data_6U81
# 
_entry.id   6U81 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6U81         
WWPDB D_1000236861 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6U81 
_pdbx_database_status.recvd_initial_deposition_date   2019-09-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, K.'    1 ? 
'Aihara, H.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Faseb J.' 
_citation.journal_id_ASTM           FAJOEC 
_citation.journal_id_CSD            2074 
_citation.journal_id_ISSN           1530-6860 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            34 
_citation.language                  ? 
_citation.page_first                4573 
_citation.page_last                 4590 
_citation.title                     'DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1096/fj.201902696 
_citation.pdbx_database_id_PubMed   32020675 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Klingler, C.'   1 ? 
primary 'Ashley, J.'     2 ? 
primary 'Shi, K.'        3 ? 
primary 'Stiefvater, A.' 4 ? 
primary 'Kyba, M.'       5 ? 
primary 'Sinnreich, M.'  6 ? 
primary 'Aihara, H.'     7 ? 
primary 'Kinter, J.'     8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6U81 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     71.640 
_cell.length_a_esd                 ? 
_cell.length_b                     73.190 
_cell.length_b_esd                 ? 
_cell.length_c                     108.070 
_cell.length_c_esd                 ? 
_cell.volume                       566646.859 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6U81 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            'C 2c 2' 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Double homeobox protein 4'                                                  15629.823 1  ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*GP*CP*GP*TP*AP*AP*TP*CP*TP*AP*AP*TP*CP*AP*AP*CP*A)-3')
;
5179.400  1  ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(*TP*GP*TP*TP*GP*AP*TP*TP*AP*GP*CP*CP*CP*AP*TP*TP*AP*CP*GP*C)-3')
;
6099.952  1  ? ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                                                               62.068    2  ? ? ? ? 
5 water       nat water                                                                        18.015    65 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Double homeobox protein 10' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQHRRESRPWPGRRGPPEGRRKR
TAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHP
;
;GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQHRRESRPWPGRRGPPEGRRKR
TAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHP
;
A ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DT)(DA)(DA)(DT)(DC)(DT)(DA)(DA)(DT)(DC)(DA)(DA)(DC)(DA)' GCGTAATCTAATCAACA B ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DT)(DG)(DA)(DT)(DT)(DA)(DG)(DC)(DC)(DC)(DA)(DT)(DT)(DA)(DC)(DG)(DC)' 
TGTTGATTAGCCCATTACGC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   ARG n 
1 4   ARG n 
1 5   ARG n 
1 6   LEU n 
1 7   VAL n 
1 8   TRP n 
1 9   THR n 
1 10  PRO n 
1 11  SER n 
1 12  GLN n 
1 13  SER n 
1 14  GLU n 
1 15  ALA n 
1 16  LEU n 
1 17  ARG n 
1 18  ALA n 
1 19  CYS n 
1 20  PHE n 
1 21  GLU n 
1 22  ARG n 
1 23  ASN n 
1 24  PRO n 
1 25  TYR n 
1 26  PRO n 
1 27  GLY n 
1 28  ILE n 
1 29  ALA n 
1 30  THR n 
1 31  ARG n 
1 32  GLU n 
1 33  ARG n 
1 34  LEU n 
1 35  ALA n 
1 36  GLN n 
1 37  ALA n 
1 38  ILE n 
1 39  GLY n 
1 40  ILE n 
1 41  PRO n 
1 42  GLU n 
1 43  PRO n 
1 44  ARG n 
1 45  VAL n 
1 46  GLN n 
1 47  ILE n 
1 48  TRP n 
1 49  PHE n 
1 50  GLN n 
1 51  ASN n 
1 52  GLU n 
1 53  ARG n 
1 54  SER n 
1 55  ARG n 
1 56  GLN n 
1 57  LEU n 
1 58  ARG n 
1 59  GLN n 
1 60  HIS n 
1 61  ARG n 
1 62  ARG n 
1 63  GLU n 
1 64  SER n 
1 65  ARG n 
1 66  PRO n 
1 67  TRP n 
1 68  PRO n 
1 69  GLY n 
1 70  ARG n 
1 71  ARG n 
1 72  GLY n 
1 73  PRO n 
1 74  PRO n 
1 75  GLU n 
1 76  GLY n 
1 77  ARG n 
1 78  ARG n 
1 79  LYS n 
1 80  ARG n 
1 81  THR n 
1 82  ALA n 
1 83  VAL n 
1 84  THR n 
1 85  GLY n 
1 86  SER n 
1 87  GLN n 
1 88  THR n 
1 89  ALA n 
1 90  LEU n 
1 91  LEU n 
1 92  LEU n 
1 93  ARG n 
1 94  ALA n 
1 95  PHE n 
1 96  GLU n 
1 97  LYS n 
1 98  ASP n 
1 99  ARG n 
1 100 PHE n 
1 101 PRO n 
1 102 GLY n 
1 103 ILE n 
1 104 ALA n 
1 105 ALA n 
1 106 ARG n 
1 107 GLU n 
1 108 GLU n 
1 109 LEU n 
1 110 ALA n 
1 111 ARG n 
1 112 GLU n 
1 113 THR n 
1 114 GLY n 
1 115 LEU n 
1 116 PRO n 
1 117 GLU n 
1 118 SER n 
1 119 ARG n 
1 120 ILE n 
1 121 GLN n 
1 122 ILE n 
1 123 TRP n 
1 124 PHE n 
1 125 GLN n 
1 126 ASN n 
1 127 ARG n 
1 128 ARG n 
1 129 ALA n 
1 130 ARG n 
1 131 HIS n 
1 132 PRO n 
2 1   DG  n 
2 2   DC  n 
2 3   DG  n 
2 4   DT  n 
2 5   DA  n 
2 6   DA  n 
2 7   DT  n 
2 8   DC  n 
2 9   DT  n 
2 10  DA  n 
2 11  DA  n 
2 12  DT  n 
2 13  DC  n 
2 14  DA  n 
2 15  DA  n 
2 16  DC  n 
2 17  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DT  n 
3 4   DT  n 
3 5   DG  n 
3 6   DA  n 
3 7   DT  n 
3 8   DT  n 
3 9   DA  n 
3 10  DG  n 
3 11  DC  n 
3 12  DC  n 
3 13  DC  n 
3 14  DA  n 
3 15  DT  n 
3 16  DT  n 
3 17  DA  n 
3 18  DC  n 
3 19  DG  n 
3 20  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   132 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DUX4, DUX10' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     83333 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 17 'Homo sapiens' Human 9606 ? 
3 1 sample 1 20 'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DUX4_HUMAN Q9UBX2 ? 1 
;GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQHRRESRPWPGRRGPPEGRRKR
TAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHP
;
19 
2 PDB 6U81       6U81   ? 2 ? 1  
3 PDB 6U81       6U81   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6U81 A 1 ? 132 ? Q9UBX2 19 ? 150 ? 19 150 
2 2 6U81 B 1 ? 17  ? 6U81   1  ? 17  ? 1  17  
3 3 6U81 C 1 ? 20  ? 6U81   1  ? 20  ? 1  20  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6U81 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.63 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.27 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Ethylene glycols, Glycerol, PEG4000, Imidazole, MES, pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-03-27 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            28.74 
_reflns.entry_id                         6U81 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.31 
_reflns.d_resolution_low                 54.01 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12667 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         6.7 
_reflns.pdbx_netI_over_sigmaI            0.083 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.31 
_reflns_shell.d_res_low                   2.39 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1897 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.7 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.39 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               29.61 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6U81 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.34 
_refine.ls_d_res_low                             46.27 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     8042 
_refine.ls_number_reflns_R_free                  371 
_refine.ls_number_reflns_R_work                  7671 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    65.09 
_refine.ls_percent_reflns_R_free                 4.61 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2177 
_refine.ls_R_factor_R_free                       0.2470 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2163 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      6E8C 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.8337 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2606 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.34 
_refine_hist.d_res_low                        46.27 
_refine_hist.number_atoms_solvent             65 
_refine_hist.number_atoms_total               1918 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1097 
_refine_hist.pdbx_number_atoms_nucleic_acid   748 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0047  ? 1967 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.6932  ? 2806 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0401  ? 294  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0040  ? 244  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 27.0034 ? 818  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.34 2.42  . . 3  49   4.38  . . . 0.2396 . 0.2760 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.42 2.52  . . 9  145  12.78 . . . 0.2438 . 0.3843 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.52 2.63  . . 16 286  24.92 . . . 0.3071 . 0.2888 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.63 2.77  . . 25 533  45.51 . . . 0.3307 . 0.3070 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.77 2.94  . . 41 806  69.83 . . . 0.2395 . 0.2923 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.94 3.17  . . 34 1090 90.06 . . . 0.3151 . 0.2647 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.17 3.49  . . 56 1140 98.11 . . . 0.2514 . 0.2183 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.49 4.00  . . 49 1197 99.60 . . . 0.2831 . 0.2013 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.00 5.03  . . 82 1167 99.84 . . . 0.1998 . 0.1803 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.03 46.27 . . 56 1258 99.47 . . . 0.2401 . 0.1854 . . . . . . . . . . . 
# 
_struct.entry_id                     6U81 
_struct.title                        'Crystal Structure of the Double Homeodomain of DUX4 in Complex with a DNA aptamer' 
_struct.pdbx_descriptor              'Double homeobox protein 4/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6U81 
_struct_keywords.text            'DUX tandem homeodomains, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 9   ? ASN A 23  ? THR A 27  ASN A 41  1 ? 15 
HELX_P HELX_P2 AA2 GLY A 27  ? GLY A 39  ? GLY A 45  GLY A 57  1 ? 13 
HELX_P HELX_P3 AA3 PRO A 41  ? GLU A 63  ? PRO A 59  GLU A 81  1 ? 23 
HELX_P HELX_P4 AA4 THR A 84  ? ASP A 98  ? THR A 102 ASP A 116 1 ? 15 
HELX_P HELX_P5 AA5 GLY A 102 ? GLY A 114 ? GLY A 120 GLY A 132 1 ? 13 
HELX_P HELX_P6 AA6 PRO A 116 ? HIS A 131 ? PRO A 134 HIS A 149 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DC 8  N3 ? ? ? 1_555 C DG 10 N1 ? ? B DC 8  C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DC 8  N4 ? ? ? 1_555 C DG 10 O6 ? ? B DC 8  C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DC 8  O2 ? ? ? 1_555 C DG 10 N2 ? ? B DC 8  C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DT 9  N3 ? ? ? 1_555 C DA 9  N1 ? ? B DT 9  C DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DT 9  O4 ? ? ? 1_555 C DA 9  N6 ? ? B DT 9  C DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 8  N3 ? ? B DA 10 C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DA 10 N6 ? ? ? 1_555 C DT 8  O4 ? ? B DA 10 C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DA 11 N1 ? ? ? 1_555 C DT 7  N3 ? ? B DA 11 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DA 11 N6 ? ? ? 1_555 C DT 7  O4 ? ? B DA 11 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA 6  N1 ? ? B DT 12 C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA 6  N6 ? ? B DT 12 C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DC 13 N3 ? ? ? 1_555 C DG 5  N1 ? ? B DC 13 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DC 13 N4 ? ? ? 1_555 C DG 5  O6 ? ? B DC 13 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DC 13 O2 ? ? ? 1_555 C DG 5  N2 ? ? B DC 13 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DA 14 N1 ? ? ? 1_555 C DT 4  N3 ? ? B DA 14 C DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DA 14 N6 ? ? ? 1_555 C DT 4  O4 ? ? B DA 14 C DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DA 15 N1 ? ? ? 1_555 C DT 3  N3 ? ? B DA 15 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DA 15 N6 ? ? ? 1_555 C DT 3  O4 ? ? B DA 15 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DC 16 N3 ? ? ? 1_555 C DG 2  N1 ? ? B DC 16 C DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DC 16 N4 ? ? ? 1_555 C DG 2  O6 ? ? B DC 16 C DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DC 16 O2 ? ? ? 1_555 C DG 2  N2 ? ? B DC 16 C DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DA 17 N1 ? ? ? 1_555 C DT 1  N3 ? ? B DA 17 C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DA 17 N6 ? ? ? 1_555 C DT 1  O4 ? ? B DA 17 C DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 201 ? 1 'binding site for residue EDO A 201' 
AC2 Software A EDO 202 ? 7 'binding site for residue EDO A 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 1 HOH F .   ? HOH A 304 . ? 1_555 ? 
2 AC2 7 THR A 88  ? THR A 106 . ? 1_555 ? 
3 AC2 7 TRP A 123 ? TRP A 141 . ? 1_555 ? 
4 AC2 7 ARG A 127 ? ARG A 145 . ? 1_555 ? 
5 AC2 7 HOH F .   ? HOH A 302 . ? 1_555 ? 
6 AC2 7 DT  C 4   ? DT  C 4   . ? 1_555 ? 
7 AC2 7 DG  C 5   ? DG  C 5   . ? 1_555 ? 
8 AC2 7 HOH H .   ? HOH C 106 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          6U81 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    6U81 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.013959 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013663 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009253 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N      . GLY A 1 1   ? 91.20212  30.65976  22.25371  1.000 20.20706 ? 19  GLY A N      1 
ATOM   2    C CA     . GLY A 1 1   ? 90.02241  30.13602  22.91813  1.000 20.68871 ? 19  GLY A CA     1 
ATOM   3    C C      . GLY A 1 1   ? 89.41530  28.96483  22.17384  1.000 22.34584 ? 19  GLY A C      1 
ATOM   4    O O      . GLY A 1 1   ? 88.81618  29.13607  21.10934  1.000 23.35606 ? 19  GLY A O      1 
ATOM   5    H H1     . GLY A 1 1   ? 91.10744  31.45721  21.94701  1.000 24.24847 ? 19  GLY A H1     1 
ATOM   6    H H2     . GLY A 1 1   ? 91.33095  30.20483  21.41803  1.000 24.24847 ? 19  GLY A H2     1 
ATOM   7    H H3     . GLY A 1 1   ? 91.97015  30.52000  22.81220  1.000 24.24847 ? 19  GLY A H3     1 
ATOM   8    H HA2    . GLY A 1 1   ? 90.26105  29.84099  23.81083  1.000 24.82645 ? 19  GLY A HA2    1 
ATOM   9    H HA3    . GLY A 1 1   ? 89.35418  30.83595  22.98493  1.000 24.82645 ? 19  GLY A HA3    1 
ATOM   10   N N      . ARG A 1 2   ? 89.57234  27.76898  22.73596  1.000 22.33027 ? 20  ARG A N      1 
ATOM   11   C CA     . ARG A 1 2   ? 89.07839  26.55423  22.11238  1.000 21.39048 ? 20  ARG A CA     1 
ATOM   12   C C      . ARG A 1 2   ? 87.67361  26.22447  22.61127  1.000 21.24689 ? 20  ARG A C      1 
ATOM   13   O O      . ARG A 1 2   ? 87.15516  26.82895  23.55122  1.000 21.95821 ? 20  ARG A O      1 
ATOM   14   C CB     . ARG A 1 2   ? 90.03130  25.38723  22.37933  1.000 22.28247 ? 20  ARG A CB     1 
ATOM   15   C CG     . ARG A 1 2   ? 90.10799  24.93928  23.82529  1.000 23.93475 ? 20  ARG A CG     1 
ATOM   16   C CD     . ARG A 1 2   ? 90.64568  23.52325  23.92554  1.000 24.60793 ? 20  ARG A CD     1 
ATOM   17   N NE     . ARG A 1 2   ? 91.97849  23.39332  23.34233  1.000 25.64838 ? 20  ARG A NE     1 
ATOM   18   C CZ     . ARG A 1 2   ? 92.61016  22.23568  23.16226  1.000 27.69202 ? 20  ARG A CZ     1 
ATOM   19   N NH1    . ARG A 1 2   ? 93.82361  22.21749  22.62850  1.000 28.87885 ? 20  ARG A NH1    1 
ATOM   20   N NH2    . ARG A 1 2   ? 92.03436  21.09253  23.51219  1.000 28.22517 ? 20  ARG A NH2    1 
ATOM   21   H H      . ARG A 1 2   ? 89.96744  27.63755  23.48844  1.000 26.79632 ? 20  ARG A H      1 
ATOM   22   H HA     . ARG A 1 2   ? 89.03224  26.68993  21.15302  1.000 25.66858 ? 20  ARG A HA     1 
ATOM   23   H HB2    . ARG A 1 2   ? 89.73859  24.62590  21.85436  1.000 26.73897 ? 20  ARG A HB2    1 
ATOM   24   H HB3    . ARG A 1 2   ? 90.92444  25.65257  22.10952  1.000 26.73897 ? 20  ARG A HB3    1 
ATOM   25   H HG2    . ARG A 1 2   ? 90.70178  25.52902  24.31572  1.000 28.72170 ? 20  ARG A HG2    1 
ATOM   26   H HG3    . ARG A 1 2   ? 89.22125  24.95991  24.21794  1.000 28.72170 ? 20  ARG A HG3    1 
ATOM   27   H HD2    . ARG A 1 2   ? 90.69932  23.26894  24.86007  1.000 29.52951 ? 20  ARG A HD2    1 
ATOM   28   H HD3    . ARG A 1 2   ? 90.04936  22.92244  23.45192  1.000 29.52951 ? 20  ARG A HD3    1 
ATOM   29   H HE     . ARG A 1 2   ? 92.38199  24.11277  23.09907  1.000 30.77805 ? 20  ARG A HE     1 
ATOM   30   H HH11   . ARG A 1 2   ? 94.20320  22.95405  22.39832  1.000 34.65462 ? 20  ARG A HH11   1 
ATOM   31   H HH12   . ARG A 1 2   ? 94.23115  21.46913  22.51246  1.000 34.65462 ? 20  ARG A HH12   1 
ATOM   32   H HH21   . ARG A 1 2   ? 91.24707  21.09589  23.85827  1.000 33.87021 ? 20  ARG A HH21   1 
ATOM   33   H HH22   . ARG A 1 2   ? 92.44846  20.34829  23.39291  1.000 33.87021 ? 20  ARG A HH22   1 
ATOM   34   N N      . ARG A 1 3   ? 87.06366  25.23702  21.96350  1.000 21.88271 ? 21  ARG A N      1 
ATOM   35   C CA     . ARG A 1 3   ? 85.70914  24.82415  22.30186  1.000 22.77399 ? 21  ARG A CA     1 
ATOM   36   C C      . ARG A 1 3   ? 85.62383  24.35031  23.74779  1.000 22.56673 ? 21  ARG A C      1 
ATOM   37   O O      . ARG A 1 3   ? 86.47267  23.59399  24.22355  1.000 22.13056 ? 21  ARG A O      1 
ATOM   38   C CB     . ARG A 1 3   ? 85.26999  23.70659  21.35445  1.000 24.54364 ? 21  ARG A CB     1 
ATOM   39   C CG     . ARG A 1 3   ? 83.92231  23.08836  21.67276  1.000 25.74100 ? 21  ARG A CG     1 
ATOM   40   C CD     . ARG A 1 3   ? 83.67547  21.87195  20.80143  1.000 26.48079 ? 21  ARG A CD     1 
ATOM   41   N NE     . ARG A 1 3   ? 83.81289  22.17813  19.38066  1.000 26.05022 ? 21  ARG A NE     1 
ATOM   42   C CZ     . ARG A 1 3   ? 82.81357  22.55585  18.58867  1.000 25.19973 ? 21  ARG A CZ     1 
ATOM   43   N NH1    . ARG A 1 3   ? 81.57716  22.68367  19.06346  1.000 24.46181 ? 21  ARG A NH1    1 
ATOM   44   N NH2    . ARG A 1 3   ? 83.05489  22.80900  17.31052  1.000 24.80784 ? 21  ARG A NH2    1 
ATOM   45   H H      . ARG A 1 3   ? 87.41506  24.78749  21.32005  1.000 26.25926 ? 21  ARG A H      1 
ATOM   46   H HA     . ARG A 1 3   ? 85.10602  25.57759  22.20451  1.000 27.32879 ? 21  ARG A HA     1 
ATOM   47   H HB2    . ARG A 1 3   ? 85.21891  24.06842  20.45591  1.000 29.45237 ? 21  ARG A HB2    1 
ATOM   48   H HB3    . ARG A 1 3   ? 85.93076  22.99732  21.38941  1.000 29.45237 ? 21  ARG A HB3    1 
ATOM   49   H HG2    . ARG A 1 3   ? 83.90325  22.81148  22.60221  1.000 30.88920 ? 21  ARG A HG2    1 
ATOM   50   H HG3    . ARG A 1 3   ? 83.21997  23.73604  21.50506  1.000 30.88920 ? 21  ARG A HG3    1 
ATOM   51   H HD2    . ARG A 1 3   ? 84.31978  21.18256  21.02620  1.000 31.77694 ? 21  ARG A HD2    1 
ATOM   52   H HD3    . ARG A 1 3   ? 82.77458  21.54693  20.95527  1.000 31.77694 ? 21  ARG A HD3    1 
ATOM   53   H HE     . ARG A 1 3   ? 84.59561  22.10936  19.03105  1.000 31.26026 ? 21  ARG A HE     1 
ATOM   54   H HH11   . ARG A 1 3   ? 81.41597  22.52130  19.89247  1.000 29.35417 ? 21  ARG A HH11   1 
ATOM   55   H HH12   . ARG A 1 3   ? 80.93923  22.92865  18.54133  1.000 29.35417 ? 21  ARG A HH12   1 
ATOM   56   H HH21   . ARG A 1 3   ? 83.85260  22.72857  16.99939  1.000 29.76941 ? 21  ARG A HH21   1 
ATOM   57   H HH22   . ARG A 1 3   ? 82.41381  23.05373  16.79214  1.000 29.76941 ? 21  ARG A HH22   1 
ATOM   58   N N      . ARG A 1 4   ? 84.58373  24.79735  24.44799  1.000 24.41064 ? 22  ARG A N      1 
ATOM   59   C CA     . ARG A 1 4   ? 84.31990  24.32168  25.80065  1.000 26.48222 ? 22  ARG A CA     1 
ATOM   60   C C      . ARG A 1 4   ? 84.02393  22.82874  25.77942  1.000 27.45123 ? 22  ARG A C      1 
ATOM   61   O O      . ARG A 1 4   ? 82.94180  22.40821  25.35319  1.000 27.63412 ? 22  ARG A O      1 
ATOM   62   C CB     . ARG A 1 4   ? 83.14848  25.08326  26.42767  1.000 27.07099 ? 22  ARG A CB     1 
ATOM   63   H H      . ARG A 1 4   ? 84.01651  25.37652  24.16089  1.000 29.29277 ? 22  ARG A H      1 
ATOM   64   H HA     . ARG A 1 4   ? 85.10240  24.47882  26.35192  1.000 31.77867 ? 22  ARG A HA     1 
ATOM   65   H HB2    . ARG A 1 4   ? 82.99047  24.73775  27.32064  1.000 32.48518 ? 22  ARG A HB2    1 
ATOM   66   H HB3    . ARG A 1 4   ? 83.37274  26.02569  26.47367  1.000 32.48518 ? 22  ARG A HB3    1 
ATOM   67   N N      . ARG A 1 5   ? 84.97806  22.02360  26.24165  1.000 27.59352 ? 23  ARG A N      1 
ATOM   68   C CA     . ARG A 1 5   ? 84.82597  20.57831  26.18490  1.000 26.85945 ? 23  ARG A CA     1 
ATOM   69   C C      . ARG A 1 5   ? 83.51611  20.15704  26.83320  1.000 26.21330 ? 23  ARG A C      1 
ATOM   70   O O      . ARG A 1 5   ? 83.03362  20.78558  27.77756  1.000 26.43576 ? 23  ARG A O      1 
ATOM   71   C CB     . ARG A 1 5   ? 86.00469  19.88706  26.87494  1.000 26.38146 ? 23  ARG A CB     1 
ATOM   72   C CG     . ARG A 1 5   ? 86.20349  20.27224  28.32962  1.000 25.90578 ? 23  ARG A CG     1 
ATOM   73   C CD     . ARG A 1 5   ? 87.41470  19.56418  28.91435  1.000 26.03451 ? 23  ARG A CD     1 
ATOM   74   N NE     . ARG A 1 5   ? 87.13278  18.16347  29.21148  1.000 26.56671 ? 23  ARG A NE     1 
ATOM   75   C CZ     . ARG A 1 5   ? 88.00422  17.16757  29.07435  1.000 27.54349 ? 23  ARG A CZ     1 
ATOM   76   N NH1    . ARG A 1 5   ? 87.63789  15.93012  29.37873  1.000 27.52408 ? 23  ARG A NH1    1 
ATOM   77   N NH2    . ARG A 1 5   ? 89.23130  17.39495  28.61936  1.000 27.43821 ? 23  ARG A NH2    1 
ATOM   78   H H      . ARG A 1 5   ? 85.71766  22.29004  26.59037  1.000 33.11222 ? 23  ARG A H      1 
ATOM   79   H HA     . ARG A 1 5   ? 84.81388  20.29248  25.25805  1.000 32.23134 ? 23  ARG A HA     1 
ATOM   80   H HB2    . ARG A 1 5   ? 85.86072  18.92831  26.84379  1.000 31.65775 ? 23  ARG A HB2    1 
ATOM   81   H HB3    . ARG A 1 5   ? 86.81797  20.11606  26.39846  1.000 31.65775 ? 23  ARG A HB3    1 
ATOM   82   H HG2    . ARG A 1 5   ? 86.34533  21.22960  28.39484  1.000 31.08693 ? 23  ARG A HG2    1 
ATOM   83   H HG3    . ARG A 1 5   ? 85.42054  20.01717  28.84227  1.000 31.08693 ? 23  ARG A HG3    1 
ATOM   84   H HD2    . ARG A 1 5   ? 88.14431  19.59841  28.27608  1.000 31.24141 ? 23  ARG A HD2    1 
ATOM   85   H HD3    . ARG A 1 5   ? 87.67465  20.00333  29.73925  1.000 31.24141 ? 23  ARG A HD3    1 
ATOM   86   H HE     . ARG A 1 5   ? 86.34534  17.96735  29.49621  1.000 31.88005 ? 23  ARG A HE     1 
ATOM   87   H HH11   . ARG A 1 5   ? 86.84112  15.77514  29.66286  1.000 33.02889 ? 23  ARG A HH11   1 
ATOM   88   H HH12   . ARG A 1 5   ? 88.19706  15.28251  29.29201  1.000 33.02889 ? 23  ARG A HH12   1 
ATOM   89   H HH21   . ARG A 1 5   ? 89.47086  18.19375  28.40930  1.000 32.92585 ? 23  ARG A HH21   1 
ATOM   90   H HH22   . ARG A 1 5   ? 89.78618  16.74337  28.53485  1.000 32.92585 ? 23  ARG A HH22   1 
ATOM   91   N N      . LEU A 1 6   ? 82.94072  19.08125  26.31237  1.000 26.19181 ? 24  LEU A N      1 
ATOM   92   C CA     . LEU A 1 6   ? 81.67443  18.55817  26.79407  1.000 26.49972 ? 24  LEU A CA     1 
ATOM   93   C C      . LEU A 1 6   ? 81.90975  17.33584  27.67873  1.000 25.90651 ? 24  LEU A C      1 
ATOM   94   O O      . LEU A 1 6   ? 82.92919  16.65074  27.56613  1.000 26.71829 ? 24  LEU A O      1 
ATOM   95   C CB     . LEU A 1 6   ? 80.76673  18.22430  25.60638  1.000 27.96497 ? 24  LEU A CB     1 
ATOM   96   C CG     . LEU A 1 6   ? 80.34690  16.78591  25.31533  1.000 29.34329 ? 24  LEU A CG     1 
ATOM   97   C CD1    . LEU A 1 6   ? 79.23016  16.81863  24.28596  1.000 30.61716 ? 24  LEU A CD1    1 
ATOM   98   C CD2    . LEU A 1 6   ? 81.49690  15.93028  24.80785  1.000 28.19442 ? 24  LEU A CD2    1 
ATOM   99   H H      . LEU A 1 6   ? 83.27454  18.62709  25.66283  1.000 31.43018 ? 24  LEU A H      1 
ATOM   100  H HA     . LEU A 1 6   ? 81.21705  19.21587  27.34100  1.000 31.79966 ? 24  LEU A HA     1 
ATOM   101  H HB2    . LEU A 1 6   ? 79.94281  18.72040  25.73266  1.000 33.55797 ? 24  LEU A HB2    1 
ATOM   102  H HB3    . LEU A 1 6   ? 81.22156  18.53432  24.80768  1.000 33.55797 ? 24  LEU A HB3    1 
ATOM   103  H HG     . LEU A 1 6   ? 80.04587  16.37240  26.13952  1.000 35.21195 ? 24  LEU A HG     1 
ATOM   104  H HD11   . LEU A 1 6   ? 78.50159  17.36030  24.62754  1.000 36.74060 ? 24  LEU A HD11   1 
ATOM   105  H HD12   . LEU A 1 6   ? 78.92198  15.91300  24.12545  1.000 36.74060 ? 24  LEU A HD12   1 
ATOM   106  H HD13   . LEU A 1 6   ? 79.57046  17.20299  23.46294  1.000 36.74060 ? 24  LEU A HD13   1 
ATOM   107  H HD21   . LEU A 1 6   ? 81.79971  16.28139  23.95584  1.000 33.83330 ? 24  LEU A HD21   1 
ATOM   108  H HD22   . LEU A 1 6   ? 81.18707  15.01765  24.69823  1.000 33.83330 ? 24  LEU A HD22   1 
ATOM   109  H HD23   . LEU A 1 6   ? 82.22042  15.95870  25.45330  1.000 33.83330 ? 24  LEU A HD23   1 
ATOM   110  N N      . VAL A 1 7   ? 80.96315  17.08026  28.57794  1.000 24.37623 ? 25  VAL A N      1 
ATOM   111  C CA     . VAL A 1 7   ? 81.06867  16.00782  29.56325  1.000 23.19186 ? 25  VAL A CA     1 
ATOM   112  C C      . VAL A 1 7   ? 80.03236  14.94234  29.22042  1.000 23.37323 ? 25  VAL A C      1 
ATOM   113  O O      . VAL A 1 7   ? 78.82514  15.17952  29.34646  1.000 24.55478 ? 25  VAL A O      1 
ATOM   114  C CB     . VAL A 1 7   ? 80.86294  16.53421  30.98936  1.000 22.42823 ? 25  VAL A CB     1 
ATOM   115  C CG1    . VAL A 1 7   ? 81.61815  15.67575  31.98997  1.000 22.64613 ? 25  VAL A CG1    1 
ATOM   116  C CG2    . VAL A 1 7   ? 81.29204  17.98517  31.08437  1.000 22.08797 ? 25  VAL A CG2    1 
ATOM   117  H H      . VAL A 1 7   ? 80.23076  17.52700  28.63820  1.000 29.25148 ? 25  VAL A H      1 
ATOM   118  H HA     . VAL A 1 7   ? 81.94805  15.60373  29.49761  1.000 27.83023 ? 25  VAL A HA     1 
ATOM   119  H HB     . VAL A 1 7   ? 79.91976  16.48621  31.21072  1.000 26.91388 ? 25  VAL A HB     1 
ATOM   120  H HG11   . VAL A 1 7   ? 81.28300  14.76672  31.94257  1.000 27.17535 ? 25  VAL A HG11   1 
ATOM   121  H HG12   . VAL A 1 7   ? 81.47954  16.03336  32.88092  1.000 27.17535 ? 25  VAL A HG12   1 
ATOM   122  H HG13   . VAL A 1 7   ? 82.56282  15.69188  31.77034  1.000 27.17535 ? 25  VAL A HG13   1 
ATOM   123  H HG21   . VAL A 1 7   ? 82.16942  18.08200  30.68222  1.000 26.50557 ? 25  VAL A HG21   1 
ATOM   124  H HG22   . VAL A 1 7   ? 81.32600  18.24392  32.01861  1.000 26.50557 ? 25  VAL A HG22   1 
ATOM   125  H HG23   . VAL A 1 7   ? 80.64885  18.53631  30.61167  1.000 26.50557 ? 25  VAL A HG23   1 
ATOM   126  N N      . TRP A 1 8   ? 80.49449  13.76587  28.79439  1.000 22.49618 ? 26  TRP A N      1 
ATOM   127  C CA     . TRP A 1 8   ? 79.58060  12.66745  28.50052  1.000 21.52842 ? 26  TRP A CA     1 
ATOM   128  C C      . TRP A 1 8   ? 78.81977  12.25866  29.75291  1.000 21.00470 ? 26  TRP A C      1 
ATOM   129  O O      . TRP A 1 8   ? 79.36316  12.26267  30.86118  1.000 21.70236 ? 26  TRP A O      1 
ATOM   130  C CB     . TRP A 1 8   ? 80.33534  11.44690  27.96257  1.000 20.78367 ? 26  TRP A CB     1 
ATOM   131  C CG     . TRP A 1 8   ? 81.20950  11.72310  26.79357  1.000 21.20404 ? 26  TRP A CG     1 
ATOM   132  C CD1    . TRP A 1 8   ? 82.56641  11.63946  26.75383  1.000 21.32487 ? 26  TRP A CD1    1 
ATOM   133  C CD2    . TRP A 1 8   ? 80.79334  12.13741  25.48587  1.000 22.36771 ? 26  TRP A CD2    1 
ATOM   134  N NE1    . TRP A 1 8   ? 83.02583  11.97351  25.50313  1.000 21.82016 ? 26  TRP A NE1    1 
ATOM   135  C CE2    . TRP A 1 8   ? 81.95717  12.28538  24.70638  1.000 22.05632 ? 26  TRP A CE2    1 
