data_6U5G
# 
_entry.id   6U5G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6U5G         
WWPDB D_1000243874 
EMDB  EMD-20645    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'MicroED structure of a FIB-milled CypA Crystal' 
_pdbx_database_related.db_id          EMD-20645 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6U5G 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.pdbx_ordinal 
_audit_author.name 
_audit_author.identifier_ORCID 
1 'Wolff, A.M.'       0000-0003-0474-7673 
2 'Martynowycz, M.W.' 0000-0003-0055-230X 
3 'Zhao, W.'          ?                   
4 'Gonen, T.'         0000-0002-9254-4069 
5 'Fraser, J.S.'      0000-0002-5080-2859 
6 'Thompson, M.C.'    0000-0002-6099-2027 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Iucrj 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2052-2525 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                306 
_citation.page_last                 323 
_citation.title                     
;Comparing serial X-ray crystallography and microcrystal electron diffraction (MicroED) as methods for routine structure determination from small macromolecular crystals
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S205225252000072X 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.ordinal 
_citation_author.name 
_citation_author.identifier_ORCID 
primary 1  'Wolff, A.M.'       0000-0003-0474-7673 
primary 2  'Young, I.D.'       0000-0003-4713-9504 
primary 3  'Sierra, R.G.'      0000-0002-6253-8282 
primary 4  'Brewster, A.S.'    0000-0002-0908-7822 
primary 5  'Martynowycz, M.W.' 0000-0003-0055-230X 
primary 6  'Nango, E.'         0000-0001-9851-7355 
primary 7  'Sugahara, M.'      ?                   
primary 8  'Nakane, T.'        0000-0003-2697-2767 
primary 9  'Ito, K.'           ?                   
primary 10 'Aquila, A.'        ?                   
primary 11 'Bhowmick, A.'      ?                   
primary 12 'Biel, J.T.'        0000-0002-0935-8362 
primary 13 'Carbajo, S.'       0000-0002-5292-4470 
primary 14 'Cohen, A.E.'       0000-0003-2414-9427 
primary 15 'Cortez, S.'        ?                   
primary 16 'Gonzalez, A.'      ?                   
primary 17 'Hino, T.'          0000-0002-8813-4622 
primary 18 'Im, D.'            ?                   
primary 19 'Koralek, J.D.'     0000-0001-8289-0497 
primary 20 'Kubo, M.'          0000-0001-8691-6252 
primary 21 'Lazarou, T.S.'     ?                   
primary 22 'Nomura, T.'        ?                   
primary 23 'Owada, S.'         ?                   
primary 24 'Samelson, A.'      ?                   
primary 25 'Tanaka, T.'        ?                   
primary 26 'Tanaka, R.'        ?                   
primary 27 'Thompson, E.M.'    ?                   
primary 28 'van den Bedem, H.' 0000-0003-2358-841X 
primary 29 'Woldeyes, R.A.'    0000-0003-0737-8383 
primary 30 'Yumoto, F.'        0000-0002-9592-397X 
primary 31 'Zhao, W.'          ?                   
primary 32 'Tono, K.'          ?                   
primary 33 'Boutet, S.'        ?                   
primary 34 'Iwata, S.'         ?                   
primary 35 'Gonen, T.'         0000-0002-9254-4069 
primary 36 'Sauter, N.K.'      ?                   
primary 37 'Fraser, J.S.'      0000-0002-5080-2859 
primary 38 'Thompson, M.C.'    0000-0002-6099-2027 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6U5G 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     42.400 
_cell.length_a_esd                 ? 
_cell.length_b                     53.400 
_cell.length_b_esd                 ? 
_cell.length_c                     87.760 
_cell.length_c_esd                 ? 
_cell.volume                       198702.682 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6U5G 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Peptidyl-prolyl cis-trans isomerase A' 18036.504 1  5.2.1.8 ? ? ? 
2 water   nat water                                   18.015    32 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPIase A,Cyclophilin A,Cyclosporin A-binding protein,Rotamase A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   ASN n 
1 4   PRO n 
1 5   THR n 
1 6   VAL n 
1 7   PHE n 
1 8   PHE n 
1 9   ASP n 
1 10  ILE n 
1 11  ALA n 
1 12  VAL n 
1 13  ASP n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  LEU n 
1 18  GLY n 
1 19  ARG n 
1 20  VAL n 
1 21  SER n 
1 22  PHE n 
1 23  GLU n 
1 24  LEU n 
1 25  PHE n 
1 26  ALA n 
1 27  ASP n 
1 28  LYS n 
1 29  VAL n 
1 30  PRO n 
1 31  LYS n 
1 32  THR n 
1 33  ALA n 
1 34  GLU n 
1 35  ASN n 
1 36  PHE n 
1 37  ARG n 
1 38  ALA n 
1 39  LEU n 
1 40  SER n 
1 41  THR n 
1 42  GLY n 
1 43  GLU n 
1 44  LYS n 
1 45  GLY n 
1 46  PHE n 
1 47  GLY n 
1 48  TYR n 
1 49  LYS n 
1 50  GLY n 
1 51  SER n 
1 52  CYS n 
1 53  PHE n 
1 54  HIS n 
1 55  ARG n 
1 56  ILE n 
1 57  ILE n 
1 58  PRO n 
1 59  GLY n 
1 60  PHE n 
1 61  MET n 
1 62  CYS n 
1 63  GLN n 
1 64  GLY n 
1 65  GLY n 
1 66  ASP n 
1 67  PHE n 
1 68  THR n 
1 69  ARG n 
1 70  HIS n 
1 71  ASN n 
1 72  GLY n 
1 73  THR n 
1 74  GLY n 
1 75  GLY n 
1 76  LYS n 
1 77  SER n 
1 78  ILE n 
1 79  TYR n 
1 80  GLY n 
1 81  GLU n 
1 82  LYS n 
1 83  PHE n 
1 84  GLU n 
1 85  ASP n 
1 86  GLU n 
1 87  ASN n 
1 88  PHE n 
1 89  ILE n 
1 90  LEU n 
1 91  LYS n 
1 92  HIS n 
1 93  THR n 
1 94  GLY n 
1 95  PRO n 
1 96  GLY n 
1 97  ILE n 
1 98  LEU n 
1 99  SER n 
1 100 MET n 
1 101 ALA n 
1 102 ASN n 
1 103 ALA n 
1 104 GLY n 
1 105 PRO n 
1 106 ASN n 
1 107 THR n 
1 108 ASN n 
1 109 GLY n 
1 110 SER n 
1 111 GLN n 
1 112 PHE n 
1 113 PHE n 
1 114 ILE n 
1 115 CYS n 
1 116 THR n 
1 117 ALA n 
1 118 LYS n 
1 119 THR n 
1 120 GLU n 
1 121 TRP n 
1 122 LEU n 
1 123 ASP n 
1 124 GLY n 
1 125 LYS n 
1 126 HIS n 
1 127 VAL n 
1 128 VAL n 
1 129 PHE n 
1 130 GLY n 
1 131 LYS n 
1 132 VAL n 
1 133 LYS n 
1 134 GLU n 
1 135 GLY n 
1 136 MET n 
1 137 ASN n 
1 138 ILE n 
1 139 VAL n 
1 140 GLU n 
1 141 ALA n 
1 142 MET n 
1 143 GLU n 
1 144 ARG n 
1 145 PHE n 
1 146 GLY n 
1 147 SER n 
1 148 ARG n 
1 149 ASN n 
1 150 GLY n 
1 151 LYS n 
1 152 THR n 
1 153 SER n 
1 154 LYS n 
1 155 LYS n 
1 156 ILE n 
1 157 THR n 
1 158 ILE n 
1 159 ALA n 
1 160 ASP n 
1 161 CYS n 
1 162 GLY n 
1 163 GLN n 
1 164 LEU n 
1 165 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   165 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PPIA, CYPA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPIA_HUMAN 
_struct_ref.pdbx_db_accession          P62937 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6U5G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 165 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P62937 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  165 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       165 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6U5G 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON CRYSTALLOGRAPHY' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.75 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.34 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_reflns.B_iso_Wilson_estimate            35.52 
_reflns.entry_id                         6U5G 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                ? 
_reflns.d_resolution_low                 ? 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       ? 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             ? 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  ? 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            ? 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               30.60 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6U5G 
_refine.pdbx_refine_id                           'ELECTRON CRYSTALLOGRAPHY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             26.48 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     11440 
_refine.ls_number_reflns_R_free                  396 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    86.01 
_refine.ls_percent_reflns_R_free                 3.46 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1867 
_refine.ls_R_factor_R_free                       0.2237 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1854 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 4YUM' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.5393 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4224 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON CRYSTALLOGRAPHY' ? 0.0112  ? 1276 ? f_bond_d           ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 0.7321  ? 1711 ? f_angle_d          ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 0.0545  ? 177  ? f_chiral_restr     ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 0.0053  ? 226  ? f_plane_restr      ? ? 
'ELECTRON CRYSTALLOGRAPHY' ? 12.8187 ? 744  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'ELECTRON CRYSTALLOGRAPHY' 2.50 2.86  . . 133 3745 87.40 . . . 0.3217 . 0.2665 . . . . . . . . . . 
'ELECTRON CRYSTALLOGRAPHY' 2.86 3.60  . . 141 3717 86.81 . . . 0.2848 . 0.2033 . . . . . . . . . . 
'ELECTRON CRYSTALLOGRAPHY' 3.60 26.48 . . 122 3582 83.82 . . . 0.1548 . 0.1461 . . . . . . . . . . 
# 
_struct.entry_id                     6U5G 
_struct.title                        'MicroED structure of a FIB-milled CypA Crystal' 
_struct.pdbx_descriptor              'Peptidyl-prolyl cis-trans isomerase A (E.C.5.2.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6U5G 
_struct_keywords.text            'Peptidyl-prolyl, cis-trans, isomerase, cyclophilin' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 VAL A 29  ? GLY A 42  ? VAL A 29  GLY A 42  1 ? 14 
HELX_P HELX_P2 AA2 THR A 119 ? ASP A 123 ? THR A 119 ASP A 123 5 ? 5  
HELX_P HELX_P3 AA3 GLY A 135 ? ARG A 144 ? GLY A 135 ARG A 144 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 55  ? ILE A 57  ? ARG A 55  ILE A 57  
AA1 2 MET A 61  ? GLY A 64  ? MET A 61  GLY A 64  
AA1 3 PHE A 112 ? CYS A 115 ? PHE A 112 CYS A 115 
AA1 4 ILE A 97  ? MET A 100 ? ILE A 97  MET A 100 
AA1 5 VAL A 128 ? GLU A 134 ? VAL A 128 GLU A 134 
AA1 6 GLU A 15  ? LEU A 24  ? GLU A 15  LEU A 24  
AA1 7 THR A 5   ? VAL A 12  ? THR A 5   VAL A 12  
AA1 8 ILE A 156 ? GLN A 163 ? ILE A 156 GLN A 163 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 55  ? N ARG A 55  O GLN A 63  ? O GLN A 63  
AA1 2 3 N CYS A 62  ? N CYS A 62  O ILE A 114 ? O ILE A 114 
AA1 3 4 O PHE A 113 ? O PHE A 113 N SER A 99  ? N SER A 99  
AA1 4 5 N LEU A 98  ? N LEU A 98  O GLY A 130 ? O GLY A 130 
AA1 5 6 O LYS A 133 ? O LYS A 133 N SER A 21  ? N SER A 21  
AA1 6 7 O VAL A 20  ? O VAL A 20  N PHE A 8   ? N PHE A 8   
AA1 7 8 N ASP A 9   ? N ASP A 9   O ASP A 160 ? O ASP A 160 
# 
_atom_sites.entry_id                    6U5G 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.023585 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018727 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011395 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 0.08930 0.25630 0.75700 1.04870 0.24650 1.71000 6.40940  18.61130 0.0 
;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
H ? ? 0.03490 0.12010 0.19700 0.05730 0.53470 3.58670 12.34710 18.95250 0.0 
;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 0.10220 0.32190 0.79820 0.81970 0.24510 1.74810 6.19250  17.38940 0.0 
;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 0.09740 0.29210 0.69100 0.69900 0.20670 1.38150 4.69430  12.71050 0.0 
;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 0.24970 0.56280 1.38990 2.18650 0.26810 1.67110 7.02670  19.53770 0.0 
;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . VAL A 1 2   ? 20.97232  -2.29703 17.86921 1.000 50.46103  ? 2   VAL A N    1 
ATOM   2    C CA   . VAL A 1 2   ? 19.59058  -2.81210 17.81109 1.000 60.98751  ? 2   VAL A CA   1 
ATOM   3    C C    . VAL A 1 2   ? 18.58372  -1.67657 17.59260 1.000 49.04281  ? 2   VAL A C    1 
ATOM   4    O O    . VAL A 1 2   ? 18.72543  -0.60434 18.16302 1.000 45.16016  ? 2   VAL A O    1 
ATOM   5    C CB   . VAL A 1 2   ? 19.21611  -3.59757 19.08209 1.000 53.43341  ? 2   VAL A CB   1 
ATOM   6    C CG1  . VAL A 1 2   ? 17.74266  -4.02367 19.04397 1.000 46.81798  ? 2   VAL A CG1  1 
ATOM   7    C CG2  . VAL A 1 2   ? 20.12988  -4.79806 19.23780 1.000 76.25297  ? 2   VAL A CG2  1 
ATOM   8    H HA   . VAL A 1 2   ? 19.54312  -3.41642 17.05382 1.000 73.07269  ? 2   VAL A HA   1 
ATOM   9    H HB   . VAL A 1 2   ? 19.33249  -3.02566 19.85687 1.000 64.00778  ? 2   VAL A HB   1 
ATOM   10   H HG11 . VAL A 1 2   ? 17.60191  -4.73203 19.69153 1.000 56.06927  ? 2   VAL A HG11 1 
ATOM   11   H HG12 . VAL A 1 2   ? 17.18713  -3.25947 19.26370 1.000 56.06927  ? 2   VAL A HG12 1 
ATOM   12   H HG13 . VAL A 1 2   ? 17.52910  -4.34264 18.15316 1.000 56.06927  ? 2   VAL A HG13 1 
ATOM   13   H HG21 . VAL A 1 2   ? 20.06590  -5.34896 18.44200 1.000 91.39125  ? 2   VAL A HG21 1 
ATOM   14   H HG22 . VAL A 1 2   ? 19.85278  -5.30707 20.01564 1.000 91.39125  ? 2   VAL A HG22 1 
ATOM   15   H HG23 . VAL A 1 2   ? 21.04174  -4.48801 19.35304 1.000 91.39125  ? 2   VAL A HG23 1 
ATOM   16   N N    . ASN A 1 3   ? 17.58716  -1.91864 16.74506 1.000 42.80846  ? 3   ASN A N    1 
ATOM   17   C CA   . ASN A 1 3   ? 16.62319  -0.88677 16.39046 1.000 36.20721  ? 3   ASN A CA   1 
ATOM   18   C C    . ASN A 1 3   ? 15.88810  -0.42874 17.63924 1.000 33.59202  ? 3   ASN A C    1 
ATOM   19   O O    . ASN A 1 3   ? 15.36108  -1.26713 18.37706 1.000 38.61951  ? 3   ASN A O    1 
ATOM   20   C CB   . ASN A 1 3   ? 15.62326  -1.40852 15.36191 1.000 41.23758  ? 3   ASN A CB   1 
ATOM   21   C CG   . ASN A 1 3   ? 16.11622  -1.23040 13.92846 1.000 32.72027  ? 3   ASN A CG   1 
ATOM   22   O OD1  . ASN A 1 3   ? 16.99801  -0.41970 13.65836 1.000 27.84359  ? 3   ASN A OD1  1 
ATOM   23   N ND2  . ASN A 1 3   ? 15.50864  -1.95271 13.00235 1.000 38.81773  ? 3   ASN A ND2  1 
ATOM   24   H H    . ASN A 1 3   ? 17.44750  -2.67521 16.36074 1.000 51.25784  ? 3   ASN A H    1 
ATOM   25   H HA   . ASN A 1 3   ? 17.09005  -0.13140 16.00015 1.000 43.33633  ? 3   ASN A HA   1 
ATOM   26   H HB2  . ASN A 1 3   ? 15.47572  -2.35502 15.51444 1.000 49.37278  ? 3   ASN A HB2  1 
ATOM   27   H HB3  . ASN A 1 3   ? 14.78867  -0.92325 15.45608 1.000 49.37278  ? 3   ASN A HB3  1 
ATOM   28   H HD21 . ASN A 1 3   ? 15.75011  -1.88800 12.17949 1.000 46.46896  ? 3   ASN A HD21 1 
ATOM   29   H HD22 . ASN A 1 3   ? 14.87202  -2.48720 13.22291 1.000 46.46896  ? 3   ASN A HD22 1 
ATOM   30   N N    . PRO A 1 4   ? 15.84611  0.86900  17.91435 1.000 33.03340  ? 4   PRO A N    1 
ATOM   31   C CA   . PRO A 1 4   ? 15.17915  1.33219  19.13437 1.000 34.29840  ? 4   PRO A CA   1 
ATOM   32   C C    . PRO A 1 4   ? 13.65914  1.21211  19.04377 1.000 35.84555  ? 4   PRO A C    1 
ATOM   33   O O    . PRO A 1 4   ? 13.05025  1.11494  17.97468 1.000 30.21815  ? 4   PRO A O    1 
ATOM   34   C CB   . PRO A 1 4   ? 15.63148  2.79366  19.25560 1.000 36.37112  ? 4   PRO A CB   1 
ATOM   35   C CG   . PRO A 1 4   ? 15.94186  3.22084  17.82719 1.000 35.01027  ? 4   PRO A CG   1 
ATOM   36   C CD   . PRO A 1 4   ? 16.38865  1.97485  17.09860 1.000 34.10196  ? 4   PRO A CD   1 
ATOM   37   H HA   . PRO A 1 4   ? 15.48832  0.83190  19.90576 1.000 41.04577  ? 4   PRO A HA   1 
ATOM   38   H HB2  . PRO A 1 4   ? 14.91768  3.33141  19.63273 1.000 43.53303  ? 4   PRO A HB2  1 
ATOM   39   H HB3  . PRO A 1 4   ? 16.42134  2.85085  19.81574 1.000 43.53303  ? 4   PRO A HB3  1 
ATOM   40   H HG2  . PRO A 1 4   ? 15.14355  3.58883  17.41708 1.000 41.90001  ? 4   PRO A HG2  1 
ATOM   41   H HG3  . PRO A 1 4   ? 16.64843  3.88538  17.83276 1.000 41.90001  ? 4   PRO A HG3  1 
ATOM   42   H HD2  . PRO A 1 4   ? 16.01976  1.95174  16.20178 1.000 40.81003  ? 4   PRO A HD2  1 
ATOM   43   H HD3  . PRO A 1 4   ? 17.35682  1.92913  17.06037 1.000 40.81003  ? 4   PRO A HD3  1 
ATOM   44   N N    . THR A 1 5   ? 13.04828  1.19795  20.21708 1.000 37.80566  ? 5   THR A N    1 
ATOM   45   C CA   . THR A 1 5   ? 11.61441  1.03856  20.35591 1.000 34.68890  ? 5   THR A CA   1 
ATOM   46   C C    . THR A 1 5   ? 11.06907  2.15823  21.22684 1.000 32.39854  ? 5   THR A C    1 
ATOM   47   O O    . THR A 1 5   ? 11.52799  2.35166  22.35437 1.000 34.71261  ? 5   THR A O    1 
ATOM   48   C CB   . THR A 1 5   ? 11.28865  -0.31897 20.95940 1.000 39.45771  ? 5   THR A CB   1 
ATOM   49   O OG1  . THR A 1 5   ? 11.81926  -1.34419 20.11349 1.000 43.77292  ? 5   THR A OG1  1 
ATOM   50   C CG2  . THR A 1 5   ? 9.75724   -0.49118 21.06966 1.000 47.25641  ? 5   THR A CG2  1 
ATOM   51   H H    . THR A 1 5   ? 13.45692  1.28157  20.96916 1.000 45.25448  ? 5   THR A H    1 
ATOM   52   H HA   . THR A 1 5   ? 11.18474  1.10337  19.48869 1.000 41.51436  ? 5   THR A HA   1 
ATOM   53   H HB   . THR A 1 5   ? 11.67484  -0.39399 21.84604 1.000 47.23693  ? 5   THR A HB   1 
ATOM   54   H HG1  . THR A 1 5   ? 11.70086  -2.09739 20.46601 1.000 52.41519  ? 5   THR A HG1  1 
ATOM   55   H HG21 . THR A 1 5   ? 9.54600   -1.37955 21.39689 1.000 56.59538  ? 5   THR A HG21 1 
ATOM   56   H HG22 . THR A 1 5   ? 9.39292   0.16538  21.68374 1.000 56.59538  ? 5   THR A HG22 1 
ATOM   57   H HG23 . THR A 1 5   ? 9.34629   -0.37031 20.19937 1.000 56.59538  ? 5   THR A HG23 1 
ATOM   58   N N    . VAL A 1 6   ? 10.07752  2.87952  20.71262 1.000 32.97281  ? 6   VAL A N    1 
ATOM   59   C CA   . VAL A 1 6   ? 9.40214   3.92998  21.46263 1.000 34.17902  ? 6   VAL A CA   1 
ATOM   60   C C    . VAL A 1 6   ? 7.93867   3.55281  21.62637 1.000 27.50923  ? 6   VAL A C    1 
ATOM   61   O O    . VAL A 1 6   ? 7.41395   2.68159  20.93800 1.000 27.64660  ? 6   VAL A O    1 
ATOM   62   C CB   . VAL A 1 6   ? 9.53785   5.30636  20.77896 1.000 29.63595  ? 6   VAL A CB   1 
ATOM   63   C CG1  . VAL A 1 6   ? 11.00730  5.60486  20.54847 1.000 31.94720  ? 6   VAL A CG1  1 
ATOM   64   C CG2  . VAL A 1 6   ? 8.79158   5.34547  19.49086 1.000 29.53833  ? 6   VAL A CG2  1 
ATOM   65   H H    . VAL A 1 6   ? 9.77298   2.77596  19.91504 1.000 39.45506  ? 6   VAL A H    1 
ATOM   66   H HA   . VAL A 1 6   ? 9.79478   3.99101  22.34750 1.000 40.90251  ? 6   VAL A HA   1 
ATOM   67   H HB   . VAL A 1 6   ? 9.15573   5.98725  21.35452 1.000 35.45082  ? 6   VAL A HB   1 
ATOM   68   H HG11 . VAL A 1 6   ? 11.09387  6.49657  20.17664 1.000 38.22433  ? 6   VAL A HG11 1 
ATOM   69   H HG12 . VAL A 1 6   ? 11.47682  5.55273  21.39567 1.000 38.22433  ? 6   VAL A HG12 1 
ATOM   70   H HG13 . VAL A 1 6   ? 11.36889  4.95170  19.92917 1.000 38.22433  ? 6   VAL A HG13 1 
ATOM   71   H HG21 . VAL A 1 6   ? 9.17116   6.03737  18.92686 1.000 35.33368  ? 6   VAL A HG21 1 
ATOM   72   H HG22 . VAL A 1 6   ? 8.86988   4.48285  19.05420 1.000 35.33368  ? 6   VAL A HG22 1 
ATOM   73   H HG23 . VAL A 1 6   ? 7.85894   5.54106  19.67202 1.000 35.33368  ? 6   VAL A HG23 1 
ATOM   74   N N    . PHE A 1 7   ? 7.26644   4.24664  22.52909 1.000 28.90622  ? 7   PHE A N    1 
ATOM   75   C CA   . PHE A 1 7   ? 5.87523   3.94644  22.81797 1.000 27.10138  ? 7   PHE A CA   1 
ATOM   76   C C    . PHE A 1 7   ? 5.12540   5.25601  22.97745 1.000 26.94663  ? 7   PHE A C    1 
ATOM   77   O O    . PHE A 1 7   ? 5.69297   6.26211  23.40590 1.000 26.18277  ? 7   PHE A O    1 
ATOM   78   C CB   . PHE A 1 7   ? 5.70677   3.06031  24.10749 1.000 29.61376  ? 7   PHE A CB   1 
ATOM   79   C CG   . PHE A 1 7   ? 5.98654   3.78819  25.40059 1.000 26.70183  ? 7   PHE A CG   1 
ATOM   80   C CD1  . PHE A 1 7   ? 5.00384   4.52559  26.02808 1.000 28.88648  ? 7   PHE A CD1  1 
ATOM   81   C CD2  . PHE A 1 7   ? 7.22437   3.73244  25.98049 1.000 28.38470  ? 7   PHE A CD2  1 
ATOM   82   C CE1  . PHE A 1 7   ? 5.25771   5.22023  27.19909 1.000 27.49026  ? 7   PHE A CE1  1 
ATOM   83   C CE2  . PHE A 1 7   ? 7.48943   4.42551  27.14731 1.000 29.98929  ? 7   PHE A CE2  1 
ATOM   84   C CZ   . PHE A 1 7   ? 6.48946   5.17217  27.75624 1.000 29.38784  ? 7   PHE A CZ   1 
ATOM   85   H H    . PHE A 1 7   ? 7.59394   4.89625  22.98774 1.000 34.57515  ? 7   PHE A H    1 
ATOM   86   H HA   . PHE A 1 7   ? 5.48814   3.45103  22.07930 1.000 32.40934  ? 7   PHE A HA   1 
ATOM   87   H HB2  . PHE A 1 7   ? 4.79310   2.73660  24.14404 1.000 35.42420  ? 7   PHE A HB2  1 
ATOM   88   H HB3  . PHE A 1 7   ? 6.32180   2.31226  24.05216 1.000 35.42420  ? 7   PHE A HB3  1 
ATOM   89   H HD1  . PHE A 1 7   ? 4.15189   4.55696  25.65649 1.000 34.55146  ? 7   PHE A HD1  1 
ATOM   90   H HD2  . PHE A 1 7   ? 7.89477   3.22293  25.58570 1.000 33.94933  ? 7   PHE A HD2  1 
ATOM   91   H HE1  . PHE A 1 7   ? 4.58318   5.71837  27.60128 1.000 32.87599  ? 7   PHE A HE1  1 
ATOM   92   H HE2  . PHE A 1 7   ? 8.33869   4.39152  27.52481 1.000 35.87484  ? 7   PHE A HE2  1 
ATOM   93   H HZ   . PHE A 1 7   ? 6.66554   5.63651  28.54256 1.000 35.15310  ? 7   PHE A HZ   1 
ATOM   94   N N    . PHE A 1 8   ? 3.83758   5.21865  22.66071 1.000 27.38992  ? 8   PHE A N    1 
ATOM   95   C CA   . PHE A 1 8   ? 2.89952   6.28641  22.96598 1.000 29.32016  ? 8   PHE A CA   1 
ATOM   96   C C    . PHE A 1 8   ? 1.82704   5.73220  23.90368 1.000 28.19173  ? 8   PHE A C    1 
ATOM   97   O O    . PHE A 1 8   ? 1.27569   4.65482  23.65673 1.000 29.90920  ? 8   PHE A O    1 
ATOM   98   C CB   . PHE A 1 8   ? 2.20383   6.82340  21.67990 1.000 31.04731  ? 8   PHE A CB   1 
ATOM   99   C CG   . PHE A 1 8   ? 3.07532   7.59959  20.77217 1.000 26.93769  ? 8   PHE A CG   1 
ATOM   100  C CD1  . PHE A 1 8   ? 4.31484   8.00560  21.17524 1.000 33.83005  ? 8   PHE A CD1  1 
ATOM   101  C CD2  . PHE A 1 8   ? 2.62313   7.96987  19.52311 1.000 27.12055  ? 8   PHE A CD2  1 
ATOM   102  C CE1  . PHE A 1 8   ? 5.14210   8.74672  20.32519 1.000 36.97099  ? 8   PHE A CE1  1 
ATOM   103  C CE2  . PHE A 1 8   ? 3.40527   8.72598  18.67383 1.000 30.96624  ? 8   PHE A CE2  1 
ATOM   104  C CZ   . PHE A 1 8   ? 4.68313   9.11249  19.06891 1.000 33.26752  ? 8   PHE A CZ   1 
ATOM   105  H H    . PHE A 1 8   ? 3.47010   4.55731  22.25183 1.000 32.75559  ? 8   PHE A H    1 
ATOM   106  H HA   . PHE A 1 8   ? 3.36947   7.02132  23.39019 1.000 35.07187  ? 8   PHE A HA   1 
ATOM   107  H HB2  . PHE A 1 8   ? 1.86204   6.06715  21.17773 1.000 37.14446  ? 8   PHE A HB2  1 
ATOM   108  H HB3  . PHE A 1 8   ? 1.47271   7.40269  21.94596 1.000 37.14446  ? 8   PHE A HB3  1 
ATOM   109  H HD1  . PHE A 1 8   ? 4.61373   7.78603  22.02808 1.000 40.48375  ? 8   PHE A HD1  1 
ATOM   110  H HD2  . PHE A 1 8   ? 1.77517   7.70509  19.24787 1.000 32.43234  ? 8   PHE A HD2  1 
ATOM   111  H HE1  . PHE A 1 8   ? 5.99545   8.99287  20.60108 1.000 44.25288  ? 8   PHE A HE1  1 
ATOM   112  H HE2  . PHE A 1 8   ? 3.07951   8.97671  17.83962 1.000 37.04717  ? 8   PHE A HE2  1 
ATOM   113  H HZ   . PHE A 1 8   ? 5.22227   9.60989  18.49722 1.000 39.80870  ? 8   PHE A HZ   1 
ATOM   114  N N    . ASP A 1 9   ? 1.46798   6.49351  24.93382 1.000 29.68776  ? 9   ASP A N    1 
ATOM   115  C CA   . ASP A 1 9   ? 0.26446   6.24084  25.73100 1.000 25.77840  ? 9   ASP A CA   1 
ATOM   116  C C    . ASP A 1 9   ? -0.82939  7.19431  25.25863 1.000 26.03904  ? 9   ASP A C    1 
ATOM   117  O O    . ASP A 1 9   ? -0.74665  8.40480  25.48490 1.000 26.38530  ? 9   ASP A O    1 
ATOM   118  C CB   . ASP A 1 9   ? 0.55494   6.43427  27.21434 1.000 29.14978  ? 9   ASP A CB   1 
ATOM   119  C CG   . ASP A 1 9   ? 1.43582   5.31945  27.79141 1.000 37.32857  ? 9   ASP A CG   1 
ATOM   120  O OD1  . ASP A 1 9   ? 1.41172   4.19544  27.23501 1.000 34.96531  ? 9   ASP A OD1  1 
ATOM   121  O OD2  . ASP A 1 9   ? 2.15060   5.55941  28.79954 1.000 35.73250  ? 9   ASP A OD2  1 
ATOM   122  H H    . ASP A 1 9   ? 1.91448   7.17917  25.19859 1.000 35.51300  ? 9   ASP A H    1 
ATOM   123  H HA   . ASP A 1 9   ? -0.03591  5.32910  25.59169 1.000 30.82176  ? 9   ASP A HA   1 
ATOM   124  H HB2  . ASP A 1 9   ? 1.01705   7.27791  27.33937 1.000 34.86742  ? 9   ASP A HB2  1 
ATOM   125  H HB3  . ASP A 1 9   ? -0.28279  6.43923  27.70329 1.000 34.86742  ? 9   ASP A HB3  1 
ATOM   126  N N    . ILE A 1 10  ? -1.80464  6.66042  24.54425 1.000 29.00054  ? 10  ILE A N    1 
ATOM   127  C CA   . ILE A 1 10  ? -2.86282  7.43736  23.90992 1.000 25.83766  ? 10  ILE A CA   1 
ATOM   128  C C    . ILE A 1 10  ? -4.02365  7.66012  24.87533 1.000 23.91845  ? 10  ILE A C    1 
ATOM   129  O O    . ILE A 1 10  ? -4.40780  6.78211  25.65190 1.000 24.24543  ? 10  ILE A O    1 
ATOM   130  C CB   . ILE A 1 10  ? -3.33821  6.72113  22.63401 1.000 24.90681  ? 10  ILE A CB   1 
ATOM   131  C CG1  . ILE A 1 10  ? -2.15471  6.47084  21.70408 1.000 26.95523  ? 10  ILE A CG1  1 
ATOM   132  C CG2  . ILE A 1 10  ? -4.41864  7.52276  21.97114 1.000 26.01975  ? 10  ILE A CG2  1 
ATOM   133  C CD1  . ILE A 1 10  ? -1.48355  7.73074  21.20922 1.000 30.39039  ? 10  ILE A CD1  1 
ATOM   134  H H    . ILE A 1 10  ? -1.88144  5.81531  24.40462 1.000 34.68834  ? 10  ILE A H    1 
ATOM   135  H HA   . ILE A 1 10  ? -2.51066  8.31252  23.68414 1.000 30.89288  ? 10  ILE A HA   1 
ATOM   136  H HB   . ILE A 1 10  ? -3.71318  5.85722  22.86631 1.000 29.77586  ? 10  ILE A HB   1 
ATOM   137  H HG12 . ILE A 1 10  ? -1.48951  5.95019  22.18087 1.000 32.23396  ? 10  ILE A HG12 1 
ATOM   138  H HG13 . ILE A 1 10  ? -2.46739  5.97923  20.92854 1.000 32.23396  ? 10  ILE A HG13 1 
ATOM   139  H HG21 . ILE A 1 10  ? -4.56324  7.17844  21.07591 1.000 31.11138  ? 10  ILE A HG21 1 
ATOM   140  H HG22 . ILE A 1 10  ? -5.23378  7.44494  22.49113 1.000 31.11138  ? 10  ILE A HG22 1 
ATOM   141  H HG23 . ILE A 1 10  ? -4.14141  8.45128  21.92764 1.000 31.11138  ? 10  ILE A HG23 1 
ATOM   142  H HD11 . ILE A 1 10  ? -0.78600  7.49050  20.57945 1.000 36.35615  ? 10  ILE A HD11 1 
ATOM   143  H HD12 . ILE A 1 10  ? -2.14484  8.29030  20.77277 1.000 36.35615  ? 10  ILE A HD12 1 
ATOM   144  H HD13 . ILE A 1 10  ? -1.09894  8.20146  21.96513 1.000 36.35615  ? 10  ILE A HD13 1 
ATOM   145  N N    . ALA A 1 11  ? -4.58291  8.85461  24.82915 1.000 27.31497  ? 11  ALA A N    1 
ATOM   146  C CA   . ALA A 1 11  ? -5.75936  9.21629  25.60845 1.000 30.62178  ? 11  ALA A CA   1 
ATOM   147  C C    . ALA A 1 11  ? -6.80187  9.84906  24.68339 1.000 28.64329  ? 11  ALA A C    1 
ATOM   148  O O    . ALA A 1 11  ? -6.46822  10.58815 23.74999 1.000 26.69747  ? 11  ALA A O    1 
ATOM   149  C CB   . ALA A 1 11  ? -5.38920  10.17386 26.76920 1.000 27.58649  ? 11  ALA A CB   1 
ATOM   150  H H    . ALA A 1 11  ? -4.29169  9.49754  24.33780 1.000 32.66565  ? 11  ALA A H    1 
ATOM   151  H HA   . ALA A 1 11  ? -6.15841  8.42422  26.00124 1.000 36.63382  ? 11  ALA A HA   1 
ATOM   152  H HB1  . ALA A 1 11  ? -6.19150  10.38660 27.27114 1.000 32.99147  ? 11  ALA A HB1  1 
ATOM   153  H HB2  . ALA A 1 11  ? -4.74428  9.73591  27.34642 1.000 32.99147  ? 11  ALA A HB2  1 
ATOM   154  H HB3  . ALA A 1 11  ? -5.00550  10.98450 26.39969 1.000 32.99147  ? 11  ALA A HB3  1 
ATOM   155  N N    . VAL A 1 12  ? -8.06849  9.53075  24.93177 1.000 30.73798  ? 12  VAL A N    1 
ATOM   156  C CA   . VAL A 1 12  ? -9.19078  10.08803 24.18647 1.000 31.33376  ? 12  VAL A CA   1 
ATOM   157  C C    . VAL A 1 12  ? -9.95307  10.98671 25.13219 1.000 26.58981  ? 12  VAL A C    1 
ATOM   158  O O    . VAL A 1 12  ? -10.49019 10.52113 26.14065 1.000 30.94768  ? 12  VAL A O    1 
ATOM   159  C CB   . VAL A 1 12  ? -10.08907 8.98894  23.60236 1.000 34.72462  ? 12  VAL A CB   1 
ATOM   160  C CG1  . VAL A 1 12  ? -11.15957 9.58177  22.70679 1.000 33.19861  ? 12  VAL A CG1  1 
ATOM   161  C CG2  . VAL A 1 12  ? -9.21884  7.99127  22.81971 1.000 32.86671  ? 12  VAL A CG2  1 
ATOM   162  H H    . VAL A 1 12  ? -8.30865  8.97796  25.54525 1.000 36.77326  ? 12  VAL A H    1 
ATOM   163  H HA   . VAL A 1 12  ? -8.86316  10.62393 23.44730 1.000 37.48820  ? 12  VAL A HA   1 
ATOM   164  H HB   . VAL A 1 12  ? -10.54096 8.52291  24.32313 1.000 41.55723  ? 12  VAL A HB   1 
ATOM   165  H HG11 . VAL A 1 12  ? -11.65194 8.86111  22.28356 1.000 39.72602  ? 12  VAL A HG11 1 
ATOM   166  H HG12 . VAL A 1 12  ? -11.75968 10.12037 23.24594 1.000 39.72602  ? 12  VAL A HG12 1 
ATOM   167  H HG13 . VAL A 1 12  ? -10.73591 10.13422 22.03135 1.000 39.72602  ? 12  VAL A HG13 1 
ATOM   168  H HG21 . VAL A 1 12  ? -9.79306  7.32718  22.40721 1.000 39.32774  ? 12  VAL A HG21 1 
ATOM   169  H HG22 . VAL A 1 12  ? -8.72462  8.47123  22.13686 1.000 39.32774  ? 12  VAL A HG22 1 
ATOM   170  H HG23 . VAL A 1 12  ? -8.60275  7.56080  23.43292 1.000 39.32774  ? 12  VAL A HG23 1 
ATOM   171  N N    . ASP A 1 13  ? -10.01251 12.26642 24.79380 1.000 31.78730  ? 13  ASP A N    1 
ATOM   172  C CA   . ASP A 1 13  ? -10.56831 13.29312 25.66899 1.000 34.67334  ? 13  ASP A CA   1 
ATOM   173  C C    . ASP A 1 13  ? -10.11536 13.08872 27.11338 1.000 30.10355  ? 13  ASP A C    1 
ATOM   174  O O    . ASP A 1 13  ? -10.90857 13.12416 28.05381 1.000 31.56342  ? 13  ASP A O    1 
ATOM   175  C CB   . ASP A 1 13  ? -12.09706 13.31951 25.57567 1.000 37.52746  ? 13  ASP A CB   1 
ATOM   176  C CG   . ASP A 1 13  ? -12.60617 14.14105 24.40843 1.000 39.97991  ? 13  ASP A CG   1 
ATOM   177  O OD1  . ASP A 1 13  ? -11.78213 14.77745 23.71314 1.000 36.72432  ? 13  ASP A OD1  1 
ATOM   178  O OD2  . ASP A 1 13  ? -13.84282 14.14397 24.18579 1.000 43.24404  ? 13  ASP A OD2  1 
ATOM   179  H H    . ASP A 1 13  ? -9.73023  12.57558 24.04258 1.000 38.03244  ? 13  ASP A H    1 
ATOM   180  H HA   . ASP A 1 13  ? -10.23267 14.15487 25.37636 1.000 41.49569  ? 13  ASP A HA   1 
ATOM   181  H HB2  . ASP A 1 13  ? -12.42166 12.41200 25.46631 1.000 44.92064  ? 13  ASP A HB2  1 
ATOM   182  H HB3  . ASP A 1 13  ? -12.45578 13.70419 26.39068 1.000 44.92064  ? 13  ASP A HB3  1 
ATOM   183  N N    . GLY A 1 14  ? -8.81523  12.87245 27.28374 1.000 33.43678  ? 14  GLY A N    1 
ATOM   184  C CA   . GLY A 1 14  ? -8.22165  12.73302 28.59008 1.000 28.57668  ? 14  GLY A CA   1 
ATOM   185  C C    . GLY A 1 14  ? -8.34068  11.36659 29.21417 1.000 27.72577  ? 14  GLY A C    1 
ATOM   186  O O    . GLY A 1 14  ? -7.81470  11.16970 30.30777 1.000 29.02733  ? 14  GLY A O    1 
ATOM   187  H H    . GLY A 1 14  ? -8.25046  12.80232 26.63898 1.000 40.01182  ? 14  GLY A H    1 
ATOM   188  H HA2  . GLY A 1 14  ? -7.27711  12.94346 28.52325 1.000 34.17970  ? 14  GLY A HA2  1 
ATOM   189  H HA3  . GLY A 1 14  ? -8.64479  13.36708 29.18992 1.000 34.17970  ? 14  GLY A HA3  1 
ATOM   190  N N    . GLU A 1 15  ? -9.01118  10.44726 28.59230 1.000 32.40629  ? 15  GLU A N    1 
ATOM   191  C CA   . GLU A 1 15  ? -9.23376  9.12375  29.16773 1.000 38.04167  ? 15  GLU A CA   1 
ATOM   192  C C    . GLU A 1 15  ? -8.29342  8.10401  28.54243 1.000 32.46698  ? 15  GLU A C    1 
ATOM   193  O O    . GLU A 1 15  ? -8.20397  8.00856  27.31315 1.000 29.22502  ? 15  GLU A O    1 
ATOM   194  C CB   . GLU A 1 15  ? -10.68757 8.69551  28.96555 1.000 39.10754  ? 15  GLU A CB   1 
ATOM   195  C CG   . GLU A 1 15  ? -11.12366 7.56953  29.86287 1.000 54.38351  ? 15  GLU A CG   1 
ATOM   196  C CD   . GLU A 1 15  ? -12.63439 7.53049  30.07862 1.000 71.60410  ? 15  GLU A CD   1 
ATOM   197  O OE1  . GLU A 1 15  ? -13.37113 8.24250  29.35500 1.000 61.17723  ? 15  GLU A OE1  1 
ATOM   198  O OE2  . GLU A 1 15  ? -13.08361 6.78296  30.98088 1.000 76.03021  ? 15  GLU A OE2  1 
ATOM   199  H H    . GLU A 1 15  ? -9.36401  10.54999 27.81476 1.000 38.77523  ? 15  GLU A H    1 
ATOM   200  H HA   . GLU A 1 15  ? -9.05169  9.15108  30.12010 1.000 45.53769  ? 15  GLU A HA   1 
ATOM   201  H HB2  . GLU A 1 15  ? -11.26330 9.45541  29.14439 1.000 46.81674  ? 15  GLU A HB2  1 
ATOM   202  H HB3  . GLU A 1 15  ? -10.80061 8.40236  28.04785 1.000 46.81674  ? 15  GLU A HB3  1 
ATOM   203  H HG2  . GLU A 1 15  ? -10.85675 6.72677  29.46361 1.000 65.14790  ? 15  GLU A HG2  1 
ATOM   204  H HG3  . GLU A 1 15  ? -10.70050 7.67492  30.72931 1.000 65.14790  ? 15  GLU A HG3  1 
ATOM   205  N N    . PRO A 1 16  ? -7.57325  7.33278  29.33965 1.000 33.88828  ? 16  PRO A N    1 
ATOM   206  C CA   . PRO A 1 16  ? -6.60042  6.40509  28.76267 1.000 31.79435  ? 16  PRO A CA   1 
ATOM   207  C C    . PRO A 1 16  ? -7.25737  5.43664  27.79708 1.000 28.87484  ? 16  PRO A C    1 
ATOM   208  O O    . PRO A 1 16  ? -8.35319  4.94255  28.04361 1.000 33.84954  ? 16  PRO A O    1 
ATOM   209  C CB   . PRO A 1 16  ? -6.04158  5.67886  29.98618 1.000 35.63601  ? 16  PRO A CB   1 
ATOM   210  C CG   . PRO A 1 16  ? -6.24520  6.61869  31.13045 1.000 32.24404  ? 16  PRO A CG   1 
ATOM   211  C CD   . PRO A 1 16  ? -7.52434  7.34981  30.81208 1.000 45.05242  ? 16  PRO A CD   1 
ATOM   212  H HA   . PRO A 1 16  ? -5.89283  6.88902  28.30876 1.000 38.04090  ? 16  PRO A HA   1 
ATOM   213  H HB2  . PRO A 1 16  ? -6.52730  4.85122  30.12761 1.000 42.65090  ? 16  PRO A HB2  1 
ATOM   214  H HB3  . PRO A 1 16  ? -5.09876  5.49204  29.85548 1.000 42.65090  ? 16  PRO A HB3  1 
ATOM   215  H HG2  . PRO A 1 16  ? -6.32814  6.11918  31.95780 1.000 38.58053  ? 16  PRO A HG2  1 
ATOM   216  H HG3  . PRO A 1 16  ? -5.49872  7.23536  31.18863 1.000 38.58053  ? 16  PRO A HG3  1 
ATOM   217  H HD2  . PRO A 1 16  ? -8.28890  6.88567  31.18747 1.000 53.95058  ? 16  PRO A HD2  1 
ATOM   218  H HD3  . PRO A 1 16  ? -7.49265  8.26030  31.14511 1.000 53.95058  ? 16  PRO A HD3  1 
ATOM   219  N N    . LEU A 1 17  ? -6.57421  5.16958  26.69073 1.000 26.70664  ? 17  LEU A N    1 
ATOM   220  C CA   . LEU A 1 17  ? -7.04315  4.25840  25.65522 1.000 24.95317  ? 17  LEU A CA   1 
ATOM   221  C C    . LEU A 1 17  ? -6.13276  3.05523  25.48374 1.000 25.54901  ? 17  LEU A C    1 
ATOM   222  O O    . LEU A 1 17  ? -6.60982  1.92378  25.42999 1.000 25.38752  ? 17  LEU A O    1 
ATOM   223  C CB   . LEU A 1 17  ? -7.15496  5.02188  24.32603 1.000 27.33748  ? 17  LEU A CB   1 
ATOM   224  C CG   . LEU A 1 17  ? -7.44977  4.19362  23.07103 1.000 26.45999  ? 17  LEU A CG   1 
ATOM   225  C CD1  . LEU A 1 17  ? -8.77178  3.50908  23.21797 1.000 27.96014  ? 17  LEU A CD1  1 
ATOM   226  C CD2  . LEU A 1 17  ? -7.43537  5.03792  21.81562 1.000 28.94367  ? 17  LEU A CD2  1 
