 . ASP A 85  ? 0.24766 0.27926 0.25310 0.01772  0.01149  0.01355  85  ASP A OD2 
1446 N N   . GLU A 86  ? 0.22400 0.31072 0.26394 0.03228  0.00964  0.00439  86  GLU A N   
1447 C CA  . GLU A 86  ? 0.21839 0.32888 0.27423 0.04000  0.01033  0.00844  86  GLU A CA  
1448 C C   . GLU A 86  ? 0.24374 0.34807 0.30315 0.05234  0.01881  0.00617  86  GLU A C   
1449 O O   . GLU A 86  ? 0.27518 0.39745 0.34667 0.05587  0.02606  0.00590  86  GLU A O   
1450 C CB  . GLU A 86  ? 0.22891 0.34673 0.28918 0.04278  0.00232  0.01504  86  GLU A CB  
1451 C CG  . GLU A 86  ? 0.22048 0.36731 0.30143 0.05265  0.00044  0.02456  86  GLU A CG  
1452 C CD  . GLU A 86  ? 0.22878 0.38818 0.31092 0.05180  -0.01030 0.03481  86  GLU A CD  
1453 O OE1 . GLU A 86  ? 0.23064 0.36924 0.29556 0.04569  -0.01355 0.03244  86  GLU A OE1 
1454 O OE2 . GLU A 86  ? 0.23448 0.42773 0.33597 0.05706  -0.01506 0.04618  86  GLU A OE2 
1461 N N   . ASN A 87  ? 0.22858 0.30765 0.27728 0.05714  0.02005  0.00297  87  ASN A N   
1462 C CA  . ASN A 87  ? 0.22763 0.29365 0.27286 0.06411  0.03072  -0.00334 87  ASN A CA  
1463 C C   . ASN A 87  ? 0.26200 0.30073 0.29028 0.06117  0.02866  -0.00781 87  ASN A C   
1464 O O   . ASN A 87  ? 0.26467 0.29828 0.28953 0.05714  0.01990  -0.00439 87  ASN A O   
1465 C CB  . ASN A 87  ? 0.25824 0.33256 0.32372 0.07983  0.03869  0.00030  87  ASN A CB  
1466 C CG  . ASN A 87  ? 0.28149 0.34817 0.35380 0.08902  0.03303  0.00923  87  ASN A CG  
1467 O OD1 . ASN A 87  ? 0.29373 0.33328 0.35153 0.08724  0.03243  0.00591  87  ASN A OD1 
1468 N ND2 . ASN A 87  ? 0.28680 0.38106 0.38133 0.09728  0.02786  0.02237  87  ASN A ND2 
1475 N N   . PHE A 88  ? 0.29716 0.31973 0.31437 0.06113  0.03794  -0.01662 88  PHE A N   
1476 C CA  . PHE A 88  ? 0.28431 0.28373 0.28521 0.05536  0.03699  -0.02244 88  PHE A CA  
1477 C C   . PHE A 88  ? 0.30722 0.28446 0.30775 0.06299  0.04961  -0.02884 88  PHE A C   
1478 O O   . PHE A 88  ? 0.36467 0.32172 0.34710 0.05451  0.05578  -0.03977 88  PHE A O   
1479 C CB  . PHE A 88  ? 0.30749 0.30679 0.28903 0.04157  0.03491  -0.02777 88  PHE A CB  
1480 C CG  . PHE A 88  ? 0.27581 0.29032 0.25950 0.03592  0.02416  -0.01908 88  PHE A CG  
1481 C CD1 . PHE A 88  ? 0.25801 0.27123 0.24552 0.03389  0.01444  -0.01334 88  PHE A CD1 
1482 C CD2 . PHE A 88  ? 0.29364 0.32162 0.27656 0.03269  0.02657  -0.01683 88  PHE A CD2 
1483 C CE1 . PHE A 88  ? 0.27612 0.29768 0.26721 0.03008  0.00864  -0.00607 88  PHE A CE1 
1484 C CE2 . PHE A 88  ? 0.28972 0.32503 0.27434 0.02760  0.01949  -0.00846 88  PHE A CE2 
1485 C CZ  . PHE A 88  ? 0.27816 0.30893 0.26782 0.02724  0.01131  -0.00322 88  PHE A CZ  
1495 N N   . ILE A 89  ? 0.29188 0.27177 0.31264 0.07833  0.05339  -0.02091 89  ILE A N   
1496 C CA  . ILE A 89  ? 0.33478 0.28974 0.36000 0.08939  0.06820  -0.02411 89  ILE A CA  
1497 C C   . ILE A 89  ? 0.34498 0.27072 0.35488 0.08243  0.06674  -0.02731 89  ILE A C   
1498 O O   . ILE A 89  ? 0.41632 0.31212 0.41404 0.07932  0.08075  -0.03912 89  ILE A O   
1499 C CB  . ILE A 89  ? 0.37614 0.34580 0.43095 0.10927  0.06928  -0.00857 89  ILE A CB  
1500 C CG1 . ILE A 89  ? 0.44064 0.44117 0.51336 0.11497  0.07394  -0.00740 89  ILE A CG1 
1501 C CG2 . ILE A 89  ? 0.48207 0.41989 0.54443 0.12378  0.08433  -0.00686 89  ILE A CG2 
1502 C CD1 . ILE A 89  ? 0.48135 0.51262 0.58506 0.12984  0.06707  0.01168  89  ILE A CD1 
1514 N N   . LEU A 90  ? 0.31410 0.24718 0.32380 0.07821  0.05184  -0.01816 90  LEU A N   
1515 C CA  . LEU A 90  ? 0.36725 0.27638 0.36602 0.07179  0.05074  -0.01909 90  LEU A CA  
1516 C C   . LEU A 90  ? 0.34844 0.25848 0.32926 0.05268  0.04424  -0.02895 90  LEU A C   
1517 O O   . LEU A 90  ? 0.34306 0.27590 0.32329 0.04674  0.03529  -0.02835 90  LEU A O   
1518 C CB  . LEU A 90  ? 0.36388 0.28080 0.37189 0.07712  0.04047  -0.00344 90  LEU A CB  
1519 C CG  . LEU A 90  ? 0.36738 0.28937 0.39499 0.09606  0.04385  0.01112  90  LEU A CG  
1520 C CD1 . LEU A 90  ? 0.40692 0.34631 0.43795 0.09558  0.03007  0.02629  90  LEU A CD1 
1521 C CD2 . LEU A 90  ? 0.47210 0.35813 0.50074 0.10574  0.06013  0.01018  90  LEU A CD2 
1533 N N   . LYS A 91  ? 0.39015 0.27517 0.35725 0.04274  0.05002  -0.03752 91  LYS A N   
1534 C CA  . LYS A 91  ? 0.34489 0.23545 0.29697 0.02330  0.04370  -0.04619 91  LYS A CA  
1535 C C   . LYS A 91  ? 0.33873 0.22786 0.29223 0.01607  0.03633  -0.04153 91  LYS A C   
1536 O O   . LYS A 91  ? 0.36445 0.23991 0.32372 0.02327  0.03871  -0.03408 91  LYS A O   
1537 C CB  . LYS A 91  ? 0.43501 0.30454 0.36680 0.01043  0.05617  -0.06322 91  LYS A CB  
1538 C CG  . LYS A 91  ? 0.60774 0.47934 0.53520 0.01492  0.06652  -0.07055 91  LYS A CG  
1539 C CD  . LYS A 91  ? 0.98187 0.83423 0.88271 -0.00377 0.07895  -0.09030 91  LYS A CD  
1540 C CE  . LYS A 91  ? 1.20196 1.05916 1.09434 -0.00319 0.09008  -0.09913 91  LYS A CE  
1541 N NZ  . LYS A 91  ? 1.23826 1.13280 1.12871 -0.00858 0.07401  -0.09106 91  LYS A NZ  
1555 N N   . HIS A 92  ? 0.32465 0.23093 0.27352 0.00115  0.02734  -0.04465 92  HIS A N   
1556 C CA  . HIS A 92  ? 0.31377 0.22631 0.26736 -0.00768 0.02094  -0.04138 92  HIS A CA  
1557 C C   . HIS A 92  ? 0.36080 0.25020 0.29970 -0.02329 0.02903  -0.05258 92  HIS A C   
1558 O O   . HIS A 92  ? 0.39587 0.29471 0.32436 -0.04119 0.02622  -0.06146 92  HIS A O   
1559 C CB  . HIS A 92  ? 0.31182 0.25765 0.27398 -0.01366 0.00841  -0.03688 92  HIS A CB  
1560 C CG  . HIS A 92  ? 0.27855 0.24085 0.25354 -0.00085 0.00327  -0.02729 92  HIS A CG  
1561 N ND1 . HIS A 92  ? 0.26996 0.23900 0.24156 0.00387  0.00295  -0.02691 92  HIS A ND1 
1562 C CD2 . HIS A 92  ? 0.27191 0.24439 0.26155 0.00553  -0.00011 -0.01912 92  HIS A CD2 
1563 C CE1 . HIS A 92  ? 0.27189 0.25295 0.25600 0.01257  -0.00070 -0.01845 92  HIS A CE1 
1564 N NE2 . HIS A 92  ? 0.26827 0.25104 0.26280 0.01329  -0.00231 -0.01443 92  HIS A NE2 
1572 N N   . THR A 93  ? 0.36716 0.22501 0.30355 -0.01788 0.03977  -0.05178 93  THR A N   
1573 C CA  . THR A 93  ? 0.41365 0.23862 0.33385 -0.03156 0.05255  -0.06387 93  THR A CA  
1574 C C   . THR A 93  ? 0.41831 0.24160 0.33684 -0.04855 0.05085  -0.06472 93  THR A C   
1575 O O   . THR A 93  ? 0.49219 0.29057 0.39522 -0.06605 0.06100  -0.07706 93  THR A O   
1576 C CB  . THR A 93  ? 0.46550 0.25163 0.38537 -0.01524 0.06827  -0.06084 93  THR A CB  
1577 O OG1 . THR A 93  ? 0.50431 0.29417 0.43823 0.00035  0.06315  -0.04270 93  THR A OG1 
1578 C CG2 . THR A 93  ? 0.52471 0.31109 0.44567 -0.00300 0.07459  -0.06491 93  THR A CG2 
1586 N N   . GLY A 94  ? 0.40570 0.25337 0.33905 -0.04567 0.04064  -0.05359 94  GLY A N   
1587 C CA  . GLY A 94  ? 0.44845 0.29595 0.38263 -0.06112 0.04138  -0.05403 94  GLY A CA  
1588 C C   . GLY A 94  ? 0.40411 0.26795 0.35313 -0.05193 0.03607  -0.04086 94  GLY A C   
1589 O O   . GLY A 94  ? 0.35857 0.23672 0.31682 -0.03574 0.03034  -0.03235 94  GLY A O   
1593 N N   . PRO A 95  ? 0.38028 0.24058 0.32975 -0.06440 0.03985  -0.04011 95  PRO A N   
1594 C CA  . PRO A 95  ? 0.36798 0.24338 0.32842 -0.05888 0.03761  -0.03004 95  PRO A CA  
1595 C C   . PRO A 95  ? 0.37468 0.23072 0.32828 -0.04212 0.03998  -0.01846 95  PRO A C   
1596 O O   . PRO A 95  ? 0.44719 0.27005 0.38876 -0.03708 0.04701  -0.01527 95  PRO A O   
1597 C CB  . PRO A 95  ? 0.42764 0.29690 0.38569 -0.07817 0.04467  -0.03285 95  PRO A CB  
1598 C CG  . PRO A 95  ? 0.53833 0.40045 0.48871 -0.09612 0.04710  -0.04525 95  PRO A CG  
1599 C CD  . PRO A 95  ? 0.46628 0.31186 0.40568 -0.08750 0.04712  -0.05035 95  PRO A CD  
1607 N N   . GLY A 96  ? 0.33640 0.21394 0.29848 -0.03450 0.03493  -0.01175 96  GLY A N   
1608 C CA  . GLY A 96  ? 0.36294 0.23284 0.31817 -0.02287 0.03440  0.00028  96  GLY A CA  
1609 C C   . GLY A 96  ? 0.32750 0.20769 0.28753 -0.00734 0.02780  0.00351  96  GLY A C   
1610 O O   . GLY A 96  ? 0.35131 0.23612 0.30828 0.00012  0.02473  0.01344  96  GLY A O   
1614 N N   . ILE A 97  ? 0.30860 0.19764 0.27565 -0.00497 0.02490  -0.00458 97  ILE A N   
1615 C CA  . ILE A 97  ? 0.31323 0.21406 0.28558 0.00773  0.01987  -0.00241 97  ILE A CA  
1616 C C   . ILE A 97  ? 0.29029 0.21626 0.27100 0.00844  0.01459  -0.00089 97  ILE A C   
1617 O O   . ILE A 97  ? 0.28226 0.22138 0.27099 0.00121  0.01459  -0.00538 97  ILE A O   
1618 C CB  . ILE A 97  ? 0.30662 0.20842 0.27993 0.00677  0.01987  -0.01193 97  ILE A CB  
1619 C CG1 . ILE A 97  ? 0.38002 0.25180 0.34316 0.00762  0.02897  -0.01571 97  ILE A CG1 
1620 C CG2 . ILE A 97  ? 0.32019 0.24184 0.30095 0.01590  0.01434  -0.01093 97  ILE A CG2 
1621 C CD1 . ILE A 97  ? 0.47808 0.33757 0.44330 0.02471  0.03297  -0.00694 97  ILE A CD1 
1633 N N   A LEU A 98  ? 0.26682 0.20005 0.24744 0.01685  0.01128  0.00542  98  LEU A N   
1634 N N   B LEU A 98  ? 0.27740 0.21087 0.25807 0.01686  0.01123  0.00547  98  LEU A N   
1635 C CA  A LEU A 98  ? 0.25439 0.20608 0.23900 0.01567  0.00858  0.00540  98  LEU A CA  
1636 C CA  B LEU A 98  ? 0.26265 0.21548 0.24871 0.01612  0.00834  0.00452  98  LEU A CA  
1637 C C   A LEU A 98  ? 0.24862 0.21161 0.24097 0.02231  0.00516  0.00330  98  LEU A C   
1638 C C   B LEU A 98  ? 0.24773 0.21078 0.24151 0.02243  0.00521  0.00195  98  LEU A C   