ATOM   136  C CE3    . TRP A 1 8   ? 79.55080  12.40044  24.90149  1.000 22.72831 ? 26  TRP A CE3    1 
ATOM   137  C CZ2    . TRP A 1 8   ? 81.91754  12.68274  23.37545  1.000 23.50084 ? 26  TRP A CZ2    1 
ATOM   138  C CZ3    . TRP A 1 8   ? 79.51066  12.79266  23.58253  1.000 23.59140 ? 26  TRP A CZ3    1 
ATOM   139  C CH2    . TRP A 1 8   ? 80.68670  12.93151  22.83062  1.000 24.52479 ? 26  TRP A CH2    1 
ATOM   140  H H      . TRP A 1 8   ? 81.32506  13.58139  28.66905  1.000 26.99542 ? 26  TRP A H      1 
ATOM   141  H HA     . TRP A 1 8   ? 78.95533  12.96609  27.82174  1.000 25.83411 ? 26  TRP A HA     1 
ATOM   142  H HB2    . TRP A 1 8   ? 80.89728  11.09520  28.67069  1.000 24.94040 ? 26  TRP A HB2    1 
ATOM   143  H HB3    . TRP A 1 8   ? 79.68690  10.77864  27.69079  1.000 24.94040 ? 26  TRP A HB3    1 
ATOM   144  H HD1    . TRP A 1 8   ? 83.10544  11.39184  27.47009  1.000 25.58985 ? 26  TRP A HD1    1 
ATOM   145  H HE1    . TRP A 1 8   ? 83.85071  11.98488  25.26014  1.000 26.18419 ? 26  TRP A HE1    1 
ATOM   146  H HE3    . TRP A 1 8   ? 78.76690  12.31218  25.39404  1.000 27.27397 ? 26  TRP A HE3    1 
ATOM   147  H HZ2    . TRP A 1 8   ? 82.69587  12.77591  22.87503  1.000 28.20101 ? 26  TRP A HZ2    1 
ATOM   148  H HZ3    . TRP A 1 8   ? 78.68949  12.96865  23.18301  1.000 28.30968 ? 26  TRP A HZ3    1 
ATOM   149  H HH2    . TRP A 1 8   ? 80.62883  13.19868  21.94170  1.000 29.42974 ? 26  TRP A HH2    1 
ATOM   150  N N      . THR A 1 9   ? 77.55682  11.89373  29.57414  1.000 19.79302 ? 27  THR A N      1 
ATOM   151  C CA     . THR A 1 9   ? 76.82785  11.26952  30.66195  1.000 19.07786 ? 27  THR A CA     1 
ATOM   152  C C      . THR A 1 9   ? 77.16773  9.78749   30.70312  1.000 17.76785 ? 27  THR A C      1 
ATOM   153  O O      . THR A 1 9   ? 77.67845  9.22860   29.72858  1.000 19.89840 ? 27  THR A O      1 
ATOM   154  C CB     . THR A 1 9   ? 75.32236  11.45638  30.49067  1.000 21.08527 ? 27  THR A CB     1 
ATOM   155  O OG1    . THR A 1 9   ? 74.87386  10.76261  29.31854  1.000 22.08371 ? 27  THR A OG1    1 
ATOM   156  C CG2    . THR A 1 9   ? 74.97482  12.93327  30.37403  1.000 21.46735 ? 27  THR A CG2    1 
ATOM   157  H H      . THR A 1 9   ? 77.11077  11.99579  28.84598  1.000 23.75162 ? 27  THR A H      1 
ATOM   158  H HA     . THR A 1 9   ? 77.07156  11.68363  31.50457  1.000 22.89344 ? 27  THR A HA     1 
ATOM   159  H HB     . THR A 1 9   ? 74.86488  11.09694  31.26682  1.000 25.30233 ? 27  THR A HB     1 
ATOM   160  H HG1    . THR A 1 9   ? 74.04599  10.86704  29.22202  1.000 26.50045 ? 27  THR A HG1    1 
ATOM   161  H HG21   . THR A 1 9   ? 75.28486  13.41011  31.15977  1.000 25.76082 ? 27  THR A HG21   1 
ATOM   162  H HG22   . THR A 1 9   ? 74.01406  13.04300  30.29792  1.000 25.76082 ? 27  THR A HG22   1 
ATOM   163  H HG23   . THR A 1 9   ? 75.39824  13.31266  29.58810  1.000 25.76082 ? 27  THR A HG23   1 
ATOM   164  N N      . PRO A 1 10  ? 76.91436  9.12717   31.82416  1.000 14.80200 ? 28  PRO A N      1 
ATOM   165  C CA     . PRO A 1 10  ? 77.14668  7.67869   31.86665  1.000 14.61723 ? 28  PRO A CA     1 
ATOM   166  C C      . PRO A 1 10  ? 76.44284  6.92356   30.75211  1.000 14.45524 ? 28  PRO A C      1 
ATOM   167  O O      . PRO A 1 10  ? 77.05231  6.04665   30.13143  1.000 13.66312 ? 28  PRO A O      1 
ATOM   168  C CB     . PRO A 1 10  ? 76.62457  7.29592   33.25523  1.000 15.26239 ? 28  PRO A CB     1 
ATOM   169  C CG     . PRO A 1 10  ? 76.83335  8.52047   34.06904  1.000 15.43748 ? 28  PRO A CG     1 
ATOM   170  C CD     . PRO A 1 10  ? 76.56123  9.66852   33.14418  1.000 14.90955 ? 28  PRO A CD     1 
ATOM   171  H HA     . PRO A 1 10  ? 78.09681  7.48858   31.82199  1.000 17.54068 ? 28  PRO A HA     1 
ATOM   172  H HB2    . PRO A 1 10  ? 75.68404  7.06376   33.20609  1.000 18.31487 ? 28  PRO A HB2    1 
ATOM   173  H HB3    . PRO A 1 10  ? 77.13259  6.54910   33.60888  1.000 18.31487 ? 28  PRO A HB3    1 
ATOM   174  H HG2    . PRO A 1 10  ? 76.21606  8.52680   34.81724  1.000 18.52498 ? 28  PRO A HG2    1 
ATOM   175  H HG3    . PRO A 1 10  ? 77.74733  8.54780   34.39277  1.000 18.52498 ? 28  PRO A HG3    1 
ATOM   176  H HD2    . PRO A 1 10  ? 75.62555  9.92244   33.17452  1.000 17.89146 ? 28  PRO A HD2    1 
ATOM   177  H HD3    . PRO A 1 10  ? 77.11912  10.43049  33.36572  1.000 17.89146 ? 28  PRO A HD3    1 
ATOM   178  N N      . SER A 1 11  ? 75.18114  7.24349   30.46370  1.000 16.71407 ? 29  SER A N      1 
ATOM   179  C CA     . SER A 1 11  ? 74.47518  6.50805   29.41901  1.000 18.94461 ? 29  SER A CA     1 
ATOM   180  C C      . SER A 1 11  ? 75.01556  6.84508   28.03409  1.000 19.74771 ? 29  SER A C      1 
ATOM   181  O O      . SER A 1 11  ? 75.01656  5.98394   27.14746  1.000 20.86548 ? 29  SER A O      1 
ATOM   182  C CB     . SER A 1 11  ? 72.97124  6.78865   29.48818  1.000 19.38668 ? 29  SER A CB     1 
ATOM   183  O OG     . SER A 1 11  ? 72.66388  8.09477   29.03254  1.000 20.57367 ? 29  SER A OG     1 
ATOM   184  H H      . SER A 1 11  ? 74.72520  7.86381   30.84700  1.000 20.05689 ? 29  SER A H      1 
ATOM   185  H HA     . SER A 1 11  ? 74.60364  5.55854   29.57007  1.000 22.73353 ? 29  SER A HA     1 
ATOM   186  H HB2    . SER A 1 11  ? 72.50689  6.14525   28.93022  1.000 23.26401 ? 29  SER A HB2    1 
ATOM   187  H HB3    . SER A 1 11  ? 72.67868  6.70151   30.40889  1.000 23.26401 ? 29  SER A HB3    1 
ATOM   188  H HG     . SER A 1 11  ? 71.83380  8.22060   29.05967  1.000 24.68841 ? 29  SER A HG     1 
ATOM   189  N N      . GLN A 1 12  ? 75.47208  8.08273   27.82673  1.000 18.45482 ? 30  GLN A N      1 
ATOM   190  C CA     . GLN A 1 12  ? 76.11176  8.43460   26.56296  1.000 18.22408 ? 30  GLN A CA     1 
ATOM   191  C C      . GLN A 1 12  ? 77.39678  7.63909   26.36054  1.000 17.99027 ? 30  GLN A C      1 
ATOM   192  O O      . GLN A 1 12  ? 77.65117  7.11182   25.27239  1.000 17.49508 ? 30  GLN A O      1 
ATOM   193  C CB     . GLN A 1 12  ? 76.40272  9.93638   26.52308  1.000 17.88347 ? 30  GLN A CB     1 
ATOM   194  C CG     . GLN A 1 12  ? 75.18050  10.81075  26.29806  1.000 16.65989 ? 30  GLN A CG     1 
ATOM   195  C CD     . GLN A 1 12  ? 75.50961  12.29418  26.31425  1.000 15.22649 ? 30  GLN A CD     1 
ATOM   196  O OE1    . GLN A 1 12  ? 76.13033  12.80429  27.25492  1.000 13.98462 ? 30  GLN A OE1    1 
ATOM   197  N NE2    . GLN A 1 12  ? 75.09865  12.99394  25.26521  1.000 14.99484 ? 30  GLN A NE2    1 
ATOM   198  H H      . GLN A 1 12  ? 75.42357  8.72668   28.39469  1.000 22.14578 ? 30  GLN A H      1 
ATOM   199  H HA     . GLN A 1 12  ? 75.50437  8.22326   25.83680  1.000 21.86889 ? 30  GLN A HA     1 
ATOM   200  H HB2    . GLN A 1 12  ? 76.79713  10.19698  27.37009  1.000 21.46016 ? 30  GLN A HB2    1 
ATOM   201  H HB3    . GLN A 1 12  ? 77.02486  10.11115  25.79968  1.000 21.46016 ? 30  GLN A HB3    1 
ATOM   202  H HG2    . GLN A 1 12  ? 74.79440  10.59836  25.43393  1.000 19.99187 ? 30  GLN A HG2    1 
ATOM   203  H HG3    . GLN A 1 12  ? 74.53481  10.63885  27.00122  1.000 19.99187 ? 30  GLN A HG3    1 
ATOM   204  H HE21   . GLN A 1 12  ? 75.25791  13.83797  25.22219  1.000 17.99380 ? 30  GLN A HE21   1 
ATOM   205  H HE22   . GLN A 1 12  ? 74.67291  12.60365  24.62801  1.000 17.99380 ? 30  GLN A HE22   1 
ATOM   206  N N      . SER A 1 13  ? 78.22358  7.54763   27.40302  1.000 18.83194 ? 31  SER A N      1 
ATOM   207  C CA     . SER A 1 13  ? 79.48226  6.81754   27.29162  1.000 21.41536 ? 31  SER A CA     1 
ATOM   208  C C      . SER A 1 13  ? 79.24952  5.33980   26.99721  1.000 23.61248 ? 31  SER A C      1 
ATOM   209  O O      . SER A 1 13  ? 80.04286  4.70832   26.28930  1.000 23.25646 ? 31  SER A O      1 
ATOM   210  C CB     . SER A 1 13  ? 80.28950  6.97804   28.57634  1.000 22.17623 ? 31  SER A CB     1 
ATOM   211  O OG     . SER A 1 13  ? 80.47663  8.34551   28.88153  1.000 22.99075 ? 31  SER A OG     1 
ATOM   212  H H      . SER A 1 13  ? 78.08019  7.89543   28.17638  1.000 22.59832 ? 31  SER A H      1 
ATOM   213  H HA     . SER A 1 13  ? 79.99772  7.19128   26.55982  1.000 25.69843 ? 31  SER A HA     1 
ATOM   214  H HB2    . SER A 1 13  ? 79.81095  6.55380   29.30567  1.000 26.61147 ? 31  SER A HB2    1 
ATOM   215  H HB3    . SER A 1 13  ? 81.15626  6.55848   28.45978  1.000 26.61147 ? 31  SER A HB3    1 
ATOM   216  H HG     . SER A 1 13  ? 80.94599  8.42377   29.57375  1.000 27.58890 ? 31  SER A HG     1 
ATOM   217  N N      . GLU A 1 14  ? 78.17873  4.76081   27.54577  1.000 26.06034 ? 32  GLU A N      1 
ATOM   218  C CA     . GLU A 1 14  ? 77.88969  3.35993   27.26086  1.000 29.47937 ? 32  GLU A CA     1 
ATOM   219  C C      . GLU A 1 14  ? 77.50754  3.16816   25.80061  1.000 28.97386 ? 32  GLU A C      1 
ATOM   220  O O      . GLU A 1 14  ? 77.94086  2.20217   25.16116  1.000 30.63185 ? 32  GLU A O      1 
ATOM   221  C CB     . GLU A 1 14  ? 76.77787  2.84829   28.17770  1.000 33.43472 ? 32  GLU A CB     1 
ATOM   222  C CG     . GLU A 1 14  ? 77.24771  2.50939   29.58488  1.000 36.79067 ? 32  GLU A CG     1 
ATOM   223  C CD     . GLU A 1 14  ? 76.16817  1.85110   30.42596  1.000 39.65218 ? 32  GLU A CD     1 
ATOM   224  O OE1    . GLU A 1 14  ? 75.00149  1.79757   29.97541  1.000 40.76251 ? 32  GLU A OE1    1 
ATOM   225  O OE2    . GLU A 1 14  ? 76.49224  1.38147   31.53859  1.000 40.37571 ? 32  GLU A OE2    1 
ATOM   226  H H      . GLU A 1 14  ? 77.61988  5.14849   28.07206  1.000 31.27240 ? 32  GLU A H      1 
ATOM   227  H HA     . GLU A 1 14  ? 78.68560  2.83518   27.43994  1.000 35.37524 ? 32  GLU A HA     1 
ATOM   228  H HB2    . GLU A 1 14  ? 76.09479  3.53309   28.25090  1.000 40.12167 ? 32  GLU A HB2    1 
ATOM   229  H HB3    . GLU A 1 14  ? 76.40036  2.04323   27.79006  1.000 40.12167 ? 32  GLU A HB3    1 
ATOM   230  H HG2    . GLU A 1 14  ? 77.99792  1.89712   29.52816  1.000 44.14880 ? 32  GLU A HG2    1 
ATOM   231  H HG3    . GLU A 1 14  ? 77.51918  3.32617   30.03218  1.000 44.14880 ? 32  GLU A HG3    1 
ATOM   232  N N      . ALA A 1 15  ? 76.70098  4.08010   25.25398  1.000 26.30384 ? 33  ALA A N      1 
ATOM   233  C CA     . ALA A 1 15  ? 76.30159  3.96467   23.85564  1.000 24.47707 ? 33  ALA A CA     1 
ATOM   234  C C      . ALA A 1 15  ? 77.49364  4.14091   22.92576  1.000 24.41783 ? 33  ALA A C      1 
ATOM   235  O O      . ALA A 1 15  ? 77.58250  3.47468   21.88863  1.000 26.40022 ? 33  ALA A O      1 
ATOM   236  C CB     . ALA A 1 15  ? 75.21606  4.99081   23.53544  1.000 24.15977 ? 33  ALA A CB     1 
ATOM   237  H H      . ALA A 1 15  ? 76.37760  4.76269   25.66519  1.000 31.56461 ? 33  ALA A H      1 
ATOM   238  H HA     . ALA A 1 15  ? 75.93269  3.07984   23.70768  1.000 29.37249 ? 33  ALA A HA     1 
ATOM   239  H HB1    . ALA A 1 15  ? 74.97601  4.91471   22.59870  1.000 28.99172 ? 33  ALA A HB1    1 
ATOM   240  H HB2    . ALA A 1 15  ? 74.44078  4.81417   24.09099  1.000 28.99172 ? 33  ALA A HB2    1 
ATOM   241  H HB3    . ALA A 1 15  ? 75.55821  5.87990   23.71806  1.000 28.99172 ? 33  ALA A HB3    1 
ATOM   242  N N      . LEU A 1 16  ? 78.41309  5.04276   23.27099  1.000 23.33302 ? 34  LEU A N      1 
ATOM   243  C CA     . LEU A 1 16  ? 79.62503  5.20523   22.47412  1.000 22.57852 ? 34  LEU A CA     1 
ATOM   244  C C      . LEU A 1 16  ? 80.46988  3.93493   22.50830  1.000 23.28031 ? 34  LEU A C      1 
ATOM   245  O O      . LEU A 1 16  ? 80.87149  3.41390   21.46156  1.000 22.20123 ? 34  LEU A O      1 
ATOM   246  C CB     . LEU A 1 16  ? 80.42544  6.40926   22.98239  1.000 21.12090 ? 34  LEU A CB     1 
ATOM   247  C CG     . LEU A 1 16  ? 79.77950  7.79461   22.83489  1.000 19.67010 ? 34  LEU A CG     1 
ATOM   248  C CD1    . LEU A 1 16  ? 80.49273  8.82339   23.69120  1.000 18.28257 ? 34  LEU A CD1    1 
ATOM   249  C CD2    . LEU A 1 16  ? 79.77796  8.23979   21.38524  1.000 19.62264 ? 34  LEU A CD2    1 
ATOM   250  H H      . LEU A 1 16  ? 78.35928  5.56495   23.95219  1.000 27.99963 ? 34  LEU A H      1 
ATOM   251  H HA     . LEU A 1 16  ? 79.37947  5.37838   21.55183  1.000 27.09423 ? 34  LEU A HA     1 
ATOM   252  H HB2    . LEU A 1 16  ? 80.59469  6.27631   23.92821  1.000 25.34508 ? 34  LEU A HB2    1 
ATOM   253  H HB3    . LEU A 1 16  ? 81.26415  6.43595   22.49582  1.000 25.34508 ? 34  LEU A HB3    1 
ATOM   254  H HG     . LEU A 1 16  ? 78.86003  7.73235   23.13754  1.000 23.60412 ? 34  LEU A HG     1 
ATOM   255  H HD11   . LEU A 1 16  ? 80.45530  8.54270   24.61894  1.000 21.93909 ? 34  LEU A HD11   1 
ATOM   256  H HD12   . LEU A 1 16  ? 80.05198  9.68118   23.58710  1.000 21.93909 ? 34  LEU A HD12   1 
ATOM   257  H HD13   . LEU A 1 16  ? 81.41643  8.88892   23.40245  1.000 21.93909 ? 34  LEU A HD13   1 
ATOM   258  H HD21   . LEU A 1 16  ? 80.69009  8.24414   21.05526  1.000 23.54716 ? 34  LEU A HD21   1 
ATOM   259  H HD22   . LEU A 1 16  ? 79.40170  9.13209   21.32931  1.000 23.54716 ? 34  LEU A HD22   1 
ATOM   260  H HD23   . LEU A 1 16  ? 79.24112  7.62126   20.86551  1.000 23.54716 ? 34  LEU A HD23   1 
ATOM   261  N N      . ARG A 1 17  ? 80.73850  3.41308   23.70848  1.000 25.88495 ? 35  ARG A N      1 
ATOM   262  C CA     . ARG A 1 17  ? 81.51330  2.18019   23.82512  1.000 29.88508 ? 35  ARG A CA     1 
ATOM   263  C C      . ARG A 1 17  ? 80.84881  1.04052   23.06272  1.000 28.63154 ? 35  ARG A C      1 
ATOM   264  O O      . ARG A 1 17  ? 81.50953  0.30722   22.31958  1.000 27.76469 ? 35  ARG A O      1 
ATOM   265  C CB     . ARG A 1 17  ? 81.69299  1.79945   25.29804  1.000 35.11531 ? 35  ARG A CB     1 
ATOM   266  C CG     . ARG A 1 17  ? 82.60010  2.73482   26.09769  1.000 41.22311 ? 35  ARG A CG     1 
ATOM   267  C CD     . ARG A 1 17  ? 83.12237  2.06016   27.37053  1.000 46.77278 ? 35  ARG A CD     1 
ATOM   268  N NE     . ARG A 1 17  ? 82.04026  1.55938   28.22348  1.000 50.63192 ? 35  ARG A NE     1 
ATOM   269  C CZ     . ARG A 1 17  ? 81.49830  2.22939   29.24144  1.000 52.83936 ? 35  ARG A CZ     1 
ATOM   270  N NH1    . ARG A 1 17  ? 81.92883  3.44455   29.56385  1.000 53.35143 ? 35  ARG A NH1    1 
ATOM   271  N NH2    . ARG A 1 17  ? 80.51761  1.67887   29.94701  1.000 53.14809 ? 35  ARG A NH2    1 
ATOM   272  H H      . ARG A 1 17  ? 80.48670  3.74959   24.45879  1.000 31.06194 ? 35  ARG A H      1 
ATOM   273  H HA     . ARG A 1 17  ? 82.39197  2.33406   23.44411  1.000 35.86210 ? 35  ARG A HA     1 
ATOM   274  H HB2    . ARG A 1 17  ? 80.82200  1.80284   25.72498  1.000 42.13838 ? 35  ARG A HB2    1 
ATOM   275  H HB3    . ARG A 1 17  ? 82.08006  0.91106   25.34099  1.000 42.13838 ? 35  ARG A HB3    1 
ATOM   276  H HG2    . ARG A 1 17  ? 83.36152  2.98739   25.55240  1.000 49.46774 ? 35  ARG A HG2    1 
ATOM   277  H HG3    . ARG A 1 17  ? 82.09969  3.52491   26.35506  1.000 49.46774 ? 35  ARG A HG3    1 
ATOM   278  H HD2    . ARG A 1 17  ? 83.68363  1.30846   27.12391  1.000 56.12734 ? 35  ARG A HD2    1 
ATOM   279  H HD3    . ARG A 1 17  ? 83.63620  2.70381   27.88296  1.000 56.12734 ? 35  ARG A HD3    1 
ATOM   280  H HE     . ARG A 1 17  ? 81.73173  0.77456   28.05477  1.000 60.75830 ? 35  ARG A HE     1 
ATOM   281  H HH11   . ARG A 1 17  ? 82.56484  3.80882   29.11397  1.000 64.02172 ? 35  ARG A HH11   1 
ATOM   282  H HH12   . ARG A 1 17  ? 81.57143  3.86669   30.22239  1.000 64.02172 ? 35  ARG A HH12   1 
ATOM   283  H HH21   . ARG A 1 17  ? 80.23336  0.89217   29.74724  1.000 63.77771 ? 35  ARG A HH21   1 
ATOM   284  H HH22   . ARG A 1 17  ? 80.16660  2.10897   30.60383  1.000 63.77771 ? 35  ARG A HH22   1 
ATOM   285  N N      . ALA A 1 18  ? 79.53667  0.87248   23.23978  1.000 28.37416 ? 36  ALA A N      1 
ATOM   286  C CA     . ALA A 1 18  ? 78.83394  -0.21879  22.57317  1.000 27.92580 ? 36  ALA A CA     1 
ATOM   287  C C      . ALA A 1 18  ? 78.98661  -0.12356  21.06094  1.000 28.63684 ? 36  ALA A C      1 
ATOM   288  O O      . ALA A 1 18  ? 79.40515  -1.08386  20.40507  1.000 29.55473 ? 36  ALA A O      1 
ATOM   289  C CB     . ALA A 1 18  ? 77.35845  -0.20593  22.96907  1.000 27.53368 ? 36  ALA A CB     1 
ATOM   290  H H      . ALA A 1 18  ? 79.03888  1.37013   23.73389  1.000 34.04899 ? 36  ALA A H      1 
ATOM   291  H HA     . ALA A 1 18  ? 79.21644  -1.06222  22.86165  1.000 33.51096 ? 36  ALA A HA     1 
ATOM   292  H HB1    . ALA A 1 18  ? 76.90182  -0.92776  22.50933  1.000 33.04041 ? 36  ALA A HB1    1 
ATOM   293  H HB2    . ALA A 1 18  ? 77.28790  -0.32805  23.92876  1.000 33.04041 ? 36  ALA A HB2    1 
ATOM   294  H HB3    . ALA A 1 18  ? 76.97061  0.64597   22.71463  1.000 33.04041 ? 36  ALA A HB3    1 
ATOM   295  N N      . CYS A 1 19  ? 78.65328  1.03560   20.48760  1.000 28.07307 ? 37  CYS A N      1 
ATOM   296  C CA     . CYS A 1 19  ? 78.78579  1.20791   19.04564  1.000 26.33851 ? 37  CYS A CA     1 
ATOM   297  C C      . CYS A 1 19  ? 80.23101  1.04907   18.59489  1.000 24.88824 ? 37  CYS A C      1 
ATOM   298  O O      . CYS A 1 19  ? 80.48362  0.62560   17.46167  1.000 24.19699 ? 37  CYS A O      1 
ATOM   299  C CB     . CYS A 1 19  ? 78.25065  2.57716   18.63426  1.000 25.80145 ? 37  CYS A CB     1 
ATOM   300  S SG     . CYS A 1 19  ? 78.33215  2.88568   16.86774  1.000 26.22686 ? 37  CYS A SG     1 
ATOM   301  H H      . CYS A 1 19  ? 78.35330  1.72459   20.90583  1.000 33.68768 ? 37  CYS A H      1 
ATOM   302  H HA     . CYS A 1 19  ? 78.25581  0.52969   18.59838  1.000 31.60621 ? 37  CYS A HA     1 
ATOM   303  H HB2    . CYS A 1 19  ? 77.32106  2.64213   18.90360  1.000 30.96174 ? 37  CYS A HB2    1 
ATOM   304  H HB3    . CYS A 1 19  ? 78.77358  3.26250   19.07895  1.000 30.96174 ? 37  CYS A HB3    1 
ATOM   305  H HG     . CYS A 1 19  ? 77.89179  3.97876   16.64133  1.000 31.47223 ? 37  CYS A HG     1 
ATOM   306  N N      . PHE A 1 20  ? 81.19081  1.38768   19.46013  1.000 24.30473 ? 38  PHE A N      1 
ATOM   307  C CA     . PHE A 1 20  ? 82.59511  1.22369   19.10300  1.000 23.83875 ? 38  PHE A CA     1 
ATOM   308  C C      . PHE A 1 20  ? 82.97781  -0.24646  19.02739  1.000 25.97843 ? 38  PHE A C      1 
ATOM   309  O O      . PHE A 1 20  ? 83.80915  -0.62782  18.19547  1.000 25.31241 ? 38  PHE A O      1 
ATOM   310  C CB     . PHE A 1 20  ? 83.47978  1.95140   20.11312  1.000 21.78896 ? 38  PHE A CB     1 
ATOM   311  C CG     . PHE A 1 20  ? 84.93894  1.95436   19.75712  1.000 21.21104 ? 38  PHE A CG     1 
ATOM   312  C CD1    . PHE A 1 20  ? 85.75705  0.89444   20.11291  1.000 20.43163 ? 38  PHE A CD1    1 
ATOM   313  C CD2    . PHE A 1 20  ? 85.49898  3.02562   19.07932  1.000 21.67577 ? 38  PHE A CD2    1 
ATOM   314  C CE1    . PHE A 1 20  ? 87.10300  0.89607   19.79336  1.000 18.99113 ? 38  PHE A CE1    1 
ATOM   315  C CE2    . PHE A 1 20  ? 86.84905  3.03199   18.75647  1.000 20.81588 ? 38  PHE A CE2    1 
ATOM   316  C CZ     . PHE A 1 20  ? 87.64832  1.96366   19.11624  1.000 19.54983 ? 38  PHE A CZ     1 
ATOM   317  H H      . PHE A 1 20  ? 81.05520  1.70889   20.24628  1.000 29.16567 ? 38  PHE A H      1 
ATOM   318  H HA     . PHE A 1 20  ? 82.74811  1.62131   18.23157  1.000 28.60650 ? 38  PHE A HA     1 
ATOM   319  H HB2    . PHE A 1 20  ? 83.18884  2.87481   20.17274  1.000 26.14675 ? 38  PHE A HB2    1 
ATOM   320  H HB3    . PHE A 1 20  ? 83.38758  1.51813   20.97606  1.000 26.14675 ? 38  PHE A HB3    1 
ATOM   321  H HD1    . PHE A 1 20  ? 85.39618  0.17140   20.57322  1.000 24.51796 ? 38  PHE A HD1    1 
ATOM   322  H HD2    . PHE A 1 20  ? 84.96477  3.74771   18.83828  1.000 26.01092 ? 38  PHE A HD2    1 
ATOM   323  H HE1    . PHE A 1 20  ? 87.63943  0.17613   20.03588  1.000 22.78935 ? 38  PHE A HE1    1 
ATOM   324  H HE2    . PHE A 1 20  ? 87.21506  3.75411   18.29878  1.000 24.97905 ? 38  PHE A HE2    1 
ATOM   325  H HZ     . PHE A 1 20  ? 88.55315  1.96580   18.90133  1.000 23.45980 ? 38  PHE A HZ     1 
ATOM   326  N N      . GLU A 1 21  ? 82.38953  -1.08314  19.88443  1.000 29.37198 ? 39  GLU A N      1 
ATOM   327  C CA     . GLU A 1 21  ? 82.65039  -2.51478  19.80177  1.000 32.68060 ? 39  GLU A CA     1 
ATOM   328  C C      . GLU A 1 21  ? 81.98755  -3.11035  18.56816  1.000 34.34020 ? 39  GLU A C      1 
ATOM   329  O O      . GLU A 1 21  ? 82.56796  -3.97442  17.90202  1.000 35.06340 ? 39  GLU A O      1 
ATOM   330  C CB     . GLU A 1 21  ? 82.16952  -3.21117  21.07606  1.000 34.35416 ? 39  GLU A CB     1 
ATOM   331  C CG     . GLU A 1 21  ? 82.84793  -2.70463  22.34630  1.000 36.71177 ? 39  GLU A CG     1 
ATOM   332  C CD     . GLU A 1 21  ? 82.43720  -3.47914  23.58573  1.000 39.60066 ? 39  GLU A CD     1 
ATOM   333  O OE1    . GLU A 1 21  ? 82.22175  -4.70738  23.47583  1.000 40.82469 ? 39  GLU A OE1    1 
ATOM   334  O OE2    . GLU A 1 21  ? 82.32781  -2.85966  24.66943  1.000 40.28573 ? 39  GLU A OE2    1 
ATOM   335  H H      . GLU A 1 21  ? 81.84672  -0.85007  20.50944  1.000 35.24637 ? 39  GLU A H      1 
ATOM   336  H HA     . GLU A 1 21  ? 83.60629  -2.66419  19.73231  1.000 39.21672 ? 39  GLU A HA     1 
ATOM   337  H HB2    . GLU A 1 21  ? 81.21545  -3.06399  21.17088  1.000 41.22499 ? 39  GLU A HB2    1 
ATOM   338  H HB3    . GLU A 1 21  ? 82.35285  -4.16070  21.00076  1.000 41.22499 ? 39  GLU A HB3    1 
ATOM   339  H HG2    . GLU A 1 21  ? 83.80900  -2.78898  22.24566  1.000 44.05412 ? 39  GLU A HG2    1 
ATOM   340  H HG3    . GLU A 1 21  ? 82.60894  -1.77437  22.48199  1.000 44.05412 ? 39  GLU A HG3    1 
ATOM   341  N N      . ARG A 1 22  ? 80.77960  -2.64850  18.23942  1.000 36.16569 ? 40  ARG A N      1 
ATOM   342  C CA     . ARG A 1 22  ? 80.13356  -3.06833  17.00067  1.000 38.81590 ? 40  ARG A CA     1 
ATOM   343  C C      . ARG A 1 22  ? 81.03128  -2.77790  15.80544  1.000 36.75512 ? 40  ARG A C      1 
ATOM   344  O O      . ARG A 1 22  ? 81.42191  -3.68735  15.06692  1.000 37.34102 ? 40  ARG A O      1 
ATOM   345  C CB     . ARG A 1 22  ? 78.78160  -2.36557  16.84673  1.000 44.11237 ? 40  ARG A CB     1 
ATOM   346  C CG     . ARG A 1 22  ? 77.58978  -3.31146  16.74026  1.000 48.62168 ? 40  ARG A CG     1 
ATOM   347  C CD     . ARG A 1 22  ? 76.30652  -2.56480  16.39507  1.000 52.20690 ? 40  ARG A CD     1 
ATOM   348  N NE     . ARG A 1 22  ? 76.41628  -1.83636  15.13055  1.000 55.32924 ? 40  ARG A NE     1 
ATOM   349  C CZ     . ARG A 1 22  ? 75.44350  -1.10089  14.59666  1.000 57.24919 ? 40  ARG A CZ     1 
ATOM   350  N NH1    . ARG A 1 22  ? 74.27078  -0.98862  15.21170  1.000 58.19863 ? 40  ARG A NH1    1 
ATOM   351  N NH2    . ARG A 1 22  ? 75.64241  -0.47511  13.44334  1.000 57.12128 ? 40  ARG A NH2    1 
ATOM   352  H H      . ARG A 1 22  ? 80.31938  -2.09717  18.71252  1.000 43.39883 ? 40  ARG A H      1 
ATOM   353  H HA     . ARG A 1 22  ? 79.96931  -4.02359  17.03806  1.000 46.57908 ? 40  ARG A HA     1 
ATOM   354  H HB2    . ARG A 1 22  ? 78.63791  -1.79809  17.62017  1.000 52.93485 ? 40  ARG A HB2    1 
ATOM   355  H HB3    . ARG A 1 22  ? 78.80251  -1.82761  16.03984  1.000 52.93485 ? 40  ARG A HB3    1 
ATOM   356  H HG2    . ARG A 1 22  ? 77.75931  -3.96335  16.04226  1.000 58.34602 ? 40  ARG A HG2    1 
ATOM   357  H HG3    . ARG A 1 22  ? 77.46062  -3.76119  17.58995  1.000 58.34602 ? 40  ARG A HG3    1 
ATOM   358  H HD2    . ARG A 1 22  ? 75.57896  -3.20135  16.31531  1.000 62.64828 ? 40  ARG A HD2    1 
ATOM   359  H HD3    . ARG A 1 22  ? 76.11162  -1.92445  17.09711  1.000 62.64828 ? 40  ARG A HD3    1 
ATOM   360  H HE     . ARG A 1 22  ? 77.16064  -1.88691  14.70279  1.000 66.39509 ? 40  ARG A HE     1 
ATOM   361  H HH11   . ARG A 1 22  ? 74.13681  -1.39240  15.95910  1.000 69.83836 ? 40  ARG A HH11   1 
ATOM   362  H HH12   . ARG A 1 22  ? 73.64585  -0.51219  14.86229  1.000 69.83836 ? 40  ARG A HH12   1 
ATOM   363  H HH21   . ARG A 1 22  ? 76.39943  -0.54483  13.04126  1.000 68.54554 ? 40  ARG A HH21   1 
ATOM   364  H HH22   . ARG A 1 22  ? 75.01429  0.00013   13.09805  1.000 68.54554 ? 40  ARG A HH22   1 
ATOM   365  N N      . ASN A 1 23  ? 81.37783  -1.51092  15.60576  1.000 35.47622 ? 41  ASN A N      1 
ATOM   366  C CA     . ASN A 1 23  ? 82.31187  -1.14139  14.55241  1.000 34.32922 ? 41  ASN A CA     1 
ATOM   367  C C      . ASN A 1 23  ? 83.07477  0.11355   14.96198  1.000 31.10711 ? 41  ASN A C      1 
ATOM   368  O O      . ASN A 1 23  ? 82.45727  1.16408   15.18182  1.000 30.65754 ? 41  ASN A O      1 
ATOM   369  C CB     . ASN A 1 23  ? 81.58375  -0.91613  13.22735  1.000 35.81265 ? 41  ASN A CB     1 
ATOM   370  C CG     . ASN A 1 23  ? 82.53740  -0.63020  12.08232  1.000 37.45000 ? 41  ASN A CG     1 
ATOM   371  O OD1    . ASN A 1 23  ? 83.40185  -1.44601  11.75780  1.000 38.20494 ? 41  ASN A OD1    1 
ATOM   372  N ND2    . ASN A 1 23  ? 82.37686  0.52705   11.45565  1.000 38.09863 ? 41  ASN A ND2    1 
ATOM   373  H H      . ASN A 1 23  ? 81.08494  -0.84741  16.06790  1.000 42.57146 ? 41  ASN A H      1 
ATOM   374  H HA     . ASN A 1 23  ? 82.94779  -1.86205  14.42149  1.000 41.19506 ? 41  ASN A HA     1 
ATOM   375  H HB2    . ASN A 1 23  ? 81.07642  -1.71240  13.00492  1.000 42.97518 ? 41  ASN A HB2    1 
ATOM   376  H HB3    . ASN A 1 23  ? 80.98672  -0.15710  13.31860  1.000 42.97518 ? 41  ASN A HB3    1 
ATOM   377  H HD21   . ASN A 1 23  ? 82.89235  0.73600   10.79975  1.000 45.71836 ? 41  ASN A HD21   1 
ATOM   378  H HD22   . ASN A 1 23  ? 81.75723  1.06877   11.70506  1.000 45.71836 ? 41  ASN A HD22   1 
ATOM   379  N N      . PRO A 1 24  ? 84.40360  0.05053   15.08036  1.000 28.37986 ? 42  PRO A N      1 
ATOM   380  C CA     . PRO A 1 24  ? 85.17665  1.24377   15.43989  1.000 26.75581 ? 42  PRO A CA     1 
ATOM   381  C C      . PRO A 1 24  ? 85.49850  2.16161   14.27139  1.000 25.99021 ? 42  PRO A C      1 
ATOM   382  O O      . PRO A 1 24  ? 86.24345  3.12857   14.46412  1.000 27.41094 ? 42  PRO A O      1 
ATOM   383  C CB     . PRO A 1 24  ? 86.46006  0.64596   16.02628  1.000 26.30410 ? 42  PRO A CB     1 
ATOM   384  C CG     . PRO A 1 24  ? 86.64882  -0.59734  15.26653  1.000 26.72062 ? 42  PRO A CG     1 
ATOM   385  C CD     . PRO A 1 24  ? 85.27445  -1.13296  14.96119  1.000 27.47069 ? 42  PRO A CD     1 
ATOM   386  H HA     . PRO A 1 24  ? 84.71820  1.74996   16.12873  1.000 32.10697 ? 42  PRO A HA     1 
ATOM   387  H HB2    . PRO A 1 24  ? 87.20362  1.25467   15.89406  1.000 31.56492 ? 42  PRO A HB2    1 
ATOM   388  H HB3    . PRO A 1 24  ? 86.34336  0.46528   16.97213  1.000 31.56492 ? 42  PRO A HB3    1 
ATOM   389  H HG2    . PRO A 1 24  ? 87.12906  -0.40518  14.44596  1.000 32.06475 ? 42  PRO A HG2    1 
ATOM   390  H HG3    . PRO A 1 24  ? 87.14953  -1.23147  15.80325  1.000 32.06475 ? 42  PRO A HG3    1 
ATOM   391  H HD2    . PRO A 1 24  ? 85.23915  -1.49645  14.06256  1.000 32.96483 ? 42  PRO A HD2    1 
ATOM   392  H HD3    . PRO A 1 24  ? 85.01997  -1.81299  15.60437  1.000 32.96483 ? 42  PRO A HD3    1 
ATOM   393  N N      . TYR A 1 25  ? 84.98455  1.88883   13.07337  1.000 23.43793 ? 43  TYR A N      1 
ATOM   394  C CA     . TYR A 1 25  ? 85.17205  2.75929   11.91165  1.000 20.83380 ? 43  TYR A CA     1 
ATOM   395  C C      . TYR A 1 25  ? 83.81358  3.08832   11.31313  1.000 20.80568 ? 43  TYR A C      1 
ATOM   396  O O      . TYR A 1 25  ? 83.53044  2.76951   10.15394  1.000 20.97494 ? 43  TYR A O      1 
ATOM   397  C CB     . TYR A 1 25  ? 86.08081  2.10477   10.87427  1.000 19.23543 ? 43  TYR A CB     1 
ATOM   398  C CG     . TYR A 1 25  ? 87.50761  1.93566   11.33180  1.000 18.57960 ? 43  TYR A CG     1 