ATOM   227  H H    . LEU A 1 17  ? -5.80825  5.51661  26.51049 1.000 31.93566  ? 17  LEU A H    1 
ATOM   228  H HA   . LEU A 1 17  ? -7.92180  3.92637  25.89736 1.000 29.83149  ? 17  LEU A HA   1 
ATOM   229  H HB2  . LEU A 1 17  ? -7.87232  5.66898  24.41291 1.000 32.69266  ? 17  LEU A HB2  1 
ATOM   230  H HB3  . LEU A 1 17  ? -6.31307  5.47850  24.17234 1.000 32.69266  ? 17  LEU A HB3  1 
ATOM   231  H HG   . LEU A 1 17  ? -6.75050  3.52864  22.97246 1.000 31.63967  ? 17  LEU A HG   1 
ATOM   232  H HD11 . LEU A 1 17  ? -8.97736  3.03922  22.39464 1.000 33.43985  ? 17  LEU A HD11 1 
ATOM   233  H HD12 . LEU A 1 17  ? -8.72138  2.87965  23.95430 1.000 33.43985  ? 17  LEU A HD12 1 
ATOM   234  H HD13 . LEU A 1 17  ? -9.45386  4.17486  23.39803 1.000 33.43985  ? 17  LEU A HD13 1 
ATOM   235  H HD21 . LEU A 1 17  ? -7.59462  4.46596  21.04855 1.000 34.62009  ? 17  LEU A HD21 1 
ATOM   236  H HD22 . LEU A 1 17  ? -8.13294  5.70900  21.87835 1.000 34.62009  ? 17  LEU A HD22 1 
ATOM   237  H HD23 . LEU A 1 17  ? -6.56952  5.46748  21.73386 1.000 34.62009  ? 17  LEU A HD23 1 
ATOM   238  N N    . GLY A 1 18  ? -4.82901  3.26192  25.39005 1.000 26.35525  ? 18  GLY A N    1 
ATOM   239  C CA   . GLY A 1 18  ? -3.91716  2.14926  25.22457 1.000 31.08713  ? 18  GLY A CA   1 
ATOM   240  C C    . GLY A 1 18  ? -2.53024  2.62484  24.85132 1.000 24.66344  ? 18  GLY A C    1 
ATOM   241  O O    . GLY A 1 18  ? -2.26378  3.82092  24.73282 1.000 24.70132  ? 18  GLY A O    1 
ATOM   242  H H    . GLY A 1 18  ? -4.45072  4.03369  25.41946 1.000 31.51398  ? 18  GLY A H    1 
ATOM   243  H HA2  . GLY A 1 18  ? -3.86022  1.64885  26.05357 1.000 37.19225  ? 18  GLY A HA2  1 
ATOM   244  H HA3  . GLY A 1 18  ? -4.24256  1.56307  24.52357 1.000 37.19225  ? 18  GLY A HA3  1 
ATOM   245  N N    . ARG A 1 19  ? -1.65109  1.65111  24.64567 1.000 27.20537  ? 19  ARG A N    1 
ATOM   246  C CA   . ARG A 1 19  ? -0.24949  1.89745  24.33696 1.000 25.56767  ? 19  ARG A CA   1 
ATOM   247  C C    . ARG A 1 19  ? 0.05168   1.44618  22.92068 1.000 21.42419  ? 19  ARG A C    1 
ATOM   248  O O    . ARG A 1 19  ? -0.35684  0.36511  22.51237 1.000 23.02177  ? 19  ARG A O    1 
ATOM   249  C CB   . ARG A 1 19  ? 0.65675   1.17126  25.33759 1.000 29.15368  ? 19  ARG A CB   1 
ATOM   250  C CG   . ARG A 1 19  ? 2.13858   1.27743  25.04141 1.000 34.03715  ? 19  ARG A CG   1 
ATOM   251  C CD   . ARG A 1 19  ? 3.00458   0.87119  26.21998 1.000 35.99939  ? 19  ARG A CD   1 
ATOM   252  N NE   . ARG A 1 19  ? 3.02168   1.89402  27.25626 1.000 37.19286  ? 19  ARG A NE   1 
ATOM   253  C CZ   . ARG A 1 19  ? 3.93208   1.97016  28.21262 1.000 32.85341  ? 19  ARG A CZ   1 
ATOM   254  N NH1  . ARG A 1 19  ? 4.88955   1.07363  28.26826 1.000 32.94225  ? 19  ARG A NH1  1 
ATOM   255  N NH2  . ARG A 1 19  ? 3.87021   2.93955  29.11052 1.000 34.87151  ? 19  ARG A NH2  1 
ATOM   256  H H    . ARG A 1 19  ? -1.84971  0.81510  24.68090 1.000 32.53413  ? 19  ARG A H    1 
ATOM   257  H HA   . ARG A 1 19  ? -0.06618  2.84856  24.38874 1.000 30.56889  ? 19  ARG A HA   1 
ATOM   258  H HB2  . ARG A 1 19  ? 0.50714   1.54813  26.21878 1.000 34.87210  ? 19  ARG A HB2  1 
ATOM   259  H HB3  . ARG A 1 19  ? 0.42516   0.22932  25.33593 1.000 34.87210  ? 19  ARG A HB3  1 
ATOM   260  H HG2  . ARG A 1 19  ? 2.35476   0.69516  24.29634 1.000 40.73226  ? 19  ARG A HG2  1 
ATOM   261  H HG3  . ARG A 1 19  ? 2.35116   2.19675  24.81657 1.000 40.73226  ? 19  ARG A HG3  1 
ATOM   262  H HD2  . ARG A 1 19  ? 2.65550   0.05287  26.60651 1.000 43.08696  ? 19  ARG A HD2  1 
ATOM   263  H HD3  . ARG A 1 19  ? 3.91491   0.73217  25.91524 1.000 43.08696  ? 19  ARG A HD3  1 
ATOM   264  H HE   . ARG A 1 19  ? 2.39918   2.48731  27.24575 1.000 44.51911  ? 19  ARG A HE   1 
ATOM   265  H HH11 . ARG A 1 19  ? 4.92183   0.44224  27.68524 1.000 39.41839  ? 19  ARG A HH11 1 
ATOM   266  H HH12 . ARG A 1 19  ? 5.48446   1.11775  28.88772 1.000 39.41839  ? 19  ARG A HH12 1 
ATOM   267  H HH21 . ARG A 1 19  ? 3.23764   3.52095  29.07272 1.000 41.73350  ? 19  ARG A HH21 1 
ATOM   268  H HH22 . ARG A 1 19  ? 4.46256   2.98839  29.73208 1.000 41.73350  ? 19  ARG A HH22 1 
ATOM   269  N N    . VAL A 1 20  ? 0.75126   2.28592  22.17440 1.000 26.75269  ? 20  VAL A N    1 
ATOM   270  C CA   . VAL A 1 20  ? 1.22288   1.97005  20.83125 1.000 26.72183  ? 20  VAL A CA   1 
ATOM   271  C C    . VAL A 1 20  ? 2.73719   2.04477  20.87210 1.000 29.18706  ? 20  VAL A C    1 
ATOM   272  O O    . VAL A 1 20  ? 3.29152   3.04696  21.33817 1.000 29.67703  ? 20  VAL A O    1 
ATOM   273  C CB   . VAL A 1 20  ? 0.67867   2.94754  19.76714 1.000 28.40372  ? 20  VAL A CB   1 
ATOM   274  C CG1  . VAL A 1 20  ? 1.15921   2.55487  18.35249 1.000 20.62790  ? 20  VAL A CG1  1 
ATOM   275  C CG2  . VAL A 1 20  ? -0.85253  3.03428  19.84071 1.000 29.52422  ? 20  VAL A CG2  1 
ATOM   276  H H    . VAL A 1 20  ? 0.97474   3.07530  22.43233 1.000 31.99092  ? 20  VAL A H    1 
ATOM   277  H HA   . VAL A 1 20  ? 0.93361   1.07622  20.58982 1.000 31.95388  ? 20  VAL A HA   1 
ATOM   278  H HB   . VAL A 1 20  ? 1.02985   3.83274  19.95153 1.000 33.97214  ? 20  VAL A HB   1 
ATOM   279  H HG11 . VAL A 1 20  ? 0.69617   3.10159  17.69859 1.000 24.64116  ? 20  VAL A HG11 1 
ATOM   280  H HG12 . VAL A 1 20  ? 2.11563   2.70448  18.29099 1.000 24.64116  ? 20  VAL A HG12 1 
ATOM   281  H HG13 . VAL A 1 20  ? 0.96056   1.61771  18.20029 1.000 24.64116  ? 20  VAL A HG13 1 
ATOM   282  H HG21 . VAL A 1 20  ? -1.16505  3.66978  19.17786 1.000 35.31675  ? 20  VAL A HG21 1 
ATOM   283  H HG22 . VAL A 1 20  ? -1.22746  2.15785  19.66126 1.000 35.31675  ? 20  VAL A HG22 1 
ATOM   284  H HG23 . VAL A 1 20  ? -1.10987  3.32872  20.72839 1.000 35.31675  ? 20  VAL A HG23 1 
ATOM   285  N N    . SER A 1 21  ? 3.40284   1.01093  20.35872 1.000 32.06911  ? 21  SER A N    1 
ATOM   286  C CA   . SER A 1 21  ? 4.85766   0.94232  20.33849 1.000 27.01547  ? 21  SER A CA   1 
ATOM   287  C C    . SER A 1 21  ? 5.30480   0.83911  18.89756 1.000 27.05296  ? 21  SER A C    1 
ATOM   288  O O    . SER A 1 21  ? 4.62685   0.19706  18.08505 1.000 24.92839  ? 21  SER A O    1 
ATOM   289  C CB   . SER A 1 21  ? 5.39138   -0.25194 21.12397 1.000 28.94808  ? 21  SER A CB   1 
ATOM   290  O OG   . SER A 1 21  ? 5.05439   -1.48037 20.51415 1.000 33.18137  ? 21  SER A OG   1 
ATOM   291  H H    . SER A 1 21  ? 3.02222   0.32346  20.00927 1.000 38.37062  ? 21  SER A H    1 
ATOM   292  H HA   . SER A 1 21  ? 5.22724   1.74207  20.74433 1.000 32.30625  ? 21  SER A HA   1 
ATOM   293  H HB2  . SER A 1 21  ? 6.35772   -0.18441 21.17417 1.000 34.62538  ? 21  SER A HB2  1 
ATOM   294  H HB3  . SER A 1 21  ? 5.01069   -0.23276 22.01594 1.000 34.62538  ? 21  SER A HB3  1 
ATOM   295  H HG   . SER A 1 21  ? 5.40676   -2.11624 20.93499 1.000 39.70533  ? 21  SER A HG   1 
ATOM   296  N N    . PHE A 1 22  ? 6.44559   1.46462  18.59089 1.000 26.00311  ? 22  PHE A N    1 
ATOM   297  C CA   . PHE A 1 22  ? 6.96621   1.51527  17.23420 1.000 22.66091  ? 22  PHE A CA   1 
ATOM   298  C C    . PHE A 1 22  ? 8.37915   0.96561  17.21714 1.000 24.87505  ? 22  PHE A C    1 
ATOM   299  O O    . PHE A 1 22  ? 9.16516   1.24149  18.12860 1.000 25.15397  ? 22  PHE A O    1 
ATOM   300  C CB   . PHE A 1 22  ? 6.98328   2.94478  16.66333 1.000 22.97622  ? 22  PHE A CB   1 
ATOM   301  C CG   . PHE A 1 22  ? 5.66354   3.66990  16.77152 1.000 27.66849  ? 22  PHE A CG   1 
ATOM   302  C CD1  . PHE A 1 22  ? 4.70087   3.51253  15.80059 1.000 26.19567  ? 22  PHE A CD1  1 
ATOM   303  C CD2  . PHE A 1 22  ? 5.39563   4.52079  17.85040 1.000 27.22554  ? 22  PHE A CD2  1 
ATOM   304  C CE1  . PHE A 1 22  ? 3.50941   4.18269  15.89557 1.000 25.88603  ? 22  PHE A CE1  1 
ATOM   305  C CE2  . PHE A 1 22  ? 4.22587   5.16707  17.94852 1.000 27.63895  ? 22  PHE A CE2  1 
ATOM   306  C CZ   . PHE A 1 22  ? 3.26036   4.98979  16.96950 1.000 28.99912  ? 22  PHE A CZ   1 
ATOM   307  H H    . PHE A 1 22  ? 6.93887   1.87164  19.16588 1.000 31.09142  ? 22  PHE A H    1 
ATOM   308  H HA   . PHE A 1 22  ? 6.39679   0.97282  16.66639 1.000 27.08078  ? 22  PHE A HA   1 
ATOM   309  H HB2  . PHE A 1 22  ? 7.64475   3.46400  17.14682 1.000 27.45915  ? 22  PHE A HB2  1 
ATOM   310  H HB3  . PHE A 1 22  ? 7.21851   2.90063  15.72333 1.000 27.45915  ? 22  PHE A HB3  1 
ATOM   311  H HD1  . PHE A 1 22  ? 4.85954   2.94947  15.07762 1.000 31.32249  ? 22  PHE A HD1  1 
ATOM   312  H HD2  . PHE A 1 22  ? 6.04030   4.63952  18.51009 1.000 32.55834  ? 22  PHE A HD2  1 
ATOM   313  H HE1  . PHE A 1 22  ? 2.86911   4.08796  15.22778 1.000 30.95092  ? 22  PHE A HE1  1 
ATOM   314  H HE2  . PHE A 1 22  ? 4.06258   5.73146  18.66943 1.000 33.05443  ? 22  PHE A HE2  1 
ATOM   315  H HZ   . PHE A 1 22  ? 2.44018   5.42181  17.04404 1.000 34.68663  ? 22  PHE A HZ   1 
ATOM   316  N N    . GLU A 1 23  ? 8.69954   0.21708  16.15953 1.000 24.81112  ? 23  GLU A N    1 
ATOM   317  C CA   . GLU A 1 23  ? 10.07734  -0.08388 15.80586 1.000 22.21493  ? 23  GLU A CA   1 
ATOM   318  C C    . GLU A 1 23  ? 10.59231  0.99187  14.86221 1.000 22.51544  ? 23  GLU A C    1 
ATOM   319  O O    . GLU A 1 23  ? 10.02436  1.20739  13.79514 1.000 23.62398  ? 23  GLU A O    1 
ATOM   320  C CB   . GLU A 1 23  ? 10.18918  -1.45485 15.15160 1.000 28.04430  ? 23  GLU A CB   1 
ATOM   321  C CG   . GLU A 1 23  ? 11.63418  -1.81308 14.75884 1.000 30.92869  ? 23  GLU A CG   1 
ATOM   322  C CD   . GLU A 1 23  ? 11.73005  -3.13206 14.04203 1.000 41.65778  ? 23  GLU A CD   1 
ATOM   323  O OE1  . GLU A 1 23  ? 12.55847  -3.22874 13.11457 1.000 42.13825  ? 23  GLU A OE1  1 
ATOM   324  O OE2  . GLU A 1 23  ? 10.98259  -4.07617 14.40188 1.000 51.48771  ? 23  GLU A OE2  1 
ATOM   325  H H    . GLU A 1 23  ? 8.12267   -0.13151 15.62540 1.000 29.66103  ? 23  GLU A H    1 
ATOM   326  H HA   . GLU A 1 23  ? 10.61898  -0.08708 16.61054 1.000 26.54561  ? 23  GLU A HA   1 
ATOM   327  H HB2  . GLU A 1 23  ? 9.87159   -2.12802 15.77360 1.000 33.54084  ? 23  GLU A HB2  1 
ATOM   328  H HB3  . GLU A 1 23  ? 9.64803   -1.46527 14.34664 1.000 33.54084  ? 23  GLU A HB3  1 
ATOM   329  H HG2  . GLU A 1 23  ? 11.98179  -1.12522 14.16984 1.000 37.00212  ? 23  GLU A HG2  1 
ATOM   330  H HG3  . GLU A 1 23  ? 12.17606  -1.86742 15.56153 1.000 37.00212  ? 23  GLU A HG3  1 
ATOM   331  N N    . LEU A 1 24  ? 11.67412  1.64413  15.25014 1.000 28.17735  ? 24  LEU A N    1 
ATOM   332  C CA   . LEU A 1 24  ? 12.33202  2.66220  14.44586 1.000 28.29719  ? 24  LEU A CA   1 
ATOM   333  C C    . LEU A 1 24  ? 13.48941  2.01142  13.70210 1.000 30.20597  ? 24  LEU A C    1 
ATOM   334  O O    . LEU A 1 24  ? 14.37593  1.42902  14.33150 1.000 30.97094  ? 24  LEU A O    1 
ATOM   335  C CB   . LEU A 1 24  ? 12.84268  3.78919  15.33781 1.000 27.88586  ? 24  LEU A CB   1 
ATOM   336  C CG   . LEU A 1 24  ? 11.80686  4.39575  16.26738 1.000 27.22056  ? 24  LEU A CG   1 
ATOM   337  C CD1  . LEU A 1 24  ? 12.31164  5.66352  16.89503 1.000 25.81348  ? 24  LEU A CD1  1 
ATOM   338  C CD2  . LEU A 1 24  ? 10.47450  4.62250  15.52487 1.000 24.21155  ? 24  LEU A CD2  1 
ATOM   339  H H    . LEU A 1 24  ? 12.06274  1.51041  16.00559 1.000 33.70050  ? 24  LEU A H    1 
ATOM   340  H HA   . LEU A 1 24  ? 11.71104  3.03268  13.79931 1.000 33.84431  ? 24  LEU A HA   1 
ATOM   341  H HB2  . LEU A 1 24  ? 13.56041  3.44103  15.88967 1.000 33.35072  ? 24  LEU A HB2  1 
ATOM   342  H HB3  . LEU A 1 24  ? 13.17637  4.50126  14.76992 1.000 33.35072  ? 24  LEU A HB3  1 
ATOM   343  H HG   . LEU A 1 24  ? 11.63582  3.77266  16.99084 1.000 32.55236  ? 24  LEU A HG   1 
ATOM   344  H HD11 . LEU A 1 24  ? 11.65646  5.98127  17.53587 1.000 30.86386  ? 24  LEU A HD11 1 
ATOM   345  H HD12 . LEU A 1 24  ? 13.15187  5.48086  17.34396 1.000 30.86386  ? 24  LEU A HD12 1 
ATOM   346  H HD13 . LEU A 1 24  ? 12.44499  6.32810  16.20116 1.000 30.86386  ? 24  LEU A HD13 1 
ATOM   347  H HD21 . LEU A 1 24  ? 9.91081   5.20445  16.05823 1.000 28.94154  ? 24  LEU A HD21 1 
ATOM   348  H HD22 . LEU A 1 24  ? 10.65766  5.03532  14.66643 1.000 28.94154  ? 24  LEU A HD22 1 
ATOM   349  H HD23 . LEU A 1 24  ? 10.03647  3.76702  15.39378 1.000 28.94154  ? 24  LEU A HD23 1 
ATOM   350  N N    . PHE A 1 25  ? 13.48259  2.11033  12.37106 1.000 32.91440  ? 25  PHE A N    1 
ATOM   351  C CA   . PHE A 1 25  ? 14.49821  1.46856  11.53091 1.000 32.10438  ? 25  PHE A CA   1 
ATOM   352  C C    . PHE A 1 25  ? 15.72463  2.38039  11.45117 1.000 29.00317  ? 25  PHE A C    1 
ATOM   353  O O    . PHE A 1 25  ? 16.06217  2.95971  10.41828 1.000 28.21629  ? 25  PHE A O    1 
ATOM   354  C CB   . PHE A 1 25  ? 13.93873  1.16438  10.14703 1.000 27.34458  ? 25  PHE A CB   1 
ATOM   355  C CG   . PHE A 1 25  ? 12.69080  0.34095  10.15941 1.000 26.54893  ? 25  PHE A CG   1 
ATOM   356  C CD1  . PHE A 1 25  ? 12.66433  -0.88979 10.76856 1.000 31.78387  ? 25  PHE A CD1  1 
ATOM   357  C CD2  . PHE A 1 25  ? 11.55130  0.78488  9.52573  1.000 30.32795  ? 25  PHE A CD2  1 
ATOM   358  C CE1  . PHE A 1 25  ? 11.51179  -1.64835 10.77151 1.000 36.23772  ? 25  PHE A CE1  1 
ATOM   359  C CE2  . PHE A 1 25  ? 10.39443  0.01011  9.48850  1.000 27.33855  ? 25  PHE A CE2  1 
ATOM   360  C CZ   . PHE A 1 25  ? 10.36649  -1.19334 10.12612 1.000 29.26857  ? 25  PHE A CZ   1 
ATOM   361  H H    . PHE A 1 25  ? 12.89279  2.54913  11.92475 1.000 39.38496  ? 25  PHE A H    1 
ATOM   362  H HA   . PHE A 1 25  ? 14.76111  0.62942  11.94032 1.000 38.41294  ? 25  PHE A HA   1 
ATOM   363  H HB2  . PHE A 1 25  ? 13.73400  2.00259  9.70387  1.000 32.70118  ? 25  PHE A HB2  1 
ATOM   364  H HB3  . PHE A 1 25  ? 14.60812  0.67689  9.64188  1.000 32.70118  ? 25  PHE A HB3  1 
ATOM   365  H HD1  . PHE A 1 25  ? 13.43069  -1.21500 11.18307 1.000 38.02833  ? 25  PHE A HD1  1 
ATOM   366  H HD2  . PHE A 1 25  ? 11.55440  1.61893  9.11434  1.000 36.28122  ? 25  PHE A HD2  1 
ATOM   367  H HE1  . PHE A 1 25  ? 11.50053  -2.46950 11.20797 1.000 43.37295  ? 25  PHE A HE1  1 
ATOM   368  H HE2  . PHE A 1 25  ? 9.64410   0.31318  9.03019  1.000 32.69395  ? 25  PHE A HE2  1 
ATOM   369  H HZ   . PHE A 1 25  ? 9.59009   -1.70528 10.12994 1.000 35.00996  ? 25  PHE A HZ   1 
ATOM   370  N N    . ALA A 1 26  ? 16.37840  2.54093  12.59655 1.000 29.89431  ? 26  ALA A N    1 
ATOM   371  C CA   . ALA A 1 26  ? 17.59483  3.34436  12.62877 1.000 32.69674  ? 26  ALA A CA   1 
ATOM   372  C C    . ALA A 1 26  ? 18.67522  2.76128  11.72588 1.000 27.07317  ? 26  ALA A C    1 
ATOM   373  O O    . ALA A 1 26  ? 19.52822  3.49598  11.21913 1.000 26.99833  ? 26  ALA A O    1 
ATOM   374  C CB   . ALA A 1 26  ? 18.09155  3.46299  14.06924 1.000 28.44327  ? 26  ALA A CB   1 
ATOM   375  H H    . ALA A 1 26  ? 16.14501  2.20354  13.35239 1.000 35.76086  ? 26  ALA A H    1 
ATOM   376  H HA   . ALA A 1 26  ? 17.39840  4.23776  12.30605 1.000 39.12377  ? 26  ALA A HA   1 
ATOM   377  H HB1  . ALA A 1 26  ? 18.90459  3.99188  14.08037 1.000 34.01961  ? 26  ALA A HB1  1 
ATOM   378  H HB2  . ALA A 1 26  ? 17.40802  3.89582  14.60435 1.000 34.01961  ? 26  ALA A HB2  1 
ATOM   379  H HB3  . ALA A 1 26  ? 18.26994  2.57480  14.41593 1.000 34.01961  ? 26  ALA A HB3  1 
ATOM   380  N N    . ASP A 1 27  ? 18.64045  1.45413  11.49170 1.000 27.91394  ? 27  ASP A N    1 
ATOM   381  C CA   . ASP A 1 27  ? 19.62890  0.83024  10.62062 1.000 32.62471  ? 27  ASP A CA   1 
ATOM   382  C C    . ASP A 1 27  ? 19.50445  1.30111  9.16845  1.000 28.46300  ? 27  ASP A C    1 
ATOM   383  O O    . ASP A 1 27  ? 20.48847  1.26762  8.42536  1.000 27.48469  ? 27  ASP A O    1 
ATOM   384  C CB   . ASP A 1 27  ? 19.50082  -0.69887 10.73422 1.000 26.27032  ? 27  ASP A CB   1 
ATOM   385  C CG   . ASP A 1 27  ? 18.15944  -1.21827 10.25958 1.000 34.55026  ? 27  ASP A CG   1 
ATOM   386  O OD1  . ASP A 1 27  ? 17.12732  -0.53538 10.47153 1.000 32.66568  ? 27  ASP A OD1  1 
ATOM   387  O OD2  . ASP A 1 27  ? 18.12317  -2.30791 9.64773  1.000 37.70277  ? 27  ASP A OD2  1 
ATOM   388  H H    . ASP A 1 27  ? 18.06107  0.91062  11.82112 1.000 33.38441  ? 27  ASP A H    1 
ATOM   389  H HA   . ASP A 1 27  ? 20.52011  1.08064  10.91035 1.000 39.03734  ? 27  ASP A HA   1 
ATOM   390  H HB2  . ASP A 1 27  ? 20.19042  -1.11384 10.19278 1.000 31.41207  ? 27  ASP A HB2  1 
ATOM   391  H HB3  . ASP A 1 27  ? 19.60895  -0.95590 11.66327 1.000 31.41207  ? 27  ASP A HB3  1 
ATOM   392  N N    . LYS A 1 28  ? 18.31377  1.71264  8.74180  1.000 29.36346  ? 28  LYS A N    1 
ATOM   393  C CA   . LYS A 1 28  ? 18.04200  2.10700  7.36870  1.000 27.99223  ? 28  LYS A CA   1 
ATOM   394  C C    . LYS A 1 28  ? 17.81945  3.59119  7.18659  1.000 26.66737  ? 28  LYS A C    1 
ATOM   395  O O    . LYS A 1 28  ? 18.19921  4.11920  6.14058  1.000 25.24669  ? 28  LYS A O    1 
ATOM   396  C CB   . LYS A 1 28  ? 16.80776  1.36967  6.85046  1.000 33.33535  ? 28  LYS A CB   1 
ATOM   397  C CG   . LYS A 1 28  ? 17.05097  -0.10340 6.58476  1.000 45.05668  ? 28  LYS A CG   1 
ATOM   398  C CD   . LYS A 1 28  ? 15.91163  -0.71473 5.78011  1.000 55.89342  ? 28  LYS A CD   1 
ATOM   399  C CE   . LYS A 1 28  ? 16.28633  -2.09323 5.23710  1.000 77.05618  ? 28  LYS A CE   1 
ATOM   400  N NZ   . LYS A 1 28  ? 17.44981  -2.01446 4.30726  1.000 77.14385  ? 28  LYS A NZ   1 
ATOM   401  H H    . LYS A 1 28  ? 17.62283  1.77340  9.25025  1.000 35.12384  ? 28  LYS A H    1 
ATOM   402  H HA   . LYS A 1 28  ? 18.80289  1.85612  6.82187  1.000 33.47837  ? 28  LYS A HA   1 
ATOM   403  H HB2  . LYS A 1 28  ? 16.10105  1.43986  7.51118  1.000 39.89010  ? 28  LYS A HB2  1 
ATOM   404  H HB3  . LYS A 1 28  ? 16.52532  1.77928  6.01779  1.000 39.89010  ? 28  LYS A HB3  1 
ATOM   405  H HG2  . LYS A 1 28  ? 17.87263  -0.20843 6.08004  1.000 53.95570  ? 28  LYS A HG2  1 
ATOM   406  H HG3  . LYS A 1 28  ? 17.11742  -0.57643 7.42898  1.000 53.95570  ? 28  LYS A HG3  1 
ATOM   407  H HD2  . LYS A 1 28  ? 15.13256  -0.81283 6.34960  1.000 66.95978  ? 28  LYS A HD2  1 
ATOM   408  H HD3  . LYS A 1 28  ? 15.70293  -0.13758 5.02895  1.000 66.95978  ? 28  LYS A HD3  1 
ATOM   409  H HE2  . LYS A 1 28  ? 16.52429  -2.67571 5.97534  1.000 92.35510  ? 28  LYS A HE2  1 
ATOM   410  H HE3  . LYS A 1 28  ? 15.53230  -2.46350 4.75209  1.000 92.35510  ? 28  LYS A HE3  1 
ATOM   411  H HZ1  . LYS A 1 28  ? 18.18394  -1.78837 4.75674  1.000 92.46030  ? 28  LYS A HZ1  1 
ATOM   412  H HZ2  . LYS A 1 28  ? 17.58155  -2.80341 3.91701  1.000 92.46030  ? 28  LYS A HZ2  1 
ATOM   413  H HZ3  . LYS A 1 28  ? 17.29630  -1.40335 3.67870  1.000 92.46030  ? 28  LYS A HZ3  1 
ATOM   414  N N    . VAL A 1 29  ? 17.21960  4.26296  8.16927  1.000 24.33707  ? 29  VAL A N    1 
ATOM   415  C CA   . VAL A 1 29  ? 17.08380  5.71470  8.15468  1.000 24.54566  ? 29  VAL A CA   1 
ATOM   416  C C    . VAL A 1 29  ? 17.49926  6.23051  9.52166  1.000 23.23439  ? 29  VAL A C    1 
ATOM   417  O O    . VAL A 1 29  ? 16.64210  6.61165  10.31822 1.000 25.74307  ? 29  VAL A O    1 
ATOM   418  C CB   . VAL A 1 29  ? 15.65862  6.17315  7.79387  1.000 31.04523  ? 29  VAL A CB   1 
ATOM   419  C CG1  . VAL A 1 29  ? 15.54024  6.46817  6.27346  1.000 27.05848  ? 29  VAL A CG1  1 
ATOM   420  C CG2  . VAL A 1 29  ? 14.65679  5.13476  8.16818  1.000 28.51778  ? 29  VAL A CG2  1 
ATOM   421  H H    . VAL A 1 29  ? 16.87812  3.89217  8.86605  1.000 29.09217  ? 29  VAL A H    1 
ATOM   422  H HA   . VAL A 1 29  ? 17.67513  6.07852  7.47728  1.000 29.34248  ? 29  VAL A HA   1 
ATOM   423  H HB   . VAL A 1 29  ? 15.47364  6.98608  8.28968  1.000 37.14196  ? 29  VAL A HB   1 
ATOM   424  H HG11 . VAL A 1 29  ? 14.65198  6.81004  6.08632  1.000 32.35786  ? 29  VAL A HG11 1 
ATOM   425  H HG12 . VAL A 1 29  ? 16.20729  7.12782  6.02689  1.000 32.35786  ? 29  VAL A HG12 1 
ATOM   426  H HG13 . VAL A 1 29  ? 15.68925  5.64658  5.77981  1.000 32.35786  ? 29  VAL A HG13 1 
ATOM   427  H HG21 . VAL A 1 29  ? 13.76587  5.50566  8.07024  1.000 34.10902  ? 29  VAL A HG21 1 
ATOM   428  H HG22 . VAL A 1 29  ? 14.76232  4.36858  7.58275  1.000 34.10902  ? 29  VAL A HG22 1 
ATOM   429  H HG23 . VAL A 1 29  ? 14.80546  4.87008  9.08945  1.000 34.10902  ? 29  VAL A HG23 1 
ATOM   430  N N    . PRO A 1 30  ? 18.79514  6.32686  9.80215  1.000 28.33485  ? 30  PRO A N    1 
ATOM   431  C CA   . PRO A 1 30  ? 19.20994  6.71883  11.16091 1.000 28.71353  ? 30  PRO A CA   1 
ATOM   432  C C    . PRO A 1 30  ? 18.86073  8.14636  11.54944 1.000 24.96844  ? 30  PRO A C    1 
ATOM   433  O O    . PRO A 1 30  ? 18.43165  8.38863  12.68460 1.000 25.58483  ? 30  PRO A O    1 
ATOM   434  C CB   . PRO A 1 30  ? 20.72696  6.47666  11.12624 1.000 24.71524  ? 30  PRO A CB   1 
ATOM   435  C CG   . PRO A 1 30  ? 21.08632  6.50212  9.70747  1.000 27.86788  ? 30  PRO A CG   1 
ATOM   436  C CD   . PRO A 1 30  ? 19.94106  5.94468  8.96034  1.000 30.19544  ? 30  PRO A CD   1 
ATOM   437  H HA   . PRO A 1 30  ? 18.79227  6.12806  11.80701 1.000 34.34392  ? 30  PRO A HA   1 
ATOM   438  H HB2  . PRO A 1 30  ? 21.18420  7.18067  11.61224 1.000 29.54597  ? 30  PRO A HB2  1 
ATOM   439  H HB3  . PRO A 1 30  ? 20.93206  5.61435  11.52027 1.000 29.54597  ? 30  PRO A HB3  1 
ATOM   440  H HG2  . PRO A 1 30  ? 21.25615  7.41729  9.43449  1.000 33.32914  ? 30  PRO A HG2  1 
ATOM   441  H HG3  . PRO A 1 30  ? 21.87901  5.96122  9.56612  1.000 33.32914  ? 30  PRO A HG3  1 
ATOM   442  H HD2  . PRO A 1 30  ? 19.87349  6.34292  8.07844  1.000 36.12221  ? 30  PRO A HD2  1 
ATOM   443  H HD3  . PRO A 1 30  ? 20.01104  4.98020  8.88434  1.000 36.12221  ? 30  PRO A HD3  1 
ATOM   444  N N    . LYS A 1 31  ? 19.00396  9.10011  10.64353 1.000 26.89269  ? 31  LYS A N    1 
ATOM   445  C CA   . LYS A 1 31  ? 18.71193  10.48190 11.00471 1.000 35.68088  ? 31  LYS A CA   1 
ATOM   446  C C    . LYS A 1 31  ? 17.23023  10.68897 11.34011 1.000 29.50318  ? 31  LYS A C    1 
ATOM   447  O O    . LYS A 1 31  ? 16.89772  11.31594 12.35283 1.000 26.87338  ? 31  LYS A O    1 
ATOM   448  C CB   . LYS A 1 31  ? 19.15397  11.41406 9.87655  1.000 33.60610  ? 31  LYS A CB   1 
ATOM   449  C CG   . LYS A 1 31  ? 19.09646  12.91137 10.26763 1.000 40.20921  ? 31  LYS A CG   1 
ATOM   450  C CD   . LYS A 1 31  ? 19.72542  13.81987 9.20710  1.000 33.17040  ? 31  LYS A CD   1 
ATOM   451  C CE   . LYS A 1 31  ? 19.72993  15.25645 9.68201  1.000 33.40379  ? 31  LYS A CE   1 
ATOM   452  N NZ   . LYS A 1 31  ? 20.73633  16.07482 8.96214  1.000 49.31750  ? 31  LYS A NZ   1 
ATOM   453  H H    . LYS A 1 31  ? 19.26216  8.98027  9.83201  1.000 32.15891  ? 31  LYS A H    1 
ATOM   454  H HA   . LYS A 1 31  ? 19.21753  10.70467 11.80199 1.000 42.70474  ? 31  LYS A HA   1 
ATOM   455  H HB2  . LYS A 1 31  ? 20.06946  11.20315 9.63508  1.000 40.21501  ? 31  LYS A HB2  1 
ATOM   456  H HB3  . LYS A 1 31  ? 18.57061  11.28196 9.11291  1.000 40.21501  ? 31  LYS A HB3  1 
ATOM   457  H HG2  . LYS A 1 31  ? 18.16954  13.17518 10.37777 1.000 48.13873  ? 31  LYS A HG2  1 
ATOM   458  H HG3  . LYS A 1 31  ? 19.57930  13.04098 11.09888 1.000 48.13873  ? 31  LYS A HG3  1 
ATOM   459  H HD2  . LYS A 1 31  ? 20.64111  13.54462 9.04383  1.000 39.69217  ? 31  LYS A HD2  1 
ATOM   460  H HD3  . LYS A 1 31  ? 19.21157  13.76654 8.38612  1.000 39.69217  ? 31  LYS A HD3  1 
ATOM   461  H HE2  . LYS A 1 31  ? 18.85537  15.64666 9.52782  1.000 39.97223  ? 31  LYS A HE2  1 
ATOM   462  H HE3  . LYS A 1 31  ? 19.94127  15.27941 10.62843 1.000 39.97223  ? 31  LYS A HE3  1 
ATOM   463  H HZ1  . LYS A 1 31  ? 21.55106  15.74265 9.09623  1.000 59.06869  ? 31  LYS A HZ1  1 
ATOM   464  H HZ2  . LYS A 1 31  ? 20.56319  16.07162 8.08915  1.000 59.06869  ? 31  LYS A HZ2  1 
ATOM   465  H HZ3  . LYS A 1 31  ? 20.71425  16.91394 9.25790  1.000 59.06869  ? 31  LYS A HZ3  1 
ATOM   466  N N    . THR A 1 32  ? 16.32704  10.19064 10.49233 1.000 31.24692  ? 32  THR A N    1 
ATOM   467  C CA   . THR A 1 32  ? 14.89314  10.33575 10.74151 1.000 29.81666  ? 32  THR A CA   1 
ATOM   468  C C    . THR A 1 32  ? 14.46640  9.56338  11.98219 1.000 23.47766  ? 32  THR A C    1 
ATOM   469  O O    . THR A 1 32  ? 13.73876  10.08011 12.83114 1.000 23.86163  ? 32  THR A O    1 
ATOM   470  C CB   . THR A 1 32  ? 14.11408  9.86164  9.51361  1.000 28.92135  ? 32  THR A CB   1 
ATOM   471  O OG1  . THR A 1 32  ? 14.60223  10.55156 8.35857  1.000 30.49525  ? 32  THR A OG1  1 
ATOM   472  C CG2  . THR A 1 32  ? 12.63265  10.11481 9.68310  1.000 28.01108  ? 32  THR A CG2  1 
ATOM   473  H H    . THR A 1 32  ? 16.51761  9.76626  9.76902  1.000 37.38398  ? 32  THR A H    1 
ATOM   474  H HA   . THR A 1 32  ? 14.68992  11.27198 10.89340 1.000 35.66768  ? 32  THR A HA   1 
ATOM   475  H HB   . THR A 1 32  ? 14.23329  8.90631  9.39514  1.000 34.59330  ? 32  THR A HB   1 
ATOM   476  H HG1  . THR A 1 32  ? 15.40129  10.33762 8.21251  1.000 36.48198  ? 32  THR A HG1  1 
ATOM   477  H HG21 . THR A 1 32  ? 12.16461  9.91005  8.85854  1.000 33.50099  ? 32  THR A HG21 1 
ATOM   478  H HG22 . THR A 1 32  ? 12.27958  9.55561  10.39270 1.000 33.50099  ? 32  THR A HG22 1 
ATOM   479  H HG23 . THR A 1 32  ? 12.47890  11.04538 9.90961  1.000 33.50099  ? 32  THR A HG23 1 
ATOM   480  N N    . ALA A 1 33  ? 14.92203  8.32804  12.11333 1.000 25.77462  ? 33  ALA A N    1 
ATOM   481  C CA   . ALA A 1 33  ? 14.55300  7.54593  13.28028 1.000 26.62215  ? 33  ALA A CA   1 
ATOM   482  C C    . ALA A 1 33  ? 15.06295  8.17431  14.56079 1.000 22.77191  ? 33  ALA A C    1 
ATOM   483  O O    . ALA A 1 33  ? 14.45146  7.98342  15.61165 1.000 22.27440  ? 33  ALA A O    1 
ATOM   484  C CB   . ALA A 1 33  ? 15.07974  6.12059  13.14526 1.000 28.22324  ? 33  ALA A CB   1 
ATOM   485  H H    . ALA A 1 33  ? 15.43601  7.92638  11.55288 1.000 30.81723  ? 33  ALA A H    1 
ATOM   486  H HA   . ALA A 1 33  ? 13.58521  7.50553  13.33173 1.000 31.83427  ? 33  ALA A HA   1 
ATOM   487  H HB1  . ALA A 1 33  ? 14.86732  5.62755  13.95315 1.000 33.75558  ? 33  ALA A HB1  1 
ATOM   488  H HB2  . ALA A 1 33  ? 14.65802  5.69922  12.38008 1.000 33.75558  ? 33  ALA A HB2  1 
ATOM   489  H HB3  . ALA A 1 33  ? 16.04101  6.14982  13.01869 1.000 33.75558  ? 33  ALA A HB3  1 
ATOM   490  N N    . GLU A 1 34  ? 16.17253  8.91556  14.49952 1.000 25.47175  ? 34  GLU A N    1 
ATOM   491  C CA   . GLU A 1 34  ? 16.73147  9.52244  15.70451 1.000 27.44510  ? 34  GLU A CA   1 
ATOM   492  C C    . GLU A 1 34  ? 15.93876  10.76048 16.10767 1.000 25.27759  ? 34  GLU A C    1 
ATOM   493  O O    . GLU A 1 34  ? 15.71950  11.00829 17.29866 1.000 26.14084  ? 34  GLU A O    1 
ATOM   494  C CB   . GLU A 1 34  ? 18.20223  9.88008  15.47869 1.000 32.95103  ? 34  GLU A CB   1 
ATOM   495  C CG   . GLU A 1 34  ? 18.83174  10.66360 16.61830 1.000 33.45922  ? 34  GLU A CG   1 
ATOM   496  C CD   . GLU A 1 34  ? 18.96516  9.84165  17.87668 1.000 33.46248  ? 34  GLU A CD   1 
ATOM   497  O OE1  . GLU A 1 34  ? 18.60435  8.63891  17.84594 1.000 35.37797  ? 34  GLU A OE1  1 
ATOM   498  O OE2  . GLU A 1 34  ? 19.43979  10.39758 18.88894 1.000 33.02324  ? 34  GLU A OE2  1 
ATOM   499  H H    . GLU A 1 34  ? 16.61465  9.07965  13.78035 1.000 30.45378  ? 34  GLU A H    1 
ATOM   500  H HA   . GLU A 1 34  ? 16.68690  8.88065  16.43047 1.000 32.82180  ? 34  GLU A HA   1 
ATOM   501  H HB2  . GLU A 1 34  ? 18.70821  9.05964  15.37024 1.000 39.42892  ? 34  GLU A HB2  1 
ATOM   502  H HB3  . GLU A 1 34  ? 18.27071  10.42063 14.67619 1.000 39.42892  ? 34  GLU A HB3  1 
ATOM   503  H HG2  . GLU A 1 34  ? 19.71831  10.95371 16.35236 1.000 40.03874  ? 34  GLU A HG2  1 
ATOM   504  H HG3  . GLU A 1 34  ? 18.27689  11.43360 16.81865 1.000 40.03874  ? 34  GLU A HG3  1 
ATOM   505  N N    . ASN A 1 35  ? 15.50720  11.55119 15.12473 1.000 24.96541  ? 35  ASN A N    1 
ATOM   506  C CA   . ASN A 1 35  ? 14.61787  12.67636 15.40181 1.000 26.74669  ? 35  ASN A CA   1 
ATOM   507  C C    . ASN A 1 35  ? 13.36128  12.21558 16.13591 1.000 24.33097  ? 35  ASN A C    1 
ATOM   508  O O    . ASN A 1 35  ? 13.06685  12.68433 17.23815 1.000 30.83832  ? 35  ASN A O    1 
ATOM   509  C CB   . ASN A 1 35  ? 14.25883  13.39464 14.10114 1.000 22.84677  ? 35  ASN A CB   1 
ATOM   510  C CG   . ASN A 1 35  ? 13.25629  14.47861 14.30351 1.000 21.26233  ? 35  ASN A CG   1 
ATOM   511  O OD1  . ASN A 1 35  ? 13.36273  15.30546 15.20316 1.000 20.82904  ? 35  ASN A OD1  1 
ATOM   512  N ND2  . ASN A 1 35  ? 12.26850  14.49248 13.44591 1.000 20.52468  ? 35  ASN A ND2  1 
ATOM   513  H H    . ASN A 1 35  ? 15.71333  11.45804 14.29501 1.000 29.84618  ? 35  ASN A H    1 
ATOM   514  H HA   . ASN A 1 35  ? 15.08320  13.30779 15.97248 1.000 31.98371  ? 35  ASN A HA   1 
ATOM   515  H HB2  . ASN A 1 35  ? 15.06059  13.79264 13.72741 1.000 27.30381  ? 35  ASN A HB2  1 
ATOM   516  H HB3  . ASN A 1 35  ? 13.88547  12.75246 13.47736 1.000 27.30381  ? 35  ASN A HB3  1 
ATOM   517  H HD21 . ASN A 1 35  ? 11.65513  15.09227 13.50616 1.000 24.51730  ? 35  ASN A HD21 1 
ATOM   518  H HD22 . ASN A 1 35  ? 12.23251  13.90180 12.82188 1.000 24.51730  ? 35  ASN A HD22 1 
ATOM   519  N N    . PHE A 1 36  ? 12.62864  11.26768 15.54918 1.000 23.57609  ? 36  PHE A N    1 
ATOM   520  C CA   . PHE A 1 36  ? 11.42084  10.73265 16.17425 1.000 25.86995  ? 36  PHE A CA   1 
ATOM   521  C C    . PHE A 1 36  ? 11.71447  10.15700 17.54140 1.000 23.13933  ? 36  PHE A C    1 
ATOM   522  O O    . PHE A 1 36  ? 10.92224  10.32710 18.46726 1.000 25.82590  ? 36  PHE A O    1 
ATOM   523  C CB   . PHE A 1 36  ? 10.80679  9.65297  15.27939 1.000 27.11481  ? 36  PHE A CB   1 
ATOM   524  C CG   . PHE A 1 36  ? 9.44985   9.20935  15.68963 1.000 26.96090  ? 36  PHE A CG   1 
ATOM   525  C CD1  . PHE A 1 36  ? 9.30195   8.20850  16.63706 1.000 24.62271  ? 36  PHE A CD1  1 
ATOM   526  C CD2  . PHE A 1 36  ? 8.30881   9.77244  15.09525 1.000 28.24460  ? 36  PHE A CD2  1 
ATOM   527  C CE1  . PHE A 1 36  ? 8.05516   7.78257  17.00987 1.000 27.30880  ? 36  PHE A CE1  1 
ATOM   528  C CE2  . PHE A 1 36  ? 7.03260   9.33893  15.44722 1.000 25.82555  ? 36  PHE A CE2  1 
ATOM   529  C CZ   . PHE A 1 36  ? 6.90377   8.34709  16.41060 1.000 30.97548  ? 36  PHE A CZ   1 
ATOM   530  H H    . PHE A 1 36  ? 12.80986  10.91576 14.78570 1.000 28.17899  ? 36  PHE A H    1 
ATOM   531  H HA   . PHE A 1 36  ? 10.78167  11.45497 16.27727 1.000 30.93162  ? 36  PHE A HA   1 
ATOM   532  H HB2  . PHE A 1 36  ? 10.74028  10.00130 14.37654 1.000 32.42546  ? 36  PHE A HB2  1 
ATOM   533  H HB3  . PHE A 1 36  ? 11.38563  8.87473  15.29294 1.000 32.42546  ? 36  PHE A HB3  1 
ATOM   534  H HD1  . PHE A 1 36  ? 10.05549  7.82322  17.02259 1.000 29.43494  ? 36  PHE A HD1  1 
ATOM   535  H HD2  . PHE A 1 36  ? 8.40645   10.44326 14.45857 1.000 33.78121  ? 36  PHE A HD2  1 
ATOM   536  H HE1  . PHE A 1 36  ? 7.96473   7.12148  17.65770 1.000 32.65825  ? 36  PHE A HE1  1 
ATOM   537  H HE2  . PHE A 1 36  ? 6.27989   9.70737  15.04401 1.000 30.87834  ? 36  PHE A HE2  1 
ATOM   538  H HZ   . PHE A 1 36  ? 6.05837   8.05284  16.66281 1.000 37.05826  ? 36  PHE A HZ   1 
ATOM   539  N N    . ARG A 1 37  ? 12.84624  9.47503  17.69023 1.000 24.46589  ? 37  ARG A N    1 
ATOM   540  C CA   . ARG A 1 37  ? 13.18550  8.89144  18.98205 1.000 26.37747  ? 37  ARG A CA   1 
ATOM   541  C C    . ARG A 1 37  ? 13.42386  9.97505  20.02688 1.000 27.88963  ? 37  ARG A C    1 
ATOM   542  O O    . ARG A 1 37  ? 12.95158  9.86499  21.16614 1.000 24.57484  ? 37  ARG A O    1 
ATOM   543  C CB   . ARG A 1 37  ? 14.42239  8.00280  18.84453 1.000 23.29996  ? 37  ARG A CB   1 
ATOM   544  C CG   . ARG A 1 37  ? 14.68095  7.10387  20.04703 1.000 26.47760  ? 37  ARG A CG   1 
ATOM   545  C CD   . ARG A 1 37  ? 16.16990  6.72636  20.19865 1.000 32.34393  ? 37  ARG A CD   1 
ATOM   546  N NE   . ARG A 1 37  ? 17.03464  7.91072  20.26536 1.000 28.18675  ? 37  ARG A NE   1 
ATOM   547  C CZ   . ARG A 1 37  ? 17.21399  8.65414  21.34724 1.000 27.72895  ? 37  ARG A CZ   1 
ATOM   548  N NH1  . ARG A 1 37  ? 16.60219  8.36341  22.48741 1.000 33.88523  ? 37  ARG A NH1  1 
ATOM   549  N NH2  . ARG A 1 37  ? 17.97848  9.71401  21.27436 1.000 31.20131  ? 37  ARG A NH2  1 
ATOM   550  H H    . ARG A 1 37  ? 13.42547  9.33784  17.06953 1.000 29.24676  ? 37  ARG A H    1 
ATOM   551  H HA   . ARG A 1 37  ? 12.44700  8.33809  19.28090 1.000 31.54065  ? 37  ARG A HA   1 
ATOM   552  H HB2  . ARG A 1 37  ? 14.30931  7.43156  18.06877 1.000 27.84764  ? 37  ARG A HB2  1 
ATOM   553  H HB3  . ARG A 1 37  ? 15.20059  8.57005  18.72821 1.000 27.84764  ? 37  ARG A HB3  1 
ATOM   554  H HG2  . ARG A 1 37  ? 14.40531  7.56675  20.85367 1.000 31.66080  ? 37  ARG A HG2  1 
ATOM   555  H HG3  . ARG A 1 37  ? 14.17265  6.28406  19.94483 1.000 31.66080  ? 37  ARG A HG3  1 
ATOM   556  H HD2  . ARG A 1 37  ? 16.28853  6.21843  21.01648 1.000 38.70040  ? 37  ARG A HD2  1 
ATOM   557  H HD3  . ARG A 1 37  ? 16.44347  6.19437  19.43508 1.000 38.70040  ? 37  ARG A HD3  1 
ATOM   558  H HE   . ARG A 1 37  ? 17.45517  8.13845  19.55059 1.000 33.71178  ? 37  ARG A HE   1 
ATOM   559  H HH11 . ARG A 1 37  ? 16.07878  7.68256  22.53311 1.000 40.54996  ? 37  ARG A HH11 1 
ATOM   560  H HH12 . ARG A 1 37  ? 16.72886  8.85572  23.18108 1.000 40.54996  ? 37  ARG A HH12 1 
ATOM   561  H HH21 . ARG A 1 37  ? 18.35733  9.92061  20.53046 1.000 37.32926  ? 37  ARG A HH21 1 
ATOM   562  H HH22 . ARG A 1 37  ? 18.10194  10.20383 21.97038 1.000 37.32926  ? 37  ARG A HH22 1 
ATOM   563  N N    . ALA A 1 38  ? 14.14823  11.03575 19.65310 1.000 28.60584  ? 38  ALA A N    1 
ATOM   564  C CA   . ALA A 1 38  ? 14.45628  12.08597 20.61687 1.000 34.50403  ? 38  ALA A CA   1 
ATOM   565  C C    . ALA A 1 38  ? 13.23154  12.93747 20.92670 1.000 27.87345  ? 38  ALA A C    1 
ATOM   566  O O    . ALA A 1 38  ? 13.15257  13.52591 22.00756 1.000 30.57042  ? 38  ALA A O    1 
ATOM   567  C CB   . ALA A 1 38  ? 15.61310  12.95746 20.10954 1.000 36.04020  ? 38  ALA A CB   1 
ATOM   568  H H    . ALA A 1 38  ? 14.46470  11.16520 18.86399 1.000 34.21469  ? 38  ALA A H    1 
ATOM   569  H HA   . ALA A 1 38  ? 14.74773  11.67302 21.44478 1.000 41.29252  ? 38  ALA A HA   1 
ATOM   570  H HB1  . ALA A 1 38  ? 15.80244  13.64500 20.76706 1.000 43.13593  ? 38  ALA A HB1  1 