1639 O O   A LEU A 98  ? 0.26608 0.22801 0.25836 0.03043  0.00376  0.00701  98  LEU A O   
1640 O O   B LEU A 98  ? 0.26879 0.23033 0.26219 0.03034  0.00409  0.00500  98  LEU A O   
1641 C CB  A LEU A 98  ? 0.31133 0.26475 0.28585 0.01515  0.00685  0.01445  98  LEU A CB  
1642 C CB  B LEU A 98  ? 0.25205 0.21051 0.22996 0.01600  0.00611  0.01234  98  LEU A CB  
1643 C CG  A LEU A 98  ? 0.30758 0.27733 0.27986 0.00928  0.00570  0.01261  98  LEU A CG  
1644 C CG  B LEU A 98  ? 0.30983 0.26444 0.27586 0.00606  0.00931  0.01506  98  LEU A CG  
1645 C CD1 A LEU A 98  ? 0.32272 0.29250 0.29696 -0.00046 0.01341  0.00325  98  LEU A CD1 
1646 C CD1 B LEU A 98  ? 0.35399 0.31790 0.30841 0.00528  0.00387  0.02588  98  LEU A CD1 
1647 C CD2 A LEU A 98  ? 0.32785 0.30316 0.28643 0.00655  0.00125  0.02382  98  LEU A CD2 
1648 C CD2 B LEU A 98  ? 0.34704 0.30857 0.31698 -0.00292 0.01536  0.00525  98  LEU A CD2 
1671 N N   A SER A 99  ? 0.22108 0.19419 0.22177 0.01957  0.00527  -0.00148 99  SER A N   
1672 N N   B SER A 99  ? 0.22001 0.19344 0.22221 0.01971  0.00509  -0.00232 99  SER A N   
1673 C CA  A SER A 99  ? 0.22832 0.20983 0.23478 0.02385  0.00285  -0.00259 99  SER A CA  
1674 C CA  B SER A 99  ? 0.25358 0.23577 0.26037 0.02433  0.00261  -0.00262 99  SER A CA  
1675 C C   A SER A 99  ? 0.22415 0.21417 0.23754 0.02163  0.00467  -0.00351 99  SER A C   
1676 C C   B SER A 99  ? 0.22780 0.21815 0.24246 0.02194  0.00446  -0.00360 99  SER A C   
1677 O O   A SER A 99  ? 0.22297 0.21188 0.23955 0.01709  0.00933  -0.00557 99  SER A O   
1678 O O   B SER A 99  ? 0.22330 0.21332 0.24405 0.01820  0.00867  -0.00534 99  SER A O   
1679 C CB  A SER A 99  ? 0.24718 0.22826 0.25583 0.02227  0.00152  -0.00554 99  SER A CB  
1680 C CB  B SER A 99  ? 0.31790 0.29918 0.32475 0.02483  0.00109  -0.00528 99  SER A CB  
1681 O OG  A SER A 99  ? 0.24296 0.23165 0.25275 0.02508  -0.00074 -0.00530 99  SER A OG  
1682 O OG  B SER A 99  ? 0.28656 0.27630 0.30151 0.02030  -0.00064 -0.00565 99  SER A OG  
1693 N N   . MET A 100 ? 0.22739 0.22364 0.24299 0.02416  0.00347  -0.00272 100 MET A N   
1694 C CA  . MET A 100 ? 0.21653 0.21454 0.23746 0.02103  0.00781  -0.00401 100 MET A CA  
1695 C C   . MET A 100 ? 0.21974 0.21787 0.25288 0.02372  0.00924  -0.00138 100 MET A C   
1696 O O   . MET A 100 ? 0.24601 0.24907 0.28000 0.02671  0.00421  0.00246  100 MET A O   
1697 C CB  . MET A 100 ? 0.25596 0.26058 0.27392 0.02030  0.00678  -0.00344 100 MET A CB  
1698 C CG  . MET A 100 ? 0.26989 0.28292 0.28017 0.01650  0.00434  -0.00316 100 MET A CG  
1699 S SD  . MET A 100 ? 0.27105 0.28079 0.27245 0.00497  0.00890  -0.00776 100 MET A SD  
1700 C CE  . MET A 100 ? 0.34797 0.35290 0.35146 -0.00410 0.01802  -0.01495 100 MET A CE  
1710 N N   . ALA A 101 ? 0.22549 0.20910 0.22339 0.01637  0.00795  0.00430  101 ALA A N   
1711 C CA  . ALA A 101 ? 0.21414 0.19290 0.21065 0.02178  0.01264  0.00734  101 ALA A CA  
1712 C C   . ALA A 101 ? 0.25965 0.22872 0.25427 0.02010  0.01792  0.00836  101 ALA A C   
1713 O O   . ALA A 101 ? 0.29046 0.25727 0.28465 0.01216  0.01858  0.00446  101 ALA A O   
1714 C CB  . ALA A 101 ? 0.28205 0.25636 0.27621 0.02407  0.01626  0.00656  101 ALA A CB  
1720 N N   . ASN A 102 ? 0.27830 0.24414 0.27144 0.02684  0.02204  0.01412  102 ASN A N   
1721 C CA  . ASN A 102 ? 0.27412 0.22715 0.26395 0.02485  0.02906  0.01638  102 ASN A CA  
1722 C C   . ASN A 102 ? 0.32615 0.27231 0.31222 0.03603  0.03576  0.02528  102 ASN A C   
1723 O O   . ASN A 102 ? 0.35626 0.31370 0.34360 0.04544  0.03368  0.02944  102 ASN A O   
1724 C CB  . ASN A 102 ? 0.27058 0.23383 0.26365 0.02017  0.02536  0.01592  102 ASN A CB  
1725 C CG  . ASN A 102 ? 0.29110 0.26794 0.28580 0.02700  0.02134  0.01997  102 ASN A CG  
1726 O OD1 . ASN A 102 ? 0.31142 0.28920 0.30339 0.03465  0.02427  0.02657  102 ASN A OD1 
1727 N ND2 . ASN A 102 ? 0.27971 0.26802 0.27794 0.02469  0.01547  0.01628  102 ASN A ND2 
1734 N N   . ALA A 103 ? 0.30374 0.23272 0.28480 0.03486  0.04462  0.02887  103 ALA A N   
1735 C CA  . ALA A 103 ? 0.34626 0.26517 0.32196 0.04726  0.05334  0.04028  103 ALA A CA  
1736 C C   . ALA A 103 ? 0.34665 0.26684 0.32033 0.04697  0.05576  0.04699  103 ALA A C   
1737 O O   . ALA A 103 ? 0.44705 0.34876 0.41357 0.05297  0.06681  0.05626  103 ALA A O   
1738 C CB  . ALA A 103 ? 0.42861 0.31586 0.39645 0.04803  0.06662  0.04009  103 ALA A CB  
1744 N N   . GLY A 104 ? 0.30193 0.24286 0.28087 0.04146  0.04679  0.04341  104 GLY A N   
1745 C CA  . GLY A 104 ? 0.32349 0.26883 0.30090 0.03971  0.04874  0.04812  104 GLY A CA  
1746 C C   . GLY A 104 ? 0.29705 0.25056 0.27968 0.02684  0.04405  0.03898  104 GLY A C   
1747 O O   . GLY A 104 ? 0.29415 0.24943 0.28085 0.02015  0.03961  0.03040  104 GLY A O   
1751 N N   A PRO A 105 ? 0.29466 0.25722 0.27748 0.02436  0.04485  0.04150  105 PRO A N   
1752 N N   B PRO A 105 ? 0.30021 0.26159 0.28267 0.02438  0.04541  0.04184  105 PRO A N   
1753 C CA  A PRO A 105 ? 0.27172 0.24698 0.26075 0.01440  0.04083  0.03379  105 PRO A CA  
1754 C CA  B PRO A 105 ? 0.29593 0.26959 0.28426 0.01410  0.04201  0.03460  105 PRO A CA  
1755 C C   A PRO A 105 ? 0.26135 0.22543 0.25075 0.00112  0.04547  0.02794  105 PRO A C   
1756 C C   B PRO A 105 ? 0.27472 0.23786 0.26389 0.00087  0.04583  0.02796  105 PRO A C   
1757 O O   A PRO A 105 ? 0.34386 0.28611 0.32659 -0.00390 0.05569  0.03048  105 PRO A O   
1758 O O   B PRO A 105 ? 0.29936 0.24027 0.28193 -0.00447 0.05590  0.02989  105 PRO A O   
1759 C CB  A PRO A 105 ? 0.33356 0.31883 0.32117 0.01499  0.04377  0.03912  105 PRO A CB  
1760 C CB  B PRO A 105 ? 0.30740 0.28698 0.29310 0.01417  0.04676  0.04107  105 PRO A CB  
1761 C CG  A PRO A 105 ? 0.36833 0.33688 0.34700 0.02077  0.05295  0.05042  105 PRO A CG  
1762 C CG  B PRO A 105 ? 0.26675 0.24712 0.24630 0.02756  0.04764  0.05089  105 PRO A CG  
1763 C CD  A PRO A 105 ? 0.36730 0.32880 0.34402 0.03084  0.05113  0.05266  105 PRO A CD  
1764 C CD  B PRO A 105 ? 0.33075 0.29390 0.30741 0.03278  0.05028  0.05319  105 PRO A CD  
1779 N N   . ASN A 106 ? 0.27642 0.25568 0.27256 -0.00451 0.03873  0.02019  106 ASN A N   
1780 C CA  . ASN A 106 ? 0.26902 0.24975 0.26666 -0.01916 0.04099  0.01305  106 ASN A CA  
1781 C C   . ASN A 106 ? 0.27480 0.23037 0.26505 -0.02475 0.04770  0.00974  106 ASN A C   
1782 O O   . ASN A 106 ? 0.30916 0.25225 0.29461 -0.03877 0.05647  0.00551  106 ASN A O   
1783 C CB  . ASN A 106 ? 0.26946 0.25724 0.26787 -0.02946 0.04702  0.01392  106 ASN A CB  
1784 C CG  . ASN A 106 ? 0.26868 0.28124 0.27382 -0.02229 0.04158  0.01673  106 ASN A CG  
1785 O OD1 . ASN A 106 ? 0.26499 0.29750 0.27712 -0.01820 0.03390  0.01366  106 ASN A OD1 
1786 N ND2 . ASN A 106 ? 0.28833 0.29860 0.29020 -0.02008 0.04702  0.02325  106 ASN A ND2 
1793 N N   . THR A 107 ? 0.28246 0.23195 0.27164 -0.01530 0.04393  0.00996  107 THR A N   
1794 C CA  . THR A 107 ? 0.30118 0.22806 0.28337 -0.01783 0.05042  0.00640  107 THR A CA  
1795 C C   . THR A 107 ? 0.30590 0.24331 0.29097 -0.01695 0.04255  0.00064  107 THR A C   
1796 O O   . THR A 107 ? 0.37275 0.29635 0.35350 -0.01182 0.04530  0.00003  107 THR A O   
1797 C CB  . THR A 107 ? 0.32105 0.22577 0.29673 -0.00475 0.05800  0.01528  107 THR A CB  
1798 O OG1 . THR A 107 ? 0.32665 0.24714 0.30687 0.00949  0.04955  0.02091  107 THR A OG1 
1799 C CG2 . THR A 107 ? 0.37754 0.26791 0.34792 -0.00579 0.06789  0.02231  107 THR A CG2 
1807 N N   . ASN A 108 ? 0.27463 0.23678 0.26647 -0.02086 0.03369  -0.00275 108 ASN A N   
1808 C CA  . ASN A 108 ? 0.26838 0.24029 0.26166 -0.01988 0.02702  -0.00651 108 ASN A CA  
1809 C C   . ASN A 108 ? 0.27308 0.23839 0.26026 -0.03271 0.03180  -0.01545 108 ASN A C   
1810 O O   . ASN A 108 ? 0.30097 0.26787 0.28597 -0.04692 0.03660  -0.02117 108 ASN A O   
1811 C CB  . ASN A 108 ? 0.24510 0.24427 0.24595 -0.01904 0.01822  -0.00575 108 ASN A CB  
1812 C CG  . ASN A 108 ? 0.27157 0.27504 0.27663 -0.00737 0.01466  0.00057  108 ASN A CG  
1813 O OD1 . ASN A 108 ? 0.28802 0.28592 0.29231 0.00116  0.01213  0.00296  108 ASN A OD1 
1814 N ND2 . ASN A 108 ? 0.24529 0.25848 0.25387 -0.00836 0.01570  0.00242  108 ASN A ND2 
1821 N N   . GLY A 109 ? 0.27175 0.23186 0.25565 -0.02933 0.03082  -0.01776 109 GLY A N   
1822 C CA  . GLY A 109 ? 0.28637 0.24176 0.26297 -0.04163 0.03541  -0.02783 109 GLY A CA  
1823 C C   . GLY A 109 ? 0.28199 0.25818 0.26051 -0.03995 0.02659  -0.02883 109 GLY A C   
1824 O O   . GLY A 109 ? 0.29716 0.29982 0.28082 -0.04238 0.01888  -0.02760 109 GLY A O   
1828 N N   . SER A 110 ? 0.26442 0.22965 0.23842 -0.03495 0.02865  -0.03009 110 SER A N   
1829 C CA  . SER A 110 ? 0.23927 0.22153 0.21380 -0.03266 0.02155  -0.02959 110 SER A CA  
1830 C C   . SER A 110 ? 0.23739 0.21582 0.21519 -0.01892 0.01868  -0.02210 110 SER A C   
1831 O O   . SER A 110 ? 0.26376 0.25461 0.24202 -0.01674 0.01332  -0.01994 110 SER A O   
1832 C CB  . SER A 110 ? 0.25653 0.23519 0.22132 -0.04324 0.02700  -0.04032 110 SER A CB  
1833 O OG  . SER A 110 ? 0.29969 0.24907 0.25792 -0.03988 0.03798  -0.04374 110 SER A OG  
1839 N N   . GLN A 111 ? 0.25508 0.21799 0.23417 -0.01022 0.02294  -0.01796 111 GLN A N   