ATOM   399  C CD1    . TYR A 1 25  ? 87.89265  0.82447   12.06061  1.000 18.23504 ? 43  TYR A CD1    1 
ATOM   400  C CD2    . TYR A 1 25  ? 88.47129  2.88443   11.02982  1.000 19.12468 ? 43  TYR A CD2    1 
ATOM   401  C CE1    . TYR A 1 25  ? 89.19565  0.66200   12.47873  1.000 18.35721 ? 43  TYR A CE1    1 
ATOM   402  C CE2    . TYR A 1 25  ? 89.77836  2.72978   11.44378  1.000 18.67825 ? 43  TYR A CE2    1 
ATOM   403  C CZ     . TYR A 1 25  ? 90.13183  1.61961   12.16944  1.000 18.76790 ? 43  TYR A CZ     1 
ATOM   404  O OH     . TYR A 1 25  ? 91.43125  1.46549   12.58626  1.000 19.75445 ? 43  TYR A OH     1 
ATOM   405  H H      . TYR A 1 25  ? 84.51289  1.18989   12.90420  1.000 28.12551 ? 43  TYR A H      1 
ATOM   406  H HA     . TYR A 1 25  ? 85.59654  3.58321   12.19777  1.000 25.00056 ? 43  TYR A HA     1 
ATOM   407  H HB2    . TYR A 1 25  ? 85.73120  1.22441   10.66537  1.000 23.08251 ? 43  TYR A HB2    1 
ATOM   408  H HB3    . TYR A 1 25  ? 86.08982  2.65610   10.07623  1.000 23.08251 ? 43  TYR A HB3    1 
ATOM   409  H HD1    . TYR A 1 25  ? 87.26087  0.17561   12.27209  1.000 21.88204 ? 43  TYR A HD1    1 
ATOM   410  H HD2    . TYR A 1 25  ? 88.23305  3.63815   10.53986  1.000 22.94961 ? 43  TYR A HD2    1 
ATOM   411  H HE1    . TYR A 1 25  ? 89.43999  -0.09081  12.96708  1.000 22.02865 ? 43  TYR A HE1    1 
ATOM   412  H HE2    . TYR A 1 25  ? 90.41558  3.37339   11.23255  1.000 22.41390 ? 43  TYR A HE2    1 
ATOM   413  H HH     . TYR A 1 25  ? 91.61512  0.64898   12.65771  1.000 23.70533 ? 43  TYR A HH     1 
ATOM   414  N N      . PRO A 1 26  ? 82.94205  3.72948   12.08489  1.000 20.05891 ? 44  PRO A N      1 
ATOM   415  C CA     . PRO A 1 26  ? 81.59738  4.02122   11.58791  1.000 18.95060 ? 44  PRO A CA     1 
ATOM   416  C C      . PRO A 1 26  ? 81.62151  5.05853   10.48271  1.000 18.69310 ? 44  PRO A C      1 
ATOM   417  O O      . PRO A 1 26  ? 82.43877  5.98302   10.47937  1.000 17.59280 ? 44  PRO A O      1 
ATOM   418  C CB     . PRO A 1 26  ? 80.87283  4.55347   12.82688  1.000 19.05438 ? 44  PRO A CB     1 
ATOM   419  C CG     . PRO A 1 26  ? 81.95096  5.15898   13.64290  1.000 18.83985 ? 44  PRO A CG     1 
ATOM   420  C CD     . PRO A 1 26  ? 83.16031  4.28590   13.43015  1.000 19.60008 ? 44  PRO A CD     1 
ATOM   421  H HA     . PRO A 1 26  ? 81.16326  3.21422   11.26978  1.000 22.74073 ? 44  PRO A HA     1 
ATOM   422  H HB2    . PRO A 1 26  ? 80.21388  5.21692   12.56896  1.000 22.86526 ? 44  PRO A HB2    1 
ATOM   423  H HB3    . PRO A 1 26  ? 80.44210  3.82474   13.30050  1.000 22.86526 ? 44  PRO A HB3    1 
ATOM   424  H HG2    . PRO A 1 26  ? 82.12238  6.06443   13.34011  1.000 22.60781 ? 44  PRO A HG2    1 
ATOM   425  H HG3    . PRO A 1 26  ? 81.69091  5.16530   14.57737  1.000 22.60781 ? 44  PRO A HG3    1 
ATOM   426  H HD2    . PRO A 1 26  ? 83.97509  4.81147   13.45857  1.000 23.52010 ? 44  PRO A HD2    1 
ATOM   427  H HD3    . PRO A 1 26  ? 83.19768  3.57977   14.09414  1.000 23.52010 ? 44  PRO A HD3    1 
ATOM   428  N N      . GLY A 1 27  ? 80.71057  4.88411   9.52845   1.000 19.38919 ? 45  GLY A N      1 
ATOM   429  C CA     . GLY A 1 27  ? 80.50453  5.86380   8.48796   1.000 19.56117 ? 45  GLY A CA     1 
ATOM   430  C C      . GLY A 1 27  ? 79.66426  7.02155   8.98257   1.000 20.00673 ? 45  GLY A C      1 
ATOM   431  O O      . GLY A 1 27  ? 79.23981  7.07891   10.13691  1.000 19.53981 ? 45  GLY A O      1 
ATOM   432  H H      . GLY A 1 27  ? 80.19759  4.19651   9.46795   1.000 23.26703 ? 45  GLY A H      1 
ATOM   433  H HA2    . GLY A 1 27  ? 81.36142  6.20709   8.19000   1.000 23.47340 ? 45  GLY A HA2    1 
ATOM   434  H HA3    . GLY A 1 27  ? 80.05152  5.45008   7.73662   1.000 23.47340 ? 45  GLY A HA3    1 
ATOM   435  N N      . ILE A 1 28  ? 79.41566  7.96576   8.07400   1.000 20.58575 ? 46  ILE A N      1 
ATOM   436  C CA     . ILE A 1 28  ? 78.63869  9.14615   8.43769   1.000 21.60200 ? 46  ILE A CA     1 
ATOM   437  C C      . ILE A 1 28  ? 77.23833  8.74664   8.88112   1.000 23.31937 ? 46  ILE A C      1 
ATOM   438  O O      . ILE A 1 28  ? 76.70082  9.28994   9.85429   1.000 24.40950 ? 46  ILE A O      1 
ATOM   439  C CB     . ILE A 1 28  ? 78.60262  10.15097  7.27043   1.000 22.19916 ? 46  ILE A CB     1 
ATOM   440  C CG1    . ILE A 1 28  ? 77.67849  11.32651  7.59797   1.000 21.46758 ? 46  ILE A CG1    1 
ATOM   441  C CG2    . ILE A 1 28  ? 78.15755  9.48308   5.97221   1.000 23.36823 ? 46  ILE A CG2    1 
ATOM   442  C CD1    . ILE A 1 28  ? 78.04605  12.05403  8.86181   1.000 21.14438 ? 46  ILE A CD1    1 
ATOM   443  H H      . ILE A 1 28  ? 79.68090  7.94620   7.25616   1.000 24.70290 ? 46  ILE A H      1 
ATOM   444  H HA     . ILE A 1 28  ? 79.07578  9.57996   9.18713   1.000 25.92240 ? 46  ILE A HA     1 
ATOM   445  H HB     . ILE A 1 28  ? 79.50573  10.48312  7.14806   1.000 26.63899 ? 46  ILE A HB     1 
ATOM   446  H HG12   . ILE A 1 28  ? 77.71502  11.96441  6.86815   1.000 25.76110 ? 46  ILE A HG12   1 
ATOM   447  H HG13   . ILE A 1 28  ? 76.77379  10.99228  7.70149   1.000 25.76110 ? 46  ILE A HG13   1 
ATOM   448  H HG21   . ILE A 1 28  ? 78.82309  8.82805   5.70976   1.000 28.04187 ? 46  ILE A HG21   1 
ATOM   449  H HG22   . ILE A 1 28  ? 78.06969  10.15984  5.28288   1.000 28.04187 ? 46  ILE A HG22   1 
ATOM   450  H HG23   . ILE A 1 28  ? 77.30359  9.04678   6.11816   1.000 28.04187 ? 46  ILE A HG23   1 
ATOM   451  H HD11   . ILE A 1 28  ? 77.89549  11.46709  9.61926   1.000 25.37325 ? 46  ILE A HD11   1 
ATOM   452  H HD12   . ILE A 1 28  ? 77.49261  12.84657  8.94233   1.000 25.37325 ? 46  ILE A HD12   1 
ATOM   453  H HD13   . ILE A 1 28  ? 78.98162  12.30676  8.82002   1.000 25.37325 ? 46  ILE A HD13   1 
ATOM   454  N N      . ALA A 1 29  ? 76.62830  7.78420   8.18951   1.000 23.73003 ? 47  ALA A N      1 
ATOM   455  C CA     . ALA A 1 29  ? 75.27315  7.38059   8.54567   1.000 24.63494 ? 47  ALA A CA     1 
ATOM   456  C C      . ALA A 1 29  ? 75.23024  6.82186   9.95997   1.000 23.31651 ? 47  ALA A C      1 
ATOM   457  O O      . ALA A 1 29  ? 74.36705  7.19369   10.76088  1.000 24.42284 ? 47  ALA A O      1 
ATOM   458  C CB     . ALA A 1 29  ? 74.74339  6.35825   7.53834   1.000 26.43193 ? 47  ALA A CB     1 
ATOM   459  H H      . ALA A 1 29  ? 76.97056  7.35934   7.52472   1.000 28.47603 ? 47  ALA A H      1 
ATOM   460  H HA     . ALA A 1 29  ? 74.69348  8.15747   8.50909   1.000 29.56192 ? 47  ALA A HA     1 
ATOM   461  H HB1    . ALA A 1 29  ? 73.87169  6.04921   7.83080   1.000 31.71832 ? 47  ALA A HB1    1 
ATOM   462  H HB2    . ALA A 1 29  ? 74.66973  6.78099   6.66842   1.000 31.71832 ? 47  ALA A HB2    1 
ATOM   463  H HB3    . ALA A 1 29  ? 75.36068  5.61145   7.49200   1.000 31.71832 ? 47  ALA A HB3    1 
ATOM   464  N N      . THR A 1 30  ? 76.16461  5.93150   10.28953  1.000 21.67682 ? 48  THR A N      1 
ATOM   465  C CA     . THR A 1 30  ? 76.20812  5.37692   11.63719  1.000 20.80990 ? 48  THR A CA     1 
ATOM   466  C C      . THR A 1 30  ? 76.39067  6.48180   12.66979  1.000 20.97516 ? 48  THR A C      1 
ATOM   467  O O      . THR A 1 30  ? 75.65830  6.54973   13.66413  1.000 20.81907 ? 48  THR A O      1 
ATOM   468  C CB     . THR A 1 30  ? 77.33517  4.34858   11.73812  1.000 20.48278 ? 48  THR A CB     1 
ATOM   469  O OG1    . THR A 1 30  ? 77.20712  3.39208   10.67863  1.000 21.07281 ? 48  THR A OG1    1 
ATOM   470  C CG2    . THR A 1 30  ? 77.28467  3.62644   13.06754  1.000 19.94983 ? 48  THR A CG2    1 
ATOM   471  H H      . THR A 1 30  ? 76.77455  5.63732   9.75940   1.000 26.01218 ? 48  THR A H      1 
ATOM   472  H HA     . THR A 1 30  ? 75.37061  4.92430   11.82326  1.000 24.97188 ? 48  THR A HA     1 
ATOM   473  H HB     . THR A 1 30  ? 78.19005  4.80163   11.66860  1.000 24.57934 ? 48  THR A HB     1 
ATOM   474  H HG1    . THR A 1 30  ? 77.85217  2.85436   10.69751  1.000 25.28737 ? 48  THR A HG1    1 
ATOM   475  H HG21   . THR A 1 30  ? 77.45462  4.25028   13.79061  1.000 23.93979 ? 48  THR A HG21   1 
ATOM   476  H HG22   . THR A 1 30  ? 77.95631  2.92697   13.09085  1.000 23.93979 ? 48  THR A HG22   1 
ATOM   477  H HG23   . THR A 1 30  ? 76.40988  3.22727   13.19523  1.000 23.93979 ? 48  THR A HG23   1 
ATOM   478  N N      . ARG A 1 31  ? 77.36152  7.36808   12.44047  1.000 20.86240 ? 49  ARG A N      1 
ATOM   479  C CA     . ARG A 1 31  ? 77.62684  8.44228   13.39005  1.000 19.94927 ? 49  ARG A CA     1 
ATOM   480  C C      . ARG A 1 31  ? 76.38690  9.30149   13.60586  1.000 20.45944 ? 49  ARG A C      1 
ATOM   481  O O      . ARG A 1 31  ? 75.99860  9.57392   14.74705  1.000 19.24153 ? 49  ARG A O      1 
ATOM   482  C CB     . ARG A 1 31  ? 78.79832  9.29173   12.89765  1.000 18.74465 ? 49  ARG A CB     1 
ATOM   483  C CG     . ARG A 1 31  ? 80.12216  8.54463   12.86927  1.000 17.89785 ? 49  ARG A CG     1 
ATOM   484  C CD     . ARG A 1 31  ? 81.31510  9.48776   12.79865  1.000 17.23667 ? 49  ARG A CD     1 
ATOM   485  N NE     . ARG A 1 31  ? 81.35611  10.27679  11.56774  1.000 15.17820 ? 49  ARG A NE     1 
ATOM   486  C CZ     . ARG A 1 31  ? 81.83280  9.83511   10.41045  1.000 13.70633 ? 49  ARG A CZ     1 
ATOM   487  N NH1    . ARG A 1 31  ? 82.29916  8.59786   10.31418  1.000 13.02416 ? 49  ARG A NH1    1 
ATOM   488  N NH2    . ARG A 1 31  ? 81.83285  10.62786  9.34423   1.000 14.39842 ? 49  ARG A NH2    1 
ATOM   489  H H      . ARG A 1 31  ? 77.87403  7.36784   11.74987  1.000 25.03488 ? 49  ARG A H      1 
ATOM   490  H HA     . ARG A 1 31  ? 77.87356  8.05485   14.24440  1.000 23.93913 ? 49  ARG A HA     1 
ATOM   491  H HB2    . ARG A 1 31  ? 78.60819  9.59315   11.99548  1.000 22.49358 ? 49  ARG A HB2    1 
ATOM   492  H HB3    . ARG A 1 31  ? 78.90069  10.05477  13.48772  1.000 22.49358 ? 49  ARG A HB3    1 
ATOM   493  H HG2    . ARG A 1 31  ? 80.20520  8.01312   13.67643  1.000 21.47742 ? 49  ARG A HG2    1 
ATOM   494  H HG3    . ARG A 1 31  ? 80.14620  7.96888   12.08899  1.000 21.47742 ? 49  ARG A HG3    1 
ATOM   495  H HD2    . ARG A 1 31  ? 81.27281  10.10451  13.54613  1.000 20.68401 ? 49  ARG A HD2    1 
ATOM   496  H HD3    . ARG A 1 31  ? 82.13147  8.96592   12.84489  1.000 20.68401 ? 49  ARG A HD3    1 
ATOM   497  H HE     . ARG A 1 31  ? 81.05106  11.08038  11.59574  1.000 18.21384 ? 49  ARG A HE     1 
ATOM   498  H HH11   . ARG A 1 31  ? 82.29286  8.08125   11.00169  1.000 15.62899 ? 49  ARG A HH11   1 
ATOM   499  H HH12   . ARG A 1 31  ? 82.60798  8.31187   9.56422   1.000 15.62899 ? 49  ARG A HH12   1 
ATOM   500  H HH21   . ARG A 1 31  ? 81.52377  11.42821  9.40346   1.000 17.27810 ? 49  ARG A HH21   1 
ATOM   501  H HH22   . ARG A 1 31  ? 82.14196  10.34065  8.59486   1.000 17.27810 ? 49  ARG A HH22   1 
ATOM   502  N N      . GLU A 1 32  ? 75.75037  9.73945   12.51518  1.000 22.31757 ? 50  GLU A N      1 
ATOM   503  C CA     . GLU A 1 32  ? 74.52823  10.52934  12.63937  1.000 22.84450 ? 50  GLU A CA     1 
ATOM   504  C C      . GLU A 1 32  ? 73.42725  9.73270   13.32847  1.000 22.26201 ? 50  GLU A C      1 
ATOM   505  O O      . GLU A 1 32  ? 72.63634  10.28898  14.09758  1.000 20.90822 ? 50  GLU A O      1 
ATOM   506  C CB     . GLU A 1 32  ? 74.06860  11.00112  11.25917  1.000 24.05470 ? 50  GLU A CB     1 
ATOM   507  C CG     . GLU A 1 32  ? 74.93827  12.09765  10.64345  1.000 25.68542 ? 50  GLU A CG     1 
ATOM   508  C CD     . GLU A 1 32  ? 74.53079  12.45089  9.21845   1.000 27.66532 ? 50  GLU A CD     1 
ATOM   509  O OE1    . GLU A 1 32  ? 73.79272  11.65799  8.58950   1.000 27.98279 ? 50  GLU A OE1    1 
ATOM   510  O OE2    . GLU A 1 32  ? 74.95238  13.52281  8.72557   1.000 28.12633 ? 50  GLU A OE2    1 
ATOM   511  H H      . GLU A 1 32  ? 76.00264  9.59441   11.70590  1.000 26.78109 ? 50  GLU A H      1 
ATOM   512  H HA     . GLU A 1 32  ? 74.71369  11.31407  13.17854  1.000 27.41340 ? 50  GLU A HA     1 
ATOM   513  H HB2    . GLU A 1 32  ? 74.07998  10.24330  10.65380  1.000 28.86563 ? 50  GLU A HB2    1 
ATOM   514  H HB3    . GLU A 1 32  ? 73.16704  11.35061  11.33632  1.000 28.86563 ? 50  GLU A HB3    1 
ATOM   515  H HG2    . GLU A 1 32  ? 74.86307  12.89994  11.18341  1.000 30.82250 ? 50  GLU A HG2    1 
ATOM   516  H HG3    . GLU A 1 32  ? 75.85986  11.79560  10.62462  1.000 30.82250 ? 50  GLU A HG3    1 
ATOM   517  N N      . ARG A 1 33  ? 73.35802  8.42696   13.06260  1.000 24.06349 ? 51  ARG A N      1 
ATOM   518  C CA     . ARG A 1 33  ? 72.37698  7.58622   13.74035  1.000 26.08674 ? 51  ARG A CA     1 
ATOM   519  C C      . ARG A 1 33  ? 72.64825  7.53721   15.23761  1.000 25.57324 ? 51  ARG A C      1 
ATOM   520  O O      . ARG A 1 33  ? 71.71732  7.58222   16.05181  1.000 26.43799 ? 51  ARG A O      1 
ATOM   521  C CB     . ARG A 1 33  ? 72.40013  6.17885   13.14459  1.000 29.54360 ? 51  ARG A CB     1 
ATOM   522  C CG     . ARG A 1 33  ? 71.24010  5.29818   13.56599  1.000 33.84374 ? 51  ARG A CG     1 
ATOM   523  C CD     . ARG A 1 33  ? 71.43343  3.84362   13.11971  1.000 38.36306 ? 51  ARG A CD     1 
ATOM   524  N NE     . ARG A 1 33  ? 71.67183  3.71890   11.67448  1.000 42.59358 ? 51  ARG A NE     1 
ATOM   525  C CZ     . ARG A 1 33  ? 72.80350  3.28821   11.11047  1.000 44.53832 ? 51  ARG A CZ     1 
ATOM   526  N NH1    . ARG A 1 33  ? 73.84320  2.91072   11.84760  1.000 45.54230 ? 51  ARG A NH1    1 
ATOM   527  N NH2    . ARG A 1 33  ? 72.89468  3.22308   9.78879   1.000 44.49182 ? 51  ARG A NH2    1 
ATOM   528  H H      . ARG A 1 33  ? 73.86056  8.01087   12.50231  1.000 28.87619 ? 51  ARG A H      1 
ATOM   529  H HA     . ARG A 1 33  ? 71.49079  7.95636   13.60408  1.000 31.30409 ? 51  ARG A HA     1 
ATOM   530  H HB2    . ARG A 1 33  ? 72.37594  6.25233   12.17768  1.000 35.45232 ? 51  ARG A HB2    1 
ATOM   531  H HB3    . ARG A 1 33  ? 73.21835  5.73881   13.42349  1.000 35.45232 ? 51  ARG A HB3    1 
ATOM   532  H HG2    . ARG A 1 33  ? 71.16392  5.31090   14.53291  1.000 40.61248 ? 51  ARG A HG2    1 
ATOM   533  H HG3    . ARG A 1 33  ? 70.42279  5.63227   13.16438  1.000 40.61248 ? 51  ARG A HG3    1 
ATOM   534  H HD2    . ARG A 1 33  ? 72.19917  3.46975   13.58315  1.000 46.03567 ? 51  ARG A HD2    1 
ATOM   535  H HD3    . ARG A 1 33  ? 70.63485  3.33750   13.33652  1.000 46.03567 ? 51  ARG A HD3    1 
ATOM   536  H HE     . ARG A 1 33  ? 71.02915  3.94180   11.14829  1.000 51.11230 ? 51  ARG A HE     1 
ATOM   537  H HH11   . ARG A 1 33  ? 73.79552  2.94097   12.70574  1.000 54.65076 ? 51  ARG A HH11   1 
ATOM   538  H HH12   . ARG A 1 33  ? 74.56357  2.63625   11.46637  1.000 54.65076 ? 51  ARG A HH12   1 
ATOM   539  H HH21   . ARG A 1 33  ? 72.22729  3.45748   9.29966   1.000 53.39019 ? 51  ARG A HH21   1 
ATOM   540  H HH22   . ARG A 1 33  ? 73.62118  2.94645   9.42100   1.000 53.39019 ? 51  ARG A HH22   1 
ATOM   541  N N      . LEU A 1 34  ? 73.92168  7.44603   15.61965  1.000 23.52475 ? 52  LEU A N      1 
ATOM   542  C CA     . LEU A 1 34  ? 74.26859  7.45455   17.03463  1.000 21.55516 ? 52  LEU A CA     1 
ATOM   543  C C      . LEU A 1 34  ? 74.11953  8.85050   17.62539  1.000 20.81642 ? 52  LEU A C      1 
ATOM   544  O O      . LEU A 1 34  ? 73.57998  9.01163   18.72547  1.000 20.49049 ? 52  LEU A O      1 
ATOM   545  C CB     . LEU A 1 34  ? 75.69255  6.93869   17.21502  1.000 21.34150 ? 52  LEU A CB     1 
ATOM   546  C CG     . LEU A 1 34  ? 76.19483  6.84145   18.65050  1.000 23.21526 ? 52  LEU A CG     1 
ATOM   547  C CD1    . LEU A 1 34  ? 75.40722  5.80025   19.42292  1.000 24.22414 ? 52  LEU A CD1    1 
ATOM   548  C CD2    . LEU A 1 34  ? 77.68816  6.52186   18.66870  1.000 24.23567 ? 52  LEU A CD2    1 
ATOM   549  H H      . LEU A 1 34  ? 74.59284  7.37926   15.08608  1.000 28.22970 ? 52  LEU A H      1 
ATOM   550  H HA     . LEU A 1 34  ? 73.66990  6.86224   17.51591  1.000 25.86619 ? 52  LEU A HA     1 
ATOM   551  H HB2    . LEU A 1 34  ? 75.74161  6.04829   16.83333  1.000 25.60980 ? 52  LEU A HB2    1 
ATOM   552  H HB3    . LEU A 1 34  ? 76.29226  7.53616   16.74145  1.000 25.60980 ? 52  LEU A HB3    1 
ATOM   553  H HG     . LEU A 1 34  ? 76.06581  7.69515   19.09261  1.000 27.85832 ? 52  LEU A HG     1 
ATOM   554  H HD11   . LEU A 1 34  ? 74.47944  6.07891   19.47271  1.000 29.06897 ? 52  LEU A HD11   1 
ATOM   555  H HD12   . LEU A 1 34  ? 75.77763  5.72251   20.31603  1.000 29.06897 ? 52  LEU A HD12   1 
ATOM   556  H HD13   . LEU A 1 34  ? 75.47267  4.94903   18.96242  1.000 29.06897 ? 52  LEU A HD13   1 
ATOM   557  H HD21   . LEU A 1 34  ? 77.85767  5.77116   18.07826  1.000 29.08280 ? 52  LEU A HD21   1 
ATOM   558  H HD22   . LEU A 1 34  ? 77.95184  6.29636   19.57453  1.000 29.08280 ? 52  LEU A HD22   1 
ATOM   559  H HD23   . LEU A 1 34  ? 78.18133  7.29981   18.36460  1.000 29.08280 ? 52  LEU A HD23   1 
ATOM   560  N N      . ALA A 1 35  ? 74.58412  9.87156   16.90395  1.000 20.81188 ? 53  ALA A N      1 
ATOM   561  C CA     . ALA A 1 35  ? 74.46079  11.24390  17.38138  1.000 21.56975 ? 53  ALA A CA     1 
ATOM   562  C C      . ALA A 1 35  ? 73.02650  11.55998  17.77373  1.000 22.29694 ? 53  ALA A C      1 
ATOM   563  O O      . ALA A 1 35  ? 72.77221  12.13366  18.83770  1.000 21.58894 ? 53  ALA A O      1 
ATOM   564  C CB     . ALA A 1 35  ? 74.94107  12.21656  16.30367  1.000 22.94769 ? 53  ALA A CB     1 
ATOM   565  H H      . ALA A 1 35  ? 74.97197  9.79538   16.14016  1.000 24.97426 ? 53  ALA A H      1 
ATOM   566  H HA     . ALA A 1 35  ? 75.02324  11.35294  18.16410  1.000 25.88370 ? 53  ALA A HA     1 
ATOM   567  H HB1    . ALA A 1 35  ? 74.81972  13.12499  16.62139  1.000 27.53722 ? 53  ALA A HB1    1 
ATOM   568  H HB2    . ALA A 1 35  ? 75.88002  12.05132  16.12490  1.000 27.53722 ? 53  ALA A HB2    1 
ATOM   569  H HB3    . ALA A 1 35  ? 74.42104  12.07603  15.49700  1.000 27.53722 ? 53  ALA A HB3    1 
ATOM   570  N N      . GLN A 1 36  ? 72.07046  11.19481  16.91544  1.000 24.77871 ? 54  GLN A N      1 
ATOM   571  C CA     . GLN A 1 36  ? 70.66802  11.48002  17.20381  1.000 25.79807 ? 54  GLN A CA     1 
ATOM   572  C C      . GLN A 1 36  ? 70.14053  10.61421  18.34212  1.000 23.94180 ? 54  GLN A C      1 
ATOM   573  O O      . GLN A 1 36  ? 69.21771  11.02357  19.05270  1.000 23.49560 ? 54  GLN A O      1 
ATOM   574  C CB     . GLN A 1 36  ? 69.82931  11.28075  15.94029  1.000 28.64106 ? 54  GLN A CB     1 
ATOM   575  C CG     . GLN A 1 36  ? 68.38765  11.77013  16.05126  1.000 31.93982 ? 54  GLN A CG     1 
ATOM   576  C CD     . GLN A 1 36  ? 67.44234  10.72044  16.62398  1.000 34.60418 ? 54  GLN A CD     1 
ATOM   577  O OE1    . GLN A 1 36  ? 67.85040  9.59952   16.92900  1.000 35.84934 ? 54  GLN A OE1    1 
ATOM   578  N NE2    . GLN A 1 36  ? 66.17133  11.08157  16.76697  1.000 34.85836 ? 54  GLN A NE2    1 
ATOM   579  H H      . GLN A 1 36  ? 72.20693  10.78689  16.17074  1.000 29.73446 ? 54  GLN A H      1 
ATOM   580  H HA     . GLN A 1 36  ? 70.58284  12.40698  17.47656  1.000 30.95769 ? 54  GLN A HA     1 
ATOM   581  H HB2    . GLN A 1 36  ? 70.24790  11.76625  15.21231  1.000 34.36928 ? 54  GLN A HB2    1 
ATOM   582  H HB3    . GLN A 1 36  ? 69.80165  10.33323  15.73453  1.000 34.36928 ? 54  GLN A HB3    1 
ATOM   583  H HG2    . GLN A 1 36  ? 68.36218  12.54477  16.63452  1.000 38.32779 ? 54  GLN A HG2    1 
ATOM   584  H HG3    . GLN A 1 36  ? 68.06760  12.00962  15.16746  1.000 38.32779 ? 54  GLN A HG3    1 
ATOM   585  H HE21   . GLN A 1 36  ? 65.59925  10.52430  17.08598  1.000 41.83003 ? 54  GLN A HE21   1 
ATOM   586  H HE22   . GLN A 1 36  ? 65.92095  11.87253  16.54048  1.000 41.83003 ? 54  GLN A HE22   1 
ATOM   587  N N      . ALA A 1 37  ? 70.71748  9.42908   18.54224  1.000 23.50812 ? 55  ALA A N      1 
ATOM   588  C CA     . ALA A 1 37  ? 70.24400  8.54885   19.60499  1.000 23.15728 ? 55  ALA A CA     1 
ATOM   589  C C      . ALA A 1 37  ? 70.59664  9.08969   20.98555  1.000 23.52179 ? 55  ALA A C      1 
ATOM   590  O O      . ALA A 1 37  ? 69.81229  8.94189   21.93016  1.000 22.61125 ? 55  ALA A O      1 
ATOM   591  C CB     . ALA A 1 37  ? 70.83102  7.15185   19.42472  1.000 22.87939 ? 55  ALA A CB     1 
ATOM   592  H H      . ALA A 1 37  ? 71.37435  9.11672   18.08339  1.000 28.20975 ? 55  ALA A H      1 
ATOM   593  H HA     . ALA A 1 37  ? 69.27775  8.48954   19.54382  1.000 27.78874 ? 55  ALA A HA     1 
ATOM   594  H HB1    . ALA A 1 37  ? 70.50215  6.57722   20.13363  1.000 27.45527 ? 55  ALA A HB1    1 
ATOM   595  H HB2    . ALA A 1 37  ? 70.55685  6.80298   18.56215  1.000 27.45527 ? 55  ALA A HB2    1 
ATOM   596  H HB3    . ALA A 1 37  ? 71.79849  7.20802   19.46647  1.000 27.45527 ? 55  ALA A HB3    1 
ATOM   597  N N      . ILE A 1 38  ? 71.76935  9.71183   21.12747  1.000 23.95983 ? 56  ILE A N      1 
ATOM   598  C CA     . ILE A 1 38  ? 72.28842  10.10103  22.43667  1.000 22.86002 ? 56  ILE A CA     1 
ATOM   599  C C      . ILE A 1 38  ? 72.26378  11.60276  22.67316  1.000 23.58329 ? 56  ILE A C      1 
ATOM   600  O O      . ILE A 1 38  ? 72.53389  12.03630  23.80623  1.000 24.68034 ? 56  ILE A O      1 
ATOM   601  C CB     . ILE A 1 38  ? 73.71674  9.56164   22.65600  1.000 21.70898 ? 56  ILE A CB     1 
ATOM   602  C CG1    . ILE A 1 38  ? 74.70021  10.20507  21.67328  1.000 22.55055 ? 56  ILE A CG1    1 
ATOM   603  C CG2    . ILE A 1 38  ? 73.72459  8.06195   22.49686  1.000 21.47991 ? 56  ILE A CG2    1 
ATOM   604  C CD1    . ILE A 1 38  ? 76.14208  9.72569   21.83081  1.000 22.18677 ? 56  ILE A CD1    1 
ATOM   605  H H      . ILE A 1 38  ? 72.28656  9.92073   20.47290  1.000 28.75179 ? 56  ILE A H      1 
ATOM   606  H HA     . ILE A 1 38  ? 71.71401  9.70131   23.10837  1.000 27.43203 ? 56  ILE A HA     1 
ATOM   607  H HB     . ILE A 1 38  ? 73.99673  9.79118   23.55590  1.000 26.05077 ? 56  ILE A HB     1 
ATOM   608  H HG12   . ILE A 1 38  ? 74.41735  9.99626   20.76924  1.000 27.06066 ? 56  ILE A HG12   1 
ATOM   609  H HG13   . ILE A 1 38  ? 74.69235  11.16537  21.80990  1.000 27.06066 ? 56  ILE A HG13   1 
ATOM   610  H HG21   . ILE A 1 38  ? 73.02995  7.68132   23.05676  1.000 25.77590 ? 56  ILE A HG21   1 
ATOM   611  H HG22   . ILE A 1 38  ? 74.59134  7.72026   22.76684  1.000 25.77590 ? 56  ILE A HG22   1 
ATOM   612  H HG23   . ILE A 1 38  ? 73.55741  7.84217   21.56699  1.000 25.77590 ? 56  ILE A HG23   1 
ATOM   613  H HD11   . ILE A 1 38  ? 76.40502  9.81559   22.76015  1.000 26.62412 ? 56  ILE A HD11   1 
ATOM   614  H HD12   . ILE A 1 38  ? 76.71832  10.26826  21.27004  1.000 26.62412 ? 56  ILE A HD12   1 
ATOM   615  H HD13   . ILE A 1 38  ? 76.19714  8.79591   21.55993  1.000 26.62412 ? 56  ILE A HD13   1 
ATOM   616  N N      . GLY A 1 39  ? 71.97349  12.40971  21.65916  1.000 22.75162 ? 57  GLY A N      1 
ATOM   617  C CA     . GLY A 1 39  ? 71.73478  13.82206  21.88097  1.000 22.13975 ? 57  GLY A CA     1 
ATOM   618  C C      . GLY A 1 39  ? 72.96630  14.70375  21.87803  1.000 22.16038 ? 57  GLY A C      1 
ATOM   619  O O      . GLY A 1 39  ? 73.04754  15.66548  22.65080  1.000 21.05120 ? 57  GLY A O      1 
ATOM   620  H H      . GLY A 1 39  ? 71.91001  12.16126  20.83829  1.000 27.30194 ? 57  GLY A H      1 
ATOM   621  H HA2    . GLY A 1 39  ? 71.14162  14.14708  21.18568  1.000 26.56771 ? 57  GLY A HA2    1 
ATOM   622  H HA3    . GLY A 1 39  ? 71.30101  13.92962  22.74188  1.000 26.56771 ? 57  GLY A HA3    1 
ATOM   623  N N      . ILE A 1 40  ? 73.93719  14.39229  21.02069  1.000 22.39979 ? 58  ILE A N      1 
ATOM   624  C CA     . ILE A 1 40  ? 75.06289  15.29916  20.79300  1.000 22.95696 ? 58  ILE A CA     1 
ATOM   625  C C      . ILE A 1 40  ? 75.39926  15.31068  19.31665  1.000 21.09039 ? 58  ILE A C      1 
ATOM   626  O O      . ILE A 1 40  ? 75.18980  14.32572  18.59715  1.000 21.92166 ? 58  ILE A O      1 
ATOM   627  C CB     . ILE A 1 40  ? 76.31107  14.89979  21.60746  1.000 26.33370 ? 58  ILE A CB     1 
ATOM   628  C CG1    . ILE A 1 40  ? 76.69504  13.44802  21.33433  1.000 27.98867 ? 58  ILE A CG1    1 
ATOM   629  C CG2    . ILE A 1 40  ? 76.07698  15.11452  23.10101  1.000 27.41151 ? 58  ILE A CG2    1 
ATOM   630  C CD1    . ILE A 1 40  ? 78.06804  13.31378  20.72349  1.000 29.30331 ? 58  ILE A CD1    1 
ATOM   631  H H      . ILE A 1 40  ? 73.96756  13.66616  20.56089  1.000 26.87975 ? 58  ILE A H      1 
ATOM   632  H HA     . ILE A 1 40  ? 74.80950  16.19676  21.05946  1.000 27.54836 ? 58  ILE A HA     1 
ATOM   633  H HB     . ILE A 1 40  ? 77.04311  15.46996  21.32474  1.000 31.60044 ? 58  ILE A HB     1 
ATOM   634  H HG12   . ILE A 1 40  ? 76.68892  12.95687  22.17077  1.000 33.58641 ? 58  ILE A HG12   1 
ATOM   635  H HG13   . ILE A 1 40  ? 76.05297  13.06196  20.71821  1.000 33.58641 ? 58  ILE A HG13   1 
ATOM   636  H HG21   . ILE A 1 40  ? 76.00283  16.06582  23.27548  1.000 32.89382 ? 58  ILE A HG21   1 
ATOM   637  H HG22   . ILE A 1 40  ? 76.82601  14.74514  23.59438  1.000 32.89382 ? 58  ILE A HG22   1 
ATOM   638  H HG23   . ILE A 1 40  ? 75.25687  14.66584  23.35984  1.000 32.89382 ? 58  ILE A HG23   1 
ATOM   639  H HD11   . ILE A 1 40  ? 78.03471  13.61557  19.80224  1.000 35.16398 ? 58  ILE A HD11   1 
ATOM   640  H HD12   . ILE A 1 40  ? 78.33899  12.38299  20.75706  1.000 35.16398 ? 58  ILE A HD12   1 
ATOM   641  H HD13   . ILE A 1 40  ? 78.69259  13.85848  21.22761  1.000 35.16398 ? 58  ILE A HD13   1 
ATOM   642  N N      . PRO A 1 41  ? 75.92717  16.43433  18.83055  1.000 17.83378 ? 59  PRO A N      1 
ATOM   643  C CA     . PRO A 1 41  ? 76.14242  16.57212  17.38775  1.000 16.11694 ? 59  PRO A CA     1 
ATOM   644  C C      . PRO A 1 41  ? 77.09665  15.51480  16.85730  1.000 14.99757 ? 59  PRO A C      1 
ATOM   645  O O      . PRO A 1 41  ? 77.99637  15.04777  17.55752  1.000 15.05744 ? 59  PRO A O      1 
ATOM   646  C CB     . PRO A 1 41  ? 76.73337  17.98047  17.24737  1.000 16.47059 ? 59  PRO A CB     1 
ATOM   647  C CG     . PRO A 1 41  ? 76.40211  18.67704  18.52106  1.000 17.08303 ? 59  PRO A CG     1 
ATOM   648  C CD     . PRO A 1 41  ? 76.39917  17.61861  19.56621  1.000 17.14524 ? 59  PRO A CD     1 
ATOM   649  H HA     . PRO A 1 41  ? 75.29994  16.51815  16.91002  1.000 19.34032 ? 59  PRO A HA     1 
ATOM   650  H HB2    . PRO A 1 41  ? 77.69384  17.92297  17.12450  1.000 19.76470 ? 59  PRO A HB2    1 
ATOM   651  H HB3    . PRO A 1 41  ? 76.32859  18.43266  16.49068  1.000 19.76470 ? 59  PRO A HB3    1 
ATOM   652  H HG2    . PRO A 1 41  ? 77.07533  19.34858  18.71267  1.000 20.49964 ? 59  PRO A HG2    1 
ATOM   653  H HG3    . PRO A 1 41  ? 75.52893  19.09348  18.44999  1.000 20.49964 ? 59  PRO A HG3    1 
ATOM   654  H HD2    . PRO A 1 41  ? 77.29181  17.47570  19.91787  1.000 20.57429 ? 59  PRO A HD2    1 
ATOM   655  H HD3    . PRO A 1 41  ? 75.79081  17.84452  20.28716  1.000 20.57429 ? 59  PRO A HD3    1 
ATOM   656  N N      . GLU A 1 42  ? 76.89524  15.14765  15.59498  1.000 14.59827 ? 60  GLU A N      1 
ATOM   657  C CA     . GLU A 1 42  ? 77.75929  14.14517  14.98118  1.000 14.98220 ? 60  GLU A CA     1 
ATOM   658  C C      . GLU A 1 42  ? 79.22653  14.53815  15.01215  1.000 15.26477 ? 60  GLU A C      1 
ATOM   659  O O      . GLU A 1 42  ? 80.06656  13.65186  15.24647  1.000 16.26611 ? 60  GLU A O      1 
ATOM   660  C CB     . GLU A 1 42  ? 77.31611  13.87933  13.53990  1.000 15.33539 ? 60  GLU A CB     1 
ATOM   661  C CG     . GLU A 1 42  ? 78.16045  12.82998  12.83045  1.000 16.46644 ? 60  GLU A CG     1 
ATOM   662  C CD     . GLU A 1 42  ? 79.32182  13.41504  12.04946  1.000 16.70356 ? 60  GLU A CD     1 