ATOM   571  H HB2  . ALA A 1 38  ? 16.39571  12.39925 19.97989 1.000 43.13593  ? 38  ALA A HB2  1 
ATOM   572  H HB3  . ALA A 1 38  ? 15.35529  13.36614 19.26846 1.000 43.13593  ? 38  ALA A HB3  1 
ATOM   573  N N    . LEU A 1 39  ? 12.27705  13.02553 20.00143 1.000 26.72278  ? 39  LEU A N    1 
ATOM   574  C CA   . LEU A 1 39  ? 11.02698  13.71559 20.29626 1.000 26.43867  ? 39  LEU A CA   1 
ATOM   575  C C    . LEU A 1 39  ? 10.09030  12.87930 21.14806 1.000 23.84250  ? 39  LEU A C    1 
ATOM   576  O O    . LEU A 1 39  ? 9.27735   13.43423 21.88322 1.000 28.93152  ? 39  LEU A O    1 
ATOM   577  C CB   . LEU A 1 39  ? 10.32189  14.09347 19.00889 1.000 25.85830  ? 39  LEU A CB   1 
ATOM   578  C CG   . LEU A 1 39  ? 11.02876  15.12554 18.15183 1.000 29.25720  ? 39  LEU A CG   1 
ATOM   579  C CD1  . LEU A 1 39  ? 10.45122  15.16482 16.73710 1.000 23.64853  ? 39  LEU A CD1  1 
ATOM   580  C CD2  . LEU A 1 39  ? 10.96242  16.47995 18.82479 1.000 35.61617  ? 39  LEU A CD2  1 
ATOM   581  H H    . LEU A 1 39  ? 12.32885  12.69877 19.20761 1.000 31.95502  ? 39  LEU A H    1 
ATOM   582  H HA   . LEU A 1 39  ? 11.23998  14.52664 20.78382 1.000 31.61409  ? 39  LEU A HA   1 
ATOM   583  H HB2  . LEU A 1 39  ? 10.22075  13.29231 18.47148 1.000 30.91765  ? 39  LEU A HB2  1 
ATOM   584  H HB3  . LEU A 1 39  ? 9.45004   14.45384 19.23454 1.000 30.91765  ? 39  LEU A HB3  1 
ATOM   585  H HG   . LEU A 1 39  ? 11.96292  14.88184 18.05767 1.000 34.99632  ? 39  LEU A HG   1 
ATOM   586  H HD11 . LEU A 1 39  ? 10.95207  15.80623 16.20923 1.000 28.26592  ? 39  LEU A HD11 1 
ATOM   587  H HD12 . LEU A 1 39  ? 10.52416  14.28212 16.34160 1.000 28.26592  ? 39  LEU A HD12 1 
ATOM   588  H HD13 . LEU A 1 39  ? 9.51946   15.43046 16.78364 1.000 28.26592  ? 39  LEU A HD13 1 
ATOM   589  H HD21 . LEU A 1 39  ? 11.48967  17.11309 18.31288 1.000 42.62709  ? 39  LEU A HD21 1 
ATOM   590  H HD22 . LEU A 1 39  ? 10.03766  16.77075 18.85876 1.000 42.62709  ? 39  LEU A HD22 1 
ATOM   591  H HD23 . LEU A 1 39  ? 11.31842  16.40364 19.72387 1.000 42.62709  ? 39  LEU A HD23 1 
ATOM   592  N N    . SER A 1 40  ? 10.21162  11.56174 21.10266 1.000 23.55498  ? 40  SER A N    1 
ATOM   593  C CA   . SER A 1 40  ? 9.42090   10.71432 21.97929 1.000 22.30125  ? 40  SER A CA   1 
ATOM   594  C C    . SER A 1 40  ? 9.94425   10.69500 23.40082 1.000 24.09965  ? 40  SER A C    1 
ATOM   595  O O    . SER A 1 40  ? 9.17264   10.45730 24.32764 1.000 28.32129  ? 40  SER A O    1 
ATOM   596  C CB   . SER A 1 40  ? 9.40048   9.29281  21.44945 1.000 24.92678  ? 40  SER A CB   1 
ATOM   597  O OG   . SER A 1 40  ? 8.89598   9.26311  20.12762 1.000 27.58931  ? 40  SER A OG   1 
ATOM   598  H H    . SER A 1 40  ? 10.74149  11.13520 20.57644 1.000 28.15367  ? 40  SER A H    1 
ATOM   599  H HA   . SER A 1 40  ? 8.51567   11.06261 21.99109 1.000 26.64918  ? 40  SER A HA   1 
ATOM   600  H HB2  . SER A 1 40  ? 10.30427  8.94059  21.45181 1.000 29.79983  ? 40  SER A HB2  1 
ATOM   601  H HB3  . SER A 1 40  ? 8.83165   8.75066  22.01814 1.000 29.79983  ? 40  SER A HB3  1 
ATOM   602  H HG   . SER A 1 40  ? 9.36622   9.74939  19.62963 1.000 32.99486  ? 40  SER A HG   1 
ATOM   603  N N    . THR A 1 41  ? 11.22678  10.95115 23.60570 1.000 27.42061  ? 41  THR A N    1 
ATOM   604  C CA   . THR A 1 41  ? 11.77568  11.01202 24.95566 1.000 26.41718  ? 41  THR A CA   1 
ATOM   605  C C    . THR A 1 41  ? 11.79162  12.42413 25.51739 1.000 26.67589  ? 41  THR A C    1 
ATOM   606  O O    . THR A 1 41  ? 11.94532  12.59525 26.72984 1.000 23.39517  ? 41  THR A O    1 
ATOM   607  C CB   . THR A 1 41  ? 13.20237  10.46532 24.97211 1.000 25.93448  ? 41  THR A CB   1 
ATOM   608  O OG1  . THR A 1 41  ? 14.02387  11.30924 24.16907 1.000 31.81683  ? 41  THR A OG1  1 
ATOM   609  C CG2  . THR A 1 41  ? 13.25673  9.04934  24.41366 1.000 28.31953  ? 41  THR A CG2  1 
ATOM   610  H H    . THR A 1 41  ? 11.80149  11.09356 22.98199 1.000 32.79241  ? 41  THR A H    1 
ATOM   611  H HA   . THR A 1 41  ? 11.23267  10.45562 25.53571 1.000 31.58830  ? 41  THR A HA   1 
ATOM   612  H HB   . THR A 1 41  ? 13.52821  10.43942 25.88538 1.000 31.00906  ? 41  THR A HB   1 
ATOM   613  H HG1  . THR A 1 41  ? 14.81786  11.03546 24.18363 1.000 38.06788  ? 41  THR A HG1  1 
ATOM   614  H HG21 . THR A 1 41  ? 14.14772  8.68258  24.52551 1.000 33.87112  ? 41  THR A HG21 1 
ATOM   615  H HG22 . THR A 1 41  ? 12.62248  8.48370  24.88130 1.000 33.87112  ? 41  THR A HG22 1 
ATOM   616  H HG23 . THR A 1 41  ? 13.03550  9.05645  23.46926 1.000 33.87112  ? 41  THR A HG23 1 
ATOM   617  N N    . GLY A 1 42  ? 11.63206  13.43015 24.66274 1.000 30.63469  ? 42  GLY A N    1 
ATOM   618  C CA   . GLY A 1 42  ? 11.74231  14.81169 25.08010 1.000 30.97258  ? 42  GLY A CA   1 
ATOM   619  C C    . GLY A 1 42  ? 13.09731  15.19639 25.60916 1.000 33.90813  ? 42  GLY A C    1 
ATOM   620  O O    . GLY A 1 42  ? 13.19440  16.15448 26.37910 1.000 40.09307  ? 42  GLY A O    1 
ATOM   621  H H    . GLY A 1 42  ? 11.45722  13.33303 23.82632 1.000 36.64931  ? 42  GLY A H    1 
ATOM   622  H HA2  . GLY A 1 42  ? 11.54579  15.38369 24.32175 1.000 37.05478  ? 42  GLY A HA2  1 
ATOM   623  H HA3  . GLY A 1 42  ? 11.09138  14.97961 25.77937 1.000 37.05478  ? 42  GLY A HA3  1 
ATOM   624  N N    . GLU A 1 43  ? 14.15431  14.48165 25.20664 1.000 38.36036  ? 43  GLU A N    1 
ATOM   625  C CA   . GLU A 1 43  ? 15.49214  14.72930 25.73205 1.000 39.88011  ? 43  GLU A CA   1 
ATOM   626  C C    . GLU A 1 43  ? 16.11611  16.01929 25.21531 1.000 36.71836  ? 43  GLU A C    1 
ATOM   627  O O    . GLU A 1 43  ? 17.09101  16.49084 25.80395 1.000 31.27690  ? 43  GLU A O    1 
ATOM   628  C CB   . GLU A 1 43  ? 16.39036  13.55003 25.39312 1.000 35.21896  ? 43  GLU A CB   1 
ATOM   629  C CG   . GLU A 1 43  ? 16.71051  13.39557 23.92661 1.000 38.61964  ? 43  GLU A CG   1 
ATOM   630  C CD   . GLU A 1 43  ? 17.62174  12.17775 23.65754 1.000 52.75330  ? 43  GLU A CD   1 
ATOM   631  O OE1  . GLU A 1 43  ? 17.14750  11.03009 23.85061 1.000 40.68583  ? 43  GLU A OE1  1 
ATOM   632  O OE2  . GLU A 1 43  ? 18.81327  12.36762 23.27336 1.000 44.19494  ? 43  GLU A OE2  1 
ATOM   633  H H    . GLU A 1 43  ? 14.11939  13.84629 24.62811 1.000 45.92012  ? 43  GLU A H    1 
ATOM   634  H HA   . GLU A 1 43  ? 15.43188  14.81312 26.69654 1.000 47.74382  ? 43  GLU A HA   1 
ATOM   635  H HB2  . GLU A 1 43  ? 17.23097  13.65850 25.86482 1.000 42.15043  ? 43  GLU A HB2  1 
ATOM   636  H HB3  . GLU A 1 43  ? 15.95030  12.73545 25.68245 1.000 42.15043  ? 43  GLU A HB3  1 
ATOM   637  H HG2  . GLU A 1 43  ? 15.88562  13.27206 23.43143 1.000 46.23125  ? 43  GLU A HG2  1 
ATOM   638  H HG3  . GLU A 1 43  ? 17.16869  14.19162 23.61468 1.000 46.23125  ? 43  GLU A HG3  1 
ATOM   639  N N    . LYS A 1 44  ? 15.56169  16.61664 24.16694 1.000 38.10757  ? 44  LYS A N    1 
ATOM   640  C CA   . LYS A 1 44  ? 16.04301  17.88671 23.65170 1.000 38.24754  ? 44  LYS A CA   1 
ATOM   641  C C    . LYS A 1 44  ? 15.29904  19.07026 24.23374 1.000 39.54525  ? 44  LYS A C    1 
ATOM   642  O O    . LYS A 1 44  ? 15.55510  20.20074 23.80366 1.000 40.28209  ? 44  LYS A O    1 
ATOM   643  C CB   . LYS A 1 44  ? 15.91391  17.93543 22.12524 1.000 44.28935  ? 44  LYS A CB   1 
ATOM   644  C CG   . LYS A 1 44  ? 16.64285  16.81023 21.37217 1.000 37.87525  ? 44  LYS A CG   1 
ATOM   645  C CD   . LYS A 1 44  ? 18.12298  16.88778 21.54779 1.000 37.32287  ? 44  LYS A CD   1 
ATOM   646  C CE   . LYS A 1 44  ? 18.82651  15.71853 20.84717 1.000 47.95083  ? 44  LYS A CE   1 
ATOM   647  N NZ   . LYS A 1 44  ? 20.32386  15.78631 20.98886 1.000 53.25104  ? 44  LYS A NZ   1 
ATOM   648  H H    . LYS A 1 44  ? 14.89277  16.29795 23.73037 1.000 45.61677  ? 44  LYS A H    1 
ATOM   649  H HA   . LYS A 1 44  ? 16.98314  17.96409 23.87770 1.000 45.78473  ? 44  LYS A HA   1 
ATOM   650  H HB2  . LYS A 1 44  ? 14.97341  17.87684 21.89518 1.000 53.03490  ? 44  LYS A HB2  1 
ATOM   651  H HB3  . LYS A 1 44  ? 16.27987  18.77791 21.81344 1.000 53.03490  ? 44  LYS A HB3  1 
ATOM   652  H HG2  . LYS A 1 44  ? 16.34231  15.95238 21.71077 1.000 45.33798  ? 44  LYS A HG2  1 
ATOM   653  H HG3  . LYS A 1 44  ? 16.44627  16.88033 20.42489 1.000 45.33798  ? 44  LYS A HG3  1 
ATOM   654  H HD2  . LYS A 1 44  ? 18.45029  17.71633 21.16401 1.000 44.67513  ? 44  LYS A HD2  1 
ATOM   655  H HD3  . LYS A 1 44  ? 18.33787  16.85233 22.49303 1.000 44.67513  ? 44  LYS A HD3  1 
ATOM   656  H HE2  . LYS A 1 44  ? 18.52375  14.88429 21.23870 1.000 57.42868  ? 44  LYS A HE2  1 
ATOM   657  H HE3  . LYS A 1 44  ? 18.61163  15.73843 19.90148 1.000 57.42868  ? 44  LYS A HE3  1 
ATOM   658  H HZ1  . LYS A 1 44  ? 20.70324  15.12423 20.53081 1.000 63.78894  ? 44  LYS A HZ1  1 
ATOM   659  H HZ2  . LYS A 1 44  ? 20.62437  16.56335 20.67581 1.000 63.78894  ? 44  LYS A HZ2  1 
ATOM   660  H HZ3  . LYS A 1 44  ? 20.55217  15.71247 21.84590 1.000 63.78894  ? 44  LYS A HZ3  1 
ATOM   661  N N    . GLY A 1 45  ? 14.38841  18.83567 25.18705 1.000 32.29031  ? 45  GLY A N    1 
ATOM   662  C CA   . GLY A 1 45  ? 13.60567  19.87687 25.80010 1.000 31.96986  ? 45  GLY A CA   1 
ATOM   663  C C    . GLY A 1 45  ? 12.18598  19.99343 25.29344 1.000 35.79626  ? 45  GLY A C    1 
ATOM   664  O O    . GLY A 1 45  ? 11.34046  20.55755 25.99664 1.000 40.20377  ? 45  GLY A O    1 
ATOM   665  H H    . GLY A 1 45  ? 14.21183  18.05214 25.49445 1.000 38.63606  ? 45  GLY A H    1 
ATOM   666  H HA2  . GLY A 1 45  ? 13.56526  19.71263 26.75524 1.000 38.25152  ? 45  GLY A HA2  1 
ATOM   667  H HA3  . GLY A 1 45  ? 14.04507  20.72748 25.64425 1.000 38.25152  ? 45  GLY A HA3  1 
ATOM   668  N N    . PHE A 1 46  ? 11.91563  19.50046 24.09106 1.000 33.35981  ? 46  PHE A N    1 
ATOM   669  C CA   . PHE A 1 46  ? 10.60219  19.51562 23.47485 1.000 30.77090  ? 46  PHE A CA   1 
ATOM   670  C C    . PHE A 1 46  ? 10.32639  18.12607 22.91583 1.000 32.85772  ? 46  PHE A C    1 
ATOM   671  O O    . PHE A 1 46  ? 11.18480  17.23929 22.92935 1.000 34.93058  ? 46  PHE A O    1 
ATOM   672  C CB   . PHE A 1 46  ? 10.50751  20.60117 22.36851 1.000 38.79618  ? 46  PHE A CB   1 
ATOM   673  C CG   . PHE A 1 46  ? 11.70732  20.66971 21.46310 1.000 32.60046  ? 46  PHE A CG   1 
ATOM   674  C CD1  . PHE A 1 46  ? 11.79443  19.86483 20.35724 1.000 40.44599  ? 46  PHE A CD1  1 
ATOM   675  C CD2  . PHE A 1 46  ? 12.74330  21.52449 21.72762 1.000 41.84606  ? 46  PHE A CD2  1 
ATOM   676  C CE1  . PHE A 1 46  ? 12.88991  19.90940 19.52795 1.000 37.06334  ? 46  PHE A CE1  1 
ATOM   677  C CE2  . PHE A 1 46  ? 13.85957  21.55755 20.91324 1.000 41.93246  ? 46  PHE A CE2  1 
ATOM   678  C CZ   . PHE A 1 46  ? 13.92190  20.75799 19.80817 1.000 37.90306  ? 46  PHE A CZ   1 
ATOM   679  H H    . PHE A 1 46  ? 12.50986  19.13353 23.58922 1.000 39.91946  ? 46  PHE A H    1 
ATOM   680  H HA   . PHE A 1 46  ? 9.92046   19.72113 24.13357 1.000 36.81277  ? 46  PHE A HA   1 
ATOM   681  H HB2  . PHE A 1 46  ? 9.73289   20.41324 21.81575 1.000 46.44311  ? 46  PHE A HB2  1 
ATOM   682  H HB3  . PHE A 1 46  ? 10.40991  21.46800 22.79275 1.000 46.44311  ? 46  PHE A HB3  1 
ATOM   683  H HD1  . PHE A 1 46  ? 11.09955  19.27762 20.16428 1.000 48.42288  ? 46  PHE A HD1  1 
ATOM   684  H HD2  . PHE A 1 46  ? 12.69543  22.08996 22.46440 1.000 50.10296  ? 46  PHE A HD2  1 
ATOM   685  H HE1  . PHE A 1 46  ? 12.92794  19.36214 18.77698 1.000 44.36369  ? 46  PHE A HE1  1 
ATOM   686  H HE2  . PHE A 1 46  ? 14.56802  22.12423 21.11790 1.000 50.20664  ? 46  PHE A HE2  1 
ATOM   687  H HZ   . PHE A 1 46  ? 14.66415  20.79135 19.24884 1.000 45.37136  ? 46  PHE A HZ   1 
ATOM   688  N N    . GLY A 1 47  ? 9.13111   17.94644 22.38941 1.000 27.15181  ? 47  GLY A N    1 
ATOM   689  C CA   . GLY A 1 47  ? 8.80351   16.65895 21.81484 1.000 29.43375  ? 47  GLY A CA   1 
ATOM   690  C C    . GLY A 1 47  ? 7.29975   16.45204 21.70632 1.000 25.68698  ? 47  GLY A C    1 
ATOM   691  O O    . GLY A 1 47  ? 6.54034   17.39894 21.51972 1.000 26.40344  ? 47  GLY A O    1 
ATOM   692  H H    . GLY A 1 47  ? 8.50832   18.53841 22.35336 1.000 32.46986  ? 47  GLY A H    1 
ATOM   693  H HA2  . GLY A 1 47  ? 9.18745   16.59400 20.92643 1.000 35.20818  ? 47  GLY A HA2  1 
ATOM   694  H HA3  . GLY A 1 47  ? 9.17135   15.95380 22.37015 1.000 35.20818  ? 47  GLY A HA3  1 
ATOM   695  N N    . TYR A 1 48  ? 6.90129   15.18879 21.82385 1.000 26.88568  ? 48  TYR A N    1 
ATOM   696  C CA   . TYR A 1 48  ? 5.54593   14.76493 21.50634 1.000 27.11107  ? 48  TYR A CA   1 
ATOM   697  C C    . TYR A 1 48  ? 4.64249   14.65365 22.72800 1.000 24.36860  ? 48  TYR A C    1 
ATOM   698  O O    . TYR A 1 48  ? 3.42186   14.68648 22.57906 1.000 27.10582  ? 48  TYR A O    1 
ATOM   699  C CB   . TYR A 1 48  ? 5.58414   13.40316 20.78177 1.000 29.60592  ? 48  TYR A CB   1 
ATOM   700  C CG   . TYR A 1 48  ? 6.18299   13.41554 19.40312 1.000 23.89701  ? 48  TYR A CG   1 
ATOM   701  C CD1  . TYR A 1 48  ? 5.95903   14.46398 18.54343 1.000 26.21746  ? 48  TYR A CD1  1 
ATOM   702  C CD2  . TYR A 1 48  ? 6.97510   12.36525 18.96033 1.000 26.12808  ? 48  TYR A CD2  1 
ATOM   703  C CE1  . TYR A 1 48  ? 6.54959   14.49257 17.25887 1.000 28.50242  ? 48  TYR A CE1  1 
ATOM   704  C CE2  . TYR A 1 48  ? 7.54562   12.36946 17.70003 1.000 23.12711  ? 48  TYR A CE2  1 
ATOM   705  C CZ   . TYR A 1 48  ? 7.31324   13.43609 16.85738 1.000 21.74113  ? 48  TYR A CZ   1 
ATOM   706  O OH   . TYR A 1 48  ? 7.84348   13.44265 15.62629 1.000 24.71182  ? 48  TYR A OH   1 
ATOM   707  H H    . TYR A 1 48  ? 7.40849   14.54763 22.09079 1.000 32.15050  ? 48  TYR A H    1 
ATOM   708  H HA   . TYR A 1 48  ? 5.14524   15.41589 20.90918 1.000 32.42097  ? 48  TYR A HA   1 
ATOM   709  H HB2  . TYR A 1 48  ? 6.10839   12.78776 21.31781 1.000 35.41479  ? 48  TYR A HB2  1 
ATOM   710  H HB3  . TYR A 1 48  ? 4.67431   13.07759 20.69748 1.000 35.41479  ? 48  TYR A HB3  1 
ATOM   711  H HD1  . TYR A 1 48  ? 5.41042   15.16577 18.81066 1.000 31.34864  ? 48  TYR A HD1  1 
ATOM   712  H HD2  . TYR A 1 48  ? 7.12592   11.64139 19.52440 1.000 31.24138  ? 48  TYR A HD2  1 
ATOM   713  H HE1  . TYR A 1 48  ? 6.41917   15.22123 16.69589 1.000 34.09059  ? 48  TYR A HE1  1 
ATOM   714  H HE2  . TYR A 1 48  ? 8.08027   11.66036 17.42394 1.000 27.64021  ? 48  TYR A HE2  1 
ATOM   715  H HH   . TYR A 1 48  ? 7.58877   14.12474 15.20741 1.000 29.54187  ? 48  TYR A HH   1 
ATOM   716  N N    . LYS A 1 49  ? 5.19311   14.52051 23.92305 1.000 25.95734  ? 49  LYS A N    1 
ATOM   717  C CA   . LYS A 1 49  ? 4.35299   14.37704 25.10434 1.000 28.53705  ? 49  LYS A CA   1 
ATOM   718  C C    . LYS A 1 49  ? 3.42929   15.57363 25.23992 1.000 32.69470  ? 49  LYS A C    1 
ATOM   719  O O    . LYS A 1 49  ? 3.90456   16.71033 25.38859 1.000 24.37224  ? 49  LYS A O    1 
ATOM   720  C CB   . LYS A 1 49  ? 5.19727   14.25427 26.35987 1.000 26.55750  ? 49  LYS A CB   1 
ATOM   721  C CG   . LYS A 1 49  ? 4.40430   14.11268 27.59778 1.000 29.88459  ? 49  LYS A CG   1 
ATOM   722  C CD   . LYS A 1 49  ? 5.28494   13.70380 28.77302 1.000 46.99697  ? 49  LYS A CD   1 
ATOM   723  C CE   . LYS A 1 49  ? 4.47071   13.48078 30.03928 1.000 40.99141  ? 49  LYS A CE   1 
ATOM   724  N NZ   . LYS A 1 49  ? 5.26869   12.75211 31.08038 1.000 66.28647  ? 49  LYS A NZ   1 
ATOM   725  H H    . LYS A 1 49  ? 6.03902   14.50991 24.07769 1.000 31.03649  ? 49  LYS A H    1 
ATOM   726  H HA   . LYS A 1 49  ? 3.82772   13.56749 25.00630 1.000 34.13214  ? 49  LYS A HA   1 
ATOM   727  H HB2  . LYS A 1 49  ? 5.76357   13.47084 26.27956 1.000 31.75668  ? 49  LYS A HB2  1 
ATOM   728  H HB3  . LYS A 1 49  ? 5.74361   15.05097 26.44750 1.000 31.75668  ? 49  LYS A HB3  1 
ATOM   729  H HG2  . LYS A 1 49  ? 3.98439   14.96081 27.81047 1.000 35.74919  ? 49  LYS A HG2  1 
ATOM   730  H HG3  . LYS A 1 49  ? 3.72716   13.42988 27.47060 1.000 35.74919  ? 49  LYS A HG3  1 
ATOM   731  H HD2  . LYS A 1 49  ? 5.74305   12.87650 28.55712 1.000 56.28405  ? 49  LYS A HD2  1 
ATOM   732  H HD3  . LYS A 1 49  ? 5.93166   14.40533 28.94767 1.000 56.28405  ? 49  LYS A HD3  1 
ATOM   733  H HE2  . LYS A 1 49  ? 4.20248   14.33842 30.40453 1.000 49.07738  ? 49  LYS A HE2  1 
ATOM   734  H HE3  . LYS A 1 49  ? 3.68659   12.95017 29.82830 1.000 49.07738  ? 49  LYS A HE3  1 
ATOM   735  H HZ1  . LYS A 1 49  ? 4.75186   12.55579 31.77784 1.000 79.43145  ? 49  LYS A HZ1  1 
ATOM   736  H HZ2  . LYS A 1 49  ? 5.59457   11.99679 30.74069 1.000 79.43145  ? 49  LYS A HZ2  1 
ATOM   737  H HZ3  . LYS A 1 49  ? 5.94527   13.26031 31.35621 1.000 79.43145  ? 49  LYS A HZ3  1 
ATOM   738  N N    . GLY A 1 50  ? 2.10237   15.29887 25.19025 1.000 31.30023  ? 50  GLY A N    1 
ATOM   739  C CA   . GLY A 1 50  ? 1.06416   16.29852 25.28263 1.000 24.56123  ? 50  GLY A CA   1 
ATOM   740  C C    . GLY A 1 50  ? 0.47788   16.72131 23.95475 1.000 22.73858  ? 50  GLY A C    1 
ATOM   741  O O    . GLY A 1 50  ? -0.63018  17.24854 23.93392 1.000 24.07300  ? 50  GLY A O    1 
ATOM   742  H H    . GLY A 1 50  ? 1.78895   14.50317 25.09956 1.000 37.44796  ? 50  GLY A H    1 
ATOM   743  H HA2  . GLY A 1 50  ? 0.34223   15.94877 25.82797 1.000 29.36116  ? 50  GLY A HA2  1 
ATOM   744  H HA3  . GLY A 1 50  ? 1.42927   17.08855 25.71093 1.000 29.36116  ? 50  GLY A HA3  1 
ATOM   745  N N    . SER A 1 51  ? 1.18658   16.49973 22.85205 1.000 24.98398  ? 51  SER A N    1 
ATOM   746  C CA   . SER A 1 51  ? 0.65711   16.81269 21.53269 1.000 30.75811  ? 51  SER A CA   1 
ATOM   747  C C    . SER A 1 51  ? -0.45731  15.82114 21.17319 1.000 29.73504  ? 51  SER A C    1 
ATOM   748  O O    . SER A 1 51  ? -0.69924  14.82538 21.86552 1.000 30.55335  ? 51  SER A O    1 
ATOM   749  C CB   . SER A 1 51  ? 1.78838   16.80707 20.49145 1.000 25.73469  ? 51  SER A CB   1 
ATOM   750  O OG   . SER A 1 51  ? 2.11633   15.49125 20.09657 1.000 25.10676  ? 51  SER A OG   1 
ATOM   751  H H    . SER A 1 51  ? 1.97976   16.16753 22.84196 1.000 29.86846  ? 51  SER A H    1 
ATOM   752  H HA   . SER A 1 51  ? 0.26985   17.70200 21.52509 1.000 36.79742  ? 51  SER A HA   1 
ATOM   753  H HB2  . SER A 1 51  ? 1.49945   17.30603 19.71141 1.000 30.76931  ? 51  SER A HB2  1 
ATOM   754  H HB3  . SER A 1 51  ? 2.57398   17.22336 20.87930 1.000 30.76931  ? 51  SER A HB3  1 
ATOM   755  H HG   . SER A 1 51  ? 2.36050   15.04343 20.76399 1.000 30.01580  ? 51  SER A HG   1 
ATOM   756  N N    . CYS A 1 52  ? -1.12277  16.08685 20.05748 1.000 27.11146  ? 52  CYS A N    1 
ATOM   757  C CA   . CYS A 1 52  ? -2.29900  15.33141 19.66429 1.000 32.03912  ? 52  CYS A CA   1 
ATOM   758  C C    . CYS A 1 52  ? -2.14154  14.76206 18.25862 1.000 29.21930  ? 52  CYS A C    1 
ATOM   759  O O    . CYS A 1 52  ? -1.22377  15.10552 17.50901 1.000 26.95919  ? 52  CYS A O    1 
ATOM   760  C CB   . CYS A 1 52  ? -3.56093  16.21645 19.71831 1.000 31.47536  ? 52  CYS A CB   1 
ATOM   761  S SG   . CYS A 1 52  ? -3.44596  17.65769 18.65151 1.000 30.33606  ? 52  CYS A SG   1 
ATOM   762  H H    . CYS A 1 52  ? -0.90745  16.70971 19.50496 1.000 32.42144  ? 52  CYS A H    1 
ATOM   763  H HA   . CYS A 1 52  ? -2.39434  14.58230 20.27311 1.000 38.33463  ? 52  CYS A HA   1 
ATOM   764  H HB2  . CYS A 1 52  ? -4.32614  15.69252 19.43395 1.000 37.65812  ? 52  CYS A HB2  1 
ATOM   765  H HB3  . CYS A 1 52  ? -3.69050  16.52595 20.62843 1.000 37.65812  ? 52  CYS A HB3  1 
ATOM   766  H HG   . CYS A 1 52  ? -4.46641  18.28422 18.72995 1.000 36.29096  ? 52  CYS A HG   1 
ATOM   767  N N    . PHE A 1 53  ? -3.10660  13.91746 17.89882 1.000 31.45639  ? 53  PHE A N    1 
ATOM   768  C CA   . PHE A 1 53  ? -3.33763  13.48082 16.52450 1.000 27.11627  ? 53  PHE A CA   1 
ATOM   769  C C    . PHE A 1 53  ? -4.43543  14.35492 15.93872 1.000 23.71508  ? 53  PHE A C    1 
ATOM   770  O O    . PHE A 1 53  ? -5.61905  14.12073 16.17303 1.000 28.39868  ? 53  PHE A O    1 
ATOM   771  C CB   . PHE A 1 53  ? -3.71374  12.00504 16.49611 1.000 28.62238  ? 53  PHE A CB   1 
ATOM   772  C CG   . PHE A 1 53  ? -2.53604  11.08381 16.62050 1.000 33.12040  ? 53  PHE A CG   1 
ATOM   773  C CD1  . PHE A 1 53  ? -1.98761  10.81325 17.86223 1.000 26.50819  ? 53  PHE A CD1  1 
ATOM   774  C CD2  . PHE A 1 53  ? -1.97771  10.47651 15.48174 1.000 32.86184  ? 53  PHE A CD2  1 
ATOM   775  C CE1  . PHE A 1 53  ? -0.89697  9.96318  17.97851 1.000 34.16900  ? 53  PHE A CE1  1 
ATOM   776  C CE2  . PHE A 1 53  ? -0.86704  9.62559  15.59052 1.000 29.84223  ? 53  PHE A CE2  1 
ATOM   777  C CZ   . PHE A 1 53  ? -0.33489  9.36411  16.84862 1.000 30.53947  ? 53  PHE A CZ   1 
ATOM   778  H H    . PHE A 1 53  ? -3.66216  13.57036 18.45601 1.000 37.63535  ? 53  PHE A H    1 
ATOM   779  H HA   . PHE A 1 53  ? -2.53327  13.60450 15.99666 1.000 32.42721  ? 53  PHE A HA   1 
ATOM   780  H HB2  . PHE A 1 53  ? -4.31404  11.82107 17.23550 1.000 34.23454  ? 53  PHE A HB2  1 
ATOM   781  H HB3  . PHE A 1 53  ? -4.15496  11.81094 15.65436 1.000 34.23454  ? 53  PHE A HB3  1 
ATOM   782  H HD1  . PHE A 1 53  ? -2.35237  11.20364 18.62344 1.000 31.69752  ? 53  PHE A HD1  1 
ATOM   783  H HD2  . PHE A 1 53  ? -2.34947  10.64095 14.64529 1.000 39.32189  ? 53  PHE A HD2  1 
ATOM   784  H HE1  . PHE A 1 53  ? -0.53618  9.79037  18.81808 1.000 40.89049  ? 53  PHE A HE1  1 
ATOM   785  H HE2  . PHE A 1 53  ? -0.49172  9.24154  14.83121 1.000 35.69836  ? 53  PHE A HE2  1 
ATOM   786  H HZ   . PHE A 1 53  ? 0.39300   8.79211  16.93741 1.000 36.53505  ? 53  PHE A HZ   1 
ATOM   787  N N    . HIS A 1 54  ? -4.03916  15.36449 15.17711 1.000 26.18936  ? 54  HIS A N    1 
ATOM   788  C CA   . HIS A 1 54  ? -4.96041  16.38527 14.69209 1.000 26.31794  ? 54  HIS A CA   1 
ATOM   789  C C    . HIS A 1 54  ? -5.68775  16.02179 13.40567 1.000 21.64182  ? 54  HIS A C    1 
ATOM   790  O O    . HIS A 1 54  ? -6.68207  16.66598 13.07001 1.000 21.75299  ? 54  HIS A O    1 
ATOM   791  C CB   . HIS A 1 54  ? -4.19994  17.69559 14.47272 1.000 25.17114  ? 54  HIS A CB   1 
ATOM   792  C CG   . HIS A 1 54  ? -3.19583  17.64489 13.36370 1.000 30.38595  ? 54  HIS A CG   1 
ATOM   793  N ND1  . HIS A 1 54  ? -3.50887  17.96215 12.05706 1.000 32.59604  ? 54  HIS A ND1  1 
ATOM   794  C CD2  . HIS A 1 54  ? -1.88234  17.31374 13.36262 1.000 26.04754  ? 54  HIS A CD2  1 
ATOM   795  C CE1  . HIS A 1 54  ? -2.42762  17.84423 11.30952 1.000 30.28221  ? 54  HIS A CE1  1 
ATOM   796  N NE2  . HIS A 1 54  ? -1.42438  17.45731 12.07852 1.000 24.14969  ? 54  HIS A NE2  1 
ATOM   797  H H    . HIS A 1 54  ? -3.22688  15.48467 14.92147 1.000 31.31492  ? 54  HIS A H    1 
ATOM   798  H HA   . HIS A 1 54  ? -5.64077  16.51854 15.37051 1.000 31.46922  ? 54  HIS A HA   1 
ATOM   799  H HB2  . HIS A 1 54  ? -4.83926  18.39304 14.25885 1.000 30.09306  ? 54  HIS A HB2  1 
ATOM   800  H HB3  . HIS A 1 54  ? -3.72566  17.91917 15.28878 1.000 30.09306  ? 54  HIS A HB3  1 
ATOM   801  H HD2  . HIS A 1 54  ? -1.38310  17.03947 14.09776 1.000 31.14474  ? 54  HIS A HD2  1 
ATOM   802  H HE1  . HIS A 1 54  ? -2.37954  18.00620 10.39499 1.000 36.22634  ? 54  HIS A HE1  1 
ATOM   803  H HE2  . HIS A 1 54  ? -0.61717  17.31848 11.81634 1.000 28.86731  ? 54  HIS A HE2  1 
ATOM   804  N N    . ARG A 1 55  ? -5.23702  15.01328 12.68570 1.000 23.29639  ? 55  ARG A N    1 
ATOM   805  C CA   . ARG A 1 55  ? -5.82550  14.66714 11.39671 1.000 23.61732  ? 55  ARG A CA   1 
ATOM   806  C C    . ARG A 1 55  ? -5.85813  13.15080 11.32048 1.000 20.90247  ? 55  ARG A C    1 
ATOM   807  O O    . ARG A 1 55  ? -4.82475  12.52472 11.08358 1.000 23.29095  ? 55  ARG A O    1 
ATOM   808  C CB   . ARG A 1 55  ? -5.02474  15.26302 10.24515 1.000 28.00428  ? 55  ARG A CB   1 
ATOM   809  C CG   . ARG A 1 55  ? -5.66044  15.06415 8.87535  1.000 32.78072  ? 55  ARG A CG   1 
ATOM   810  C CD   . ARG A 1 55  ? -5.12701  16.07355 7.84519  1.000 40.93372  ? 55  ARG A CD   1 
ATOM   811  N NE   . ARG A 1 55  ? -6.03928  16.22904 6.71523  1.000 40.05944  ? 55  ARG A NE   1 
ATOM   812  C CZ   . ARG A 1 55  ? -5.93221  15.55088 5.57863  1.000 47.77601  ? 55  ARG A CZ   1 
ATOM   813  N NH1  . ARG A 1 55  ? -4.94337  14.68076 5.40911  1.000 46.45003  ? 55  ARG A NH1  1 
ATOM   814  N NH2  . ARG A 1 55  ? -6.81445  15.73853 4.61049  1.000 44.33526  ? 55  ARG A NH2  1 
ATOM   815  H H    . ARG A 1 55  ? -4.58392  14.50545 12.92058 1.000 27.84335  ? 55  ARG A H    1 
ATOM   816  H HA   . ARG A 1 55  ? -6.73203  15.00836 11.34499 1.000 28.22847  ? 55  ARG A HA   1 
ATOM   817  H HB2  . ARG A 1 55  ? -4.93377  16.21755 10.39176 1.000 33.49282  ? 55  ARG A HB2  1 
ATOM   818  H HB3  . ARG A 1 55  ? -4.14950  14.84526 10.22702 1.000 33.49282  ? 55  ARG A HB3  1 
ATOM   819  H HG2  . ARG A 1 55  ? -5.46002  14.17033 8.55626  1.000 39.22455  ? 55  ARG A HG2  1 
ATOM   820  H HG3  . ARG A 1 55  ? -6.62040  15.18309 8.94774  1.000 39.22455  ? 55  ARG A HG3  1 
ATOM   821  H HD2  . ARG A 1 55  ? -5.02020  16.93869 8.27065  1.000 49.00815  ? 55  ARG A HD2  1 
ATOM   822  H HD3  . ARG A 1 55  ? -4.27304  15.76312 7.50566  1.000 49.00815  ? 55  ARG A HD3  1 
ATOM   823  H HE   . ARG A 1 55  ? -6.68397  16.79323 6.79047  1.000 47.95901  ? 55  ARG A HE   1 
ATOM   824  H HH11 . ARG A 1 55  ? -4.36919  14.55471 6.03682  1.000 55.62772  ? 55  ARG A HH11 1 
ATOM   825  H HH12 . ARG A 1 55  ? -4.87720  14.24334 4.67162  1.000 55.62772  ? 55  ARG A HH12 1 
ATOM   826  H HH21 . ARG A 1 55  ? -7.45727  16.29975 4.71735  1.000 53.09000  ? 55  ARG A HH21 1 
ATOM   827  H HH22 . ARG A 1 55  ? -6.74504  15.29928 3.87440  1.000 53.09000  ? 55  ARG A HH22 1 
ATOM   828  N N    . ILE A 1 56  ? -7.03656  12.57708 11.51840 1.000 19.20360  ? 56  ILE A N    1 
ATOM   829  C CA   . ILE A 1 56  ? -7.23127  11.14206 11.46158 1.000 19.32262  ? 56  ILE A CA   1 
ATOM   830  C C    . ILE A 1 56  ? -8.25956  10.85246 10.39234 1.000 22.58951  ? 56  ILE A C    1 
ATOM   831  O O    . ILE A 1 56  ? -9.41450  11.28056 10.50556 1.000 24.22692  ? 56  ILE A O    1 
ATOM   832  C CB   . ILE A 1 56  ? -7.69179  10.58729 12.81025 1.000 22.77864  ? 56  ILE A CB   1 
ATOM   833  C CG1  . ILE A 1 56  ? -6.61468  10.84276 13.87434 1.000 25.28174  ? 56  ILE A CG1  1 
ATOM   834  C CG2  . ILE A 1 56  ? -7.98177  9.12311  12.69790 1.000 26.21809  ? 56  ILE A CG2  1 
ATOM   835  C CD1  . ILE A 1 56  ? -7.06892  10.49086 15.31881 1.000 33.65078  ? 56  ILE A CD1  1 
ATOM   836  H H    . ILE A 1 56  ? -7.75682  13.01377 11.69195 1.000 22.93200  ? 56  ILE A H    1 
ATOM   837  H HA   . ILE A 1 56  ? -6.39780  10.71325 11.21188 1.000 23.07483  ? 56  ILE A HA   1 
ATOM   838  H HB   . ILE A 1 56  ? -8.50670  11.04230 13.07443 1.000 27.22205  ? 56  ILE A HB   1 
ATOM   839  H HG12 . ILE A 1 56  ? -5.83703  10.30100 13.66784 1.000 30.22578  ? 56  ILE A HG12 1 
ATOM   840  H HG13 . ILE A 1 56  ? -6.37742  11.78318 13.85899 1.000 30.22578  ? 56  ILE A HG13 1 
ATOM   841  H HG21 . ILE A 1 56  ? -8.13526  8.76258  13.58523 1.000 31.34940  ? 56  ILE A HG21 1 
ATOM   842  H HG22 . ILE A 1 56  ? -8.77191  8.99886  12.14914 1.000 31.34940  ? 56  ILE A HG22 1 
ATOM   843  H HG23 . ILE A 1 56  ? -7.22167  8.68117  12.28822 1.000 31.34940  ? 56  ILE A HG23 1 
ATOM   844  H HD11 . ILE A 1 56  ? -6.45668  10.89924 15.95070 1.000 40.26862  ? 56  ILE A HD11 1 
ATOM   845  H HD12 . ILE A 1 56  ? -7.96595  10.83201 15.45970 1.000 40.26862  ? 56  ILE A HD12 1 
ATOM   846  H HD13 . ILE A 1 56  ? -7.06096  9.52687  15.42633 1.000 40.26862  ? 56  ILE A HD13 1 
ATOM   847  N N    . ILE A 1 57  ? -7.85648  10.09406 9.37973  1.000 21.66800  ? 57  ILE A N    1 
ATOM   848  C CA   . ILE A 1 57  ? -8.75938  9.73848  8.29134  1.000 22.08325  ? 57  ILE A CA   1 
ATOM   849  C C    . ILE A 1 57  ? -8.85197  8.22088  8.24689  1.000 20.89349  ? 57  ILE A C    1 
ATOM   850  O O    . ILE A 1 57  ? -7.86051  7.55391  7.94823  1.000 24.18506  ? 57  ILE A O    1 
ATOM   851  C CB   . ILE A 1 57  ? -8.29147  10.32082 6.94584  1.000 23.66671  ? 57  ILE A CB   1 
ATOM   852  C CG1  . ILE A 1 57  ? -8.24504  11.85373 6.99579  1.000 22.91081  ? 57  ILE A CG1  1 
ATOM   853  C CG2  . ILE A 1 57  ? -9.17678  9.85613  5.80496  1.000 23.66207  ? 57  ILE A CG2  1 
ATOM   854  C CD1  . ILE A 1 57  ? -7.47638  12.48583 5.84379  1.000 28.90206  ? 57  ILE A CD1  1 
ATOM   855  H H    . ILE A 1 57  ? -7.06300  9.77219  9.29976  1.000 25.88929  ? 57  ILE A H    1 
ATOM   856  H HA   . ILE A 1 57  ? -9.64099  10.10290 8.46701  1.000 26.38759  ? 57  ILE A HA   1 
ATOM   857  H HB   . ILE A 1 57  ? -7.39325  9.99096  6.78684  1.000 28.28773  ? 57  ILE A HB   1 
ATOM   858  H HG12 . ILE A 1 57  ? -9.15303  12.19374 6.96682  1.000 27.38066  ? 57  ILE A HG12 1 
ATOM   859  H HG13 . ILE A 1 57  ? -7.81528  12.12535 7.82189  1.000 27.38066  ? 57  ILE A HG13 1 
ATOM   860  H HG21 . ILE A 1 57  ? -8.90966  10.31260 4.99183  1.000 28.28217  ? 57  ILE A HG21 1 
ATOM   861  H HG22 . ILE A 1 57  ? -9.07377  8.89785  5.69543  1.000 28.28217  ? 57  ILE A HG22 1 
ATOM   862  H HG23 . ILE A 1 57  ? -10.09980 10.06771 6.01511  1.000 28.28217  ? 57  ILE A HG23 1 
ATOM   863  H HD11 . ILE A 1 57  ? -7.48572  13.45003 5.94930  1.000 34.57015  ? 57  ILE A HD11 1 
ATOM   864  H HD12 . ILE A 1 57  ? -6.56270  12.16041 5.85755  1.000 34.57015  ? 57  ILE A HD12 1 
ATOM   865  H HD13 . ILE A 1 57  ? -7.90236  12.24044 5.00760  1.000 34.57015  ? 57  ILE A HD13 1 
ATOM   866  N N    . PRO A 1 58  ? -10.01175 7.64051  8.51294  1.000 24.93690  ? 58  PRO A N    1 
ATOM   867  C CA   . PRO A 1 58  ? -10.09213 6.18058  8.51103  1.000 27.17511  ? 58  PRO A CA   1 
ATOM   868  C C    . PRO A 1 58  ? -9.90635  5.59724  7.11586  1.000 24.06724  ? 58  PRO A C    1 
ATOM   869  O O    . PRO A 1 58  ? -10.39112 6.12462  6.11917  1.000 26.65712  ? 58  PRO A O    1 
ATOM   870  C CB   . PRO A 1 58  ? -11.49400 5.92000  9.07246  1.000 26.05042  ? 58  PRO A CB   1 
ATOM   871  C CG   . PRO A 1 58  ? -11.84681 7.14344  9.78340  1.000 23.04046  ? 58  PRO A CG   1 
ATOM   872  C CD   . PRO A 1 58  ? -11.26741 8.23873  9.00403  1.000 23.33316  ? 58  PRO A CD   1 
ATOM   873  H HA   . PRO A 1 58  ? -9.42476  5.79121  9.09746  1.000 32.49782  ? 58  PRO A HA   1 
ATOM   874  H HB2  . PRO A 1 58  ? -12.11419 5.74880  8.34655  1.000 31.14819  ? 58  PRO A HB2  1 
ATOM   875  H HB3  . PRO A 1 58  ? -11.47241 5.16117  9.67629  1.000 31.14819  ? 58  PRO A HB3  1 
ATOM   876  H HG2  . PRO A 1 58  ? -12.81197 7.22803  9.83031  1.000 27.53624  ? 58  PRO A HG2  1 
ATOM   877  H HG3  . PRO A 1 58  ? -11.47179 7.12208  10.67772 1.000 27.53624  ? 58  PRO A HG3  1 
ATOM   878  H HD2  . PRO A 1 58  ? -11.84711 8.48838  8.26746  1.000 27.88748  ? 58  PRO A HD2  1 
ATOM   879  H HD3  . PRO A 1 58  ? -11.09110 9.01097  9.56391  1.000 27.88748  ? 58  PRO A HD3  1 
ATOM   880  N N    . GLY A 1 59  ? -9.20404  4.48437  7.05517  1.000 24.70731  ? 59  GLY A N    1 
ATOM   881  C CA   . GLY A 1 59  ? -8.78917  3.95372  5.78744  1.000 26.70430  ? 59  GLY A CA   1 
ATOM   882  C C    . GLY A 1 59  ? -7.60746  4.64686  5.16164  1.000 26.37387  ? 59  GLY A C    1 
ATOM   883  O O    . GLY A 1 59  ? -7.25688  4.31523  4.02439  1.000 26.12436  ? 59  GLY A O    1 
ATOM   884  H H    . GLY A 1 59  ? -8.95763  4.02159  7.73687  1.000 29.53646  ? 59  GLY A H    1 
ATOM   885  H HA2  . GLY A 1 59  ? -8.55538  3.01958  5.90420  1.000 31.93285  ? 59  GLY A HA2  1 
ATOM   886  H HA3  . GLY A 1 59  ? -9.53172  4.01822  5.16667  1.000 31.93285  ? 59  GLY A HA3  1 
ATOM   887  N N    . PHE A 1 60  ? -6.99582  5.60762  5.85133  1.000 26.75986  ? 60  PHE A N    1 
ATOM   888  C CA   . PHE A 1 60  ? -5.89706  6.36593  5.27686  1.000 26.51419  ? 60  PHE A CA   1 
ATOM   889  C C    . PHE A 1 60  ? -4.74254  6.42471  6.24871  1.000 24.41263  ? 60  PHE A C    1 
ATOM   890  O O    . PHE A 1 60  ? -3.75287  5.71843  6.06229  1.000 25.66103  ? 60  PHE A O    1 
ATOM   891  C CB   . PHE A 1 60  ? -6.34080  7.78152  4.91886  1.000 33.41420  ? 60  PHE A CB   1 
ATOM   892  C CG   . PHE A 1 60  ? -5.31619  8.58327  4.15572  1.000 31.97449  ? 60  PHE A CG   1 
ATOM   893  C CD1  . PHE A 1 60  ? -4.17403  7.99731  3.65009  1.000 31.38368  ? 60  PHE A CD1  1 
ATOM   894  C CD2  . PHE A 1 60  ? -5.49613  9.94505  3.96771  1.000 34.24443  ? 60  PHE A CD2  1 
ATOM   895  C CE1  . PHE A 1 60  ? -3.24529  8.74586  2.94364  1.000 35.61061  ? 60  PHE A CE1  1 
ATOM   896  C CE2  . PHE A 1 60  ? -4.55956  10.69986 3.26601  1.000 33.72351  ? 60  PHE A CE2  1 
ATOM   897  C CZ   . PHE A 1 60  ? -3.44493  10.09725 2.75877  1.000 40.44065  ? 60  PHE A CZ   1 
ATOM   898  H H    . PHE A 1 60  ? -7.20136  5.83689  6.65432  1.000 31.99952  ? 60  PHE A H    1 
ATOM   899  H HA   . PHE A 1 60  ? -5.60511  5.92809  4.46202  1.000 31.70471  ? 60  PHE A HA   1 
ATOM   900  H HB2  . PHE A 1 60  ? -7.13802  7.72583  4.36909  1.000 39.98472  ? 60  PHE A HB2  1 
ATOM   901  H HB3  . PHE A 1 60  ? -6.53630  8.26093  5.73914  1.000 39.98472  ? 60  PHE A HB3  1 
ATOM   902  H HD1  . PHE A 1 60  ? -4.02537  7.08920  3.78479  1.000 37.54810  ? 60  PHE A HD1  1 
ATOM   903  H HD2  . PHE A 1 60  ? -6.25252  10.36005 4.31491  1.000 40.98100  ? 60  PHE A HD2  1 
ATOM   904  H HE1  . PHE A 1 60  ? -2.48710  8.33604  2.59424  1.000 42.62042  ? 60  PHE A HE1  1 
ATOM   905  H HE2  . PHE A 1 60  ? -4.69323  11.61200 3.14337  1.000 40.35590  ? 60  PHE A HE2  1 
ATOM   906  H HZ   . PHE A 1 60  ? -2.81933  10.59897 2.28783  1.000 48.41647  ? 60  PHE A HZ   1 
ATOM   907  N N    . MET A 1 61  ? -4.85525  7.26136  7.27702  1.000 24.62823  ? 61  MET A N    1 
ATOM   908  C CA   . MET A 1 61  ? -3.73349  7.46766  8.17905  1.000 24.38683  ? 61  MET A CA   1 
ATOM   909  C C    . MET A 1 61  ? -4.13574  8.34983  9.35502  1.000 22.59569  ? 61  MET A C    1 
ATOM   910  O O    . MET A 1 61  ? -4.99908  9.21851  9.23122  1.000 21.57191  ? 61  MET A O    1 
ATOM   911  C CB   . MET A 1 61  ? -2.55405  8.10187  7.41666  1.000 26.80755  ? 61  MET A CB   1 
ATOM   912  C CG   . MET A 1 61  ? -2.88748  9.41277  6.69171  1.000 28.32421  ? 61  MET A CG   1 
ATOM   913  S SD   . MET A 1 61  ? -2.54928  10.88700 7.65980  1.000 39.58152  ? 61  MET A SD   1 