1840 C CA  . GLN A 111 ? 0.23635 0.20125 0.21843 0.00032  0.02056  -0.01234 111 GLN A CA  
1841 C C   . GLN A 111 ? 0.23449 0.21194 0.22288 0.00396  0.01266  -0.00654 111 GLN A C   
1842 O O   . GLN A 111 ? 0.24819 0.22819 0.23965 0.00360  0.01085  -0.00464 111 GLN A O   
1843 C CB  . GLN A 111 ? 0.25241 0.20329 0.23369 0.00949  0.02768  -0.00888 111 GLN A CB  
1844 C CG  . GLN A 111 ? 0.28243 0.21601 0.25608 0.00965  0.03812  -0.01399 111 GLN A CG  
1845 C CD  . GLN A 111 ? 0.31266 0.23435 0.28578 0.02304  0.04589  -0.00740 111 GLN A CD  
1846 O OE1 . GLN A 111 ? 0.35519 0.29125 0.33383 0.03309  0.04215  -0.00063 111 GLN A OE1 
1847 N NE2 . GLN A 111 ? 0.35609 0.25302 0.32232 0.02330  0.05724  -0.00846 111 GLN A NE2 
1856 N N   . PHE A 112 ? 0.23956 0.22355 0.22900 0.00693  0.00929  -0.00427 112 PHE A N   
1857 C CA  . PHE A 112 ? 0.23194 0.22254 0.22468 0.00884  0.00402  -0.00024 112 PHE A CA  
1858 C C   . PHE A 112 ? 0.24214 0.23497 0.23560 0.01148  0.00396  0.00131  112 PHE A C   
1859 O O   . PHE A 112 ? 0.23888 0.23306 0.23113 0.01242  0.00676  0.00018  112 PHE A O   
1860 C CB  . PHE A 112 ? 0.24507 0.24316 0.23633 0.00580  0.00044  0.00093  112 PHE A CB  
1861 C CG  . PHE A 112 ? 0.24507 0.24669 0.23196 0.00303  0.00086  -0.00006 112 PHE A CG  
1862 C CD1 . PHE A 112 ? 0.29442 0.29609 0.28036 0.00410  0.00037  0.00306  112 PHE A CD1 
1863 C CD2 . PHE A 112 ? 0.26564 0.27000 0.24835 -0.00224 0.00302  -0.00535 112 PHE A CD2 
1864 C CE1 . PHE A 112 ? 0.32219 0.32837 0.30389 0.00137  0.00155  0.00238  112 PHE A CE1 
1865 C CE2 . PHE A 112 ? 0.27451 0.28299 0.25225 -0.00483 0.00419  -0.00724 112 PHE A CE2 
1866 C CZ  . PHE A 112 ? 0.30992 0.32026 0.28745 -0.00234 0.00326  -0.00271 112 PHE A CZ  
1876 N N   A PHE A 113 ? 0.23785 0.23215 0.23257 0.01148  0.00146  0.00315  113 PHE A N   
1877 N N   B PHE A 113 ? 0.23570 0.23001 0.23090 0.01209  0.00163  0.00313  113 PHE A N   
1878 C CA  A PHE A 113 ? 0.21105 0.20985 0.20561 0.00973  0.00167  0.00315  113 PHE A CA  
1879 C CA  B PHE A 113 ? 0.25135 0.24997 0.24657 0.01025  0.00137  0.00313  113 PHE A CA  
1880 C C   A PHE A 113 ? 0.22103 0.21434 0.21308 0.00618  0.00088  0.00425  113 PHE A C   
1881 C C   B PHE A 113 ? 0.22355 0.21645 0.21545 0.00637  0.00080  0.00447  113 PHE A C   
1882 O O   A PHE A 113 ? 0.22105 0.20758 0.21250 0.00803  0.00039  0.00543  113 PHE A O   
1883 O O   B PHE A 113 ? 0.22697 0.21378 0.21786 0.00838  0.00005  0.00659  113 PHE A O   
1884 C CB  A PHE A 113 ? 0.18466 0.19154 0.18199 0.01222  0.00226  0.00285  113 PHE A CB  
1885 C CB  B PHE A 113 ? 0.22376 0.22613 0.22056 0.01104  0.00092  0.00233  113 PHE A CB  
1886 C CG  A PHE A 113 ? 0.22037 0.22526 0.21829 0.01356  0.00114  0.00274  113 PHE A CG  
1887 C CG  B PHE A 113 ? 0.28685 0.29452 0.28585 0.01697  0.00202  0.00390  113 PHE A CG  
1888 C CD1 A PHE A 113 ? 0.24738 0.24905 0.24626 0.01807  0.00208  0.00435  113 PHE A CD1 
1889 C CD1 B PHE A 113 ? 0.33102 0.34186 0.33079 0.02185  0.00491  0.00586  113 PHE A CD1 
1890 C CD2 A PHE A 113 ? 0.21656 0.22221 0.21293 0.00918  0.00050  0.00026  113 PHE A CD2 
1891 C CD2 B PHE A 113 ? 0.34035 0.34865 0.33953 0.01863  0.00147  0.00418  113 PHE A CD2 
1892 C CE1 A PHE A 113 ? 0.26376 0.26634 0.26285 0.01922  0.00146  0.00439  113 PHE A CE1 
1893 C CE1 B PHE A 113 ? 0.47778 0.48964 0.47801 0.02912  0.00777  0.00957  113 PHE A CE1 
1894 C CE2 A PHE A 113 ? 0.25455 0.25955 0.25030 0.01022  0.00034  -0.00110 113 PHE A CE2 
1895 C CE2 B PHE A 113 ? 0.33999 0.35246 0.33986 0.02453  0.00329  0.00760  113 PHE A CE2 
1896 C CZ  A PHE A 113 ? 0.26305 0.26798 0.26059 0.01588  0.00039  0.00147  113 PHE A CZ  
1897 C CZ  B PHE A 113 ? 0.53032 0.54352 0.53051 0.03022  0.00670  0.01106  113 PHE A CZ  
1916 N N   . ILE A 114 ? 0.21490 0.21027 0.20486 0.00154  0.00215  0.00433  114 ILE A N   
1917 C CA  . ILE A 114 ? 0.22692 0.21244 0.21233 -0.00347 0.00417  0.00561  114 ILE A CA  
1918 C C   . ILE A 114 ? 0.24326 0.23314 0.22914 -0.01000 0.00564  0.00076  114 ILE A C   
1919 O O   . ILE A 114 ? 0.24965 0.25527 0.23813 -0.01374 0.00568  -0.00124 114 ILE A O   
1920 C CB  . ILE A 114 ? 0.24804 0.23356 0.22950 -0.00684 0.00577  0.00896  114 ILE A CB  
1921 C CG1 . ILE A 114 ? 0.28796 0.27703 0.26852 -0.00174 0.00361  0.01217  114 ILE A CG1 
1922 C CG2 . ILE A 114 ? 0.31559 0.28454 0.29055 -0.01148 0.01010  0.01176  114 ILE A CG2 
1923 C CD1 . ILE A 114 ? 0.31304 0.30757 0.28938 -0.00528 0.00511  0.01448  114 ILE A CD1 
1935 N N   . CYS A 115 ? 0.27070 0.24982 0.25388 -0.01160 0.00727  -0.00176 115 CYS A N   
1936 C CA  . CYS A 115 ? 0.27647 0.26198 0.25831 -0.02077 0.00900  -0.00849 115 CYS A CA  
1937 C C   . CYS A 115 ? 0.29040 0.26977 0.26697 -0.03291 0.01374  -0.01049 115 CYS A C   
1938 O O   . CYS A 115 ? 0.33110 0.28852 0.30154 -0.03344 0.01805  -0.00663 115 CYS A O   
1939 C CB  . CYS A 115 ? 0.30173 0.27480 0.27993 -0.02031 0.01101  -0.01237 115 CYS A CB  
1940 S SG  . CYS A 115 ? 0.33902 0.32036 0.32270 -0.00851 0.00666  -0.01015 115 CYS A SG  
1946 N N   . THR A 116 ? 0.26010 0.26006 0.23835 -0.04341 0.01386  -0.01611 116 THR A N   
1947 C CA  . THR A 116 ? 0.28705 0.28336 0.25991 -0.05915 0.01943  -0.02000 116 THR A CA  
1948 C C   . THR A 116 ? 0.29610 0.29634 0.26445 -0.07379 0.02263  -0.03099 116 THR A C   
1949 O O   . THR A 116 ? 0.36591 0.36887 0.32980 -0.09138 0.02774  -0.03714 116 THR A O   
1950 C CB  . THR A 116 ? 0.33646 0.35870 0.31490 -0.06232 0.01793  -0.01790 116 THR A CB  
1951 O OG1 . THR A 116 ? 0.32051 0.37761 0.30739 -0.05873 0.01301  -0.01981 116 THR A OG1 
1952 C CG2 . THR A 116 ? 0.31771 0.33315 0.29751 -0.05085 0.01647  -0.00927 116 THR A CG2 
1960 N N   . ALA A 117 ? 0.34167 0.34060 0.30966 -0.06837 0.02071  -0.03426 117 ALA A N   
1961 C CA  . ALA A 117 ? 0.35286 0.35350 0.31451 -0.08126 0.02404  -0.04597 117 ALA A CA  
1962 C C   . ALA A 117 ? 0.32238 0.30419 0.28130 -0.06984 0.02426  -0.04581 117 ALA A C   
1963 O O   . ALA A 117 ? 0.32067 0.29849 0.28508 -0.05315 0.02017  -0.03670 117 ALA A O   
1964 C CB  . ALA A 117 ? 0.41344 0.46079 0.38154 -0.08660 0.01820  -0.05027 117 ALA A CB  
1970 N N   . LYS A 118 ? 0.35248 0.32583 0.30268 -0.08021 0.02947  -0.05709 118 LYS A N   
1971 C CA  . LYS A 118 ? 0.32358 0.28815 0.27182 -0.07002 0.02945  -0.05841 118 LYS A CA  
1972 C C   . LYS A 118 ? 0.36011 0.36336 0.31700 -0.06254 0.02012  -0.05560 118 LYS A C   
1973 O O   . LYS A 118 ? 0.37476 0.41173 0.33347 -0.07187 0.01676  -0.06005 118 LYS A O   
1974 C CB  . LYS A 118 ? 0.37399 0.31900 0.30872 -0.08417 0.03903  -0.07303 118 LYS A CB  
1975 C CG  . LYS A 118 ? 0.40952 0.34677 0.34140 -0.07416 0.04022  -0.07541 118 LYS A CG  
1976 C CD  . LYS A 118 ? 0.60056 0.51260 0.51645 -0.08842 0.05233  -0.09192 118 LYS A CD  
1977 C CE  . LYS A 118 ? 0.86084 0.77843 0.77448 -0.08025 0.05210  -0.09622 118 LYS A CE  
1978 N NZ  . LYS A 118 ? 1.01753 0.90058 0.91460 -0.08941 0.06635  -0.11119 118 LYS A NZ  
1992 N N   . THR A 119 ? 0.30144 0.30178 0.26401 -0.04531 0.01631  -0.04659 119 THR A N   
1993 C CA  . THR A 119 ? 0.27881 0.30913 0.24847 -0.03592 0.00933  -0.04114 119 THR A CA  
1994 C C   . THR A 119 ? 0.27830 0.30235 0.24536 -0.02854 0.01025  -0.04196 119 THR A C   
1995 O O   . THR A 119 ? 0.29161 0.31266 0.26417 -0.01549 0.00788  -0.03319 119 THR A O   
1996 C CB  . THR A 119 ? 0.27312 0.30794 0.25189 -0.02412 0.00503  -0.02941 119 THR A CB  
1997 O OG1 . THR A 119 ? 0.27337 0.28192 0.25289 -0.01579 0.00650  -0.02426 119 THR A OG1 
1998 C CG2 . THR A 119 ? 0.33541 0.37876 0.31673 -0.03033 0.00468  -0.02859 119 THR A CG2 
2006 N N   . GLU A 120 ? 0.31666 0.34075 0.27496 -0.03806 0.01423  -0.05315 120 GLU A N   
2007 C CA  . GLU A 120 ? 0.32057 0.33423 0.27493 -0.03148 0.01717  -0.05527 120 GLU A CA  
2008 C C   . GLU A 120 ? 0.27900 0.31911 0.23848 -0.02179 0.01146  -0.04791 120 GLU A C   
2009 O O   . GLU A 120 ? 0.30882 0.34131 0.26842 -0.01290 0.01295  -0.04525 120 GLU A O   
2010 C CB  . GLU A 120 ? 0.37602 0.38080 0.31742 -0.04540 0.02466  -0.07122 120 GLU A CB  
2011 C CG  . GLU A 120 ? 0.50763 0.54833 0.44464 -0.05908 0.02184  -0.08022 120 GLU A CG  
2012 C CD  . GLU A 120 ? 0.65324 0.71136 0.59081 -0.07471 0.02027  -0.08453 120 GLU A CD  
2013 O OE1 . GLU A 120 ? 0.55383 0.59547 0.49513 -0.07584 0.02139  -0.08024 120 GLU A OE1 
2014 O OE2 . GLU A 120 ? 0.67424 0.76828 0.60808 -0.08698 0.01789  -0.09265 120 GLU A OE2 
2021 N N   . TRP A 121 ? 0.27913 0.35079 0.24278 -0.02226 0.00584  -0.04326 121 TRP A N   
2022 C CA  . TRP A 121 ? 0.26959 0.36301 0.23671 -0.01121 0.00215  -0.03361 121 TRP A CA  
2023 C C   . TRP A 121 ? 0.27667 0.35423 0.25129 0.00232  0.00155  -0.02148 121 TRP A C   
2024 O O   . TRP A 121 ? 0.31993 0.40641 0.29586 0.01109  0.00098  -0.01339 121 TRP A O   
2025 C CB  . TRP A 121 ? 0.30019 0.43235 0.26968 -0.01178 -0.00243 -0.02926 121 TRP A CB  
2026 C CG  . TRP A 121 ? 0.26891 0.40215 0.24557 -0.00978 -0.00416 -0.02370 121 TRP A CG  
2027 C CD1 . TRP A 121 ? 0.27116 0.40265 0.25482 0.00375  -0.00518 -0.01099 121 TRP A CD1 
2028 C CD2 . TRP A 121 ? 0.23902 0.37354 0.21572 -0.02229 -0.00368 -0.03109 121 TRP A CD2 