ATOM   663  O OE1    . GLU A 1 42  ? 79.28149  14.62073  11.72153  1.000 17.28351 ? 60  GLU A OE1    1 
ATOM   664  O OE2    . GLU A 1 42  ? 80.27448  12.66300  11.75342  1.000 16.27363 ? 60  GLU A OE2    1 
ATOM   665  H H      . GLU A 1 42  ? 76.27823  15.45672  15.08178  1.000 17.51793 ? 60  GLU A H      1 
ATOM   666  H HA     . GLU A 1 42  ? 77.65406  13.32370  15.48617  1.000 17.97864 ? 60  GLU A HA     1 
ATOM   667  H HB2    . GLU A 1 42  ? 76.39782  13.56695  13.54736  1.000 18.40246 ? 60  GLU A HB2    1 
ATOM   668  H HB3    . GLU A 1 42  ? 77.38160  14.70495  13.03496  1.000 18.40246 ? 60  GLU A HB3    1 
ATOM   669  H HG2    . GLU A 1 42  ? 78.52445  12.22114  13.49206  1.000 19.75973 ? 60  GLU A HG2    1 
ATOM   670  H HG3    . GLU A 1 42  ? 77.59797  12.34459  12.20683  1.000 19.75973 ? 60  GLU A HG3    1 
ATOM   671  N N      . PRO A 1 43  ? 79.61070  15.79461  14.77024  1.000 14.78510 ? 61  PRO A N      1 
ATOM   672  C CA     . PRO A 1 43  ? 81.03357  16.14580  14.88619  1.000 13.83344 ? 61  PRO A CA     1 
ATOM   673  C C      . PRO A 1 43  ? 81.64240  15.70493  16.20233  1.000 14.74943 ? 61  PRO A C      1 
ATOM   674  O O      . PRO A 1 43  ? 82.79020  15.24678  16.23151  1.000 14.20740 ? 61  PRO A O      1 
ATOM   675  C CB     . PRO A 1 43  ? 81.01796  17.66974  14.73491  1.000 13.35876 ? 61  PRO A CB     1 
ATOM   676  C CG     . PRO A 1 43  ? 79.85112  17.93151  13.87952  1.000 13.86173 ? 61  PRO A CG     1 
ATOM   677  C CD     . PRO A 1 43  ? 78.80931  16.93149  14.28625  1.000 14.20089 ? 61  PRO A CD     1 
ATOM   678  H HA     . PRO A 1 43  ? 81.54002  15.76089  14.15389  1.000 16.60013 ? 61  PRO A HA     1 
ATOM   679  H HB2    . PRO A 1 43  ? 80.91767  18.09055  15.60310  1.000 16.03052 ? 61  PRO A HB2    1 
ATOM   680  H HB3    . PRO A 1 43  ? 81.83720  17.97185  14.31245  1.000 16.03052 ? 61  PRO A HB3    1 
ATOM   681  H HG2    . PRO A 1 43  ? 79.53431  18.83639  14.02691  1.000 16.63407 ? 61  PRO A HG2    1 
ATOM   682  H HG3    . PRO A 1 43  ? 80.09546  17.81309  12.94830  1.000 16.63407 ? 61  PRO A HG3    1 
ATOM   683  H HD2    . PRO A 1 43  ? 78.24757  17.28507  14.99359  1.000 17.04107 ? 61  PRO A HD2    1 
ATOM   684  H HD3    . PRO A 1 43  ? 78.26350  16.67216  13.52747  1.000 17.04107 ? 61  PRO A HD3    1 
ATOM   685  N N      . ARG A 1 44  ? 80.89460  15.82117  17.29957  1.000 16.56038 ? 62  ARG A N      1 
ATOM   686  C CA     . ARG A 1 44  ? 81.39897  15.34187  18.57930  1.000 19.14619 ? 62  ARG A CA     1 
ATOM   687  C C      . ARG A 1 44  ? 81.59164  13.83031  18.55823  1.000 19.03612 ? 62  ARG A C      1 
ATOM   688  O O      . ARG A 1 44  ? 82.59595  13.31812  19.06844  1.000 19.33505 ? 62  ARG A O      1 
ATOM   689  C CB     . ARG A 1 44  ? 80.44312  15.74425  19.70359  1.000 20.24311 ? 62  ARG A CB     1 
ATOM   690  C CG     . ARG A 1 44  ? 80.28698  17.24296  19.90483  1.000 20.64487 ? 62  ARG A CG     1 
ATOM   691  C CD     . ARG A 1 44  ? 81.62309  17.92464  20.05827  1.000 22.77307 ? 62  ARG A CD     1 
ATOM   692  N NE     . ARG A 1 44  ? 82.11243  18.42368  18.77773  1.000 25.02754 ? 62  ARG A NE     1 
ATOM   693  C CZ     . ARG A 1 44  ? 83.38130  18.72511  18.52124  1.000 25.84629 ? 62  ARG A CZ     1 
ATOM   694  N NH1    . ARG A 1 44  ? 84.30947  18.56731  19.45719  1.000 26.24883 ? 62  ARG A NH1    1 
ATOM   695  N NH2    . ARG A 1 44  ? 83.72343  19.17729  17.32023  1.000 26.36576 ? 62  ARG A NH2    1 
ATOM   696  H H      . ARG A 1 44  ? 80.10773  16.16708  17.32759  1.000 19.87246 ? 62  ARG A H      1 
ATOM   697  H HA     . ARG A 1 44  ? 82.25882  15.75548  18.75395  1.000 22.97543 ? 62  ARG A HA     1 
ATOM   698  H HB2    . ARG A 1 44  ? 79.56486  15.38406  19.50402  1.000 24.29174 ? 62  ARG A HB2    1 
ATOM   699  H HB3    . ARG A 1 44  ? 80.77331  15.37139  20.53596  1.000 24.29174 ? 62  ARG A HB3    1 
ATOM   700  H HG2    . ARG A 1 44  ? 79.83695  17.62495  19.13512  1.000 24.77384 ? 62  ARG A HG2    1 
ATOM   701  H HG3    . ARG A 1 44  ? 79.76778  17.40658  20.70768  1.000 24.77384 ? 62  ARG A HG3    1 
ATOM   702  H HD2    . ARG A 1 44  ? 81.53354  18.67576  20.66548  1.000 27.32768 ? 62  ARG A HD2    1 
ATOM   703  H HD3    . ARG A 1 44  ? 82.26958  17.29122  20.40717  1.000 27.32768 ? 62  ARG A HD3    1 
ATOM   704  H HE     . ARG A 1 44  ? 81.54008  18.53026  18.14476  1.000 30.03305 ? 62  ARG A HE     1 
ATOM   705  H HH11   . ARG A 1 44  ? 84.09089  18.26886  20.23356  1.000 31.49859 ? 62  ARG A HH11   1 
ATOM   706  H HH12   . ARG A 1 44  ? 85.12934  18.76353  19.28714  1.000 31.49859 ? 62  ARG A HH12   1 
ATOM   707  H HH21   . ARG A 1 44  ? 83.12458  19.27445  16.71070  1.000 31.63892 ? 62  ARG A HH21   1 
ATOM   708  H HH22   . ARG A 1 44  ? 84.54383  19.37294  17.15209  1.000 31.63892 ? 62  ARG A HH22   1 
ATOM   709  N N      . VAL A 1 45  ? 80.63603  13.09822  17.97798  1.000 17.40312 ? 63  VAL A N      1 
ATOM   710  C CA     . VAL A 1 45  ? 80.77427  11.64712  17.88012  1.000 16.62849 ? 63  VAL A CA     1 
ATOM   711  C C      . VAL A 1 45  ? 82.00995  11.29631  17.06610  1.000 15.51240 ? 63  VAL A C      1 
ATOM   712  O O      . VAL A 1 45  ? 82.80155  10.42618  17.44726  1.000 16.41122 ? 63  VAL A O      1 
ATOM   713  C CB     . VAL A 1 45  ? 79.50658  11.01834  17.27203  1.000 18.06309 ? 63  VAL A CB     1 
ATOM   714  C CG1    . VAL A 1 45  ? 79.72712  9.53961   16.99624  1.000 18.85343 ? 63  VAL A CG1    1 
ATOM   715  C CG2    . VAL A 1 45  ? 78.32063  11.19789  18.19737  1.000 18.24300 ? 63  VAL A CG2    1 
ATOM   716  H H      . VAL A 1 45  ? 79.91109  13.41360  17.63946  1.000 20.88374 ? 63  VAL A H      1 
ATOM   717  H HA     . VAL A 1 45  ? 80.88373  11.28795  18.77450  1.000 19.95419 ? 63  VAL A HA     1 
ATOM   718  H HB     . VAL A 1 45  ? 79.31315  11.46727  16.43421  1.000 21.67570 ? 63  VAL A HB     1 
ATOM   719  H HG11   . VAL A 1 45  ? 80.27882  9.44496   16.20405  1.000 22.62412 ? 63  VAL A HG11   1 
ATOM   720  H HG12   . VAL A 1 45  ? 78.86756  9.11334   16.85359  1.000 22.62412 ? 63  VAL A HG12   1 
ATOM   721  H HG13   . VAL A 1 45  ? 80.17242  9.13904   17.75923  1.000 22.62412 ? 63  VAL A HG13   1 
ATOM   722  H HG21   . VAL A 1 45  ? 78.56022  10.88218  19.08271  1.000 21.89160 ? 63  VAL A HG21   1 
ATOM   723  H HG22   . VAL A 1 45  ? 77.57212  10.68492  17.85460  1.000 21.89160 ? 63  VAL A HG22   1 
ATOM   724  H HG23   . VAL A 1 45  ? 78.08788  12.13886  18.23349  1.000 21.89160 ? 63  VAL A HG23   1 
ATOM   725  N N      . GLN A 1 46  ? 82.19209  11.96735  15.92799  1.000 14.20963 ? 64  GLN A N      1 
ATOM   726  C CA     . GLN A 1 46  ? 83.35458  11.70338  15.08945  1.000 13.04078 ? 64  GLN A CA     1 
ATOM   727  C C      . GLN A 1 46  ? 84.64166  11.87647  15.88393  1.000 12.06546 ? 64  GLN A C      1 
ATOM   728  O O      . GLN A 1 46  ? 85.50869  10.99683  15.88638  1.000 11.27937 ? 64  GLN A O      1 
ATOM   729  C CB     . GLN A 1 46  ? 83.33328  12.62932  13.87312  1.000 14.81189 ? 64  GLN A CB     1 
ATOM   730  C CG     . GLN A 1 46  ? 84.44183  12.36927  12.85866  1.000 16.60923 ? 64  GLN A CG     1 
ATOM   731  C CD     . GLN A 1 46  ? 84.18001  13.03507  11.52300  1.000 17.82134 ? 64  GLN A CD     1 
ATOM   732  O OE1    . GLN A 1 46  ? 83.43191  14.00823  11.43416  1.000 17.97450 ? 64  GLN A OE1    1 
ATOM   733  N NE2    . GLN A 1 46  ? 84.79235  12.50618  10.47240  1.000 19.24088 ? 64  GLN A NE2    1 
ATOM   734  H H      . GLN A 1 46  ? 81.66250  12.57298  15.62408  1.000 17.05156 ? 64  GLN A H      1 
ATOM   735  H HA     . GLN A 1 46  ? 83.31998  10.78826  14.76968  1.000 15.64893 ? 64  GLN A HA     1 
ATOM   736  H HB2    . GLN A 1 46  ? 82.48547  12.51786  13.41520  1.000 17.77426 ? 64  GLN A HB2    1 
ATOM   737  H HB3    . GLN A 1 46  ? 83.42657  13.54464  14.18036  1.000 17.77426 ? 64  GLN A HB3    1 
ATOM   738  H HG2    . GLN A 1 46  ? 85.27788  12.71557  13.20795  1.000 19.93107 ? 64  GLN A HG2    1 
ATOM   739  H HG3    . GLN A 1 46  ? 84.51542  11.41379  12.70849  1.000 19.93107 ? 64  GLN A HG3    1 
ATOM   740  H HE21   . GLN A 1 46  ? 84.67723  12.84671  9.69113   1.000 23.08906 ? 64  GLN A HE21   1 
ATOM   741  H HE22   . GLN A 1 46  ? 85.30459  11.82264  10.57232  1.000 23.08906 ? 64  GLN A HE22   1 
ATOM   742  N N      . ILE A 1 47  ? 84.77208  13.00372  16.58430  1.000 13.04244 ? 65  ILE A N      1 
ATOM   743  C CA     . ILE A 1 47  ? 85.96281  13.24795  17.39432  1.000 12.67932 ? 65  ILE A CA     1 
ATOM   744  C C      . ILE A 1 47  ? 86.15231  12.12384  18.40074  1.000 13.89096 ? 65  ILE A C      1 
ATOM   745  O O      . ILE A 1 47  ? 87.25648  11.59221  18.56338  1.000 14.24415 ? 65  ILE A O      1 
ATOM   746  C CB     . ILE A 1 47  ? 85.86386  14.61426  18.09837  1.000 12.59014 ? 65  ILE A CB     1 
ATOM   747  C CG1    . ILE A 1 47  ? 85.84390  15.76435  17.08337  1.000 12.86979 ? 65  ILE A CG1    1 
ATOM   748  C CG2    . ILE A 1 47  ? 87.00239  14.78147  19.09071  1.000 12.11534 ? 65  ILE A CG2    1 
ATOM   749  C CD1    . ILE A 1 47  ? 87.11413  15.92634  16.28587  1.000 13.37456 ? 65  ILE A CD1    1 
ATOM   750  H H      . ILE A 1 47  ? 84.19066  13.63700  16.60704  1.000 15.65093 ? 65  ILE A H      1 
ATOM   751  H HA     . ILE A 1 47  ? 86.73534  13.26533  16.80798  1.000 15.21518 ? 65  ILE A HA     1 
ATOM   752  H HB     . ILE A 1 47  ? 85.02467  14.64050  18.58413  1.000 15.10816 ? 65  ILE A HB     1 
ATOM   753  H HG12   . ILE A 1 47  ? 85.12257  15.60719  16.45417  1.000 15.44375 ? 65  ILE A HG12   1 
ATOM   754  H HG13   . ILE A 1 47  ? 85.69198  16.59446  17.56164  1.000 15.44375 ? 65  ILE A HG13   1 
ATOM   755  H HG21   . ILE A 1 47  ? 86.81347  14.25086  19.88043  1.000 14.53841 ? 65  ILE A HG21   1 
ATOM   756  H HG22   . ILE A 1 47  ? 87.07642  15.71819  19.33151  1.000 14.53841 ? 65  ILE A HG22   1 
ATOM   757  H HG23   . ILE A 1 47  ? 87.82713  14.47962  18.67890  1.000 14.53841 ? 65  ILE A HG23   1 
ATOM   758  H HD11   . ILE A 1 47  ? 87.86124  16.01968  16.89743  1.000 16.04947 ? 65  ILE A HD11   1 
ATOM   759  H HD12   . ILE A 1 47  ? 87.03984  16.71853  15.73107  1.000 16.04947 ? 65  ILE A HD12   1 
ATOM   760  H HD13   . ILE A 1 47  ? 87.23905  15.14252  15.72826  1.000 16.04947 ? 65  ILE A HD13   1 
ATOM   761  N N      . TRP A 1 48  ? 85.07874  11.74451  19.09712  1.000 15.05527 ? 66  TRP A N      1 
ATOM   762  C CA     . TRP A 1 48  ? 85.20677  10.70484  20.11137  1.000 16.58451 ? 66  TRP A CA     1 
ATOM   763  C C      . TRP A 1 48  ? 85.78148  9.42601   19.50987  1.000 18.64786 ? 66  TRP A C      1 
ATOM   764  O O      . TRP A 1 48  ? 86.70667  8.82535   20.06684  1.000 20.00310 ? 66  TRP A O      1 
ATOM   765  C CB     . TRP A 1 48  ? 83.85697  10.42836  20.77550  1.000 15.90455 ? 66  TRP A CB     1 
ATOM   766  C CG     . TRP A 1 48  ? 83.98848  9.39776   21.84089  1.000 16.58937 ? 66  TRP A CG     1 
ATOM   767  C CD1    . TRP A 1 48  ? 84.31078  9.60811   23.14817  1.000 16.47960 ? 66  TRP A CD1    1 
ATOM   768  C CD2    . TRP A 1 48  ? 83.84337  7.98436   21.68546  1.000 17.89254 ? 66  TRP A CD2    1 
ATOM   769  N NE1    . TRP A 1 48  ? 84.36661  8.41229   23.82120  1.000 16.72622 ? 66  TRP A NE1    1 
ATOM   770  C CE2    . TRP A 1 48  ? 84.08202  7.39902   22.94421  1.000 17.90311 ? 66  TRP A CE2    1 
ATOM   771  C CE3    . TRP A 1 48  ? 83.52757  7.15612   20.60485  1.000 19.49515 ? 66  TRP A CE3    1 
ATOM   772  C CZ2    . TRP A 1 48  ? 84.01350  6.02221   23.15263  1.000 18.90377 ? 66  TRP A CZ2    1 
ATOM   773  C CZ3    . TRP A 1 48  ? 83.45775  5.78944   20.81306  1.000 19.83228 ? 66  TRP A CZ3    1 
ATOM   774  C CH2    . TRP A 1 48  ? 83.70137  5.23608   22.07721  1.000 19.34036 ? 66  TRP A CH2    1 
ATOM   775  H H      . TRP A 1 48  ? 84.28680  12.06619  19.00246  1.000 18.06632 ? 66  TRP A H      1 
ATOM   776  H HA     . TRP A 1 48  ? 85.81282  11.02056  20.79979  1.000 19.90141 ? 66  TRP A HA     1 
ATOM   777  H HB2    . TRP A 1 48  ? 83.52173  11.24516  21.17719  1.000 19.08546 ? 66  TRP A HB2    1 
ATOM   778  H HB3    . TRP A 1 48  ? 83.23019  10.10452  20.10979  1.000 19.08546 ? 66  TRP A HB3    1 
ATOM   779  H HD1    . TRP A 1 48  ? 84.46996  10.44125  23.52953  1.000 19.77552 ? 66  TRP A HD1    1 
ATOM   780  H HE1    . TRP A 1 48  ? 84.55003  8.31547   24.65581  1.000 20.07146 ? 66  TRP A HE1    1 
ATOM   781  H HE3    . TRP A 1 48  ? 83.36748  7.51617   19.76245  1.000 23.39419 ? 66  TRP A HE3    1 
ATOM   782  H HZ2    . TRP A 1 48  ? 84.17384  5.65227   23.99069  1.000 22.68453 ? 66  TRP A HZ2    1 
ATOM   783  H HZ3    . TRP A 1 48  ? 83.24555  5.22897   20.10191  1.000 23.79873 ? 66  TRP A HZ3    1 
ATOM   784  H HH2    . TRP A 1 48  ? 83.64976  4.31410   22.18763  1.000 23.20843 ? 66  TRP A HH2    1 
ATOM   785  N N      . PHE A 1 49  ? 85.24969  8.99752   18.36390  1.000 18.67243 ? 67  PHE A N      1 
ATOM   786  C CA     . PHE A 1 49  ? 85.76280  7.79122   17.72598  1.000 20.02272 ? 67  PHE A CA     1 
ATOM   787  C C      . PHE A 1 49  ? 87.22138  7.95346   17.33936  1.000 20.57162 ? 67  PHE A C      1 
ATOM   788  O O      . PHE A 1 49  ? 88.01908  7.02082   17.49017  1.000 21.22533 ? 67  PHE A O      1 
ATOM   789  C CB     . PHE A 1 49  ? 84.93027  7.44671   16.49393  1.000 21.73914 ? 67  PHE A CB     1 
ATOM   790  C CG     . PHE A 1 49  ? 83.76798  6.54339   16.78430  1.000 23.20544 ? 67  PHE A CG     1 
ATOM   791  C CD1    . PHE A 1 49  ? 82.53771  7.07000   17.13424  1.000 23.39126 ? 67  PHE A CD1    1 
ATOM   792  C CD2    . PHE A 1 49  ? 83.90859  5.16799   16.70714  1.000 23.28559 ? 67  PHE A CD2    1 
ATOM   793  C CE1    . PHE A 1 49  ? 81.47012  6.24578   17.40016  1.000 24.07964 ? 67  PHE A CE1    1 
ATOM   794  C CE2    . PHE A 1 49  ? 82.84424  4.33518   16.97218  1.000 24.31342 ? 67  PHE A CE2    1 
ATOM   795  C CZ     . PHE A 1 49  ? 81.62100  4.87434   17.31967  1.000 24.84562 ? 67  PHE A CZ     1 
ATOM   796  H H      . PHE A 1 49  ? 84.60382  9.38076   17.94487  1.000 22.40692 ? 67  PHE A H      1 
ATOM   797  H HA     . PHE A 1 49  ? 85.69040  7.05673   18.35541  1.000 24.02726 ? 67  PHE A HA     1 
ATOM   798  H HB2    . PHE A 1 49  ? 84.57977  8.26779   16.11460  1.000 26.08697 ? 67  PHE A HB2    1 
ATOM   799  H HB3    . PHE A 1 49  ? 85.49910  6.99923   15.84810  1.000 26.08697 ? 67  PHE A HB3    1 
ATOM   800  H HD1    . PHE A 1 49  ? 82.43157  7.99222   17.19027  1.000 28.06952 ? 67  PHE A HD1    1 
ATOM   801  H HD2    . PHE A 1 49  ? 84.73124  4.80243   16.47364  1.000 27.94271 ? 67  PHE A HD2    1 
ATOM   802  H HE1    . PHE A 1 49  ? 80.64725  6.61063   17.63397  1.000 28.89557 ? 67  PHE A HE1    1 
ATOM   803  H HE2    . PHE A 1 49  ? 82.94879  3.41270   16.91737  1.000 29.17610 ? 67  PHE A HE2    1 
ATOM   804  H HZ     . PHE A 1 49  ? 80.89984  4.31525   17.49925  1.000 29.81475 ? 67  PHE A HZ     1 
ATOM   805  N N      . GLN A 1 50  ? 87.58900  9.12647   16.82519  1.000 20.40939 ? 68  GLN A N      1 
ATOM   806  C CA     . GLN A 1 50  ? 88.98425  9.35753   16.47388  1.000 20.28706 ? 68  GLN A CA     1 
ATOM   807  C C      . GLN A 1 50  ? 89.87241  9.28101   17.70572  1.000 19.78300 ? 68  GLN A C      1 
ATOM   808  O O      . GLN A 1 50  ? 90.95552  8.69106   17.66000  1.000 19.88686 ? 68  GLN A O      1 
ATOM   809  C CB     . GLN A 1 50  ? 89.12732  10.70655  15.76977  1.000 21.46152 ? 68  GLN A CB     1 
ATOM   810  C CG     . GLN A 1 50  ? 88.38137  10.75640  14.43001  1.000 21.34100 ? 68  GLN A CG     1 
ATOM   811  C CD     . GLN A 1 50  ? 88.51676  12.09120  13.72188  1.000 20.37477 ? 68  GLN A CD     1 
ATOM   812  O OE1    . GLN A 1 50  ? 89.12658  13.02330  14.24428  1.000 19.23316 ? 68  GLN A OE1    1 
ATOM   813  N NE2    . GLN A 1 50  ? 87.94613  12.18634  12.52042  1.000 20.67894 ? 68  GLN A NE2    1 
ATOM   814  H H      . GLN A 1 50  ? 87.06153  9.78865   16.67387  1.000 24.49127 ? 68  GLN A H      1 
ATOM   815  H HA     . GLN A 1 50  ? 89.27846  8.67194   15.85395  1.000 24.34447 ? 68  GLN A HA     1 
ATOM   816  H HB2    . GLN A 1 50  ? 88.76528  11.40142  16.34161  1.000 25.75382 ? 68  GLN A HB2    1 
ATOM   817  H HB3    . GLN A 1 50  ? 90.06690  10.87490  15.59731  1.000 25.75382 ? 68  GLN A HB3    1 
ATOM   818  H HG2    . GLN A 1 50  ? 88.73932  10.07057  13.84486  1.000 25.60920 ? 68  GLN A HG2    1 
ATOM   819  H HG3    . GLN A 1 50  ? 87.43781  10.59741  14.58911  1.000 25.60920 ? 68  GLN A HG3    1 
ATOM   820  H HE21   . GLN A 1 50  ? 87.99478  12.92241  12.07835  1.000 24.81473 ? 68  GLN A HE21   1 
ATOM   821  H HE22   . GLN A 1 50  ? 87.52945  11.51162  12.18764  1.000 24.81473 ? 68  GLN A HE22   1 
ATOM   822  N N      . ASN A 1 51  ? 89.42011  9.85160   18.82453  1.000 20.87188 ? 69  ASN A N      1 
ATOM   823  C CA     . ASN A 1 51  ? 90.19841  9.77875   20.05530  1.000 20.93015 ? 69  ASN A CA     1 
ATOM   824  C C      . ASN A 1 51  ? 90.15852  8.37815   20.64134  1.000 22.23853 ? 69  ASN A C      1 
ATOM   825  O O      . ASN A 1 51  ? 91.17266  7.87657   21.13689  1.000 23.14050 ? 69  ASN A O      1 
ATOM   826  C CB     . ASN A 1 51  ? 89.67566  10.79113  21.07478  1.000 20.97608 ? 69  ASN A CB     1 
ATOM   827  C CG     . ASN A 1 51  ? 90.36191  12.14500  20.96952  1.000 20.73948 ? 69  ASN A CG     1 
ATOM   828  O OD1    . ASN A 1 51  ? 91.56078  12.23016  20.71392  1.000 21.18267 ? 69  ASN A OD1    1 
ATOM   829  N ND2    . ASN A 1 51  ? 89.59941  13.21110  21.17898  1.000 20.36387 ? 69  ASN A ND2    1 
ATOM   830  H H      . ASN A 1 51  ? 88.67740  10.27950  18.89431  1.000 25.04626 ? 69  ASN A H      1 
ATOM   831  H HA     . ASN A 1 51  ? 91.12003  10.00397  19.85331  1.000 25.11618 ? 69  ASN A HA     1 
ATOM   832  H HB2    . ASN A 1 51  ? 88.72607  10.92462  20.92862  1.000 25.17130 ? 69  ASN A HB2    1 
ATOM   833  H HB3    . ASN A 1 51  ? 89.82856  10.44665  21.96857  1.000 25.17130 ? 69  ASN A HB3    1 
ATOM   834  H HD21   . ASN A 1 51  ? 89.93985  13.99939  21.13096  1.000 24.43664 ? 69  ASN A HD21   1 
ATOM   835  H HD22   . ASN A 1 51  ? 88.76495  13.11355  21.36271  1.000 24.43664 ? 69  ASN A HD22   1 
ATOM   836  N N      . GLU A 1 52  ? 88.99760  7.72840   20.59985  1.000 22.75454 ? 70  GLU A N      1 
ATOM   837  C CA     . GLU A 1 52  ? 88.90359  6.39677   21.18027  1.000 23.90110 ? 70  GLU A CA     1 
ATOM   838  C C      . GLU A 1 52  ? 89.81982  5.42736   20.44778  1.000 23.96205 ? 70  GLU A C      1 
ATOM   839  O O      . GLU A 1 52  ? 90.54921  4.65514   21.08048  1.000 25.49790 ? 70  GLU A O      1 
ATOM   840  C CB     . GLU A 1 52  ? 87.45214  5.90958   21.16016  1.000 25.01325 ? 70  GLU A CB     1 
ATOM   841  C CG     . GLU A 1 52  ? 87.23865  4.56051   21.84363  1.000 24.41220 ? 70  GLU A CG     1 
ATOM   842  C CD     . GLU A 1 52  ? 87.65716  4.55833   23.30279  1.000 23.72358 ? 70  GLU A CD     1 
ATOM   843  O OE1    . GLU A 1 52  ? 87.60325  5.62455   23.95214  1.000 23.56023 ? 70  GLU A OE1    1 
ATOM   844  O OE2    . GLU A 1 52  ? 88.04544  3.48333   23.80199  1.000 24.01326 ? 70  GLU A OE2    1 
ATOM   845  H H      . GLU A 1 52  ? 88.27124  8.02904   20.25112  1.000 27.30545 ? 70  GLU A H      1 
ATOM   846  H HA     . GLU A 1 52  ? 89.18324  6.43416   22.10833  1.000 28.68132 ? 70  GLU A HA     1 
ATOM   847  H HB2    . GLU A 1 52  ? 86.89901  6.56241   21.61706  1.000 30.01590 ? 70  GLU A HB2    1 
ATOM   848  H HB3    . GLU A 1 52  ? 87.16700  5.82095   20.23726  1.000 30.01590 ? 70  GLU A HB3    1 
ATOM   849  H HG2    . GLU A 1 52  ? 86.29661  4.33285   21.80313  1.000 29.29464 ? 70  GLU A HG2    1 
ATOM   850  H HG3    . GLU A 1 52  ? 87.76277  3.88743   21.38194  1.000 29.29464 ? 70  GLU A HG3    1 
ATOM   851  N N      . ARG A 1 53  ? 89.81459  5.46580   19.11378  1.000 22.49465 ? 71  ARG A N      1 
ATOM   852  C CA     . ARG A 1 53  ? 90.74306  4.63365   18.35416  1.000 21.77186 ? 71  ARG A CA     1 
ATOM   853  C C      . ARG A 1 53  ? 92.18067  4.91530   18.76934  1.000 22.49504 ? 71  ARG A C      1 
ATOM   854  O O      . ARG A 1 53  ? 92.94961  3.99105   19.05590  1.000 22.40273 ? 71  ARG A O      1 
ATOM   855  C CB     . ARG A 1 53  ? 90.56524  4.86675   16.85157  1.000 19.91456 ? 71  ARG A CB     1 
ATOM   856  C CG     . ARG A 1 53  ? 89.32196  4.22915   16.25703  1.000 19.45942 ? 71  ARG A CG     1 
ATOM   857  C CD     . ARG A 1 53  ? 89.43693  4.10242   14.74379  1.000 19.82221 ? 71  ARG A CD     1 
ATOM   858  N NE     . ARG A 1 53  ? 89.59855  5.39896   14.08730  1.000 19.38755 ? 71  ARG A NE     1 
ATOM   859  C CZ     . ARG A 1 53  ? 88.60873  6.11392   13.55991  1.000 18.92189 ? 71  ARG A CZ     1 
ATOM   860  N NH1    . ARG A 1 53  ? 87.35687  5.66958   13.59738  1.000 19.37986 ? 71  ARG A NH1    1 
ATOM   861  N NH2    . ARG A 1 53  ? 88.87599  7.28351   12.98975  1.000 18.01049 ? 71  ARG A NH2    1 
ATOM   862  H H      . ARG A 1 53  ? 89.29381  5.95536   18.63553  1.000 26.99357 ? 71  ARG A H      1 
ATOM   863  H HA     . ARG A 1 53  ? 90.54412  3.70167   18.53508  1.000 26.12623 ? 71  ARG A HA     1 
ATOM   864  H HB2    . ARG A 1 53  ? 90.50938  5.82187   16.69181  1.000 23.89747 ? 71  ARG A HB2    1 
ATOM   865  H HB3    . ARG A 1 53  ? 91.33354  4.49735   16.38880  1.000 23.89747 ? 71  ARG A HB3    1 
ATOM   866  H HG2    . ARG A 1 53  ? 89.20495  3.34156   16.63040  1.000 23.35130 ? 71  ARG A HG2    1 
ATOM   867  H HG3    . ARG A 1 53  ? 88.54915  4.77905   16.46018  1.000 23.35130 ? 71  ARG A HG3    1 
ATOM   868  H HD2    . ARG A 1 53  ? 90.20971  3.55715   14.52839  1.000 23.78665 ? 71  ARG A HD2    1 
ATOM   869  H HD3    . ARG A 1 53  ? 88.63134  3.68764   14.39755  1.000 23.78665 ? 71  ARG A HD3    1 
ATOM   870  H HE     . ARG A 1 53  ? 90.39341  5.72364   14.03853  1.000 23.26506 ? 71  ARG A HE     1 
ATOM   871  H HH11   . ARG A 1 53  ? 87.18010  4.91263   13.96532  1.000 23.25583 ? 71  ARG A HH11   1 
ATOM   872  H HH12   . ARG A 1 53  ? 86.72351  6.13898   13.25370  1.000 23.25583 ? 71  ARG A HH12   1 
ATOM   873  H HH21   . ARG A 1 53  ? 89.68498  7.57410   12.96326  1.000 21.61259 ? 71  ARG A HH21   1 
ATOM   874  H HH22   . ARG A 1 53  ? 88.24004  7.75015   12.64710  1.000 21.61259 ? 71  ARG A HH22   1 
ATOM   875  N N      . SER A 1 54  ? 92.55798  6.19583   18.81648  1.000 22.85402 ? 72  SER A N      1 
ATOM   876  C CA     . SER A 1 54  ? 93.90834  6.55448   19.23189  1.000 23.63754 ? 72  SER A CA     1 
ATOM   877  C C      . SER A 1 54  ? 94.20273  6.03796   20.63289  1.000 24.90834 ? 72  SER A C      1 
ATOM   878  O O      . SER A 1 54  ? 95.30158  5.53930   20.90060  1.000 26.26835 ? 72  SER A O      1 
ATOM   879  C CB     . SER A 1 54  ? 94.08658  8.07033   19.16004  1.000 25.19808 ? 72  SER A CB     1 
ATOM   880  O OG     . SER A 1 54  ? 93.97360  8.53373   17.81795  1.000 25.31356 ? 72  SER A OG     1 
ATOM   881  H H      . SER A 1 54  ? 92.05617  6.86464   18.61527  1.000 27.42483 ? 72  SER A H      1 
ATOM   882  H HA     . SER A 1 54  ? 94.54813  6.15022   18.62514  1.000 28.36505 ? 72  SER A HA     1 
ATOM   883  H HB2    . SER A 1 54  ? 93.40038  8.49434   19.69879  1.000 30.23770 ? 72  SER A HB2    1 
ATOM   884  H HB3    . SER A 1 54  ? 94.96518  8.30095   19.50029  1.000 30.23770 ? 72  SER A HB3    1 
ATOM   885  H HG     . SER A 1 54  ? 94.08984  9.36519   17.79035  1.000 30.37627 ? 72  SER A HG     1 
ATOM   886  N N      . ARG A 1 55  ? 93.22759  6.13428   21.53814  1.000 25.46996 ? 73  ARG A N      1 
ATOM   887  C CA     . ARG A 1 55  ? 93.39107  5.54298   22.86265  1.000 26.31247 ? 73  ARG A CA     1 
ATOM   888  C C      . ARG A 1 55  ? 93.57182  4.03194   22.76990  1.000 28.34228 ? 73  ARG A C      1 
ATOM   889  O O      . ARG A 1 55  ? 94.43467  3.45794   23.44411  1.000 28.46486 ? 73  ARG A O      1 
ATOM   890  C CB     . ARG A 1 55  ? 92.18537  5.88214   23.74601  1.000 26.05989 ? 73  ARG A CB     1 
ATOM   891  C CG     . ARG A 1 55  ? 92.05873  7.36707   24.11794  1.000 26.31230 ? 73  ARG A CG     1 
ATOM   892  C CD     . ARG A 1 55  ? 91.05231  7.59059   25.24235  1.000 26.44733 ? 73  ARG A CD     1 
ATOM   893  N NE     . ARG A 1 55  ? 89.66137  7.43264   24.81475  1.000 26.18728 ? 73  ARG A NE     1 
ATOM   894  C CZ     . ARG A 1 55  ? 88.85742  8.43148   24.45156  1.000 25.94605 ? 73  ARG A CZ     1 
ATOM   895  N NH1    . ARG A 1 55  ? 89.28798  9.68828   24.45097  1.000 26.04541 ? 73  ARG A NH1    1 
ATOM   896  N NH2    . ARG A 1 55  ? 87.60966  8.17167   24.08488  1.000 25.53794 ? 73  ARG A NH2    1 
ATOM   897  H H      . ARG A 1 55  ? 92.47465  6.53016   21.41186  1.000 30.56395 ? 73  ARG A H      1 
ATOM   898  H HA     . ARG A 1 55  ? 94.18289  5.92040   23.27677  1.000 31.57497 ? 73  ARG A HA     1 
ATOM   899  H HB2    . ARG A 1 55  ? 91.37670  5.62944   23.27369  1.000 31.27187 ? 73  ARG A HB2    1 
ATOM   900  H HB3    . ARG A 1 55  ? 92.25780  5.37932   24.57234  1.000 31.27187 ? 73  ARG A HB3    1 
ATOM   901  H HG2    . ARG A 1 55  ? 92.92157  7.69694   24.41390  1.000 31.57477 ? 73  ARG A HG2    1 
ATOM   902  H HG3    . ARG A 1 55  ? 91.76114  7.86657   23.34151  1.000 31.57477 ? 73  ARG A HG3    1 
ATOM   903  H HD2    . ARG A 1 55  ? 91.22145  6.94679   25.94791  1.000 31.73680 ? 73  ARG A HD2    1 
ATOM   904  H HD3    . ARG A 1 55  ? 91.15788  8.49236   25.58377  1.000 31.73680 ? 73  ARG A HD3    1 
ATOM   905  H HE     . ARG A 1 55  ? 89.33883  6.63562   24.79654  1.000 31.42474 ? 73  ARG A HE     1 
ATOM   906  H HH11   . ARG A 1 55  ? 90.09553  9.86627   24.68715  1.000 31.25449 ? 73  ARG A HH11   1 
ATOM   907  H HH12   . ARG A 1 55  ? 88.75916  10.32387  24.21440  1.000 31.25449 ? 73  ARG A HH12   1 
ATOM   908  H HH21   . ARG A 1 55  ? 87.32220  7.36114   24.08211  1.000 30.64552 ? 73  ARG A HH21   1 
ATOM   909  H HH22   . ARG A 1 55  ? 87.08800  8.81373   23.84988  1.000 30.64552 ? 73  ARG A HH22   1 
ATOM   910  N N      . GLN A 1 56  ? 92.76478  3.36866   21.93984  1.000 29.85715 ? 74  GLN A N      1 
ATOM   911  C CA     . GLN A 1 56  ? 92.85625  1.91649   21.82328  1.000 30.95989 ? 74  GLN A CA     1 
ATOM   912  C C      . GLN A 1 56  ? 94.14999  1.49598   21.13932  1.000 29.77819 ? 74  GLN A C      1 
ATOM   913  O O      . GLN A 1 56  ? 94.77047  0.50119   21.52953  1.000 27.97832 ? 74  GLN A O      1 
ATOM   914  C CB     . GLN A 1 56  ? 91.65255  1.38047   21.05291  1.000 32.79446 ? 74  GLN A CB     1 
ATOM   915  C CG     . GLN A 1 56  ? 90.33148  1.58052   21.75882  1.000 34.29398 ? 74  GLN A CG     1 
ATOM   916  C CD     . GLN A 1 56  ? 90.07619  0.52535   22.79903  1.000 35.76475 ? 74  GLN A CD     1 
ATOM   917  O OE1    . GLN A 1 56  ? 90.91910  -0.33372  23.04150  1.000 36.71144 ? 74  GLN A OE1    1 
ATOM   918  N NE2    . GLN A 1 56  ? 88.90429  0.57592   23.41846  1.000 36.52827 ? 74  GLN A NE2    1 
ATOM   919  H H      . GLN A 1 56  ? 92.16522  3.73115   21.44112  1.000 35.82859 ? 74  GLN A H      1 
ATOM   920  H HA     . GLN A 1 56  ? 92.84633  1.53133   22.71348  1.000 37.15186 ? 74  GLN A HA     1 
ATOM   921  H HB2    . GLN A 1 56  ? 91.60237  1.83654   20.19829  1.000 39.35336 ? 74  GLN A HB2    1 
ATOM   922  H HB3    . GLN A 1 56  ? 91.77156  0.42786   20.91411  1.000 39.35336 ? 74  GLN A HB3    1 
ATOM   923  H HG2    . GLN A 1 56  ? 90.33398  2.44468   22.19942  1.000 41.15277 ? 74  GLN A HG2    1 
ATOM   924  H HG3    . GLN A 1 56  ? 89.61381  1.54235   21.10737  1.000 41.15277 ? 74  GLN A HG3    1 
ATOM   925  H HE21   . GLN A 1 56  ? 88.71127  -0.00594  24.02160  1.000 43.83392 ? 74  GLN A HE21   1 