ATOM   914  C CE   . MET A 1 61  ? -3.98786  11.90242 7.25861  1.000 41.86257  ? 61  MET A CE   1 
ATOM   915  H H    . MET A 1 61  ? -5.56162  7.71314  7.46817  1.000 29.44156  ? 61  MET A H    1 
ATOM   916  H HA   . MET A 1 61  ? -3.46731  6.60947  8.54449  1.000 29.15189  ? 61  MET A HA   1 
ATOM   917  H HB2  . MET A 1 61  ? -1.84416  8.29107  8.05003  1.000 32.05675  ? 61  MET A HB2  1 
ATOM   918  H HB3  . MET A 1 61  ? -2.24354  7.47014  6.74927  1.000 32.05675  ? 61  MET A HB3  1 
ATOM   919  H HG2  . MET A 1 61  ? -2.35717  9.46411  5.88112  1.000 33.87673  ? 61  MET A HG2  1 
ATOM   920  H HG3  . MET A 1 61  ? -3.83202  9.41515  6.47092  1.000 33.87673  ? 61  MET A HG3  1 
ATOM   921  H HE1  . MET A 1 61  ? -3.82252  12.81305 7.54896  1.000 50.12277  ? 61  MET A HE1  1 
ATOM   922  H HE2  . MET A 1 61  ? -4.13130  11.88193 6.29949  1.000 50.12277  ? 61  MET A HE2  1 
ATOM   923  H HE3  . MET A 1 61  ? -4.76444  11.54495 7.71691  1.000 50.12277  ? 61  MET A HE3  1 
ATOM   924  N N    . CYS A 1 62  ? -3.46053  8.14037  10.47988 1.000 23.48119  ? 62  CYS A N    1 
ATOM   925  C CA   . CYS A 1 62  ? -3.55795  9.00348  11.64514 1.000 22.19818  ? 62  CYS A CA   1 
ATOM   926  C C    . CYS A 1 62  ? -2.29908  9.84923  11.65701 1.000 22.27757  ? 62  CYS A C    1 
ATOM   927  O O    . CYS A 1 62  ? -1.19444  9.30391  11.66758 1.000 23.53484  ? 62  CYS A O    1 
ATOM   928  C CB   . CYS A 1 62  ? -3.67168  8.18452  12.93408 1.000 23.85249  ? 62  CYS A CB   1 
ATOM   929  S SG   . CYS A 1 62  ? -4.93112  6.90295  12.89675 1.000 28.51900  ? 62  CYS A SG   1 
ATOM   930  H H    . CYS A 1 62  ? -2.92095  7.48045  10.59374 1.000 28.06512  ? 62  CYS A H    1 
ATOM   931  H HA   . CYS A 1 62  ? -4.34440  9.56900  11.59423 1.000 26.52550  ? 62  CYS A HA   1 
ATOM   932  H HB2  . CYS A 1 62  ? -2.81942  7.75260  13.10139 1.000 28.51068  ? 62  CYS A HB2  1 
ATOM   933  H HB3  . CYS A 1 62  ? -3.88767  8.78604  13.66375 1.000 28.51068  ? 62  CYS A HB3  1 
ATOM   934  H HG   . CYS A 1 62  ? -4.92597  6.31947  13.94533 1.000 34.11048  ? 62  CYS A HG   1 
ATOM   935  N N    . GLN A 1 63  ? -2.45723  11.16317 11.71586 1.000 21.01268  ? 63  GLN A N    1 
ATOM   936  C CA   . GLN A 1 63  ? -1.32190  12.07061 11.70405 1.000 20.84938  ? 63  GLN A CA   1 
ATOM   937  C C    . GLN A 1 63  ? -1.30384  12.92933 12.95986 1.000 21.21431  ? 63  GLN A C    1 
ATOM   938  O O    . GLN A 1 63  ? -2.33519  13.43719 13.39800 1.000 22.31330  ? 63  GLN A O    1 
ATOM   939  C CB   . GLN A 1 63  ? -1.34182  12.95894 10.44362 1.000 22.56625  ? 63  GLN A CB   1 
ATOM   940  C CG   . GLN A 1 63  ? -0.29093  14.04791 10.41637 1.000 21.97106  ? 63  GLN A CG   1 
ATOM   941  C CD   . GLN A 1 63  ? -0.20796  14.75246 9.10474  1.000 23.90838  ? 63  GLN A CD   1 
ATOM   942  O OE1  . GLN A 1 63  ? -0.51737  14.19162 8.06756  1.000 32.89982  ? 63  GLN A OE1  1 
ATOM   943  N NE2  . GLN A 1 63  ? 0.21237   15.99511 9.13966  1.000 28.99793  ? 63  GLN A NE2  1 
ATOM   944  H H    . GLN A 1 63  ? -3.22074  11.55607 11.76363 1.000 25.10290  ? 63  GLN A H    1 
ATOM   945  H HA   . GLN A 1 63  ? -0.50105  11.55380 11.70239 1.000 24.90695  ? 63  GLN A HA   1 
ATOM   946  H HB2  . GLN A 1 63  ? -1.19749  12.39509 9.66764  1.000 26.96718  ? 63  GLN A HB2  1 
ATOM   947  H HB3  . GLN A 1 63  ? -2.20911  13.38928 10.38431 1.000 26.96718  ? 63  GLN A HB3  1 
ATOM   948  H HG2  . GLN A 1 63  ? -0.50354  14.70693 11.09563 1.000 26.25296  ? 63  GLN A HG2  1 
ATOM   949  H HG3  . GLN A 1 63  ? 0.57611   13.65256 10.59757 1.000 26.25296  ? 63  GLN A HG3  1 
ATOM   950  H HE21 . GLN A 1 63  ? 0.42140   16.35739 9.89110  1.000 34.68521  ? 63  GLN A HE21 1 
ATOM   951  H HE22 . GLN A 1 63  ? 0.27881   16.44721 8.41110  1.000 34.68521  ? 63  GLN A HE22 1 
ATOM   952  N N    . GLY A 1 64  ? -0.11950  13.09812 13.52122 1.000 24.65711  ? 64  GLY A N    1 
ATOM   953  C CA   . GLY A 1 64  ? 0.09425   13.96876 14.66124 1.000 27.68387  ? 64  GLY A CA   1 
ATOM   954  C C    . GLY A 1 64  ? 1.49865   14.54289 14.64516 1.000 21.95593  ? 64  GLY A C    1 
ATOM   955  O O    . GLY A 1 64  ? 2.10506   14.71334 13.57030 1.000 22.12516  ? 64  GLY A O    1 
ATOM   956  H H    . GLY A 1 64  ? 0.59741   12.70718 13.25140 1.000 29.47622  ? 64  GLY A H    1 
ATOM   957  H HA2  . GLY A 1 64  ? -0.54209  14.70051 14.63858 1.000 33.10833  ? 64  GLY A HA2  1 
ATOM   958  H HA3  . GLY A 1 64  ? -0.02880  13.46859 15.48318 1.000 33.10833  ? 64  GLY A HA3  1 
ATOM   959  N N    . GLY A 1 65  ? 2.00964   14.88016 15.81907 1.000 22.77770  ? 65  GLY A N    1 
ATOM   960  C CA   . GLY A 1 65  ? 3.35919   15.35654 15.96697 1.000 23.48414  ? 65  GLY A CA   1 
ATOM   961  C C    . GLY A 1 65  ? 3.55636   16.85330 15.95210 1.000 24.52516  ? 65  GLY A C    1 
ATOM   962  O O    . GLY A 1 65  ? 4.69136   17.30149 16.12212 1.000 26.00127  ? 65  GLY A O    1 
ATOM   963  H H    . GLY A 1 65  ? 1.57689   14.83819 16.56107 1.000 27.22093  ? 65  GLY A H    1 
ATOM   964  H HA2  . GLY A 1 65  ? 3.70532   15.02911 16.81188 1.000 28.06865  ? 65  GLY A HA2  1 
ATOM   965  H HA3  . GLY A 1 65  ? 3.89130   14.98903 15.24400 1.000 28.06865  ? 65  GLY A HA3  1 
ATOM   966  N N    . ASP A 1 66  ? 2.51010   17.63775 15.74389 1.000 27.94590  ? 66  ASP A N    1 
ATOM   967  C CA   . ASP A 1 66  ? 2.62019   19.09063 15.69988 1.000 25.57604  ? 66  ASP A CA   1 
ATOM   968  C C    . ASP A 1 66  ? 2.47416   19.60076 17.12511 1.000 28.64156  ? 66  ASP A C    1 
ATOM   969  O O    . ASP A 1 66  ? 1.35850   19.73458 17.63979 1.000 32.19738  ? 66  ASP A O    1 
ATOM   970  C CB   . ASP A 1 66  ? 1.56145   19.67543 14.77608 1.000 24.25589  ? 66  ASP A CB   1 
ATOM   971  C CG   . ASP A 1 66  ? 1.70604   21.16374 14.61532 1.000 23.88362  ? 66  ASP A CG   1 
ATOM   972  O OD1  . ASP A 1 66  ? 2.51500   21.75394 15.36310 1.000 25.47946  ? 66  ASP A OD1  1 
ATOM   973  O OD2  . ASP A 1 66  ? 1.02429   21.75109 13.75640 1.000 22.61675  ? 66  ASP A OD2  1 
ATOM   974  H H    . ASP A 1 66  ? 1.70934   17.34843 15.62274 1.000 33.42277  ? 66  ASP A H    1 
ATOM   975  H HA   . ASP A 1 66  ? 3.49143   19.35200 15.36296 1.000 30.57894  ? 66  ASP A HA   1 
ATOM   976  H HB2  . ASP A 1 66  ? 1.64334   19.26747 13.89986 1.000 28.99475  ? 66  ASP A HB2  1 
ATOM   977  H HB3  . ASP A 1 66  ? 0.68265   19.49530 15.14509 1.000 28.99475  ? 66  ASP A HB3  1 
ATOM   978  N N    . PHE A 1 67  ? 3.60578   19.87986 17.77026 1.000 27.75479  ? 67  PHE A N    1 
ATOM   979  C CA   . PHE A 1 67  ? 3.60392   20.29878 19.15935 1.000 24.88900  ? 67  PHE A CA   1 
ATOM   980  C C    . PHE A 1 67  ? 3.84170   21.78117 19.33416 1.000 24.64501  ? 67  PHE A C    1 
ATOM   981  O O    . PHE A 1 67  ? 4.12236   22.20809 20.44934 1.000 31.46364  ? 67  PHE A O    1 
ATOM   982  C CB   . PHE A 1 67  ? 4.63715   19.50587 19.96314 1.000 26.10405  ? 67  PHE A CB   1 
ATOM   983  C CG   . PHE A 1 67  ? 5.99054   19.55422 19.40598 1.000 24.82097  ? 67  PHE A CG   1 
ATOM   984  C CD1  . PHE A 1 67  ? 6.82675   20.61613 19.68958 1.000 30.42519  ? 67  PHE A CD1  1 
ATOM   985  C CD2  . PHE A 1 67  ? 6.45696   18.53770 18.59595 1.000 30.25825  ? 67  PHE A CD2  1 
ATOM   986  C CE1  . PHE A 1 67  ? 8.11918   20.68419 19.13534 1.000 29.47221  ? 67  PHE A CE1  1 
ATOM   987  C CE2  . PHE A 1 67  ? 7.77586   18.58755 18.07321 1.000 32.11872  ? 67  PHE A CE2  1 
ATOM   988  C CZ   . PHE A 1 67  ? 8.58033   19.67046 18.33903 1.000 28.43168  ? 67  PHE A CZ   1 
ATOM   989  H H    . PHE A 1 67  ? 4.38868   19.83190 17.41760 1.000 33.19343  ? 67  PHE A H    1 
ATOM   990  H HA   . PHE A 1 67  ? 2.72832   20.09886 19.52577 1.000 29.75448  ? 67  PHE A HA   1 
ATOM   991  H HB2  . PHE A 1 67  ? 4.67535   19.86729 20.86249 1.000 31.21255  ? 67  PHE A HB2  1 
ATOM   992  H HB3  . PHE A 1 67  ? 4.36258   18.57595 19.99069 1.000 31.21255  ? 67  PHE A HB3  1 
ATOM   993  H HD1  . PHE A 1 67  ? 6.53252   21.29455 20.25356 1.000 36.39791  ? 67  PHE A HD1  1 
ATOM   994  H HD2  . PHE A 1 67  ? 5.90486   17.81761 18.39209 1.000 36.19759  ? 67  PHE A HD2  1 
ATOM   995  H HE1  . PHE A 1 67  ? 8.66095   21.41950 19.31058 1.000 35.25433  ? 67  PHE A HE1  1 
ATOM   996  H HE2  . PHE A 1 67  ? 8.09578   17.88771 17.55093 1.000 38.43014  ? 67  PHE A HE2  1 
ATOM   997  H HZ   . PHE A 1 67  ? 9.43645   19.71424 17.97843 1.000 34.00570  ? 67  PHE A HZ   1 
ATOM   998  N N    . THR A 1 68  ? 3.71428   22.57394 18.27787 1.000 25.63807  ? 68  THR A N    1 
ATOM   999  C CA   . THR A 1 68  ? 3.80921   24.01547 18.39216 1.000 24.39043  ? 68  THR A CA   1 
ATOM   1000 C C    . THR A 1 68  ? 2.57957   24.73883 17.87402 1.000 25.09267  ? 68  THR A C    1 
ATOM   1001 O O    . THR A 1 68  ? 2.34671   25.88392 18.27272 1.000 23.85718  ? 68  THR A O    1 
ATOM   1002 C CB   . THR A 1 68  ? 5.03994   24.54407 17.63809 1.000 27.64571  ? 68  THR A CB   1 
ATOM   1003 O OG1  . THR A 1 68  ? 4.77594   24.58424 16.23544 1.000 31.00695  ? 68  THR A OG1  1 
ATOM   1004 C CG2  . THR A 1 68  ? 6.25998   23.67407 17.87573 1.000 30.00838  ? 68  THR A CG2  1 
ATOM   1005 H H    . THR A 1 68  ? 3.57093   22.29431 17.47733 1.000 30.65337  ? 68  THR A H    1 
ATOM   1006 H HA   . THR A 1 68  ? 3.92571   24.24516 19.32734 1.000 29.15620  ? 68  THR A HA   1 
ATOM   1007 H HB   . THR A 1 68  ? 5.23394   25.43621 17.96573 1.000 33.06253  ? 68  THR A HB   1 
ATOM   1008 H HG1  . THR A 1 68  ? 5.38464   25.00748 15.84053 1.000 37.09602  ? 68  THR A HG1  1 
ATOM   1009 H HG21 . THR A 1 68  ? 7.05761   24.12848 17.56236 1.000 35.89775  ? 68  THR A HG21 1 
ATOM   1010 H HG22 . THR A 1 68  ? 6.35532   23.48794 18.82291 1.000 35.89775  ? 68  THR A HG22 1 
ATOM   1011 H HG23 . THR A 1 68  ? 6.16736   22.83508 17.39780 1.000 35.89775  ? 68  THR A HG23 1 
ATOM   1012 N N    . ARG A 1 69  ? 1.79225   24.11292 16.99967 1.000 26.24196  ? 69  ARG A N    1 
ATOM   1013 C CA   . ARG A 1 69  ? 0.57333   24.73582 16.49095 1.000 28.18480  ? 69  ARG A CA   1 
ATOM   1014 C C    . ARG A 1 69  ? -0.61700  23.79437 16.46615 1.000 24.83273  ? 69  ARG A C    1 
ATOM   1015 O O    . ARG A 1 69  ? -1.72224  24.24756 16.17194 1.000 29.14776  ? 69  ARG A O    1 
ATOM   1016 C CB   . ARG A 1 69  ? 0.79283   25.31939 15.08119 1.000 26.86937  ? 69  ARG A CB   1 
ATOM   1017 C CG   . ARG A 1 69  ? 1.97392   26.26675 15.02350 1.000 26.04636  ? 69  ARG A CG   1 
ATOM   1018 C CD   . ARG A 1 69  ? 1.99722   27.12941 13.75112 1.000 34.23822  ? 69  ARG A CD   1 
ATOM   1019 N NE   . ARG A 1 69  ? 0.72863   27.82747 13.53331 1.000 44.72607  ? 69  ARG A NE   1 
ATOM   1020 C CZ   . ARG A 1 69  ? 0.41691   29.00365 14.06899 1.000 43.78663  ? 69  ARG A CZ   1 
ATOM   1021 N NH1  . ARG A 1 69  ? 1.28256   29.62095 14.87970 1.000 39.90548  ? 69  ARG A NH1  1 
ATOM   1022 N NH2  . ARG A 1 69  ? -0.76071  29.55310 13.79324 1.000 33.06819  ? 69  ARG A NH2  1 
ATOM   1023 H H    . ARG A 1 69  ? 1.94268   23.32648 16.68584 1.000 31.37804  ? 69  ARG A H    1 
ATOM   1024 H HA   . ARG A 1 69  ? 0.34698   25.48580 17.06296 1.000 33.70945  ? 69  ARG A HA   1 
ATOM   1025 H HB2  . ARG A 1 69  ? 0.95831   24.59301 14.45999 1.000 32.13093  ? 69  ARG A HB2  1 
ATOM   1026 H HB3  . ARG A 1 69  ? -0.00040  25.80984 14.81443 1.000 32.13093  ? 69  ARG A HB3  1 
ATOM   1027 H HG2  . ARG A 1 69  ? 1.93617   26.86371 15.78711 1.000 31.14332  ? 69  ARG A HG2  1 
ATOM   1028 H HG3  . ARG A 1 69  ? 2.79397   25.74921 15.04720 1.000 31.14332  ? 69  ARG A HG3  1 
ATOM   1029 H HD2  . ARG A 1 69  ? 2.69859   27.79478 13.83023 1.000 40.97355  ? 69  ARG A HD2  1 
ATOM   1030 H HD3  . ARG A 1 69  ? 2.16473   26.56044 12.98358 1.000 40.97355  ? 69  ARG A HD3  1 
ATOM   1031 H HE   . ARG A 1 69  ? 0.14602   27.45134 13.02469 1.000 53.55897  ? 69  ARG A HE   1 
ATOM   1032 H HH11 . ARG A 1 69  ? 2.04185   29.25720 15.05510 1.000 47.77426  ? 69  ARG A HH11 1 
ATOM   1033 H HH12 . ARG A 1 69  ? 1.08007   30.38177 15.22577 1.000 47.77426  ? 69  ARG A HH12 1 
ATOM   1034 H HH21 . ARG A 1 69  ? -1.31280  29.14824 13.27277 1.000 39.56952  ? 69  ARG A HH21 1 
ATOM   1035 H HH22 . ARG A 1 69  ? -0.97099  30.31366 14.13519 1.000 39.56952  ? 69  ARG A HH22 1 
ATOM   1036 N N    . HIS A 1 70  ? -0.44606  22.52139 16.79541 1.000 27.73730  ? 70  HIS A N    1 
ATOM   1037 C CA   . HIS A 1 70  ? -1.53717  21.59190 17.11644 1.000 28.71687  ? 70  HIS A CA   1 
ATOM   1038 C C    . HIS A 1 70  ? -2.56936  21.47470 16.00973 1.000 26.08244  ? 70  HIS A C    1 
ATOM   1039 O O    . HIS A 1 70  ? -3.66175  20.95507 16.24425 1.000 29.55227  ? 70  HIS A O    1 
ATOM   1040 C CB   . HIS A 1 70  ? -2.21305  21.97154 18.44890 1.000 20.99087  ? 70  HIS A CB   1 
ATOM   1041 C CG   . HIS A 1 70  ? -1.26068  22.60203 19.41927 1.000 32.48946  ? 70  HIS A CG   1 
ATOM   1042 N ND1  . HIS A 1 70  ? -1.35189  23.92228 19.80296 1.000 30.66052  ? 70  HIS A ND1  1 
ATOM   1043 C CD2  . HIS A 1 70  ? -0.14755  22.11428 20.02462 1.000 37.42018  ? 70  HIS A CD2  1 
ATOM   1044 C CE1  . HIS A 1 70  ? -0.35363  24.21327 20.61960 1.000 28.24917  ? 70  HIS A CE1  1 
ATOM   1045 N NE2  . HIS A 1 70  ? 0.39501   23.13556 20.76833 1.000 28.12101  ? 70  HIS A NE2  1 
ATOM   1046 H H    . HIS A 1 70  ? 0.32764   22.14902 16.84376 1.000 33.17245  ? 70  HIS A H    1 
ATOM   1047 H HA   . HIS A 1 70  ? -1.14896  20.70867 17.21691 1.000 34.34793  ? 70  HIS A HA   1 
ATOM   1048 H HB2  . HIS A 1 70  ? -2.92621  22.60495 18.27257 1.000 25.07673  ? 70  HIS A HB2  1 
ATOM   1049 H HB3  . HIS A 1 70  ? -2.57470  21.17061 18.85954 1.000 25.07673  ? 70  HIS A HB3  1 
ATOM   1050 H HD2  . HIS A 1 70  ? 0.18618   21.24943 19.95003 1.000 44.79190  ? 70  HIS A HD2  1 
ATOM   1051 H HE1  . HIS A 1 70  ? -0.20382  25.03834 21.02174 1.000 33.78669  ? 70  HIS A HE1  1 
ATOM   1052 H HE2  . HIS A 1 70  ? 1.10486   23.08145 21.25082 1.000 33.63290  ? 70  HIS A HE2  1 
ATOM   1053 N N    . ASN A 1 71  ? -2.24832  21.91563 14.80044 1.000 23.43558  ? 71  ASN A N    1 
ATOM   1054 C CA   . ASN A 1 71  ? -3.19506  21.78498 13.70314 1.000 24.93554  ? 71  ASN A CA   1 
ATOM   1055 C C    . ASN A 1 71  ? -2.57555  21.27343 12.40222 1.000 27.17167  ? 71  ASN A C    1 
ATOM   1056 O O    . ASN A 1 71  ? -3.29292  21.14165 11.40015 1.000 28.97357  ? 71  ASN A O    1 
ATOM   1057 C CB   . ASN A 1 71  ? -3.88925  23.14329 13.46173 1.000 23.67155  ? 71  ASN A CB   1 
ATOM   1058 C CG   . ASN A 1 71  ? -2.92387  24.22900 13.01099 1.000 23.10487  ? 71  ASN A CG   1 
ATOM   1059 O OD1  . ASN A 1 71  ? -1.81068  23.95283 12.61916 1.000 25.10539  ? 71  ASN A OD1  1 
ATOM   1060 N ND2  . ASN A 1 71  ? -3.35035  25.46442 13.08130 1.000 28.16693  ? 71  ASN A ND2  1 
ATOM   1061 H H    . ASN A 1 71  ? -1.50120  22.28785 14.59338 1.000 28.01038  ? 71  ASN A H    1 
ATOM   1062 H HA   . ASN A 1 71  ? -3.87688  21.14028 13.94887 1.000 29.81033  ? 71  ASN A HA   1 
ATOM   1063 H HB2  . ASN A 1 71  ? -4.56217  23.03557 12.77147 1.000 28.29355  ? 71  ASN A HB2  1 
ATOM   1064 H HB3  . ASN A 1 71  ? -4.30509  23.43642 14.28760 1.000 28.29355  ? 71  ASN A HB3  1 
ATOM   1065 H HD21 . ASN A 1 71  ? -2.83826  26.11067 12.83692 1.000 33.68800  ? 71  ASN A HD21 1 
ATOM   1066 H HD22 . ASN A 1 71  ? -4.14268  25.62992 13.37188 1.000 33.68800  ? 71  ASN A HD22 1 
ATOM   1067 N N    . GLY A 1 72  ? -1.27307  21.00693 12.37244 1.000 25.45296  ? 72  GLY A N    1 
ATOM   1068 C CA   . GLY A 1 72  ? -0.58755  20.61870 11.15699 1.000 24.22657  ? 72  GLY A CA   1 
ATOM   1069 C C    . GLY A 1 72  ? 0.23380   21.70255 10.48685 1.000 22.06217  ? 72  GLY A C    1 
ATOM   1070 O O    . GLY A 1 72  ? 0.87615   21.42071 9.46723  1.000 19.22458  ? 72  GLY A O    1 
ATOM   1071 H H    . GLY A 1 72  ? -0.75879  21.04637 13.06059 1.000 30.43123  ? 72  GLY A H    1 
ATOM   1072 H HA2  . GLY A 1 72  ? 0.01176   19.88461 11.36400 1.000 28.95956  ? 72  GLY A HA2  1 
ATOM   1073 H HA3  . GLY A 1 72  ? -1.24881  20.31524 10.51548 1.000 28.95956  ? 72  GLY A HA3  1 
ATOM   1074 N N    . THR A 1 73  ? 0.21986   22.92850 11.00969 1.000 24.49091  ? 73  THR A N    1 
ATOM   1075 C CA   . THR A 1 73  ? 0.98129   24.03881 10.45844 1.000 23.71166  ? 73  THR A CA   1 
ATOM   1076 C C    . THR A 1 73  ? 2.25107   24.32859 11.23459 1.000 22.61396  ? 73  THR A C    1 
ATOM   1077 O O    . THR A 1 73  ? 2.94276   25.30254 10.92873 1.000 21.80368  ? 73  THR A O    1 
ATOM   1078 C CB   . THR A 1 73  ? 0.11928   25.29678 10.42038 1.000 21.71662  ? 73  THR A CB   1 
ATOM   1079 O OG1  . THR A 1 73  ? -0.17607  25.72579 11.74927 1.000 24.47995  ? 73  THR A OG1  1 
ATOM   1080 C CG2  . THR A 1 73  ? -1.15990  25.02712 9.69961  1.000 21.72799  ? 73  THR A CG2  1 
ATOM   1081 H H    . THR A 1 73  ? -0.23811  23.14441 11.70484 1.000 29.27678  ? 73  THR A H    1 
ATOM   1082 H HA   . THR A 1 73  ? 1.23164   23.81485 9.54845  1.000 28.34168  ? 73  THR A HA   1 
ATOM   1083 H HB   . THR A 1 73  ? 0.59923   25.99977 9.95522  1.000 25.94763  ? 73  THR A HB   1 
ATOM   1084 H HG1  . THR A 1 73  ? -0.61444  25.13299 12.15179 1.000 29.26362  ? 73  THR A HG1  1 
ATOM   1085 H HG21 . THR A 1 73  ? -1.69067  25.83759 9.65124  1.000 25.96127  ? 73  THR A HG21 1 
ATOM   1086 H HG22 . THR A 1 73  ? -0.97449  24.71804 8.79906  1.000 25.96127  ? 73  THR A HG22 1 
ATOM   1087 H HG23 . THR A 1 73  ? -1.66739  24.34596 10.16799 1.000 25.96127  ? 73  THR A HG23 1 
ATOM   1088 N N    . GLY A 1 74  ? 2.57258   23.52701 12.23309 1.000 24.61347  ? 74  GLY A N    1 
ATOM   1089 C CA   . GLY A 1 74  ? 3.79296   23.76837 12.96957 1.000 24.01735  ? 74  GLY A CA   1 
ATOM   1090 C C    . GLY A 1 74  ? 4.65610   22.53512 13.16687 1.000 27.05503  ? 74  GLY A C    1 
ATOM   1091 O O    . GLY A 1 74  ? 4.63524   21.63382 12.34482 1.000 25.55905  ? 74  GLY A O    1 
ATOM   1092 H H    . GLY A 1 74  ? 2.10990   22.85171 12.49673 1.000 29.42385  ? 74  GLY A H    1 
ATOM   1093 H HA2  . GLY A 1 74  ? 4.32096   24.42855 12.49388 1.000 28.70851  ? 74  GLY A HA2  1 
ATOM   1094 H HA3  . GLY A 1 74  ? 3.56660   24.11691 13.84602 1.000 28.70851  ? 74  GLY A HA3  1 
ATOM   1095 N N    . GLY A 1 75  ? 5.40092   22.47158 14.26163 1.000 30.52705  ? 75  GLY A N    1 
ATOM   1096 C CA   . GLY A 1 75  ? 6.34220   21.39348 14.48802 1.000 27.99863  ? 75  GLY A CA   1 
ATOM   1097 C C    . GLY A 1 75  ? 7.73915   21.76604 14.02266 1.000 25.99259  ? 75  GLY A C    1 
ATOM   1098 O O    . GLY A 1 75  ? 7.94704   22.65636 13.20022 1.000 27.44062  ? 75  GLY A O    1 
ATOM   1099 H H    . GLY A 1 75  ? 5.37683   23.05143 14.89628 1.000 36.52015  ? 75  GLY A H    1 
ATOM   1100 H HA2  . GLY A 1 75  ? 6.37668   21.18644 15.43503 1.000 33.48605  ? 75  GLY A HA2  1 
ATOM   1101 H HA3  . GLY A 1 75  ? 6.05468   20.60448 14.00252 1.000 33.48605  ? 75  GLY A HA3  1 
ATOM   1102 N N    . LYS A 1 76  ? 8.72030   21.04981 14.56575 1.000 28.91307  ? 76  LYS A N    1 
ATOM   1103 C CA   . LYS A 1 76  ? 10.11933  21.29327 14.27873 1.000 26.38026  ? 76  LYS A CA   1 
ATOM   1104 C C    . LYS A 1 76  ? 10.89805  20.05508 14.66145 1.000 26.28055  ? 76  LYS A C    1 
ATOM   1105 O O    . LYS A 1 76  ? 10.52366  19.33985 15.59298 1.000 27.09051  ? 76  LYS A O    1 
ATOM   1106 C CB   . LYS A 1 76  ? 10.62702  22.51087 15.04718 1.000 34.19169  ? 76  LYS A CB   1 
ATOM   1107 C CG   . LYS A 1 76  ? 10.59779  22.39242 16.57107 1.000 36.90562  ? 76  LYS A CG   1 
ATOM   1108 C CD   . LYS A 1 76  ? 11.18377  23.63728 17.24799 1.000 40.55695  ? 76  LYS A CD   1 
ATOM   1109 C CE   . LYS A 1 76  ? 11.30542  23.43884 18.75320 1.000 48.98892  ? 76  LYS A CE   1 
ATOM   1110 N NZ   . LYS A 1 76  ? 12.19930  24.46386 19.37164 1.000 53.85609  ? 76  LYS A NZ   1 
ATOM   1111 H H    . LYS A 1 76  ? 8.59290   20.40206 15.11692 1.000 34.58337  ? 76  LYS A H    1 
ATOM   1112 H HA   . LYS A 1 76  ? 10.24916  21.45606 13.33134 1.000 31.54400  ? 76  LYS A HA   1 
ATOM   1113 H HB2  . LYS A 1 76  ? 11.54801  22.67154 14.78858 1.000 40.91772  ? 76  LYS A HB2  1 
ATOM   1114 H HB3  . LYS A 1 76  ? 10.07723  23.27310 14.80713 1.000 40.91772  ? 76  LYS A HB3  1 
ATOM   1115 H HG2  . LYS A 1 76  ? 9.67982   22.28918 16.86698 1.000 44.17442  ? 76  LYS A HG2  1 
ATOM   1116 H HG3  . LYS A 1 76  ? 11.12249  21.62319 16.84289 1.000 44.17442  ? 76  LYS A HG3  1 
ATOM   1117 H HD2  . LYS A 1 76  ? 12.06789  23.81322 16.88983 1.000 48.55602  ? 76  LYS A HD2  1 
ATOM   1118 H HD3  . LYS A 1 76  ? 10.60269  24.39670 17.08516 1.000 48.55602  ? 76  LYS A HD3  1 
ATOM   1119 H HE2  . LYS A 1 76  ? 10.42767  23.51526 19.15892 1.000 58.67439  ? 76  LYS A HE2  1 
ATOM   1120 H HE3  . LYS A 1 76  ? 11.67834  22.56144 18.93210 1.000 58.67439  ? 76  LYS A HE3  1 
ATOM   1121 H HZ1  . LYS A 1 76  ? 12.26815  24.31929 20.24711 1.000 64.51500  ? 76  LYS A HZ1  1 
ATOM   1122 H HZ2  . LYS A 1 76  ? 13.01005  24.42046 19.00708 1.000 64.51500  ? 76  LYS A HZ2  1 
ATOM   1123 H HZ3  . LYS A 1 76  ? 11.86606  25.27834 19.23871 1.000 64.51500  ? 76  LYS A HZ3  1 
ATOM   1124 N N    . SER A 1 77  ? 11.97834  19.81444 13.93075 1.000 28.03537  ? 77  SER A N    1 
ATOM   1125 C CA   . SER A 1 77  ? 12.87597  18.70767 14.20927 1.000 26.14975  ? 77  SER A CA   1 
ATOM   1126 C C    . SER A 1 77  ? 13.93391  19.09409 15.23955 1.000 28.15076  ? 77  SER A C    1 
ATOM   1127 O O    . SER A 1 77  ? 14.07061  20.24916 15.63139 1.000 34.19643  ? 77  SER A O    1 
ATOM   1128 C CB   . SER A 1 77  ? 13.56605  18.24640 12.93201 1.000 29.56436  ? 77  SER A CB   1 
ATOM   1129 O OG   . SER A 1 77  ? 14.52583  19.18479 12.48815 1.000 30.88909  ? 77  SER A OG   1 
ATOM   1130 H H    . SER A 1 77  ? 12.21657  20.28903 13.25428 1.000 33.53013  ? 77  SER A H    1 
ATOM   1131 H HA   . SER A 1 77  ? 12.34848  17.97761 14.56936 1.000 31.26739  ? 77  SER A HA   1 
ATOM   1132 H HB2  . SER A 1 77  ? 14.01140  17.40222 13.10502 1.000 35.36492  ? 77  SER A HB2  1 
ATOM   1133 H HB3  . SER A 1 77  ? 12.89686  18.13257 12.23909 1.000 35.36492  ? 77  SER A HB3  1 
ATOM   1134 H HG   . SER A 1 77  ? 14.17761  19.94714 12.43182 1.000 36.95460  ? 77  SER A HG   1 
ATOM   1135 N N    . ILE A 1 78  ? 14.70535  18.10122 15.67582 1.000 27.03902  ? 78  ILE A N    1 
ATOM   1136 C CA   . ILE A 1 78  ? 15.81239  18.38750 16.58261 1.000 27.32794  ? 78  ILE A CA   1 
ATOM   1137 C C    . ILE A 1 78  ? 17.00411  19.03507 15.87605 1.000 34.74502  ? 78  ILE A C    1 
ATOM   1138 O O    . ILE A 1 78  ? 17.91890  19.55302 16.53736 1.000 28.96381  ? 78  ILE A O    1 
ATOM   1139 C CB   . ILE A 1 78  ? 16.25383  17.09018 17.28039 1.000 27.62448  ? 78  ILE A CB   1 
ATOM   1140 C CG1  . ILE A 1 78  ? 16.76848  16.08407 16.23583 1.000 27.79390  ? 78  ILE A CG1  1 
ATOM   1141 C CG2  . ILE A 1 78  ? 15.10146  16.50813 18.12239 1.000 25.09800  ? 78  ILE A CG2  1 
ATOM   1142 C CD1  . ILE A 1 78  ? 17.33127  14.79501 16.82533 1.000 29.31040  ? 78  ILE A CD1  1 
ATOM   1143 H H    . ILE A 1 78  ? 14.61124  17.27235 15.46674 1.000 32.33451  ? 78  ILE A H    1 
ATOM   1144 H HA   . ILE A 1 78  ? 15.50468  19.02027 17.25030 1.000 32.68121  ? 78  ILE A HA   1 
ATOM   1145 H HB   . ILE A 1 78  ? 16.98293  17.28823 17.88875 1.000 33.03706  ? 78  ILE A HB   1 
ATOM   1146 H HG12 . ILE A 1 78  ? 16.03347  15.84247 15.65079 1.000 33.24037  ? 78  ILE A HG12 1 
ATOM   1147 H HG13 . ILE A 1 78  ? 17.47598  16.50530 15.72308 1.000 33.24037  ? 78  ILE A HG13 1 
ATOM   1148 H HG21 . ILE A 1 78  ? 15.44234  15.77789 18.66224 1.000 30.00528  ? 78  ILE A HG21 1 
ATOM   1149 H HG22 . ILE A 1 78  ? 14.74577  17.20519 18.69554 1.000 30.00528  ? 78  ILE A HG22 1 
ATOM   1150 H HG23 . ILE A 1 78  ? 14.40793  16.18356 17.52693 1.000 30.00528  ? 78  ILE A HG23 1 
ATOM   1151 H HD11 . ILE A 1 78  ? 17.67345  14.24173 16.10582 1.000 35.06016  ? 78  ILE A HD11 1 
ATOM   1152 H HD12 . ILE A 1 78  ? 18.04688  15.01574 17.44185 1.000 35.06016  ? 78  ILE A HD12 1 
ATOM   1153 H HD13 . ILE A 1 78  ? 16.62310  14.32677 17.29453 1.000 35.06016  ? 78  ILE A HD13 1 
ATOM   1154 N N    . TYR A 1 79  ? 17.01622  19.01732 14.55234 1.000 31.29804  ? 79  TYR A N    1 
ATOM   1155 C CA   . TYR A 1 79  ? 18.10749  19.55213 13.76636 1.000 28.78376  ? 79  TYR A CA   1 
ATOM   1156 C C    . TYR A 1 79  ? 17.83701  20.97081 13.31089 1.000 31.29846  ? 79  TYR A C    1 
ATOM   1157 O O    . TYR A 1 79  ? 18.69263  21.57323 12.66728 1.000 40.86099  ? 79  TYR A O    1 
ATOM   1158 C CB   . TYR A 1 79  ? 18.35330  18.65806 12.54032 1.000 36.86739  ? 79  TYR A CB   1 
ATOM   1159 C CG   . TYR A 1 79  ? 18.39693  17.16661 12.81931 1.000 30.50856  ? 79  TYR A CG   1 
ATOM   1160 C CD1  . TYR A 1 79  ? 19.37174  16.62317 13.63560 1.000 29.93722  ? 79  TYR A CD1  1 
ATOM   1161 C CD2  . TYR A 1 79  ? 17.46437  16.30791 12.26316 1.000 29.51323  ? 79  TYR A CD2  1 
ATOM   1162 C CE1  . TYR A 1 79  ? 19.41638  15.28335 13.90685 1.000 26.64587  ? 79  TYR A CE1  1 
ATOM   1163 C CE2  . TYR A 1 79  ? 17.51701  14.96137 12.51267 1.000 28.55965  ? 79  TYR A CE2  1 
ATOM   1164 C CZ   . TYR A 1 79  ? 18.49916  14.45695 13.34453 1.000 30.14833  ? 79  TYR A CZ   1 
ATOM   1165 O OH   . TYR A 1 79  ? 18.55657  13.11462 13.62001 1.000 33.27243  ? 79  TYR A OH   1 
ATOM   1166 H H    . TYR A 1 79  ? 16.38150  18.68938 14.07360 1.000 37.44533  ? 79  TYR A H    1 
ATOM   1167 H HA   . TYR A 1 79  ? 18.91710  19.55253 14.30062 1.000 34.42820  ? 79  TYR A HA   1 
ATOM   1168 H HB2  . TYR A 1 79  ? 17.63913  18.81182 11.90219 1.000 44.12855  ? 79  TYR A HB2  1 
ATOM   1169 H HB3  . TYR A 1 79  ? 19.20626  18.90387 12.14925 1.000 44.12855  ? 79  TYR A HB3  1 
ATOM   1170 H HD1  . TYR A 1 79  ? 20.01334  17.18291 14.00969 1.000 35.81235  ? 79  TYR A HD1  1 
ATOM   1171 H HD2  . TYR A 1 79  ? 16.79512  16.64836 11.71445 1.000 35.30356  ? 79  TYR A HD2  1 
ATOM   1172 H HE1  . TYR A 1 79  ? 20.07059  14.94141 14.47253 1.000 31.86273  ? 79  TYR A HE1  1 
ATOM   1173 H HE2  . TYR A 1 79  ? 16.89488  14.38961 12.12416 1.000 34.15926  ? 79  TYR A HE2  1 
ATOM   1174 H HH   . TYR A 1 79  ? 17.98074  12.70352 13.16723 1.000 39.81461  ? 79  TYR A HH   1 
ATOM   1175 N N    . GLY A 1 80  ? 16.68500  21.50295 13.60555 1.000 37.59871  ? 80  GLY A N    1 
ATOM   1176 C CA   . GLY A 1 80  ? 16.31588  22.82873 13.17618 1.000 38.35438  ? 80  GLY A CA   1 
ATOM   1177 C C    . GLY A 1 80  ? 14.86163  22.84853 12.77412 1.000 42.49778  ? 80  GLY A C    1 
ATOM   1178 O O    . GLY A 1 80  ? 14.10990  21.92216 13.06161 1.000 41.41624  ? 80  GLY A O    1 
ATOM   1179 H H    . GLY A 1 80  ? 16.07739  21.10699 14.06774 1.000 45.00614  ? 80  GLY A H    1 
ATOM   1180 H HA2  . GLY A 1 80  ? 16.45290  23.46155 13.89844 1.000 45.91294  ? 80  GLY A HA2  1 
ATOM   1181 H HA3  . GLY A 1 80  ? 16.85758  23.09430 12.41661 1.000 45.91294  ? 80  GLY A HA3  1 
ATOM   1182 N N    . GLU A 1 81  ? 14.45800  23.92337 12.09652 1.000 40.42259  ? 81  GLU A N    1 
ATOM   1183 C CA   . GLU A 1 81  ? 13.06147  24.05972 11.71602 1.000 40.24076  ? 81  GLU A CA   1 
ATOM   1184 C C    . GLU A 1 81  ? 12.64314  22.96823 10.74836 1.000 43.70752  ? 81  GLU A C    1 
ATOM   1185 O O    . GLU A 1 81  ? 11.45590  22.65272 10.65875 1.000 44.97141  ? 81  GLU A O    1 
ATOM   1186 C CB   . GLU A 1 81  ? 12.83339  25.43672 11.10376 1.000 59.52292  ? 81  GLU A CB   1 
ATOM   1187 C CG   . GLU A 1 81  ? 11.44080  25.66587 10.52905 1.000 62.08591  ? 81  GLU A CG   1 
ATOM   1188 C CD   . GLU A 1 81  ? 11.18983  27.13675 10.19662 1.000 84.38420  ? 81  GLU A CD   1 
ATOM   1189 O OE1  . GLU A 1 81  ? 10.90274  27.92490 11.13406 1.000 75.75591  ? 81  GLU A OE1  1 
ATOM   1190 O OE2  . GLU A 1 81  ? 11.29618  27.50235 8.99914  1.000 79.68461  ? 81  GLU A OE2  1 
ATOM   1191 H H    . GLU A 1 81  ? 14.96520  24.57317 11.85135 1.000 48.39480  ? 81  GLU A H    1 
ATOM   1192 H HA   . GLU A 1 81  ? 12.50342  23.98417 12.50580 1.000 48.17660  ? 81  GLU A HA   1 
ATOM   1193 H HB2  . GLU A 1 81  ? 12.97751  26.10564 11.79128 1.000 71.31519  ? 81  GLU A HB2  1 
ATOM   1194 H HB3  . GLU A 1 81  ? 13.46943  25.56049 10.38194 1.000 71.31519  ? 81  GLU A HB3  1 
ATOM   1195 H HG2  . GLU A 1 81  ? 11.34426  25.15048 9.71299  1.000 74.39078  ? 81  GLU A HG2  1 
ATOM   1196 H HG3  . GLU A 1 81  ? 10.77782  25.38517 11.17910 1.000 74.39078  ? 81  GLU A HG3  1 
ATOM   1197 N N    . LYS A 1 82  ? 13.58845  22.39875 10.00359 1.000 43.83655  ? 82  LYS A N    1 
ATOM   1198 C CA   . LYS A 1 82  ? 13.28342  21.36841 9.01730  1.000 38.90503  ? 82  LYS A CA   1 
ATOM   1199 C C    . LYS A 1 82  ? 14.55989  20.59688 8.74018  1.000 35.14554  ? 82  LYS A C    1 
ATOM   1200 O O    . LYS A 1 82  ? 15.64279  20.98594 9.17964  1.000 38.00434  ? 82  LYS A O    1 
ATOM   1201 C CB   . LYS A 1 82  ? 12.72471  21.95705 7.71593  1.000 48.56568  ? 82  LYS A CB   1 
ATOM   1202 C CG   . LYS A 1 82  ? 13.62907  22.98685 7.06126  1.000 67.98040  ? 82  LYS A CG   1 
ATOM   1203 C CD   . LYS A 1 82  ? 13.06173  23.45885 5.72355  1.000 88.74578  ? 82  LYS A CD   1 
ATOM   1204 C CE   . LYS A 1 82  ? 14.08790  24.31701 4.94663  1.000 110.44184 ? 82  LYS A CE   1 
ATOM   1205 N NZ   . LYS A 1 82  ? 15.31294  23.55258 4.50131  1.000 70.11521  ? 82  LYS A NZ   1 
ATOM   1206 H H    . LYS A 1 82  ? 14.42433  22.59508 10.05212 1.000 52.49154  ? 82  LYS A H    1 
ATOM   1207 H HA   . LYS A 1 82  ? 12.61525  20.77020 9.38689  1.000 46.57372  ? 82  LYS A HA   1 
ATOM   1208 H HB2  . LYS A 1 82  ? 12.59182  21.23581 7.08106  1.000 58.16650  ? 82  LYS A HB2  1 
ATOM   1209 H HB3  . LYS A 1 82  ? 11.87802  22.38912 7.90919  1.000 58.16650  ? 82  LYS A HB3  1 
ATOM   1210 H HG2  . LYS A 1 82  ? 13.71477  23.75681 7.64497  1.000 81.46416  ? 82  LYS A HG2  1 
ATOM   1211 H HG3  . LYS A 1 82  ? 14.50105  22.59334 6.90099  1.000 81.46416  ? 82  LYS A HG3  1 
ATOM   1212 H HD2  . LYS A 1 82  ? 12.83492  22.68791 5.18031  1.000 106.38262 ? 82  LYS A HD2  1 
ATOM   1213 H HD3  . LYS A 1 82  ? 12.27072  23.99755 5.88168  1.000 106.38262 ? 82  LYS A HD3  1 
ATOM   1214 H HE2  . LYS A 1 82  ? 13.65882  24.67428 4.15344  1.000 132.41789 ? 82  LYS A HE2  1 
ATOM   1215 H HE3  . LYS A 1 82  ? 14.38460  25.04218 5.51847  1.000 132.41789 ? 82  LYS A HE3  1 
ATOM   1216 H HZ1  . LYS A 1 82  ? 15.86997  24.09550 4.06881  1.000 84.02594  ? 82  LYS A HZ1  1 
ATOM   1217 H HZ2  . LYS A 1 82  ? 15.73262  23.21163 5.20821  1.000 84.02594  ? 82  LYS A HZ2  1 
ATOM   1218 H HZ3  . LYS A 1 82  ? 15.07654  22.88866 3.95779  1.000 84.02594  ? 82  LYS A HZ3  1 
ATOM   1219 N N    . PHE A 1 83  ? 14.42108  19.49490 8.00488  1.000 27.74602  ? 83  PHE A N    1 
ATOM   1220 C CA   . PHE A 1 83  ? 15.58519  18.71777 7.60809  1.000 25.47425  ? 83  PHE A CA   1 
ATOM   1221 C C    . PHE A 1 83  ? 15.23932  17.86123 6.40675  1.000 23.16676  ? 83  PHE A C    1 
ATOM   1222 O O    . PHE A 1 83  ? 14.07305  17.65127 6.08567  1.000 25.48129  ? 83  PHE A O    1 
ATOM   1223 C CB   . PHE A 1 83  ? 16.13551  17.87519 8.76622  1.000 28.88905  ? 83  PHE A CB   1 
ATOM   1224 C CG   . PHE A 1 83  ? 15.30194  16.70638 9.16200  1.000 27.32518  ? 83  PHE A CG   1 
ATOM   1225 C CD1  . PHE A 1 83  ? 14.28268  16.85561 10.09713 1.000 26.45255  ? 83  PHE A CD1  1 
ATOM   1226 C CD2  . PHE A 1 83  ? 15.58654  15.44650 8.68013  1.000 26.64085  ? 83  PHE A CD2  1 
ATOM   1227 C CE1  . PHE A 1 83  ? 13.53966  15.79671 10.51168 1.000 22.48244  ? 83  PHE A CE1  1 
ATOM   1228 C CE2  . PHE A 1 83  ? 14.83157  14.36726 9.09724  1.000 27.99975  ? 83  PHE A CE2  1 
ATOM   1229 C CZ   . PHE A 1 83  ? 13.79977  14.55232 10.00618 1.000 27.34102  ? 83  PHE A CZ   1 
ATOM   1230 H H    . PHE A 1 83  ? 13.66948  19.18221 7.72752  1.000 33.18291  ? 83  PHE A H    1 
ATOM   1231 H HA   . PHE A 1 83  ? 16.28744  19.32667 7.33064  1.000 30.45679  ? 83  PHE A HA   1 
ATOM   1232 H HB2  . PHE A 1 83  ? 17.00636  17.53441 8.50857  1.000 34.55454  ? 83  PHE A HB2  1 
ATOM   1233 H HB3  . PHE A 1 83  ? 16.22008  18.44635 9.54566  1.000 34.55454  ? 83  PHE A HB3  1 
ATOM   1234 H HD1  . PHE A 1 83  ? 14.10608  17.69930 10.44627 1.000 31.63074  ? 83  PHE A HD1  1 
ATOM   1235 H HD2  . PHE A 1 83  ? 16.28367  15.32361 8.07696  1.000 31.85671  ? 83  PHE A HD2  1 
ATOM   1236 H HE1  . PHE A 1 83  ? 12.85938  15.91673 11.13434 1.000 26.86662  ? 83  PHE A HE1  1 
ATOM   1237 H HE2  . PHE A 1 83  ? 15.01495  13.51674 8.76876  1.000 33.48738  ? 83  PHE A HE2  1 
ATOM   1238 H HZ   . PHE A 1 83  ? 13.28251  13.82699 10.27309 1.000 32.69691  ? 83  PHE A HZ   1 
ATOM   1239 N N    . GLU A 1 84  ? 16.27208  17.36202 5.75060  1.000 20.85510  ? 84  GLU A N    1 
ATOM   1240 C CA   . GLU A 1 84  ? 16.09466  16.83029 4.41094  1.000 22.94493  ? 84  GLU A CA   1 
ATOM   1241 C C    . GLU A 1 84  ? 15.45902  15.44862 4.42071  1.000 22.05047  ? 84  GLU A C    1 
ATOM   1242 O O    . GLU A 1 84  ? 15.36811  14.77934 5.44610  1.000 25.37447  ? 84  GLU A O    1 
ATOM   1243 C CB   . GLU A 1 84  ? 17.43638  16.70016 3.69959  1.000 25.95608  ? 84  GLU A CB   1 
ATOM   1244 C CG   . GLU A 1 84  ? 18.41275  15.66123 4.36451  1.000 26.81996  ? 84  GLU A CG   1 
ATOM   1245 C CD   . GLU A 1 84  ? 19.17724  16.18554 5.54453  1.000 22.64274  ? 84  GLU A CD   1 
ATOM   1246 O OE1  . GLU A 1 84  ? 18.79162  17.23102 6.11118  1.000 25.48717  ? 84  GLU A OE1  1 
ATOM   1247 O OE2  . GLU A 1 84  ? 20.17383  15.54244 5.90389  1.000 31.17179  ? 84  GLU A OE2  1 
ATOM   1248 H H    . GLU A 1 84  ? 17.07571  17.31958 6.05387  1.000 24.91380  ? 84  GLU A H    1 
ATOM   1249 H HA   . GLU A 1 84  ? 15.51361  17.44786 3.93990  1.000 27.42160  ? 84  GLU A HA   1 
ATOM   1250 H HB2  . GLU A 1 84  ? 17.27793  16.41415 2.78636  1.000 31.03499  ? 84  GLU A HB2  1 
ATOM   1251 H HB3  . GLU A 1 84  ? 17.87650  17.56455 3.70490  1.000 31.03499  ? 84  GLU A HB3  1 
ATOM   1252 H HG2  . GLU A 1 84  ? 17.89348  14.90027 4.66816  1.000 32.07163  ? 84  GLU A HG2  1 
ATOM   1253 H HG3  . GLU A 1 84  ? 19.06017  15.37730 3.70034  1.000 32.07163  ? 84  GLU A HG3  1 
ATOM   1254 N N    . ASP A 1 85  ? 15.07544  14.99794 3.23066  1.000 21.95228  ? 85  ASP A N    1 
ATOM   1255 C CA   . ASP A 1 85  ? 14.63085  13.62170 3.05393  1.000 21.67451  ? 85  ASP A CA   1 
ATOM   1256 C C    . ASP A 1 85  ? 15.85122  12.71479 3.06772  1.000 22.38894  ? 85  ASP A C    1 
ATOM   1257 O O    . ASP A 1 85  ? 16.73185  12.83978 2.20807  1.000 19.76498  ? 85  ASP A O    1 