2029 N NE1 . TRP A 121 ? 0.29103 0.42474 0.27919 0.00176  -0.00576 -0.01023 121 TRP A NE1 
2030 C CE2 . TRP A 121 ? 0.27678 0.41357 0.26141 -0.01421 -0.00523 -0.02176 121 TRP A CE2 
2031 C CE3 . TRP A 121 ? 0.28888 0.42268 0.25851 -0.04094 -0.00084 -0.04539 121 TRP A CE3 
2032 C CZ2 . TRP A 121 ? 0.29636 0.43780 0.28316 -0.02307 -0.00492 -0.02516 121 TRP A CZ2 
2033 C CZ3 . TRP A 121 ? 0.36960 0.50563 0.34111 -0.05119 -0.00004 -0.04859 121 TRP A CZ3 
2034 C CH2 . TRP A 121 ? 0.33896 0.48121 0.31950 -0.04186 -0.00258 -0.03808 121 TRP A CH2 
2045 N N   . LEU A 122 ? 0.24225 0.29681 0.22050 0.00308  0.00249  -0.02035 122 LEU A N   
2046 C CA  . LEU A 122 ? 0.24807 0.28897 0.23208 0.01231  0.00240  -0.01182 122 LEU A CA  
2047 C C   . LEU A 122 ? 0.26441 0.28928 0.24772 0.01525  0.00527  -0.01328 122 LEU A C   
2048 O O   . LEU A 122 ? 0.25537 0.27491 0.24341 0.02099  0.00520  -0.00709 122 LEU A O   
2049 C CB  . LEU A 122 ? 0.25734 0.28878 0.24519 0.01167  0.00149  -0.00952 122 LEU A CB  
2050 C CG  . LEU A 122 ? 0.27879 0.32856 0.26875 0.01063  -0.00059 -0.00718 122 LEU A CG  
2051 C CD1 . LEU A 122 ? 0.35047 0.38802 0.34303 0.00927  -0.00046 -0.00624 122 LEU A CD1 
2052 C CD2 . LEU A 122 ? 0.30225 0.36574 0.29454 0.02035  -0.00091 0.00170  122 LEU A CD2 
2064 N N   . ASP A 123 ? 0.25013 0.31086 0.22480 -0.01390 0.00943  -0.00412 123 ASP A N   
2065 C CA  . ASP A 123 ? 0.24157 0.27876 0.21995 -0.01826 0.01879  -0.01357 123 ASP A CA  
2066 C C   . ASP A 123 ? 0.26595 0.30281 0.24124 -0.01712 0.01868  -0.00524 123 ASP A C   
2067 O O   . ASP A 123 ? 0.29843 0.35831 0.26115 -0.02222 0.01637  0.00281  123 ASP A O   
2068 C CB  . ASP A 123 ? 0.29565 0.33587 0.26646 -0.03643 0.03180  -0.03085 123 ASP A CB  
2069 C CG  . ASP A 123 ? 0.31541 0.34270 0.28838 -0.03870 0.03832  -0.04118 123 ASP A CG  
2070 O OD1 . ASP A 123 ? 0.30685 0.32299 0.28831 -0.02564 0.03153  -0.03509 123 ASP A OD1 
2071 O OD2 . ASP A 123 ? 0.35600 0.38301 0.31934 -0.05678 0.05334  -0.05728 123 ASP A OD2 
2076 N N   . GLY A 124 ? 0.26274 0.27716 0.24875 -0.01092 0.02136  -0.00617 124 GLY A N   
2077 C CA  . GLY A 124 ? 0.27497 0.28462 0.25839 -0.01212 0.02404  -0.00120 124 GLY A CA  
2078 C C   . GLY A 124 ? 0.27773 0.28051 0.25758 -0.00243 0.01975  0.01434  124 GLY A C   
2079 O O   . GLY A 124 ? 0.31674 0.31099 0.29116 -0.00475 0.02477  0.01910  124 GLY A O   
2083 N N   A LYS A 125 ? 0.25835 0.26214 0.24008 0.00791  0.01365  0.02233  125 LYS A N   
2084 N N   B LYS A 125 ? 0.25739 0.26111 0.23924 0.00788  0.01364  0.02218  125 LYS A N   
2085 C CA  A LYS A 125 ? 0.27891 0.26955 0.25903 0.01962  0.01435  0.03704  125 LYS A CA  
2086 C CA  B LYS A 125 ? 0.27732 0.26886 0.25708 0.01954  0.01424  0.03729  125 LYS A CA  
2087 C C   A LYS A 125 ? 0.26618 0.23734 0.25741 0.02505  0.01447  0.03185  125 LYS A C   
2088 C C   B LYS A 125 ? 0.27922 0.25145 0.26988 0.02584  0.01422  0.03309  125 LYS A C   
2089 O O   A LYS A 125 ? 0.27631 0.22563 0.26701 0.02799  0.02141  0.03573  125 LYS A O   
2090 O O   B LYS A 125 ? 0.27903 0.22985 0.26843 0.03067  0.02113  0.03938  125 LYS A O   
2091 C CB  A LYS A 125 ? 0.36506 0.37971 0.33898 0.02905  0.00925  0.05338  125 LYS A CB  
2092 C CB  B LYS A 125 ? 0.36150 0.37868 0.33399 0.02803  0.00924  0.05382  125 LYS A CB  
2093 C CG  A LYS A 125 ? 0.57385 0.61660 0.53369 0.02369  0.00818  0.06298  125 LYS A CG  
2094 C CG  B LYS A 125 ? 0.53646 0.53898 0.50853 0.04555  0.01386  0.07384  125 LYS A CG  
2095 C CD  A LYS A 125 ? 0.72823 0.80992 0.68540 0.03316  0.00078  0.07942  125 LYS A CD  
2096 C CD  B LYS A 125 ? 0.74528 0.78333 0.71565 0.05823  0.00797  0.09279  125 LYS A CD  
2097 C CE  A LYS A 125 ? 0.79092 0.85821 0.75779 0.05552  0.00252  0.09557  125 LYS A CE  
2098 C CE  B LYS A 125 ? 0.76528 0.84670 0.72343 0.04730  0.00152  0.09583  125 LYS A CE  
2099 N NZ  A LYS A 125 ? 0.80293 0.91589 0.77131 0.06834  -0.00428 0.11457  125 LYS A NZ  
2100 N NZ  B LYS A 125 ? 0.83875 0.96617 0.79480 0.06055  -0.00471 0.11913  125 LYS A NZ  
2127 N N   . HIS A 126 ? 0.25787 0.23581 0.25674 0.02452  0.00898  0.02270  126 HIS A N   
2128 C CA  . HIS A 126 ? 0.24833 0.21402 0.25542 0.02783  0.00785  0.01795  126 HIS A CA  
2129 C C   . HIS A 126 ? 0.24294 0.21066 0.25806 0.02244  0.00653  0.00665  126 HIS A C   
2130 O O   . HIS A 126 ? 0.26580 0.24210 0.28136 0.01969  0.00651  0.00197  126 HIS A O   
2131 C CB  . HIS A 126 ? 0.24087 0.21494 0.24912 0.03470  0.00304  0.02102  126 HIS A CB  
2132 C CG  . HIS A 126 ? 0.24480 0.22164 0.24979 0.04506  0.00529  0.03566  126 HIS A CG  
2133 N ND1 . HIS A 126 ? 0.26035 0.21615 0.26793 0.05328  0.01260  0.04115  126 HIS A ND1 
2134 C CD2 . HIS A 126 ? 0.26455 0.26385 0.26379 0.04974  0.00347  0.04825  126 HIS A CD2 
2135 C CE1 . HIS A 126 ? 0.30129 0.26299 0.30702 0.06628  0.01618  0.05833  126 HIS A CE1 
2136 N NE2 . HIS A 126 ? 0.31515 0.30749 0.31581 0.06485  0.00893  0.06438  126 HIS A NE2 
2144 N N   . VAL A 127 ? 0.24016 0.20179 0.26134 0.02049  0.00756  0.00261  127 VAL A N   
2145 C CA  . VAL A 127 ? 0.22548 0.19714 0.25691 0.01896  0.00590  -0.00343 127 VAL A CA  
2146 C C   . VAL A 127 ? 0.22669 0.20064 0.26070 0.02421  0.00088  -0.00344 127 VAL A C   
2147 O O   . VAL A 127 ? 0.24970 0.22062 0.28184 0.02410  -0.00182 -0.00335 127 VAL A O   
2148 C CB  . VAL A 127 ? 0.23042 0.20686 0.26677 0.01212  0.00811  -0.00761 127 VAL A CB  
2149 C CG1 . VAL A 127 ? 0.25272 0.25092 0.30260 0.01405  0.00500  -0.00965 127 VAL A CG1 
2150 C CG2 . VAL A 127 ? 0.25810 0.22897 0.29015 0.00486  0.01592  -0.00871 127 VAL A CG2 
2160 N N   . VAL A 128 ? 0.23392 0.21015 0.27113 0.02748  0.00267  -0.00428 128 VAL A N   
2161 C CA  . VAL A 128 ? 0.21633 0.19013 0.25454 0.03270  0.00166  -0.00306 128 VAL A CA  
2162 C C   . VAL A 128 ? 0.24524 0.23162 0.29429 0.03794  -0.00054 0.00095  128 VAL A C   
2163 O O   . VAL A 128 ? 0.26228 0.25980 0.32179 0.04017  0.00255  0.00174  128 VAL A O   
2164 C CB  . VAL A 128 ? 0.23570 0.20062 0.27041 0.03246  0.01038  -0.00627 128 VAL A CB  
2165 C CG1 . VAL A 128 ? 0.27517 0.23049 0.30956 0.03846  0.01385  -0.00368 128 VAL A CG1 
2166 C CG2 . VAL A 128 ? 0.27789 0.24410 0.30104 0.02450  0.01023  -0.01013 128 VAL A CG2 
2176 N N   . PHE A 129 ? 0.22116 0.21162 0.26808 0.03939  -0.00617 0.00404  129 PHE A N   
2177 C CA  . PHE A 129 ? 0.22373 0.23790 0.27951 0.04279  -0.01064 0.00981  129 PHE A CA  
2178 C C   . PHE A 129 ? 0.22027 0.23644 0.27282 0.05008  -0.01326 0.01837  129 PHE A C   
2179 O O   . PHE A 129 ? 0.24583 0.28956 0.30534 0.05463  -0.01810 0.02696  129 PHE A O   
2180 C CB  . PHE A 129 ? 0.23321 0.26315 0.28767 0.02994  -0.01511 0.00357  129 PHE A CB  
2181 C CG  . PHE A 129 ? 0.24181 0.25901 0.28408 0.02200  -0.01644 -0.00144 129 PHE A CG  
2182 C CD1 . PHE A 129 ? 0.23167 0.22485 0.26660 0.01960  -0.01198 -0.00579 129 PHE A CD1 
2183 C CD2 . PHE A 129 ? 0.26104 0.29423 0.29979 0.01802  -0.02144 -0.00023 129 PHE A CD2 
2184 C CE1 . PHE A 129 ? 0.27162 0.25348 0.29875 0.01537  -0.01059 -0.00939 129 PHE A CE1 
2185 C CE2 . PHE A 129 ? 0.27743 0.29805 0.30536 0.00968  -0.02015 -0.00660 129 PHE A CE2 
2186 C CZ  . PHE A 129 ? 0.28727 0.28076 0.31068 0.00913  -0.01383 -0.01157 129 PHE A CZ  
2196 N N   . GLY A 130 ? 0.24612 0.23834 0.28822 0.05117  -0.00957 0.01749  130 GLY A N   
2197 C CA  . GLY A 130 ? 0.28286 0.27285 0.31985 0.05803  -0.00937 0.02677  130 GLY A CA  
2198 C C   . GLY A 130 ? 0.28941 0.24928 0.31442 0.05618  -0.00091 0.02224  130 GLY A C   
2199 O O   . GLY A 130 ? 0.29037 0.23819 0.31249 0.04966  0.00382  0.01233  130 GLY A O   
2203 N N   A LYS A 131 ? 0.28891 0.24072 0.30547 0.06026  0.00136  0.02978  131 LYS A N   
2204 N N   B LYS A 131 ? 0.29028 0.24162 0.30729 0.06088  0.00193  0.03014  131 LYS A N   
2205 N N   C LYS A 131 ? 0.28815 0.23981 0.30470 0.06023  0.00142  0.02969  131 LYS A N   
2206 C CA  A LYS A 131 ? 0.29585 0.21873 0.29940 0.05651  0.01264  0.02496  131 LYS A CA  
2207 C CA  B LYS A 131 ? 0.32895 0.25313 0.33231 0.05530  0.01153  0.02384  131 LYS A CA  
2208 C CA  C LYS A 131 ? 0.30277 0.22647 0.30615 0.05530  0.01185  0.02370  131 LYS A CA  
2209 C C   A LYS A 131 ? 0.30151 0.22153 0.29277 0.05571  0.01044  0.03101  131 LYS A C   
2210 C C   B LYS A 131 ? 0.25952 0.18376 0.25138 0.05399  0.00781  0.02948  131 LYS A C   
2211 C C   C LYS A 131 ? 0.30468 0.22455 0.29606 0.05552  0.01051  0.03063  131 LYS A C   
2212 O O   A LYS A 131 ? 0.27775 0.21022 0.27000 0.06568  0.00690  0.04665  131 LYS A O   
2213 O O   B LYS A 131 ? 0.30363 0.24680 0.29723 0.06055  0.00062  0.04211  131 LYS A O   
2214 O O   C LYS A 131 ? 0.27766 0.20926 0.27043 0.06602  0.00751  0.04651  131 LYS A O   
2215 C CB  A LYS A 131 ? 0.32550 0.22423 0.33047 0.06520  0.03083  0.02930  131 LYS A CB  
2216 C CB  B LYS A 131 ? 0.33666 0.23392 0.33900 0.06175  0.03043  0.02617  131 LYS A CB  
2217 C CB  C LYS A 131 ? 0.31617 0.21494 0.32005 0.06131  0.03012  0.02501  131 LYS A CB  
2218 C CG  A LYS A 131 ? 0.32530 0.19103 0.31395 0.05789  0.04746  0.02277  131 LYS A CG  
2219 C CG  B LYS A 131 ? 0.31795 0.20648 0.32179 0.07965  0.03883  0.04598  131 LYS A CG  