ATOM   926  H HE22   . GLN A 1 56  ? 88.33755  1.19056   23.21691  1.000 43.83392 ? 74  GLN A HE22   1 
ATOM   927  N N      . LEU A 1 57  ? 94.56640  2.23328   20.10931  1.000 31.00069 ? 75  LEU A N      1 
ATOM   928  C CA     . LEU A 1 57  ? 95.81941  1.90938   19.43867  1.000 32.06588 ? 75  LEU A CA     1 
ATOM   929  C C      . LEU A 1 57  ? 96.99218  2.01063   20.40276  1.000 32.89072 ? 75  LEU A C      1 
ATOM   930  O O      . LEU A 1 57  ? 97.87953  1.15051   20.40772  1.000 31.72500 ? 75  LEU A O      1 
ATOM   931  C CB     . LEU A 1 57  ? 96.02657  2.83363   18.23652  1.000 30.97968 ? 75  LEU A CB     1 
ATOM   932  C CG     . LEU A 1 57  ? 95.00460  2.71356   17.09866  1.000 28.86608 ? 75  LEU A CG     1 
ATOM   933  C CD1    . LEU A 1 57  ? 95.31146  3.71690   16.00889  1.000 28.60235 ? 75  LEU A CD1    1 
ATOM   934  C CD2    . LEU A 1 57  ? 94.97131  1.31109   16.53055  1.000 27.61788 ? 75  LEU A CD2    1 
ATOM   935  H H      . LEU A 1 57  ? 94.14911  2.91258   19.78679  1.000 37.20083 ? 75  LEU A H      1 
ATOM   936  H HA     . LEU A 1 57  ? 95.77584  0.99828   19.10867  1.000 38.47906 ? 75  LEU A HA     1 
ATOM   937  H HB2    . LEU A 1 57  ? 95.99501  3.75006   18.55285  1.000 37.17562 ? 75  LEU A HB2    1 
ATOM   938  H HB3    . LEU A 1 57  ? 96.89901  2.64328   17.85771  1.000 37.17562 ? 75  LEU A HB3    1 
ATOM   939  H HG     . LEU A 1 57  ? 94.12325  2.90381   17.45634  1.000 34.63930 ? 75  LEU A HG     1 
ATOM   940  H HD11   . LEU A 1 57  ? 95.24590  4.61221   16.37635  1.000 34.32283 ? 75  LEU A HD11   1 
ATOM   941  H HD12   . LEU A 1 57  ? 94.67070  3.60708   15.28898  1.000 34.32283 ? 75  LEU A HD12   1 
ATOM   942  H HD13   . LEU A 1 57  ? 96.20995  3.55978   15.67885  1.000 34.32283 ? 75  LEU A HD13   1 
ATOM   943  H HD21   . LEU A 1 57  ? 95.86914  1.05589   16.26662  1.000 33.14146 ? 75  LEU A HD21   1 
ATOM   944  H HD22   . LEU A 1 57  ? 94.38313  1.29664   15.75936  1.000 33.14146 ? 75  LEU A HD22   1 
ATOM   945  H HD23   . LEU A 1 57  ? 94.64081  0.70287   17.21006  1.000 33.14146 ? 75  LEU A HD23   1 
ATOM   946  N N      . ARG A 1 58  ? 97.00784  3.05097   21.23637  1.000 35.51954 ? 76  ARG A N      1 
ATOM   947  C CA     . ARG A 1 58  ? 98.07290  3.18148   22.22316  1.000 38.03977 ? 76  ARG A CA     1 
ATOM   948  C C      . ARG A 1 58  ? 98.05869  2.02710   23.21739  1.000 39.92931 ? 76  ARG A C      1 
ATOM   949  O O      . ARG A 1 58  ? 99.11832  1.60243   23.68781  1.000 39.95221 ? 76  ARG A O      1 
ATOM   950  C CB     . ARG A 1 58  ? 97.94567  4.52217   22.94953  1.000 38.76450 ? 76  ARG A CB     1 
ATOM   951  C CG     . ARG A 1 58  ? 98.94580  4.71111   24.07335  1.000 40.80695 ? 76  ARG A CG     1 
ATOM   952  C CD     . ARG A 1 58  ? 99.08269  6.17424   24.49891  1.000 42.44128 ? 76  ARG A CD     1 
ATOM   953  N NE     . ARG A 1 58  ? 97.82193  6.74335   24.97217  1.000 43.91593 ? 76  ARG A NE     1 
ATOM   954  C CZ     . ARG A 1 58  ? 97.05184  7.57959   24.27860  1.000 44.75196 ? 76  ARG A CZ     1 
ATOM   955  N NH1    . ARG A 1 58  ? 97.39451  7.97333   23.05935  1.000 45.60561 ? 76  ARG A NH1    1 
ATOM   956  N NH2    . ARG A 1 58  ? 95.92558  8.03006   24.81184  1.000 44.80355 ? 76  ARG A NH2    1 
ATOM   957  H H      . ARG A 1 58  ? 96.42401  3.68230   21.24986  1.000 42.62345 ? 76  ARG A H      1 
ATOM   958  H HA     . ARG A 1 58  ? 98.92971  3.16832   21.76862  1.000 45.64773 ? 76  ARG A HA     1 
ATOM   959  H HB2    . ARG A 1 58  ? 98.08302  5.23730   22.30873  1.000 46.51741 ? 76  ARG A HB2    1 
ATOM   960  H HB3    . ARG A 1 58  ? 97.05646  4.58555   23.33187  1.000 46.51741 ? 76  ARG A HB3    1 
ATOM   961  H HG2    . ARG A 1 58  ? 98.65592  4.19990   24.84506  1.000 48.96834 ? 76  ARG A HG2    1 
ATOM   962  H HG3    . ARG A 1 58  ? 99.81647  4.40158   23.77834  1.000 48.96834 ? 76  ARG A HG3    1 
ATOM   963  H HD2    . ARG A 1 58  ? 99.72890  6.23525   25.21973  1.000 50.92954 ? 76  ARG A HD2    1 
ATOM   964  H HD3    . ARG A 1 58  ? 99.38225  6.69820   23.73955  1.000 50.92954 ? 76  ARG A HD3    1 
ATOM   965  H HE     . ARG A 1 58  ? 97.55708  6.52082   25.75953  1.000 52.69911 ? 76  ARG A HE     1 
ATOM   966  H HH11   . ARG A 1 58  ? 98.12421  7.68819   22.70461  1.000 54.72674 ? 76  ARG A HH11   1 
ATOM   967  H HH12   . ARG A 1 58  ? 96.88702  8.51378   22.62351  1.000 54.72674 ? 76  ARG A HH12   1 
ATOM   968  H HH21   . ARG A 1 58  ? 95.69485  7.78225   25.60238  1.000 53.76426 ? 76  ARG A HH21   1 
ATOM   969  H HH22   . ARG A 1 58  ? 95.42532  8.57025   24.36739  1.000 53.76426 ? 76  ARG A HH22   1 
ATOM   970  N N      . GLN A 1 59  ? 96.87831  1.49681   23.53761  1.000 42.77419 ? 77  GLN A N      1 
ATOM   971  C CA     . GLN A 1 59  ? 96.78275  0.45362   24.55171  1.000 45.43711 ? 77  GLN A CA     1 
ATOM   972  C C      . GLN A 1 59  ? 97.15619  -0.91159  23.98633  1.000 47.26328 ? 77  GLN A C      1 
ATOM   973  O O      . GLN A 1 59  ? 97.99441  -1.61802  24.55644  1.000 48.40977 ? 77  GLN A O      1 
ATOM   974  C CB     . GLN A 1 59  ? 95.36972  0.42555   25.13486  1.000 46.87644 ? 77  GLN A CB     1 
ATOM   975  C CG     . GLN A 1 59  ? 95.19543  -0.56011  26.26284  1.000 47.89678 ? 77  GLN A CG     1 
ATOM   976  C CD     . GLN A 1 59  ? 96.13488  -0.30997  27.41786  1.000 48.53744 ? 77  GLN A CD     1 
ATOM   977  O OE1    . GLN A 1 59  ? 96.71298  0.77161   27.54104  1.000 48.34851 ? 77  GLN A OE1    1 
ATOM   978  N NE2    . GLN A 1 59  ? 96.30465  -1.31646  28.27158  1.000 48.30722 ? 77  GLN A NE2    1 
ATOM   979  H H      . GLN A 1 59  ? 96.12688  1.72223   23.18527  1.000 51.32903 ? 77  GLN A H      1 
ATOM   980  H HA     . GLN A 1 59  ? 97.40324  0.65692   25.26904  1.000 54.52454 ? 77  GLN A HA     1 
ATOM   981  H HB2    . GLN A 1 59  ? 95.15648  1.30770   25.47727  1.000 56.25173 ? 77  GLN A HB2    1 
ATOM   982  H HB3    . GLN A 1 59  ? 94.74723  0.18329   24.43150  1.000 56.25173 ? 77  GLN A HB3    1 
ATOM   983  H HG2    . GLN A 1 59  ? 94.28724  -0.49789  26.59782  1.000 57.47614 ? 77  GLN A HG2    1 
ATOM   984  H HG3    . GLN A 1 59  ? 95.36510  -1.45465  25.92832  1.000 57.47614 ? 77  GLN A HG3    1 
ATOM   985  H HE21   . GLN A 1 59  ? 96.82980  -1.22406  28.94632  1.000 57.96866 ? 77  GLN A HE21   1 
ATOM   986  H HE22   . GLN A 1 59  ? 95.88921  -2.05935  28.14859  1.000 57.96866 ? 77  GLN A HE22   1 
ATOM   987  N N      . HIS A 1 60  ? 96.53550  -1.30576  22.87254  1.000 47.27996 ? 78  HIS A N      1 
ATOM   988  C CA     . HIS A 1 60  ? 96.89265  -2.57118  22.24077  1.000 46.63110 ? 78  HIS A CA     1 
ATOM   989  C C      . HIS A 1 60  ? 98.39908  -2.67168  22.03316  1.000 46.72878 ? 78  HIS A C      1 
ATOM   990  O O      . HIS A 1 60  ? 98.98683  -3.74785  22.19090  1.000 46.43094 ? 78  HIS A O      1 
ATOM   991  C CB     . HIS A 1 60  ? 96.15696  -2.71761  20.90667  1.000 46.26962 ? 78  HIS A CB     1 
ATOM   992  C CG     . HIS A 1 60  ? 94.68984  -2.98970  21.04545  1.000 46.56509 ? 78  HIS A CG     1 
ATOM   993  N ND1    . HIS A 1 60  ? 93.87820  -2.29139  21.91407  1.000 46.70640 ? 78  HIS A ND1    1 
ATOM   994  C CD2    . HIS A 1 60  ? 93.88634  -3.87929  20.41462  1.000 46.57012 ? 78  HIS A CD2    1 
ATOM   995  C CE1    . HIS A 1 60  ? 92.64021  -2.74295  21.81625  1.000 46.50009 ? 78  HIS A CE1    1 
ATOM   996  N NE2    . HIS A 1 60  ? 92.61807  -3.70596  20.91293  1.000 46.34733 ? 78  HIS A NE2    1 
ATOM   997  H H      . HIS A 1 60  ? 95.91535  -0.86548  22.47109  1.000 56.73595 ? 78  HIS A H      1 
ATOM   998  H HA     . HIS A 1 60  ? 96.61560  -3.30116  22.81633  1.000 55.95731 ? 78  HIS A HA     1 
ATOM   999  H HB2    . HIS A 1 60  ? 96.25790  -1.89415  20.40405  1.000 55.52355 ? 78  HIS A HB2    1 
ATOM   1000 H HB3    . HIS A 1 60  ? 96.54870  -3.45643  20.41516  1.000 55.52355 ? 78  HIS A HB3    1 
ATOM   1001 H HD2    . HIS A 1 60  ? 94.14505  -4.49283  19.76536  1.000 55.88414 ? 78  HIS A HD2    1 
ATOM   1002 H HE1    . HIS A 1 60  ? 91.90884  -2.43493  22.30114  1.000 55.80010 ? 78  HIS A HE1    1 
ATOM   1003 H HE2    . HIS A 1 60  ? 91.92242  -4.15223  20.67518  1.000 55.61679 ? 78  HIS A HE2    1 
ATOM   1004 N N      . ARG A 1 61  ? 99.04454  -1.55282  21.69206  1.000 47.91719 ? 79  ARG A N      1 
ATOM   1005 C CA     . ARG A 1 61  ? 100.48964 -1.56677  21.48873  1.000 48.92966 ? 79  ARG A CA     1 
ATOM   1006 C C      . ARG A 1 61  ? 101.23476 -1.75261  22.80342  1.000 52.17813 ? 79  ARG A C      1 
ATOM   1007 O O      . ARG A 1 61  ? 102.30324 -2.37386  22.82596  1.000 52.03735 ? 79  ARG A O      1 
ATOM   1008 C CB     . ARG A 1 61  ? 100.93980 -0.27713  20.80096  1.000 46.77309 ? 79  ARG A CB     1 
ATOM   1009 C CG     . ARG A 1 61  ? 101.75492 -0.51671  19.55184  1.000 45.39402 ? 79  ARG A CG     1 
ATOM   1010 C CD     . ARG A 1 61  ? 102.27957 0.77392   18.95270  1.000 45.18012 ? 79  ARG A CD     1 
ATOM   1011 N NE     . ARG A 1 61  ? 101.22424 1.59931   18.37339  1.000 44.22004 ? 79  ARG A NE     1 
ATOM   1012 C CZ     . ARG A 1 61  ? 100.66958 2.65102   18.96950  1.000 44.56650 ? 79  ARG A CZ     1 
ATOM   1013 N NH1    . ARG A 1 61  ? 99.71660  3.33334   18.34673  1.000 45.63143 ? 79  ARG A NH1    1 
ATOM   1014 N NH2    . ARG A 1 61  ? 101.05910 3.03027   20.17942  1.000 43.92803 ? 79  ARG A NH2    1 
ATOM   1015 H H      . ARG A 1 61  ? 98.67326  -0.78605  21.57454  1.000 57.50063 ? 79  ARG A H      1 
ATOM   1016 H HA     . ARG A 1 61  ? 100.71534 -2.30836  20.90562  1.000 58.71559 ? 79  ARG A HA     1 
ATOM   1017 H HB2    . ARG A 1 61  ? 100.15484 0.23478   20.55060  1.000 56.12771 ? 79  ARG A HB2    1 
ATOM   1018 H HB3    . ARG A 1 61  ? 101.48559 0.23351   21.41923  1.000 56.12771 ? 79  ARG A HB3    1 
ATOM   1019 H HG2    . ARG A 1 61  ? 102.51472 -1.07875  19.77025  1.000 54.47282 ? 79  ARG A HG2    1 
ATOM   1020 H HG3    . ARG A 1 61  ? 101.19908 -0.95362  18.88772  1.000 54.47282 ? 79  ARG A HG3    1 
ATOM   1021 H HD2    . ARG A 1 61  ? 102.71616 1.29054   19.64797  1.000 54.21615 ? 79  ARG A HD2    1 
ATOM   1022 H HD3    . ARG A 1 61  ? 102.91334 0.56134   18.24982  1.000 54.21615 ? 79  ARG A HD3    1 
ATOM   1023 H HE     . ARG A 1 61  ? 100.94024 1.39024   17.58903  1.000 53.06405 ? 79  ARG A HE     1 
ATOM   1024 H HH11   . ARG A 1 61  ? 99.46029  3.09484   17.56122  1.000 54.75772 ? 79  ARG A HH11   1 
ATOM   1025 H HH12   . ARG A 1 61  ? 99.35542  4.01395   18.72871  1.000 54.75772 ? 79  ARG A HH12   1 
ATOM   1026 H HH21   . ARG A 1 61  ? 101.67756 2.59449   20.58832  1.000 52.71363 ? 79  ARG A HH21   1 
ATOM   1027 H HH22   . ARG A 1 61  ? 100.69318 3.71194   20.55497  1.000 52.71363 ? 79  ARG A HH22   1 
ATOM   1028 N N      . ARG A 1 62  ? 100.69111 -1.22665  23.90324  1.000 55.68161 ? 80  ARG A N      1 
ATOM   1029 C CA     . ARG A 1 62  ? 101.29659 -1.46591  25.20783  1.000 58.86907 ? 80  ARG A CA     1 
ATOM   1030 C C      . ARG A 1 62  ? 101.10125 -2.91797  25.63957  1.000 58.89902 ? 80  ARG A C      1 
ATOM   1031 O O      . ARG A 1 62  ? 102.02253 -3.54009  26.18361  1.000 58.94323 ? 80  ARG A O      1 
ATOM   1032 C CB     . ARG A 1 62  ? 100.71494 -0.49170  26.23774  1.000 61.82859 ? 80  ARG A CB     1 
ATOM   1033 C CG     . ARG A 1 62  ? 101.26810 -0.67326  27.64678  1.000 65.55756 ? 80  ARG A CG     1 
ATOM   1034 C CD     . ARG A 1 62  ? 101.38195 0.64854   28.41604  1.000 68.19113 ? 80  ARG A CD     1 
ATOM   1035 N NE     . ARG A 1 62  ? 100.11348 1.37782   28.48591  1.000 70.46900 ? 80  ARG A NE     1 
ATOM   1036 C CZ     . ARG A 1 62  ? 99.79957  2.44342   27.74836  1.000 71.27357 ? 80  ARG A CZ     1 
ATOM   1037 N NH1    . ARG A 1 62  ? 100.65700 2.93909   26.86291  1.000 70.88690 ? 80  ARG A NH1    1 
ATOM   1038 N NH2    . ARG A 1 62  ? 98.61451  3.02322   27.90157  1.000 71.53917 ? 80  ARG A NH2    1 
ATOM   1039 H H      . ARG A 1 62  ? 99.98448  -0.73671  23.91877  1.000 66.81793 ? 80  ARG A H      1 
ATOM   1040 H HA     . ARG A 1 62  ? 102.25099 -1.30000  25.15780  1.000 70.64289 ? 80  ARG A HA     1 
ATOM   1041 H HB2    . ARG A 1 62  ? 100.91634 0.41450   25.95643  1.000 74.19430 ? 80  ARG A HB2    1 
ATOM   1042 H HB3    . ARG A 1 62  ? 99.75442  -0.62047  26.27921  1.000 74.19430 ? 80  ARG A HB3    1 
ATOM   1043 H HG2    . ARG A 1 62  ? 100.67766 -1.25966  28.14520  1.000 78.66907 ? 80  ARG A HG2    1 
ATOM   1044 H HG3    . ARG A 1 62  ? 102.15408 -1.06417  27.59078  1.000 78.66907 ? 80  ARG A HG3    1 
ATOM   1045 H HD2    . ARG A 1 62  ? 101.67034 0.46217   29.32323  1.000 81.82936 ? 80  ARG A HD2    1 
ATOM   1046 H HD3    . ARG A 1 62  ? 102.03016 1.21748   27.97214  1.000 81.82936 ? 80  ARG A HD3    1 
ATOM   1047 H HE     . ARG A 1 62  ? 99.52509  1.09666   29.04657  1.000 84.56280 ? 80  ARG A HE     1 
ATOM   1048 H HH11   . ARG A 1 62  ? 101.42777 2.57213   26.75872  1.000 85.06428 ? 80  ARG A HH11   1 
ATOM   1049 H HH12   . ARG A 1 62  ? 100.44129 3.62691   26.39391  1.000 85.06428 ? 80  ARG A HH12   1 
ATOM   1050 H HH21   . ARG A 1 62  ? 98.05395  2.71116   28.47427  1.000 85.84700 ? 80  ARG A HH21   1 
ATOM   1051 H HH22   . ARG A 1 62  ? 98.40772  3.71070   27.42806  1.000 85.84700 ? 80  ARG A HH22   1 
ATOM   1052 N N      . GLU A 1 63  ? 99.91461  -3.48096  25.39152  1.000 59.19416 ? 81  GLU A N      1 
ATOM   1053 C CA     . GLU A 1 63  ? 99.62617  -4.88110  25.69968  1.000 59.44770 ? 81  GLU A CA     1 
ATOM   1054 C C      . GLU A 1 63  ? 100.27172 -5.85338  24.72572  1.000 59.85128 ? 81  GLU A C      1 
ATOM   1055 O O      . GLU A 1 63  ? 100.12788 -7.06917  24.89987  1.000 59.92678 ? 81  GLU A O      1 
ATOM   1056 C CB     . GLU A 1 63  ? 98.11940  -5.13565  25.70420  1.000 59.68872 ? 81  GLU A CB     1 
ATOM   1057 C CG     . GLU A 1 63  ? 97.39486  -4.34905  26.80992  1.000 59.62259 ? 81  GLU A CG     1 
ATOM   1058 C CD     . GLU A 1 63  ? 95.92131  -4.57561  26.80516  1.000 59.11377 ? 81  GLU A CD     1 
ATOM   1059 O OE1    . GLU A 1 63  ? 95.46715  -5.43480  26.02692  1.000 58.55440 ? 81  GLU A OE1    1 
ATOM   1060 O OE2    . GLU A 1 63  ? 95.22318  -3.89849  27.57440  1.000 58.92621 ? 81  GLU A OE2    1 
ATOM   1061 H H      . GLU A 1 63  ? 99.24973  -3.06462  25.03911  1.000 71.03299 ? 81  GLU A H      1 
ATOM   1062 H HA     . GLU A 1 63  ? 99.96983  -5.05654  26.58963  1.000 71.33724 ? 81  GLU A HA     1 
ATOM   1063 H HB2    . GLU A 1 63  ? 97.74962  -4.86481  24.84933  1.000 71.62647 ? 81  GLU A HB2    1 
ATOM   1064 H HB3    . GLU A 1 63  ? 97.95806  -6.08081  25.85097  1.000 71.62647 ? 81  GLU A HB3    1 
ATOM   1065 H HG2    . GLU A 1 63  ? 97.73865  -4.62719  27.67325  1.000 71.54711 ? 81  GLU A HG2    1 
ATOM   1066 H HG3    . GLU A 1 63  ? 97.55333  -3.40101  26.67950  1.000 71.54711 ? 81  GLU A HG3    1 
ATOM   1067 N N      . SER A 1 64  ? 100.94073 -5.35810  23.68846  1.000 59.54982 ? 82  SER A N      1 
ATOM   1068 C CA     . SER A 1 64  ? 101.49739 -6.21620  22.65035  1.000 58.38344 ? 82  SER A CA     1 
ATOM   1069 C C      . SER A 1 64  ? 100.41937 -7.08256  22.00494  1.000 57.64923 ? 82  SER A C      1 
ATOM   1070 O O      . SER A 1 64  ? 100.70878 -8.16117  21.48420  1.000 58.20142 ? 82  SER A O      1 
ATOM   1071 C CB     . SER A 1 64  ? 102.61656 -7.09298  23.21326  1.000 58.28300 ? 82  SER A CB     1 
ATOM   1072 O OG     . SER A 1 64  ? 103.62367 -6.29889  23.81291  1.000 59.00038 ? 82  SER A OG     1 
ATOM   1073 H H      . SER A 1 64  ? 101.08568 -4.51951  23.56448  1.000 71.45979 ? 82  SER A H      1 
ATOM   1074 H HA     . SER A 1 64  ? 101.87972 -5.65904  21.95444  1.000 70.06012 ? 82  SER A HA     1 
ATOM   1075 H HB2    . SER A 1 64  ? 102.24473 -7.68951  23.88169  1.000 69.93960 ? 82  SER A HB2    1 
ATOM   1076 H HB3    . SER A 1 64  ? 103.00854 -7.60769  22.49053  1.000 69.93960 ? 82  SER A HB3    1 
ATOM   1077 H HG     . SER A 1 64  ? 104.22812 -6.79042  24.12696  1.000 70.80046 ? 82  SER A HG     1 
ATOM   1078 N N      . ARG A 1 65  ? 99.15205  -6.62587  22.05752  1.000 56.27834 ? 83  ARG A N      1 
ATOM   1079 C CA     . ARG A 1 65  ? 98.05059  -7.32224  21.39975  1.000 55.46069 ? 83  ARG A CA     1 
ATOM   1080 C C      . ARG A 1 65  ? 97.78749  -6.71116  20.03157  1.000 52.99648 ? 83  ARG A C      1 
ATOM   1081 O O      . ARG A 1 65  ? 97.73555  -5.47861  19.91122  1.000 53.49921 ? 83  ARG A O      1 
ATOM   1082 C CB     . ARG A 1 65  ? 96.78427  -7.24669  22.24496  1.000 57.30721 ? 83  ARG A CB     1 
ATOM   1083 C CG     . ARG A 1 65  ? 96.69549  -8.29961  23.34105  1.000 58.84064 ? 83  ARG A CG     1 
ATOM   1084 C CD     . ARG A 1 65  ? 95.53691  -8.01971  24.28730  1.000 59.49417 ? 83  ARG A CD     1 
ATOM   1085 N NE     . ARG A 1 65  ? 94.34930  -7.54401  23.58026  1.000 60.44583 ? 83  ARG A NE     1 
ATOM   1086 C CZ     . ARG A 1 65  ? 93.26250  -7.05995  24.17508  1.000 60.90611 ? 83  ARG A CZ     1 
ATOM   1087 N NH1    . ARG A 1 65  ? 93.19771  -6.97972  25.50063  1.000 61.12898 ? 83  ARG A NH1    1 
ATOM   1088 N NH2    . ARG A 1 65  ? 92.23585  -6.65363  23.43852  1.000 60.46484 ? 83  ARG A NH2    1 
ATOM   1089 H H      . ARG A 1 65  ? 98.91273  -5.91123  22.47179  1.000 67.53401 ? 83  ARG A H      1 
ATOM   1090 H HA     . ARG A 1 65  ? 98.28675  -8.25587  21.28370  1.000 66.55283 ? 83  ARG A HA     1 
ATOM   1091 H HB2    . ARG A 1 65  ? 96.74833  -6.37600  22.67101  1.000 68.76865 ? 83  ARG A HB2    1 
ATOM   1092 H HB3    . ARG A 1 65  ? 96.01683  -7.36335  21.66330  1.000 68.76865 ? 83  ARG A HB3    1 
ATOM   1093 H HG2    . ARG A 1 65  ? 96.55756  -9.17157  22.93910  1.000 70.60877 ? 83  ARG A HG2    1 
ATOM   1094 H HG3    . ARG A 1 65  ? 97.51749  -8.29798  23.85603  1.000 70.60877 ? 83  ARG A HG3    1 
ATOM   1095 H HD2    . ARG A 1 65  ? 95.30314  -8.83676  24.75494  1.000 71.39301 ? 83  ARG A HD2    1 
ATOM   1096 H HD3    . ARG A 1 65  ? 95.80310  -7.33776  24.92369  1.000 71.39301 ? 83  ARG A HD3    1 
ATOM   1097 H HE     . ARG A 1 65  ? 94.35352  -7.57953  22.72100  1.000 72.53499 ? 83  ARG A HE     1 
ATOM   1098 H HH11   . ARG A 1 65  ? 93.86167  -7.24188  25.98025  1.000 73.35478 ? 83  ARG A HH11   1 
ATOM   1099 H HH12   . ARG A 1 65  ? 92.49184  -6.66567  25.87842  1.000 73.35478 ? 83  ARG A HH12   1 
ATOM   1100 H HH21   . ARG A 1 65  ? 92.27529  -6.70400  22.58091  1.000 72.55781 ? 83  ARG A HH21   1 
ATOM   1101 H HH22   . ARG A 1 65  ? 91.53118  -6.33998  23.81889  1.000 72.55781 ? 83  ARG A HH22   1 
ATOM   1102 N N      . PRO A 1 66  ? 97.60810  -7.50893  18.98208  1.000 49.94982 ? 84  PRO A N      1 
ATOM   1103 C CA     . PRO A 1 66  ? 97.40438  -6.92676  17.65253  1.000 47.54891 ? 84  PRO A CA     1 
ATOM   1104 C C      . PRO A 1 66  ? 96.08526  -6.17919  17.56429  1.000 44.23605 ? 84  PRO A C      1 
ATOM   1105 O O      . PRO A 1 66  ? 95.09150  -6.53835  18.20021  1.000 43.64241 ? 84  PRO A O      1 
ATOM   1106 C CB     . PRO A 1 66  ? 97.41809  -8.14586  16.72349  1.000 48.19560 ? 84  PRO A CB     1 
ATOM   1107 C CG     . PRO A 1 66  ? 96.98809  -9.27514  17.58419  1.000 48.94310 ? 84  PRO A CG     1 
ATOM   1108 C CD     . PRO A 1 66  ? 97.53690  -8.97976  18.95374  1.000 49.48482 ? 84  PRO A CD     1 
ATOM   1109 H HA     . PRO A 1 66  ? 98.13320  -6.33014  17.42066  1.000 57.05869 ? 84  PRO A HA     1 
ATOM   1110 H HB2    . PRO A 1 66  ? 96.79828  -8.01098  15.98963  1.000 57.83472 ? 84  PRO A HB2    1 
ATOM   1111 H HB3    . PRO A 1 66  ? 98.31329  -8.29087  16.37927  1.000 57.83472 ? 84  PRO A HB3    1 
ATOM   1112 H HG2    . PRO A 1 66  ? 96.01937  -9.32054  17.60468  1.000 58.73172 ? 84  PRO A HG2    1 
ATOM   1113 H HG3    . PRO A 1 66  ? 97.35195  -10.10585 17.24006  1.000 58.73172 ? 84  PRO A HG3    1 
ATOM   1114 H HD2    . PRO A 1 66  ? 96.93959  -9.30955  19.64321  1.000 59.38178 ? 84  PRO A HD2    1 
ATOM   1115 H HD3    . PRO A 1 66  ? 98.41811  -9.36996  19.06376  1.000 59.38178 ? 84  PRO A HD3    1 
ATOM   1116 N N      . TRP A 1 67  ? 96.08928  -5.12411  16.75731  1.000 41.93633 ? 85  TRP A N      1 
ATOM   1117 C CA     . TRP A 1 67  ? 94.90447  -4.30161  16.56863  1.000 39.85240 ? 85  TRP A CA     1 
ATOM   1118 C C      . TRP A 1 67  ? 94.07448  -4.86530  15.42095  1.000 40.58467 ? 85  TRP A C      1 
ATOM   1119 O O      . TRP A 1 67  ? 94.59830  -5.00338  14.30769  1.000 39.06172 ? 85  TRP A O      1 
ATOM   1120 C CB     . TRP A 1 67  ? 95.30223  -2.86216  16.28314  1.000 36.75175 ? 85  TRP A CB     1 
ATOM   1121 C CG     . TRP A 1 67  ? 94.19485  -2.01304  15.74157  1.000 33.05405 ? 85  TRP A CG     1 
ATOM   1122 C CD1    . TRP A 1 67  ? 94.02941  -1.61375  14.44777  1.000 30.69287 ? 85  TRP A CD1    1 
ATOM   1123 C CD2    . TRP A 1 67  ? 93.09768  -1.45838  16.47745  1.000 31.05234 ? 85  TRP A CD2    1 
ATOM   1124 N NE1    . TRP A 1 67  ? 92.90155  -0.84476  14.33245  1.000 30.04415 ? 85  TRP A NE1    1 
ATOM   1125 C CE2    . TRP A 1 67  ? 92.30824  -0.73444  15.56338  1.000 30.60557 ? 85  TRP A CE2    1 
ATOM   1126 C CE3    . TRP A 1 67  ? 92.70696  -1.50320  17.81921  1.000 29.93565 ? 85  TRP A CE3    1 
ATOM   1127 C CZ2    . TRP A 1 67  ? 91.14853  -0.05865  15.94813  1.000 30.05119 ? 85  TRP A CZ2    1 
ATOM   1128 C CZ3    . TRP A 1 67  ? 91.55625  -0.83287  18.19859  1.000 29.53826 ? 85  TRP A CZ3    1 
ATOM   1129 C CH2    . TRP A 1 67  ? 90.79090  -0.12111  17.26646  1.000 29.44544 ? 85  TRP A CH2    1 
ATOM   1130 H H      . TRP A 1 67  ? 96.77214  -4.86269  16.30458  1.000 50.32359 ? 85  TRP A H      1 
ATOM   1131 H HA     . TRP A 1 67  ? 94.35722  -4.31180  17.36946  1.000 47.82287 ? 85  TRP A HA     1 
ATOM   1132 H HB2    . TRP A 1 67  ? 95.60720  -2.45531  17.10919  1.000 44.10210 ? 85  TRP A HB2    1 
ATOM   1133 H HB3    . TRP A 1 67  ? 96.01870  -2.86255  15.62925  1.000 44.10210 ? 85  TRP A HB3    1 
ATOM   1134 H HD1    . TRP A 1 67  ? 94.59940  -1.83184  13.74602  1.000 36.83144 ? 85  TRP A HD1    1 
ATOM   1135 H HE1    . TRP A 1 67  ? 92.61231  -0.48861  13.60506  1.000 36.05299 ? 85  TRP A HE1    1 
ATOM   1136 H HE3    . TRP A 1 67  ? 93.20978  -1.97373  18.44426  1.000 35.92278 ? 85  TRP A HE3    1 
ATOM   1137 H HZ2    . TRP A 1 67  ? 90.63895  0.41569   15.33150  1.000 36.06143 ? 85  TRP A HZ2    1 
ATOM   1138 H HZ3    . TRP A 1 67  ? 91.28681  -0.85574  19.08841  1.000 35.44591 ? 85  TRP A HZ3    1 
ATOM   1139 H HH2    . TRP A 1 67  ? 90.02232  0.31886   17.55039  1.000 35.33453 ? 85  TRP A HH2    1 
ATOM   1140 N N      . PRO A 1 68  ? 92.79025  -5.21453  15.63819  1.000 43.30772 ? 86  PRO A N      1 
ATOM   1141 C CA     . PRO A 1 68  ? 92.00429  -5.83211  14.55693  1.000 45.41902 ? 86  PRO A CA     1 
ATOM   1142 C C      . PRO A 1 68  ? 91.94840  -4.98788  13.29283  1.000 48.84269 ? 86  PRO A C      1 
ATOM   1143 O O      . PRO A 1 68  ? 92.35863  -5.44215  12.22020  1.000 49.63024 ? 86  PRO A O      1 
ATOM   1144 C CB     . PRO A 1 68  ? 90.61129  -5.99548  15.18179  1.000 44.25655 ? 86  PRO A CB     1 
ATOM   1145 C CG     . PRO A 1 68  ? 90.85102  -6.05281  16.64766  1.000 43.85571 ? 86  PRO A CG     1 
ATOM   1146 C CD     . PRO A 1 68  ? 92.04149  -5.17112  16.90898  1.000 43.67692 ? 86  PRO A CD     1 
ATOM   1147 H HA     . PRO A 1 68  ? 92.37292  -6.70271  14.33996  1.000 54.50283 ? 86  PRO A HA     1 
ATOM   1148 H HB2    . PRO A 1 68  ? 90.05464  -5.23548  14.95060  1.000 53.10786 ? 86  PRO A HB2    1 
ATOM   1149 H HB3    . PRO A 1 68  ? 90.20145  -6.81551  14.86480  1.000 53.10786 ? 86  PRO A HB3    1 
ATOM   1150 H HG2    . PRO A 1 68  ? 90.07010  -5.72312  17.11923  1.000 52.62686 ? 86  PRO A HG2    1 
ATOM   1151 H HG3    . PRO A 1 68  ? 91.03694  -6.96726  16.91246  1.000 52.62686 ? 86  PRO A HG3    1 
ATOM   1152 H HD2    . PRO A 1 68  ? 91.76077  -4.26515  17.11225  1.000 52.41230 ? 86  PRO A HD2    1 
ATOM   1153 H HD3    . PRO A 1 68  ? 92.57761  -5.52344  17.63654  1.000 52.41230 ? 86  PRO A HD3    1 
ATOM   1154 N N      . GLY A 1 69  ? 91.44645  -3.76638  13.40106  1.000 51.56112 ? 87  GLY A N      1 
ATOM   1155 C CA     . GLY A 1 69  ? 91.36179  -2.87538  12.26382  1.000 54.29399 ? 87  GLY A CA     1 
ATOM   1156 C C      . GLY A 1 69  ? 89.98559  -2.84753  11.63257  1.000 56.76143 ? 87  GLY A C      1 
ATOM   1157 O O      . GLY A 1 69  ? 88.97542  -3.23649  12.22326  1.000 56.75183 ? 87  GLY A O      1 
ATOM   1158 H H      . GLY A 1 69  ? 91.14559  -3.42967  14.13298  1.000 61.87335 ? 87  GLY A H      1 
ATOM   1159 H HA2    . GLY A 1 69  ? 91.58282  -1.97468  12.54807  1.000 65.15278 ? 87  GLY A HA2    1 
ATOM   1160 H HA3    . GLY A 1 69  ? 91.99863  -3.15889  11.58931  1.000 65.15278 ? 87  GLY A HA3    1 
ATOM   1161 N N      . ARG A 1 70  ? 89.96088  -2.38233  10.38838  1.000 60.01366 ? 88  ARG A N      1 
ATOM   1162 C CA     . ARG A 1 70  ? 88.71460  -2.21082  9.64820   1.000 63.50428 ? 88  ARG A CA     1 
ATOM   1163 C C      . ARG A 1 70  ? 88.13988  -3.58600  9.33372   1.000 64.49609 ? 88  ARG A C      1 
ATOM   1164 O O      . ARG A 1 70  ? 88.56302  -4.24981  8.38495   1.000 64.53110 ? 88  ARG A O      1 
ATOM   1165 C CB     . ARG A 1 70  ? 88.96717  -1.40907  8.37480   1.000 66.04330 ? 88  ARG A CB     1 
ATOM   1166 C CG     . ARG A 1 70  ? 87.71044  -1.03926  7.59116   1.000 68.44933 ? 88  ARG A CG     1 
ATOM   1167 C CD     . ARG A 1 70  ? 86.92855  0.07638   8.27399   1.000 70.61152 ? 88  ARG A CD     1 
ATOM   1168 N NE     . ARG A 1 70  ? 87.64829  1.35383   8.24037   1.000 72.40398 ? 88  ARG A NE     1 
ATOM   1169 C CZ     . ARG A 1 70  ? 87.25041  2.44934   7.59184   1.000 73.19042 ? 88  ARG A CZ     1 
ATOM   1170 N NH1    . ARG A 1 70  ? 86.11325  2.47100   6.90738   1.000 73.60917 ? 88  ARG A NH1    1 
ATOM   1171 N NH2    . ARG A 1 70  ? 87.99620  3.54532   7.63876   1.000 73.15954 ? 88  ARG A NH2    1 
ATOM   1172 H H      . ARG A 1 70  ? 90.66175  -2.15571  9.94449   1.000 72.01639 ? 88  ARG A H      1 
ATOM   1173 H HA     . ARG A 1 70  ? 88.07378  -1.72660  10.19207  1.000 76.20514 ? 88  ARG A HA     1 
ATOM   1174 H HB2    . ARG A 1 70  ? 89.41478  -0.58275  8.61509   1.000 79.25196 ? 88  ARG A HB2    1 
ATOM   1175 H HB3    . ARG A 1 70  ? 89.53306  -1.93430  7.78760   1.000 79.25196 ? 88  ARG A HB3    1 
ATOM   1176 H HG2    . ARG A 1 70  ? 87.96292  -0.73536  6.70527   1.000 82.13920 ? 88  ARG A HG2    1 
ATOM   1177 H HG3    . ARG A 1 70  ? 87.13446  -1.81680  7.52354   1.000 82.13920 ? 88  ARG A HG3    1 
ATOM   1178 H HD2    . ARG A 1 70  ? 86.07973  0.19514   7.81979   1.000 84.73383 ? 88  ARG A HD2    1 
ATOM   1179 H HD3    . ARG A 1 70  ? 86.77772  -0.16174  9.20213   1.000 84.73383 ? 88  ARG A HD3    1 
ATOM   1180 H HE     . ARG A 1 70  ? 88.38881  1.40044   8.67518   1.000 86.88477 ? 88  ARG A HE     1 
ATOM   1181 H HH11   . ARG A 1 70  ? 85.61686  1.76943   6.87593   1.000 88.33101 ? 88  ARG A HH11   1 
ATOM   1182 H HH12   . ARG A 1 70  ? 85.87292  3.18661   6.49538   1.000 88.33101 ? 88  ARG A HH12   1 
ATOM   1183 H HH21   . ARG A 1 70  ? 88.73116  3.54652   8.08534   1.000 87.79145 ? 88  ARG A HH21   1 
ATOM   1184 H HH22   . ARG A 1 70  ? 87.74476  4.25468   7.22259   1.000 87.79145 ? 88  ARG A HH22   1 
ATOM   1185 N N      . ARG A 1 71  ? 87.17229  -4.02189  10.13659  1.000 65.41003 ? 89  ARG A N      1 
ATOM   1186 C CA     . ARG A 1 71  ? 86.47211  -5.27993  9.91400   1.000 66.19650 ? 89  ARG A CA     1 
ATOM   1187 C C      . ARG A 1 71  ? 85.14151  -5.00441  9.22614   1.000 63.76232 ? 89  ARG A C      1 
ATOM   1188 O O      . ARG A 1 71  ? 84.37633  -4.13754  9.66246   1.000 63.31459 ? 89  ARG A O      1 
ATOM   1189 C CB     . ARG A 1 71  ? 86.24472  -6.02678  11.22930  1.000 69.40351 ? 89  ARG A CB     1 