ATOM   1258 C CB   . ASP A 1 85  ? 13.86031  13.46138 1.74418  1.000 22.57386  ? 85  ASP A CB   1 
ATOM   1259 C CG   . ASP A 1 85  ? 12.63311  14.36898 1.66195  1.000 25.57356  ? 85  ASP A CG   1 
ATOM   1260 O OD1  . ASP A 1 85  ? 11.83158  14.37397 2.61589  1.000 26.91378  ? 85  ASP A OD1  1 
ATOM   1261 O OD2  . ASP A 1 85  ? 12.46857  15.09415 0.65577  1.000 25.16086  ? 85  ASP A OD2  1 
ATOM   1262 H H    . ASP A 1 85  ? 15.06359  15.46881 2.51112  1.000 26.23042  ? 85  ASP A H    1 
ATOM   1263 H HA   . ASP A 1 85  ? 14.03128  13.37569 3.77566  1.000 25.89710  ? 85  ASP A HA   1 
ATOM   1264 H HB2  . ASP A 1 85  ? 14.44665  13.68279 1.00386  1.000 26.97632  ? 85  ASP A HB2  1 
ATOM   1265 H HB3  . ASP A 1 85  ? 13.55912  12.54268 1.66556  1.000 26.97632  ? 85  ASP A HB3  1 
ATOM   1266 N N    . GLU A 1 86  ? 15.91590  11.81833 4.05431  1.000 25.28066  ? 86  GLU A N    1 
ATOM   1267 C CA   . GLU A 1 86  ? 17.09943  10.97966 4.22595  1.000 24.02650  ? 86  GLU A CA   1 
ATOM   1268 C C    . GLU A 1 86  ? 17.24836  9.99057  3.07828  1.000 27.58914  ? 86  GLU A C    1 
ATOM   1269 O O    . GLU A 1 86  ? 18.24872  10.00813 2.34901  1.000 29.64312  ? 86  GLU A O    1 
ATOM   1270 C CB   . GLU A 1 86  ? 17.01863  10.24727 5.55795  1.000 28.73969  ? 86  GLU A CB   1 
ATOM   1271 C CG   . GLU A 1 86  ? 18.31780  9.61777  5.99832  1.000 28.76033  ? 86  GLU A CG   1 
ATOM   1272 C CD   . GLU A 1 86  ? 18.29906  9.16460  7.41780  1.000 26.32770  ? 86  GLU A CD   1 
ATOM   1273 O OE1  . GLU A 1 86  ? 17.24769  9.31727  8.05502  1.000 29.95245  ? 86  GLU A OE1  1 
ATOM   1274 O OE2  . GLU A 1 86  ? 19.33351  8.63852  7.89328  1.000 29.66335  ? 86  GLU A OE2  1 
ATOM   1275 H H    . GLU A 1 86  ? 15.29382  11.67831 4.63137  1.000 30.22447  ? 86  GLU A H    1 
ATOM   1276 H HA   . GLU A 1 86  ? 17.88620  11.54698 4.23347  1.000 28.71948  ? 86  GLU A HA   1 
ATOM   1277 H HB2  . GLU A 1 86  ? 16.75073  10.87917 6.24340  1.000 34.37532  ? 86  GLU A HB2  1 
ATOM   1278 H HB3  . GLU A 1 86  ? 16.35939  9.53967  5.48314  1.000 34.37532  ? 86  GLU A HB3  1 
ATOM   1279 H HG2  . GLU A 1 86  ? 18.49730  8.84447  5.44092  1.000 34.40008  ? 86  GLU A HG2  1 
ATOM   1280 H HG3  . GLU A 1 86  ? 19.03079  10.26844 5.90256  1.000 34.40008  ? 86  GLU A HG3  1 
ATOM   1281 N N    . ASN A 1 87  ? 16.24531  9.14561  2.87589  1.000 25.30916  ? 87  ASN A N    1 
ATOM   1282 C CA   . ASN A 1 87  ? 16.23697  8.24108  1.73401  1.000 24.49084  ? 87  ASN A CA   1 
ATOM   1283 C C    . ASN A 1 87  ? 14.82571  7.70136  1.59884  1.000 24.70386  ? 87  ASN A C    1 
ATOM   1284 O O    . ASN A 1 87  ? 14.00073  7.86706  2.49202  1.000 33.32576  ? 87  ASN A O    1 
ATOM   1285 C CB   . ASN A 1 87  ? 17.24829  7.10198  1.89365  1.000 28.48373  ? 87  ASN A CB   1 
ATOM   1286 C CG   . ASN A 1 87  ? 16.92110  6.18101  3.05722  1.000 29.84447  ? 87  ASN A CG   1 
ATOM   1287 O OD1  . ASN A 1 87  ? 15.92142  5.46419  3.02803  1.000 28.26833  ? 87  ASN A OD1  1 
ATOM   1288 N ND2  . ASN A 1 87  ? 17.74909  6.21613  4.09723  1.000 27.23820  ? 87  ASN A ND2  1 
ATOM   1289 H H    . ASN A 1 87  ? 15.55681  9.07702  3.38664  1.000 30.25867  ? 87  ASN A H    1 
ATOM   1290 H HA   . ASN A 1 87  ? 16.46912  8.73014  0.92913  1.000 29.27670  ? 87  ASN A HA   1 
ATOM   1291 H HB2  . ASN A 1 87  ? 17.25471  6.56954  1.08287  1.000 34.06816  ? 87  ASN A HB2  1 
ATOM   1292 H HB3  . ASN A 1 87  ? 18.12788  7.48018  2.04916  1.000 34.06816  ? 87  ASN A HB3  1 
ATOM   1293 H HD21 . ASN A 1 87  ? 17.60449  5.71250  4.77917  1.000 32.57353  ? 87  ASN A HD21 1 
ATOM   1294 H HD22 . ASN A 1 87  ? 18.42915  6.74246  4.08786  1.000 32.57353  ? 87  ASN A HD22 1 
ATOM   1295 N N    . PHE A 1 88  ? 14.56336  7.03067  0.48609  1.000 25.18114  ? 88  PHE A N    1 
ATOM   1296 C CA   . PHE A 1 88  ? 13.27429  6.39105  0.25687  1.000 24.33077  ? 88  PHE A CA   1 
ATOM   1297 C C    . PHE A 1 88  ? 13.46448  4.89608  0.03177  1.000 26.01912  ? 88  PHE A C    1 
ATOM   1298 O O    . PHE A 1 88  ? 12.89071  4.30507  -0.88763 1.000 31.79362  ? 88  PHE A O    1 
ATOM   1299 C CB   . PHE A 1 88  ? 12.58006  7.05654  -0.92315 1.000 26.23549  ? 88  PHE A CB   1 
ATOM   1300 C CG   . PHE A 1 88  ? 12.32813  8.51473  -0.71088 1.000 29.80539  ? 88  PHE A CG   1 
ATOM   1301 C CD1  . PHE A 1 88  ? 11.35084  8.95098  0.19746  1.000 28.53975  ? 88  PHE A CD1  1 
ATOM   1302 C CD2  . PHE A 1 88  ? 13.05359  9.45910  -1.40986 1.000 26.66217  ? 88  PHE A CD2  1 
ATOM   1303 C CE1  . PHE A 1 88  ? 11.11360  10.31721 0.38153  1.000 25.35164  ? 88  PHE A CE1  1 
ATOM   1304 C CE2  . PHE A 1 88  ? 12.84283  10.80786 -1.19738 1.000 25.77337  ? 88  PHE A CE2  1 
ATOM   1305 C CZ   . PHE A 1 88  ? 11.86781  11.23531 -0.31751 1.000 25.32181  ? 88  PHE A CZ   1 
ATOM   1306 H H    . PHE A 1 88  ? 15.12132  6.92941  -0.16047 1.000 30.10506  ? 88  PHE A H    1 
ATOM   1307 H HA   . PHE A 1 88  ? 12.69890  6.49432  1.03092  1.000 29.08461  ? 88  PHE A HA   1 
ATOM   1308 H HB2  . PHE A 1 88  ? 13.13844  6.96149  -1.71060 1.000 31.37027  ? 88  PHE A HB2  1 
ATOM   1309 H HB3  . PHE A 1 88  ? 11.72429  6.62379  -1.06907 1.000 31.37027  ? 88  PHE A HB3  1 
ATOM   1310 H HD1  . PHE A 1 88  ? 10.85776  8.32745  0.68014  1.000 34.13539  ? 88  PHE A HD1  1 
ATOM   1311 H HD2  . PHE A 1 88  ? 13.69025  9.18455  -2.02969 1.000 31.88229  ? 88  PHE A HD2  1 
ATOM   1312 H HE1  . PHE A 1 88  ? 10.45301  10.60358 0.97019  1.000 30.30966  ? 88  PHE A HE1  1 
ATOM   1313 H HE2  . PHE A 1 88  ? 13.36157  11.43285 -1.65037 1.000 30.81573  ? 88  PHE A HE2  1 
ATOM   1314 H HZ   . PHE A 1 88  ? 11.71961  12.14538 -0.19624 1.000 30.27385  ? 88  PHE A HZ   1 
ATOM   1315 N N    . ILE A 1 89  ? 14.25959  4.26867  0.89350  1.000 26.33955  ? 89  ILE A N    1 
ATOM   1316 C CA   . ILE A 1 89  ? 14.47208  2.82996  0.78637  1.000 31.57998  ? 89  ILE A CA   1 
ATOM   1317 C C    . ILE A 1 89  ? 13.18233  2.09079  1.10820  1.000 25.85228  ? 89  ILE A C    1 
ATOM   1318 O O    . ILE A 1 89  ? 12.79332  1.13898  0.42041  1.000 27.02168  ? 89  ILE A O    1 
ATOM   1319 C CB   . ILE A 1 89  ? 15.62392  2.39598  1.71747  1.000 28.75617  ? 89  ILE A CB   1 
ATOM   1320 C CG1  . ILE A 1 89  ? 16.92222  3.07687  1.30451  1.000 27.94123  ? 89  ILE A CG1  1 
ATOM   1321 C CG2  . ILE A 1 89  ? 15.79767  0.89825  1.73253  1.000 33.34985  ? 89  ILE A CG2  1 
ATOM   1322 C CD1  . ILE A 1 89  ? 17.99951  3.08992  2.39503  1.000 36.61863  ? 89  ILE A CD1  1 
ATOM   1323 H H    . ILE A 1 89  ? 14.68181  4.64725  1.54004  1.000 31.49514  ? 89  ILE A H    1 
ATOM   1324 H HA   . ILE A 1 89  ? 14.72439  2.61223  -0.12458 1.000 37.78366  ? 89  ILE A HA   1 
ATOM   1325 H HB   . ILE A 1 89  ? 15.39115  2.67424  2.61707  1.000 34.39509  ? 89  ILE A HB   1 
ATOM   1326 H HG12 . ILE A 1 89  ? 17.28675  2.60978  0.53650  1.000 33.41716  ? 89  ILE A HG12 1 
ATOM   1327 H HG13 . ILE A 1 89  ? 16.72864  3.99829  1.07124  1.000 33.41716  ? 89  ILE A HG13 1 
ATOM   1328 H HG21 . ILE A 1 89  ? 16.64727  0.68305  2.14818  1.000 39.90750  ? 89  ILE A HG21 1 
ATOM   1329 H HG22 . ILE A 1 89  ? 15.07176  0.50120  2.23880  1.000 39.90750  ? 89  ILE A HG22 1 
ATOM   1330 H HG23 . ILE A 1 89  ? 15.78314  0.56946  0.82007  1.000 39.90750  ? 89  ILE A HG23 1 
ATOM   1331 H HD11 . ILE A 1 89  ? 18.75804  3.60803  2.08343  1.000 43.83004  ? 89  ILE A HD11 1 
ATOM   1332 H HD12 . ILE A 1 89  ? 17.63165  3.49183  3.19755  1.000 43.83004  ? 89  ILE A HD12 1 
ATOM   1333 H HD13 . ILE A 1 89  ? 18.27464  2.17794  2.57807  1.000 43.83004  ? 89  ILE A HD13 1 
ATOM   1334 N N    . LEU A 1 90  ? 12.53567  2.48474  2.19268  1.000 29.02866  ? 90  LEU A N    1 
ATOM   1335 C CA   . LEU A 1 90  ? 11.36050  1.79636  2.68830  1.000 32.23847  ? 90  LEU A CA   1 
ATOM   1336 C C    . LEU A 1 90  ? 10.08844  2.36743  2.08590  1.000 24.35425  ? 90  LEU A C    1 
ATOM   1337 O O    . LEU A 1 90  ? 9.97362   3.57257  1.84572  1.000 23.08068  ? 90  LEU A O    1 
ATOM   1338 C CB   . LEU A 1 90  ? 11.30495  1.89075  4.20471  1.000 27.35142  ? 90  LEU A CB   1 
ATOM   1339 C CG   . LEU A 1 90  ? 12.41395  1.20356  4.95809  1.000 25.37043  ? 90  LEU A CG   1 
ATOM   1340 C CD1  . LEU A 1 90  ? 12.26468  1.47596  6.43232  1.000 31.13967  ? 90  LEU A CD1  1 
ATOM   1341 C CD2  . LEU A 1 90  ? 12.37290  -0.24999 4.70995  1.000 38.16574  ? 90  LEU A CD2  1 
ATOM   1342 H H    . LEU A 1 90  ? 12.76412  3.16351  2.66880  1.000 34.72208  ? 90  LEU A H    1 
ATOM   1343 H HA   . LEU A 1 90  ? 11.40772  0.86255  2.43009  1.000 38.57385  ? 90  LEU A HA   1 
ATOM   1344 H HB2  . LEU A 1 90  ? 11.33210  2.82905  4.44917  1.000 32.70939  ? 90  LEU A HB2  1 
ATOM   1345 H HB3  . LEU A 1 90  ? 10.47036  1.49482  4.50066  1.000 32.70939  ? 90  LEU A HB3  1 
ATOM   1346 H HG   . LEU A 1 90  ? 13.27172  1.54228  4.65742  1.000 30.33220  ? 90  LEU A HG   1 
ATOM   1347 H HD11 . LEU A 1 90  ? 12.94036  0.97550  6.91594  1.000 37.25529  ? 90  LEU A HD11 1 
ATOM   1348 H HD12 . LEU A 1 90  ? 12.37974  2.42593  6.59117  1.000 37.25529  ? 90  LEU A HD12 1 
ATOM   1349 H HD13 . LEU A 1 90  ? 11.38007  1.19776  6.71689  1.000 37.25529  ? 90  LEU A HD13 1 
ATOM   1350 H HD21 . LEU A 1 90  ? 12.98742  -0.69145 5.31688  1.000 45.68658  ? 90  LEU A HD21 1 
ATOM   1351 H HD22 . LEU A 1 90  ? 11.47022  -0.57092 4.86183  1.000 45.68658  ? 90  LEU A HD22 1 
ATOM   1352 H HD23 . LEU A 1 90  ? 12.63470  -0.42113 3.79175  1.000 45.68658  ? 90  LEU A HD23 1 
ATOM   1353 N N    . LYS A 1 91  ? 9.14266   1.47551  1.82703  1.000 29.91556  ? 91  LYS A N    1 
ATOM   1354 C CA   . LYS A 1 91  ? 7.89589   1.79761  1.15032  1.000 37.63547  ? 91  LYS A CA   1 
ATOM   1355 C C    . LYS A 1 91  ? 6.71903   1.73218  2.12196  1.000 28.86422  ? 91  LYS A C    1 
ATOM   1356 O O    . LYS A 1 91  ? 6.78950   1.12380  3.19065  1.000 24.81615  ? 91  LYS A O    1 
ATOM   1357 C CB   . LYS A 1 91  ? 7.65320   0.85174  -0.03989 1.000 30.13496  ? 91  LYS A CB   1 
ATOM   1358 C CG   . LYS A 1 91  ? 8.85805   0.60102  -0.88054 1.000 36.31191  ? 91  LYS A CG   1 
ATOM   1359 C CD   . LYS A 1 91  ? 9.49496   1.89554  -1.40804 1.000 43.95756  ? 91  LYS A CD   1 
ATOM   1360 C CE   . LYS A 1 91  ? 10.78367  1.60623  -2.20641 1.000 55.23283  ? 91  LYS A CE   1 
ATOM   1361 N NZ   . LYS A 1 91  ? 10.52996  0.64234  -3.33153 1.000 77.77948  ? 91  LYS A NZ   1 
ATOM   1362 H H    . LYS A 1 91  ? 9.20299   0.64507  2.04228  1.000 35.78636  ? 91  LYS A H    1 
ATOM   1363 H HA   . LYS A 1 91  ? 7.94738   2.70473  0.81063  1.000 45.05025  ? 91  LYS A HA   1 
ATOM   1364 H HB2  . LYS A 1 91  ? 7.35009   -0.00407 0.30160  1.000 36.04964  ? 91  LYS A HB2  1 
ATOM   1365 H HB3  . LYS A 1 91  ? 6.97251   1.24101  -0.61088 1.000 36.04964  ? 91  LYS A HB3  1 
ATOM   1366 H HG2  . LYS A 1 91  ? 9.52281   0.13491  -0.34976 1.000 43.46198  ? 91  LYS A HG2  1 
ATOM   1367 H HG3  . LYS A 1 91  ? 8.60399   0.05951  -1.64417 1.000 43.46198  ? 91  LYS A HG3  1 
ATOM   1368 H HD2  . LYS A 1 91  ? 8.86766   2.34666  -1.99446 1.000 52.63676  ? 91  LYS A HD2  1 
ATOM   1369 H HD3  . LYS A 1 91  ? 9.72197   2.47004  -0.66017 1.000 52.63676  ? 91  LYS A HD3  1 
ATOM   1370 H HE2  . LYS A 1 91  ? 11.12021  2.43396  -2.58390 1.000 66.16708  ? 91  LYS A HE2  1 
ATOM   1371 H HE3  . LYS A 1 91  ? 11.44713  1.21728  -1.61528 1.000 66.16708  ? 91  LYS A HE3  1 
ATOM   1372 H HZ1  . LYS A 1 91  ? 11.24946  0.58621  -3.85236 1.000 93.22307  ? 91  LYS A HZ1  1 
ATOM   1373 H HZ2  . LYS A 1 91  ? 9.84028   0.92015  -3.82067 1.000 93.22307  ? 91  LYS A HZ2  1 
ATOM   1374 H HZ3  . LYS A 1 91  ? 10.34599  -0.16495 -3.00511 1.000 93.22307  ? 91  LYS A HZ3  1 
ATOM   1375 N N    . HIS A 1 92  ? 5.63761   2.40604  1.74352  1.000 30.51169  ? 92  HIS A N    1 
ATOM   1376 C CA   . HIS A 1 92  ? 4.37389   2.35191  2.46895  1.000 26.09548  ? 92  HIS A CA   1 
ATOM   1377 C C    . HIS A 1 92  ? 3.68823   1.07049  2.02099  1.000 26.33313  ? 92  HIS A C    1 
ATOM   1378 O O    . HIS A 1 92  ? 2.92489   1.04284  1.05821  1.000 27.93629  ? 92  HIS A O    1 
ATOM   1379 C CB   . HIS A 1 92  ? 3.53641   3.58305  2.17560  1.000 26.01188  ? 92  HIS A CB   1 
ATOM   1380 C CG   . HIS A 1 92  ? 4.24255   4.87282  2.44137  1.000 24.67231  ? 92  HIS A CG   1 
ATOM   1381 N ND1  . HIS A 1 92  ? 5.19780   5.38260  1.59341  1.000 26.99421  ? 92  HIS A ND1  1 
ATOM   1382 C CD2  . HIS A 1 92  ? 4.10412   5.77207  3.44165  1.000 22.53786  ? 92  HIS A CD2  1 
ATOM   1383 C CE1  . HIS A 1 92  ? 5.62850   6.54008  2.06575  1.000 23.50560  ? 92  HIS A CE1  1 
ATOM   1384 N NE2  . HIS A 1 92  ? 4.96216   6.80956  3.17034  1.000 22.12677  ? 92  HIS A NE2  1 
ATOM   1385 H H    . HIS A 1 92  ? 5.61041   2.91525  1.05102  1.000 36.50171  ? 92  HIS A H    1 
ATOM   1386 H HA   . HIS A 1 92  ? 4.52031   2.32465  3.42745  1.000 31.20226  ? 92  HIS A HA   1 
ATOM   1387 H HB2  . HIS A 1 92  ? 3.28393   3.57195  1.23910  1.000 31.10194  ? 92  HIS A HB2  1 
ATOM   1388 H HB3  . HIS A 1 92  ? 2.74313   3.56012  2.73336  1.000 31.10194  ? 92  HIS A HB3  1 
ATOM   1389 H HD1  . HIS A 1 92  ? 5.47193   5.00751  0.86970  1.000 32.28074  ? 92  HIS A HD1  1 
ATOM   1390 H HD2  . HIS A 1 92  ? 3.53572   5.70142  4.17433  1.000 26.93312  ? 92  HIS A HD2  1 
ATOM   1391 H HE1  . HIS A 1 92  ? 6.28843   7.07265  1.68397  1.000 28.09441  ? 92  HIS A HE1  1 
ATOM   1392 N N    . THR A 1 93  ? 3.97669   -0.01679 2.72186  1.000 28.72109  ? 93  THR A N    1 
ATOM   1393 C CA   . THR A 1 93  ? 3.51293   -1.33501 2.30263  1.000 31.16843  ? 93  THR A CA   1 
ATOM   1394 C C    . THR A 1 93  ? 2.13043   -1.69960 2.81728  1.000 25.06176  ? 93  THR A C    1 
ATOM   1395 O O    . THR A 1 93  ? 1.41593   -2.46087 2.16031  1.000 27.36654  ? 93  THR A O    1 
ATOM   1396 C CB   . THR A 1 93  ? 4.50013   -2.40179 2.77459  1.000 29.47566  ? 93  THR A CB   1 
ATOM   1397 O OG1  . THR A 1 93  ? 4.71882   -2.26133 4.18870  1.000 27.01313  ? 93  THR A OG1  1 
ATOM   1398 C CG2  . THR A 1 93  ? 5.78283   -2.27337 2.02350  1.000 27.91417  ? 93  THR A CG2  1 
ATOM   1399 H H    . THR A 1 93  ? 4.44048   -0.02011 3.44608  1.000 34.35299  ? 93  THR A H    1 
ATOM   1400 H HA   . THR A 1 93  ? 3.47211   -1.33882 1.33350  1.000 37.28980  ? 93  THR A HA   1 
ATOM   1401 H HB   . THR A 1 93  ? 4.14663   -3.28959 2.60799  1.000 35.25848  ? 93  THR A HB   1 
ATOM   1402 H HG1  . THR A 1 93  ? 5.23868   -2.86271 4.46015  1.000 32.30345  ? 93  THR A HG1  1 
ATOM   1403 H HG21 . THR A 1 93  ? 6.39466   -2.97772 2.28893  1.000 33.38468  ? 93  THR A HG21 1 
ATOM   1404 H HG22 . THR A 1 93  ? 5.61746   -2.34273 1.07022  1.000 33.38468  ? 93  THR A HG22 1 
ATOM   1405 H HG23 . THR A 1 93  ? 6.19205   -1.41398 2.21030  1.000 33.38468  ? 93  THR A HG23 1 
ATOM   1406 N N    . GLY A 1 94  ? 1.73116   -1.17387 3.95995  1.000 25.97849  ? 94  GLY A N    1 
ATOM   1407 C CA   . GLY A 1 94  ? 0.42567   -1.45867 4.49366  1.000 29.85432  ? 94  GLY A CA   1 
ATOM   1408 C C    . GLY A 1 94  ? 0.15396   -0.73547 5.79359  1.000 30.52385  ? 94  GLY A C    1 
ATOM   1409 O O    . GLY A 1 94  ? 0.82051   0.24803  6.12998  1.000 28.58396  ? 94  GLY A O    1 
ATOM   1410 H H    . GLY A 1 94  ? 2.20536   -0.64546 4.44525  1.000 31.06187  ? 94  GLY A H    1 
ATOM   1411 H HA2  . GLY A 1 94  ? -0.24832  -1.19013 3.84983  1.000 35.71287  ? 94  GLY A HA2  1 
ATOM   1412 H HA3  . GLY A 1 94  ? 0.34705   -2.41208 4.65409  1.000 35.71287  ? 94  GLY A HA3  1 
ATOM   1413 N N    . PRO A 1 95  ? -0.84127  -1.20578 6.54926  1.000 28.38283  ? 95  PRO A N    1 
ATOM   1414 C CA   . PRO A 1 95  ? -1.13201  -0.58054 7.84479  1.000 28.48190  ? 95  PRO A CA   1 
ATOM   1415 C C    . PRO A 1 95  ? 0.02876   -0.74284 8.82026  1.000 26.47229  ? 95  PRO A C    1 
ATOM   1416 O O    . PRO A 1 95  ? 0.81475   -1.68654 8.73625  1.000 23.88106  ? 95  PRO A O    1 
ATOM   1417 C CB   . PRO A 1 95  ? -2.39103  -1.31927 8.32072  1.000 30.70712  ? 95  PRO A CB   1 
ATOM   1418 C CG   . PRO A 1 95  ? -2.98148  -1.93832 7.07850  1.000 26.70386  ? 95  PRO A CG   1 
ATOM   1419 C CD   . PRO A 1 95  ? -1.81254  -2.26524 6.21567  1.000 31.48491  ? 95  PRO A CD   1 
ATOM   1420 H HA   . PRO A 1 95  ? -1.33026  0.36300  7.73837  1.000 34.06597  ? 95  PRO A HA   1 
ATOM   1421 H HB2  . PRO A 1 95  ? -2.14805  -2.00181 8.96570  1.000 36.73623  ? 95  PRO A HB2  1 
ATOM   1422 H HB3  . PRO A 1 95  ? -3.01036  -0.68947 8.72157  1.000 36.73623  ? 95  PRO A HB3  1 
ATOM   1423 H HG2  . PRO A 1 95  ? -3.47501  -2.74020 7.31160  1.000 31.93231  ? 95  PRO A HG2  1 
ATOM   1424 H HG3  . PRO A 1 95  ? -3.56881  -1.30300 6.63997  1.000 31.93231  ? 95  PRO A HG3  1 
ATOM   1425 H HD2  . PRO A 1 95  ? -1.45682  -3.14113 6.43288  1.000 37.66958  ? 95  PRO A HD2  1 
ATOM   1426 H HD3  . PRO A 1 95  ? -2.05482  -2.22899 5.27711  1.000 37.66958  ? 95  PRO A HD3  1 
ATOM   1427 N N    . GLY A 1 96  ? 0.13962   0.21819  9.73513  1.000 22.54594  ? 96  GLY A N    1 
ATOM   1428 C CA   . GLY A 1 96  ? 1.16367   0.22282  10.73554 1.000 21.97836  ? 96  GLY A CA   1 
ATOM   1429 C C    . GLY A 1 96  ? 2.42243   0.94342  10.34380 1.000 22.34444  ? 96  GLY A C    1 
ATOM   1430 O O    . GLY A 1 96  ? 3.23959   1.22051  11.21919 1.000 21.67864  ? 96  GLY A O    1 
ATOM   1431 H H    . GLY A 1 96  ? -0.39044  0.89348  9.78637  1.000 26.94281  ? 96  GLY A H    1 
ATOM   1432 H HA2  . GLY A 1 96  ? 0.81553   0.64778  11.53499 1.000 26.26172  ? 96  GLY A HA2  1 
ATOM   1433 H HA3  . GLY A 1 96  ? 1.39990   -0.69481 10.94302 1.000 26.26172  ? 96  GLY A HA3  1 
ATOM   1434 N N    . ILE A 1 97  ? 2.61313   1.24082  9.05767  1.000 23.96787  ? 97  ILE A N    1 
ATOM   1435 C CA   . ILE A 1 97  ? 3.80418   1.95550  8.62370  1.000 22.70889  ? 97  ILE A CA   1 
ATOM   1436 C C    . ILE A 1 97  ? 3.87847   3.31918  9.30043  1.000 22.15521  ? 97  ILE A C    1 
ATOM   1437 O O    . ILE A 1 97  ? 2.86567   3.99719  9.50355  1.000 22.87214  ? 97  ILE A O    1 
ATOM   1438 C CB   . ILE A 1 97  ? 3.79978   2.08148  7.09143  1.000 23.65553  ? 97  ILE A CB   1 
ATOM   1439 C CG1  . ILE A 1 97  ? 4.17645   0.73623  6.46587  1.000 26.49520  ? 97  ILE A CG1  1 
ATOM   1440 C CG2  . ILE A 1 97  ? 4.73897   3.18049  6.64740  1.000 26.02265  ? 97  ILE A CG2  1 
ATOM   1441 C CD1  . ILE A 1 97  ? 5.59136   0.27117  6.74380  1.000 27.85752  ? 97  ILE A CD1  1 
ATOM   1442 H H    . ILE A 1 97  ? 2.06930   1.03983  8.42250  1.000 28.64913  ? 97  ILE A H    1 
ATOM   1443 H HA   . ILE A 1 97  ? 4.59188   1.45659  8.89113  1.000 27.13835  ? 97  ILE A HA   1 
ATOM   1444 H HB   . ILE A 1 97  ? 2.90824   2.32007  6.79289  1.000 28.27432  ? 97  ILE A HB   1 
ATOM   1445 H HG12 . ILE A 1 97  ? 3.57498   0.05826  6.81155  1.000 31.68193  ? 97  ILE A HG12 1 
ATOM   1446 H HG13 . ILE A 1 97  ? 4.07815   0.80740  5.50350  1.000 31.68193  ? 97  ILE A HG13 1 
ATOM   1447 H HG21 . ILE A 1 97  ? 4.92791   3.07170  5.70222  1.000 31.11487  ? 97  ILE A HG21 1 
ATOM   1448 H HG22 . ILE A 1 97  ? 4.31617   4.03943  6.80348  1.000 31.11487  ? 97  ILE A HG22 1 
ATOM   1449 H HG23 . ILE A 1 97  ? 5.56120   3.11882  7.15832  1.000 31.11487  ? 97  ILE A HG23 1 
ATOM   1450 H HD11 . ILE A 1 97  ? 5.77920   -0.51052 6.20106  1.000 33.31671  ? 97  ILE A HD11 1 
ATOM   1451 H HD12 . ILE A 1 97  ? 6.20827   0.98541  6.51980  1.000 33.31671  ? 97  ILE A HD12 1 
ATOM   1452 H HD13 . ILE A 1 97  ? 5.67136   0.04782  7.68434  1.000 33.31671  ? 97  ILE A HD13 1 
ATOM   1453 N N    . LEU A 1 98  ? 5.08773   3.72436  9.65783  1.000 22.07575  ? 98  LEU A N    1 
ATOM   1454 C CA   . LEU A 1 98  ? 5.36003   5.03592  10.22638 1.000 20.30771  ? 98  LEU A CA   1 
ATOM   1455 C C    . LEU A 1 98  ? 6.17222   5.86712  9.23836  1.000 20.25137  ? 98  LEU A C    1 
ATOM   1456 O O    . LEU A 1 98  ? 7.29148   5.49867  8.88570  1.000 24.52863  ? 98  LEU A O    1 
ATOM   1457 C CB   . LEU A 1 98  ? 6.11239   4.86064  11.53327 1.000 20.63385  ? 98  LEU A CB   1 
ATOM   1458 C CG   . LEU A 1 98  ? 6.28196   6.08623  12.39298 1.000 26.59379  ? 98  LEU A CG   1 
ATOM   1459 C CD1  . LEU A 1 98  ? 4.96361   6.64855  12.84204 1.000 25.94636  ? 98  LEU A CD1  1 
ATOM   1460 C CD2  . LEU A 1 98  ? 7.13484   5.71037  13.61356 1.000 40.13016  ? 98  LEU A CD2  1 
ATOM   1461 H H    . LEU A 1 98  ? 5.79318   3.23905  9.57771  1.000 26.37859  ? 98  LEU A H    1 
ATOM   1462 H HA   . LEU A 1 98  ? 4.53092   5.51380  10.38481 1.000 24.25694  ? 98  LEU A HA   1 
ATOM   1463 H HB2  . LEU A 1 98  ? 5.63648   4.20459  12.06621 1.000 24.64831  ? 98  LEU A HB2  1 
ATOM   1464 H HB3  . LEU A 1 98  ? 7.00226   4.53597  11.32441 1.000 24.64831  ? 98  LEU A HB3  1 
ATOM   1465 H HG   . LEU A 1 98  ? 6.71900   6.77983  11.87452 1.000 31.80024  ? 98  LEU A HG   1 
ATOM   1466 H HD11 . LEU A 1 98  ? 5.12553   7.37364  13.46569 1.000 31.02331  ? 98  LEU A HD11 1 
ATOM   1467 H HD12 . LEU A 1 98  ? 4.48132   6.97934  12.06818 1.000 31.02331  ? 98  LEU A HD12 1 
ATOM   1468 H HD13 . LEU A 1 98  ? 4.45240   5.94737  13.27553 1.000 31.02331  ? 98  LEU A HD13 1 
ATOM   1469 H HD21 . LEU A 1 98  ? 7.21962   6.48560  14.19038 1.000 48.04388  ? 98  LEU A HD21 1 
ATOM   1470 H HD22 . LEU A 1 98  ? 6.69967   4.98775  14.09246 1.000 48.04388  ? 98  LEU A HD22 1 
ATOM   1471 H HD23 . LEU A 1 98  ? 8.01138   5.42589  13.31082 1.000 48.04388  ? 98  LEU A HD23 1 
ATOM   1472 N N    . SER A 1 99  ? 5.61080   6.97689  8.78471  1.000 19.91632  ? 99  SER A N    1 
ATOM   1473 C CA   . SER A 1 99  ? 6.25534   7.81657  7.78946  1.000 20.69407  ? 99  SER A CA   1 
ATOM   1474 C C    . SER A 1 99  ? 6.16226   9.27800  8.18477  1.000 18.95580  ? 99  SER A C    1 
ATOM   1475 O O    . SER A 1 99  ? 5.35235   9.66805  9.01610  1.000 23.25626  ? 99  SER A O    1 
ATOM   1476 C CB   . SER A 1 99  ? 5.62260   7.63104  6.42303  1.000 21.49686  ? 99  SER A CB   1 
ATOM   1477 O OG   . SER A 1 99  ? 6.32934   8.35192  5.43537  1.000 22.61119  ? 99  SER A OG   1 
ATOM   1478 H H    . SER A 1 99  ? 4.84416   7.26901  9.04263  1.000 23.78726  ? 99  SER A H    1 
ATOM   1479 H HA   . SER A 1 99  ? 7.19451   7.57808  7.74484  1.000 24.72057  ? 99  SER A HA   1 
ATOM   1480 H HB2  . SER A 1 99  ? 5.63598   6.68831  6.19502  1.000 25.68391  ? 99  SER A HB2  1 
ATOM   1481 H HB3  . SER A 1 99  ? 4.70777   7.95210  6.45324  1.000 25.68391  ? 99  SER A HB3  1 
ATOM   1482 H HG   . SER A 1 99  ? 5.92172   8.30979  4.70211  1.000 27.02111  ? 99  SER A HG   1 
ATOM   1483 N N    . MET A 1 100 ? 7.02605   10.07804 7.59174  1.000 20.64368  ? 100 MET A N    1 
ATOM   1484 C CA   . MET A 1 100 ? 7.13802   11.48766 7.92309  1.000 25.00319  ? 100 MET A CA   1 
ATOM   1485 C C    . MET A 1 100 ? 6.24410   12.30998 7.00895  1.000 23.38101  ? 100 MET A C    1 
ATOM   1486 O O    . MET A 1 100 ? 6.19736   12.07975 5.79949  1.000 25.78952  ? 100 MET A O    1 
ATOM   1487 C CB   . MET A 1 100 ? 8.58443   11.97024 7.77441  1.000 29.62856  ? 100 MET A CB   1 
ATOM   1488 C CG   . MET A 1 100 ? 9.52175   11.51868 8.86400  1.000 29.00804  ? 100 MET A CG   1 
ATOM   1489 S SD   . MET A 1 100 ? 9.00775   12.15986 10.46781 1.000 25.60598  ? 100 MET A SD   1 
ATOM   1490 C CE   . MET A 1 100 ? 9.55984   13.84896 10.38190 1.000 25.18496  ? 100 MET A CE   1 
ATOM   1491 H H    . MET A 1 100 ? 7.57306   9.82438  6.97852  1.000 24.66010  ? 100 MET A H    1 
ATOM   1492 H HA   . MET A 1 100 ? 6.86879   11.61260 8.84656  1.000 29.89152  ? 100 MET A HA   1 
ATOM   1493 H HB2  . MET A 1 100 ? 8.93426   11.63697 6.93331  1.000 35.44195  ? 100 MET A HB2  1 
ATOM   1494 H HB3  . MET A 1 100 ? 8.58576   12.94024 7.77322  1.000 35.44195  ? 100 MET A HB3  1 
ATOM   1495 H HG2  . MET A 1 100 ? 9.52339   10.54963 8.90691  1.000 34.69733  ? 100 MET A HG2  1 
ATOM   1496 H HG3  . MET A 1 100 ? 10.41594  11.84394 8.67551  1.000 34.69733  ? 100 MET A HG3  1 
ATOM   1497 H HE1  . MET A 1 100 ? 9.05620   14.37865 11.01962 1.000 30.10964  ? 100 MET A HE1  1 
ATOM   1498 H HE2  . MET A 1 100 ? 10.50515  13.88353 10.59662 1.000 30.10964  ? 100 MET A HE2  1 
ATOM   1499 H HE3  . MET A 1 100 ? 9.41218   14.18418 9.48372  1.000 30.10964  ? 100 MET A HE3  1 
ATOM   1500 N N    . ALA A 1 101 ? 5.52651   13.25626 7.59369  1.000 24.31816  ? 101 ALA A N    1 
ATOM   1501 C CA   . ALA A 1 101 ? 4.73799   14.21888 6.84238  1.000 23.08459  ? 101 ALA A CA   1 
ATOM   1502 C C    . ALA A 1 101 ? 5.61779   15.37287 6.38755  1.000 21.13106  ? 101 ALA A C    1 
ATOM   1503 O O    . ALA A 1 101 ? 6.66157   15.64075 6.97146  1.000 28.86394  ? 101 ALA A O    1 
ATOM   1504 C CB   . ALA A 1 101 ? 3.60585   14.74549 7.71090  1.000 20.73938  ? 101 ALA A CB   1 
ATOM   1505 H H    . ALA A 1 101 ? 5.47784   13.36541 8.44535  1.000 29.06948  ? 101 ALA A H    1 
ATOM   1506 H HA   . ALA A 1 101 ? 4.35604   13.79657 6.05710  1.000 27.58919  ? 101 ALA A HA   1 
ATOM   1507 H HB1  . ALA A 1 101 ? 3.06119   15.35260 7.18586  1.000 24.77494  ? 101 ALA A HB1  1 
ATOM   1508 H HB2  . ALA A 1 101 ? 3.06793   13.99815 8.01588  1.000 24.77494  ? 101 ALA A HB2  1 
ATOM   1509 H HB3  . ALA A 1 101 ? 3.98325   15.21375 8.47196  1.000 24.77494  ? 101 ALA A HB3  1 
ATOM   1510 N N    . ASN A 1 102 ? 5.18463   16.07500 5.35052  1.000 19.30356  ? 102 ASN A N    1 
ATOM   1511 C CA   . ASN A 1 102 ? 5.97453   17.19778 4.86571  1.000 23.40231  ? 102 ASN A CA   1 
ATOM   1512 C C    . ASN A 1 102 ? 5.14737   18.02320 3.89852  1.000 23.97894  ? 102 ASN A C    1 
ATOM   1513 O O    . ASN A 1 102 ? 4.11528   17.58193 3.39141  1.000 26.38541  ? 102 ASN A O    1 
ATOM   1514 C CB   . ASN A 1 102 ? 7.27632   16.74843 4.17718  1.000 28.04843  ? 102 ASN A CB   1 
ATOM   1515 C CG   . ASN A 1 102 ? 7.04935   15.70680 3.08566  1.000 25.77115  ? 102 ASN A CG   1 
ATOM   1516 O OD1  . ASN A 1 102 ? 6.39683   15.96839 2.08816  1.000 23.14223  ? 102 ASN A OD1  1 
ATOM   1517 N ND2  . ASN A 1 102 ? 7.61136   14.52171 3.27646  1.000 32.85118  ? 102 ASN A ND2  1 
ATOM   1518 H H    . ASN A 1 102 ? 4.45476   15.92499 4.92110  1.000 23.05195  ? 102 ASN A H    1 
ATOM   1519 H HA   . ASN A 1 102 ? 6.19324   17.74763 5.63430  1.000 27.97045  ? 102 ASN A HA   1 
ATOM   1520 H HB2  . ASN A 1 102 ? 7.69913   17.52036 3.76945  1.000 33.54580  ? 102 ASN A HB2  1 
ATOM   1521 H HB3  . ASN A 1 102 ? 7.86594   16.35986 4.84221  1.000 33.54580  ? 102 ASN A HB3  1 
ATOM   1522 H HD21 . ASN A 1 102 ? 7.51337   13.89997 2.69042  1.000 39.30910  ? 102 ASN A HD21 1 
ATOM   1523 H HD22 . ASN A 1 102 ? 8.07402   14.37449 3.98630  1.000 39.30910  ? 102 ASN A HD22 1 
ATOM   1524 N N    . ALA A 1 103 ? 5.64508   19.22251 3.62964  1.000 28.46097  ? 103 ALA A N    1 
ATOM   1525 C CA   . ALA A 1 103 ? 5.00704   20.18130 2.74166  1.000 33.38667  ? 103 ALA A CA   1 
ATOM   1526 C C    . ALA A 1 103 ? 5.80580   20.41079 1.46467  1.000 27.88354  ? 103 ALA A C    1 
ATOM   1527 O O    . ALA A 1 103 ? 5.82658   21.52104 0.94105  1.000 29.51072  ? 103 ALA A O    1 
ATOM   1528 C CB   . ALA A 1 103 ? 4.81114   21.49960 3.48818  1.000 27.28837  ? 103 ALA A CB   1 
ATOM   1529 H H    . ALA A 1 103 ? 6.38161   19.51485 3.96378  1.000 34.04084  ? 103 ALA A H    1 
ATOM   1530 H HA   . ALA A 1 103 ? 4.14162   19.83512 2.47315  1.000 39.95169  ? 103 ALA A HA   1 
ATOM   1531 H HB1  . ALA A 1 103 ? 4.37765   22.13549 2.89773  1.000 32.63373  ? 103 ALA A HB1  1 
ATOM   1532 H HB2  . ALA A 1 103 ? 4.25674   21.34142 4.26826  1.000 32.63373  ? 103 ALA A HB2  1 
ATOM   1533 H HB3  . ALA A 1 103 ? 5.67754   21.83949 3.76155  1.000 32.63373  ? 103 ALA A HB3  1 
ATOM   1534 N N    . GLY A 1 104 ? 6.46174   19.37073 0.96096  1.000 28.95860  ? 104 GLY A N    1 
ATOM   1535 C CA   . GLY A 1 104 ? 7.34039   19.48634 -0.17072 1.000 26.95787  ? 104 GLY A CA   1 
ATOM   1536 C C    . GLY A 1 104 ? 8.66414   18.78912 0.07386  1.000 30.77503  ? 104 GLY A C    1 
ATOM   1537 O O    . GLY A 1 104 ? 8.90722   18.17604 1.12290  1.000 27.08286  ? 104 GLY A O    1 
ATOM   1538 H H    . GLY A 1 104 ? 6.40629   18.57102 1.27238  1.000 34.63801  ? 104 GLY A H    1 
ATOM   1539 H HA2  . GLY A 1 104 ? 6.92052   19.08717 -0.94871 1.000 32.23713  ? 104 GLY A HA2  1 
ATOM   1540 H HA3  . GLY A 1 104 ? 7.51397   20.42341 -0.35145 1.000 32.23713  ? 104 GLY A HA3  1 
ATOM   1541 N N    . PRO A 1 105 ? 9.55592   18.86685 -0.90900 1.000 32.56091  ? 105 PRO A N    1 
ATOM   1542 C CA   . PRO A 1 105 ? 10.84037  18.15783 -0.77741 1.000 26.84455  ? 105 PRO A CA   1 
ATOM   1543 C C    . PRO A 1 105 ? 11.66492  18.76096 0.34981  1.000 21.23826  ? 105 PRO A C    1 
ATOM   1544 O O    . PRO A 1 105 ? 11.75226  19.97972 0.47416  1.000 20.52507  ? 105 PRO A O    1 
ATOM   1545 C CB   . PRO A 1 105 ? 11.50905  18.35517 -2.14564 1.000 33.16371  ? 105 PRO A CB   1 
ATOM   1546 C CG   . PRO A 1 105 ? 10.79954  19.60332 -2.77329 1.000 30.83625  ? 105 PRO A CG   1 
ATOM   1547 C CD   . PRO A 1 105 ? 9.38345   19.54383 -2.21488 1.000 34.15766  ? 105 PRO A CD   1 
ATOM   1548 H HA   . PRO A 1 105 ? 10.70429  17.21020 -0.62129 1.000 32.10114  ? 105 PRO A HA   1 
ATOM   1549 H HB2  . PRO A 1 105 ? 12.45788  18.51881 -2.02796 1.000 39.68414  ? 105 PRO A HB2  1 
ATOM   1550 H HB3  . PRO A 1 105 ? 11.37391  17.56722 -2.69497 1.000 39.68414  ? 105 PRO A HB3  1 
ATOM   1551 H HG2  . PRO A 1 105 ? 11.25016  20.41728 -2.49886 1.000 36.89118  ? 105 PRO A HG2  1 
ATOM   1552 H HG3  . PRO A 1 105 ? 10.79744  19.53536 -3.74090 1.000 36.89118  ? 105 PRO A HG3  1 
ATOM   1553 H HD2  . PRO A 1 105 ? 9.02239   20.43616 -2.09540 1.000 40.87687  ? 105 PRO A HD2  1 
ATOM   1554 H HD3  . PRO A 1 105 ? 8.80486   19.02705 -2.79717 1.000 40.87687  ? 105 PRO A HD3  1 
ATOM   1555 N N    . ASN A 1 106 ? 12.25557  17.89728 1.17885  1.000 24.05058  ? 106 ASN A N    1 
ATOM   1556 C CA   . ASN A 1 106 ? 13.20605  18.28564 2.22868  1.000 23.79921  ? 106 ASN A CA   1 
ATOM   1557 C C    . ASN A 1 106 ? 12.60387  19.35877 3.14104  1.000 21.06975  ? 106 ASN A C    1 
ATOM   1558 O O    . ASN A 1 106 ? 13.07515  20.49033 3.23421  1.000 21.79612  ? 106 ASN A O    1 
ATOM   1559 C CB   . ASN A 1 106 ? 14.54487  18.74617 1.62081  1.000 22.89545  ? 106 ASN A CB   1 
ATOM   1560 C CG   . ASN A 1 106 ? 15.03278  17.83171 0.52536  1.000 20.86343  ? 106 ASN A CG   1 
ATOM   1561 O OD1  . ASN A 1 106 ? 15.19018  16.64947 0.74398  1.000 23.50465  ? 106 ASN A OD1  1 
ATOM   1562 N ND2  . ASN A 1 106 ? 15.26431  18.37160 -0.65471 1.000 20.12228  ? 106 ASN A ND2  1 
ATOM   1563 H H    . ASN A 1 106 ? 12.11772  17.04878 1.15322  1.000 28.74838  ? 106 ASN A H    1 
ATOM   1564 H HA   . ASN A 1 106 ? 13.38613  17.50688 2.77823  1.000 28.44674  ? 106 ASN A HA   1 
ATOM   1565 H HB2  . ASN A 1 106 ? 14.43256  19.63278 1.24370  1.000 27.36223  ? 106 ASN A HB2  1 
ATOM   1566 H HB3  . ASN A 1 106 ? 15.21884  18.76519 2.31816  1.000 27.36223  ? 106 ASN A HB3  1 
ATOM   1567 H HD21 . ASN A 1 106 ? 15.54348  17.88197 -1.30427 1.000 24.03442  ? 106 ASN A HD21 1 
ATOM   1568 H HD22 . ASN A 1 106 ? 15.13620  19.21344 -0.77503 1.000 24.03442  ? 106 ASN A HD22 1 
ATOM   1569 N N    . THR A 1 107 ? 11.51828  18.97881 3.80095  1.000 24.44215  ? 107 THR A N    1 
ATOM   1570 C CA   . THR A 1 107 ? 10.84881  19.84352 4.75957  1.000 23.71718  ? 107 THR A CA   1 
ATOM   1571 C C    . THR A 1 107 ? 10.35345  19.02093 5.93321  1.000 21.68702  ? 107 THR A C    1 
ATOM   1572 O O    . THR A 1 107 ? 9.36066   19.37657 6.56318  1.000 30.76810  ? 107 THR A O    1 
ATOM   1573 C CB   . THR A 1 107 ? 9.66207   20.62352 4.14834  1.000 27.82499  ? 107 THR A CB   1 
ATOM   1574 O OG1  . THR A 1 107 ? 8.59603   19.73968 3.77932  1.000 28.55429  ? 107 THR A OG1  1 
ATOM   1575 C CG2  . THR A 1 107 ? 10.05427  21.39107 2.91003  1.000 32.88146  ? 107 THR A CG2  1 
ATOM   1576 H H    . THR A 1 107 ? 11.14326  18.21035 3.70908  1.000 29.21826  ? 107 THR A H    1 
ATOM   1577 H HA   . THR A 1 107 ? 11.48961  20.50619 5.06149  1.000 28.34830  ? 107 THR A HA   1 
ATOM   1578 H HB   . THR A 1 107 ? 9.36556   21.24813 4.82867  1.000 33.27767  ? 107 THR A HB   1 
ATOM   1579 H HG1  . THR A 1 107 ? 8.83636   19.25098 3.13978  1.000 34.15284  ? 107 THR A HG1  1 
ATOM   1580 H HG21 . THR A 1 107 ? 9.32985   21.97657 2.63928  1.000 39.34543  ? 107 THR A HG21 1 
ATOM   1581 H HG22 . THR A 1 107 ? 10.84273  21.92734 3.08793  1.000 39.34543  ? 107 THR A HG22 1 
ATOM   1582 H HG23 . THR A 1 107 ? 10.24895  20.77562 2.18599  1.000 39.34543  ? 107 THR A HG23 1 
ATOM   1583 N N    . ASN A 1 108 ? 10.99440  17.89472 6.21270  1.000 21.25354  ? 108 ASN A N    1 
ATOM   1584 C CA   . ASN A 1 108 ? 10.59965  17.08568 7.35815  1.000 20.33774  ? 108 ASN A CA   1 
ATOM   1585 C C    . ASN A 1 108 ? 10.81664  17.86523 8.65193  1.000 24.51035  ? 108 ASN A C    1 
ATOM   1586 O O    . ASN A 1 108 ? 11.83170  18.54066 8.82654  1.000 28.43005  ? 108 ASN A O    1 
ATOM   1587 C CB   . ASN A 1 108 ? 11.40877  15.78257 7.40781  1.000 21.80060  ? 108 ASN A CB   1 
ATOM   1588 C CG   . ASN A 1 108 ? 11.11664  14.85559 6.24024  1.000 21.91237  ? 108 ASN A CG   1 
ATOM   1589 O OD1  . ASN A 1 108 ? 9.97228   14.55557 5.97596  1.000 24.88548  ? 108 ASN A OD1  1 
ATOM   1590 N ND2  . ASN A 1 108 ? 12.14351  14.44647 5.50997  1.000 20.81826  ? 108 ASN A ND2  1 
ATOM   1591 H H    . ASN A 1 108 ? 11.65433  17.57888 5.76066  1.000 25.39193  ? 108 ASN A H    1 
ATOM   1592 H HA   . ASN A 1 108 ? 9.66052   16.85764 7.27489  1.000 24.29298  ? 108 ASN A HA   1 
ATOM   1593 H HB2  . ASN A 1 108 ? 12.35433  15.99811 7.38862  1.000 26.04840  ? 108 ASN A HB2  1 
ATOM   1594 H HB3  . ASN A 1 108 ? 11.19301  15.30894 8.22635  1.000 26.04840  ? 108 ASN A HB3  1 
ATOM   1595 H HD21 . ASN A 1 108 ? 12.01364  13.92109 4.84160  1.000 24.86960  ? 108 ASN A HD21 1 
ATOM   1596 H HD22 . ASN A 1 108 ? 12.93996  14.70627 5.70428  1.000 24.86960  ? 108 ASN A HD22 1 
ATOM   1597 N N    . GLY A 1 109 ? 9.85758   17.77263 9.56542  1.000 28.31601  ? 109 GLY A N    1 
ATOM   1598 C CA   . GLY A 1 109 ? 9.96651   18.39518 10.86921 1.000 20.64953  ? 109 GLY A CA   1 
ATOM   1599 C C    . GLY A 1 109 ? 9.70536   17.34674 11.92198 1.000 20.89278  ? 109 GLY A C    1 
ATOM   1600 O O    . GLY A 1 109 ? 10.50066  16.41993 12.06930 1.000 21.98429  ? 109 GLY A O    1 