2220 C CG  C LYS A 131 ? 0.36423 0.23735 0.35356 0.04835  0.04397  0.01163  131 LYS A CG  
2221 C CD  A LYS A 131 ? 0.41636 0.25504 0.40468 0.05714  0.06996  0.01667  131 LYS A CD  
2222 C CD  B LYS A 131 ? 0.40599 0.25554 0.40661 0.08565  0.06510  0.04695  131 LYS A CD  
2223 C CD  C LYS A 131 ? 0.39826 0.24598 0.38738 0.04928  0.06576  0.00811  131 LYS A CD  
2224 C CE  A LYS A 131 ? 0.43392 0.24938 0.40422 0.03728  0.08578  -0.00124 131 LYS A CE  
2225 C CE  B LYS A 131 ? 0.54689 0.39052 0.55482 0.11036  0.07499  0.07186  131 LYS A CE  
2226 C CE  C LYS A 131 ? 0.43937 0.26853 0.41242 0.02926  0.08119  -0.01035 131 LYS A CE  
2227 N NZ  A LYS A 131 ? 0.42392 0.26748 0.39117 0.02094  0.06950  -0.01496 131 LYS A NZ  
2228 N NZ  B LYS A 131 ? 0.65694 0.45471 0.66237 0.11530  0.10642  0.06996  131 LYS A NZ  
2229 N NZ  C LYS A 131 ? 0.47354 0.27827 0.44502 0.02523  0.10529  -0.01811 131 LYS A NZ  
2269 N N   . VAL A 132 ? 0.30835 0.21613 0.28801 0.04380  0.01308  0.01951  132 VAL A N   
2270 C CA  . VAL A 132 ? 0.31762 0.21770 0.28310 0.04098  0.01447  0.02348  132 VAL A CA  
2271 C C   . VAL A 132 ? 0.35276 0.23035 0.31136 0.05335  0.02797  0.03946  132 VAL A C   
2272 O O   . VAL A 132 ? 0.38948 0.23948 0.34653 0.05602  0.04539  0.03780  132 VAL A O   
2273 C CB  . VAL A 132 ? 0.32464 0.21473 0.28066 0.02630  0.01942  0.00728  132 VAL A CB  
2274 C CG1 . VAL A 132 ? 0.36156 0.23944 0.30064 0.02182  0.02400  0.01058  132 VAL A CG1 
2275 C CG2 . VAL A 132 ? 0.34503 0.25648 0.30912 0.01912  0.00875  -0.00378 132 VAL A CG2 
2285 N N   . LYS A 133 ? 0.32695 0.21589 0.28004 0.06086  0.02235  0.05609  133 LYS A N   
2286 C CA  . LYS A 133 ? 0.41275 0.28094 0.35771 0.07642  0.03578  0.07722  133 LYS A CA  
2287 C C   . LYS A 133 ? 0.41211 0.25560 0.33371 0.06720  0.04450  0.07635  133 LYS A C   
2288 O O   . LYS A 133 ? 0.52890 0.33149 0.43857 0.07111  0.06639  0.08110  133 LYS A O   
2289 C CB  . LYS A 133 ? 0.46903 0.37546 0.42412 0.09349  0.02354  0.10122  133 LYS A CB  
2290 C CG  . LYS A 133 ? 0.62478 0.51935 0.57320 0.11517  0.03523  0.13073  133 LYS A CG  
2291 C CD  . LYS A 133 ? 0.82094 0.77290 0.78288 0.13028  0.01840  0.15391  133 LYS A CD  
2292 C CE  . LYS A 133 ? 0.94667 0.89623 0.90839 0.15899  0.02986  0.18947  133 LYS A CE  
2293 N NZ  . LYS A 133 ? 0.98174 1.00308 0.95408 0.16422  0.00925  0.20612  133 LYS A NZ  
2307 N N   . GLU A 134 ? 0.39424 0.26035 0.30784 0.05626  0.03068  0.07319  134 GLU A N   
2308 C CA  . GLU A 134 ? 0.39245 0.23910 0.28372 0.04495  0.03807  0.07036  134 GLU A CA  
2309 C C   . GLU A 134 ? 0.36529 0.22367 0.25722 0.02387  0.03044  0.04457  134 GLU A C   
2310 O O   . GLU A 134 ? 0.35980 0.24713 0.26559 0.02030  0.01617  0.03636  134 GLU A O   
2311 C CB  . GLU A 134 ? 0.47752 0.34347 0.35575 0.05005  0.03033  0.09148  134 GLU A CB  
2312 C CG  . GLU A 134 ? 0.63225 0.49753 0.51255 0.07561  0.03588  0.12296  134 GLU A CG  
2313 C CD  . GLU A 134 ? 0.74069 0.63921 0.60852 0.08021  0.02470  0.14609  134 GLU A CD  
2314 O OE1 . GLU A 134 ? 0.73388 0.68415 0.60952 0.07252  0.00418  0.14305  134 GLU A OE1 
2315 O OE2 . GLU A 134 ? 0.75994 0.63210 0.60854 0.08946  0.03835  0.16618  134 GLU A OE2 
2322 N N   . GLY A 135 ? 0.40323 0.23851 0.28016 0.01037  0.04247  0.03255  135 GLY A N   
2323 C CA  . GLY A 135 ? 0.37239 0.22332 0.25208 -0.00674 0.03662  0.01074  135 GLY A CA  
2324 C C   . GLY A 135 ? 0.35820 0.21502 0.25301 -0.01226 0.03774  -0.00755 135 GLY A C   
2325 O O   . GLY A 135 ? 0.34458 0.22375 0.24968 -0.01875 0.02952  -0.01995 135 GLY A O   
2329 N N   . MET A 136 ? 0.37351 0.24390 0.23946 -0.03144 0.01459  0.01765  136 MET A N   
2330 C CA  . MET A 136 ? 0.40380 0.27051 0.25932 -0.03195 0.01116  0.02185  136 MET A CA  
2331 C C   . MET A 136 ? 0.37628 0.25512 0.24405 -0.04324 0.00102  0.02836  136 MET A C   
2332 O O   . MET A 136 ? 0.38052 0.26699 0.25260 -0.04338 -0.00033 0.03208  136 MET A O   
2333 C CB  . MET A 136 ? 0.47404 0.30993 0.29207 -0.02482 0.00340  0.01833  136 MET A CB  
2334 C CG  . MET A 136 ? 0.49764 0.32333 0.29593 -0.01703 0.00020  0.02079  136 MET A CG  
2335 S SD  . MET A 136 ? 0.49700 0.33648 0.30557 -0.00269 0.02538  0.02828  136 MET A SD  
2336 C CE  . MET A 136 ? 0.55112 0.38359 0.34164 -0.00064 0.01397  0.03091  136 MET A CE  
2346 N N   . ASN A 137 ? 0.37604 0.25916 0.25363 -0.05118 -0.00392 0.03260  137 ASN A N   
2347 C CA  . ASN A 137 ? 0.40031 0.30165 0.30131 -0.06033 -0.00867 0.04513  137 ASN A CA  
2348 C C   . ASN A 137 ? 0.33714 0.26524 0.25508 -0.05409 0.00342  0.04922  137 ASN A C   
2349 O O   . ASN A 137 ? 0.35154 0.29667 0.28772 -0.05842 0.00075  0.05944  137 ASN A O   
2350 C CB  . ASN A 137 ? 0.38396 0.28585 0.29523 -0.06630 -0.00990 0.05424  137 ASN A CB  
2351 C CG  . ASN A 137 ? 0.35913 0.26353 0.26223 -0.05497 0.00396  0.04982  137 ASN A CG  
2352 O OD1 . ASN A 137 ? 0.41288 0.30369 0.29911 -0.04773 0.00583  0.03627  137 ASN A OD1 
2353 N ND2 . ASN A 137 ? 0.39472 0.31581 0.31029 -0.05035 0.01358  0.06288  137 ASN A ND2 
2360 N N   . ILE A 138 ? 0.31857 0.24836 0.23277 -0.04315 0.01319  0.04125  138 ILE A N   
2361 C CA  . ILE A 138 ? 0.31554 0.26231 0.24070 -0.03395 0.01938  0.04198  138 ILE A CA  
2362 C C   . ILE A 138 ? 0.33225 0.28091 0.26102 -0.03479 0.01876  0.04051  138 ILE A C   
2363 O O   . ILE A 138 ? 0.31873 0.28257 0.25710 -0.03235 0.01966  0.04548  138 ILE A O   
2364 C CB  . ILE A 138 ? 0.30694 0.24744 0.22883 -0.02068 0.02167  0.03212  138 ILE A CB  
2365 C CG1 . ILE A 138 ? 0.35187 0.28792 0.26255 -0.01501 0.02343  0.03452  138 ILE A CG1 
2366 C CG2 . ILE A 138 ? 0.36178 0.31136 0.29117 -0.00785 0.02138  0.02982  138 ILE A CG2 
2367 C CD1 . ILE A 138 ? 0.35479 0.30788 0.26826 -0.01041 0.03069  0.05082  138 ILE A CD1 
2379 N N   . VAL A 139 ? 0.31393 0.24665 0.23261 -0.03524 0.01910  0.03563  139 VAL A N   
2380 C CA  . VAL A 139 ? 0.30597 0.23674 0.22149 -0.03308 0.02088  0.03789  139 VAL A CA  
2381 C C   . VAL A 139 ? 0.34716 0.27977 0.25680 -0.03924 0.01024  0.04306  139 VAL A C   
2382 O O   . VAL A 139 ? 0.35566 0.29720 0.27048 -0.03728 0.01009  0.04642  139 VAL A O   
2383 C CB  . VAL A 139 ? 0.33857 0.25045 0.23878 -0.02638 0.02752  0.03620  139 VAL A CB  
2384 C CG1 . VAL A 139 ? 0.37078 0.27714 0.26053 -0.01863 0.03318  0.04191  139 VAL A CG1 
2385 C CG2 . VAL A 139 ? 0.37568 0.29023 0.29661 -0.02151 0.03634  0.03396  139 VAL A CG2 
2395 N N   . GLU A 140 ? 0.34469 0.26709 0.24716 -0.04682 -0.00190 0.04393  140 GLU A N   
2396 C CA  . GLU A 140 ? 0.35680 0.27977 0.26533 -0.05430 -0.01883 0.04952  140 GLU A CA  
2397 C C   . GLU A 140 ? 0.36323 0.31919 0.30524 -0.05813 -0.01482 0.06074  140 GLU A C   
2398 O O   . GLU A 140 ? 0.37029 0.33486 0.32277 -0.05963 -0.02301 0.06535  140 GLU A O   
2399 C CB  . GLU A 140 ? 0.39002 0.29410 0.29511 -0.06309 -0.03681 0.04973  140 GLU A CB  
2400 C CG  . GLU A 140 ? 0.48056 0.34673 0.34285 -0.05360 -0.04386 0.03806  140 GLU A CG  
2401 C CD  . GLU A 140 ? 0.72364 0.56535 0.57892 -0.06067 -0.06343 0.03585  140 GLU A CD  
2402 O OE1 . GLU A 140 ? 0.67717 0.53384 0.56425 -0.07395 -0.06501 0.04507  140 GLU A OE1 
2403 O OE2 . GLU A 140 ? 0.68794 0.49281 0.50257 -0.04975 -0.07623 0.02595  140 GLU A OE2 
2410 N N   . ALA A 141 ? 0.32707 0.29988 0.28188 -0.05546 -0.00189 0.06526  141 ALA A N   
2411 C CA  . ALA A 141 ? 0.31924 0.32181 0.29785 -0.05133 0.00600  0.07781  141 ALA A CA  
2412 C C   . ALA A 141 ? 0.34897 0.35882 0.32297 -0.04111 0.01114  0.07288  141 ALA A C   
2413 O O   . ALA A 141 ? 0.36987 0.39951 0.35999 -0.03933 0.01074  0.08193  141 ALA A O   
2414 C CB  . ALA A 141 ? 0.32817 0.33848 0.30718 -0.04262 0.01903  0.08278  141 ALA A CB  
2420 N N   . MET A 142 ? 0.34671 0.34114 0.30418 -0.03442 0.01526  0.06039  142 MET A N   
2421 C CA  . MET A 142 ? 0.31363 0.30994 0.27099 -0.02621 0.01782  0.05669  142 MET A CA  
2422 C C   . MET A 142 ? 0.36157 0.35708 0.31656 -0.03030 0.01159  0.05983  142 MET A C   
2423 O O   . MET A 142 ? 0.34017 0.34623 0.30061 -0.02486 0.01190  0.06232  142 MET A O   
2424 C CB  . MET A 142 ? 0.35486 0.33370 0.30812 -0.02197 0.02154  0.04752  142 MET A CB  
2425 C CG  . MET A 142 ? 0.39604 0.37250 0.35244 -0.01506 0.02193  0.04173  142 MET A CG  
2426 S SD  . MET A 142 ? 0.45842 0.41636 0.42525 -0.01437 0.02341  0.03448  142 MET A SD  
2427 C CE  . MET A 142 ? 0.37437 0.33354 0.35717 -0.01086 0.02396  0.03792  142 MET A CE  
2437 N N   . GLU A 143 ? 0.36817 0.34590 0.30925 -0.03663 0.00364  0.05812  143 GLU A N   
2438 C CA  . GLU A 143 ? 0.42012 0.38644 0.34744 -0.03514 -0.00596 0.05807  143 GLU A CA  
2439 C C   . GLU A 143 ? 0.42181 0.40862 0.37060 -0.03919 -0.01648 0.06558  143 GLU A C   
2440 O O   . GLU A 143 ? 0.47303 0.45792 0.41544 -0.03409 -0.02161 0.06549  143 GLU A O   
2441 C CB  . GLU A 143 ? 0.49318 0.42988 0.39414 -0.03605 -0.01766 0.05302  143 GLU A CB  
2442 C CG  . GLU A 143 ? 0.64885 0.55991 0.51568 -0.02368 -0.02073 0.04967  143 GLU A CG  
2443 C CD  . GLU A 143 ? 0.50898 0.38426 0.33980 -0.01813 -0.03627 0.04302  143 GLU A CD  