ATOM   1190 C CG     . ARG A 1 71  ? 85.52033  -5.22527  12.30288  1.000 72.13965 ? 89  ARG A CG     1 
ATOM   1191 C CD     . ARG A 1 71  ? 85.17314  -6.11163  13.49088  1.000 74.32966 ? 89  ARG A CD     1 
ATOM   1192 N NE     . ARG A 1 71  ? 84.68771  -5.35322  14.64234  1.000 75.85776 ? 89  ARG A NE     1 
ATOM   1193 C CZ     . ARG A 1 71  ? 85.46888  -4.82833  15.58345  1.000 77.21583 ? 89  ARG A CZ     1 
ATOM   1194 N NH1    . ARG A 1 71  ? 86.78830  -4.96412  15.51827  1.000 77.61495 ? 89  ARG A NH1    1 
ATOM   1195 N NH2    . ARG A 1 71  ? 84.92921  -4.15997  16.59541  1.000 77.69068 ? 89  ARG A NH2    1 
ATOM   1196 H H      . ARG A 1 71  ? 86.89904  -3.59557  10.83171  1.000 78.49203 ? 89  ARG A H      1 
ATOM   1197 H HA     . ARG A 1 71  ? 87.00654  -5.84715  9.33646   1.000 79.43580 ? 89  ARG A HA     1 
ATOM   1198 H HB2    . ARG A 1 71  ? 85.71252  -6.81686  11.04642  1.000 83.28421 ? 89  ARG A HB2    1 
ATOM   1199 H HB3    . ARG A 1 71  ? 87.10757  -6.28420  11.59004  1.000 83.28421 ? 89  ARG A HB3    1 
ATOM   1200 H HG2    . ARG A 1 71  ? 86.09222  -4.50526  12.61181  1.000 86.56758 ? 89  ARG A HG2    1 
ATOM   1201 H HG3    . ARG A 1 71  ? 84.69810  -4.86251  11.93785  1.000 86.56758 ? 89  ARG A HG3    1 
ATOM   1202 H HD2    . ARG A 1 71  ? 84.47752  -6.73436  13.22779  1.000 89.19559 ? 89  ARG A HD2    1 
ATOM   1203 H HD3    . ARG A 1 71  ? 85.96672  -6.59725  13.76530  1.000 89.19559 ? 89  ARG A HD3    1 
ATOM   1204 H HE     . ARG A 1 71  ? 83.83869  -5.23823  14.71683  1.000 91.02931 ? 89  ARG A HE     1 
ATOM   1205 H HH11   . ARG A 1 71  ? 87.14453  -5.39404  14.86415  1.000 93.13794 ? 89  ARG A HH11   1 
ATOM   1206 H HH12   . ARG A 1 71  ? 87.28653  -4.62214  16.13017  1.000 93.13794 ? 89  ARG A HH12   1 
ATOM   1207 H HH21   . ARG A 1 71  ? 84.07561  -4.06646  16.64247  1.000 93.22882 ? 89  ARG A HH21   1 
ATOM   1208 H HH22   . ARG A 1 71  ? 85.43317  -3.82046  17.20398  1.000 93.22882 ? 89  ARG A HH22   1 
ATOM   1209 N N      . GLY A 1 72  ? 84.87138  -5.74543  8.15626   1.000 61.77315 ? 90  GLY A N      1 
ATOM   1210 C CA     . GLY A 1 72  ? 83.69729  -5.52354  7.34985   1.000 59.73596 ? 90  GLY A CA     1 
ATOM   1211 C C      . GLY A 1 72  ? 83.94382  -4.45449  6.30491   1.000 58.11345 ? 90  GLY A C      1 
ATOM   1212 O O      . GLY A 1 72  ? 84.91991  -3.70069  6.37694   1.000 57.83173 ? 90  GLY A O      1 
ATOM   1213 H H      . GLY A 1 72  ? 85.36632  -6.39176  7.87900   1.000 74.12778 ? 90  GLY A H      1 
ATOM   1214 H HA2    . GLY A 1 72  ? 83.45096  -6.34679  6.89987   1.000 71.68315 ? 90  GLY A HA2    1 
ATOM   1215 H HA3    . GLY A 1 72  ? 82.96207  -5.24088  7.91594   1.000 71.68315 ? 90  GLY A HA3    1 
ATOM   1216 N N      . PRO A 1 73  ? 83.06798  -4.36811  5.30891   1.000 57.33618 ? 91  PRO A N      1 
ATOM   1217 C CA     . PRO A 1 73  ? 83.24010  -3.36473  4.25046   1.000 55.93216 ? 91  PRO A CA     1 
ATOM   1218 C C      . PRO A 1 73  ? 83.31209  -1.96052  4.83549   1.000 52.90662 ? 91  PRO A C      1 
ATOM   1219 O O      . PRO A 1 73  ? 82.57816  -1.64104  5.78116   1.000 52.42616 ? 91  PRO A O      1 
ATOM   1220 C CB     . PRO A 1 73  ? 81.98661  -3.54333  3.38073   1.000 57.16188 ? 91  PRO A CB     1 
ATOM   1221 C CG     . PRO A 1 73  ? 81.53685  -4.94228  3.63924   1.000 58.09430 ? 91  PRO A CG     1 
ATOM   1222 C CD     . PRO A 1 73  ? 81.89524  -5.22972  5.06961   1.000 58.15219 ? 91  PRO A CD     1 
ATOM   1223 H HA     . PRO A 1 73  ? 84.03482  -3.54612  3.72472   1.000 67.11859 ? 91  PRO A HA     1 
ATOM   1224 H HB2    . PRO A 1 73  ? 81.30630  -2.90488  3.64621   1.000 68.59425 ? 91  PRO A HB2    1 
ATOM   1225 H HB3    . PRO A 1 73  ? 82.21237  -3.41802  2.44573   1.000 68.59425 ? 91  PRO A HB3    1 
ATOM   1226 H HG2    . PRO A 1 73  ? 80.57841  -5.00802  3.50518   1.000 69.71316 ? 91  PRO A HG2    1 
ATOM   1227 H HG3    . PRO A 1 73  ? 81.99806  -5.55030  3.04050   1.000 69.71316 ? 91  PRO A HG3    1 
ATOM   1228 H HD2    . PRO A 1 73  ? 81.16550  -4.99109  5.66243   1.000 69.78263 ? 91  PRO A HD2    1 
ATOM   1229 H HD3    . PRO A 1 73  ? 82.12507  -6.16487  5.18612   1.000 69.78263 ? 91  PRO A HD3    1 
ATOM   1230 N N      . PRO A 1 74  ? 84.18196  -1.09998  4.30198   1.000 49.62596 ? 92  PRO A N      1 
ATOM   1231 C CA     . PRO A 1 74  ? 84.25261  0.27841   4.81199   1.000 47.42651 ? 92  PRO A CA     1 
ATOM   1232 C C      . PRO A 1 74  ? 82.94409  1.02302   4.58758   1.000 44.98184 ? 92  PRO A C      1 
ATOM   1233 O O      . PRO A 1 74  ? 82.39687  1.03730   3.48169   1.000 46.14671 ? 92  PRO A O      1 
ATOM   1234 C CB     . PRO A 1 74  ? 85.40117  0.89671   4.00399   1.000 47.81176 ? 92  PRO A CB     1 
ATOM   1235 C CG     . PRO A 1 74  ? 86.19837  -0.25837  3.51599   1.000 48.54007 ? 92  PRO A CG     1 
ATOM   1236 C CD     . PRO A 1 74  ? 85.20890  -1.35262  3.27928   1.000 48.91298 ? 92  PRO A CD     1 
ATOM   1237 H HA     . PRO A 1 74  ? 84.47234  0.28200   5.75677   1.000 56.91181 ? 92  PRO A HA     1 
ATOM   1238 H HB2    . PRO A 1 74  ? 85.04360  1.40922   3.26212   1.000 57.37411 ? 92  PRO A HB2    1 
ATOM   1239 H HB3    . PRO A 1 74  ? 85.93542  1.46962   4.57605   1.000 57.37411 ? 92  PRO A HB3    1 
ATOM   1240 H HG2    . PRO A 1 74  ? 86.65281  -0.02003  2.69284   1.000 58.24808 ? 92  PRO A HG2    1 
ATOM   1241 H HG3    . PRO A 1 74  ? 86.84631  -0.51871  4.18927   1.000 58.24808 ? 92  PRO A HG3    1 
ATOM   1242 H HD2    . PRO A 1 74  ? 84.83180  -1.29126  2.38769   1.000 58.69558 ? 92  PRO A HD2    1 
ATOM   1243 H HD3    . PRO A 1 74  ? 85.61803  -2.22276  3.40729   1.000 58.69558 ? 92  PRO A HD3    1 
ATOM   1244 N N      . GLU A 1 75  ? 82.44808  1.65618   5.64867   1.000 40.29192 ? 93  GLU A N      1 
ATOM   1245 C CA     . GLU A 1 75  ? 81.17684  2.35438   5.56410   1.000 35.68886 ? 93  GLU A CA     1 
ATOM   1246 C C      . GLU A 1 75  ? 81.33844  3.66467   4.79747   1.000 31.85174 ? 93  GLU A C      1 
ATOM   1247 O O      . GLU A 1 75  ? 82.44338  4.18571   4.62542   1.000 33.20423 ? 93  GLU A O      1 
ATOM   1248 C CB     . GLU A 1 75  ? 80.61743  2.61514   6.96137   1.000 35.66254 ? 93  GLU A CB     1 
ATOM   1249 C CG     . GLU A 1 75  ? 80.49595  1.35805   7.81251   1.000 35.59685 ? 93  GLU A CG     1 
ATOM   1250 C CD     . GLU A 1 75  ? 79.60411  1.54674   9.02692   1.000 35.73264 ? 93  GLU A CD     1 
ATOM   1251 O OE1    . GLU A 1 75  ? 79.07282  2.66093   9.20870   1.000 35.97489 ? 93  GLU A OE1    1 
ATOM   1252 O OE2    . GLU A 1 75  ? 79.42947  0.58020   9.80001   1.000 35.66175 ? 93  GLU A OE2    1 
ATOM   1253 H H      . GLU A 1 75  ? 82.82748  1.69365   6.41954   1.000 48.35030 ? 93  GLU A H      1 
ATOM   1254 H HA     . GLU A 1 75  ? 80.53443  1.80715   5.08583   1.000 42.82663 ? 93  GLU A HA     1 
ATOM   1255 H HB2    . GLU A 1 75  ? 81.20665  3.23130   7.42403   1.000 42.79504 ? 93  GLU A HB2    1 
ATOM   1256 H HB3    . GLU A 1 75  ? 79.73241  3.00298   6.87640   1.000 42.79504 ? 93  GLU A HB3    1 
ATOM   1257 H HG2    . GLU A 1 75  ? 80.11801  0.64686   7.27189   1.000 42.71622 ? 93  GLU A HG2    1 
ATOM   1258 H HG3    . GLU A 1 75  ? 81.37785  1.10349   8.12612   1.000 42.71622 ? 93  GLU A HG3    1 
ATOM   1259 N N      . GLY A 1 76  ? 80.21059  4.19698   4.33498   1.000 26.87478 ? 94  GLY A N      1 
ATOM   1260 C CA     . GLY A 1 76  ? 80.24794  5.35959   3.46457   1.000 23.22977 ? 94  GLY A CA     1 
ATOM   1261 C C      . GLY A 1 76  ? 80.76471  6.59838   4.17595   1.000 21.29554 ? 94  GLY A C      1 
ATOM   1262 O O      . GLY A 1 76  ? 80.42136  6.87347   5.32537   1.000 20.39506 ? 94  GLY A O      1 
ATOM   1263 H H      . GLY A 1 76  ? 79.42055  3.90552   4.50958   1.000 32.24974 ? 94  GLY A H      1 
ATOM   1264 H HA2    . GLY A 1 76  ? 80.82818  5.17688   2.70904   1.000 27.87572 ? 94  GLY A HA2    1 
ATOM   1265 H HA3    . GLY A 1 76  ? 79.35362  5.54555   3.13821   1.000 27.87572 ? 94  GLY A HA3    1 
ATOM   1266 N N      . ARG A 1 77  ? 81.59769  7.35747   3.46716   1.000 22.15826 ? 95  ARG A N      1 
ATOM   1267 C CA     . ARG A 1 77  ? 82.13209  8.61303   3.97518   1.000 22.89851 ? 95  ARG A CA     1 
ATOM   1268 C C      . ARG A 1 77  ? 81.04964  9.69257   3.97930   1.000 22.51669 ? 95  ARG A C      1 
ATOM   1269 O O      . ARG A 1 77  ? 79.91275  9.48756   3.54790   1.000 21.50073 ? 95  ARG A O      1 
ATOM   1270 C CB     . ARG A 1 77  ? 83.31200  9.08153   3.12145   1.000 24.40154 ? 95  ARG A CB     1 
ATOM   1271 C CG     . ARG A 1 77  ? 84.63700  8.38445   3.38888   1.000 25.22790 ? 95  ARG A CG     1 
ATOM   1272 C CD     . ARG A 1 77  ? 85.80625  9.20840   2.85151   1.000 25.47106 ? 95  ARG A CD     1 
ATOM   1273 N NE     . ARG A 1 77  ? 87.10035  8.57271   3.09262   1.000 27.07150 ? 95  ARG A NE     1 
ATOM   1274 C CZ     . ARG A 1 77  ? 88.26658  9.21776   3.10427   1.000 28.03820 ? 95  ARG A CZ     1 
ATOM   1275 N NH1    . ARG A 1 77  ? 88.30810  10.52880  2.90469   1.000 27.36163 ? 95  ARG A NH1    1 
ATOM   1276 N NH2    . ARG A 1 77  ? 89.39855  8.55409   3.32440   1.000 28.49590 ? 95  ARG A NH2    1 
ATOM   1277 H H      . ARG A 1 77  ? 81.87223  7.16242   2.67584   1.000 26.58991 ? 95  ARG A H      1 
ATOM   1278 H HA     . ARG A 1 77  ? 82.43617  8.46046   4.88357   1.000 27.47821 ? 95  ARG A HA     1 
ATOM   1279 H HB2    . ARG A 1 77  ? 83.09113  8.93199   2.18884   1.000 29.28185 ? 95  ARG A HB2    1 
ATOM   1280 H HB3    . ARG A 1 77  ? 83.44720  10.02844  3.28266   1.000 29.28185 ? 95  ARG A HB3    1 
ATOM   1281 H HG2    . ARG A 1 77  ? 84.75528  8.27050   4.34487   1.000 30.27348 ? 95  ARG A HG2    1 
ATOM   1282 H HG3    . ARG A 1 77  ? 84.64234  7.52015   2.94858   1.000 30.27348 ? 95  ARG A HG3    1 
ATOM   1283 H HD2    . ARG A 1 77  ? 85.70077  9.32090   1.89385   1.000 30.56527 ? 95  ARG A HD2    1 
ATOM   1284 H HD3    . ARG A 1 77  ? 85.81095  10.07426  3.28874   1.000 30.56527 ? 95  ARG A HD3    1 
ATOM   1285 H HE     . ARG A 1 77  ? 87.10978  7.72492   3.23674   1.000 32.48580 ? 95  ARG A HE     1 
ATOM   1286 H HH11   . ARG A 1 77  ? 87.58045  10.96605  2.76704   1.000 32.83396 ? 95  ARG A HH11   1 
ATOM   1287 H HH12   . ARG A 1 77  ? 89.06265  10.94134  2.91297   1.000 32.83396 ? 95  ARG A HH12   1 
ATOM   1288 H HH21   . ARG A 1 77  ? 89.37981  7.70505   3.46000   1.000 34.19508 ? 95  ARG A HH21   1 
ATOM   1289 H HH22   . ARG A 1 77  ? 90.14895  8.97415   3.33109   1.000 34.19508 ? 95  ARG A HH22   1 
ATOM   1290 N N      . ARG A 1 78  ? 81.42133  10.86644  4.47460   1.000 24.28787 ? 96  ARG A N      1 
ATOM   1291 C CA     . ARG A 1 78  ? 80.56863  12.03704  4.35904   1.000 26.16595 ? 96  ARG A CA     1 
ATOM   1292 C C      . ARG A 1 78  ? 80.58789  12.54984  2.92435   1.000 25.73731 ? 96  ARG A C      1 
ATOM   1293 O O      . ARG A 1 78  ? 81.57538  12.39994  2.20054   1.000 25.88221 ? 96  ARG A O      1 
ATOM   1294 C CB     . ARG A 1 78  ? 81.04278  13.13141  5.31829   1.000 28.42026 ? 96  ARG A CB     1 
ATOM   1295 C CG     . ARG A 1 78  ? 80.17202  14.37888  5.35443   1.000 32.22403 ? 96  ARG A CG     1 
ATOM   1296 C CD     . ARG A 1 78  ? 80.83727  15.48978  6.16298   1.000 35.23915 ? 96  ARG A CD     1 
ATOM   1297 N NE     . ARG A 1 78  ? 81.37024  14.99455  7.43004   1.000 36.95281 ? 96  ARG A NE     1 
ATOM   1298 C CZ     . ARG A 1 78  ? 80.70910  14.99510  8.58273   1.000 37.77397 ? 96  ARG A CZ     1 
ATOM   1299 N NH1    . ARG A 1 78  ? 79.47365  15.47488  8.65245   1.000 38.00702 ? 96  ARG A NH1    1 
ATOM   1300 N NH2    . ARG A 1 78  ? 81.29210  14.51268  9.67306   1.000 37.94568 ? 96  ARG A NH2    1 
ATOM   1301 H H      . ARG A 1 78  ? 82.16441  11.01050  4.88286   1.000 29.14544 ? 96  ARG A H      1 
ATOM   1302 H HA     . ARG A 1 78  ? 79.65503  11.81109  4.59394   1.000 31.39914 ? 96  ARG A HA     1 
ATOM   1303 H HB2    . ARG A 1 78  ? 81.06253  12.76479  6.21612   1.000 34.10431 ? 96  ARG A HB2    1 
ATOM   1304 H HB3    . ARG A 1 78  ? 81.93412  13.40689  5.05274   1.000 34.10431 ? 96  ARG A HB3    1 
ATOM   1305 H HG2    . ARG A 1 78  ? 80.03071  14.70031  4.45021   1.000 38.66884 ? 96  ARG A HG2    1 
ATOM   1306 H HG3    . ARG A 1 78  ? 79.32064  14.16649  5.76787   1.000 38.66884 ? 96  ARG A HG3    1 
ATOM   1307 H HD2    . ARG A 1 78  ? 81.57099  15.86328  5.65009   1.000 42.28698 ? 96  ARG A HD2    1 
ATOM   1308 H HD3    . ARG A 1 78  ? 80.18344  16.17946  6.35731   1.000 42.28698 ? 96  ARG A HD3    1 
ATOM   1309 H HE     . ARG A 1 78  ? 82.17050  14.67961  7.42982   1.000 44.34337 ? 96  ARG A HE     1 
ATOM   1310 H HH11   . ARG A 1 78  ? 79.09398  15.78912  7.94768   1.000 45.60842 ? 96  ARG A HH11   1 
ATOM   1311 H HH12   . ARG A 1 78  ? 79.05275  15.47152  9.40241   1.000 45.60842 ? 96  ARG A HH12   1 
ATOM   1312 H HH21   . ARG A 1 78  ? 82.09300  14.20224  9.63087   1.000 45.53482 ? 96  ARG A HH21   1 
ATOM   1313 H HH22   . ARG A 1 78  ? 80.86897  14.51052  10.42176  1.000 45.53482 ? 96  ARG A HH22   1 
ATOM   1314 N N      . LYS A 1 79  ? 79.47533  13.14417  2.50723   1.000 25.39433 ? 97  LYS A N      1 
ATOM   1315 C CA     . LYS A 1 79  ? 79.43657  13.79754  1.20825   1.000 25.85945 ? 97  LYS A CA     1 
ATOM   1316 C C      . LYS A 1 79  ? 80.44845  14.93387  1.16738   1.000 23.49334 ? 97  LYS A C      1 
ATOM   1317 O O      . LYS A 1 79  ? 80.46596  15.79528  2.05288   1.000 23.92804 ? 97  LYS A O      1 
ATOM   1318 C CB     . LYS A 1 79  ? 78.03599  14.33743  0.92510   1.000 29.57104 ? 97  LYS A CB     1 
ATOM   1319 C CG     . LYS A 1 79  ? 76.99066  13.27832  0.64869   1.000 33.15694 ? 97  LYS A CG     1 
ATOM   1320 C CD     . LYS A 1 79  ? 75.66700  13.92485  0.27854   1.000 36.21148 ? 97  LYS A CD     1 
ATOM   1321 C CE     . LYS A 1 79  ? 74.63618  12.89197  -0.15678  1.000 38.37002 ? 97  LYS A CE     1 
ATOM   1322 N NZ     . LYS A 1 79  ? 73.27858  13.49571  -0.35765  1.000 39.27962 ? 97  LYS A NZ     1 
ATOM   1323 H H      . LYS A 1 79  ? 78.74023  13.18205  2.95197   1.000 30.47319 ? 97  LYS A H      1 
ATOM   1324 H HA     . LYS A 1 79  ? 79.65718  13.15259  0.51812   1.000 31.03134 ? 97  LYS A HA     1 
ATOM   1325 H HB2    . LYS A 1 79  ? 77.73999  14.84484  1.69699   1.000 35.48525 ? 97  LYS A HB2    1 
ATOM   1326 H HB3    . LYS A 1 79  ? 78.08012  14.91386  0.14620   1.000 35.48525 ? 97  LYS A HB3    1 
ATOM   1327 H HG2    . LYS A 1 79  ? 77.27995  12.72047  -0.09024  1.000 39.78833 ? 97  LYS A HG2    1 
ATOM   1328 H HG3    . LYS A 1 79  ? 76.85904  12.73600  1.44208   1.000 39.78833 ? 97  LYS A HG3    1 
ATOM   1329 H HD2    . LYS A 1 79  ? 75.31565  14.39877  1.04851   1.000 43.45377 ? 97  LYS A HD2    1 
ATOM   1330 H HD3    . LYS A 1 79  ? 75.80671  14.54278  -0.45600  1.000 43.45377 ? 97  LYS A HD3    1 
ATOM   1331 H HE2    . LYS A 1 79  ? 74.91758  12.49549  -0.99614  1.000 46.04403 ? 97  LYS A HE2    1 
ATOM   1332 H HE3    . LYS A 1 79  ? 74.56400  12.20683  0.52606   1.000 46.04403 ? 97  LYS A HE3    1 
ATOM   1333 H HZ1    . LYS A 1 79  ? 72.99058  13.85710  0.40298   1.000 47.13554 ? 97  LYS A HZ1    1 
ATOM   1334 H HZ2    . LYS A 1 79  ? 72.70195  12.86900  -0.61617  1.000 47.13554 ? 97  LYS A HZ2    1 
ATOM   1335 H HZ3    . LYS A 1 79  ? 73.31631  14.12875  -0.98210  1.000 47.13554 ? 97  LYS A HZ3    1 
ATOM   1336 N N      . ARG A 1 80  ? 81.29066  14.93743  0.13254   1.000 21.14111 ? 98  ARG A N      1 
ATOM   1337 C CA     . ARG A 1 80  ? 82.24769  16.02026  -0.05723  1.000 19.41589 ? 98  ARG A CA     1 
ATOM   1338 C C      . ARG A 1 80  ? 81.53854  17.36624  -0.02500  1.000 18.55677 ? 98  ARG A C      1 
ATOM   1339 O O      . ARG A 1 80  ? 80.87742  17.75322  -0.99221  1.000 17.23907 ? 98  ARG A O      1 
ATOM   1340 C CB     . ARG A 1 80  ? 83.00280  15.86497  -1.37642  1.000 19.10615 ? 98  ARG A CB     1 
ATOM   1341 C CG     . ARG A 1 80  ? 84.06737  16.94242  -1.60002  1.000 19.13755 ? 98  ARG A CG     1 
ATOM   1342 C CD     . ARG A 1 80  ? 84.72788  16.81546  -2.96193  1.000 18.43160 ? 98  ARG A CD     1 
ATOM   1343 N NE     . ARG A 1 80  ? 85.65157  17.91647  -3.24400  1.000 17.84891 ? 98  ARG A NE     1 
ATOM   1344 C CZ     . ARG A 1 80  ? 86.97304  17.86173  -3.08325  1.000 16.95293 ? 98  ARG A CZ     1 
ATOM   1345 N NH1    . ARG A 1 80  ? 87.55481  16.75558  -2.63899  1.000 17.86283 ? 98  ARG A NH1    1 
ATOM   1346 N NH2    . ARG A 1 80  ? 87.72135  18.92060  -3.37078  1.000 14.68691 ? 98  ARG A NH2    1 
ATOM   1347 H H      . ARG A 1 80  ? 81.32517  14.32478  -0.47002  1.000 25.36934 ? 98  ARG A H      1 
ATOM   1348 H HA     . ARG A 1 80  ? 82.89710  15.98809  0.66258   1.000 23.29907 ? 98  ARG A HA     1 
ATOM   1349 H HB2    . ARG A 1 80  ? 83.44659  15.00247  -1.38329  1.000 22.92738 ? 98  ARG A HB2    1 
ATOM   1350 H HB3    . ARG A 1 80  ? 82.36830  15.91744  -2.10823  1.000 22.92738 ? 98  ARG A HB3    1 
ATOM   1351 H HG2    . ARG A 1 80  ? 83.65261  17.81755  -1.54507  1.000 22.96506 ? 98  ARG A HG2    1 
ATOM   1352 H HG3    . ARG A 1 80  ? 84.75491  16.85792  -0.92101  1.000 22.96506 ? 98  ARG A HG3    1 
ATOM   1353 H HD2    . ARG A 1 80  ? 85.22999  15.98617  -2.99457  1.000 22.11792 ? 98  ARG A HD2    1 
ATOM   1354 H HD3    . ARG A 1 80  ? 84.04213  16.81532  -3.64796  1.000 22.11792 ? 98  ARG A HD3    1 
ATOM   1355 H HE     . ARG A 1 80  ? 85.31609  18.65294  -3.53497  1.000 21.41870 ? 98  ARG A HE     1 
ATOM   1356 H HH11   . ARG A 1 80  ? 87.07833  16.06460  -2.45163  1.000 21.43539 ? 98  ARG A HH11   1 
ATOM   1357 H HH12   . ARG A 1 80  ? 88.40850  16.72938  -2.53831  1.000 21.43539 ? 98  ARG A HH12   1 
ATOM   1358 H HH21   . ARG A 1 80  ? 87.35292  19.64157  -3.66072  1.000 17.62429 ? 98  ARG A HH21   1 
ATOM   1359 H HH22   . ARG A 1 80  ? 88.57434  18.88530  -3.26703  1.000 17.62429 ? 98  ARG A HH22   1 
ATOM   1360 N N      . THR A 1 81  ? 81.67541  18.08071  1.08742   1.000 19.89375 ? 99  THR A N      1 
ATOM   1361 C CA     . THR A 1 81  ? 81.05184  19.38672  1.23241   1.000 19.81459 ? 99  THR A CA     1 
ATOM   1362 C C      . THR A 1 81  ? 81.38859  20.27531  0.04502   1.000 20.43014 ? 99  THR A C      1 
ATOM   1363 O O      . THR A 1 81  ? 82.55881  20.45965  -0.29651  1.000 18.93625 ? 99  THR A O      1 
ATOM   1364 C CB     . THR A 1 81  ? 81.52565  20.04325  2.52854   1.000 19.89685 ? 99  THR A CB     1 
ATOM   1365 O OG1    . THR A 1 81  ? 81.21243  19.19362  3.63982   1.000 20.34671 ? 99  THR A OG1    1 
ATOM   1366 C CG2    . THR A 1 81  ? 80.86541  21.39907  2.71784   1.000 19.95493 ? 99  THR A CG2    1 
ATOM   1367 H H      . THR A 1 81  ? 82.12658  17.82909  1.77498   1.000 23.87250 ? 99  THR A H      1 
ATOM   1368 H HA     . THR A 1 81  ? 80.08848  19.28119  1.27354   1.000 23.77751 ? 99  THR A HA     1 
ATOM   1369 H HB     . THR A 1 81  ? 82.48519  20.17996  2.48985   1.000 23.87622 ? 99  THR A HB     1 
ATOM   1370 H HG1    . THR A 1 81  ? 81.48685  19.54127  4.35356   1.000 24.41605 ? 99  THR A HG1    1 
ATOM   1371 H HG21   . THR A 1 81  ? 81.21595  22.03190  2.07166   1.000 23.94592 ? 99  THR A HG21   1 
ATOM   1372 H HG22   . THR A 1 81  ? 81.04142  21.73187  3.61180   1.000 23.94592 ? 99  THR A HG22   1 
ATOM   1373 H HG23   . THR A 1 81  ? 79.90649  21.32130  2.59403   1.000 23.94592 ? 99  THR A HG23   1 
ATOM   1374 N N      . ALA A 1 82  ? 80.35381  20.81509  -0.59200  1.000 22.36913 ? 100 ALA A N      1 
ATOM   1375 C CA     . ALA A 1 82  ? 80.53348  21.77060  -1.67218  1.000 24.08526 ? 100 ALA A CA     1 
ATOM   1376 C C      . ALA A 1 82  ? 80.68115  23.16595  -1.08777  1.000 24.71916 ? 100 ALA A C      1 
ATOM   1377 O O      . ALA A 1 82  ? 79.83910  23.60266  -0.29924  1.000 26.15199 ? 100 ALA A O      1 
ATOM   1378 C CB     . ALA A 1 82  ? 79.34997  21.72461  -2.63332  1.000 25.16451 ? 100 ALA A CB     1 
ATOM   1379 H H      . ALA A 1 82  ? 79.53103  20.64023  -0.41297  1.000 26.84295 ? 100 ALA A H      1 
ATOM   1380 H HA     . ALA A 1 82  ? 81.33634  21.55365  -2.17144  1.000 28.90231 ? 100 ALA A HA     1 
ATOM   1381 H HB1    . ALA A 1 82  ? 79.51979  22.32928  -3.37253  1.000 30.19741 ? 100 ALA A HB1    1 
ATOM   1382 H HB2    . ALA A 1 82  ? 79.24679  20.81861  -2.96409  1.000 30.19741 ? 100 ALA A HB2    1 
ATOM   1383 H HB3    . ALA A 1 82  ? 78.54824  21.99738  -2.16033  1.000 30.19741 ? 100 ALA A HB3    1 
ATOM   1384 N N      . VAL A 1 83  ? 81.75011  23.85788  -1.47120  1.000 24.76153 ? 101 VAL A N      1 
ATOM   1385 C CA     . VAL A 1 83  ? 82.04320  25.19918  -0.98004  1.000 24.96877 ? 101 VAL A CA     1 
ATOM   1386 C C      . VAL A 1 83  ? 82.07854  26.13769  -2.17512  1.000 25.31040 ? 101 VAL A C      1 
ATOM   1387 O O      . VAL A 1 83  ? 82.86874  25.93849  -3.10584  1.000 25.19157 ? 101 VAL A O      1 
ATOM   1388 C CB     . VAL A 1 83  ? 83.36711  25.24409  -0.20243  1.000 25.20902 ? 101 VAL A CB     1 
ATOM   1389 C CG1    . VAL A 1 83  ? 83.68125  26.66809  0.24338   1.000 25.49012 ? 101 VAL A CG1    1 
ATOM   1390 C CG2    . VAL A 1 83  ? 83.29615  24.31396  0.99373   1.000 25.19889 ? 101 VAL A CG2    1 
ATOM   1391 H H      . VAL A 1 83  ? 82.33421  23.56289  -2.02924  1.000 29.71384 ? 101 VAL A H      1 
ATOM   1392 H HA     . VAL A 1 83  ? 81.33176  25.48874  -0.38767  1.000 29.96253 ? 101 VAL A HA     1 
ATOM   1393 H HB     . VAL A 1 83  ? 84.08634  24.94846  -0.78227  1.000 30.25083 ? 101 VAL A HB     1 
ATOM   1394 H HG11   . VAL A 1 83  ? 83.90163  27.20168  -0.53611  1.000 30.58814 ? 101 VAL A HG11   1 
ATOM   1395 H HG12   . VAL A 1 83  ? 84.43416  26.64879  0.85465   1.000 30.58814 ? 101 VAL A HG12   1 
ATOM   1396 H HG13   . VAL A 1 83  ? 82.90313  27.03853  0.68859   1.000 30.58814 ? 101 VAL A HG13   1 
ATOM   1397 H HG21   . VAL A 1 83  ? 82.56584  24.59303  1.56789   1.000 30.23867 ? 101 VAL A HG21   1 
ATOM   1398 H HG22   . VAL A 1 83  ? 84.13463  24.35944  1.47931   1.000 30.23867 ? 101 VAL A HG22   1 
ATOM   1399 H HG23   . VAL A 1 83  ? 83.14368  23.40848  0.68107   1.000 30.23867 ? 101 VAL A HG23   1 
ATOM   1400 N N      . THR A 1 84  ? 81.22746  27.15777  -2.14818  1.000 26.58479 ? 102 THR A N      1 
ATOM   1401 C CA     . THR A 1 84  ? 81.14311  28.08950  -3.25872  1.000 27.61722 ? 102 THR A CA     1 
ATOM   1402 C C      . THR A 1 84  ? 82.37201  28.99539  -3.28621  1.000 28.39450 ? 102 THR A C      1 
ATOM   1403 O O      . THR A 1 84  ? 83.17342  29.04130  -2.34649  1.000 28.00990 ? 102 THR A O      1 
ATOM   1404 C CB     . THR A 1 84  ? 79.87636  28.93778  -3.15846  1.000 28.67168 ? 102 THR A CB     1 
ATOM   1405 O OG1    . THR A 1 84  ? 79.97256  29.80922  -2.02668  1.000 28.90817 ? 102 THR A OG1    1 
ATOM   1406 C CG2    . THR A 1 84  ? 78.63986  28.05473  -3.01331  1.000 29.82010 ? 102 THR A CG2    1 
ATOM   1407 H H      . THR A 1 84  ? 80.69039  27.32967  -1.49887  1.000 31.90174 ? 102 THR A H      1 
ATOM   1408 H HA     . THR A 1 84  ? 81.10797  27.58764  -4.08806  1.000 33.14067 ? 102 THR A HA     1 
ATOM   1409 H HB     . THR A 1 84  ? 79.77806  29.46381  -3.96749  1.000 34.40601 ? 102 THR A HB     1 
ATOM   1410 H HG1    . THR A 1 84  ? 79.26428  30.25339  -1.94507  1.000 34.68980 ? 102 THR A HG1    1 
ATOM   1411 H HG21   . THR A 1 84  ? 78.59875  27.41867  -3.74450  1.000 35.78412 ? 102 THR A HG21   1 
ATOM   1412 H HG22   . THR A 1 84  ? 77.83856  28.60122  -3.02604  1.000 35.78412 ? 102 THR A HG22   1 
ATOM   1413 H HG23   . THR A 1 84  ? 78.67600  27.56850  -2.17476  1.000 35.78412 ? 102 THR A HG23   1 
ATOM   1414 N N      . GLY A 1 85  ? 82.50815  29.73178  -4.39090  1.000 29.15989 ? 103 GLY A N      1 
ATOM   1415 C CA     . GLY A 1 85  ? 83.63472  30.63880  -4.52987  1.000 28.47385 ? 103 GLY A CA     1 
ATOM   1416 C C      . GLY A 1 85  ? 83.60835  31.76221  -3.51290  1.000 28.71560 ? 103 GLY A C      1 
ATOM   1417 O O      . GLY A 1 85  ? 84.65503  32.18105  -3.01207  1.000 29.19467 ? 103 GLY A O      1 
ATOM   1418 H H      . GLY A 1 85  ? 81.96909  29.72210  -5.06092  1.000 34.99187 ? 103 GLY A H      1 
ATOM   1419 H HA2    . GLY A 1 85  ? 84.46060  30.14320  -4.41495  1.000 34.16863 ? 103 GLY A HA2    1 
ATOM   1420 H HA3    . GLY A 1 85  ? 83.62244  31.03070  -5.41709  1.000 34.16863 ? 103 GLY A HA3    1 
ATOM   1421 N N      . SER A 1 86  ? 82.41647  32.26847  -3.19396  1.000 29.37615 ? 104 SER A N      1 
ATOM   1422 C CA     . SER A 1 86  ? 82.31809  33.32767  -2.19465  1.000 30.21949 ? 104 SER A CA     1 
ATOM   1423 C C      . SER A 1 86  ? 82.62130  32.79160  -0.80188  1.000 28.34548 ? 104 SER A C      1 
ATOM   1424 O O      . SER A 1 86  ? 83.36072  33.42077  -0.03322  1.000 26.21200 ? 104 SER A O      1 
ATOM   1425 C CB     . SER A 1 86  ? 80.92859  33.96075  -2.23973  1.000 31.91824 ? 104 SER A CB     1 
ATOM   1426 O OG     . SER A 1 86  ? 79.92833  32.96307  -2.33715  1.000 33.72450 ? 104 SER A OG     1 
ATOM   1427 H H      . SER A 1 86  ? 81.66649  32.02112  -3.53448  1.000 35.25138 ? 104 SER A H      1 
ATOM   1428 H HA     . SER A 1 86  ? 82.96687  34.01897  -2.39985  1.000 36.26339 ? 104 SER A HA     1 
ATOM   1429 H HB2    . SER A 1 86  ? 80.78735  34.47240  -1.42784  1.000 38.30189 ? 104 SER A HB2    1 
ATOM   1430 H HB3    . SER A 1 86  ? 80.87107  34.54326  -3.01321  1.000 38.30189 ? 104 SER A HB3    1 
ATOM   1431 H HG     . SER A 1 86  ? 79.16728  33.31858  -2.34009  1.000 40.46940 ? 104 SER A HG     1 
ATOM   1432 N N      . GLN A 1 87  ? 82.05660  31.63039  -0.45953  1.000 27.37329 ? 105 GLN A N      1 
ATOM   1433 C CA     . GLN A 1 87  ? 82.42388  30.97283  0.78785   1.000 26.50332 ? 105 GLN A CA     1 
ATOM   1434 C C      . GLN A 1 87  ? 83.93834  30.83257  0.89933   1.000 25.55232 ? 105 GLN A C      1 
ATOM   1435 O O      . GLN A 1 87  ? 84.51978  31.09348  1.95898   1.000 25.82402 ? 105 GLN A O      1 
ATOM   1436 C CB     . GLN A 1 87  ? 81.74002  29.60459  0.87760   1.000 26.63176 ? 105 GLN A CB     1 
ATOM   1437 C CG     . GLN A 1 87  ? 80.22558  29.68255  1.07644   1.000 26.18207 ? 105 GLN A CG     1 
ATOM   1438 C CD     . GLN A 1 87  ? 79.54743  28.31842  1.08244   1.000 24.96688 ? 105 GLN A CD     1 
ATOM   1439 O OE1    . GLN A 1 87  ? 79.91902  27.41406  0.32870   1.000 23.79520 ? 105 GLN A OE1    1 
ATOM   1440 N NE2    . GLN A 1 87  ? 78.54516  28.16715  1.94015   1.000 24.68288 ? 105 GLN A NE2    1 
ATOM   1441 H H      . GLN A 1 87  ? 81.46806  31.21181  -0.92645  1.000 32.84795 ? 105 GLN A H      1 
ATOM   1442 H HA     . GLN A 1 87  ? 82.11456  31.50608  1.53676   1.000 31.80398 ? 105 GLN A HA     1 
ATOM   1443 H HB2    . GLN A 1 87  ? 81.90569  29.11893  0.05444   1.000 31.95811 ? 105 GLN A HB2    1 
ATOM   1444 H HB3    . GLN A 1 87  ? 82.11256  29.11890  1.63007   1.000 31.95811 ? 105 GLN A HB3    1 
ATOM   1445 H HG2    . GLN A 1 87  ? 80.04226  30.10977  1.92777   1.000 31.41848 ? 105 GLN A HG2    1 
ATOM   1446 H HG3    . GLN A 1 87  ? 79.84047  30.20316  0.35425   1.000 31.41848 ? 105 GLN A HG3    1 
ATOM   1447 H HE21   . GLN A 1 87  ? 78.12717  27.41690  1.98507   1.000 29.61946 ? 105 GLN A HE21   1 
ATOM   1448 H HE22   . GLN A 1 87  ? 78.31400  28.81942  2.45075   1.000 29.61946 ? 105 GLN A HE22   1 
ATOM   1449 N N      . THR A 1 88  ? 84.59952  30.43778  -0.19093  1.000 22.83171 ? 106 THR A N      1 
ATOM   1450 C CA     . THR A 1 88  ? 86.05246  30.32892  -0.15717  1.000 22.21183 ? 106 THR A CA     1 
ATOM   1451 C C      . THR A 1 88  ? 86.69610  31.68463  0.09794   1.000 23.07070 ? 106 THR A C      1 
ATOM   1452 O O      . THR A 1 88  ? 87.64633  31.79284  0.88168   1.000 23.17198 ? 106 THR A O      1 