ATOM   1601 H H    . GLY A 1 109 ? 9.12043   17.34536 9.44863  1.000 33.86690  ? 109 GLY A H    1 
ATOM   1602 H HA2  . GLY A 1 109 ? 10.85581  18.76217 10.99317 1.000 24.66712  ? 109 GLY A HA2  1 
ATOM   1603 H HA3  . GLY A 1 109 ? 9.31539   19.10887 10.95632 1.000 24.66712  ? 109 GLY A HA3  1 
ATOM   1604 N N    . SER A 1 110 ? 8.59053   17.48227 12.65171 1.000 26.54542  ? 110 SER A N    1 
ATOM   1605 C CA   . SER A 1 110 ? 8.17323   16.52777 13.66952 1.000 20.75977  ? 110 SER A CA   1 
ATOM   1606 C C    . SER A 1 110 ? 6.87407   15.80455 13.35737 1.000 18.73435  ? 110 SER A C    1 
ATOM   1607 O O    . SER A 1 110 ? 6.49872   14.89605 14.09402 1.000 21.05971  ? 110 SER A O    1 
ATOM   1608 C CB   . SER A 1 110 ? 8.01490   17.24118 15.01189 1.000 22.94642  ? 110 SER A CB   1 
ATOM   1609 O OG   . SER A 1 110 ? 7.21001   18.37644 14.88175 1.000 23.50913  ? 110 SER A OG   1 
ATOM   1610 H H    . SER A 1 110 ? 8.04578   18.14248 12.56825 1.000 31.74219  ? 110 SER A H    1 
ATOM   1611 H HA   . SER A 1 110 ? 8.86492   15.85286 13.75293 1.000 24.79941  ? 110 SER A HA   1 
ATOM   1612 H HB2  . SER A 1 110 ? 7.60282   16.63326 15.64555 1.000 27.42339  ? 110 SER A HB2  1 
ATOM   1613 H HB3  . SER A 1 110 ? 8.89039   17.51012 15.33140 1.000 27.42339  ? 110 SER A HB3  1 
ATOM   1614 H HG   . SER A 1 110 ? 6.50081   18.18086 14.47630 1.000 28.09864  ? 110 SER A HG   1 
ATOM   1615 N N    . GLN A 1 111 ? 6.17823   16.17398 12.30681 1.000 25.06143  ? 111 GLN A N    1 
ATOM   1616 C CA   . GLN A 1 111 ? 4.88664   15.57933 12.00902 1.000 25.62482  ? 111 GLN A CA   1 
ATOM   1617 C C    . GLN A 1 111 ? 5.06011   14.25486 11.28066 1.000 22.53445  ? 111 GLN A C    1 
ATOM   1618 O O    . GLN A 1 111 ? 5.77830   14.16569 10.27686 1.000 21.65401  ? 111 GLN A O    1 
ATOM   1619 C CB   . GLN A 1 111 ? 4.05760   16.54465 11.17142 1.000 23.82017  ? 111 GLN A CB   1 
ATOM   1620 C CG   . GLN A 1 111 ? 3.63557   17.80132 11.91293 1.000 29.29191  ? 111 GLN A CG   1 
ATOM   1621 C CD   . GLN A 1 111 ? 2.67056   18.67430 11.09432 1.000 24.43379  ? 111 GLN A CD   1 
ATOM   1622 O OE1  . GLN A 1 111 ? 1.66562   18.19237 10.57106 1.000 25.06577  ? 111 GLN A OE1  1 
ATOM   1623 N NE2  . GLN A 1 111 ? 2.97511   19.95286 10.99158 1.000 22.67868  ? 111 GLN A NE2  1 
ATOM   1624 H H    . GLN A 1 111 ? 6.42959   16.77209 11.74228 1.000 29.96141  ? 111 GLN A H    1 
ATOM   1625 H HA   . GLN A 1 111 ? 4.41406   15.39872 12.83663 1.000 30.63747  ? 111 GLN A HA   1 
ATOM   1626 H HB2  . GLN A 1 111 ? 4.58174   16.81790 10.40232 1.000 28.47189  ? 111 GLN A HB2  1 
ATOM   1627 H HB3  . GLN A 1 111 ? 3.25213   16.08990 10.87934 1.000 28.47189  ? 111 GLN A HB3  1 
ATOM   1628 H HG2  . GLN A 1 111 ? 3.18795   17.54844 12.73548 1.000 35.03797  ? 111 GLN A HG2  1 
ATOM   1629 H HG3  . GLN A 1 111 ? 4.42342   18.33057 12.11314 1.000 35.03797  ? 111 GLN A HG3  1 
ATOM   1630 H HE21 . GLN A 1 111 ? 3.68316   20.25819 11.37244 1.000 27.10210  ? 111 GLN A HE21 1 
ATOM   1631 H HE22 . GLN A 1 111 ? 2.46574   20.48158 10.54371 1.000 27.10210  ? 111 GLN A HE22 1 
ATOM   1632 N N    . PHE A 1 112 ? 4.40681   13.23016 11.80369 1.000 19.41262  ? 112 PHE A N    1 
ATOM   1633 C CA   . PHE A 1 112 ? 4.43782   11.89184 11.24905 1.000 20.54930  ? 112 PHE A CA   1 
ATOM   1634 C C    . PHE A 1 112 ? 3.00919   11.46831 10.95402 1.000 20.52952  ? 112 PHE A C    1 
ATOM   1635 O O    . PHE A 1 112 ? 2.05064   12.08458 11.41680 1.000 19.99078  ? 112 PHE A O    1 
ATOM   1636 C CB   . PHE A 1 112 ? 5.10106   10.90179 12.22849 1.000 21.74939  ? 112 PHE A CB   1 
ATOM   1637 C CG   . PHE A 1 112 ? 4.43612   10.85937 13.55258 1.000 21.88504  ? 112 PHE A CG   1 
ATOM   1638 C CD1  . PHE A 1 112 ? 4.77705   11.77571 14.53242 1.000 22.67876  ? 112 PHE A CD1  1 
ATOM   1639 C CD2  . PHE A 1 112 ? 3.41041   9.95178  13.79565 1.000 23.23658  ? 112 PHE A CD2  1 
ATOM   1640 C CE1  . PHE A 1 112 ? 4.12406   11.78256 15.74968 1.000 23.80075  ? 112 PHE A CE1  1 
ATOM   1641 C CE2  . PHE A 1 112 ? 2.75312   9.94558  14.99371 1.000 28.64432  ? 112 PHE A CE2  1 
ATOM   1642 C CZ   . PHE A 1 112 ? 3.09706   10.86651 15.97798 1.000 29.70188  ? 112 PHE A CZ   1 
ATOM   1643 H H    . PHE A 1 112 ? 3.91896   13.29001 12.50940 1.000 23.18283  ? 112 PHE A H    1 
ATOM   1644 H HA   . PHE A 1 112 ? 4.95177   11.87925 10.42649 1.000 24.54684  ? 112 PHE A HA   1 
ATOM   1645 H HB2  . PHE A 1 112 ? 5.06477   10.01058 11.84727 1.000 25.98696  ? 112 PHE A HB2  1 
ATOM   1646 H HB3  . PHE A 1 112 ? 6.02407   11.16645 12.36605 1.000 25.98696  ? 112 PHE A HB3  1 
ATOM   1647 H HD1  . PHE A 1 112 ? 5.45297   12.39336 14.36949 1.000 27.10219  ? 112 PHE A HD1  1 
ATOM   1648 H HD2  . PHE A 1 112 ? 3.16933   9.34256  13.13563 1.000 27.77158  ? 112 PHE A HD2  1 
ATOM   1649 H HE1  . PHE A 1 112 ? 4.36644   12.39120 16.40976 1.000 28.44858  ? 112 PHE A HE1  1 
ATOM   1650 H HE2  . PHE A 1 112 ? 2.07696   9.32669  15.15079 1.000 34.26087  ? 112 PHE A HE2  1 
ATOM   1651 H HZ   . PHE A 1 112 ? 2.64188   10.87149 16.78896 1.000 35.52994  ? 112 PHE A HZ   1 
ATOM   1652 N N    . PHE A 1 113 ? 2.86215   10.36487 10.23424 1.000 22.09515  ? 113 PHE A N    1 
ATOM   1653 C CA   . PHE A 1 113 ? 1.55328   9.73994  10.12287 1.000 22.59373  ? 113 PHE A CA   1 
ATOM   1654 C C    . PHE A 1 113 ? 1.71342   8.23423  10.18572 1.000 19.52915  ? 113 PHE A C    1 
ATOM   1655 O O    . PHE A 1 113 ? 2.69607   7.68649  9.68743  1.000 19.64206  ? 113 PHE A O    1 
ATOM   1656 C CB   . PHE A 1 113 ? 0.79991   10.18533 8.84424  1.000 23.62111  ? 113 PHE A CB   1 
ATOM   1657 C CG   . PHE A 1 113 ? 1.44440   9.77232  7.57645  1.000 25.89495  ? 113 PHE A CG   1 
ATOM   1658 C CD1  . PHE A 1 113 ? 2.46689   10.52729 7.02741  1.000 23.69724  ? 113 PHE A CD1  1 
ATOM   1659 C CD2  . PHE A 1 113 ? 1.00912   8.63166  6.90474  1.000 24.91334  ? 113 PHE A CD2  1 
ATOM   1660 C CE1  . PHE A 1 113 ? 3.06866   10.14133 5.82752  1.000 22.76358  ? 113 PHE A CE1  1 
ATOM   1661 C CE2  . PHE A 1 113 ? 1.61476   8.23646  5.72524  1.000 28.54092  ? 113 PHE A CE2  1 
ATOM   1662 C CZ   . PHE A 1 113 ? 2.64865   9.00399  5.18498  1.000 26.23911  ? 113 PHE A CZ   1 
ATOM   1663 H H    . PHE A 1 113 ? 3.49450   9.96653  9.80871  1.000 26.40187  ? 113 PHE A H    1 
ATOM   1664 H HA   . PHE A 1 113 ? 0.99789   10.00258 10.87351 1.000 27.00016  ? 113 PHE A HA   1 
ATOM   1665 H HB2  . PHE A 1 113 ? -0.08993  9.79954  8.85969  1.000 28.23302  ? 113 PHE A HB2  1 
ATOM   1666 H HB3  . PHE A 1 113 ? 0.74171   11.15358 8.84135  1.000 28.23302  ? 113 PHE A HB3  1 
ATOM   1667 H HD1  . PHE A 1 113 ? 2.75539   11.29772 7.46112  1.000 28.32438  ? 113 PHE A HD1  1 
ATOM   1668 H HD2  . PHE A 1 113 ? 0.30585   8.13200  7.25209  1.000 29.78369  ? 113 PHE A HD2  1 
ATOM   1669 H HE1  . PHE A 1 113 ? 3.75363   10.65491 5.46426  1.000 27.20398  ? 113 PHE A HE1  1 
ATOM   1670 H HE2  . PHE A 1 113 ? 1.33414   7.46201  5.29353  1.000 34.13680  ? 113 PHE A HE2  1 
ATOM   1671 H HZ   . PHE A 1 113 ? 3.05299   8.74403  4.38884  1.000 31.37462  ? 113 PHE A HZ   1 
ATOM   1672 N N    . ILE A 1 114 ? 0.74975   7.58854  10.83470 1.000 23.36029  ? 114 ILE A N    1 
ATOM   1673 C CA   . ILE A 1 114 ? 0.65712   6.14022  10.90948 1.000 22.16832  ? 114 ILE A CA   1 
ATOM   1674 C C    . ILE A 1 114 ? -0.30060  5.69739  9.81773  1.000 20.70829  ? 114 ILE A C    1 
ATOM   1675 O O    . ILE A 1 114 ? -1.48182  6.05232  9.83556  1.000 23.58741  ? 114 ILE A O    1 
ATOM   1676 C CB   . ILE A 1 114 ? 0.17186   5.67572  12.29097 1.000 21.97512  ? 114 ILE A CB   1 
ATOM   1677 C CG1  . ILE A 1 114 ? 0.95241   6.38720  13.38855 1.000 29.64534  ? 114 ILE A CG1  1 
ATOM   1678 C CG2  . ILE A 1 114 ? 0.33904   4.18620  12.42533 1.000 20.95145  ? 114 ILE A CG2  1 
ATOM   1679 C CD1  . ILE A 1 114 ? 0.53866   6.00464  14.82037 1.000 26.96982  ? 114 ILE A CD1  1 
ATOM   1680 H H    . ILE A 1 114 ? 0.11401   7.98653  11.25547 1.000 27.92003  ? 114 ILE A H    1 
ATOM   1681 H HA   . ILE A 1 114 ? 1.52849   5.74501  10.75010 1.000 26.48966  ? 114 ILE A HA   1 
ATOM   1682 H HB   . ILE A 1 114 ? -0.76822  5.89826  12.37826 1.000 26.25783  ? 114 ILE A HB   1 
ATOM   1683 H HG12 . ILE A 1 114 ? 1.89265   6.17092  13.28828 1.000 35.46209  ? 114 ILE A HG12 1 
ATOM   1684 H HG13 . ILE A 1 114 ? 0.81969   7.34316  13.29143 1.000 35.46209  ? 114 ILE A HG13 1 
ATOM   1685 H HG21 . ILE A 1 114 ? -0.04695  3.89982  13.26789 1.000 25.02943  ? 114 ILE A HG21 1 
ATOM   1686 H HG22 . ILE A 1 114 ? -0.11543  3.74961  11.68794 1.000 25.02943  ? 114 ILE A HG22 1 
ATOM   1687 H HG23 . ILE A 1 114 ? 1.28474   3.97142  12.40476 1.000 25.02943  ? 114 ILE A HG23 1 
ATOM   1688 H HD11 . ILE A 1 114 ? 0.98769   6.59354  15.44685 1.000 32.25147  ? 114 ILE A HD11 1 
ATOM   1689 H HD12 . ILE A 1 114 ? -0.42269  6.10016  14.90747 1.000 32.25147  ? 114 ILE A HD12 1 
ATOM   1690 H HD13 . ILE A 1 114 ? 0.79623   5.08468  14.98838 1.000 32.25147  ? 114 ILE A HD13 1 
ATOM   1691 N N    . CYS A 1 115 ? 0.18748   4.90583  8.87945  1.000 21.96612  ? 115 CYS A N    1 
ATOM   1692 C CA   . CYS A 1 115 ? -0.68770  4.35370  7.85697  1.000 21.66416  ? 115 CYS A CA   1 
ATOM   1693 C C    . CYS A 1 115 ? -1.70200  3.38809  8.45781  1.000 21.16283  ? 115 CYS A C    1 
ATOM   1694 O O    . CYS A 1 115 ? -1.33799  2.40162  9.10634  1.000 21.06386  ? 115 CYS A O    1 
ATOM   1695 C CB   . CYS A 1 115 ? 0.13481   3.63902  6.79649  1.000 24.65620  ? 115 CYS A CB   1 
ATOM   1696 S SG   . CYS A 1 115 ? 1.16337   4.71325  5.76293  1.000 25.62596  ? 115 CYS A SG   1 
ATOM   1697 H H    . CYS A 1 115 ? 1.01287   4.67410  8.81139  1.000 26.24702  ? 115 CYS A H    1 
ATOM   1698 H HA   . CYS A 1 115 ? -1.17517  5.08647  7.44914  1.000 25.88468  ? 115 CYS A HA   1 
ATOM   1699 H HB2  . CYS A 1 115 ? 0.72608   3.01075  7.23985  1.000 29.47513  ? 115 CYS A HB2  1 
ATOM   1700 H HB3  . CYS A 1 115 ? -0.47199  3.16428  6.20716  1.000 29.47513  ? 115 CYS A HB3  1 
ATOM   1701 H HG   . CYS A 1 115 ? 1.97069   5.26679  6.45707  1.000 30.63883  ? 115 CYS A HG   1 
ATOM   1702 N N    . THR A 1 116 ? -2.98032  3.65511  8.21059  1.000 24.49229  ? 116 THR A N    1 
ATOM   1703 C CA   . THR A 1 116 ? -4.03015  2.68673  8.48522  1.000 26.55400  ? 116 THR A CA   1 
ATOM   1704 C C    . THR A 1 116 ? -4.48225  1.96626  7.22694  1.000 23.89629  ? 116 THR A C    1 
ATOM   1705 O O    . THR A 1 116 ? -5.57378  1.39795  7.21102  1.000 32.61288  ? 116 THR A O    1 
ATOM   1706 C CB   . THR A 1 116 ? -5.21958  3.35922  9.17105  1.000 27.16546  ? 116 THR A CB   1 
ATOM   1707 O OG1  . THR A 1 116 ? -5.77956  4.37987  8.34577  1.000 28.53129  ? 116 THR A OG1  1 
ATOM   1708 C CG2  . THR A 1 116 ? -4.76403  3.97009  10.46007 1.000 32.78932  ? 116 THR A CG2  1 
ATOM   1709 H H    . THR A 1 116 ? -3.26416  4.39707  7.88114  1.000 29.27844  ? 116 THR A H    1 
ATOM   1710 H HA   . THR A 1 116 ? -3.68027  2.02397  9.10104  1.000 31.75248  ? 116 THR A HA   1 
ATOM   1711 H HB   . THR A 1 116 ? -5.90674  2.69615  9.34150  1.000 32.48623  ? 116 THR A HB   1 
ATOM   1712 H HG1  . THR A 1 116 ? -6.41043  4.76113  8.74857  1.000 34.12523  ? 116 THR A HG1  1 
ATOM   1713 H HG21 . THR A 1 116 ? -5.52610  4.31430  10.95167 1.000 39.23487  ? 116 THR A HG21 1 
ATOM   1714 H HG22 . THR A 1 116 ? -4.31452  3.30335  11.00258 1.000 39.23487  ? 116 THR A HG22 1 
ATOM   1715 H HG23 . THR A 1 116 ? -4.14867  4.69864  10.28273 1.000 39.23487  ? 116 THR A HG23 1 
ATOM   1716 N N    . ALA A 1 117 ? -3.69140  2.03405  6.16110  1.000 24.02867  ? 117 ALA A N    1 
ATOM   1717 C CA   . ALA A 1 117 ? -3.95774  1.37730  4.88748  1.000 24.07186  ? 117 ALA A CA   1 
ATOM   1718 C C    . ALA A 1 117 ? -2.66920  1.43105  4.08821  1.000 23.51447  ? 117 ALA A C    1 
ATOM   1719 O O    . ALA A 1 117 ? -1.70913  2.09402  4.48029  1.000 26.66065  ? 117 ALA A O    1 
ATOM   1720 C CB   . ALA A 1 117 ? -5.08772  2.04800  4.10627  1.000 26.55845  ? 117 ALA A CB   1 
ATOM   1721 H H    . ALA A 1 117 ? -2.95510  2.47828  6.15025  1.000 28.72209  ? 117 ALA A H    1 
ATOM   1722 H HA   . ALA A 1 117 ? -4.21429  0.45609  5.05015  1.000 28.77391  ? 117 ALA A HA   1 
ATOM   1723 H HB1  . ALA A 1 117 ? -5.21995  1.57242  3.27126  1.000 31.75782  ? 117 ALA A HB1  1 
ATOM   1724 H HB2  . ALA A 1 117 ? -5.89948  2.01762  4.63638  1.000 31.75782  ? 117 ALA A HB2  1 
ATOM   1725 H HB3  . ALA A 1 117 ? -4.84401  2.96961  3.92702  1.000 31.75782  ? 117 ALA A HB3  1 
ATOM   1726 N N    . LYS A 1 118 ? -2.65935  0.74120  2.95724  1.000 23.79966  ? 118 LYS A N    1 
ATOM   1727 C CA   . LYS A 1 118 ? -1.52942  0.83743  2.04159  1.000 29.83476  ? 118 LYS A CA   1 
ATOM   1728 C C    . LYS A 1 118 ? -1.58751  2.14211  1.25164  1.000 27.45751  ? 118 LYS A C    1 
ATOM   1729 O O    . LYS A 1 118 ? -2.63104  2.50382  0.70532  1.000 27.83635  ? 118 LYS A O    1 
ATOM   1730 C CB   . LYS A 1 118 ? -1.50228  -0.36513 1.10054  1.000 30.18558  ? 118 LYS A CB   1 
ATOM   1731 C CG   . LYS A 1 118 ? -0.37953  -0.34586 0.09709  1.000 32.68824  ? 118 LYS A CG   1 
ATOM   1732 C CD   . LYS A 1 118 ? -0.33762  -1.62065 -0.73267 1.000 38.37376  ? 118 LYS A CD   1 
ATOM   1733 C CE   . LYS A 1 118 ? 0.71755   -1.53624 -1.82204 1.000 54.45714  ? 118 LYS A CE   1 
ATOM   1734 N NZ   . LYS A 1 118 ? 0.86385   -2.83151 -2.55172 1.000 71.18203  ? 118 LYS A NZ   1 
ATOM   1735 H H    . LYS A 1 118 ? -3.28811  0.21484  2.69800  1.000 28.44728  ? 118 LYS A H    1 
ATOM   1736 H HA   . LYS A 1 118 ? -0.70456  0.83883  2.55198  1.000 35.68939  ? 118 LYS A HA   1 
ATOM   1737 H HB2  . LYS A 1 118 ? -1.40707  -1.17120 1.63165  1.000 36.11038  ? 118 LYS A HB2  1 
ATOM   1738 H HB3  . LYS A 1 118 ? -2.33668  -0.38997 0.60651  1.000 36.11038  ? 118 LYS A HB3  1 
ATOM   1739 H HG2  . LYS A 1 118 ? -0.50221  0.40420  -0.50561 1.000 39.11357  ? 118 LYS A HG2  1 
ATOM   1740 H HG3  . LYS A 1 118 ? 0.46594   -0.26074 0.56487  1.000 39.11357  ? 118 LYS A HG3  1 
ATOM   1741 H HD2  . LYS A 1 118 ? -0.12388  -2.37213 -0.15778 1.000 45.93620  ? 118 LYS A HD2  1 
ATOM   1742 H HD3  . LYS A 1 118 ? -1.20059  -1.75960 -1.15323 1.000 45.93620  ? 118 LYS A HD3  1 
ATOM   1743 H HE2  . LYS A 1 118 ? 0.46289   -0.85358 -2.46237 1.000 65.23625  ? 118 LYS A HE2  1 
ATOM   1744 H HE3  . LYS A 1 118 ? 1.57310   -1.31389 -1.42267 1.000 65.23625  ? 118 LYS A HE3  1 
ATOM   1745 H HZ1  . LYS A 1 118 ? 1.49886   -2.76176 -3.17140 1.000 85.30612  ? 118 LYS A HZ1  1 
ATOM   1746 H HZ2  . LYS A 1 118 ? 1.08589   -3.47835 -1.98217 1.000 85.30612  ? 118 LYS A HZ2  1 
ATOM   1747 H HZ3  . LYS A 1 118 ? 0.09624   -3.04622 -2.94766 1.000 85.30612  ? 118 LYS A HZ3  1 
ATOM   1748 N N    . THR A 1 119 ? -0.46140  2.85572  1.20319  1.000 29.50099  ? 119 THR A N    1 
ATOM   1749 C CA   . THR A 1 119 ? -0.39943  4.17970  0.59011  1.000 28.93549  ? 119 THR A CA   1 
ATOM   1750 C C    . THR A 1 119 ? 0.80550   4.24685  -0.34058 1.000 26.88873  ? 119 THR A C    1 
ATOM   1751 O O    . THR A 1 119 ? 1.73530   5.02438  -0.15863 1.000 29.59458  ? 119 THR A O    1 
ATOM   1752 C CB   . THR A 1 119 ? -0.33158  5.28948  1.64520  1.000 27.85120  ? 119 THR A CB   1 
ATOM   1753 O OG1  . THR A 1 119 ? 0.90439   5.20462  2.35369  1.000 32.42603  ? 119 THR A OG1  1 
ATOM   1754 C CG2  . THR A 1 119 ? -1.44687  5.18210  2.66700  1.000 29.62467  ? 119 THR A CG2  1 
ATOM   1755 H H    . THR A 1 119 ? 0.29017   2.58809  1.52431  1.000 35.28887  ? 119 THR A H    1 
ATOM   1756 H HA   . THR A 1 119 ? -1.20352  4.30944  0.06333  1.000 34.61027  ? 119 THR A HA   1 
ATOM   1757 H HB   . THR A 1 119 ? -0.41657  6.13812  1.18315  1.000 33.30912  ? 119 THR A HB   1 
ATOM   1758 H HG1  . THR A 1 119 ? 0.92728   5.78362  2.96183  1.000 38.79892  ? 119 THR A HG1  1 
ATOM   1759 H HG21 . THR A 1 119 ? -1.41331  5.93691  3.27530  1.000 35.43729  ? 119 THR A HG21 1 
ATOM   1760 H HG22 . THR A 1 119 ? -2.30743  5.17649  2.21946  1.000 35.43729  ? 119 THR A HG22 1 
ATOM   1761 H HG23 . THR A 1 119 ? -1.35187  4.36241  3.17689  1.000 35.43729  ? 119 THR A HG23 1 
ATOM   1762 N N    . GLU A 1 120 ? 0.78095   3.41059  -1.36329 1.000 29.76326  ? 120 GLU A N    1 
ATOM   1763 C CA   . GLU A 1 120 ? 1.93235   3.29514  -2.24366 1.000 33.91618  ? 120 GLU A CA   1 
ATOM   1764 C C    . GLU A 1 120 ? 2.20758   4.58084  -3.02768 1.000 35.60672  ? 120 GLU A C    1 
ATOM   1765 O O    . GLU A 1 120 ? 3.32075   4.76188  -3.53613 1.000 35.09159  ? 120 GLU A O    1 
ATOM   1766 C CB   . GLU A 1 120 ? 1.72486   2.09933  -3.19249 1.000 35.42046  ? 120 GLU A CB   1 
ATOM   1767 C CG   . GLU A 1 120 ? 0.64482   2.28112  -4.25533 1.000 53.32319  ? 120 GLU A CG   1 
ATOM   1768 C CD   . GLU A 1 120 ? -0.77840  2.15066  -3.71369 1.000 60.66911  ? 120 GLU A CD   1 
ATOM   1769 O OE1  . GLU A 1 120 ? -1.75099  2.37755  -4.48547 1.000 54.97635  ? 120 GLU A OE1  1 
ATOM   1770 O OE2  . GLU A 1 120 ? -0.92308  1.83742  -2.50975 1.000 50.19951  ? 120 GLU A OE2  1 
ATOM   1771 H H    . GLU A 1 120 ? 0.11789   2.90306  -1.56912 1.000 35.60360  ? 120 GLU A H    1 
ATOM   1772 H HA   . GLU A 1 120 ? 2.72713   3.12152  -1.71537 1.000 40.58710  ? 120 GLU A HA   1 
ATOM   1773 H HB2  . GLU A 1 120 ? 2.55988   1.92969  -3.65602 1.000 42.39223  ? 120 GLU A HB2  1 
ATOM   1774 H HB3  . GLU A 1 120 ? 1.47820   1.32703  -2.65993 1.000 42.39223  ? 120 GLU A HB3  1 
ATOM   1775 H HG2  . GLU A 1 120 ? 0.73389   3.16572  -4.64319 1.000 63.87551  ? 120 GLU A HG2  1 
ATOM   1776 H HG3  . GLU A 1 120 ? 0.76380   1.60492  -4.94054 1.000 63.87551  ? 120 GLU A HG3  1 
ATOM   1777 N N    . TRP A 1 121 ? 1.21953   5.46102  -3.17068 1.000 32.48353  ? 121 TRP A N    1 
ATOM   1778 C CA   . TRP A 1 121 ? 1.42758   6.68005  -3.93630 1.000 27.69564  ? 121 TRP A CA   1 
ATOM   1779 C C    . TRP A 1 121 ? 2.30665   7.68030  -3.20816 1.000 30.58304  ? 121 TRP A C    1 
ATOM   1780 O O    . TRP A 1 121 ? 2.65398   8.71119  -3.79747 1.000 31.78143  ? 121 TRP A O    1 
ATOM   1781 C CB   . TRP A 1 121 ? 0.09007   7.33754  -4.26680 1.000 26.07440  ? 121 TRP A CB   1 
ATOM   1782 C CG   . TRP A 1 121 ? -0.68291  7.75572  -3.06848 1.000 25.76880  ? 121 TRP A CG   1 
ATOM   1783 C CD1  . TRP A 1 121 ? -0.60596  8.95273  -2.42310 1.000 24.36658  ? 121 TRP A CD1  1 
ATOM   1784 C CD2  . TRP A 1 121 ? -1.63532  6.97620  -2.35819 1.000 24.30006  ? 121 TRP A CD2  1 
ATOM   1785 N NE1  . TRP A 1 121 ? -1.44636  8.96965  -1.35227 1.000 25.16313  ? 121 TRP A NE1  1 
ATOM   1786 C CE2  . TRP A 1 121 ? -2.09982  7.76873  -1.29120 1.000 25.81080  ? 121 TRP A CE2  1 
ATOM   1787 C CE3  . TRP A 1 121 ? -2.15380  5.68846  -2.52790 1.000 24.69537  ? 121 TRP A CE3  1 
ATOM   1788 C CZ2  . TRP A 1 121 ? -3.05624  7.32306  -0.39991 1.000 27.54935  ? 121 TRP A CZ2  1 
ATOM   1789 C CZ3  . TRP A 1 121 ? -3.10247  5.24766  -1.65432 1.000 27.85645  ? 121 TRP A CZ3  1 
ATOM   1790 C CH2  . TRP A 1 121 ? -3.54180  6.05705  -0.58735 1.000 29.55568  ? 121 TRP A CH2  1 
ATOM   1791 H H    . TRP A 1 121 ? 0.43129   5.37442  -2.83783 1.000 38.86792  ? 121 TRP A H    1 
ATOM   1792 H HA   . TRP A 1 121 ? 1.85836   6.44316  -4.77249 1.000 33.12245  ? 121 TRP A HA   1 
ATOM   1793 H HB2  . TRP A 1 121 ? 0.25531   8.12848  -4.80346 1.000 31.17696  ? 121 TRP A HB2  1 
ATOM   1794 H HB3  . TRP A 1 121 ? -0.45332  6.70660  -4.76435 1.000 31.17696  ? 121 TRP A HB3  1 
ATOM   1795 H HD1  . TRP A 1 121 ? -0.05687  9.65873  -2.67798 1.000 29.12758  ? 121 TRP A HD1  1 
ATOM   1796 H HE1  . TRP A 1 121 ? -1.54941  9.62543  -0.80552 1.000 30.08345  ? 121 TRP A HE1  1 
ATOM   1797 H HE3  . TRP A 1 121 ? -1.85764  5.14472  -3.22182 1.000 29.52213  ? 121 TRP A HE3  1 
ATOM   1798 H HZ2  . TRP A 1 121 ? -3.35726  7.85985  0.29733  1.000 32.94690  ? 121 TRP A HZ2  1 
ATOM   1799 H HZ3  . TRP A 1 121 ? -3.46598  4.39871  -1.76404 1.000 33.31543  ? 121 TRP A HZ3  1 
ATOM   1800 H HH2  . TRP A 1 121 ? -4.17716  5.72278  0.00382  1.000 35.35450  ? 121 TRP A HH2  1 
ATOM   1801 N N    . LEU A 1 122 ? 2.66133   7.41163  -1.95206 1.000 27.66330  ? 122 LEU A N    1 
ATOM   1802 C CA   . LEU A 1 122 ? 3.55720   8.28119  -1.20825 1.000 27.33672  ? 122 LEU A CA   1 
ATOM   1803 C C    . LEU A 1 122 ? 4.98554   7.76851  -1.23762 1.000 28.36758  ? 122 LEU A C    1 
ATOM   1804 O O    . LEU A 1 122 ? 5.87139   8.39478  -0.64940 1.000 28.65214  ? 122 LEU A O    1 
ATOM   1805 C CB   . LEU A 1 122 ? 3.08374   8.43829  0.24761  1.000 28.13366  ? 122 LEU A CB   1 
ATOM   1806 C CG   . LEU A 1 122 ? 1.67350   8.97737  0.48156  1.000 24.93463  ? 122 LEU A CG   1 
ATOM   1807 C CD1  . LEU A 1 122 ? 1.29418   8.93042  1.94206  1.000 32.84018  ? 122 LEU A CD1  1 
ATOM   1808 C CD2  . LEU A 1 122 ? 1.56498   10.37323 -0.00955 1.000 28.12136  ? 122 LEU A CD2  1 
ATOM   1809 H H    . LEU A 1 122 ? 2.39168   6.72520  -1.50969 1.000 33.08364  ? 122 LEU A H    1 
ATOM   1810 H HA   . LEU A 1 122 ? 3.53822   9.16754  -1.60185 1.000 32.69174  ? 122 LEU A HA   1 
ATOM   1811 H HB2  . LEU A 1 122 ? 3.12245   7.56451  0.66704  1.000 33.64808  ? 122 LEU A HB2  1 
ATOM   1812 H HB3  . LEU A 1 122 ? 3.69353   9.04729  0.69276  1.000 33.64808  ? 122 LEU A HB3  1 
ATOM   1813 H HG   . LEU A 1 122 ? 1.05447   8.41416  -0.00884 1.000 29.80924  ? 122 LEU A HG   1 
ATOM   1814 H HD11 . LEU A 1 122 ? 0.38193   9.24472  2.04168  1.000 39.29590  ? 122 LEU A HD11 1 
ATOM   1815 H HD12 . LEU A 1 122 ? 1.36528   8.01592  2.25757  1.000 39.29590  ? 122 LEU A HD12 1 
ATOM   1816 H HD13 . LEU A 1 122 ? 1.89729   9.50115  2.44349  1.000 39.29590  ? 122 LEU A HD13 1 
ATOM   1817 H HD21 . LEU A 1 122 ? 0.63268   10.64074 0.00269  1.000 33.63332  ? 122 LEU A HD21 1 
ATOM   1818 H HD22 . LEU A 1 122 ? 2.08315   10.95316 0.57018  1.000 33.63332  ? 122 LEU A HD22 1 
ATOM   1819 H HD23 . LEU A 1 122 ? 1.90983   10.41711 -0.91512 1.000 33.63332  ? 122 LEU A HD23 1 
ATOM   1820 N N    . ASP A 1 123 ? 5.22596   6.64534  -1.90232 1.000 28.28665  ? 123 ASP A N    1 
ATOM   1821 C CA   . ASP A 1 123 ? 6.58229   6.14775  -2.06439 1.000 26.16966  ? 123 ASP A CA   1 
ATOM   1822 C C    . ASP A 1 123 ? 7.43066   7.16208  -2.82422 1.000 29.56448  ? 123 ASP A C    1 
ATOM   1823 O O    . ASP A 1 123 ? 7.02716   7.66495  -3.87232 1.000 31.37438  ? 123 ASP A O    1 
ATOM   1824 C CB   . ASP A 1 123 ? 6.54562   4.80161  -2.79418 1.000 30.31956  ? 123 ASP A CB   1 
ATOM   1825 C CG   . ASP A 1 123 ? 5.92353   3.69280  -1.94605 1.000 30.55084  ? 123 ASP A CG   1 
ATOM   1826 O OD1  . ASP A 1 123 ? 5.87116   3.81915  -0.69711 1.000 28.63785  ? 123 ASP A OD1  1 
ATOM   1827 O OD2  . ASP A 1 123 ? 5.48033   2.69094  -2.53017 1.000 28.83996  ? 123 ASP A OD2  1 
ATOM   1828 H H    . ASP A 1 123 ? 4.62203   6.15431  -2.26805 1.000 33.83166  ? 123 ASP A H    1 
ATOM   1829 H HA   . ASP A 1 123 ? 6.99493   6.01047  -1.19734 1.000 31.29127  ? 123 ASP A HA   1 
ATOM   1830 H HB2  . ASP A 1 123 ? 6.01811   4.89374  -3.60297 1.000 36.27116  ? 123 ASP A HB2  1 
ATOM   1831 H HB3  . ASP A 1 123 ? 7.45181   4.53725  -3.01744 1.000 36.27116  ? 123 ASP A HB3  1 
ATOM   1832 N N    . GLY A 1 124 ? 8.61708   7.44937  -2.29922 1.000 28.28886  ? 124 GLY A N    1 
ATOM   1833 C CA   . GLY A 1 124 ? 9.51037   8.41110  -2.89279 1.000 24.45091  ? 124 GLY A CA   1 
ATOM   1834 C C    . GLY A 1 124 ? 9.22963   9.84432  -2.52981 1.000 27.41579  ? 124 GLY A C    1 
ATOM   1835 O O    . GLY A 1 124 ? 9.98178   10.72325 -2.97360 1.000 27.64987  ? 124 GLY A O    1 
ATOM   1836 H H    . GLY A 1 124 ? 8.92659   7.08767  -1.58300 1.000 33.83432  ? 124 GLY A H    1 
ATOM   1837 H HA2  . GLY A 1 124 ? 10.41647  8.20716  -2.61301 1.000 29.22878  ? 124 GLY A HA2  1 
ATOM   1838 H HA3  . GLY A 1 124 ? 9.45292   8.33374  -3.85800 1.000 29.22878  ? 124 GLY A HA3  1 
ATOM   1839 N N    . LYS A 1 125 ? 8.17418   10.10956 -1.74098 1.000 26.60934  ? 125 LYS A N    1 
ATOM   1840 C CA   . LYS A 1 125 ? 7.79723   11.45974 -1.34391 1.000 26.72982  ? 125 LYS A CA   1 
ATOM   1841 C C    . LYS A 1 125 ? 7.78237   11.65547 0.15306  1.000 24.10759  ? 125 LYS A C    1 
ATOM   1842 O O    . LYS A 1 125 ? 8.01846   12.76546 0.61961  1.000 27.25423  ? 125 LYS A O    1 
ATOM   1843 C CB   . LYS A 1 125 ? 6.39884   11.82558 -1.87358 1.000 33.40109  ? 125 LYS A CB   1 
ATOM   1844 C CG   . LYS A 1 125 ? 6.20683   11.51089 -3.35780 1.000 48.68875  ? 125 LYS A CG   1 
ATOM   1845 C CD   . LYS A 1 125 ? 4.81075   11.90616 -3.87227 1.000 55.37461  ? 125 LYS A CD   1 
ATOM   1846 C CE   . LYS A 1 125 ? 4.61882   11.42873 -5.33072 1.000 62.19947  ? 125 LYS A CE   1 
ATOM   1847 N NZ   . LYS A 1 125 ? 3.29545   11.85903 -5.86195 1.000 87.12741  ? 125 LYS A NZ   1 
ATOM   1848 H H    . LYS A 1 125 ? 7.65448   9.50406  -1.42021 1.000 31.81889  ? 125 LYS A H    1 
ATOM   1849 H HA   . LYS A 1 125 ? 8.43436   12.07566 -1.73839 1.000 31.96347  ? 125 LYS A HA   1 
ATOM   1850 H HB2  . LYS A 1 125 ? 5.73465   11.32423 -1.37518 1.000 39.96900  ? 125 LYS A HB2  1 
ATOM   1851 H HB3  . LYS A 1 125 ? 6.25708   12.77728 -1.75084 1.000 39.96900  ? 125 LYS A HB3  1 
ATOM   1852 H HG2  . LYS A 1 125 ? 6.86630   12.00086 -3.87348 1.000 58.31419  ? 125 LYS A HG2  1 
ATOM   1853 H HG3  . LYS A 1 125 ? 6.31874   10.55741 -3.49659 1.000 58.31419  ? 125 LYS A HG3  1 
ATOM   1854 H HD2  . LYS A 1 125 ? 4.13048   11.49161 -3.31884 1.000 66.33721  ? 125 LYS A HD2  1 
ATOM   1855 H HD3  . LYS A 1 125 ? 4.71589   12.87119 -3.84749 1.000 66.33721  ? 125 LYS A HD3  1 
ATOM   1856 H HE2  . LYS A 1 125 ? 5.31341   11.81054 -5.88989 1.000 74.52705  ? 125 LYS A HE2  1 
ATOM   1857 H HE3  . LYS A 1 125 ? 4.66254   10.46023 -5.36222 1.000 74.52705  ? 125 LYS A HE3  1 
ATOM   1858 H HZ1  . LYS A 1 125 ? 3.24429   12.74754 -5.86834 1.000 104.44058 ? 125 LYS A HZ1  1 
ATOM   1859 H HZ2  . LYS A 1 125 ? 3.18819   11.55757 -6.69244 1.000 104.44058 ? 125 LYS A HZ2  1 
ATOM   1860 H HZ3  . LYS A 1 125 ? 2.64253   11.53579 -5.35076 1.000 104.44058 ? 125 LYS A HZ3  1 
ATOM   1861 N N    . HIS A 1 126 ? 7.48510   10.61426 0.90940  1.000 25.50422  ? 126 HIS A N    1 
ATOM   1862 C CA   . HIS A 1 126 ? 7.54031   10.63147 2.35798  1.000 23.19349  ? 126 HIS A CA   1 
ATOM   1863 C C    . HIS A 1 126 ? 8.47659   9.53117  2.81529  1.000 20.23345  ? 126 HIS A C    1 
ATOM   1864 O O    . HIS A 1 126 ? 8.42991   8.41404  2.30132  1.000 24.18672  ? 126 HIS A O    1 
ATOM   1865 C CB   . HIS A 1 126 ? 6.16347   10.42835 2.94856  1.000 22.65934  ? 126 HIS A CB   1 
ATOM   1866 C CG   . HIS A 1 126 ? 5.19420   11.50917 2.59358  1.000 25.44537  ? 126 HIS A CG   1 
ATOM   1867 N ND1  . HIS A 1 126 ? 4.88407   12.54680 3.44487  1.000 24.26440  ? 126 HIS A ND1  1 
ATOM   1868 C CD2  . HIS A 1 126 ? 4.45299   11.69908 1.47903  1.000 25.03941  ? 126 HIS A CD2  1 
ATOM   1869 C CE1  . HIS A 1 126 ? 3.98141   13.32554 2.87349  1.000 24.22521  ? 126 HIS A CE1  1 
ATOM   1870 N NE2  . HIS A 1 126 ? 3.72231   12.84626 1.67199  1.000 27.78966  ? 126 HIS A NE2  1 
ATOM   1871 H H    . HIS A 1 126 ? 7.23810   9.85396  0.59234  1.000 30.49274  ? 126 HIS A H    1 
ATOM   1872 H HA   . HIS A 1 126 ? 7.87908   11.48189 2.67878  1.000 27.71987  ? 126 HIS A HA   1 
ATOM   1873 H HB2  . HIS A 1 126 ? 5.80417   9.58866  2.62188  1.000 27.07889  ? 126 HIS A HB2  1 
ATOM   1874 H HB3  . HIS A 1 126 ? 6.23881   10.40324 3.91531  1.000 27.07889  ? 126 HIS A HB3  1 
ATOM   1875 H HD1  . HIS A 1 126 ? 5.22417   12.66883 4.22528  1.000 29.00496  ? 126 HIS A HD1  1 
ATOM   1876 H HD2  . HIS A 1 126 ? 4.44018   11.15578 0.72433  1.000 29.93498  ? 126 HIS A HD2  1 
ATOM   1877 H HE1  . HIS A 1 126 ? 3.59530   14.08153 3.25336  1.000 28.95794  ? 126 HIS A HE1  1 
ATOM   1878 N N    . VAL A 1 127 ? 9.31851   9.84341  3.78668  1.000 20.61857  ? 127 VAL A N    1 
ATOM   1879 C CA   . VAL A 1 127 ? 10.28216  8.87055  4.28563  1.000 21.47251  ? 127 VAL A CA   1 
ATOM   1880 C C    . VAL A 1 127 ? 9.59967   7.93633  5.27327  1.000 17.59648  ? 127 VAL A C    1 
ATOM   1881 O O    . VAL A 1 127 ? 9.06222   8.37115  6.29095  1.000 19.81326  ? 127 VAL A O    1 
ATOM   1882 C CB   . VAL A 1 127 ? 11.48862  9.56656  4.93345  1.000 29.87156  ? 127 VAL A CB   1 
ATOM   1883 C CG1  . VAL A 1 127 ? 12.50421  8.54596  5.51652  1.000 23.27038  ? 127 VAL A CG1  1 
ATOM   1884 C CG2  . VAL A 1 127 ? 12.16283  10.48220 3.92108  1.000 26.74987  ? 127 VAL A CG2  1 
ATOM   1885 H H    . VAL A 1 127 ? 9.35358   10.61022 4.17445  1.000 24.62997  ? 127 VAL A H    1 
ATOM   1886 H HA   . VAL A 1 127 ? 10.59438  8.33691  3.53821  1.000 25.65470  ? 127 VAL A HA   1 
ATOM   1887 H HB   . VAL A 1 127 ? 11.16971  10.10014 5.67810  1.000 35.73355  ? 127 VAL A HB   1 
ATOM   1888 H HG11 . VAL A 1 127 ? 13.33325  9.00657  5.72007  1.000 27.81215  ? 127 VAL A HG11 1 
ATOM   1889 H HG12 . VAL A 1 127 ? 12.13384  8.15867  6.32506  1.000 27.81215  ? 127 VAL A HG12 1 
ATOM   1890 H HG13 . VAL A 1 127 ? 12.66493  7.85019  4.86003  1.000 27.81215  ? 127 VAL A HG13 1 
ATOM   1891 H HG21 . VAL A 1 127 ? 12.95601  10.86874 4.32401  1.000 31.98753  ? 127 VAL A HG21 1 
ATOM   1892 H HG22 . VAL A 1 127 ? 12.40848  9.96252  3.13974  1.000 31.98753  ? 127 VAL A HG22 1 
ATOM   1893 H HG23 . VAL A 1 127 ? 11.54355  11.18512 3.66951  1.000 31.98753  ? 127 VAL A HG23 1 
ATOM   1894 N N    . VAL A 1 128 ? 9.65186   6.64928  4.97509  1.000 18.75707  ? 128 VAL A N    1 
ATOM   1895 C CA   . VAL A 1 128 ? 9.26857   5.61588  5.92973  1.000 21.09864  ? 128 VAL A CA   1 
ATOM   1896 C C    . VAL A 1 128 ? 10.43358  5.32078  6.85969  1.000 21.70262  ? 128 VAL A C    1 
ATOM   1897 O O    . VAL A 1 128 ? 11.55796  5.07376  6.40525  1.000 21.26030  ? 128 VAL A O    1 
ATOM   1898 C CB   . VAL A 1 128 ? 8.82675   4.34593  5.19223  1.000 21.71797  ? 128 VAL A CB   1 
ATOM   1899 C CG1  . VAL A 1 128 ? 8.70987   3.20053  6.16595  1.000 21.21254  ? 128 VAL A CG1  1 
ATOM   1900 C CG2  . VAL A 1 128 ? 7.51119   4.63310  4.45746  1.000 23.05102  ? 128 VAL A CG2  1 
ATOM   1901 H H    . VAL A 1 128 ? 9.90951   6.34006  4.21509  1.000 22.39617  ? 128 VAL A H    1 
ATOM   1902 H HA   . VAL A 1 128 ? 8.53027   5.94383  6.46663  1.000 25.20605  ? 128 VAL A HA   1 
ATOM   1903 H HB   . VAL A 1 128 ? 9.48335   4.07991  4.52966  1.000 25.94925  ? 128 VAL A HB   1 
ATOM   1904 H HG11 . VAL A 1 128 ? 8.17815   2.49644  5.76292  1.000 25.34274  ? 128 VAL A HG11 1 
ATOM   1905 H HG12 . VAL A 1 128 ? 9.59789   2.86835  6.37083  1.000 25.34274  ? 128 VAL A HG12 1 
ATOM   1906 H HG13 . VAL A 1 128 ? 8.28013   3.51716  6.97587  1.000 25.34274  ? 128 VAL A HG13 1 
ATOM   1907 H HG21 . VAL A 1 128 ? 7.23874   3.83702  3.97484  1.000 27.54890  ? 128 VAL A HG21 1 
ATOM   1908 H HG22 . VAL A 1 128 ? 6.83268   4.87439  5.10731  1.000 27.54890  ? 128 VAL A HG22 1 
ATOM   1909 H HG23 . VAL A 1 128 ? 7.64964   5.36526  3.83643  1.000 27.54890  ? 128 VAL A HG23 1 
ATOM   1910 N N    . PHE A 1 129 ? 10.16655  5.33734  8.16852  1.000 20.31012  ? 129 PHE A N    1 
ATOM   1911 C CA   . PHE A 1 129 ? 11.24193  5.12720  9.12160  1.000 19.26888  ? 129 PHE A CA   1 
ATOM   1912 C C    . PHE A 1 129 ? 10.86975  4.21266  10.27354 1.000 23.59175  ? 129 PHE A C    1 
ATOM   1913 O O    . PHE A 1 129 ? 11.68131  4.07354  11.20031 1.000 25.84819  ? 129 PHE A O    1 
ATOM   1914 C CB   . PHE A 1 129 ? 11.71807  6.46969  9.67513  1.000 21.86836  ? 129 PHE A CB   1 
ATOM   1915 C CG   . PHE A 1 129 ? 10.69899  7.17205  10.52702 1.000 24.54620  ? 129 PHE A CG   1 
ATOM   1916 C CD1  . PHE A 1 129 ? 9.71449   7.97422  9.94615  1.000 23.44349  ? 129 PHE A CD1  1 
ATOM   1917 C CD2  . PHE A 1 129 ? 10.72299  7.05162  11.89429 1.000 23.95528  ? 129 PHE A CD2  1 
ATOM   1918 C CE1  . PHE A 1 129 ? 8.79119   8.60747  10.69670 1.000 21.69413  ? 129 PHE A CE1  1 
ATOM   1919 C CE2  . PHE A 1 129 ? 9.77478   7.68813  12.64121 1.000 26.39262  ? 129 PHE A CE2  1 
ATOM   1920 C CZ   . PHE A 1 129 ? 8.81480   8.45539  12.03994 1.000 24.17532  ? 129 PHE A CZ   1 
ATOM   1921 H H    . PHE A 1 129 ? 9.38968   5.46531  8.51450  1.000 24.25983  ? 129 PHE A H    1 
ATOM   1922 H HA   . PHE A 1 129 ? 11.97704  4.70048  8.65425  1.000 23.01034  ? 129 PHE A HA   1 
ATOM   1923 H HB2  . PHE A 1 129 ? 12.50629  6.31988  10.22026 1.000 26.12972  ? 129 PHE A HB2  1 
ATOM   1924 H HB3  . PHE A 1 129 ? 11.93497  7.05380  8.93171  1.000 26.12972  ? 129 PHE A HB3  1 
ATOM   1925 H HD1  . PHE A 1 129 ? 9.69548   8.07365  9.02168  1.000 28.01987  ? 129 PHE A HD1  1 
ATOM   1926 H HD2  . PHE A 1 129 ? 11.38030  6.54027  12.30827 1.000 28.63402  ? 129 PHE A HD2  1 
ATOM   1927 H HE1  . PHE A 1 129 ? 8.14535   9.14283  10.29523 1.000 25.92065  ? 129 PHE A HE1  1 
ATOM   1928 H HE2  . PHE A 1 129 ? 9.78117   7.59961  13.56697 1.000 31.55883  ? 129 PHE A HE2  1 
ATOM   1929 H HZ   . PHE A 1 129 ? 8.17073   8.87741  12.56145 1.000 28.89807  ? 129 PHE A HZ   1 
ATOM   1930 N N    . GLY A 1 130 ? 9.68135   3.60965  10.26807 1.000 22.60329  ? 130 GLY A N    1 
ATOM   1931 C CA   . GLY A 1 130 ? 9.28551   2.79312  11.40018 1.000 21.19374  ? 130 GLY A CA   1 
ATOM   1932 C C    . GLY A 1 130 ? 8.02569   2.03432  11.09190 1.000 23.85568  ? 130 GLY A C    1 
ATOM   1933 O O    . GLY A 1 130 ? 7.44554   2.17253  10.01421 1.000 25.18624  ? 130 GLY A O    1 
ATOM   1934 H H    . GLY A 1 130 ? 9.10311   3.65938  9.63344  1.000 27.01163  ? 130 GLY A H    1 
ATOM   1935 H HA2  . GLY A 1 130 ? 9.98897   2.15888  11.60944 1.000 25.32017  ? 130 GLY A HA2  1 
ATOM   1936 H HA3  . GLY A 1 130 ? 9.12900   3.35760  12.17333 1.000 25.32017  ? 130 GLY A HA3  1 
ATOM   1937 N N    . LYS A 1 131 ? 7.59994   1.23336  12.06475 1.000 23.08486  ? 131 LYS A N    1 
ATOM   1938 C CA   . LYS A 1 131 ? 6.31382   0.57233  11.93953 1.000 23.06453  ? 131 LYS A CA   1 
ATOM   1939 C C    . LYS A 1 131 ? 5.78008   0.27939  13.32900 1.000 24.33595  ? 131 LYS A C    1 
ATOM   1940 O O    . LYS A 1 131 ? 6.54511   0.08000  14.26585 1.000 25.60533  ? 131 LYS A O    1 
ATOM   1941 C CB   . LYS A 1 131 ? 6.42660   -0.71539 11.11151 1.000 25.10320  ? 131 LYS A CB   1 
ATOM   1942 C CG   . LYS A 1 131 ? 7.04637   -1.89482 11.82645 1.000 32.19640  ? 131 LYS A CG   1 
ATOM   1943 C CD   . LYS A 1 131 ? 6.97441   -3.16737 10.96410 1.000 50.67647  ? 131 LYS A CD   1 
ATOM   1944 C CE   . LYS A 1 131 ? 7.62273   -4.36969 11.63255 1.000 59.97410  ? 131 LYS A CE   1 