2444 O OE1 . GLU A 143 ? 0.57306 0.44417 0.41122 -0.02787 -0.04697 0.04081  143 GLU A OE1 
2445 O OE2 . GLU A 143 ? 0.55607 0.40453 0.34775 -0.00112 -0.03741 0.04051  143 GLU A OE2 
2452 N N   . ARG A 144 ? 0.38220 0.39046 0.35957 -0.04664 -0.01807 0.07482  144 ARG A N   
2453 C CA  . ARG A 144 ? 0.40321 0.43707 0.41310 -0.05017 -0.02559 0.08743  144 ARG A CA  
2454 C C   . ARG A 144 ? 0.41415 0.47001 0.42955 -0.03829 -0.01354 0.09090  144 ARG A C   
2455 O O   . ARG A 144 ? 0.45854 0.53476 0.49790 -0.03829 -0.01974 0.10058  144 ARG A O   
2456 C CB  . ARG A 144 ? 0.53787 0.59002 0.58156 -0.05900 -0.02466 0.10225  144 ARG A CB  
2457 C CG  . ARG A 144 ? 0.80720 0.83137 0.84447 -0.07117 -0.04245 0.09731  144 ARG A CG  
2458 C CD  . ARG A 144 ? 0.98017 1.02015 1.06119 -0.08339 -0.04703 0.11583  144 ARG A CD  
2459 N NE  . ARG A 144 ? 1.08434 1.09562 1.14843 -0.09033 -0.05516 0.10876  144 ARG A NE  
2460 C CZ  . ARG A 144 ? 1.08658 1.10255 1.15192 -0.08990 -0.03914 0.11476  144 ARG A CZ  
2461 N NH1 . ARG A 144 ? 1.13899 1.12594 1.18672 -0.09583 -0.04934 0.10688  144 ARG A NH1 
2462 N NH2 . ARG A 144 ? 0.98481 1.03079 1.06349 -0.07994 -0.01398 0.12825  144 ARG A NH2 
2476 N N   . PHE A 145 ? 0.33782 0.38756 0.33385 -0.02752 -0.00011 0.08287  145 PHE A N   
2477 C CA  . PHE A 145 ? 0.30608 0.36756 0.30156 -0.01425 0.00615  0.08317  145 PHE A CA  
2478 C C   . PHE A 145 ? 0.33478 0.37815 0.31292 -0.01169 0.00196  0.07543  145 PHE A C   
2479 O O   . PHE A 145 ? 0.35287 0.40007 0.32902 -0.00112 0.00503  0.07437  145 PHE A O   
2480 C CB  . PHE A 145 ? 0.32392 0.38450 0.31107 -0.00099 0.01686  0.07888  145 PHE A CB  
2481 C CG  . PHE A 145 ? 0.34520 0.42258 0.34205 0.00339  0.02490  0.08937  145 PHE A CG  
2482 C CD1 . PHE A 145 ? 0.38815 0.49463 0.40219 0.01342  0.03224  0.10583  145 PHE A CD1 
2483 C CD2 . PHE A 145 ? 0.34071 0.40564 0.33085 -0.00098 0.02710  0.08570  145 PHE A CD2 
2484 C CE1 . PHE A 145 ? 0.42973 0.55268 0.45409 0.02052  0.04476  0.12133  145 PHE A CE1 
2485 C CE2 . PHE A 145 ? 0.37442 0.45289 0.37115 0.00522  0.03688  0.09814  145 PHE A CE2 
2486 C CZ  . PHE A 145 ? 0.39440 0.50108 0.40792 0.01606  0.04663  0.11673  145 PHE A CZ  
2496 N N   . GLY A 146 ? 0.30898 0.41713 0.33328 -0.02834 0.02437  0.03337  146 GLY A N   
2497 C CA  . GLY A 146 ? 0.27198 0.36313 0.29556 -0.01016 0.02024  0.02869  146 GLY A CA  
2498 C C   . GLY A 146 ? 0.27924 0.41828 0.31469 -0.00629 0.01666  0.02899  146 GLY A C   
2499 O O   . GLY A 146 ? 0.29427 0.48779 0.34085 -0.01615 0.01840  0.03113  146 GLY A O   
2503 N N   . SER A 147 ? 0.26843 0.39035 0.30057 0.00548  0.01086  0.02798  147 SER A N   
2504 C CA  . SER A 147 ? 0.27063 0.43574 0.31237 0.01258  0.00533  0.02887  147 SER A CA  
2505 C C   . SER A 147 ? 0.27430 0.40983 0.30700 0.01275  -0.00163 0.03059  147 SER A C   
2506 O O   . SER A 147 ? 0.27533 0.36213 0.29524 0.01025  -0.00126 0.03021  147 SER A O   
2507 C CB  . SER A 147 ? 0.28346 0.47928 0.33102 0.04526  0.00490  0.02532  147 SER A CB  
2508 O OG  . SER A 147 ? 0.29851 0.44356 0.33197 0.06788  0.00124  0.02432  147 SER A OG  
2514 N N   . ARG A 148 ? 0.27743 0.45035 0.31677 0.01523  -0.00819 0.03252  148 ARG A N   
2515 C CA  . ARG A 148 ? 0.28251 0.43537 0.31165 0.01115  -0.01485 0.03467  148 ARG A CA  
2516 C C   . ARG A 148 ? 0.29525 0.40422 0.30840 0.03049  -0.01776 0.03917  148 ARG A C   
2517 O O   . ARG A 148 ? 0.31319 0.39369 0.31352 0.02049  -0.01947 0.04057  148 ARG A O   
2518 C CB  . ARG A 148 ? 0.28680 0.49110 0.32433 0.01286  -0.02280 0.03709  148 ARG A CB  
2519 C CG  . ARG A 148 ? 0.29062 0.53811 0.34012 -0.01487 -0.02343 0.03335  148 ARG A CG  
2520 C CD  . ARG A 148 ? 0.36270 0.57975 0.40213 -0.04033 -0.02547 0.02787  148 ARG A CD  
2521 N NE  . ARG A 148 ? 0.34022 0.54519 0.36741 -0.03297 -0.03119 0.02886  148 ARG A NE  
2522 C CZ  . ARG A 148 ? 0.33711 0.58020 0.36530 -0.03510 -0.03930 0.02997  148 ARG A CZ  
2523 N NH1 . ARG A 148 ? 0.33305 0.63208 0.37585 -0.04412 -0.04313 0.02917  148 ARG A NH1 
2524 N NH2 . ARG A 148 ? 0.30609 0.53492 0.31909 -0.02992 -0.04391 0.03272  148 ARG A NH2 
2538 N N   . ASN A 149 ? 0.30835 0.41268 0.32040 0.05735  -0.01962 0.04092  149 ASN A N   
2539 C CA  . ASN A 149 ? 0.33085 0.38362 0.32358 0.07210  -0.02501 0.04669  149 ASN A CA  
2540 C C   . ASN A 149 ? 0.32908 0.33610 0.31275 0.06749  -0.01780 0.04259  149 ASN A C   
2541 O O   . ASN A 149 ? 0.40968 0.37137 0.37581 0.07439  -0.02225 0.04718  149 ASN A O   
2542 C CB  . ASN A 149 ? 0.35914 0.41728 0.35016 0.10592  -0.03544 0.05005  149 ASN A CB  
2543 C CG  . ASN A 149 ? 0.43726 0.51406 0.43949 0.12758  -0.03132 0.03940  149 ASN A CG  
2544 O OD1 . ASN A 149 ? 0.37706 0.44716 0.38205 0.11772  -0.02100 0.03226  149 ASN A OD1 
2545 N ND2 . ASN A 149 ? 0.49919 0.60305 0.50719 0.15982  -0.04042 0.03758  149 ASN A ND2 
2552 N N   . GLY A 150 ? 0.30816 0.32577 0.30152 0.05389  -0.00838 0.03559  150 GLY A N   
2553 C CA  . GLY A 150 ? 0.31183 0.29339 0.29781 0.04777  -0.00201 0.03177  150 GLY A CA  
2554 C C   . GLY A 150 ? 0.31137 0.29165 0.29851 0.06439  0.00157  0.02584  150 GLY A C   
2555 O O   . GLY A 150 ? 0.31505 0.27744 0.29889 0.05625  0.00770  0.02207  150 GLY A O   
2559 N N   A LYS A 151 ? 0.32612 0.32877 0.31784 0.08897  -0.00258 0.02329  151 LYS A N   
2560 N N   B LYS A 151 ? 0.32630 0.32886 0.31799 0.08921  -0.00258 0.02322  151 LYS A N   
2561 C CA  A LYS A 151 ? 0.33517 0.34419 0.32807 0.10736  0.00110  0.01331  151 LYS A CA  
2562 C CA  B LYS A 151 ? 0.33635 0.34376 0.32868 0.10831  0.00083  0.01317  151 LYS A CA  
2563 C C   A LYS A 151 ? 0.32664 0.37845 0.33277 0.09074  0.01182  0.01015  151 LYS A C   
2564 C C   B LYS A 151 ? 0.32725 0.38110 0.33367 0.09352  0.01145  0.00954  151 LYS A C   
2565 O O   A LYS A 151 ? 0.30473 0.39637 0.32338 0.07336  0.01369  0.01473  151 LYS A O   
2566 O O   B LYS A 151 ? 0.33993 0.44122 0.36044 0.08093  0.01297  0.01313  151 LYS A O   
2567 C CB  A LYS A 151 ? 0.35930 0.39190 0.35629 0.14165  -0.00691 0.00826  151 LYS A CB  
2568 C CB  B LYS A 151 ? 0.36282 0.38849 0.35761 0.14350  -0.00788 0.00824  151 LYS A CB  
2569 C CG  A LYS A 151 ? 0.41619 0.39463 0.39461 0.15922  -0.02102 0.01407  151 LYS A CG  
2570 C CG  B LYS A 151 ? 0.44245 0.46553 0.43367 0.17110  -0.00699 -0.00708 151 LYS A CG  
2571 C CD  A LYS A 151 ? 0.55678 0.55963 0.54008 0.19777  -0.03202 0.00901  151 LYS A CD  
2572 C CD  B LYS A 151 ? 0.57584 0.61238 0.56851 0.21301  -0.01891 -0.01474 151 LYS A CD  
2573 C CE  A LYS A 151 ? 0.64418 0.58962 0.60623 0.21413  -0.04994 0.01942  151 LYS A CE  
2574 C CE  B LYS A 151 ? 0.60215 0.61990 0.58558 0.24414  -0.02101 -0.03386 151 LYS A CE  
2575 N NZ  A LYS A 151 ? 0.72748 0.69454 0.69405 0.25659  -0.06345 0.01414  151 LYS A NZ  
2576 N NZ  B LYS A 151 ? 0.73105 0.74649 0.71201 0.28975  -0.03653 -0.04269 151 LYS A NZ  
2603 N N   . THR A 152 ? 0.34314 0.38327 0.34363 0.09244  0.01769  0.00356  152 THR A N   
2604 C CA  . THR A 152 ? 0.29797 0.37686 0.30677 0.07544  0.02666  0.00351  152 THR A CA  
2605 C C   . THR A 152 ? 0.32974 0.46793 0.34811 0.09486  0.03045  -0.00610 152 THR A C   
2606 O O   . THR A 152 ? 0.37709 0.50988 0.39115 0.12622  0.02714  -0.01802 152 THR A O   
2607 C CB  . THR A 152 ? 0.32438 0.36617 0.32132 0.06326  0.03096  0.00310  152 THR A CB  
2608 O OG1 . THR A 152 ? 0.36917 0.38640 0.35483 0.08483  0.03020  -0.00774 152 THR A OG1 
2609 C CG2 . THR A 152 ? 0.38276 0.37772 0.37275 0.04604  0.02745  0.01020  152 THR A CG2 
2617 N N   . SER A 153 ? 0.29428 0.49039 0.32456 0.07560  0.03647  -0.00152 153 SER A N   
2618 C CA  . SER A 153 ? 0.29710 0.56832 0.33884 0.09006  0.04160  -0.01057 153 SER A CA  
2619 C C   . SER A 153 ? 0.33925 0.62278 0.37327 0.09226  0.04977  -0.01850 153 SER A C   
2620 O O   . SER A 153 ? 0.33266 0.67543 0.37322 0.11334  0.05401  -0.03190 153 SER A O   
2621 C CB  . SER A 153 ? 0.42223 0.76024 0.47972 0.06351  0.04376  -0.00052 153 SER A CB  
2622 O OG  . SER A 153 ? 0.37385 0.69922 0.42552 0.02373  0.04688  0.01323  153 SER A OG  
2628 N N   . LYS A 154 ? 0.32826 0.56191 0.34855 0.07317  0.05149  -0.01202 154 LYS A N   
2629 C CA  . LYS A 154 ? 0.37334 0.60565 0.38218 0.07558  0.05734  -0.01919 154 LYS A CA  
2630 C C   . LYS A 154 ? 0.33574 0.48647 0.32854 0.07636  0.05282  -0.01963 154 LYS A C   
2631 O O   . LYS A 154 ? 0.33081 0.43513 0.32226 0.06781  0.04695  -0.01128 154 LYS A O   
2632 C CB  . LYS A 154 ? 0.34854 0.62121 0.35749 0.04129  0.06379  -0.00522 154 LYS A CB  
2633 C CG  . LYS A 154 ? 0.39916 0.76671 0.42260 0.03739  0.06969  -0.00578 154 LYS A CG  
2634 C CD  . LYS A 154 ? 0.60684 1.01493 0.62611 -0.00073 0.07499  0.01081  154 LYS A CD  
2635 C CE  . LYS A 154 ? 0.76466 1.27768 0.79898 -0.00614 0.08135  0.00945  154 LYS A CE  
2636 N NZ  . LYS A 154 ? 0.89959 1.44741 0.92892 -0.05469 0.08336  0.03286  154 LYS A NZ  
2650 N N   . LYS A 155 ? 0.34968 0.48900 0.33012 0.08603  0.05554  -0.03067 155 LYS A N   
2651 C CA  . LYS A 155 ? 0.33031 0.40067 0.29548 0.08553  0.05114  -0.03264 155 LYS A CA  
2652 C C   . LYS A 155 ? 0.31533 0.37143 0.27664 0.05505  0.05274  -0.01721 155 LYS A C   