ATOM   1453 C CB     . THR A 1 88  ? 86.56705  29.73131  -1.46517  1.000 22.78585 ? 106 THR A CB     1 
ATOM   1454 O OG1    . THR A 1 88  ? 85.91080  28.47955  -1.70953  1.000 23.71336 ? 106 THR A OG1    1 
ATOM   1455 C CG2    . THR A 1 88  ? 88.07303  29.50227  -1.39439  1.000 22.42461 ? 106 THR A CG2    1 
ATOM   1456 H H      . THR A 1 88  ? 84.23708  30.23261  -0.94336  1.000 27.39806 ? 106 THR A H      1 
ATOM   1457 H HA     . THR A 1 88  ? 86.30453  29.73151  0.56426   1.000 26.65419 ? 106 THR A HA     1 
ATOM   1458 H HB     . THR A 1 88  ? 86.38411  30.34396  -2.19463  1.000 27.34302 ? 106 THR A HB     1 
ATOM   1459 H HG1    . THR A 1 88  ? 86.16686  28.15921  -2.44261  1.000 28.45603 ? 106 THR A HG1    1 
ATOM   1460 H HG21   . THR A 1 88  ? 88.53477  30.35214  -1.32073  1.000 26.90953 ? 106 THR A HG21   1 
ATOM   1461 H HG22   . THR A 1 88  ? 88.37736  29.04702  -2.19503  1.000 26.90953 ? 106 THR A HG22   1 
ATOM   1462 H HG23   . THR A 1 88  ? 88.28987  28.95815  -0.62120  1.000 26.90953 ? 106 THR A HG23   1 
ATOM   1463 N N      . ALA A 1 89  ? 86.18609  32.73442  -0.54793  1.000 24.21136 ? 107 ALA A N      1 
ATOM   1464 C CA     . ALA A 1 89  ? 86.79548  34.05152  -0.40699  1.000 24.77283 ? 107 ALA A CA     1 
ATOM   1465 C C      . ALA A 1 89  ? 86.79094  34.51010  1.04457   1.000 25.41254 ? 107 ALA A C      1 
ATOM   1466 O O      . ALA A 1 89  ? 87.73755  35.16339  1.49718   1.000 25.32282 ? 107 ALA A O      1 
ATOM   1467 C CB     . ALA A 1 89  ? 86.06554  35.05982  -1.29214  1.000 25.42263 ? 107 ALA A CB     1 
ATOM   1468 H H      . ALA A 1 89  ? 85.49924  32.70959  -1.06486  1.000 29.05363 ? 107 ALA A H      1 
ATOM   1469 H HA     . ALA A 1 89  ? 87.71839  34.00358  -0.70169  1.000 29.72739 ? 107 ALA A HA     1 
ATOM   1470 H HB1    . ALA A 1 89  ? 86.46608  35.93486  -1.17060  1.000 30.50715 ? 107 ALA A HB1    1 
ATOM   1471 H HB2    . ALA A 1 89  ? 86.14754  34.78429  -2.21856  1.000 30.50715 ? 107 ALA A HB2    1 
ATOM   1472 H HB3    . ALA A 1 89  ? 85.13025  35.08573  -1.03629  1.000 30.50715 ? 107 ALA A HB3    1 
ATOM   1473 N N      . LEU A 1 90  ? 85.72839  34.18685  1.78812   1.000 26.96820 ? 108 LEU A N      1 
ATOM   1474 C CA     . LEU A 1 90  ? 85.66749  34.56261  3.19863   1.000 28.31269 ? 108 LEU A CA     1 
ATOM   1475 C C      . LEU A 1 90  ? 86.68704  33.78599  4.01870   1.000 29.05905 ? 108 LEU A C      1 
ATOM   1476 O O      . LEU A 1 90  ? 87.34670  34.35152  4.89825   1.000 30.48636 ? 108 LEU A O      1 
ATOM   1477 C CB     . LEU A 1 90  ? 84.25958  34.32756  3.74534   1.000 30.19401 ? 108 LEU A CB     1 
ATOM   1478 C CG     . LEU A 1 90  ? 83.23301  35.44605  3.55603   1.000 32.96995 ? 108 LEU A CG     1 
ATOM   1479 C CD1    . LEU A 1 90  ? 83.20539  35.95285  2.12621   1.000 34.30046 ? 108 LEU A CD1    1 
ATOM   1480 C CD2    . LEU A 1 90  ? 81.85475  34.95532  3.96267   1.000 33.64701 ? 108 LEU A CD2    1 
ATOM   1481 H H      . LEU A 1 90  ? 85.04056  33.75664  1.50281   1.000 32.36184 ? 108 LEU A H      1 
ATOM   1482 H HA     . LEU A 1 90  ? 85.86891  35.50822  3.27707   1.000 33.97523 ? 108 LEU A HA     1 
ATOM   1483 H HB2    . LEU A 1 90  ? 83.89979  33.53941  3.30914   1.000 36.23282 ? 108 LEU A HB2    1 
ATOM   1484 H HB3    . LEU A 1 90  ? 84.33408  34.17344  4.70011   1.000 36.23282 ? 108 LEU A HB3    1 
ATOM   1485 H HG     . LEU A 1 90  ? 83.48761  36.19294  4.12015   1.000 39.56394 ? 108 LEU A HG     1 
ATOM   1486 H HD11   . LEU A 1 90  ? 84.07959  36.30696  1.89973   1.000 41.16055 ? 108 LEU A HD11   1 
ATOM   1487 H HD12   . LEU A 1 90  ? 82.53619  36.65105  2.05150   1.000 41.16055 ? 108 LEU A HD12   1 
ATOM   1488 H HD13   . LEU A 1 90  ? 82.98316  35.21700  1.53457   1.000 41.16055 ? 108 LEU A HD13   1 
ATOM   1489 H HD21   . LEU A 1 90  ? 81.59114  34.23076  3.37410   1.000 40.37641 ? 108 LEU A HD21   1 
ATOM   1490 H HD22   . LEU A 1 90  ? 81.22382  35.68830  3.88804   1.000 40.37641 ? 108 LEU A HD22   1 
ATOM   1491 H HD23   . LEU A 1 90  ? 81.88935  34.64073  4.87959   1.000 40.37641 ? 108 LEU A HD23   1 
ATOM   1492 N N      . LEU A 1 91  ? 86.82605  32.48713  3.75002   1.000 28.77884 ? 109 LEU A N      1 
ATOM   1493 C CA     . LEU A 1 91  ? 87.81350  31.68860  4.46754   1.000 29.24805 ? 109 LEU A CA     1 
ATOM   1494 C C      . LEU A 1 91  ? 89.22965  32.17141  4.17506   1.000 28.72111 ? 109 LEU A C      1 
ATOM   1495 O O      . LEU A 1 91  ? 90.08929  32.17982  5.06501   1.000 28.73714 ? 109 LEU A O      1 
ATOM   1496 C CB     . LEU A 1 91  ? 87.65823  30.21505  4.09469   1.000 29.77682 ? 109 LEU A CB     1 
ATOM   1497 C CG     . LEU A 1 91  ? 86.29490  29.61350  4.44032   1.000 30.46121 ? 109 LEU A CG     1 
ATOM   1498 C CD1    . LEU A 1 91  ? 86.14277  28.24576  3.80452   1.000 29.88722 ? 109 LEU A CD1    1 
ATOM   1499 C CD2    . LEU A 1 91  ? 86.11483  29.53000  5.94995   1.000 31.02954 ? 109 LEU A CD2    1 
ATOM   1500 H H      . LEU A 1 91  ? 86.36797  32.05239  3.16627   1.000 34.53461 ? 109 LEU A H      1 
ATOM   1501 H HA     . LEU A 1 91  ? 87.65906  31.77645  5.42113   1.000 35.09766 ? 109 LEU A HA     1 
ATOM   1502 H HB2    . LEU A 1 91  ? 87.78501  30.12430  3.13731   1.000 35.73218 ? 109 LEU A HB2    1 
ATOM   1503 H HB3    . LEU A 1 91  ? 88.33315  29.70439  4.56861   1.000 35.73218 ? 109 LEU A HB3    1 
ATOM   1504 H HG     . LEU A 1 91  ? 85.59646  30.18708  4.08805   1.000 36.55345 ? 109 LEU A HG     1 
ATOM   1505 H HD11   . LEU A 1 91  ? 86.32555  28.31699  2.85456   1.000 35.86466 ? 109 LEU A HD11   1 
ATOM   1506 H HD12   . LEU A 1 91  ? 85.23571  27.93170  3.94420   1.000 35.86466 ? 109 LEU A HD12   1 
ATOM   1507 H HD13   . LEU A 1 91  ? 86.77197  27.63380  4.21745   1.000 35.86466 ? 109 LEU A HD13   1 
ATOM   1508 H HD21   . LEU A 1 91  ? 86.85440  29.02977  6.32902   1.000 37.23545 ? 109 LEU A HD21   1 
ATOM   1509 H HD22   . LEU A 1 91  ? 85.27750  29.08029  6.14371   1.000 37.23545 ? 109 LEU A HD22   1 
ATOM   1510 H HD23   . LEU A 1 91  ? 86.10053  30.42799  6.31643   1.000 37.23545 ? 109 LEU A HD23   1 
ATOM   1511 N N      . LEU A 1 92  ? 89.49157  32.58225  2.93373   1.000 27.35590 ? 110 LEU A N      1 
ATOM   1512 C CA     . LEU A 1 92  ? 90.81549  33.08859  2.59464   1.000 26.86049 ? 110 LEU A CA     1 
ATOM   1513 C C      . LEU A 1 92  ? 91.11477  34.38777  3.32914   1.000 28.45699 ? 110 LEU A C      1 
ATOM   1514 O O      . LEU A 1 92  ? 92.24385  34.59998  3.78857   1.000 27.47316 ? 110 LEU A O      1 
ATOM   1515 C CB     . LEU A 1 92  ? 90.92498  33.28618  1.08687   1.000 25.85580 ? 110 LEU A CB     1 
ATOM   1516 C CG     . LEU A 1 92  ? 90.83485  31.99650  0.27948   1.000 26.18357 ? 110 LEU A CG     1 
ATOM   1517 C CD1    . LEU A 1 92  ? 90.75227  32.30593  -1.20356  1.000 25.41867 ? 110 LEU A CD1    1 
ATOM   1518 C CD2    . LEU A 1 92  ? 92.02945  31.08358  0.58702   1.000 27.08739 ? 110 LEU A CD2    1 
ATOM   1519 H H      . LEU A 1 92  ? 88.92954  32.57759  2.28281   1.000 32.82708 ? 110 LEU A H      1 
ATOM   1520 H HA     . LEU A 1 92  ? 91.48002  32.43456  2.86212   1.000 32.23259 ? 110 LEU A HA     1 
ATOM   1521 H HB2    . LEU A 1 92  ? 90.20334  33.86623  0.79760   1.000 31.02696 ? 110 LEU A HB2    1 
ATOM   1522 H HB3    . LEU A 1 92  ? 91.78086  33.69807  0.89011   1.000 31.02696 ? 110 LEU A HB3    1 
ATOM   1523 H HG     . LEU A 1 92  ? 90.02807  31.51906  0.52857   1.000 31.42028 ? 110 LEU A HG     1 
ATOM   1524 H HD11   . LEU A 1 92  ? 89.96166  32.84252  -1.37066  1.000 30.50241 ? 110 LEU A HD11   1 
ATOM   1525 H HD12   . LEU A 1 92  ? 90.69708  31.47287  -1.69738  1.000 30.50241 ? 110 LEU A HD12   1 
ATOM   1526 H HD13   . LEU A 1 92  ? 91.54650  32.79563  -1.46869  1.000 30.50241 ? 110 LEU A HD13   1 
ATOM   1527 H HD21   . LEU A 1 92  ? 92.84692  31.60233  0.52742   1.000 32.50486 ? 110 LEU A HD21   1 
ATOM   1528 H HD22   . LEU A 1 92  ? 92.04879  30.36036  -0.05911  1.000 32.50486 ? 110 LEU A HD22   1 
ATOM   1529 H HD23   . LEU A 1 92  ? 91.93014  30.72445  1.48260   1.000 32.50486 ? 110 LEU A HD23   1 
ATOM   1530 N N      . ARG A 1 93  ? 90.12059  35.27301  3.44496   1.000 30.88967 ? 111 ARG A N      1 
ATOM   1531 C CA     . ARG A 1 93  ? 90.32864  36.51190  4.18837   1.000 33.65720 ? 111 ARG A CA     1 
ATOM   1532 C C      . ARG A 1 93  ? 90.47927  36.22837  5.67573   1.000 35.64204 ? 111 ARG A C      1 
ATOM   1533 O O      . ARG A 1 93  ? 91.35200  36.80306  6.33861   1.000 37.09948 ? 111 ARG A O      1 
ATOM   1534 C CB     . ARG A 1 93  ? 89.17344  37.48363  3.93556   1.000 34.72403 ? 111 ARG A CB     1 
ATOM   1535 C CG     . ARG A 1 93  ? 89.31122  38.83330  4.64529   1.000 36.34843 ? 111 ARG A CG     1 
ATOM   1536 C CD     . ARG A 1 93  ? 88.30997  39.85954  4.10691   1.000 37.91890 ? 111 ARG A CD     1 
ATOM   1537 N NE     . ARG A 1 93  ? 88.15926  41.03267  4.97238   1.000 39.22167 ? 111 ARG A NE     1 
ATOM   1538 C CZ     . ARG A 1 93  ? 89.01024  42.05679  5.01808   1.000 39.98099 ? 111 ARG A CZ     1 
ATOM   1539 N NH1    . ARG A 1 93  ? 88.77826  43.07675  5.83283   1.000 40.66212 ? 111 ARG A NH1    1 
ATOM   1540 N NH2    . ARG A 1 93  ? 90.09809  42.06627  4.26023   1.000 39.64440 ? 111 ARG A NH2    1 
ATOM   1541 H H      . ARG A 1 93  ? 89.33425  35.18043  3.10926   1.000 37.06760 ? 111 ARG A H      1 
ATOM   1542 H HA     . ARG A 1 93  ? 91.14209  36.93674  3.87419   1.000 40.38864 ? 111 ARG A HA     1 
ATOM   1543 H HB2    . ARG A 1 93  ? 89.11940  37.65791  2.98288   1.000 41.66883 ? 111 ARG A HB2    1 
ATOM   1544 H HB3    . ARG A 1 93  ? 88.35100  37.07275  4.24484   1.000 41.66883 ? 111 ARG A HB3    1 
ATOM   1545 H HG2    . ARG A 1 93  ? 89.14565  38.71531  5.59374   1.000 43.61812 ? 111 ARG A HG2    1 
ATOM   1546 H HG3    . ARG A 1 93  ? 90.20652  39.17936  4.50533   1.000 43.61812 ? 111 ARG A HG3    1 
ATOM   1547 H HD2    . ARG A 1 93  ? 88.61247  40.16774  3.23835   1.000 45.50268 ? 111 ARG A HD2    1 
ATOM   1548 H HD3    . ARG A 1 93  ? 87.44069  39.43704  4.02475   1.000 45.50268 ? 111 ARG A HD3    1 
ATOM   1549 H HE     . ARG A 1 93  ? 87.47169  41.06212  5.48810   1.000 47.06600 ? 111 ARG A HE     1 
ATOM   1550 H HH11   . ARG A 1 93  ? 88.07813  43.07756  6.33224   1.000 48.79455 ? 111 ARG A HH11   1 
ATOM   1551 H HH12   . ARG A 1 93  ? 89.32793  43.73753  5.86188   1.000 48.79455 ? 111 ARG A HH12   1 
ATOM   1552 H HH21   . ARG A 1 93  ? 90.26017  41.40696  3.73237   1.000 47.57328 ? 111 ARG A HH21   1 
ATOM   1553 H HH22   . ARG A 1 93  ? 90.64165  42.73172  4.29653   1.000 47.57328 ? 111 ARG A HH22   1 
ATOM   1554 N N      . ALA A 1 94  ? 89.64622  35.33302  6.21532   1.000 35.21375 ? 112 ALA A N      1 
ATOM   1555 C CA     . ALA A 1 94  ? 89.80593  34.92646  7.60603   1.000 34.47531 ? 112 ALA A CA     1 
ATOM   1556 C C      . ALA A 1 94  ? 91.14157  34.22844  7.82914   1.000 34.07970 ? 112 ALA A C      1 
ATOM   1557 O O      . ALA A 1 94  ? 91.69419  34.28443  8.93394   1.000 33.43156 ? 112 ALA A O      1 
ATOM   1558 C CB     . ALA A 1 94  ? 88.64727  34.01647  8.01616   1.000 34.17175 ? 112 ALA A CB     1 
ATOM   1559 H H      . ALA A 1 94  ? 88.99342  34.95477  5.80256   1.000 42.25650 ? 112 ALA A H      1 
ATOM   1560 H HA     . ALA A 1 94  ? 89.78263  35.71294  8.17331   1.000 41.37037 ? 112 ALA A HA     1 
ATOM   1561 H HB1    . ALA A 1 94  ? 88.76130  33.75887  8.94435   1.000 41.00610 ? 112 ALA A HB1    1 
ATOM   1562 H HB2    . ALA A 1 94  ? 87.81287  34.49890  7.90687   1.000 41.00610 ? 112 ALA A HB2    1 
ATOM   1563 H HB3    . ALA A 1 94  ? 88.64984  33.22789  7.45132   1.000 41.00610 ? 112 ALA A HB3    1 
ATOM   1564 N N      . PHE A 1 95  ? 91.68198  33.58564  6.79000   1.000 35.00837 ? 113 PHE A N      1 
ATOM   1565 C CA     . PHE A 1 95  ? 92.91229  32.81268  6.92969   1.000 36.89778 ? 113 PHE A CA     1 
ATOM   1566 C C      . PHE A 1 95  ? 94.14737  33.70748  6.95203   1.000 41.36582 ? 113 PHE A C      1 
ATOM   1567 O O      . PHE A 1 95  ? 95.07857  33.46017  7.72740   1.000 41.74090 ? 113 PHE A O      1 
ATOM   1568 C CB     . PHE A 1 95  ? 93.01155  31.79281  5.79370   1.000 34.60814 ? 113 PHE A CB     1 
ATOM   1569 C CG     . PHE A 1 95  ? 94.21393  30.89511  5.87980   1.000 32.23360 ? 113 PHE A CG     1 
ATOM   1570 C CD1    . PHE A 1 95  ? 94.28996  29.90948  6.84455   1.000 31.86404 ? 113 PHE A CD1    1 
ATOM   1571 C CD2    . PHE A 1 95  ? 95.25960  31.02547  4.98087   1.000 31.40816 ? 113 PHE A CD2    1 
ATOM   1572 C CE1    . PHE A 1 95  ? 95.39481  29.07713  6.91970   1.000 31.71031 ? 113 PHE A CE1    1 
ATOM   1573 C CE2    . PHE A 1 95  ? 96.36324  30.19830  5.05280   1.000 30.88087 ? 113 PHE A CE2    1 
ATOM   1574 C CZ     . PHE A 1 95  ? 96.42962  29.22332  6.02309   1.000 31.02083 ? 113 PHE A CZ     1 
ATOM   1575 H H      . PHE A 1 95  ? 91.35444  33.58252  5.99483   1.000 42.01005 ? 113 PHE A H      1 
ATOM   1576 H HA     . PHE A 1 95  ? 92.88453  32.33106  7.77122   1.000 44.27734 ? 113 PHE A HA     1 
ATOM   1577 H HB2    . PHE A 1 95  ? 92.22165  31.23010  5.81139   1.000 41.52977 ? 113 PHE A HB2    1 
ATOM   1578 H HB3    . PHE A 1 95  ? 93.05991  32.27031  4.95075   1.000 41.52977 ? 113 PHE A HB3    1 
ATOM   1579 H HD1    . PHE A 1 95  ? 93.59207  29.80353  7.45004   1.000 38.23685 ? 113 PHE A HD1    1 
ATOM   1580 H HD2    . PHE A 1 95  ? 95.21797  31.67862  4.32014   1.000 37.68979 ? 113 PHE A HD2    1 
ATOM   1581 H HE1    . PHE A 1 95  ? 95.43763  28.41947  7.57586   1.000 38.05237 ? 113 PHE A HE1    1 
ATOM   1582 H HE2    . PHE A 1 95  ? 97.06106  30.29966  4.44644   1.000 37.05705 ? 113 PHE A HE2    1 
ATOM   1583 H HZ     . PHE A 1 95  ? 97.17165  28.66490  6.07268   1.000 37.22499 ? 113 PHE A HZ     1 
ATOM   1584 N N      . GLU A 1 96  ? 94.18228  34.74336  6.10725   1.000 45.20095 ? 114 GLU A N      1 
ATOM   1585 C CA     . GLU A 1 96  ? 95.31300  35.66777  6.12709   1.000 48.52056 ? 114 GLU A CA     1 
ATOM   1586 C C      . GLU A 1 96  ? 95.36708  36.46267  7.42525   1.000 47.36727 ? 114 GLU A C      1 
ATOM   1587 O O      . GLU A 1 96  ? 96.45339  36.86667  7.85597   1.000 47.25287 ? 114 GLU A O      1 
ATOM   1588 C CB     . GLU A 1 96  ? 95.24009  36.61877  4.93539   1.000 52.92494 ? 114 GLU A CB     1 
ATOM   1589 C CG     . GLU A 1 96  ? 95.39423  35.93245  3.59225   1.000 57.66195 ? 114 GLU A CG     1 
ATOM   1590 C CD     . GLU A 1 96  ? 95.22087  36.88986  2.42813   1.000 62.07936 ? 114 GLU A CD     1 
ATOM   1591 O OE1    . GLU A 1 96  ? 95.03509  38.10501  2.67350   1.000 63.51698 ? 114 GLU A OE1    1 
ATOM   1592 O OE2    . GLU A 1 96  ? 95.26747  36.42510  1.26780   1.000 63.47450 ? 114 GLU A OE2    1 
ATOM   1593 H H      . GLU A 1 96  ? 93.57584  34.92754  5.52596   1.000 54.24114 ? 114 GLU A H      1 
ATOM   1594 H HA     . GLU A 1 96  ? 96.13166  35.15294  6.05200   1.000 58.22467 ? 114 GLU A HA     1 
ATOM   1595 H HB2    . GLU A 1 96  ? 94.37753  37.06242  4.94343   1.000 63.50992 ? 114 GLU A HB2    1 
ATOM   1596 H HB3    . GLU A 1 96  ? 95.95088  37.27390  5.01593   1.000 63.50992 ? 114 GLU A HB3    1 
ATOM   1597 H HG2    . GLU A 1 96  ? 96.28165  35.54516  3.53399   1.000 69.19434 ? 114 GLU A HG2    1 
ATOM   1598 H HG3    . GLU A 1 96  ? 94.72282  35.23691  3.51261   1.000 69.19434 ? 114 GLU A HG3    1 
ATOM   1599 N N      . LYS A 1 97  ? 94.21525  36.70170  8.05720   1.000 45.58481 ? 115 LYS A N      1 
ATOM   1600 C CA     . LYS A 1 97  ? 94.20930  37.37618  9.35067   1.000 44.32635 ? 115 LYS A CA     1 
ATOM   1601 C C      . LYS A 1 97  ? 94.69786  36.44847  10.45539  1.000 41.68231 ? 115 LYS A C      1 
ATOM   1602 O O      . LYS A 1 97  ? 95.58388  36.81266  11.23677  1.000 41.13127 ? 115 LYS A O      1 
ATOM   1603 C CB     . LYS A 1 97  ? 92.80650  37.89510  9.66846   1.000 46.60772 ? 115 LYS A CB     1 
ATOM   1604 C CG     . LYS A 1 97  ? 92.34949  39.03381  8.76580   1.000 49.78308 ? 115 LYS A CG     1 
ATOM   1605 C CD     . LYS A 1 97  ? 90.99420  39.58534  9.19709   1.000 52.41931 ? 115 LYS A CD     1 
ATOM   1606 C CE     . LYS A 1 97  ? 90.54545  40.74418  8.31066   1.000 53.89546 ? 115 LYS A CE     1 
ATOM   1607 N NZ     . LYS A 1 97  ? 91.47779  41.90867  8.38981   1.000 55.06060 ? 115 LYS A NZ     1 
ATOM   1608 H H      . LYS A 1 97  ? 93.43705  36.48604  7.76140   1.000 54.70178 ? 115 LYS A H      1 
ATOM   1609 H HA     . LYS A 1 97  ? 94.80908  38.13721  9.30617   1.000 53.19162 ? 115 LYS A HA     1 
ATOM   1610 H HB2    . LYS A 1 97  ? 92.17475  37.16606  9.56705   1.000 55.92926 ? 115 LYS A HB2    1 
ATOM   1611 H HB3    . LYS A 1 97  ? 92.79456  38.21973  10.58245  1.000 55.92926 ? 115 LYS A HB3    1 
ATOM   1612 H HG2    . LYS A 1 97  ? 92.99765  39.75437  8.80552   1.000 59.73970 ? 115 LYS A HG2    1 
ATOM   1613 H HG3    . LYS A 1 97  ? 92.26987  38.70901  7.85527   1.000 59.73970 ? 115 LYS A HG3    1 
ATOM   1614 H HD2    . LYS A 1 97  ? 90.32872  38.88215  9.13741   1.000 62.90317 ? 115 LYS A HD2    1 
ATOM   1615 H HD3    . LYS A 1 97  ? 91.05547  39.90751  10.10997  1.000 62.90317 ? 115 LYS A HD3    1 
ATOM   1616 H HE2    . LYS A 1 97  ? 90.51263  40.44554  7.38836   1.000 64.67455 ? 115 LYS A HE2    1 
ATOM   1617 H HE3    . LYS A 1 97  ? 89.66672  41.04081  8.59480   1.000 64.67455 ? 115 LYS A HE3    1 
ATOM   1618 H HZ1    . LYS A 1 97  ? 91.54377  42.18910  9.23190   1.000 66.07272 ? 115 LYS A HZ1    1 
ATOM   1619 H HZ2    . LYS A 1 97  ? 91.17416  42.57651  7.88594   1.000 66.07272 ? 115 LYS A HZ2    1 
ATOM   1620 H HZ3    . LYS A 1 97  ? 92.28539  41.67226  8.10000   1.000 66.07272 ? 115 LYS A HZ3    1 
ATOM   1621 N N      . ASP A 1 98  ? 94.13642  35.24150  10.53166  1.000 39.80764 ? 116 ASP A N      1 
ATOM   1622 C CA     . ASP A 1 98  ? 94.45525  34.30997  11.61285  1.000 37.24712 ? 116 ASP A CA     1 
ATOM   1623 C C      . ASP A 1 98  ? 94.37828  32.88788  11.07048  1.000 34.41209 ? 116 ASP A C      1 
ATOM   1624 O O      . ASP A 1 98  ? 93.28501  32.39581  10.77278  1.000 33.56796 ? 116 ASP A O      1 
ATOM   1625 C CB     . ASP A 1 98  ? 93.49592  34.50258  12.78598  1.000 37.22352 ? 116 ASP A CB     1 
ATOM   1626 C CG     . ASP A 1 98  ? 93.95050  33.78610  14.03792  1.000 37.35870 ? 116 ASP A CG     1 
ATOM   1627 O OD1    . ASP A 1 98  ? 94.99657  33.10239  13.98982  1.000 37.59097 ? 116 ASP A OD1    1 
ATOM   1628 O OD2    . ASP A 1 98  ? 93.26065  33.91308  15.07296  1.000 37.41702 ? 116 ASP A OD2    1 
ATOM   1629 H H      . ASP A 1 98  ? 93.56454  34.93709  9.96607   1.000 47.76916 ? 116 ASP A H      1 
ATOM   1630 H HA     . ASP A 1 98  ? 95.36390  34.46537  11.91467  1.000 44.69654 ? 116 ASP A HA     1 
ATOM   1631 H HB2    . ASP A 1 98  ? 93.43090  35.44888  12.98894  1.000 44.66822 ? 116 ASP A HB2    1 
ATOM   1632 H HB3    . ASP A 1 98  ? 92.62395  34.15503  12.54148  1.000 44.66822 ? 116 ASP A HB3    1 
ATOM   1633 N N      . ARG A 1 99  ? 95.53396  32.22725  10.94758  1.000 32.33464 ? 117 ARG A N      1 
ATOM   1634 C CA     . ARG A 1 99  ? 95.54522  30.83590  10.50471  1.000 31.94349 ? 117 ARG A CA     1 
ATOM   1635 C C      . ARG A 1 99  ? 94.87984  29.91337  11.51937  1.000 31.31889 ? 117 ARG A C      1 
ATOM   1636 O O      . ARG A 1 99  ? 94.32212  28.87753  11.13710  1.000 31.05804 ? 117 ARG A O      1 
ATOM   1637 C CB     . ARG A 1 99  ? 96.98047  30.37091  10.24638  1.000 32.56080 ? 117 ARG A CB     1 
ATOM   1638 C CG     . ARG A 1 99  ? 97.63510  30.99074  9.01794   1.000 33.98950 ? 117 ARG A CG     1 
ATOM   1639 C CD     . ARG A 1 99  ? 99.14213  30.74805  9.00320   1.000 35.16781 ? 117 ARG A CD     1 
ATOM   1640 N NE     . ARG A 1 99  ? 99.48047  29.32501  8.97834   1.000 36.14276 ? 117 ARG A NE     1 
ATOM   1641 C CZ     . ARG A 1 99  ? 99.78717  28.63352  7.88266   1.000 37.50975 ? 117 ARG A CZ     1 
ATOM   1642 N NH1    . ARG A 1 99  ? 99.80892  29.22060  6.69130   1.000 38.86075 ? 117 ARG A NH1    1 
ATOM   1643 N NH2    . ARG A 1 99  ? 100.07780 27.34184  7.97915   1.000 36.90297 ? 117 ARG A NH2    1 
ATOM   1644 H H      . ARG A 1 99  ? 96.31067  32.55784  11.11202  1.000 38.80157 ? 117 ARG A H      1 
ATOM   1645 H HA     . ARG A 1 99  ? 95.05248  30.77898  9.67112   1.000 38.33218 ? 117 ARG A HA     1 
ATOM   1646 H HB2    . ARG A 1 99  ? 97.52343  30.60291  11.01596  1.000 39.07296 ? 117 ARG A HB2    1 
ATOM   1647 H HB3    . ARG A 1 99  ? 96.97564  29.40897  10.12163  1.000 39.07296 ? 117 ARG A HB3    1 
ATOM   1648 H HG2    . ARG A 1 99  ? 97.25505  30.59562  8.21772   1.000 40.78740 ? 117 ARG A HG2    1 
ATOM   1649 H HG3    . ARG A 1 99  ? 97.48074  31.94837  9.02055   1.000 40.78740 ? 117 ARG A HG3    1 
ATOM   1650 H HD2    . ARG A 1 99  ? 99.52222  31.16138  8.21226   1.000 42.20138 ? 117 ARG A HD2    1 
ATOM   1651 H HD3    . ARG A 1 99  ? 99.53372  31.13637  9.80118   1.000 42.20138 ? 117 ARG A HD3    1 
ATOM   1652 H HE     . ARG A 1 99  ? 99.48133  28.90336  9.72788   1.000 43.37131 ? 117 ARG A HE     1 
ATOM   1653 H HH11   . ARG A 1 99  ? 99.62346  30.05740  6.62083   1.000 46.63290 ? 117 ARG A HH11   1 
ATOM   1654 H HH12   . ARG A 1 99  ? 100.00845 28.76389  5.99044   1.000 46.63290 ? 117 ARG A HH12   1 
ATOM   1655 H HH21   . ARG A 1 99  ? 100.06751 26.95498  8.74716   1.000 44.28357 ? 117 ARG A HH21   1 
ATOM   1656 H HH22   . ARG A 1 99  ? 100.27638 26.89190  7.27366   1.000 44.28357 ? 117 ARG A HH22   1 
ATOM   1657 N N      . PHE A 1 100 ? 94.92410  30.26829  12.80758  1.000 29.83219 ? 118 PHE A N      1 
ATOM   1658 C CA     . PHE A 1 100 ? 94.40765  29.41647  13.87257  1.000 26.74581 ? 118 PHE A CA     1 
ATOM   1659 C C      . PHE A 1 100 ? 93.18061  30.04449  14.52383  1.000 24.97043 ? 118 PHE A C      1 
ATOM   1660 O O      . PHE A 1 100 ? 93.23611  30.44970  15.69193  1.000 25.37661 ? 118 PHE A O      1 
ATOM   1661 C CB     . PHE A 1 100 ? 95.49050  29.16220  14.92650  1.000 25.00507 ? 118 PHE A CB     1 
ATOM   1662 C CG     . PHE A 1 100 ? 96.67958  28.40057  14.40833  1.000 24.19444 ? 118 PHE A CG     1 
ATOM   1663 C CD1    . PHE A 1 100 ? 96.65137  27.01462  14.32063  1.000 24.43004 ? 118 PHE A CD1    1 
ATOM   1664 C CD2    . PHE A 1 100 ? 97.82887  29.06598  14.01461  1.000 23.48422 ? 118 PHE A CD2    1 
ATOM   1665 C CE1    . PHE A 1 100 ? 97.74711  26.30872  13.84251  1.000 23.84937 ? 118 PHE A CE1    1 
ATOM   1666 C CE2    . PHE A 1 100 ? 98.92599  28.36637  13.54233  1.000 23.73438 ? 118 PHE A CE2    1 
ATOM   1667 C CZ     . PHE A 1 100 ? 98.88378  26.98543  13.45527  1.000 23.64156 ? 118 PHE A CZ     1 
ATOM   1668 H H      . PHE A 1 100 ? 95.25440  31.01013  13.09076  1.000 35.79863 ? 118 PHE A H      1 
ATOM   1669 H HA     . PHE A 1 100 ? 94.13811  28.56765  13.48820  1.000 32.09497 ? 118 PHE A HA     1 
ATOM   1670 H HB2    . PHE A 1 100 ? 95.80864  30.01642  15.25815  1.000 30.00608 ? 118 PHE A HB2    1 
ATOM   1671 H HB3    . PHE A 1 100 ? 95.10371  28.64777  15.65221  1.000 30.00608 ? 118 PHE A HB3    1 
ATOM   1672 H HD1    . PHE A 1 100 ? 95.88849  26.55347  14.58566  1.000 29.31605 ? 118 PHE A HD1    1 
ATOM   1673 H HD2    . PHE A 1 100 ? 97.86384  29.99377  14.06820  1.000 28.18106 ? 118 PHE A HD2    1 
ATOM   1674 H HE1    . PHE A 1 100 ? 97.71425  25.38116  13.78364  1.000 28.61924 ? 118 PHE A HE1    1 
ATOM   1675 H HE2    . PHE A 1 100 ? 99.69255  28.82474  13.28313  1.000 28.48125 ? 118 PHE A HE2    1 
ATOM   1676 H HZ     . PHE A 1 100 ? 99.62030  26.51558  13.13639  1.000 28.36987 ? 118 PHE A HZ     1 
ATOM   1677 N N      . PRO A 1 101 ? 92.05710  30.13530  13.81761  1.000 23.76280 ? 119 PRO A N      1 
ATOM   1678 C CA     . PRO A 1 101 ? 90.84273  30.66263  14.44868  1.000 24.05032 ? 119 PRO A CA     1 
ATOM   1679 C C      . PRO A 1 101 ? 90.40373  29.79559  15.61957  1.000 24.29254 ? 119 PRO A C      1 
ATOM   1680 O O      . PRO A 1 101 ? 90.51407  28.56890  15.58694  1.000 24.86718 ? 119 PRO A O      1 
ATOM   1681 C CB     . PRO A 1 101 ? 89.81225  30.64208  13.31278  1.000 23.85567 ? 119 PRO A CB     1 
ATOM   1682 C CG     . PRO A 1 101 ? 90.31439  29.62784  12.35352  1.000 23.69652 ? 119 PRO A CG     1 
ATOM   1683 C CD     . PRO A 1 101 ? 91.81316  29.69863  12.43337  1.000 24.11133 ? 119 PRO A CD     1 
ATOM   1684 H HA     . PRO A 1 101 ? 90.98069  31.57410  14.75048  1.000 28.86038 ? 119 PRO A HA     1 
ATOM   1685 H HB2    . PRO A 1 101 ? 88.94280  30.38956  13.66091  1.000 28.62680 ? 119 PRO A HB2    1 
ATOM   1686 H HB3    . PRO A 1 101 ? 89.76190  31.51720  12.89742  1.000 28.62680 ? 119 PRO A HB3    1 
ATOM   1687 H HG2    . PRO A 1 101 ? 89.99736  28.74802  12.61103  1.000 28.43582 ? 119 PRO A HG2    1 
ATOM   1688 H HG3    . PRO A 1 101 ? 90.00705  29.84251  11.45889  1.000 28.43582 ? 119 PRO A HG3    1 
ATOM   1689 H HD2    . PRO A 1 101 ? 92.20919  28.82818  12.27094  1.000 28.93360 ? 119 PRO A HD2    1 
ATOM   1690 H HD3    . PRO A 1 101 ? 92.16259  30.34540  11.80053  1.000 28.93360 ? 119 PRO A HD3    1 
ATOM   1691 N N      . GLY A 1 102 ? 89.91374  30.45056  16.66787  1.000 24.01397 ? 120 GLY A N      1 
ATOM   1692 C CA     . GLY A 1 102 ? 89.33581  29.75182  17.79206  1.000 23.64467 ? 120 GLY A CA     1 
ATOM   1693 C C      . GLY A 1 102 ? 87.89351  29.38877  17.52511  1.000 24.51475 ? 120 GLY A C      1 
ATOM   1694 O O      . GLY A 1 102 ? 87.34851  29.60833  16.44448  1.000 24.85859 ? 120 GLY A O      1 
ATOM   1695 H H      . GLY A 1 102 ? 89.90758  31.30700  16.74576  1.000 28.81677 ? 120 GLY A H      1 
ATOM   1696 H HA2    . GLY A 1 102 ? 89.83524  28.93771  17.96143  1.000 28.37361 ? 120 GLY A HA2    1 
ATOM   1697 H HA3    . GLY A 1 102 ? 89.37384  30.31547  18.58057  1.000 28.37361 ? 120 GLY A HA3    1 
ATOM   1698 N N      . ILE A 1 103 ? 87.25774  28.81561  18.54632  1.000 25.51104 ? 121 ILE A N      1 
ATOM   1699 C CA     . ILE A 1 103 ? 85.85723  28.43267  18.40261  1.000 26.44292 ? 121 ILE A CA     1 
ATOM   1700 C C      . ILE A 1 103 ? 84.99481  29.65914  18.14007  1.000 27.91370 ? 121 ILE A C      1 
ATOM   1701 O O      . ILE A 1 103 ? 83.98878  29.58185  17.42247  1.000 28.09806 ? 121 ILE A O      1 
ATOM   1702 C CB     . ILE A 1 103 ? 85.38582  27.65823  19.65027  1.000 26.36233 ? 121 ILE A CB     1 
ATOM   1703 C CG1    . ILE A 1 103 ? 83.91707  27.24260  19.51121  1.000 25.32738 ? 121 ILE A CG1    1 
ATOM   1704 C CG2    . ILE A 1 103 ? 85.58369  28.49175  20.91166  1.000 26.98095 ? 121 ILE A CG2    1 
ATOM   1705 C CD1    . ILE A 1 103 ? 83.64078  26.33311  18.34047  1.000 24.52041 ? 121 ILE A CD1    1 
ATOM   1706 H H      . ILE A 1 103 ? 87.60626  28.64219  19.31318  1.000 30.61325 ? 121 ILE A H      1 
ATOM   1707 H HA     . ILE A 1 103 ? 85.77210  27.84059  17.63901  1.000 31.73150 ? 121 ILE A HA     1 
ATOM   1708 H HB     . ILE A 1 103 ? 85.92624  26.85592  19.72201  1.000 31.63479 ? 121 ILE A HB     1 
ATOM   1709 H HG12   . ILE A 1 103 ? 83.64954  26.77411  20.31733  1.000 30.39285 ? 121 ILE A HG12   1 
ATOM   1710 H HG13   . ILE A 1 103 ? 83.37816  28.04102  19.39717  1.000 30.39285 ? 121 ILE A HG13   1 
ATOM   1711 H HG21   . ILE A 1 103 ? 86.53032  28.66842  21.02817  1.000 32.37714 ? 121 ILE A HG21   1 
ATOM   1712 H HG22   . ILE A 1 103 ? 85.24325  27.99728  21.67356  1.000 32.37714 ? 121 ILE A HG22   1 
ATOM   1713 H HG23   . ILE A 1 103 ? 85.10044  29.32746  20.81697  1.000 32.37714 ? 121 ILE A HG23   1 
ATOM   1714 H HD11   . ILE A 1 103 ? 83.78647  26.82495  17.51721  1.000 29.42449 ? 121 ILE A HD11   1 
ATOM   1715 H HD12   . ILE A 1 103 ? 82.72048  26.03006  18.38630  1.000 29.42449 ? 121 ILE A HD12   1 
ATOM   1716 H HD13   . ILE A 1 103 ? 84.24183  25.57292  18.38240  1.000 29.42449 ? 121 ILE A HD13   1 