ATOM   1945 N NZ   . LYS A 1 131 ? 6.81504   -4.83664 12.79634 1.000 73.93549  ? 131 LYS A NZ   1 
ATOM   1946 H H    . LYS A 1 131 ? 8.03062   1.06291  12.78937 1.000 27.58951  ? 131 LYS A H    1 
ATOM   1947 H HA   . LYS A 1 131 ? 5.68318   1.16015  11.49495 1.000 27.56512  ? 131 LYS A HA   1 
ATOM   1948 H HB2  . LYS A 1 131 ? 5.53505   -0.98034 10.83612 1.000 30.01153  ? 131 LYS A HB2  1 
ATOM   1949 H HB3  . LYS A 1 131 ? 6.97330   -0.53018 10.33195 1.000 30.01153  ? 131 LYS A HB3  1 
ATOM   1950 H HG2  . LYS A 1 131 ? 7.97876   -1.70452 12.01443 1.000 38.52336  ? 131 LYS A HG2  1 
ATOM   1951 H HG3  . LYS A 1 131 ? 6.56771   -2.05823 12.65414 1.000 38.52336  ? 131 LYS A HG3  1 
ATOM   1952 H HD2  . LYS A 1 131 ? 6.04382   -3.38372 10.79652 1.000 60.69945  ? 131 LYS A HD2  1 
ATOM   1953 H HD3  . LYS A 1 131 ? 7.43411   -3.00733 10.12508 1.000 60.69945  ? 131 LYS A HD3  1 
ATOM   1954 H HE2  . LYS A 1 131 ? 7.68968   -5.09681 10.99403 1.000 71.85661  ? 131 LYS A HE2  1 
ATOM   1955 H HE3  . LYS A 1 131 ? 8.50589   -4.12495 11.95044 1.000 71.85661  ? 131 LYS A HE3  1 
ATOM   1956 H HZ1  . LYS A 1 131 ? 7.21861   -5.52514 13.19031 1.000 88.61027  ? 131 LYS A HZ1  1 
ATOM   1957 H HZ2  . LYS A 1 131 ? 6.72442   -4.17789 13.38790 1.000 88.61027  ? 131 LYS A HZ2  1 
ATOM   1958 H HZ3  . LYS A 1 131 ? 6.00760   -5.09278 12.52332 1.000 88.61027  ? 131 LYS A HZ3  1 
ATOM   1959 N N    . VAL A 1 132 ? 4.46003   0.17806  13.43560 1.000 26.77781  ? 132 VAL A N    1 
ATOM   1960 C CA   . VAL A 1 132 ? 3.85323   -0.24030 14.68794 1.000 24.61822  ? 132 VAL A CA   1 
ATOM   1961 C C    . VAL A 1 132 ? 4.31120   -1.64745 15.01662 1.000 22.74565  ? 132 VAL A C    1 
ATOM   1962 O O    . VAL A 1 132 ? 4.28637   -2.54078 14.16441 1.000 26.75477  ? 132 VAL A O    1 
ATOM   1963 C CB   . VAL A 1 132 ? 2.32484   -0.15894 14.58204 1.000 23.91850  ? 132 VAL A CB   1 
ATOM   1964 C CG1  . VAL A 1 132 ? 1.67750   -0.84127 15.77821 1.000 26.05625  ? 132 VAL A CG1  1 
ATOM   1965 C CG2  . VAL A 1 132 ? 1.87596   1.28768  14.44059 1.000 24.18900  ? 132 VAL A CG2  1 
ATOM   1966 H H    . VAL A 1 132 ? 3.90086   0.34431  12.80371 1.000 32.02105  ? 132 VAL A H    1 
ATOM   1967 H HA   . VAL A 1 132 ? 4.14288   0.35120  15.40007 1.000 29.42955  ? 132 VAL A HA   1 
ATOM   1968 H HB   . VAL A 1 132 ? 2.02987   -0.62789 13.78581 1.000 28.58989  ? 132 VAL A HB   1 
ATOM   1969 H HG11 . VAL A 1 132 ? 0.75251   -0.55626 15.84194 1.000 31.15518  ? 132 VAL A HG11 1 
ATOM   1970 H HG12 . VAL A 1 132 ? 1.71970   -1.80243 15.65452 1.000 31.15518  ? 132 VAL A HG12 1 
ATOM   1971 H HG13 . VAL A 1 132 ? 2.15726   -0.58995 16.58293 1.000 31.15518  ? 132 VAL A HG13 1 
ATOM   1972 H HG21 . VAL A 1 132 ? 0.91195   1.31036  14.33539 1.000 28.91448  ? 132 VAL A HG21 1 
ATOM   1973 H HG22 . VAL A 1 132 ? 2.13338   1.77754  15.23726 1.000 28.91448  ? 132 VAL A HG22 1 
ATOM   1974 H HG23 . VAL A 1 132 ? 2.30300   1.67606  13.66105 1.000 28.91448  ? 132 VAL A HG23 1 
ATOM   1975 N N    . LYS A 1 133 ? 4.72925   -1.85069 16.26080 1.000 29.66220  ? 133 LYS A N    1 
ATOM   1976 C CA   . LYS A 1 133 ? 5.14703   -3.15460 16.76496 1.000 34.44401  ? 133 LYS A CA   1 
ATOM   1977 C C    . LYS A 1 133 ? 4.07624   -3.77148 17.65446 1.000 26.02538  ? 133 LYS A C    1 
ATOM   1978 O O    . LYS A 1 133 ? 3.76741   -4.95592 17.53553 1.000 30.86974  ? 133 LYS A O    1 
ATOM   1979 C CB   . LYS A 1 133 ? 6.48730   -3.01579 17.51498 1.000 38.46949  ? 133 LYS A CB   1 
ATOM   1980 C CG   . LYS A 1 133 ? 7.05365   -4.29361 18.03494 1.000 49.05042  ? 133 LYS A CG   1 
ATOM   1981 C CD   . LYS A 1 133 ? 8.27989   -4.00684 18.94057 1.000 73.61671  ? 133 LYS A CD   1 
ATOM   1982 C CE   . LYS A 1 133 ? 8.80001   -5.27823 19.60912 1.000 74.53378  ? 133 LYS A CE   1 
ATOM   1983 N NZ   . LYS A 1 133 ? 9.96179   -4.98664 20.49179 1.000 64.31732  ? 133 LYS A NZ   1 
ATOM   1984 H H    . LYS A 1 133 ? 4.78171   -1.22833 16.85200 1.000 35.48232  ? 133 LYS A H    1 
ATOM   1985 H HA   . LYS A 1 133 ? 5.30192   -3.76540 16.02751 1.000 41.22049  ? 133 LYS A HA   1 
ATOM   1986 H HB2  . LYS A 1 133 ? 7.14054   -2.63375 16.90815 1.000 46.05107  ? 133 LYS A HB2  1 
ATOM   1987 H HB3  . LYS A 1 133 ? 6.35483   -2.42628 18.27381 1.000 46.05107  ? 133 LYS A HB3  1 
ATOM   1988 H HG2  . LYS A 1 133 ? 6.38273   -4.75841 18.55909 1.000 58.74819  ? 133 LYS A HG2  1 
ATOM   1989 H HG3  . LYS A 1 133 ? 7.33903   -4.84969 17.29316 1.000 58.74819  ? 133 LYS A HG3  1 
ATOM   1990 H HD2  . LYS A 1 133 ? 8.99483   -3.63232 18.40253 1.000 88.22774  ? 133 LYS A HD2  1 
ATOM   1991 H HD3  . LYS A 1 133 ? 8.02499   -3.38047 19.63597 1.000 88.22774  ? 133 LYS A HD3  1 
ATOM   1992 H HE2  . LYS A 1 133 ? 8.09567   -5.66932 20.14937 1.000 89.32822  ? 133 LYS A HE2  1 
ATOM   1993 H HE3  . LYS A 1 133 ? 9.08366   -5.90756 18.92767 1.000 89.32822  ? 133 LYS A HE3  1 
ATOM   1994 H HZ1  . LYS A 1 133 ? 10.28371  -5.74374 20.83130 1.000 77.06847  ? 133 LYS A HZ1  1 
ATOM   1995 H HZ2  . LYS A 1 133 ? 10.60393  -4.58281 20.02631 1.000 77.06847  ? 133 LYS A HZ2  1 
ATOM   1996 H HZ3  . LYS A 1 133 ? 9.71076   -4.45442 21.15949 1.000 77.06847  ? 133 LYS A HZ3  1 
ATOM   1997 N N    . GLU A 1 134 ? 3.48600   -2.98566 18.53558 1.000 26.16641  ? 134 GLU A N    1 
ATOM   1998 C CA   . GLU A 1 134 ? 2.42119   -3.46196 19.39966 1.000 29.48702  ? 134 GLU A CA   1 
ATOM   1999 C C    . GLU A 1 134 ? 1.40119   -2.34920 19.49423 1.000 28.20201  ? 134 GLU A C    1 
ATOM   2000 O O    . GLU A 1 134 ? 1.75346   -1.16355 19.49480 1.000 28.78052  ? 134 GLU A O    1 
ATOM   2001 C CB   . GLU A 1 134 ? 2.88272   -3.85534 20.84568 1.000 32.20679  ? 134 GLU A CB   1 
ATOM   2002 C CG   . GLU A 1 134 ? 3.81603   -5.05983 20.88843 1.000 40.22598  ? 134 GLU A CG   1 
ATOM   2003 C CD   . GLU A 1 134 ? 4.29946   -5.38923 22.27176 1.000 46.05504  ? 134 GLU A CD   1 
ATOM   2004 O OE1  . GLU A 1 134 ? 3.63478   -6.20471 22.94002 1.000 43.89300  ? 134 GLU A OE1  1 
ATOM   2005 O OE2  . GLU A 1 134 ? 5.34103   -4.83072 22.68779 1.000 44.39162  ? 134 GLU A OE2  1 
ATOM   2006 H H    . GLU A 1 134 ? 3.68718   -2.15808 18.65487 1.000 31.28738  ? 134 GLU A H    1 
ATOM   2007 H HA   . GLU A 1 134 ? 2.03909   -4.26497 19.01226 1.000 35.27211  ? 134 GLU A HA   1 
ATOM   2008 H HB2  . GLU A 1 134 ? 3.35268   -3.10297 21.23809 1.000 38.53584  ? 134 GLU A HB2  1 
ATOM   2009 H HB3  . GLU A 1 134 ? 2.09884   -4.06965 21.37530 1.000 38.53584  ? 134 GLU A HB3  1 
ATOM   2010 H HG2  . GLU A 1 134 ? 3.34403   -5.83492 20.54585 1.000 48.15887  ? 134 GLU A HG2  1 
ATOM   2011 H HG3  . GLU A 1 134 ? 4.59299   -4.87453 20.33806 1.000 48.15887  ? 134 GLU A HG3  1 
ATOM   2012 N N    . GLY A 1 135 ? 0.14310   -2.74286 19.63488 1.000 25.48661  ? 135 GLY A N    1 
ATOM   2013 C CA   . GLY A 1 135 ? -0.91476  -1.77736 19.77790 1.000 24.42459  ? 135 GLY A CA   1 
ATOM   2014 C C    . GLY A 1 135 ? -1.53341  -1.34216 18.48978 1.000 23.51835  ? 135 GLY A C    1 
ATOM   2015 O O    . GLY A 1 135 ? -2.16475  -0.28759 18.44788 1.000 27.13247  ? 135 GLY A O    1 
ATOM   2016 H H    . GLY A 1 135 ? -0.11533  -3.56298 19.64966 1.000 30.47162  ? 135 GLY A H    1 
ATOM   2017 H HA2  . GLY A 1 135 ? -1.61454  -2.16053 20.32960 1.000 29.19720  ? 135 GLY A HA2  1 
ATOM   2018 H HA3  . GLY A 1 135 ? -0.56063  -0.98942 20.21909 1.000 29.19720  ? 135 GLY A HA3  1 
ATOM   2019 N N    . MET A 1 136 ? -1.37455  -2.12028 17.43517 1.000 26.19427  ? 136 MET A N    1 
ATOM   2020 C CA   . MET A 1 136 ? -2.11557  -1.83908 16.22140 1.000 31.49717  ? 136 MET A CA   1 
ATOM   2021 C C    . MET A 1 136 ? -3.61842  -1.83133 16.48423 1.000 28.08506  ? 136 MET A C    1 
ATOM   2022 O O    . MET A 1 136 ? -4.35260  -1.09689 15.82119 1.000 31.81797  ? 136 MET A O    1 
ATOM   2023 C CB   . MET A 1 136 ? -1.73188  -2.85125 15.13897 1.000 29.25270  ? 136 MET A CB   1 
ATOM   2024 C CG   . MET A 1 136 ? -2.15989  -2.42140 13.75891 1.000 42.23548  ? 136 MET A CG   1 
ATOM   2025 S SD   . MET A 1 136 ? -1.35492  -0.89378 13.19047 1.000 34.10176  ? 136 MET A SD   1 
ATOM   2026 C CE   . MET A 1 136 ? -2.56288  -0.23164 12.05794 1.000 31.19235  ? 136 MET A CE   1 
ATOM   2027 H H    . MET A 1 136 ? -0.85452  -2.80411 17.39588 1.000 31.32081  ? 136 MET A H    1 
ATOM   2028 H HA   . MET A 1 136 ? -1.87007  -0.96284 15.88549 1.000 37.68430  ? 136 MET A HA   1 
ATOM   2029 H HB2  . MET A 1 136 ? -0.76780  -2.95817 15.13456 1.000 34.99093  ? 136 MET A HB2  1 
ATOM   2030 H HB3  . MET A 1 136 ? -2.15890  -3.69985 15.33499 1.000 34.99093  ? 136 MET A HB3  1 
ATOM   2031 H HG2  . MET A 1 136 ? -1.93837  -3.12520 13.12924 1.000 50.57026  ? 136 MET A HG2  1 
ATOM   2032 H HG3  . MET A 1 136 ? -3.11773  -2.26832 13.76190 1.000 50.57026  ? 136 MET A HG3  1 
ATOM   2033 H HE1  . MET A 1 136 ? -2.23518  0.60947  11.70291 1.000 37.31851  ? 136 MET A HE1  1 
ATOM   2034 H HE2  . MET A 1 136 ? -2.69915  -0.86481 11.33583 1.000 37.31851  ? 136 MET A HE2  1 
ATOM   2035 H HE3  . MET A 1 136 ? -3.39604  -0.08782 12.53340 1.000 37.31851  ? 136 MET A HE3  1 
ATOM   2036 N N    . ASN A 1 137 ? -4.08897  -2.62003 17.45112 1.000 26.15218  ? 137 ASN A N    1 
ATOM   2037 C CA   . ASN A 1 137 ? -5.47671  -2.51573 17.90295 1.000 25.43391  ? 137 ASN A CA   1 
ATOM   2038 C C    . ASN A 1 137 ? -5.78706  -1.14183 18.49183 1.000 26.85016  ? 137 ASN A C    1 
ATOM   2039 O O    . ASN A 1 137 ? -6.88485  -0.61061 18.29765 1.000 27.41945  ? 137 ASN A O    1 
ATOM   2040 C CB   . ASN A 1 137 ? -5.78073  -3.60370 18.94054 1.000 25.26458  ? 137 ASN A CB   1 
ATOM   2041 C CG   . ASN A 1 137 ? -4.74673  -3.65746 20.07966 1.000 22.79431  ? 137 ASN A CG   1 
ATOM   2042 O OD1  . ASN A 1 137 ? -3.55340  -3.72690 19.84391 1.000 27.88206  ? 137 ASN A OD1  1 
ATOM   2043 N ND2  . ASN A 1 137 ? -5.20985  -3.63322 21.29725 1.000 22.95628  ? 137 ASN A ND2  1 
ATOM   2044 H H    . ASN A 1 137 ? -3.62894  -3.22056 17.86019 1.000 31.27030  ? 137 ASN A H    1 
ATOM   2045 H HA   . ASN A 1 137 ? -6.04980  -2.64969 17.13189 1.000 30.40838  ? 137 ASN A HA   1 
ATOM   2046 H HB2  . ASN A 1 137 ? -6.64986  -3.42914 19.33430 1.000 30.20519  ? 137 ASN A HB2  1 
ATOM   2047 H HB3  . ASN A 1 137 ? -5.78390  -4.46750 18.49925 1.000 30.20519  ? 137 ASN A HB3  1 
ATOM   2048 H HD21 . ASN A 1 137 ? -4.66762  -3.66140 21.96418 1.000 27.43522  ? 137 ASN A HD21 1 
ATOM   2049 H HD22 . ASN A 1 137 ? -6.05776  -3.58903 21.43400 1.000 27.43522  ? 137 ASN A HD22 1 
ATOM   2050 N N    . ILE A 1 138 ? -4.83247  -0.55154 19.20866 1.000 25.90440  ? 138 ILE A N    1 
ATOM   2051 C CA   . ILE A 1 138 ? -5.02193  0.77406  19.77264 1.000 23.36576  ? 138 ILE A CA   1 
ATOM   2052 C C    . ILE A 1 138 ? -5.04592  1.81628  18.68576 1.000 27.51876  ? 138 ILE A C    1 
ATOM   2053 O O    . ILE A 1 138 ? -5.71744  2.83486  18.82944 1.000 31.00048  ? 138 ILE A O    1 
ATOM   2054 C CB   . ILE A 1 138 ? -3.90378  1.08431  20.77829 1.000 26.19856  ? 138 ILE A CB   1 
ATOM   2055 C CG1  . ILE A 1 138 ? -3.87131  0.05417  21.91440 1.000 28.08090  ? 138 ILE A CG1  1 
ATOM   2056 C CG2  . ILE A 1 138 ? -4.03434  2.49204  21.32203 1.000 26.49813  ? 138 ILE A CG2  1 
ATOM   2057 C CD1  . ILE A 1 138 ? -5.21971  -0.12183 22.69395 1.000 26.87949  ? 138 ILE A CD1  1 
ATOM   2058 H H    . ILE A 1 138 ? -4.06560  -0.90020 19.38171 1.000 30.97297  ? 138 ILE A H    1 
ATOM   2059 H HA   . ILE A 1 138 ? -5.87481  0.78609  20.23454 1.000 27.92660  ? 138 ILE A HA   1 
ATOM   2060 H HB   . ILE A 1 138 ? -3.06070  1.02322  20.30249 1.000 31.32596  ? 138 ILE A HB   1 
ATOM   2061 H HG12 . ILE A 1 138 ? -3.63894  -0.80928 21.53844 1.000 33.58477  ? 138 ILE A HG12 1 
ATOM   2062 H HG13 . ILE A 1 138 ? -3.19845  0.32810  22.55715 1.000 33.58477  ? 138 ILE A HG13 1 
ATOM   2063 H HG21 . ILE A 1 138 ? -3.50738  2.56752  22.13290 1.000 31.68544  ? 138 ILE A HG21 1 
ATOM   2064 H HG22 . ILE A 1 138 ? -3.70949  3.11890  20.65688 1.000 31.68544  ? 138 ILE A HG22 1 
ATOM   2065 H HG23 . ILE A 1 138 ? -4.96782  2.67020  21.51640 1.000 31.68544  ? 138 ILE A HG23 1 
ATOM   2066 H HD11 . ILE A 1 138 ? -5.05395  -0.63605 23.49956 1.000 32.14308  ? 138 ILE A HD11 1 
ATOM   2067 H HD12 . ILE A 1 138 ? -5.56696  0.75367  22.92595 1.000 32.14308  ? 138 ILE A HD12 1 
ATOM   2068 H HD13 . ILE A 1 138 ? -5.85324  -0.58949 22.12752 1.000 32.14308  ? 138 ILE A HD13 1 
ATOM   2069 N N    . VAL A 1 139 ? -4.32956  1.58833  17.58201 1.000 28.37060  ? 139 VAL A N    1 
ATOM   2070 C CA   . VAL A 1 139 ? -4.36559  2.53205  16.46696 1.000 31.59346  ? 139 VAL A CA   1 
ATOM   2071 C C    . VAL A 1 139 ? -5.69847  2.44330  15.74288 1.000 31.11533  ? 139 VAL A C    1 
ATOM   2072 O O    . VAL A 1 139 ? -6.22907  3.44637  15.25665 1.000 33.12296  ? 139 VAL A O    1 
ATOM   2073 C CB   . VAL A 1 139 ? -3.18918  2.27771  15.50433 1.000 33.03291  ? 139 VAL A CB   1 
ATOM   2074 C CG1  . VAL A 1 139 ? -3.29587  3.14259  14.28750 1.000 36.91610  ? 139 VAL A CG1  1 
ATOM   2075 C CG2  . VAL A 1 139 ? -1.86019  2.53590  16.21038 1.000 37.50020  ? 139 VAL A CG2  1 
ATOM   2076 H H    . VAL A 1 139 ? -3.82268  0.90501  17.45652 1.000 33.93241  ? 139 VAL A H    1 
ATOM   2077 H HA   . VAL A 1 139 ? -4.27130  3.42872  16.82473 1.000 37.79984  ? 139 VAL A HA   1 
ATOM   2078 H HB   . VAL A 1 139 ? -3.22024  1.35031  15.22172 1.000 39.52718  ? 139 VAL A HB   1 
ATOM   2079 H HG11 . VAL A 1 139 ? -2.44308  3.14399  13.82529 1.000 44.18700  ? 139 VAL A HG11 1 
ATOM   2080 H HG12 . VAL A 1 139 ? -3.98637  2.78665  13.70662 1.000 44.18700  ? 139 VAL A HG12 1 
ATOM   2081 H HG13 . VAL A 1 139 ? -3.52571  4.04461  14.56034 1.000 44.18700  ? 139 VAL A HG13 1 
ATOM   2082 H HG21 . VAL A 1 139 ? -1.13464  2.36968  15.58841 1.000 44.88792  ? 139 VAL A HG21 1 
ATOM   2083 H HG22 . VAL A 1 139 ? -1.83518  3.45850  16.50885 1.000 44.88792  ? 139 VAL A HG22 1 
ATOM   2084 H HG23 . VAL A 1 139 ? -1.78614  1.93974  16.97196 1.000 44.88792  ? 139 VAL A HG23 1 
ATOM   2085 N N    . GLU A 1 140 ? -6.24584  1.24073  15.63495 1.000 32.66474  ? 140 GLU A N    1 
ATOM   2086 C CA   . GLU A 1 140 ? -7.54958  1.07705  15.01139 1.000 31.89714  ? 140 GLU A CA   1 
ATOM   2087 C C    . GLU A 1 140 ? -8.65855  1.69044  15.85881 1.000 29.85107  ? 140 GLU A C    1 
ATOM   2088 O O    . GLU A 1 140 ? -9.66822  2.15573  15.32513 1.000 29.92253  ? 140 GLU A O    1 
ATOM   2089 C CB   . GLU A 1 140 ? -7.79176  -0.40418 14.76668 1.000 34.03932  ? 140 GLU A CB   1 
ATOM   2090 C CG   . GLU A 1 140 ? -6.82199  -1.04086 13.81048 1.000 36.26723  ? 140 GLU A CG   1 
ATOM   2091 C CD   . GLU A 1 140 ? -6.72045  -2.56247 13.98740 1.000 47.19103  ? 140 GLU A CD   1 
ATOM   2092 O OE1  . GLU A 1 140 ? -7.57498  -3.14683 14.70765 1.000 45.41196  ? 140 GLU A OE1  1 
ATOM   2093 O OE2  . GLU A 1 140 ? -5.78218  -3.16866 13.40620 1.000 35.64993  ? 140 GLU A OE2  1 
ATOM   2094 H H    . GLU A 1 140 ? -5.88715  0.50979  15.91181 1.000 39.08537  ? 140 GLU A H    1 
ATOM   2095 H HA   . GLU A 1 140 ? -7.56801  1.53193  14.15486 1.000 38.16425  ? 140 GLU A HA   1 
ATOM   2096 H HB2  . GLU A 1 140 ? -7.72082  -0.87334 15.61271 1.000 40.73487  ? 140 GLU A HB2  1 
ATOM   2097 H HB3  . GLU A 1 140 ? -8.68251  -0.51562 14.39920 1.000 40.73487  ? 140 GLU A HB3  1 
ATOM   2098 H HG2  . GLU A 1 140 ? -7.11233  -0.86385 12.90203 1.000 43.40836  ? 140 GLU A HG2  1 
ATOM   2099 H HG3  . GLU A 1 140 ? -5.94063  -0.66304 13.95665 1.000 43.40836  ? 140 GLU A HG3  1 
ATOM   2100 N N    . ALA A 1 141 ? -8.47387  1.74545  17.16700 1.000 29.23986  ? 141 ALA A N    1 
ATOM   2101 C CA   . ALA A 1 141 ? -9.43839  2.44483  18.00086 1.000 34.96135  ? 141 ALA A CA   1 
ATOM   2102 C C    . ALA A 1 141 ? -9.29931  3.95160  17.86796 1.000 31.89867  ? 141 ALA A C    1 
ATOM   2103 O O    . ALA A 1 141 ? -10.29758 4.66768  17.97643 1.000 31.94527  ? 141 ALA A O    1 
ATOM   2104 C CB   . ALA A 1 141 ? -9.28028  2.02047  19.46354 1.000 30.86844  ? 141 ALA A CB   1 
ATOM   2105 H H    . ALA A 1 141 ? -7.81278  1.39413  17.59025 1.000 34.97552  ? 141 ALA A H    1 
ATOM   2106 H HA   . ALA A 1 141 ? -10.33269 2.19912  17.71669 1.000 41.84131  ? 141 ALA A HA   1 
ATOM   2107 H HB1  . ALA A 1 141 ? -9.94014  2.48633  20.00062 1.000 36.92981  ? 141 ALA A HB1  1 
ATOM   2108 H HB2  . ALA A 1 141 ? -9.41573  1.06234  19.53079 1.000 36.92981  ? 141 ALA A HB2  1 
ATOM   2109 H HB3  . ALA A 1 141 ? -8.38712  2.25019  19.76422 1.000 36.92981  ? 141 ALA A HB3  1 
ATOM   2110 N N    . MET A 1 142 ? -8.08244  4.45658  17.65697 1.000 29.48508  ? 142 MET A N    1 
ATOM   2111 C CA   . MET A 1 142 ? -7.93848  5.87506  17.34055 1.000 35.39452  ? 142 MET A CA   1 
ATOM   2112 C C    . MET A 1 142 ? -8.64572  6.21004  16.02667 1.000 32.46931  ? 142 MET A C    1 
ATOM   2113 O O    . MET A 1 142 ? -9.23239  7.28568  15.86650 1.000 33.64342  ? 142 MET A O    1 
ATOM   2114 C CB   . MET A 1 142 ? -6.45303  6.25667  17.24973 1.000 34.94404  ? 142 MET A CB   1 
ATOM   2115 C CG   . MET A 1 142 ? -5.66061  6.14410  18.51067 1.000 43.52782  ? 142 MET A CG   1 
ATOM   2116 S SD   . MET A 1 142 ? -3.87974  6.23484  18.18113 1.000 49.96987  ? 142 MET A SD   1 
ATOM   2117 C CE   . MET A 1 142 ? -3.77096  7.71918  17.18313 1.000 39.02551  ? 142 MET A CE   1 
ATOM   2118 H H    . MET A 1 142 ? -7.34687  4.01225  17.69022 1.000 35.26978  ? 142 MET A H    1 
ATOM   2119 H HA   . MET A 1 142 ? -8.33203  6.39099  18.06154 1.000 42.36111  ? 142 MET A HA   1 
ATOM   2120 H HB2  . MET A 1 142 ? -6.03210  5.67668  16.59602 1.000 41.82054  ? 142 MET A HB2  1 
ATOM   2121 H HB3  . MET A 1 142 ? -6.39620  7.18035  16.95907 1.000 41.82054  ? 142 MET A HB3  1 
ATOM   2122 H HG2  . MET A 1 142 ? -5.89902  6.87166  19.10625 1.000 52.12107  ? 142 MET A HG2  1 
ATOM   2123 H HG3  . MET A 1 142 ? -5.85031  5.29255  18.93467 1.000 52.12107  ? 142 MET A HG3  1 
ATOM   2124 H HE1  . MET A 1 142 ? -2.83633  7.93494  17.03887 1.000 46.71830  ? 142 MET A HE1  1 
ATOM   2125 H HE2  . MET A 1 142 ? -4.20895  7.56047  16.33231 1.000 46.71830  ? 142 MET A HE2  1 
ATOM   2126 H HE3  . MET A 1 142 ? -4.21011  8.44689  17.65056 1.000 46.71830  ? 142 MET A HE3  1 
ATOM   2127 N N    . GLU A 1 143 ? -8.57435  5.30583  15.06572 1.000 30.11590  ? 143 GLU A N    1 
ATOM   2128 C CA   . GLU A 1 143 ? -9.09601  5.58827  13.74132 1.000 30.23121  ? 143 GLU A CA   1 
ATOM   2129 C C    . GLU A 1 143 ? -10.58082 5.90000  13.76742 1.000 33.09376  ? 143 GLU A C    1 
ATOM   2130 O O    . GLU A 1 143 ? -11.04986 6.73112  12.98696 1.000 35.10875  ? 143 GLU A O    1 
ATOM   2131 C CB   . GLU A 1 143 ? -8.82467  4.38784  12.84584 1.000 39.28429  ? 143 GLU A CB   1 
ATOM   2132 C CG   . GLU A 1 143 ? -8.72819  4.71687  11.37287 1.000 35.72311  ? 143 GLU A CG   1 
ATOM   2133 C CD   . GLU A 1 143 ? -8.25370  3.54050  10.53456 1.000 41.45282  ? 143 GLU A CD   1 
ATOM   2134 O OE1  . GLU A 1 143 ? -7.96363  2.46947  11.10195 1.000 41.82778  ? 143 GLU A OE1  1 
ATOM   2135 O OE2  . GLU A 1 143 ? -8.17911  3.67883  9.29470  1.000 42.78833  ? 143 GLU A OE2  1 
ATOM   2136 H H    . GLU A 1 143 ? -8.22992  4.52265  15.15282 1.000 36.02677  ? 143 GLU A H    1 
ATOM   2137 H HA   . GLU A 1 143 ? -8.64603  6.36683  13.37765 1.000 36.16514  ? 143 GLU A HA   1 
ATOM   2138 H HB2  . GLU A 1 143 ? -7.98275  3.98680  13.11273 1.000 47.02883  ? 143 GLU A HB2  1 
ATOM   2139 H HB3  . GLU A 1 143 ? -9.54635  3.74935  12.95727 1.000 47.02883  ? 143 GLU A HB3  1 
ATOM   2140 H HG2  . GLU A 1 143 ? -9.60416  4.98051  11.05027 1.000 42.75542  ? 143 GLU A HG2  1 
ATOM   2141 H HG3  . GLU A 1 143 ? -8.09763  5.44406  11.25250 1.000 42.75542  ? 143 GLU A HG3  1 
ATOM   2142 N N    . ARG A 1 144 ? -11.33114 5.26606  14.66318 1.000 33.47498  ? 144 ARG A N    1 
ATOM   2143 C CA   . ARG A 1 144 ? -12.77356 5.44217  14.66521 1.000 39.62063  ? 144 ARG A CA   1 
ATOM   2144 C C    . ARG A 1 144 ? -13.19158 6.81110  15.16477 1.000 33.69970  ? 144 ARG A C    1 
ATOM   2145 O O    . ARG A 1 144 ? -14.30793 7.23749  14.87724 1.000 40.76747  ? 144 ARG A O    1 
ATOM   2146 C CB   . ARG A 1 144 ? -13.41669 4.33498  15.49611 1.000 35.98460  ? 144 ARG A CB   1 
ATOM   2147 C CG   . ARG A 1 144 ? -12.79727 2.98104  15.21553 1.000 42.88084  ? 144 ARG A CG   1 
ATOM   2148 C CD   . ARG A 1 144 ? -13.76609 1.82078  15.36287 1.000 53.49368  ? 144 ARG A CD   1 
ATOM   2149 N NE   . ARG A 1 144 ? -13.05888 0.54340  15.44581 1.000 51.75949  ? 144 ARG A NE   1 
ATOM   2150 C CZ   . ARG A 1 144 ? -12.54701 0.05832  16.57759 1.000 61.06175  ? 144 ARG A CZ   1 
ATOM   2151 N NH1  . ARG A 1 144 ? -12.66278 0.74395  17.72723 1.000 48.78761  ? 144 ARG A NH1  1 
ATOM   2152 N NH2  . ARG A 1 144 ? -11.93091 -1.11821 16.57150 1.000 48.96656  ? 144 ARG A NH2  1 
ATOM   2153 H H    . ARG A 1 144 ? -11.03172 4.73633  15.27091 1.000 40.05766  ? 144 ARG A H    1 
ATOM   2154 H HA   . ARG A 1 144 ? -13.10898 5.36386  13.75842 1.000 47.43244  ? 144 ARG A HA   1 
ATOM   2155 H HB2  . ARG A 1 144 ? -13.29775 4.53377  16.43805 1.000 43.06920  ? 144 ARG A HB2  1 
ATOM   2156 H HB3  . ARG A 1 144 ? -14.36199 4.28601  15.28417 1.000 43.06920  ? 144 ARG A HB3  1 
ATOM   2157 H HG2  . ARG A 1 144 ? -12.46359 2.97286  14.30477 1.000 51.34470  ? 144 ARG A HG2  1 
ATOM   2158 H HG3  . ARG A 1 144 ? -12.06721 2.83653  15.83765 1.000 51.34470  ? 144 ARG A HG3  1 
ATOM   2159 H HD2  . ARG A 1 144 ? -14.28497 1.93611  16.17426 1.000 64.08011  ? 144 ARG A HD2  1 
ATOM   2160 H HD3  . ARG A 1 144 ? -14.35562 1.79431  14.59302 1.000 64.08011  ? 144 ARG A HD3  1 
ATOM   2161 H HE   . ARG A 1 144 ? -12.96831 0.08059  14.72665 1.000 61.99908  ? 144 ARG A HE   1 
ATOM   2162 H HH11 . ARG A 1 144 ? -13.06943 1.50168  17.73691 1.000 58.43282  ? 144 ARG A HH11 1 
ATOM   2163 H HH12 . ARG A 1 144 ? -12.33025 0.42509  18.45341 1.000 58.43282  ? 144 ARG A HH12 1 
ATOM   2164 H HH21 . ARG A 1 144 ? -11.59968 -1.43392 17.29966 1.000 58.64756  ? 144 ARG A HH21 1 
ATOM   2165 H HH22 . ARG A 1 144 ? -11.86317 -1.56435 15.83940 1.000 58.64756  ? 144 ARG A HH22 1 
ATOM   2166 N N    . PHE A 1 145 ? -12.33010 7.51003  15.87458 1.000 33.61690  ? 145 PHE A N    1 
ATOM   2167 C CA   . PHE A 1 145 ? -12.58350 8.89018  16.24937 1.000 37.08212  ? 145 PHE A CA   1 
ATOM   2168 C C    . PHE A 1 145 ? -12.20201 9.86835  15.16155 1.000 33.12198  ? 145 PHE A C    1 
ATOM   2169 O O    . PHE A 1 145 ? -12.20883 11.08068 15.40672 1.000 35.32919  ? 145 PHE A O    1 
ATOM   2170 C CB   . PHE A 1 145 ? -11.82785 9.24142  17.53182 1.000 36.45609  ? 145 PHE A CB   1 
ATOM   2171 C CG   . PHE A 1 145 ? -12.19965 8.37346  18.69956 1.000 37.58609  ? 145 PHE A CG   1 
ATOM   2172 C CD1  . PHE A 1 145 ? -13.45843 8.46155  19.28339 1.000 34.97647  ? 145 PHE A CD1  1 
ATOM   2173 C CD2  . PHE A 1 145 ? -11.28451 7.45671  19.21334 1.000 35.87193  ? 145 PHE A CD2  1 
ATOM   2174 C CE1  . PHE A 1 145 ? -13.78971 7.64103  20.33305 1.000 38.07659  ? 145 PHE A CE1  1 
ATOM   2175 C CE2  . PHE A 1 145 ? -11.61107 6.63966  20.28424 1.000 33.01900  ? 145 PHE A CE2  1 
ATOM   2176 C CZ   . PHE A 1 145 ? -12.85499 6.72369  20.83898 1.000 35.69699  ? 145 PHE A CZ   1 
ATOM   2177 H H    . PHE A 1 145 ? -11.57761 7.20455  16.15749 1.000 40.22796  ? 145 PHE A H    1 
ATOM   2178 H HA   . PHE A 1 145 ? -13.53239 8.98578  16.42649 1.000 44.38623  ? 145 PHE A HA   1 
ATOM   2179 H HB2  . PHE A 1 145 ? -10.87661 9.13623  17.37377 1.000 43.63500  ? 145 PHE A HB2  1 
ATOM   2180 H HB3  . PHE A 1 145 ? -12.02495 10.16089 17.76976 1.000 43.63500  ? 145 PHE A HB3  1 
ATOM   2181 H HD1  . PHE A 1 145 ? -14.07701 9.07732  18.96232 1.000 41.85945  ? 145 PHE A HD1  1 
ATOM   2182 H HD2  . PHE A 1 145 ? -10.43934 7.39194  18.83073 1.000 42.93401  ? 145 PHE A HD2  1 
ATOM   2183 H HE1  . PHE A 1 145 ? -14.63784 7.69313  20.71100 1.000 45.57959  ? 145 PHE A HE1  1 
ATOM   2184 H HE2  . PHE A 1 145 ? -10.98705 6.03862  20.62225 1.000 39.51048  ? 145 PHE A HE2  1 
ATOM   2185 H HZ   . PHE A 1 145 ? -13.08374 6.17296  21.55261 1.000 42.72408  ? 145 PHE A HZ   1 
ATOM   2186 N N    . GLY A 1 146 ? -11.89585 9.38196  13.96253 1.000 28.94634  ? 146 GLY A N    1 
ATOM   2187 C CA   . GLY A 1 146 ? -11.62110 10.24155 12.83232 1.000 32.49726  ? 146 GLY A CA   1 
ATOM   2188 C C    . GLY A 1 146 ? -12.82951 10.46504 11.93825 1.000 26.41487  ? 146 GLY A C    1 
ATOM   2189 O O    . GLY A 1 146 ? -13.96467 10.12461 12.26704 1.000 32.01547  ? 146 GLY A O    1 
ATOM   2190 H H    . GLY A 1 146 ? -11.84180 8.54277  13.78241 1.000 34.62330  ? 146 GLY A H    1 
ATOM   2191 H HA2  . GLY A 1 146 ? -11.32155 11.10546 13.15611 1.000 38.88440  ? 146 GLY A HA2  1 
ATOM   2192 H HA3  . GLY A 1 146 ? -10.91778 9.84442  12.29517 1.000 38.88440  ? 146 GLY A HA3  1 
ATOM   2193 N N    . SER A 1 147 ? -12.55710 11.03416 10.76358 1.000 27.61624  ? 147 SER A N    1 
ATOM   2194 C CA   . SER A 1 147 ? -13.61418 11.38443 9.82509  1.000 26.31350  ? 147 SER A CA   1 
ATOM   2195 C C    . SER A 1 147 ? -13.02243 11.59993 8.45133  1.000 23.14840  ? 147 SER A C    1 
ATOM   2196 O O    . SER A 1 147 ? -11.81848 11.78813 8.30873  1.000 25.29441  ? 147 SER A O    1 
ATOM   2197 C CB   . SER A 1 147 ? -14.36198 12.64554 10.26185 1.000 36.42446  ? 147 SER A CB   1 
ATOM   2198 O OG   . SER A 1 147 ? -13.51574 13.75897 10.45095 1.000 28.48646  ? 147 SER A OG   1 
ATOM   2199 H H    . SER A 1 147 ? -11.76519 11.22683 10.48906 1.000 33.02717  ? 147 SER A H    1 
ATOM   2200 H HA   . SER A 1 147 ? -14.23727 10.64241 9.77956  1.000 31.46389  ? 147 SER A HA   1 
ATOM   2201 H HB2  . SER A 1 147 ? -15.01206 12.86821 9.57723  1.000 43.59704  ? 147 SER A HB2  1 
ATOM   2202 H HB3  . SER A 1 147 ? -14.81344 12.45867 11.09980 1.000 43.59704  ? 147 SER A HB3  1 
ATOM   2203 H HG   . SER A 1 147 ? -12.98109 13.60969 11.08139 1.000 34.07143  ? 147 SER A HG   1 
ATOM   2204 N N    . ARG A 1 148 ? -13.89855 11.62366 7.44371  1.000 26.22418  ? 148 ARG A N    1 
ATOM   2205 C CA   . ARG A 1 148 ? -13.42821 11.65368 6.05960  1.000 30.97380  ? 148 ARG A CA   1 
ATOM   2206 C C    . ARG A 1 148 ? -12.59326 12.88276 5.77921  1.000 26.37873  ? 148 ARG A C    1 
ATOM   2207 O O    . ARG A 1 148 ? -11.66931 12.82307 4.96476  1.000 31.11017  ? 148 ARG A O    1 
ATOM   2208 C CB   . ARG A 1 148 ? -14.59050 11.59419 5.06522  1.000 30.00979  ? 148 ARG A CB   1 
ATOM   2209 C CG   . ARG A 1 148 ? -15.31669 10.27262 5.05032  1.000 44.59211  ? 148 ARG A CG   1 
ATOM   2210 C CD   . ARG A 1 148 ? -14.69766 9.31775  4.04249  1.000 48.83999  ? 148 ARG A CD   1 
ATOM   2211 N NE   . ARG A 1 148 ? -15.14602 9.60900  2.68333  1.000 43.13609  ? 148 ARG A NE   1 
ATOM   2212 C CZ   . ARG A 1 148 ? -14.42019 10.29030 1.81298  1.000 43.96926  ? 148 ARG A CZ   1 
ATOM   2213 N NH1  . ARG A 1 148 ? -13.22464 10.74431 2.17408  1.000 53.46393  ? 148 ARG A NH1  1 
ATOM   2214 N NH2  . ARG A 1 148 ? -14.88717 10.53447 0.60524  1.000 37.67727  ? 148 ARG A NH2  1 
ATOM   2215 H H    . ARG A 1 148 ? -14.75388 11.62299 7.53319  1.000 31.35671  ? 148 ARG A H    1 
ATOM   2216 H HA   . ARG A 1 148 ? -12.88514 10.86140 5.92445  1.000 37.05625  ? 148 ARG A HA   1 
ATOM   2217 H HB2  . ARG A 1 148 ? -15.23386 12.28203 5.29730  1.000 35.89943  ? 148 ARG A HB2  1 
ATOM   2218 H HB3  . ARG A 1 148 ? -14.24453 11.75108 4.17269  1.000 35.89943  ? 148 ARG A HB3  1 
ATOM   2219 H HG2  . ARG A 1 148 ? -15.26470 9.86602  5.92946  1.000 53.39822  ? 148 ARG A HG2  1 
ATOM   2220 H HG3  . ARG A 1 148 ? -16.24422 10.41693 4.80587  1.000 53.39822  ? 148 ARG A HG3  1 
ATOM   2221 H HD2  . ARG A 1 148 ? -13.73187 9.40366  4.07006  1.000 58.49568  ? 148 ARG A HD2  1 
ATOM   2222 H HD3  . ARG A 1 148 ? -14.95623 8.40868  4.26074  1.000 58.49568  ? 148 ARG A HD3  1 
ATOM   2223 H HE   . ARG A 1 148 ? -15.91912 9.32373  2.43729  1.000 51.65099  ? 148 ARG A HE   1 
ATOM   2224 H HH11 . ARG A 1 148 ? -12.92938 10.59416 2.96773  1.000 64.04441  ? 148 ARG A HH11 1 
ATOM   2225 H HH12 . ARG A 1 148 ? -12.74617 11.18830 1.61413  1.000 64.04441  ? 148 ARG A HH12 1 
ATOM   2226 H HH21 . ARG A 1 148 ? -15.66707 10.25037 0.38021  1.000 45.10041  ? 148 ARG A HH21 1 
ATOM   2227 H HH22 . ARG A 1 148 ? -14.41204 10.97793 0.04204  1.000 45.10041  ? 148 ARG A HH22 1 
ATOM   2228 N N    . ASN A 1 149 ? -12.85886 13.97707 6.47274  1.000 24.90207  ? 149 ASN A N    1 
ATOM   2229 C CA   . ASN A 1 149 ? -12.07589 15.18512 6.28814  1.000 30.63189  ? 149 ASN A CA   1 
ATOM   2230 C C    . ASN A 1 149 ? -10.93937 15.33447 7.28645  1.000 28.16209  ? 149 ASN A C    1 
ATOM   2231 O O    . ASN A 1 149 ? -10.11386 16.23507 7.11172  1.000 32.19587  ? 149 ASN A O    1 
ATOM   2232 C CB   . ASN A 1 149 ? -12.96934 16.42940 6.36473  1.000 34.56951  ? 149 ASN A CB   1 
ATOM   2233 C CG   . ASN A 1 149 ? -13.40042 16.76314 7.77142  1.000 38.92149  ? 149 ASN A CG   1 
ATOM   2234 O OD1  . ASN A 1 149 ? -13.62824 15.89067 8.58692  1.000 37.80311  ? 149 ASN A OD1  1 
ATOM   2235 N ND2  . ASN A 1 149 ? -13.52348 18.03637 8.05402  1.000 49.29437  ? 149 ASN A ND2  1 
ATOM   2236 H H    . ASN A 1 149 ? -13.48724 14.04476 7.05597  1.000 29.77017  ? 149 ASN A H    1 
ATOM   2237 H HA   . ASN A 1 149 ? -11.68842 15.14914 5.39962  1.000 36.64596  ? 149 ASN A HA   1 
ATOM   2238 H HB2  . ASN A 1 149 ? -12.48026 17.19014 6.01405  1.000 41.37110  ? 149 ASN A HB2  1 
ATOM   2239 H HB3  . ASN A 1 149 ? -13.76816 16.27631 5.83618  1.000 41.37110  ? 149 ASN A HB3  1 
ATOM   2240 H HD21 . ASN A 1 149 ? -13.36106 18.62820 7.45156  1.000 59.04093  ? 149 ASN A HD21 1 
ATOM   2241 H HD22 . ASN A 1 149 ? -13.76667 18.28040 8.84200  1.000 59.04093  ? 149 ASN A HD22 1 
ATOM   2242 N N    . GLY A 1 150 ? -10.87707 14.48880 8.31325  1.000 27.73273  ? 150 GLY A N    1 
ATOM   2243 C CA   . GLY A 1 150 ? -9.76884  14.44622 9.23349  1.000 25.98932  ? 150 GLY A CA   1 
ATOM   2244 C C    . GLY A 1 150 ? -10.04221 15.03929 10.59144 1.000 27.72540  ? 150 GLY A C    1 
ATOM   2245 O O    . GLY A 1 150 ? -9.27951  14.76234 11.51023 1.000 29.68053  ? 150 GLY A O    1 
ATOM   2246 H H    . GLY A 1 150 ? -11.49117 13.91466 8.49446  1.000 33.16696  ? 150 GLY A H    1 
ATOM   2247 H HA2  . GLY A 1 150 ? -9.50923  13.52065 9.36319  1.000 31.07487  ? 150 GLY A HA2  1 
ATOM   2248 H HA3  . GLY A 1 150 ? -9.02441  14.93150 8.84462  1.000 31.07487  ? 150 GLY A HA3  1 
ATOM   2249 N N    . LYS A 1 151 ? -11.09426 15.84735 10.75454 1.000 39.76017  ? 151 LYS A N    1 
ATOM   2250 C CA   . LYS A 1 151 ? -11.42783 16.38516 12.07087 1.000 34.21289  ? 151 LYS A CA   1 
ATOM   2251 C C    . LYS A 1 151 ? -11.83684 15.25668 13.00276 1.000 36.69691  ? 151 LYS A C    1 
ATOM   2252 O O    . LYS A 1 151 ? -12.69345 14.43707 12.66763 1.000 37.32179  ? 151 LYS A O    1 
ATOM   2253 C CB   . LYS A 1 151 ? -12.55810 17.40828 11.99054 1.000 40.23483  ? 151 LYS A CB   1 
ATOM   2254 C CG   . LYS A 1 151 ? -12.23888 18.62895 11.14221 1.000 71.47869  ? 151 LYS A CG   1 
ATOM   2255 C CD   . LYS A 1 151 ? -13.38303 19.66634 11.19516 1.000 83.68040  ? 151 LYS A CD   1 
ATOM   2256 C CE   . LYS A 1 151 ? -13.20268 20.76505 10.14091 1.000 95.33279  ? 151 LYS A CE   1 
ATOM   2257 N NZ   . LYS A 1 151 ? -11.88233 21.45763 10.26644 1.000 97.94683  ? 151 LYS A NZ   1 
ATOM   2258 H H    . LYS A 1 151 ? -11.62385 16.09542 10.12399 1.000 47.59989  ? 151 LYS A H    1 
ATOM   2259 H HA   . LYS A 1 151 ? -10.64422 16.83444 12.42442 1.000 40.94315  ? 151 LYS A HA   1 
ATOM   2260 H HB2  . LYS A 1 151 ? -13.33778 16.97863 11.60531 1.000 48.16948  ? 151 LYS A HB2  1 
ATOM   2261 H HB3  . LYS A 1 151 ? -12.75932 17.71834 12.88735 1.000 48.16948  ? 151 LYS A HB3  1 
ATOM   2262 H HG2  . LYS A 1 151 ? -11.43012 19.04906 11.47432 1.000 85.66212  ? 151 LYS A HG2  1 
ATOM   2263 H HG3  . LYS A 1 151 ? -12.11625 18.35637 10.21941 1.000 85.66212  ? 151 LYS A HG3  1 
ATOM   2264 H HD2  . LYS A 1 151 ? -14.22795 19.22029 11.02767 1.000 100.30416 ? 151 LYS A HD2  1 
ATOM   2265 H HD3  . LYS A 1 151 ? -13.39631 20.08430 12.07039 1.000 100.30416 ? 151 LYS A HD3  1 
ATOM   2266 H HE2  . LYS A 1 151 ? -13.25343 20.36941 9.25672  1.000 114.28703 ? 151 LYS A HE2  1 
ATOM   2267 H HE3  . LYS A 1 151 ? -13.90284 21.42770 10.24854 1.000 114.28703 ? 151 LYS A HE3  1 
ATOM   2268 H HZ1  . LYS A 1 151 ? -11.81506 22.09832 9.65236  1.000 117.42388 ? 151 LYS A HZ1  1 
ATOM   2269 H HZ2  . LYS A 1 151 ? -11.80575 21.82281 11.07445 1.000 117.42388 ? 151 LYS A HZ2  1 
ATOM   2270 H HZ3  . LYS A 1 151 ? -11.22033 20.87446 10.14912 1.000 117.42388 ? 151 LYS A HZ3  1 
ATOM   2271 N N    . THR A 1 152 ? -11.22677 15.21758 14.17468 1.000 39.56051  ? 152 THR A N    1 
ATOM   2272 C CA   . THR A 1 152 ? -11.50464 14.16435 15.13198 1.000 38.06536  ? 152 THR A CA   1 
ATOM   2273 C C    . THR A 1 152 ? -12.71468 14.52576 15.97398 1.000 36.10450  ? 152 THR A C    1 
ATOM   2274 O O    . THR A 1 152 ? -12.87475 15.67685 16.39370 1.000 36.82842  ? 152 THR A O    1 
ATOM   2275 C CB   . THR A 1 152 ? -10.28968 13.94152 16.03352 1.000 46.07406  ? 152 THR A CB   1 
ATOM   2276 O OG1  . THR A 1 152 ? -9.93385  15.17218 16.68316 1.000 51.39339  ? 152 THR A OG1  1 
ATOM   2277 C CG2  . THR A 1 152 ? -9.10363  13.44719 15.22277 1.000 40.70927  ? 152 THR A CG2  1 
ATOM   2278 H H    . THR A 1 152 ? -10.64483 15.79226 14.44057 1.000 47.36030  ? 152 THR A H    1 
ATOM   2279 H HA   . THR A 1 152 ? -11.69463 13.33654 14.66344 1.000 45.56612  ? 152 THR A HA   1 
ATOM   2280 H HB   . THR A 1 152 ? -10.50728 13.27268 16.70150 1.000 55.17656  ? 152 THR A HB   1 
ATOM   2281 H HG1  . THR A 1 152 ? -10.59476 15.47733 17.10231 1.000 61.55975  ? 152 THR A HG1  1 
ATOM   2282 H HG21 . THR A 1 152 ? -8.34388  13.29384 15.80601 1.000 48.73881  ? 152 THR A HG21 1 
ATOM   2283 H HG22 . THR A 1 152 ? -9.33023  12.61655 14.77601 1.000 48.73881  ? 152 THR A HG22 1 
ATOM   2284 H HG23 . THR A 1 152 ? -8.85982  14.10735 14.55520 1.000 48.73881  ? 152 THR A HG23 1 
ATOM   2285 N N    . SER A 1 153 ? -13.55057 13.51982 16.24599 1.000 39.91804  ? 153 SER A N    1 
ATOM   2286 C CA   . SER A 1 153 ? -14.71587 13.72344 17.09744 1.000 35.95784  ? 153 SER A CA   1 
ATOM   2287 C C    . SER A 1 153 ? -14.35272 13.91168 18.55886 1.000 34.83146  ? 153 SER A C    1 