2653 O O   . LYS A 155 ? 0.33139 0.42017 0.28983 0.04281  0.05792  -0.01330 155 LYS A O   
2654 C CB  . LYS A 155 ? 0.39859 0.46341 0.35083 0.10768  0.05186  -0.05286 155 LYS A CB  
2655 C CG  . LYS A 155 ? 0.63665 0.63373 0.57168 0.10706  0.04615  -0.05754 155 LYS A CG  
2656 C CD  . LYS A 155 ? 0.87852 0.82200 0.81118 0.11236  0.03663  -0.05352 155 LYS A CD  
2657 C CE  . LYS A 155 ? 1.07867 0.97223 0.99387 0.13398  0.02768  -0.06949 155 LYS A CE  
2658 N NZ  . LYS A 155 ? 1.12772 0.97286 1.03861 0.13475  0.01741  -0.06019 155 LYS A NZ  
2672 N N   . ILE A 156 ? 0.30725 0.31697 0.26728 0.04426  0.04737  -0.00880 156 ILE A N   
2673 C CA  . ILE A 156 ? 0.29744 0.28999 0.25519 0.02062  0.04597  0.00424  156 ILE A CA  
2674 C C   . ILE A 156 ? 0.33952 0.29184 0.28525 0.02321  0.04366  -0.00148 156 ILE A C   
2675 O O   . ILE A 156 ? 0.34781 0.26581 0.29100 0.02871  0.03958  -0.00534 156 ILE A O   
2676 C CB  . ILE A 156 ? 0.32900 0.30631 0.29507 0.00891  0.04110  0.01380  156 ILE A CB  
2677 C CG1 . ILE A 156 ? 0.37855 0.39807 0.35704 0.00554  0.04218  0.01801  156 ILE A CG1 
2678 C CG2 . ILE A 156 ? 0.34113 0.29634 0.30353 -0.00991 0.03721  0.02386  156 ILE A CG2 
2679 C CD1 . ILE A 156 ? 0.41689 0.48374 0.39764 -0.00918 0.04644  0.02543  156 ILE A CD1 
2691 N N   . THR A 157 ? 0.30714 0.26592 0.24456 0.01686  0.04547  -0.00082 157 THR A N   
2692 C CA  . THR A 157 ? 0.31451 0.24473 0.24037 0.01891  0.04329  -0.00818 157 THR A CA  
2693 C C   . THR A 157 ? 0.34248 0.26453 0.26565 0.00368  0.03990  0.00265  157 THR A C   
2694 O O   . THR A 157 ? 0.34966 0.28757 0.27467 -0.00810 0.03902  0.01589  157 THR A O   
2695 C CB  . THR A 157 ? 0.43253 0.37673 0.34745 0.03059  0.04664  -0.02274 157 THR A CB  
2696 O OG1 . THR A 157 ? 0.44623 0.43490 0.35998 0.02424  0.05169  -0.01777 157 THR A OG1 
2697 C CG2 . THR A 157 ? 0.44586 0.39345 0.36201 0.05188  0.04725  -0.03648 157 THR A CG2 
2705 N N   . ILE A 158 ? 0.34828 0.24392 0.26619 0.00370  0.03630  -0.00261 158 ILE A N   
2706 C CA  . ILE A 158 ? 0.32784 0.21920 0.24255 -0.00475 0.03177  0.00359  158 ILE A CA  
2707 C C   . ILE A 158 ? 0.33457 0.24268 0.23674 -0.00422 0.03366  -0.00167 158 ILE A C   
2708 O O   . ILE A 158 ? 0.38639 0.28494 0.28038 -0.00090 0.03340  -0.01437 158 ILE A O   
2709 C CB  . ILE A 158 ? 0.33665 0.20569 0.25352 -0.00583 0.02748  -0.00068 158 ILE A CB  
2710 C CG1 . ILE A 158 ? 0.36778 0.22673 0.29546 -0.00625 0.02606  0.00312  158 ILE A CG1 
2711 C CG2 . ILE A 158 ? 0.38658 0.25875 0.30226 -0.00992 0.02150  0.00397  158 ILE A CG2 
2712 C CD1 . ILE A 158 ? 0.38804 0.23418 0.31674 -0.00826 0.02367  -0.00277 158 ILE A CD1 
2724 N N   . ALA A 159 ? 0.32967 0.26405 0.22822 -0.01007 0.03491  0.00857  159 ALA A N   
2725 C CA  . ALA A 159 ? 0.35396 0.31400 0.23907 -0.01003 0.03770  0.00341  159 ALA A CA  
2726 C C   . ALA A 159 ? 0.36535 0.31740 0.24260 -0.01442 0.03113  0.00503  159 ALA A C   
2727 O O   . ALA A 159 ? 0.40552 0.36859 0.27111 -0.01249 0.03225  -0.00682 159 ALA A O   
2728 C CB  . ALA A 159 ? 0.36960 0.36726 0.25139 -0.01918 0.04091  0.01695  159 ALA A CB  
2734 N N   . ASP A 160 ? 0.35771 0.29292 0.24086 -0.01878 0.02317  0.01770  160 ASP A N   
2735 C CA  . ASP A 160 ? 0.35119 0.28345 0.23024 -0.01920 0.01545  0.01820  160 ASP A CA  
2736 C C   . ASP A 160 ? 0.36536 0.27497 0.25712 -0.01601 0.00852  0.02188  160 ASP A C   
2737 O O   . ASP A 160 ? 0.36730 0.26304 0.26723 -0.01616 0.00812  0.02819  160 ASP A O   
2738 C CB  . ASP A 160 ? 0.38255 0.33362 0.24932 -0.02520 0.00972  0.03353  160 ASP A CB  
2739 C CG  . ASP A 160 ? 0.43329 0.39400 0.29294 -0.02364 0.00298  0.02966  160 ASP A CG  
2740 O OD1 . ASP A 160 ? 0.43551 0.39267 0.29919 -0.02066 0.00350  0.01396  160 ASP A OD1 
2741 O OD2 . ASP A 160 ? 0.51839 0.49232 0.36694 -0.02767 -0.00416 0.04497  160 ASP A OD2 
2746 N N   . CYS A 161 ? 0.37308 0.28443 0.26652 -0.01311 0.00306  0.01580  161 CYS A N   
2747 C CA  . CYS A 161 ? 0.33315 0.23399 0.23893 -0.00701 -0.00352 0.01528  161 CYS A CA  
2748 C C   . CYS A 161 ? 0.34300 0.26209 0.24848 -0.00314 -0.01121 0.01149  161 CYS A C   
2749 O O   . CYS A 161 ? 0.39171 0.32913 0.28797 -0.00850 -0.00974 0.00600  161 CYS A O   
2750 C CB  . CYS A 161 ? 0.35376 0.24504 0.26871 -0.00784 0.00274  0.00462  161 CYS A CB  
2751 S SG  . CYS A 161 ? 0.37812 0.27187 0.28573 -0.01582 0.00988  -0.01002 161 CYS A SG  
2757 N N   . GLY A 162 ? 0.37223 0.28899 0.28775 0.00748  -0.02029 0.01255  162 GLY A N   
2758 C CA  . GLY A 162 ? 0.39793 0.33954 0.31674 0.01534  -0.02908 0.00802  162 GLY A CA  
2759 C C   . GLY A 162 ? 0.38247 0.31785 0.31200 0.03374  -0.04122 0.00858  162 GLY A C   
2760 O O   . GLY A 162 ? 0.39831 0.30922 0.33351 0.03834  -0.04167 0.00871  162 GLY A O   
2764 N N   . GLN A 163 ? 0.36645 0.32686 0.29867 0.04609  -0.05223 0.00646  163 GLN A N   
2765 C CA  . GLN A 163 ? 0.40452 0.36503 0.34776 0.06965  -0.06559 0.00176  163 GLN A CA  
2766 C C   . GLN A 163 ? 0.45960 0.39284 0.39120 0.08295  -0.08350 0.01940  163 GLN A C   
2767 O O   . GLN A 163 ? 0.51727 0.46249 0.43682 0.07710  -0.08684 0.03043  163 GLN A O   
2768 C CB  . GLN A 163 ? 0.38690 0.40232 0.34357 0.07667  -0.06646 -0.01501 163 GLN A CB  
2769 C CG  . GLN A 163 ? 0.44309 0.46925 0.41417 0.10509  -0.07867 -0.02621 163 GLN A CG  
2770 C CD  . GLN A 163 ? 0.43468 0.52922 0.42248 0.10910  -0.07606 -0.04571 163 GLN A CD  
2771 O OE1 . GLN A 163 ? 0.42458 0.55357 0.41164 0.08566  -0.06532 -0.04916 163 GLN A OE1 
2772 N NE2 . GLN A 163 ? 0.46919 0.58477 0.47098 0.13893  -0.08741 -0.05918 163 GLN A NE2 
2781 N N   . LEU A 164 ? 0.45014 0.34297 0.38208 0.09836  -0.09586 0.02304  164 LEU A N   
2782 C CA  . LEU A 164 ? 0.51659 0.37246 0.43431 0.11199  -0.11793 0.04159  164 LEU A CA  
2783 C C   . LEU A 164 ? 0.58800 0.45617 0.51450 0.14658  -0.13747 0.03136  164 LEU A C   
2784 O O   . LEU A 164 ? 0.69396 0.55736 0.60969 0.15948  -0.15543 0.04504  164 LEU A O   
2785 C CB  . LEU A 164 ? 0.57430 0.36806 0.48232 0.10645  -0.12417 0.05332  164 LEU A CB  
2786 C CG  . LEU A 164 ? 0.65118 0.43228 0.54915 0.07482  -0.10914 0.06701  164 LEU A CG  
2787 C CD1 . LEU A 164 ? 0.77823 0.50119 0.66762 0.06931  -0.11904 0.07770  164 LEU A CD1 
2788 C CD2 . LEU A 164 ? 0.70795 0.50318 0.58853 0.05875  -0.10819 0.08712  164 LEU A CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  CYS 52  52  52  CYS CYS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 CYS 115 115 115 CYS CYS A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 TRP 121 121 121 TRP TRP A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 MET 136 136 136 MET MET A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 MET 142 142 142 MET MET A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLU 165 165 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   201 99  HOH HOH A . 
B 2 HOH 2   202 131 HOH HOH A . 
B 2 HOH 3   203 149 HOH HOH A . 
B 2 HOH 4   204 129 HOH HOH A . 
B 2 HOH 5   205 53  HOH HOH A . 
B 2 HOH 6   206 80  HOH HOH A . 
B 2 HOH 7   207 60  HOH HOH A . 
B 2 HOH 8   208 77  HOH HOH A . 
B 2 HOH 9   209 103 HOH HOH A . 
B 2 HOH 10  210 75  HOH HOH A . 
B 2 HOH 11  211 117 HOH HOH A . 
B 2 HOH 12  212 46  HOH HOH A . 
B 2 HOH 13  213 89  HOH HOH A . 
B 2 HOH 14  214 152 HOH HOH A . 
B 2 HOH 15  215 125 HOH HOH A . 
B 2 HOH 16  216 64  HOH HOH A . 
B 2 HOH 17  217 106 HOH HOH A . 
B 2 HOH 18  218 116 HOH HOH A . 
B 2 HOH 19  219 74  HOH HOH A . 
B 2 HOH 20  220 40  HOH HOH A . 
B 2 HOH 21  221 137 HOH HOH A . 
B 2 HOH 22  222 12  HOH HOH A . 
B 2 HOH 23  223 43  HOH HOH A . 
B 2 HOH 24  224 84  HOH HOH A . 
B 2 HOH 25  225 38  HOH HOH A . 
B 2 HOH 26  226 27  HOH HOH A . 
B 2 HOH 27  227 93  HOH HOH A . 
B 2 HOH 28  228 115 HOH HOH A . 
B 2 HOH 29  229 25  HOH HOH A . 
B 2 HOH 30  230 30  HOH HOH A . 
B 2 HOH 31  231 7   HOH HOH A . 
B 2 HOH 32  232 11  HOH HOH A . 
B 2 HOH 33  233 132 HOH HOH A . 
B 2 HOH 34  234 52  HOH HOH A . 
B 2 HOH 35  235 107 HOH HOH A . 
B 2 HOH 36  236 3   HOH HOH A . 
B 2 HOH 37  237 102 HOH HOH A . 
B 2 HOH 38  238 2   HOH HOH A . 
B 2 HOH 39  239 42  HOH HOH A . 
B 2 HOH 40  240 4   HOH HOH A . 
B 2 HOH 41  241 135 HOH HOH A . 
B 2 HOH 42  242 16  HOH HOH A . 
B 2 HOH 43  243 62  HOH HOH A . 
B 2 HOH 44  244 63  HOH HOH A . 
B 2 HOH 45  245 146 HOH HOH A . 
B 2 HOH 46  246 33  HOH HOH A . 
B 2 HOH 47  247 105 HOH HOH A . 
B 2 HOH 48  248 19  HOH HOH A . 
B 2 HOH 49  249 61  HOH HOH A . 
B 2 HOH 50  250 39  HOH HOH A . 
B 2 HOH 51  251 73  HOH HOH A . 
B 2 HOH 52  252 5   HOH HOH A . 
B 2 HOH 53  253 79  HOH HOH A . 
B 2 HOH 54  254 148 HOH HOH A . 
B 2 HOH 55  255 123 HOH HOH A . 
B 2 HOH 56  256 9   HOH HOH A . 
B 2 HOH 57  257 22  HOH HOH A . 
B 2 HOH 58  258 97  HOH HOH A . 
B 2 HOH 59  259 6   HOH HOH A . 
B 2 HOH 60  260 1   HOH HOH A . 
B 2 HOH 61  261 69  HOH HOH A . 
B 2 HOH 62  262 55  HOH HOH A . 
B 2 HOH 63  263 65  HOH HOH A . 
B 2 HOH 64  264 15  HOH HOH A . 
B 2 HOH 65  265 82  HOH HOH A . 
B 2 HOH 66  266 23  HOH HOH A . 
B 2 HOH 67  267 111 HOH HOH A . 
B 2 HOH 68  268 35  HOH HOH A . 
B 2 HOH 69  269 47  HOH HOH A . 
B 2 HOH 70  270 59  HOH HOH A . 
B 2 HOH 71  271 104 HOH HOH A . 