ATOM   2288 O O    . SER A 1 153 ? -15.11789 14.53358 19.29288 1.000 37.47524  ? 153 SER A O    1 
ATOM   2289 C CB   . SER A 1 153 ? -15.66927 12.54789 16.98101 1.000 41.50187  ? 153 SER A CB   1 
ATOM   2290 O OG   . SER A 1 153 ? -15.02815 11.34550 17.32500 1.000 41.80518  ? 153 SER A OG   1 
ATOM   2291 H H    . SER A 1 153 ? -13.46309 12.71694 15.95046 1.000 47.78934  ? 153 SER A H    1 
ATOM   2292 H HA   . SER A 1 153 ? -15.16832 14.52389 16.78846 1.000 43.03710  ? 153 SER A HA   1 
ATOM   2293 H HB2  . SER A 1 153 ? -16.41839 12.68873 17.58091 1.000 49.68993  ? 153 SER A HB2  1 
ATOM   2294 H HB3  . SER A 1 153 ? -15.98425 12.48671 16.06561 1.000 49.68993  ? 153 SER A HB3  1 
ATOM   2295 H HG   . SER A 1 153 ? -15.55456 10.69924 17.22094 1.000 50.05390  ? 153 SER A HG   1 
ATOM   2296 N N    . LYS A 1 154 ? -13.20723 13.40280 18.99077 1.000 45.18499  ? 154 LYS A N    1 
ATOM   2297 C CA   . LYS A 1 154 ? -12.70947 13.59496 20.34158 1.000 36.63291  ? 154 LYS A CA   1 
ATOM   2298 C C    . LYS A 1 154 ? -11.22154 13.89480 20.26942 1.000 32.47913  ? 154 LYS A C    1 
ATOM   2299 O O    . LYS A 1 154 ? -10.56026 13.57906 19.28194 1.000 34.66623  ? 154 LYS A O    1 
ATOM   2300 C CB   . LYS A 1 154 ? -12.97522 12.35056 21.18169 1.000 39.62763  ? 154 LYS A CB   1 
ATOM   2301 C CG   . LYS A 1 154 ? -14.44372 12.08640 21.41981 1.000 51.61989  ? 154 LYS A CG   1 
ATOM   2302 C CD   . LYS A 1 154 ? -14.65052 10.79551 22.19241 1.000 54.14999  ? 154 LYS A CD   1 
ATOM   2303 C CE   . LYS A 1 154 ? -16.12494 10.54190 22.48422 1.000 67.46987  ? 154 LYS A CE   1 
ATOM   2304 N NZ   . LYS A 1 154 ? -16.35020 9.17226  23.06381 1.000 67.72883  ? 154 LYS A NZ   1 
ATOM   2305 H H    . LYS A 1 154 ? -12.68344 12.92646 18.50256 1.000 54.10967  ? 154 LYS A H    1 
ATOM   2306 H HA   . LYS A 1 154 ? -13.14168 14.35163 20.76767 1.000 43.84717  ? 154 LYS A HA   1 
ATOM   2307 H HB2  . LYS A 1 154 ? -12.60490 11.57948 20.72431 1.000 47.44085  ? 154 LYS A HB2  1 
ATOM   2308 H HB3  . LYS A 1 154 ? -12.54893 12.45989 22.04611 1.000 47.44085  ? 154 LYS A HB3  1 
ATOM   2309 H HG2  . LYS A 1 154 ? -14.82328 12.81561 21.93468 1.000 61.83155  ? 154 LYS A HG2  1 
ATOM   2310 H HG3  . LYS A 1 154 ? -14.90001 12.00952 20.56729 1.000 61.83155  ? 154 LYS A HG3  1 
ATOM   2311 H HD2  . LYS A 1 154 ? -14.31193 10.05170 21.66991 1.000 64.86767  ? 154 LYS A HD2  1 
ATOM   2312 H HD3  . LYS A 1 154 ? -14.17831 10.84911 23.03801 1.000 64.86767  ? 154 LYS A HD3  1 
ATOM   2313 H HE2  . LYS A 1 154 ? -16.44246 11.19864 23.12357 1.000 80.85153  ? 154 LYS A HE2  1 
ATOM   2314 H HE3  . LYS A 1 154 ? -16.63099 10.61010 21.65951 1.000 80.85153  ? 154 LYS A HE3  1 
ATOM   2315 H HZ1  . LYS A 1 154 ? -17.21561 9.05197  23.23320 1.000 81.16228  ? 154 LYS A HZ1  1 
ATOM   2316 H HZ2  . LYS A 1 154 ? -16.07930 8.54983  22.48823 1.000 81.16228  ? 154 LYS A HZ2  1 
ATOM   2317 H HZ3  . LYS A 1 154 ? -15.89244 9.08347  23.82189 1.000 81.16228  ? 154 LYS A HZ3  1 
ATOM   2318 N N    . LYS A 1 155 ? -10.69462 14.48281 21.34070 1.000 34.38024  ? 155 LYS A N    1 
ATOM   2319 C CA   . LYS A 1 155 ? -9.28748  14.87972 21.40896 1.000 38.94543  ? 155 LYS A CA   1 
ATOM   2320 C C    . LYS A 1 155 ? -8.40980  13.64479 21.62845 1.000 34.19836  ? 155 LYS A C    1 
ATOM   2321 O O    . LYS A 1 155 ? -8.43434  13.03026 22.69951 1.000 32.60763  ? 155 LYS A O    1 
ATOM   2322 C CB   . LYS A 1 155 ? -9.09064  15.90825 22.52287 1.000 37.86500  ? 155 LYS A CB   1 
ATOM   2323 C CG   . LYS A 1 155 ? -7.82670  16.69467 22.45365 1.000 42.24972  ? 155 LYS A CG   1 
ATOM   2324 C CD   . LYS A 1 155 ? -7.83064  17.61088 21.24558 1.000 55.15212  ? 155 LYS A CD   1 
ATOM   2325 C CE   . LYS A 1 155 ? -6.66073  18.58587 21.27032 1.000 63.49189  ? 155 LYS A CE   1 
ATOM   2326 N NZ   . LYS A 1 155 ? -6.75471  19.55488 20.13260 1.000 74.35963  ? 155 LYS A NZ   1 
ATOM   2327 H H    . LYS A 1 155 ? -11.13800 14.66662 22.05430 1.000 41.14397  ? 155 LYS A H    1 
ATOM   2328 H HA   . LYS A 1 155 ? -9.02595  15.27873 20.56439 1.000 46.62221  ? 155 LYS A HA   1 
ATOM   2329 H HB2  . LYS A 1 155 ? -9.82595  16.53993 22.48825 1.000 45.32569  ? 155 LYS A HB2  1 
ATOM   2330 H HB3  . LYS A 1 155 ? -9.09403  15.44147 23.37317 1.000 45.32569  ? 155 LYS A HB3  1 
ATOM   2331 H HG2  . LYS A 1 155 ? -7.73874  17.23812 23.25228 1.000 50.58735  ? 155 LYS A HG2  1 
ATOM   2332 H HG3  . LYS A 1 155 ? -7.07207  16.08978 22.37919 1.000 50.58735  ? 155 LYS A HG3  1 
ATOM   2333 H HD2  . LYS A 1 155 ? -7.76355  17.07681 20.43864 1.000 66.07023  ? 155 LYS A HD2  1 
ATOM   2334 H HD3  . LYS A 1 155 ? -8.65348  18.12443 21.23607 1.000 66.07023  ? 155 LYS A HD3  1 
ATOM   2335 H HE2  . LYS A 1 155 ? -6.67217  19.08484 22.10207 1.000 76.07795  ? 155 LYS A HE2  1 
ATOM   2336 H HE3  . LYS A 1 155 ? -5.82800  18.09505 21.18932 1.000 76.07795  ? 155 LYS A HE3  1 
ATOM   2337 H HZ1  . LYS A 1 155 ? -6.72090  19.11861 19.35760 1.000 89.11924  ? 155 LYS A HZ1  1 
ATOM   2338 H HZ2  . LYS A 1 155 ? -7.52168  20.00411 20.17794 1.000 89.11924  ? 155 LYS A HZ2  1 
ATOM   2339 H HZ3  . LYS A 1 155 ? -6.07888  20.13286 20.16841 1.000 89.11924  ? 155 LYS A HZ3  1 
ATOM   2340 N N    . ILE A 1 156 ? -7.63417  13.27731 20.61262 1.000 35.23326  ? 156 ILE A N    1 
ATOM   2341 C CA   . ILE A 1 156 ? -6.70113  12.15519 20.68049 1.000 36.00215  ? 156 ILE A CA   1 
ATOM   2342 C C    . ILE A 1 156 ? -5.32753  12.71198 21.02551 1.000 30.54694  ? 156 ILE A C    1 
ATOM   2343 O O    . ILE A 1 156 ? -4.72174  13.44999 20.24110 1.000 31.37148  ? 156 ILE A O    1 
ATOM   2344 C CB   . ILE A 1 156 ? -6.67339  11.37462 19.35971 1.000 37.62425  ? 156 ILE A CB   1 
ATOM   2345 C CG1  . ILE A 1 156 ? -8.10723  11.04200 18.92867 1.000 36.91577  ? 156 ILE A CG1  1 
ATOM   2346 C CG2  . ILE A 1 156 ? -5.82364  10.14680 19.48930 1.000 26.14203  ? 156 ILE A CG2  1 
ATOM   2347 C CD1  . ILE A 1 156 ? -8.75722  10.08860 19.81982 1.000 41.27174  ? 156 ILE A CD1  1 
ATOM   2348 H H    . ILE A 1 156 ? -7.63014  13.67473 19.84997 1.000 42.16759  ? 156 ILE A H    1 
ATOM   2349 H HA   . ILE A 1 156 ? -6.97118  11.55322 21.39155 1.000 43.09027  ? 156 ILE A HA   1 
ATOM   2350 H HB   . ILE A 1 156 ? -6.27274  11.92536 18.66900 1.000 45.03679  ? 156 ILE A HB   1 
ATOM   2351 H HG12 . ILE A 1 156 ? -8.63316  11.85704 18.92574 1.000 44.18661  ? 156 ILE A HG12 1 
ATOM   2352 H HG13 . ILE A 1 156 ? -8.08801  10.65637 18.03883 1.000 44.18661  ? 156 ILE A HG13 1 
ATOM   2353 H HG21 . ILE A 1 156 ? -5.94467  9.59436  18.70122 1.000 31.25812  ? 156 ILE A HG21 1 
ATOM   2354 H HG22 . ILE A 1 156 ? -4.89409  10.41284 19.56719 1.000 31.25812  ? 156 ILE A HG22 1 
ATOM   2355 H HG23 . ILE A 1 156 ? -6.09502  9.65708  20.28140 1.000 31.25812  ? 156 ILE A HG23 1 
ATOM   2356 H HD11 . ILE A 1 156 ? -9.68312  9.98470  19.54999 1.000 49.41377  ? 156 ILE A HD11 1 
ATOM   2357 H HD12 . ILE A 1 156 ? -8.29764  9.23647  19.76004 1.000 49.41377  ? 156 ILE A HD12 1 
ATOM   2358 H HD13 . ILE A 1 156 ? -8.71327  10.42508 20.72853 1.000 49.41377  ? 156 ILE A HD13 1 
ATOM   2359 N N    . THR A 1 157 ? -4.82961  12.37788 22.20093 1.000 26.69496  ? 157 THR A N    1 
ATOM   2360 C CA   . THR A 1 157 ? -3.57197  12.93835 22.65055 1.000 33.66298  ? 157 THR A CA   1 
ATOM   2361 C C    . THR A 1 157 ? -2.56767  11.85046 23.01921 1.000 30.49407  ? 157 THR A C    1 
ATOM   2362 O O    . THR A 1 157 ? -2.92364  10.70147 23.30673 1.000 28.06644  ? 157 THR A O    1 
ATOM   2363 C CB   . THR A 1 157 ? -3.76491  13.85162 23.86999 1.000 33.08268  ? 157 THR A CB   1 
ATOM   2364 O OG1  . THR A 1 157 ? -4.55153  13.17047 24.85922 1.000 32.28152  ? 157 THR A OG1  1 
ATOM   2365 C CG2  . THR A 1 157 ? -4.42486  15.15436 23.50275 1.000 48.30647  ? 157 THR A CG2  1 
ATOM   2366 H H    . THR A 1 157 ? -5.20013  11.83162 22.75221 1.000 31.92164  ? 157 THR A H    1 
ATOM   2367 H HA   . THR A 1 157 ? -3.20367  13.45062 21.91378 1.000 40.28326  ? 157 THR A HA   1 
ATOM   2368 H HB   . THR A 1 157 ? -2.89328  14.06890 24.23599 1.000 39.58690  ? 157 THR A HB   1 
ATOM   2369 H HG1  . THR A 1 157 ? -4.58974  13.62934 25.56177 1.000 38.62551  ? 157 THR A HG1  1 
ATOM   2370 H HG21 . THR A 1 157 ? -4.52388  15.71006 24.29160 1.000 57.85545  ? 157 THR A HG21 1 
ATOM   2371 H HG22 . THR A 1 157 ? -3.88506  15.62735 22.85022 1.000 57.85545  ? 157 THR A HG22 1 
ATOM   2372 H HG23 . THR A 1 157 ? -5.30185  14.98671 23.12369 1.000 57.85545  ? 157 THR A HG23 1 
ATOM   2373 N N    . ILE A 1 158 ? -1.29873  12.24662 23.01909 1.000 27.43799  ? 158 ILE A N    1 
ATOM   2374 C CA   . ILE A 1 158 ? -0.20868  11.39469 23.47951 1.000 29.83218  ? 158 ILE A CA   1 
ATOM   2375 C C    . ILE A 1 158 ? -0.01242  11.77959 24.94317 1.000 24.84499  ? 158 ILE A C    1 
ATOM   2376 O O    . ILE A 1 158 ? 0.66760   12.73083 25.27990 1.000 27.76459  ? 158 ILE A O    1 
ATOM   2377 C CB   . ILE A 1 158 ? 1.05951   11.56412 22.63882 1.000 30.36154  ? 158 ILE A CB   1 
ATOM   2378 C CG1  . ILE A 1 158 ? 0.80064   11.16704 21.18310 1.000 29.23207  ? 158 ILE A CG1  1 
ATOM   2379 C CG2  . ILE A 1 158 ? 2.21854   10.75150 23.21009 1.000 29.04538  ? 158 ILE A CG2  1 
ATOM   2380 C CD1  . ILE A 1 158 ? 1.98389   11.46419 20.26480 1.000 34.85850  ? 158 ILE A CD1  1 
ATOM   2381 H H    . ILE A 1 158 ? -1.03848  13.02129 22.75122 1.000 32.81327  ? 158 ILE A H    1 
ATOM   2382 H HA   . ILE A 1 158 ? -0.46368  10.46046 23.42389 1.000 35.68630  ? 158 ILE A HA   1 
ATOM   2383 H HB   . ILE A 1 158 ? 1.30398   12.50235 22.66829 1.000 36.32153  ? 158 ILE A HB   1 
ATOM   2384 H HG12 . ILE A 1 158 ? 0.62277   10.21432 21.14344 1.000 34.96617  ? 158 ILE A HG12 1 
ATOM   2385 H HG13 . ILE A 1 158 ? 0.03415   11.66165 20.85332 1.000 34.96617  ? 158 ILE A HG13 1 
ATOM   2386 H HG21 . ILE A 1 158 ? 2.99106   10.85409 22.63251 1.000 34.74214  ? 158 ILE A HG21 1 
ATOM   2387 H HG22 . ILE A 1 158 ? 2.42500   11.07821 24.09977 1.000 34.74214  ? 158 ILE A HG22 1 
ATOM   2388 H HG23 . ILE A 1 158 ? 1.95893   9.81786  23.25255 1.000 34.74214  ? 158 ILE A HG23 1 
ATOM   2389 H HD11 . ILE A 1 158 ? 1.71886   11.30241 19.34584 1.000 41.71789  ? 158 ILE A HD11 1 
ATOM   2390 H HD12 . ILE A 1 158 ? 2.24435   12.39199 20.37550 1.000 41.71789  ? 158 ILE A HD12 1 
ATOM   2391 H HD13 . ILE A 1 158 ? 2.72260   10.88254 20.50330 1.000 41.71789  ? 158 ILE A HD13 1 
ATOM   2392 N N    . ALA A 1 159 ? -0.61620  11.01073 25.82112 1.000 28.70244  ? 159 ALA A N    1 
ATOM   2393 C CA   . ALA A 1 159 ? -0.54757  11.34191 27.23694 1.000 29.81859  ? 159 ALA A CA   1 
ATOM   2394 C C    . ALA A 1 159 ? 0.84217   11.10334 27.78099 1.000 25.54724  ? 159 ALA A C    1 
ATOM   2395 O O    . ALA A 1 159 ? 1.27248   11.80115 28.69668 1.000 32.40129  ? 159 ALA A O    1 
ATOM   2396 C CB   . ALA A 1 159 ? -1.56415  10.51603 28.03676 1.000 29.21207  ? 159 ALA A CB   1 
ATOM   2397 H H    . ALA A 1 159 ? -1.06626  10.30222 25.63391 1.000 34.33062  ? 159 ALA A H    1 
ATOM   2398 H HA   . ALA A 1 159 ? -0.77491  12.27853 27.34630 1.000 35.67000  ? 159 ALA A HA   1 
ATOM   2399 H HB1  . ALA A 1 159 ? -1.49335  10.75091 28.97523 1.000 34.94217  ? 159 ALA A HB1  1 
ATOM   2400 H HB2  . ALA A 1 159 ? -2.45671  10.71399 27.71266 1.000 34.94217  ? 159 ALA A HB2  1 
ATOM   2401 H HB3  . ALA A 1 159 ? -1.36995  9.57335  27.91615 1.000 34.94217  ? 159 ALA A HB3  1 
ATOM   2402 N N    . ASP A 1 160 ? 1.55349   10.13153 27.22199 1.000 30.46363  ? 160 ASP A N    1 
ATOM   2403 C CA   . ASP A 1 160 ? 2.92105   9.82629  27.61231 1.000 32.31651  ? 160 ASP A CA   1 
ATOM   2404 C C    . ASP A 1 160 ? 3.63568   9.14418  26.44959 1.000 26.83145  ? 160 ASP A C    1 
ATOM   2405 O O    . ASP A 1 160 ? 3.04221   8.37356  25.69044 1.000 27.63059  ? 160 ASP A O    1 
ATOM   2406 C CB   . ASP A 1 160 ? 2.96778   8.93630  28.86754 1.000 34.83261  ? 160 ASP A CB   1 
ATOM   2407 C CG   . ASP A 1 160 ? 4.22668   9.16259  29.70238 1.000 43.89789  ? 160 ASP A CG   1 
ATOM   2408 O OD1  . ASP A 1 160 ? 5.21541   9.72859  29.16867 1.000 37.10617  ? 160 ASP A OD1  1 
ATOM   2409 O OD2  . ASP A 1 160 ? 4.21772   8.79399  30.90299 1.000 52.36513  ? 160 ASP A OD2  1 
ATOM   2410 H H    . ASP A 1 160 ? 1.25734   9.62069  26.59674 1.000 36.44404  ? 160 ASP A H    1 
ATOM   2411 H HA   . ASP A 1 160 ? 3.38714   10.65422 27.80775 1.000 38.66750  ? 160 ASP A HA   1 
ATOM   2412 H HB2  . ASP A 1 160 ? 2.19850   9.13380  29.42441 1.000 41.68682  ? 160 ASP A HB2  1 
ATOM   2413 H HB3  . ASP A 1 160 ? 2.95062   8.00519  28.59618 1.000 41.68682  ? 160 ASP A HB3  1 
ATOM   2414 N N    . CYS A 1 161 ? 4.92504   9.42861  26.33345 1.000 26.71831  ? 161 CYS A N    1 
ATOM   2415 C CA   . CYS A 1 161 ? 5.74538   8.76319  25.34824 1.000 24.51109  ? 161 CYS A CA   1 
ATOM   2416 C C    . CYS A 1 161 ? 7.12658   8.54651  25.92815 1.000 24.67247  ? 161 CYS A C    1 
ATOM   2417 O O    . CYS A 1 161 ? 7.53233   9.22685  26.86669 1.000 27.58470  ? 161 CYS A O    1 
ATOM   2418 C CB   . CYS A 1 161 ? 5.76720   9.57165  24.07174 1.000 23.51890  ? 161 CYS A CB   1 
ATOM   2419 S SG   . CYS A 1 161 ? 5.92591   11.20203 24.27137 1.000 19.11056  ? 161 CYS A SG   1 
ATOM   2420 H H    . CYS A 1 161 ? 5.34375   10.00425 26.81608 1.000 31.94965  ? 161 CYS A H    1 
ATOM   2421 H HA   . CYS A 1 161 ? 5.40127   7.88129  25.13671 1.000 29.30099  ? 161 CYS A HA   1 
ATOM   2422 H HB2  . CYS A 1 161 ? 6.51587   9.27173  23.53281 1.000 28.11037  ? 161 CYS A HB2  1 
ATOM   2423 H HB3  . CYS A 1 161 ? 4.93478   9.41764  23.59820 1.000 28.11037  ? 161 CYS A HB3  1 
ATOM   2424 H HG   . CYS A 1 161 ? 6.92264   11.42322 24.90194 1.000 22.82035  ? 161 CYS A HG   1 
ATOM   2425 N N    . GLY A 1 162 ? 7.85380   7.60838  25.32760 1.000 32.68441  ? 162 GLY A N    1 
ATOM   2426 C CA   . GLY A 1 162 ? 9.23122   7.36241  25.70470 1.000 26.12067  ? 162 GLY A CA   1 
ATOM   2427 C C    . GLY A 1 162 ? 9.79443   6.18602  24.93992 1.000 27.42483  ? 162 GLY A C    1 
ATOM   2428 O O    . GLY A 1 162 ? 9.19824   5.70236  23.97817 1.000 27.18579  ? 162 GLY A O    1 
ATOM   2429 H H    . GLY A 1 162 ? 7.56760   7.10002  24.69574 1.000 39.10898  ? 162 GLY A H    1 
ATOM   2430 H HA2  . GLY A 1 162 ? 9.76893   8.14634  25.51180 1.000 31.23249  ? 162 GLY A HA2  1 
ATOM   2431 H HA3  . GLY A 1 162 ? 9.28191   7.17052  26.65418 1.000 31.23249  ? 162 GLY A HA3  1 
ATOM   2432 N N    . GLN A 1 163 ? 10.94260  5.71554  25.40786 1.000 30.87554  ? 163 GLN A N    1 
ATOM   2433 C CA   . GLN A 1 163 ? 11.67753  4.64086  24.75932 1.000 32.04022  ? 163 GLN A CA   1 
ATOM   2434 C C    . GLN A 1 163 ? 11.62273  3.38013  25.61853 1.000 30.05004  ? 163 GLN A C    1 
ATOM   2435 O O    . GLN A 1 163 ? 11.57014  3.44170  26.84513 1.000 33.45453  ? 163 GLN A O    1 
ATOM   2436 C CB   . GLN A 1 163 ? 13.13497  5.07646  24.48467 1.000 30.92916  ? 163 GLN A CB   1 
ATOM   2437 C CG   . GLN A 1 163 ? 13.96007  4.06757  23.66378 1.000 35.96830  ? 163 GLN A CG   1 
ATOM   2438 C CD   . GLN A 1 163 ? 15.29954  4.59474  23.27439 1.000 30.52103  ? 163 GLN A CD   1 
ATOM   2439 O OE1  . GLN A 1 163 ? 15.66806  5.70080  23.64726 1.000 35.66061  ? 163 GLN A OE1  1 
ATOM   2440 N NE2  . GLN A 1 163 ? 16.04381  3.81002  22.52282 1.000 30.19413  ? 163 GLN A NE2  1 
ATOM   2441 H H    . GLN A 1 163 ? 11.32558  6.01132  26.11880 1.000 36.93834  ? 163 GLN A H    1 
ATOM   2442 H HA   . GLN A 1 163 ? 11.27490  4.41760  23.90554 1.000 38.33595  ? 163 GLN A HA   1 
ATOM   2443 H HB2  . GLN A 1 163 ? 13.11992  5.91198  23.99215 1.000 37.00268  ? 163 GLN A HB2  1 
ATOM   2444 H HB3  . GLN A 1 163 ? 13.58557  5.20047  25.33466 1.000 37.00268  ? 163 GLN A HB3  1 
ATOM   2445 H HG2  . GLN A 1 163 ? 14.09602  3.26618  24.19311 1.000 43.04964  ? 163 GLN A HG2  1 
ATOM   2446 H HG3  . GLN A 1 163 ? 13.47603  3.85061  22.85167 1.000 43.04964  ? 163 GLN A HG3  1 
ATOM   2447 H HE21 . GLN A 1 163 ? 15.74909  3.03853  22.28295 1.000 36.12065  ? 163 GLN A HE21 1 
ATOM   2448 H HE22 . GLN A 1 163 ? 16.82453  4.06911  22.27192 1.000 36.12065  ? 163 GLN A HE22 1 
ATOM   2449 N N    . LEU A 1 164 ? 11.63578  2.23257  24.96157 1.000 35.38936  ? 164 LEU A N    1 
ATOM   2450 C CA   . LEU A 1 164 ? 11.71217  0.95181  25.64334 1.000 36.46499  ? 164 LEU A CA   1 
ATOM   2451 C C    . LEU A 1 164 ? 13.04261  0.23319  25.37426 1.000 33.75287  ? 164 LEU A C    1 
ATOM   2452 O O    . LEU A 1 164 ? 13.49230  -0.61541 26.16276 1.000 34.02334  ? 164 LEU A O    1 
ATOM   2453 C CB   . LEU A 1 164 ? 10.55808  0.06632  25.19078 1.000 39.42794  ? 164 LEU A CB   1 
ATOM   2454 C CG   . LEU A 1 164 ? 9.16024   0.65664  25.33457 1.000 43.18988  ? 164 LEU A CG   1 
ATOM   2455 C CD1  . LEU A 1 164 ? 8.09124   -0.29084 24.77560 1.000 49.57730  ? 164 LEU A CD1  1 
ATOM   2456 C CD2  . LEU A 1 164 ? 8.89073   0.98402  26.78123 1.000 59.46503  ? 164 LEU A CD2  1 
ATOM   2457 H H    . LEU A 1 164 ? 11.60074  2.16683  24.10480 1.000 42.35491  ? 164 LEU A H    1 
ATOM   2458 H HA   . LEU A 1 164 ? 11.65163  1.10342  26.59950 1.000 43.64568  ? 164 LEU A HA   1 
ATOM   2459 H HB2  . LEU A 1 164 ? 10.68652  -0.14000 24.25172 1.000 47.20121  ? 164 LEU A HB2  1 
ATOM   2460 H HB3  . LEU A 1 164 ? 10.57986  -0.74914 25.71561 1.000 47.20121  ? 164 LEU A HB3  1 
ATOM   2461 H HG   . LEU A 1 164 ? 9.10772   1.47563  24.81746 1.000 51.71554  ? 164 LEU A HG   1 
ATOM   2462 H HD11 . LEU A 1 164 ? 7.21720   0.11136  24.89879 1.000 59.38044  ? 164 LEU A HD11 1 
ATOM   2463 H HD12 . LEU A 1 164 ? 8.25918   -0.43437 23.83109 1.000 59.38044  ? 164 LEU A HD12 1 
ATOM   2464 H HD13 . LEU A 1 164 ? 8.13711   -1.13472 25.25170 1.000 59.38044  ? 164 LEU A HD13 1 
ATOM   2465 H HD21 . LEU A 1 164 ? 7.95280   1.20865  26.88475 1.000 71.24573  ? 164 LEU A HD21 1 
ATOM   2466 H HD22 . LEU A 1 164 ? 9.10780   0.21112  27.32566 1.000 71.24573  ? 164 LEU A HD22 1 
ATOM   2467 H HD23 . LEU A 1 164 ? 9.44223   1.73802  27.04243 1.000 71.24573  ? 164 LEU A HD23 1 
HETATM 2468 O O    . HOH B 2 .   ? 5.37884   8.05916  -5.25017 1.000 15.72797  ? 201 HOH A O    1 
HETATM 2469 O O    . HOH B 2 .   ? 12.33782  26.51229 7.29062  1.000 27.75902  ? 202 HOH A O    1 
HETATM 2470 O O    . HOH B 2 .   ? 7.53885   15.79863 9.02131  1.000 11.87588  ? 203 HOH A O    1 
HETATM 2471 O O    . HOH B 2 .   ? 10.67018  16.31646 2.74365  1.000 14.19374  ? 204 HOH A O    1 
HETATM 2472 O O    . HOH B 2 .   ? -3.13133  13.72881 26.53940 1.000 15.28051  ? 205 HOH A O    1 
HETATM 2473 O O    . HOH B 2 .   ? 11.72429  12.57314 12.30830 1.000 19.44088  ? 206 HOH A O    1 
HETATM 2474 O O    . HOH B 2 .   ? 9.35028   26.79400 7.96419  1.000 9.79980   ? 207 HOH A O    1 
HETATM 2475 O O    . HOH B 2 .   ? 17.29530  21.00650 18.27550 1.000 26.06731  ? 208 HOH A O    1 
HETATM 2476 O O    . HOH B 2 .   ? 14.00600  12.17298 6.52614  1.000 11.98068  ? 209 HOH A O    1 
HETATM 2477 O O    . HOH B 2 .   ? 16.33295  6.62023  25.95098 1.000 25.96735  ? 210 HOH A O    1 
HETATM 2478 O O    . HOH B 2 .   ? -3.27204  5.17245  27.41407 1.000 16.32303  ? 211 HOH A O    1 
HETATM 2479 O O    . HOH B 2 .   ? 1.24107   11.83686 -4.16941 1.000 27.50004  ? 212 HOH A O    1 
HETATM 2480 O O    . HOH B 2 .   ? 16.99389  14.57504 0.16609  1.000 10.26027  ? 213 HOH A O    1 
HETATM 2481 O O    . HOH B 2 .   ? 13.23022  4.41143  4.01191  1.000 18.15551  ? 214 HOH A O    1 
HETATM 2482 O O    . HOH B 2 .   ? 4.59468   0.21966  -1.61246 1.000 12.09915  ? 215 HOH A O    1 
HETATM 2483 O O    . HOH B 2 .   ? 15.10777  22.51106 16.90341 1.000 15.89454  ? 216 HOH A O    1 
HETATM 2484 O O    . HOH B 2 .   ? 20.61937  3.23455  5.03523  1.000 22.52861  ? 217 HOH A O    1 
HETATM 2485 O O    . HOH B 2 .   ? 8.68677   6.38629  0.35518  1.000 13.78481  ? 218 HOH A O    1 
HETATM 2486 O O    . HOH B 2 .   ? -8.91309  17.66027 4.63852  1.000 12.84618  ? 219 HOH A O    1 
HETATM 2487 O O    . HOH B 2 .   ? 18.46814  5.76291  17.55140 1.000 8.18601   ? 220 HOH A O    1 
HETATM 2488 O O    . HOH B 2 .   ? -0.16393  -5.64911 19.53468 1.000 11.48385  ? 221 HOH A O    1 
HETATM 2489 O O    . HOH B 2 .   ? 3.53685   21.61901 8.26346  1.000 18.99203  ? 222 HOH A O    1 
HETATM 2490 O O    . HOH B 2 .   ? 2.21611   14.59852 -0.19678 1.000 8.41951   ? 223 HOH A O    1 
HETATM 2491 O O    . HOH B 2 .   ? -5.39518  14.18978 2.47558  1.000 19.91264  ? 224 HOH A O    1 
HETATM 2492 O O    . HOH B 2 .   ? 1.20068   2.12349  3.76473  1.000 15.53955  ? 225 HOH A O    1 
HETATM 2493 O O    . HOH B 2 .   ? -12.84401 3.22574  19.41385 1.000 21.33956  ? 226 HOH A O    1 
HETATM 2494 O O    . HOH B 2 .   ? 10.45689  17.85482 27.06469 1.000 12.56206  ? 227 HOH A O    1 
HETATM 2495 O O    . HOH B 2 .   ? 20.59684  12.51754 5.50961  1.000 19.75022  ? 228 HOH A O    1 
HETATM 2496 O O    . HOH B 2 .   ? 20.92021  7.86481  5.35036  1.000 9.33561   ? 229 HOH A O    1 
HETATM 2497 O O    . HOH B 2 .   ? -1.486    11.672   0.509    1.000 11.19411  ? 230 HOH A O    1 
HETATM 2498 O O    . HOH B 2 .   ? -11.28737 1.77440  9.18328  1.000 16.87355  ? 231 HOH A O    1 
HETATM 2499 O O    . HOH B 2 .   ? -11.91112 3.40014  11.30822 1.000 18.70642  ? 232 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  CYS 52  52  52  CYS CYS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 CYS 115 115 115 CYS CYS A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 TRP 121 121 121 TRP TRP A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 MET 136 136 136 MET MET A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 MET 142 142 142 MET MET A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLU 165 165 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  201 6  HOH HOH A . 
B 2 HOH 2  202 28 HOH HOH A . 
B 2 HOH 3  203 4  HOH HOH A . 
B 2 HOH 4  204 8  HOH HOH A . 
B 2 HOH 5  205 10 HOH HOH A . 
B 2 HOH 6  206 29 HOH HOH A . 
B 2 HOH 7  207 25 HOH HOH A . 
B 2 HOH 8  208 22 HOH HOH A . 
B 2 HOH 9  209 3  HOH HOH A . 
B 2 HOH 10 210 32 HOH HOH A . 
B 2 HOH 11 211 24 HOH HOH A . 
B 2 HOH 12 212 27 HOH HOH A . 
B 2 HOH 13 213 1  HOH HOH A . 
B 2 HOH 14 214 11 HOH HOH A . 
B 2 HOH 15 215 2  HOH HOH A . 
B 2 HOH 16 216 15 HOH HOH A . 
B 2 HOH 17 217 31 HOH HOH A . 
B 2 HOH 18 218 9  HOH HOH A . 
B 2 HOH 19 219 5  HOH HOH A . 
B 2 HOH 20 220 21 HOH HOH A . 
B 2 HOH 21 221 26 HOH HOH A . 
B 2 HOH 22 222 23 HOH HOH A . 
B 2 HOH 23 223 14 HOH HOH A . 
B 2 HOH 24 224 18 HOH HOH A . 
B 2 HOH 25 225 16 HOH HOH A . 
B 2 HOH 26 226 20 HOH HOH A . 
B 2 HOH 27 227 7  HOH HOH A . 
B 2 HOH 28 228 30 HOH HOH A . 
B 2 HOH 29 229 17 HOH HOH A . 
B 2 HOH 30 230 19 HOH HOH A . 
B 2 HOH 31 231 13 HOH HOH A . 
B 2 HOH 32 232 12 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  7420 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-01-29 
2 'Structure model' 1 1 2020-02-12 
3 'Structure model' 1 2 2020-03-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 2 'Structure model' 'Structure summary'   
3 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' audit_author    
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.country'              
2  3 'Structure model' '_citation.journal_abbrev'       
3  3 'Structure model' '_citation.journal_id_CSD'       
4  3 'Structure model' '_citation.journal_id_ISSN'      
5  3 'Structure model' '_citation.journal_volume'       
6  3 'Structure model' '_citation.page_first'           
7  3 'Structure model' '_citation.page_last'            
8  3 'Structure model' '_citation.pdbx_database_id_DOI' 
9  3 'Structure model' '_citation.title'                
10 3 'Structure model' '_citation.year'                 
11 3 'Structure model' '_citation_author.name'          
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .         2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         3 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         4 
# 
_em_3d_fitting.entry_id          6U5G 
_em_3d_fitting.id                1 
_em_3d_fitting.details           ? 
_em_3d_fitting.overall_b_value   ? 
_em_3d_fitting.ref_protocol      ? 
_em_3d_fitting.ref_space         RECIPROCAL 
_em_3d_fitting.target_criteria   ? 
_em_3d_fitting.method            ? 
# 
_em_3d_fitting_list.3d_fitting_id             1 
_em_3d_fitting_list.id                        1 
_em_3d_fitting_list.details                   ? 
_em_3d_fitting_list.pdb_chain_id              ? 
_em_3d_fitting_list.pdb_chain_residue_range   ? 
_em_3d_fitting_list.pdb_entry_id              4YUM 
# 
_em_3d_reconstruction.entry_id                    6U5G 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.algorithm                   ? 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.refinement_type             ? 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.num_particles               ? 
_em_3d_reconstruction.resolution                  2.5 
_em_3d_reconstruction.resolution_method           'DIFFRACTION PATTERN/LAYERLINES' 
_em_3d_reconstruction.symmetry_type               '3D CRYSTAL' 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.magnification_calibration   ? 
# 
_em_buffer.id            1 
_em_buffer.details       ? 
_em_buffer.pH            7.5 
_em_buffer.specimen_id   1 
_em_buffer.name          ? 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.details              monomer 
_em_entity_assembly.name                 'Peptidyl-prolyl cis-trans isomerase A' 
_em_entity_assembly.source               RECOMBINANT 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.entity_id_list       1 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_imaging.id                              1 
_em_imaging.entry_id                        6U5G 
_em_imaging.accelerating_voltage            200 
_em_imaging.alignment_procedure             ? 
_em_imaging.c2_aperture_diameter            ? 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.calibrated_magnification        ? 
_em_imaging.cryogen                         ? 
_em_imaging.details                         ? 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.illumination_mode               OTHER 
_em_imaging.microscope_model                'FEI TALOS ARCTICA' 
_em_imaging.mode                            DIFFRACTION 
_em_imaging.nominal_cs                      ? 
_em_imaging.nominal_defocus_max             ? 
_em_imaging.nominal_defocus_min             ? 
_em_imaging.nominal_magnification           ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.residual_tilt                   ? 
_em_imaging.specimen_holder_model           ? 
_em_imaging.specimen_id                     1 
_em_imaging.citation_id                     ? 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.specimen_holder_type            ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          unspecified 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
# 
_em_vitrification.id                    1 
_em_vitrification.specimen_id           1 
_em_vitrification.chamber_temperature   ? 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.details               ? 
_em_vitrification.humidity              ? 
_em_vitrification.instrument            ? 
_em_vitrification.entry_id              6U5G 
_em_vitrification.citation_id           ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                6U5G 
_em_experiment.id                      1 
_em_experiment.aggregation_state       '3D ARRAY' 
_em_experiment.reconstruction_method   CRYSTALLOGRAPHY 
_em_experiment.entity_assembly_id      1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HD22 A ASN 35  ? ? O A HOH 206 ? ? 1.51 
2 1 O    A ASP 123 ? ? O A HOH 201 ? ? 2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             161 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             161 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.650 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.162 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 60  ? ? -131.72 -76.24 
2 1 HIS A 70  ? ? 56.51   16.25  
3 1 THR A 107 ? ? -142.07 26.32  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A GLU 165 ? A GLU 165 
# 
_em_3d_crystal_entity.id                    1 
_em_3d_crystal_entity.image_processing_id   1 
_em_3d_crystal_entity.angle_alpha           90 
_em_3d_crystal_entity.angle_beta            90 
_em_3d_crystal_entity.angle_gamma           90 
_em_3d_crystal_entity.length_a              42.40 
_em_3d_crystal_entity.length_b              53.40 
_em_3d_crystal_entity.length_c              87.76 
_em_3d_crystal_entity.space_group_name      'P 21 21 21' 
_em_3d_crystal_entity.space_group_num       19 
# 
_em_crystal_formation.id                    1 
_em_crystal_formation.specimen_id           1 
_em_crystal_formation.atmosphere            ? 
_em_crystal_formation.details               
;600 uL of protein at 60 mg/mL was combined with 400 uL of 50 percent PEG 3350 in a glass vial  and stirred with an Octagon stir bar at 500 RPM
;
_em_crystal_formation.instrument            ? 
_em_crystal_formation.lipid_mixture         NA 
_em_crystal_formation.lipid_protein_ratio   ? 
_em_crystal_formation.temperature           296 
_em_crystal_formation.time                  ? 
_em_crystal_formation.time_unit             ? 
# 
_em_ctf_correction.id                       1 
_em_ctf_correction.em_image_processing_id   1 
_em_ctf_correction.type                     NONE 
_em_ctf_correction.details                  ? 
# 
_em_diffraction.id                1 
_em_diffraction.camera_length     2055 
_em_diffraction.imaging_id        1 
_em_diffraction.tilt_angle_list   ? 
# 
loop_
_em_diffraction_shell.id 
_em_diffraction_shell.em_diffraction_stats_id 
_em_diffraction_shell.fourier_space_coverage 
_em_diffraction_shell.high_resolution 
_em_diffraction_shell.low_resolution 
_em_diffraction_shell.multiplicity 
_em_diffraction_shell.num_structure_factors 
_em_diffraction_shell.phase_residual 
1 1 84 3.6045 30.4934 3.41 3581 14.45 
2 1 87 2.8617 3.6045  3.64 3719 22.05 
3 1 87 2.5002 2.8617  3.72 3746 32.30 
# 
_em_diffraction_stats.id                               1 
_em_diffraction_stats.details                          ? 
_em_diffraction_stats.image_processing_id              1 
_em_diffraction_stats.fourier_space_coverage           86 
_em_diffraction_stats.high_resolution                  2.5 
_em_diffraction_stats.num_intensities_measured         22370 
_em_diffraction_stats.num_structure_factors            6236 
_em_diffraction_stats.overall_phase_error              23.06 
_em_diffraction_stats.overall_phase_residual           23.06 
_em_diffraction_stats.phase_error_rejection_criteria   0 
_em_diffraction_stats.r_merge                          0.217 
_em_diffraction_stats.r_sym                            0.217 
# 
_em_entity_assembly_naturalsource.id                   1 
_em_entity_assembly_naturalsource.entity_assembly_id   1 
_em_entity_assembly_naturalsource.cell                 ? 
_em_entity_assembly_naturalsource.cellular_location    ? 
_em_entity_assembly_naturalsource.ncbi_tax_id          9606 
_em_entity_assembly_naturalsource.organ                ? 
_em_entity_assembly_naturalsource.organelle            ? 
_em_entity_assembly_naturalsource.organism             'Homo sapiens' 
_em_entity_assembly_naturalsource.strain               ? 
_em_entity_assembly_naturalsource.tissue               ? 
# 
_em_entity_assembly_recombinant.id                   2 
_em_entity_assembly_recombinant.entity_assembly_id   1 
_em_entity_assembly_recombinant.cell                 ? 
_em_entity_assembly_recombinant.ncbi_tax_id          469008 
_em_entity_assembly_recombinant.organism             'Escherichia coli BL21(DE3)' 
_em_entity_assembly_recombinant.plasmid              ? 
_em_entity_assembly_recombinant.strain               ? 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.id                            1 
_em_image_recording.imaging_id                    1 
_em_image_recording.avg_electron_dose_per_image   .06 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.details                       ? 
_em_image_recording.detector_mode                 ? 
_em_image_recording.film_or_detector_model        'TVIPS TEMCAM-F416 (4k x 4k)' 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_grids_imaged              1 
_em_image_recording.num_real_images               ? 
# 
loop_
_em_software.id 
_em_software.category 
_em_software.details 
_em_software.name 
_em_software.version 
_em_software.image_processing_id 
_em_software.fitting_id 
_em_software.imaging_id 
1  'IMAGE ACQUISITION'             ?      ?      ?         ? ? 1 
2  MASKING                         ?      ?      ?         ? ? ? 
3  'CTF CORRECTION'                ?      ?      ?         1 ? ? 
4  'LAYERLINE INDEXING'            ?      ?      ?         ? ? ? 
5  'DIFFRACTION INDEXING'          ?      ?      ?         ? ? ? 
6  'MODEL FITTING'                 ?      PHENIX dev2880   ? 1 ? 
7  OTHER                           ?      ?      ?         ? ? ? 
8  'MOLECULAR REPLACEMENT'         PHASER PHENIX dev2880   1 ? ? 
9  'LATTICE DISTORTION CORRECTION' ?      ?      ?         1 ? ? 
10 'SYMMETRY DETERMINATION'        ?      ?      ?         1 ? ? 
11 'CRYSTALLOGRAPHY MERGING'       ?      ?      ?         1 ? ? 
12 RECONSTRUCTION                  ?      PHENIX dev2880   1 ? ? 
13 'MODEL REFINEMENT'              ?      PHENIX 1.16-3549 ? 1 ? 
# 
_em_specimen.id                      1 
_em_specimen.experiment_id           1 
_em_specimen.concentration           ? 
_em_specimen.details                 ? 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.staining_applied        NO 
_em_specimen.vitrification_applied   YES 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM123159    1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM124149    2 
'National Science Foundation (NSF, United States)'                                         'United States' STC-1231306 3 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM117126    4 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 21 21 21' 
_space_group.name_Hall        'P 2ac 2ab' 
_space_group.IT_number        19 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z           
2 x+1/2,-y+1/2,-z 
3 -x,y+1/2,-z+1/2 
4 -x+1/2,-y,z+1/2 
#