B 2 HOH 72  272 108 HOH HOH A . 
B 2 HOH 73  273 17  HOH HOH A . 
B 2 HOH 74  274 36  HOH HOH A . 
B 2 HOH 75  275 76  HOH HOH A . 
B 2 HOH 76  276 110 HOH HOH A . 
B 2 HOH 77  277 41  HOH HOH A . 
B 2 HOH 78  278 124 HOH HOH A . 
B 2 HOH 79  279 68  HOH HOH A . 
B 2 HOH 80  280 24  HOH HOH A . 
B 2 HOH 81  281 136 HOH HOH A . 
B 2 HOH 82  282 31  HOH HOH A . 
B 2 HOH 83  283 96  HOH HOH A . 
B 2 HOH 84  284 67  HOH HOH A . 
B 2 HOH 85  285 8   HOH HOH A . 
B 2 HOH 86  286 48  HOH HOH A . 
B 2 HOH 87  287 101 HOH HOH A . 
B 2 HOH 88  288 28  HOH HOH A . 
B 2 HOH 89  289 98  HOH HOH A . 
B 2 HOH 90  290 66  HOH HOH A . 
B 2 HOH 91  291 18  HOH HOH A . 
B 2 HOH 92  292 21  HOH HOH A . 
B 2 HOH 93  293 141 HOH HOH A . 
B 2 HOH 94  294 72  HOH HOH A . 
B 2 HOH 95  295 114 HOH HOH A . 
B 2 HOH 96  296 133 HOH HOH A . 
B 2 HOH 97  297 94  HOH HOH A . 
B 2 HOH 98  298 85  HOH HOH A . 
B 2 HOH 99  299 10  HOH HOH A . 
B 2 HOH 100 300 51  HOH HOH A . 
B 2 HOH 101 301 58  HOH HOH A . 
B 2 HOH 102 302 20  HOH HOH A . 
B 2 HOH 103 303 87  HOH HOH A . 
B 2 HOH 104 304 57  HOH HOH A . 
B 2 HOH 105 305 54  HOH HOH A . 
B 2 HOH 106 306 44  HOH HOH A . 
B 2 HOH 107 307 32  HOH HOH A . 
B 2 HOH 108 308 127 HOH HOH A . 
B 2 HOH 109 309 143 HOH HOH A . 
B 2 HOH 110 310 14  HOH HOH A . 
B 2 HOH 111 311 34  HOH HOH A . 
B 2 HOH 112 312 78  HOH HOH A . 
B 2 HOH 113 313 91  HOH HOH A . 
B 2 HOH 114 314 26  HOH HOH A . 
B 2 HOH 115 315 45  HOH HOH A . 
B 2 HOH 116 316 118 HOH HOH A . 
B 2 HOH 117 317 121 HOH HOH A . 
B 2 HOH 118 318 150 HOH HOH A . 
B 2 HOH 119 319 29  HOH HOH A . 
B 2 HOH 120 320 140 HOH HOH A . 
B 2 HOH 121 321 122 HOH HOH A . 
B 2 HOH 122 322 130 HOH HOH A . 
B 2 HOH 123 323 113 HOH HOH A . 
B 2 HOH 124 324 13  HOH HOH A . 
B 2 HOH 125 325 154 HOH HOH A . 
B 2 HOH 126 326 70  HOH HOH A . 
B 2 HOH 127 327 95  HOH HOH A . 
B 2 HOH 128 328 142 HOH HOH A . 
B 2 HOH 129 329 100 HOH HOH A . 
B 2 HOH 130 330 153 HOH HOH A . 
B 2 HOH 131 331 71  HOH HOH A . 
B 2 HOH 132 332 139 HOH HOH A . 
B 2 HOH 133 333 134 HOH HOH A . 
B 2 HOH 134 334 151 HOH HOH A . 
B 2 HOH 135 335 126 HOH HOH A . 
B 2 HOH 136 336 37  HOH HOH A . 
B 2 HOH 137 337 138 HOH HOH A . 
B 2 HOH 138 338 88  HOH HOH A . 
B 2 HOH 139 339 128 HOH HOH A . 
B 2 HOH 140 340 120 HOH HOH A . 
B 2 HOH 141 341 92  HOH HOH A . 
B 2 HOH 142 342 81  HOH HOH A . 
B 2 HOH 143 343 86  HOH HOH A . 
B 2 HOH 144 344 49  HOH HOH A . 
B 2 HOH 145 345 83  HOH HOH A . 
B 2 HOH 146 346 56  HOH HOH A . 
B 2 HOH 147 347 50  HOH HOH A . 
B 2 HOH 148 348 90  HOH HOH A . 
B 2 HOH 149 349 147 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  7540 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-01-29 
2 'Structure model' 1 1 2020-02-12 
3 'Structure model' 1 2 2020-03-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 2 'Structure model' 'Structure summary'   
3 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' audit_author    
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.country'              
2  3 'Structure model' '_citation.journal_abbrev'       
3  3 'Structure model' '_citation.journal_id_CSD'       
4  3 'Structure model' '_citation.journal_id_ISSN'      
5  3 'Structure model' '_citation.journal_volume'       
6  3 'Structure model' '_citation.page_first'           
7  3 'Structure model' '_citation.page_last'            
8  3 'Structure model' '_citation.pdbx_database_id_DOI' 
9  3 'Structure model' '_citation.title'                
10 3 'Structure model' '_citation.year'                 
11 3 'Structure model' '_citation_author.name'          
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 4.43307056759  6.00564532966 22.7491975782 0.292348861573 ? 0.00836811519762 ? -0.00643768653135 ? 
0.21336455429  ? 0.0296613621427   ? 0.21560669695  ? 3.59976705027 ? 0.706886395074 ? -1.27875643824 ? 1.83821879135  ? 
-0.0851250026229 ? 4.71611905765 ? 0.0417877137352  ? -0.216808069365  ? -0.0854580230508 ? 0.245670260069    ? -0.0477019177242 ? 
-0.0758753762548  ? 0.185389484997   ? 0.233843343005   ? 0.0183471815424  ? 
2 'X-RAY DIFFRACTION' ? refined 9.29116805254  6.38331513965 17.974753592  0.191102466492 ? 0.0285896516351  ? -0.0172398164518  ? 
0.177618041156 ? 0.0143507393306   ? 0.168587714563 ? 3.4207633642  ? 0.689668629331 ? -1.05474608263 ? 2.76459747633  ? 
-0.942275109397  ? 3.54726536731 ? -0.0227373541404 ? -0.0504100154326 ? -0.187154635585  ? 0.153213282991    ? -0.0230368768774 ? 
-0.161237669783   ? 0.177854265088   ? 0.273799536686   ? 0.0552225454344  ? 
3 'X-RAY DIFFRACTION' ? refined 1.34873772821  13.8586271878 15.4650867296 0.225701855847 ? 0.00213616263512 ? 0.0222856465801   ? 
0.166476219268 ? 0.00838529120535  ? 0.200757255352 ? 2.99174763196 ? 0.992653809815 ? 0.850502649734 ? 2.65953371929  ? 
1.18260728674    ? 4.04734131294 ? -0.0200738348026 ? -0.0165799360847 ? -0.0367235959902 ? -0.0171931090308  ? 0.092005009605   ? 
-0.00466369649638 ? -0.21440767575   ? 0.00135165500299 ? -0.0710747662365 ? 
4 'X-RAY DIFFRACTION' ? refined 8.57734190089  21.7688364113 12.8791568559 0.307109750824 ? -0.0310823451177 ? 0.0211737364167   ? 
0.208130344146 ? -0.011370562285   ? 0.273714114785 ? 3.37248632073 ? -1.03551823259 ? -1.34491770653 ? 0.975901194443 ? 
0.458603172126   ? 2.053165963   ? 0.172588134398   ? 0.0158801605443  ? 0.386963971422   ? -0.0956114509937  ? -0.026089473082  ? 
-0.138508862642   ? -0.456191390742  ? 0.178773749822   ? -0.143356316004  ? 
5 'X-RAY DIFFRACTION' ? refined 8.82099389167  5.39809948319 5.23240691336 0.24110396295  ? 0.040916110505   ? 0.00977445399205  ? 
0.201220484116 ? -0.00713118997738 ? 0.236530791214 ? 3.40253853935 ? 1.63434287512  ? -1.58584661598 ? 2.60899354281  ? 
-0.593352914556  ? 3.39659018769 ? -0.115055558842  ? 0.0696865681699  ? -0.300779968104  ? -0.0841517363653  ? -0.0199211770398 ? 
-0.108685916458   ? 0.4062640161     ? 0.112774953956   ? 0.142177170852   ? 
6 'X-RAY DIFFRACTION' ? refined 4.17762894955  11.2281248618 4.87957931412 0.180044945576 ? 0.022433773184   ? 0.00255294088436  ? 
0.181767660533 ? 0.00618901955515  ? 0.179573257068 ? 2.3459474686  ? 0.174353863657 ? -1.437835616   ? 0.65859782429  ? 
-0.173153408533  ? 3.475826905   ? 0.0676703616325  ? 0.137986175691   ? 0.037518034155   ? -0.00756981328327 ? -0.0300625409337 ? 
-0.00969921684233 ? -0.0259338425651 ? -0.144650518602  ? -0.0351860328072 ? 
7 'X-RAY DIFFRACTION' ? refined 6.93284587588  3.99281584897 8.66206689392 0.203758884008 ? 0.0361858735537  ? 0.0010813395007   ? 
0.156821709036 ? -0.00213144235536 ? 0.224574942584 ? 3.65473327002 ? 1.31987603154  ? -3.04765481999 ? 1.42494858012  ? 
0.019085656398   ? 4.51730186442 ? -0.162291224072  ? -0.0194263266446 ? -0.182165949142  ? 0.00987742314262  ? -0.023224398323  ? 
-0.190439945125   ? 0.234203290853   ? 0.101030248826   ? 0.137181643272   ? 
8 'X-RAY DIFFRACTION' ? refined -7.35828772067 2.80793392279 16.9436113583 0.304746652693 ? -0.0474866297099 ? 0.00277121129753  ? 
0.268278946317 ? 0.0557101045045   ? 0.243225219051 ? 2.64091934057 ? -3.76980334005 ? 1.6491275547   ? 5.77313532317  ? 
-1.70256055907   ? 2.11463426869 ? 0.0907278762851  ? -0.0360398671367 ? -0.156402681702  ? -0.308858522273   ? 0.159187859867   ? 
0.355598101591    ? 0.243050661553   ? -0.335362892313  ? -0.218121136738  ? 
9 'X-RAY DIFFRACTION' ? refined -4.96737706    12.1236643598 18.4034079607 0.282934951494 ? 0.00873005396601 ? 0.0344326492593   ? 
0.201920491421 ? 0.012130278867    ? 0.244357683605 ? 3.87707908541 ? 0.552591784171 ? 1.76807836643  ? 1.03101526201  ? 
0.498145537062   ? 5.85562586159 ? 0.0154300249697  ? -0.380031934653  ? 0.0464347770292  ? 0.100070836315    ? 0.0191113010561  ? 
0.156358637993    ? -0.151331620509  ? -0.682384995969  ? -0.0326826215403 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 2 through 14 )
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 15 through 41 )
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 42 through 64 )
;
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 65 through 84 )
;
5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 85 through 100 )
;
6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 101 through 122 )
;
7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 123 through 135 )
;
8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 136 through 145 )
;
9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 146 through 164 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? DIALS  ? ? ? .         2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DIALS  ? ? ? .         3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? DIALS  ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .         5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             PHE 
_pdbx_validate_rmsd_angle.auth_seq_id_1              8 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PHE 
_pdbx_validate_rmsd_angle.auth_seq_id_2              8 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PHE 
_pdbx_validate_rmsd_angle.auth_seq_id_3              8 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.49 
_pdbx_validate_rmsd_angle.angle_target_value         120.80 
_pdbx_validate_rmsd_angle.angle_deviation            -4.31 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 60 ? ? -140.47 -73.70 
2 1 PHE A 60 ? ? -140.47 -74.40 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A GLU 165 ? A GLU 165 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM123159    1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM124149    2 
'National Science Foundation (NSF, United States)'                                         'United States' STC-1231306 3 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM117126    4 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_serial_crystallography_data_reduction.diffrn_id             1 
_pdbx_serial_crystallography_data_reduction.frames_total          ? 
_pdbx_serial_crystallography_data_reduction.xfel_pulse_events     ? 
_pdbx_serial_crystallography_data_reduction.frame_hits            ? 
_pdbx_serial_crystallography_data_reduction.crystal_hits          ? 
_pdbx_serial_crystallography_data_reduction.droplet_hits          ? 
_pdbx_serial_crystallography_data_reduction.frames_failed_index   ? 
_pdbx_serial_crystallography_data_reduction.frames_indexed        23947 
_pdbx_serial_crystallography_data_reduction.lattices_indexed      ? 
_pdbx_serial_crystallography_data_reduction.xfel_run_numbers      ? 
# 
_pdbx_serial_crystallography_measurement.diffrn_id                    1 
_pdbx_serial_crystallography_measurement.pulse_energy                 ? 
_pdbx_serial_crystallography_measurement.pulse_duration               10 
_pdbx_serial_crystallography_measurement.xfel_pulse_repetition_rate   30 
_pdbx_serial_crystallography_measurement.pulse_photon_energy          ? 
_pdbx_serial_crystallography_measurement.photons_per_pulse            ? 
_pdbx_serial_crystallography_measurement.source_size                  ? 
_pdbx_serial_crystallography_measurement.source_distance              ? 
_pdbx_serial_crystallography_measurement.focal_spot_size              ? 
_pdbx_serial_crystallography_measurement.collimation                  ? 
_pdbx_serial_crystallography_measurement.collection_time_total        ? 
# 
_pdbx_serial_crystallography_sample_delivery.diffrn_id     1 
_pdbx_serial_crystallography_sample_delivery.description   'Cellulose (Sugahara et al., 2017)' 
_pdbx_serial_crystallography_sample_delivery.method        injection 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 21 21 21' 
_space_group.name_Hall        'P 2ac 2ab' 
_space_group.IT_number        19 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z           
2 x+1/2,-y+1/2,-z 
3 -x,y+1/2,-z+1/2 
4 -x+1/2,-y,z+1/2 
#