ATOM   1717 N N      . ALA A 1 104 ? 85.36976  30.80727  18.70754  1.000 28.73440 ? 122 ALA A N      1 
ATOM   1718 C CA     . ALA A 1 104 ? 84.62536  32.03615  18.45575  1.000 28.81465 ? 122 ALA A CA     1 
ATOM   1719 C C      . ALA A 1 104 ? 84.70339  32.42920  16.98699  1.000 28.65358 ? 122 ALA A C      1 
ATOM   1720 O O      . ALA A 1 104 ? 83.67920  32.67049  16.33764  1.000 27.83487 ? 122 ALA A O      1 
ATOM   1721 C CB     . ALA A 1 104 ? 85.16563  33.15504  19.34209  1.000 29.00926 ? 122 ALA A CB     1 
ATOM   1722 H H      . ALA A 1 104 ? 86.04283  30.89855  19.23503  1.000 34.48128 ? 122 ALA A H      1 
ATOM   1723 H HA     . ALA A 1 104 ? 83.69237  31.89373  18.67972  1.000 34.57757 ? 122 ALA A HA     1 
ATOM   1724 H HB1    . ALA A 1 104 ? 84.64765  33.96006  19.18538  1.000 34.81111 ? 122 ALA A HB1    1 
ATOM   1725 H HB2    . ALA A 1 104 ? 85.08795  32.88735  20.27117  1.000 34.81111 ? 122 ALA A HB2    1 
ATOM   1726 H HB3    . ALA A 1 104 ? 86.09665  33.31227  19.11989  1.000 34.81111 ? 122 ALA A HB3    1 
ATOM   1727 N N      . ALA A 1 105 ? 85.91880  32.49351  16.44383  1.000 29.66854 ? 123 ALA A N      1 
ATOM   1728 C CA     . ALA A 1 105 ? 86.08249  32.86193  15.04249  1.000 30.78722 ? 123 ALA A CA     1 
ATOM   1729 C C      . ALA A 1 105 ? 85.38562  31.86731  14.11900  1.000 32.99036 ? 123 ALA A C      1 
ATOM   1730 O O      . ALA A 1 105 ? 84.70858  32.26779  13.16474  1.000 33.58862 ? 123 ALA A O      1 
ATOM   1731 C CB     . ALA A 1 105 ? 87.56913  32.96064  14.70229  1.000 30.13832 ? 123 ALA A CB     1 
ATOM   1732 H H      . ALA A 1 105 ? 86.65368  32.33075  16.85983  1.000 35.60225 ? 123 ALA A H      1 
ATOM   1733 H HA     . ALA A 1 105 ? 85.67929  33.73240  14.89890  1.000 36.94466 ? 123 ALA A HA     1 
ATOM   1734 H HB1    . ALA A 1 105 ? 87.66378  33.21237  13.77032  1.000 36.16598 ? 123 ALA A HB1    1 
ATOM   1735 H HB2    . ALA A 1 105 ? 87.97900  33.63226  15.26960  1.000 36.16598 ? 123 ALA A HB2    1 
ATOM   1736 H HB3    . ALA A 1 105 ? 87.98620  32.09849  14.85605  1.000 36.16598 ? 123 ALA A HB3    1 
ATOM   1737 N N      . ARG A 1 106 ? 85.53547  30.56501  14.38474  1.000 33.60241 ? 124 ARG A N      1 
ATOM   1738 C CA     . ARG A 1 106 ? 84.95197  29.56326  13.49694  1.000 34.00504 ? 124 ARG A CA     1 
ATOM   1739 C C      . ARG A 1 106 ? 83.43092  29.64118  13.48978  1.000 35.78096 ? 124 ARG A C      1 
ATOM   1740 O O      . ARG A 1 106 ? 82.80395  29.55003  12.42749  1.000 35.25267 ? 124 ARG A O      1 
ATOM   1741 C CB     . ARG A 1 106 ? 85.40394  28.16266  13.90662  1.000 32.70809 ? 124 ARG A CB     1 
ATOM   1742 C CG     . ARG A 1 106 ? 86.86289  27.87452  13.62437  1.000 32.10416 ? 124 ARG A CG     1 
ATOM   1743 C CD     . ARG A 1 106 ? 87.14231  26.38094  13.64887  1.000 31.15428 ? 124 ARG A CD     1 
ATOM   1744 N NE     . ARG A 1 106 ? 86.73769  25.75453  14.90740  1.000 29.63109 ? 124 ARG A NE     1 
ATOM   1745 C CZ     . ARG A 1 106 ? 87.47334  25.75419  16.01539  1.000 27.96581 ? 124 ARG A CZ     1 
ATOM   1746 N NH1    . ARG A 1 106 ? 87.02563  25.15461  17.10944  1.000 28.13686 ? 124 ARG A NH1    1 
ATOM   1747 N NH2    . ARG A 1 106 ? 88.65446  26.35671  16.03679  1.000 26.90926 ? 124 ARG A NH2    1 
ATOM   1748 H H      . ARG A 1 106 ? 85.96199  30.24435  15.05918  1.000 40.32290 ? 124 ARG A H      1 
ATOM   1749 H HA     . ARG A 1 106 ? 85.26927  29.73412  12.59636  1.000 40.80605 ? 124 ARG A HA     1 
ATOM   1750 H HB2    . ARG A 1 106 ? 85.26239  28.05773  14.86048  1.000 39.24970 ? 124 ARG A HB2    1 
ATOM   1751 H HB3    . ARG A 1 106 ? 84.87564  27.51134  13.41920  1.000 39.24970 ? 124 ARG A HB3    1 
ATOM   1752 H HG2    . ARG A 1 106 ? 87.09489  28.21507  12.74625  1.000 38.52499 ? 124 ARG A HG2    1 
ATOM   1753 H HG3    . ARG A 1 106 ? 87.41245  28.29998  14.30103  1.000 38.52499 ? 124 ARG A HG3    1 
ATOM   1754 H HD2    . ARG A 1 106 ? 86.65087  25.95467  12.92938  1.000 37.38514 ? 124 ARG A HD2    1 
ATOM   1755 H HD3    . ARG A 1 106 ? 88.09414  26.23458  13.53271  1.000 37.38514 ? 124 ARG A HD3    1 
ATOM   1756 H HE     . ARG A 1 106 ? 85.97369  25.36048  14.93246  1.000 35.55731 ? 124 ARG A HE     1 
ATOM   1757 H HH11   . ARG A 1 106 ? 86.25880  24.76534  17.10326  1.000 33.76423 ? 124 ARG A HH11   1 
ATOM   1758 H HH12   . ARG A 1 106 ? 87.50197  25.15487  17.82547  1.000 33.76423 ? 124 ARG A HH12   1 
ATOM   1759 H HH21   . ARG A 1 106 ? 88.94898  26.75082  15.33142  1.000 32.29112 ? 124 ARG A HH21   1 
ATOM   1760 H HH22   . ARG A 1 106 ? 89.12593  26.35335  16.75603  1.000 32.29112 ? 124 ARG A HH22   1 
ATOM   1761 N N      . GLU A 1 107 ? 82.81581  29.79201  14.66490  1.000 37.78376 ? 125 GLU A N      1 
ATOM   1762 C CA     . GLU A 1 107 ? 81.36025  29.80654  14.73092  1.000 40.05079 ? 125 GLU A CA     1 
ATOM   1763 C C      . GLU A 1 107 ? 80.75674  31.01365  14.02334  1.000 40.79037 ? 125 GLU A C      1 
ATOM   1764 O O      . GLU A 1 107 ? 79.60261  30.94231  13.58783  1.000 40.99382 ? 125 GLU A O      1 
ATOM   1765 C CB     . GLU A 1 107 ? 80.89731  29.76275  16.18834  1.000 41.90173 ? 125 GLU A CB     1 
ATOM   1766 C CG     . GLU A 1 107 ? 80.82336  28.34668  16.76712  1.000 43.95190 ? 125 GLU A CG     1 
ATOM   1767 C CD     . GLU A 1 107 ? 80.37128  28.31378  18.22073  1.000 45.76003 ? 125 GLU A CD     1 
ATOM   1768 O OE1    . GLU A 1 107 ? 80.32264  29.38486  18.86345  1.000 46.50457 ? 125 GLU A OE1    1 
ATOM   1769 O OE2    . GLU A 1 107 ? 80.06537  27.21140  18.72214  1.000 46.23712 ? 125 GLU A OE2    1 
ATOM   1770 H H      . GLU A 1 107 ? 83.21318  29.88579  15.42180  1.000 45.34051 ? 125 GLU A H      1 
ATOM   1771 H HA     . GLU A 1 107 ? 81.02351  29.01069  14.29031  1.000 48.06095 ? 125 GLU A HA     1 
ATOM   1772 H HB2    . GLU A 1 107 ? 81.52075  30.27214  16.72940  1.000 50.28207 ? 125 GLU A HB2    1 
ATOM   1773 H HB3    . GLU A 1 107 ? 80.01142  30.15355  16.24642  1.000 50.28207 ? 125 GLU A HB3    1 
ATOM   1774 H HG2    . GLU A 1 107 ? 80.19068  27.82728  16.24670  1.000 52.74228 ? 125 GLU A HG2    1 
ATOM   1775 H HG3    . GLU A 1 107 ? 81.70347  27.94163  16.71978  1.000 52.74228 ? 125 GLU A HG3    1 
ATOM   1776 N N      . GLU A 1 108 ? 81.50287  32.11177  13.88847  1.000 40.58063 ? 126 GLU A N      1 
ATOM   1777 C CA     . GLU A 1 108 ? 80.99412  33.24533  13.12360  1.000 40.07353 ? 126 GLU A CA     1 
ATOM   1778 C C      . GLU A 1 108 ? 81.12996  33.02161  11.62247  1.000 38.45414 ? 126 GLU A C      1 
ATOM   1779 O O      . GLU A 1 108 ? 80.26175  33.44523  10.85048  1.000 38.80480 ? 126 GLU A O      1 
ATOM   1780 C CB     . GLU A 1 108 ? 81.71653  34.52810  13.51946  1.000 41.47967 ? 126 GLU A CB     1 
ATOM   1781 C CG     . GLU A 1 108 ? 81.28993  35.71531  12.67449  1.000 42.86275 ? 126 GLU A CG     1 
ATOM   1782 C CD     . GLU A 1 108 ? 81.75168  37.03349  13.24202  1.000 44.43690 ? 126 GLU A CD     1 
ATOM   1783 O OE1    . GLU A 1 108 ? 82.20542  37.04863  14.40827  1.000 45.13410 ? 126 GLU A OE1    1 
ATOM   1784 O OE2    . GLU A 1 108 ? 81.65616  38.04978  12.51929  1.000 44.92730 ? 126 GLU A OE2    1 
ATOM   1785 H H      . GLU A 1 108 ? 82.28772  32.22135  14.22254  1.000 48.69676 ? 126 GLU A H      1 
ATOM   1786 H HA     . GLU A 1 108 ? 80.05333  33.35033  13.33526  1.000 48.08824 ? 126 GLU A HA     1 
ATOM   1787 H HB2    . GLU A 1 108 ? 81.51804  34.73061  14.44708  1.000 49.77561 ? 126 GLU A HB2    1 
ATOM   1788 H HB3    . GLU A 1 108 ? 82.67148  34.40285  13.40422  1.000 49.77561 ? 126 GLU A HB3    1 
ATOM   1789 H HG2    . GLU A 1 108 ? 81.66805  35.62272  11.78604  1.000 51.43530 ? 126 GLU A HG2    1 
ATOM   1790 H HG3    . GLU A 1 108 ? 80.32150  35.73424  12.62258  1.000 51.43530 ? 126 GLU A HG3    1 
ATOM   1791 N N      . LEU A 1 109 ? 82.21676  32.38011  11.18611  1.000 36.22423 ? 127 LEU A N      1 
ATOM   1792 C CA     . LEU A 1 109 ? 82.34097  32.03397  9.77462   1.000 34.59516 ? 127 LEU A CA     1 
ATOM   1793 C C      . LEU A 1 109 ? 81.19524  31.13255  9.33403   1.000 33.25260 ? 127 LEU A C      1 
ATOM   1794 O O      . LEU A 1 109 ? 80.70699  31.23883  8.20217   1.000 31.64263 ? 127 LEU A O      1 
ATOM   1795 C CB     . LEU A 1 109 ? 83.68570  31.35811  9.51856   1.000 35.01118 ? 127 LEU A CB     1 
ATOM   1796 C CG     . LEU A 1 109 ? 84.92021  32.25361  9.64944   1.000 36.27981 ? 127 LEU A CG     1 
ATOM   1797 C CD1    . LEU A 1 109 ? 86.21348  31.43932  9.59864   1.000 35.75873 ? 127 LEU A CD1    1 
ATOM   1798 C CD2    . LEU A 1 109 ? 84.92370  33.31867  8.55917   1.000 37.22958 ? 127 LEU A CD2    1 
ATOM   1799 H H      . LEU A 1 109 ? 82.88051  32.14017  11.67750  1.000 43.46908 ? 127 LEU A H      1 
ATOM   1800 H HA     . LEU A 1 109 ? 82.30933  32.84597  9.24495   1.000 41.51420 ? 127 LEU A HA     1 
ATOM   1801 H HB2    . LEU A 1 109 ? 83.78682  30.63401  10.15602  1.000 42.01342 ? 127 LEU A HB2    1 
ATOM   1802 H HB3    . LEU A 1 109 ? 83.68033  31.00608  8.61471   1.000 42.01342 ? 127 LEU A HB3    1 
ATOM   1803 H HG     . LEU A 1 109 ? 84.88571  32.69313  10.51346  1.000 43.53578 ? 127 LEU A HG     1 
ATOM   1804 H HD11   . LEU A 1 109 ? 86.21987  30.81038  10.33708  1.000 42.91048 ? 127 LEU A HD11   1 
ATOM   1805 H HD12   . LEU A 1 109 ? 86.96957  32.04258  9.67140   1.000 42.91048 ? 127 LEU A HD12   1 
ATOM   1806 H HD13   . LEU A 1 109 ? 86.25227  30.96047  8.75596   1.000 42.91048 ? 127 LEU A HD13   1 
ATOM   1807 H HD21   . LEU A 1 109 ? 84.85757  32.88514  7.69397   1.000 44.67550 ? 127 LEU A HD21   1 
ATOM   1808 H HD22   . LEU A 1 109 ? 85.75001  33.82377  8.61376   1.000 44.67550 ? 127 LEU A HD22   1 
ATOM   1809 H HD23   . LEU A 1 109 ? 84.16569  33.90914  8.69208   1.000 44.67550 ? 127 LEU A HD23   1 
ATOM   1810 N N      . ALA A 1 110 ? 80.74771  30.24180  10.22084  1.000 33.78561 ? 128 ALA A N      1 
ATOM   1811 C CA     . ALA A 1 110 ? 79.62064  29.37669  9.90598   1.000 34.39145 ? 128 ALA A CA     1 
ATOM   1812 C C      . ALA A 1 110 ? 78.33350  30.16514  9.73263   1.000 35.07127 ? 128 ALA A C      1 
ATOM   1813 O O      . ALA A 1 110 ? 77.41487  29.69079  9.05705   1.000 35.43809 ? 128 ALA A O      1 
ATOM   1814 C CB     . ALA A 1 110 ? 79.44381  28.32609  10.99949  1.000 34.73656 ? 128 ALA A CB     1 
ATOM   1815 H H      . ALA A 1 110 ? 81.07930  30.12217  11.00528  1.000 40.54273 ? 128 ALA A H      1 
ATOM   1816 H HA     . ALA A 1 110 ? 79.80397  28.91081  9.07517   1.000 41.26974 ? 128 ALA A HA     1 
ATOM   1817 H HB1    . ALA A 1 110 ? 78.69933  27.74969  10.76623  1.000 41.68387 ? 128 ALA A HB1    1 
ATOM   1818 H HB2    . ALA A 1 110 ? 80.25774  27.80311  11.06955  1.000 41.68387 ? 128 ALA A HB2    1 
ATOM   1819 H HB3    . ALA A 1 110 ? 79.26464  28.77351  11.84128  1.000 41.68387 ? 128 ALA A HB3    1 
ATOM   1820 N N      . ARG A 1 111 ? 78.24050  31.34980  10.33496  1.000 35.41517 ? 129 ARG A N      1 
ATOM   1821 C CA     . ARG A 1 111 ? 77.11435  32.23140  10.05210  1.000 36.05773 ? 129 ARG A CA     1 
ATOM   1822 C C      . ARG A 1 111 ? 77.32824  32.98038  8.74411   1.000 34.96798 ? 129 ARG A C      1 
ATOM   1823 O O      . ARG A 1 111 ? 76.43758  33.01876  7.88848   1.000 33.51617 ? 129 ARG A O      1 
ATOM   1824 C CB     . ARG A 1 111 ? 76.90807  33.21560  11.20394  1.000 38.02135 ? 129 ARG A CB     1 
ATOM   1825 C CG     . ARG A 1 111 ? 76.26948  32.59050  12.43196  1.000 40.39903 ? 129 ARG A CG     1 
ATOM   1826 C CD     . ARG A 1 111 ? 75.89281  33.63012  13.47513  1.000 42.48007 ? 129 ARG A CD     1 
ATOM   1827 N NE     . ARG A 1 111 ? 77.06025  34.26606  14.08435  1.000 43.95082 ? 129 ARG A NE     1 
ATOM   1828 C CZ     . ARG A 1 111 ? 77.76398  33.74592  15.08646  1.000 44.87974 ? 129 ARG A CZ     1 
ATOM   1829 N NH1    . ARG A 1 111 ? 77.43544  32.56616  15.59966  1.000 44.62667 ? 129 ARG A NH1    1 
ATOM   1830 N NH2    . ARG A 1 111 ? 78.80631  34.40569  15.57456  1.000 45.96826 ? 129 ARG A NH2    1 
ATOM   1831 H H      . ARG A 1 111 ? 78.80761  31.66037  10.90200  1.000 42.49820 ? 129 ARG A H      1 
ATOM   1832 H HA     . ARG A 1 111 ? 76.30898  31.69662  9.97270   1.000 43.26928 ? 129 ARG A HA     1 
ATOM   1833 H HB2    . ARG A 1 111 ? 77.77044  33.57307  11.46746  1.000 45.62562 ? 129 ARG A HB2    1 
ATOM   1834 H HB3    . ARG A 1 111 ? 76.32977  33.93330  10.90165  1.000 45.62562 ? 129 ARG A HB3    1 
ATOM   1835 H HG2    . ARG A 1 111 ? 75.46246  32.12165  12.16777  1.000 48.47883 ? 129 ARG A HG2    1 
ATOM   1836 H HG3    . ARG A 1 111 ? 76.89619  31.97031  12.83630  1.000 48.47883 ? 129 ARG A HG3    1 
ATOM   1837 H HD2    . ARG A 1 111 ? 75.35953  34.32237  13.05405  1.000 50.97609 ? 129 ARG A HD2    1 
ATOM   1838 H HD3    . ARG A 1 111 ? 75.38281  33.20108  14.17992  1.000 50.97609 ? 129 ARG A HD3    1 
ATOM   1839 H HE     . ARG A 1 111 ? 77.30893  35.02842  13.77359  1.000 52.74099 ? 129 ARG A HE     1 
ATOM   1840 H HH11   . ARG A 1 111 ? 76.76325  32.13221  15.28432  1.000 53.55201 ? 129 ARG A HH11   1 
ATOM   1841 H HH12   . ARG A 1 111 ? 77.89486  32.23601  16.24738  1.000 53.55201 ? 129 ARG A HH12   1 
ATOM   1842 H HH21   . ARG A 1 111 ? 79.02608  35.16826  15.24321  1.000 55.16192 ? 129 ARG A HH21   1 
ATOM   1843 H HH22   . ARG A 1 111 ? 79.26223  34.07083  16.22233  1.000 55.16192 ? 129 ARG A HH22   1 
ATOM   1844 N N      . GLU A 1 112 ? 78.51598  33.56126  8.56619   1.000 35.66714 ? 130 GLU A N      1 
ATOM   1845 C CA     . GLU A 1 112 ? 78.83235  34.33315  7.36977   1.000 35.04723 ? 130 GLU A CA     1 
ATOM   1846 C C      . GLU A 1 112 ? 78.95525  33.48067  6.11245   1.000 34.04145 ? 130 GLU A C      1 
ATOM   1847 O O      . GLU A 1 112 ? 79.14139  34.04779  5.03116   1.000 34.89040 ? 130 GLU A O      1 
ATOM   1848 C CB     . GLU A 1 112 ? 80.13471  35.10787  7.58028   1.000 35.13077 ? 130 GLU A CB     1 
ATOM   1849 C CG     . GLU A 1 112 ? 80.11001  36.06771  8.75928   1.000 35.99320 ? 130 GLU A CG     1 
ATOM   1850 C CD     . GLU A 1 112 ? 81.45640  36.72809  8.99790   1.000 36.19478 ? 130 GLU A CD     1 
ATOM   1851 O OE1    . GLU A 1 112 ? 82.39512  36.46712  8.21473   1.000 35.98700 ? 130 GLU A OE1    1 
ATOM   1852 O OE2    . GLU A 1 112 ? 81.57503  37.50706  9.96959   1.000 36.29100 ? 130 GLU A OE2    1 
ATOM   1853 H H      . GLU A 1 112 ? 79.16218  33.52125  9.13225   1.000 42.80057 ? 130 GLU A H      1 
ATOM   1854 H HA     . GLU A 1 112 ? 78.11413  34.96889  7.22526   1.000 42.05667 ? 130 GLU A HA     1 
ATOM   1855 H HB2    . GLU A 1 112 ? 80.85134  34.47249  7.73399   1.000 42.15692 ? 130 GLU A HB2    1 
ATOM   1856 H HB3    . GLU A 1 112 ? 80.31789  35.62787  6.78220   1.000 42.15692 ? 130 GLU A HB3    1 
ATOM   1857 H HG2    . GLU A 1 112 ? 79.45864  36.76546  8.58673   1.000 43.19184 ? 130 GLU A HG2    1 
ATOM   1858 H HG3    . GLU A 1 112 ? 79.86791  35.57885  9.56134   1.000 43.19184 ? 130 GLU A HG3    1 
ATOM   1859 N N      . THR A 1 113 ? 78.86530  32.15484  6.20810   1.000 32.65405 ? 131 THR A N      1 
ATOM   1860 C CA     . THR A 1 113 ? 79.00632  31.30832  5.02787   1.000 31.56491 ? 131 THR A CA     1 
ATOM   1861 C C      . THR A 1 113 ? 77.84456  30.33238  4.89088   1.000 29.95189 ? 131 THR A C      1 
ATOM   1862 O O      . THR A 1 113 ? 77.47448  29.95398  3.77507   1.000 29.81734 ? 131 THR A O      1 
ATOM   1863 C CB     . THR A 1 113 ? 80.31989  30.52425  5.07975   1.000 31.04320 ? 131 THR A CB     1 
ATOM   1864 O OG1    . THR A 1 113 ? 80.30703  29.65000  6.21462   1.000 31.40265 ? 131 THR A OG1    1 
ATOM   1865 C CG2    . THR A 1 113 ? 81.51350  31.46554  5.17854   1.000 31.26098 ? 131 THR A CG2    1 
ATOM   1866 H H      . THR A 1 113 ? 78.72414  31.72579  6.93993   1.000 39.18486 ? 131 THR A H      1 
ATOM   1867 H HA     . THR A 1 113 ? 79.01188  31.88528  4.24814   1.000 37.87789 ? 131 THR A HA     1 
ATOM   1868 H HB     . THR A 1 113 ? 80.41603  30.00379  4.26686   1.000 37.25184 ? 131 THR A HB     1 
ATOM   1869 H HG1    . THR A 1 113 ? 81.02238  29.21089  6.24713   1.000 37.68318 ? 131 THR A HG1    1 
ATOM   1870 H HG21   . THR A 1 113 ? 81.51716  32.07683  4.42540   1.000 37.51318 ? 131 THR A HG21   1 
ATOM   1871 H HG22   . THR A 1 113 ? 82.33896  30.95613  5.17453   1.000 37.51318 ? 131 THR A HG22   1 
ATOM   1872 H HG23   . THR A 1 113 ? 81.46423  31.97867  6.00023   1.000 37.51318 ? 131 THR A HG23   1 
ATOM   1873 N N      . GLY A 1 114 ? 77.26311  29.92138  6.01324   1.000 28.35966 ? 132 GLY A N      1 
ATOM   1874 C CA     . GLY A 1 114 ? 76.30989  28.83639  6.00995   1.000 27.09797 ? 132 GLY A CA     1 
ATOM   1875 C C      . GLY A 1 114 ? 76.93685  27.46460  6.06489   1.000 26.08537 ? 132 GLY A C      1 
ATOM   1876 O O      . GLY A 1 114 ? 76.21082  26.46457  6.00586   1.000 26.72575 ? 132 GLY A O      1 
ATOM   1877 H H      . GLY A 1 114 ? 77.40954  30.26114  6.78959   1.000 34.03159 ? 132 GLY A H      1 
ATOM   1878 H HA2    . GLY A 1 114 ? 75.72628  28.92952  6.77913   1.000 32.51757 ? 132 GLY A HA2    1 
ATOM   1879 H HA3    . GLY A 1 114 ? 75.77718  28.88958  5.20107   1.000 32.51757 ? 132 GLY A HA3    1 
ATOM   1880 N N      . LEU A 1 115 ? 78.25420  27.38548  6.16719   1.000 24.94736 ? 133 LEU A N      1 
ATOM   1881 C CA     . LEU A 1 115 ? 78.95153  26.11804  6.27678   1.000 22.71208 ? 133 LEU A CA     1 
ATOM   1882 C C      . LEU A 1 115 ? 78.91260  25.60739  7.71536   1.000 20.24924 ? 133 LEU A C      1 
ATOM   1883 O O      . LEU A 1 115 ? 78.94584  26.39711  8.66207   1.000 19.68324 ? 133 LEU A O      1 
ATOM   1884 C CB     . LEU A 1 115 ? 80.40231  26.27515  5.84182   1.000 22.72380 ? 133 LEU A CB     1 
ATOM   1885 C CG     . LEU A 1 115 ? 80.66253  26.56786  4.36946   1.000 22.92695 ? 133 LEU A CG     1 
ATOM   1886 C CD1    . LEU A 1 115 ? 82.06471  27.14058  4.19573   1.000 23.74353 ? 133 LEU A CD1    1 
ATOM   1887 C CD2    . LEU A 1 115 ? 80.48337  25.30212  3.55196   1.000 22.52016 ? 133 LEU A CD2    1 
ATOM   1888 H H      . LEU A 1 115 ? 78.77877  28.06692  6.17566   1.000 29.93683 ? 133 LEU A H      1 
ATOM   1889 H HA     . LEU A 1 115 ? 78.52347  25.46304  5.70352   1.000 27.25450 ? 133 LEU A HA     1 
ATOM   1890 H HB2    . LEU A 1 115 ? 80.78631  27.00885  6.34693   1.000 27.26856 ? 133 LEU A HB2    1 
ATOM   1891 H HB3    . LEU A 1 115 ? 80.86648  25.44953  6.05110   1.000 27.26856 ? 133 LEU A HB3    1 
ATOM   1892 H HG     . LEU A 1 115 ? 80.02848  27.22555  4.04338   1.000 27.51234 ? 133 LEU A HG     1 
ATOM   1893 H HD11   . LEU A 1 115 ? 82.13347  27.96602  4.70052   1.000 28.49224 ? 133 LEU A HD11   1 
ATOM   1894 H HD12   . LEU A 1 115 ? 82.22032  27.31467  3.25425   1.000 28.49224 ? 133 LEU A HD12   1 
ATOM   1895 H HD13   . LEU A 1 115 ? 82.71169  26.49695  4.52445   1.000 28.49224 ? 133 LEU A HD13   1 
ATOM   1896 H HD21   . LEU A 1 115 ? 81.09440  24.62447  3.88109   1.000 27.02419 ? 133 LEU A HD21   1 
ATOM   1897 H HD22   . LEU A 1 115 ? 80.67586  25.49724  2.62149   1.000 27.02419 ? 133 LEU A HD22   1 
ATOM   1898 H HD23   . LEU A 1 115 ? 79.56799  24.99437  3.64289   1.000 27.02419 ? 133 LEU A HD23   1 
ATOM   1899 N N      . PRO A 1 116 ? 78.85283  24.29180  7.91092   1.000 19.31287 ? 134 PRO A N      1 
ATOM   1900 C CA     . PRO A 1 116 ? 78.97753  23.76026  9.26888   1.000 18.48323 ? 134 PRO A CA     1 
ATOM   1901 C C      . PRO A 1 116 ? 80.33589  24.11034  9.85312   1.000 17.87834 ? 134 PRO A C      1 
ATOM   1902 O O      . PRO A 1 116 ? 81.36628  24.01024  9.18201   1.000 17.23007 ? 134 PRO A O      1 
ATOM   1903 C CB     . PRO A 1 116 ? 78.81211  22.24837  9.07889   1.000 18.42290 ? 134 PRO A CB     1 
ATOM   1904 C CG     . PRO A 1 116 ? 78.14383  22.09505  7.77911   1.000 18.81088 ? 134 PRO A CG     1 
ATOM   1905 C CD     . PRO A 1 116 ? 78.63398  23.21460  6.93179   1.000 19.15085 ? 134 PRO A CD     1 
ATOM   1906 H HA     . PRO A 1 116 ? 78.27012  24.09036  9.84464   1.000 22.17988 ? 134 PRO A HA     1 
ATOM   1907 H HB2    . PRO A 1 116 ? 79.68229  21.81979  9.07382   1.000 22.10749 ? 134 PRO A HB2    1 
ATOM   1908 H HB3    . PRO A 1 116 ? 78.26708  21.88415  9.79386   1.000 22.10749 ? 134 PRO A HB3    1 
ATOM   1909 H HG2    . PRO A 1 116 ? 78.38169  21.23963  7.38849   1.000 22.57306 ? 134 PRO A HG2    1 
ATOM   1910 H HG3    . PRO A 1 116 ? 77.18266  22.14988  7.89760   1.000 22.57306 ? 134 PRO A HG3    1 
ATOM   1911 H HD2    . PRO A 1 116 ? 79.46224  22.97638  6.48668   1.000 22.98101 ? 134 PRO A HD2    1 
ATOM   1912 H HD3    . PRO A 1 116 ? 77.96698  23.47160  6.27607   1.000 22.98101 ? 134 PRO A HD3    1 
ATOM   1913 N N      . GLU A 1 117 ? 80.32497  24.53970  11.11627  1.000 17.61010 ? 135 GLU A N      1 
ATOM   1914 C CA     . GLU A 1 117 ? 81.57103  24.87860  11.79254  1.000 16.49673 ? 135 GLU A CA     1 
ATOM   1915 C C      . GLU A 1 117 ? 82.55795  23.72329  11.71764  1.000 16.93790 ? 135 GLU A C      1 
ATOM   1916 O O      . GLU A 1 117 ? 83.76191  23.93399  11.53050  1.000 18.06509 ? 135 GLU A O      1 
ATOM   1917 C CB     . GLU A 1 117 ? 81.27900  25.26039  13.24378  1.000 16.34307 ? 135 GLU A CB     1 
ATOM   1918 C CG     . GLU A 1 117 ? 82.50499  25.52322  14.10438  1.000 18.31632 ? 135 GLU A CG     1 
ATOM   1919 C CD     . GLU A 1 117 ? 83.07516  24.26251  14.74244  1.000 19.71560 ? 135 GLU A CD     1 
ATOM   1920 O OE1    . GLU A 1 117 ? 82.33730  23.25707  14.84433  1.000 19.88315 ? 135 GLU A OE1    1 
ATOM   1921 O OE2    . GLU A 1 117 ? 84.26140  24.28036  15.14838  1.000 19.71708 ? 135 GLU A OE2    1 
ATOM   1922 H H      . GLU A 1 117 ? 79.61823  24.64144  11.59561  1.000 21.13212 ? 135 GLU A H      1 
ATOM   1923 H HA     . GLU A 1 117 ? 81.97884  25.64571  11.36112  1.000 19.79608 ? 135 GLU A HA     1 
ATOM   1924 H HB2    . GLU A 1 117 ? 80.74464  26.06993  13.24566  1.000 19.61168 ? 135 GLU A HB2    1 
ATOM   1925 H HB3    . GLU A 1 117 ? 80.78458  24.53555  13.65737  1.000 19.61168 ? 135 GLU A HB3    1 
ATOM   1926 H HG2    . GLU A 1 117 ? 83.19820  25.91662  13.55156  1.000 21.97959 ? 135 GLU A HG2    1 
ATOM   1927 H HG3    . GLU A 1 117 ? 82.26277  26.13434  14.81765  1.000 21.97959 ? 135 GLU A HG3    1 
ATOM   1928 N N      . SER A 1 118 ? 82.06324  22.49002  11.84269  1.000 16.17138 ? 136 SER A N      1 
ATOM   1929 C CA     . SER A 1 118 ? 82.95340  21.33642  11.77558  1.000 18.13012 ? 136 SER A CA     1 
ATOM   1930 C C      . SER A 1 118 ? 83.71211  21.30724  10.45444  1.000 18.75862 ? 136 SER A C      1 
ATOM   1931 O O      . SER A 1 118 ? 84.90168  20.97220  10.41946  1.000 19.13041 ? 136 SER A O      1 
ATOM   1932 C CB     . SER A 1 118 ? 82.15979  20.04111  11.96843  1.000 17.68900 ? 136 SER A CB     1 
ATOM   1933 O OG     . SER A 1 118 ? 81.53551  19.62697  10.76736  1.000 16.54946 ? 136 SER A OG     1 
ATOM   1934 H H      . SER A 1 118 ? 81.23341  22.29990  11.96450  1.000 19.40566 ? 136 SER A H      1 
ATOM   1935 H HA     . SER A 1 118 ? 83.59978  21.39868  12.49614  1.000 21.75615 ? 136 SER A HA     1 
ATOM   1936 H HB2    . SER A 1 118 ? 82.76666  19.34357  12.26177  1.000 21.22680 ? 136 SER A HB2    1 
ATOM   1937 H HB3    . SER A 1 118 ? 81.47638  20.19047  12.64040  1.000 21.22680 ? 136 SER A HB3    1 
ATOM   1938 H HG     . SER A 1 118 ? 81.10013  18.92069  10.89858  1.000 19.85936 ? 136 SER A HG     1 
ATOM   1939 N N      . ARG A 1 119 ? 83.04238  21.66518  9.35648   1.000 18.98373 ? 137 ARG A N      1 
ATOM   1940 C CA     . ARG A 1 119 ? 83.70369  21.66997  8.05663   1.000 18.98151 ? 137 ARG A CA     1 
ATOM   1941 C C      . ARG A 1 119 ? 84.67129  22.83953  7.93189   1.000 18.48257 ? 137 ARG A C      1 
ATOM   1942 O O      . ARG A 1 119 ? 85.73669  22.70812  7.31756   1.000 16.94492 ? 137 ARG A O      1 
ATOM   1943 C CB     . ARG A 1 119 ? 82.65858  21.71619  6.94601   1.000 19.03794 ? 137 ARG A CB     1 
ATOM   1944 C CG     . ARG A 1 119 ? 81.75023  20.49850  6.91236   1.000 19.61747 ? 137 ARG A CG     1 
ATOM   1945 C CD     . ARG A 1 119 ? 82.54940  19.22020  6.77268   1.000 19.57815 ? 137 ARG A CD     1 
ATOM   1946 N NE     . ARG A 1 119 ? 82.86463  18.62169  8.06751   1.000 19.86499 ? 137 ARG A NE     1 
ATOM   1947 C CZ     . ARG A 1 119 ? 83.78658  17.68240  8.25115   1.000 20.01231 ? 137 ARG A CZ     1 
ATOM   1948 N NH1    . ARG A 1 119 ? 84.50035  17.23583  7.22838   1.000 19.71532 ? 137 ARG A NH1    1 
ATOM   1949 N NH2    . ARG A 1 119 ? 84.00281  17.19290  9.46172   1.000 20.65682 ? 137 ARG A NH2    1 
ATOM   1950 H H      . ARG A 1 119 ? 82.21684  21.90558  9.33939   1.000 22.78047 ? 137 ARG A H      1 
ATOM   1951 H HA     . ARG A 1 119 ? 84.21353  20.85050  7.95956   1.000 22.77781 ? 137 ARG A HA     1 
ATOM   1952 H HB2    . ARG A 1 119 ? 82.10048  22.49901  7.07492   1.000 22.84553 ? 137 ARG A HB2    1 
ATOM   1953 H HB3    . ARG A 1 119 ? 83.11372  21.77037  6.09114   1.000 22.84553 ? 137 ARG A HB3    1 
ATOM   1954 H HG2    . ARG A 1 119 ? 81.24211  20.45280  7.73736   1.000 23.54096 ? 137 ARG A HG2    1 
ATOM   1955 H HG3    . ARG A 1 119 ? 81.14791  20.56679  6.15510   1.000 23.54096 ? 137 ARG A HG3    1 
ATOM   1956 H HD2    . ARG A 1 119 ? 82.03472  18.57737  6.26006   1.000 23.49378 ? 137 ARG A HD2    1 
ATOM   1957 H HD3    . ARG A 1 119 ? 83.38417  19.41462  6.31853   1.000 23.49378 ? 137 ARG A HD3    1 
ATOM   1958 H HE     . ARG A 1 119 ? 82.42555  18.89463  8.75476   1.000 23.83799 ? 137 ARG A HE     1 
ATOM   1959 H HH11   . ARG A 1 119 ? 84.36825  17.55390  6.44036   1.000 23.65839 ? 137 ARG A HH11   1 
ATOM   1960 H HH12   . ARG A 1 119 ? 85.09581  16.62786  7.35244   1.000 23.65839 ? 137 ARG A HH12   1 
ATOM   1961 H HH21   . ARG A 1 119 ? 83.54642  17.48269  10.13055  1.000 24.78819 ? 137 ARG A HH21   1 
ATOM   1962 H HH22   . ARG A 1 119 ? 84.59970  16.58507  9.57946   1.000 24.78819 ? 137 ARG A HH22   1 
ATOM   1963 N N      . ILE A 1 120 ? 84.31660  23.99212  8.50289   1.000 19.25475 ? 138 ILE A N      1 
ATOM   1964 C CA     . ILE A 1 120 ? 85.23126  25.12950  8.50576   1.000 19.13447 ? 138 ILE A CA     1 
ATOM   1965 C C      . ILE A 1 120 ? 86.51758  24.76956  9.23448   1.000 17.77102 ? 138 ILE A C      1 
ATOM   1966 O O      . ILE A 1 120 ? 87.61942  25.12566  8.79713   1.000 16.86489 ? 138 ILE A O      1 
ATOM   1967 C CB     . ILE A 1 120 ? 84.54827  26.35740  9.13410   1.000 20.64386 ? 138 ILE A CB     1 
ATOM   1968 C CG1    . ILE A 1 120 ? 83.30706  26.73161  8.32329   1.000 20.33411 ? 138 ILE A CG1    1 
ATOM   1969 C CG2    . ILE A 1 120 ? 85.51897  27.53406  9.20752   1.000 22.05567 ? 138 ILE A CG2    1 
ATOM   1970 C CD1    . ILE A 1 120 ? 82.61867  27.99067  8.79592   1.000 20.52467 ? 138 ILE A CD1    1 
ATOM   1971 H H      . ILE A 1 120 ? 83.56247  24.13818  8.88960   1.000 23.10571 ? 138 ILE A H      1 
ATOM   1972 H HA     . ILE A 1 120 ? 85.45825  25.34907  7.58861   1.000 22.96136 ? 138 ILE A HA     1 
ATOM   1973 H HB     . ILE A 1 120 ? 84.27661  26.13350  10.03797  1.000 24.77263 ? 138 ILE A HB     1 
ATOM   1974 H HG12   . ILE A 1 120 ? 83.56905  26.86806  7.39936   1.000 24.40093 ? 138 ILE A HG12   1 
ATOM   1975 H HG13   . ILE A 1 120 ? 82.66662  26.00552  8.38275   1.000 24.40093 ? 138 ILE A HG13   1 
ATOM   1976 H HG21   . ILE A 1 120 ? 86.28264  27.28014  9.74903   1.000 26.46680 ? 138 ILE A HG21   1 
ATOM   1977 H HG22   . ILE A 1 120 ? 85.06633  28.29229  9.60889   1.000 26.46680 ? 138 ILE A HG22   1 
ATOM   1978 H HG23   . ILE A 1 120 ? 85.81014  27.75972  8.31019   1.000 26.46680 ? 138 ILE A HG23   1 
ATOM   1979 H HD11   . ILE A 1 120 ? 82.52398  27.95570  9.76065   1.000 24.62960 ? 138 ILE A HD11   1 
ATOM   1980 H HD12   . ILE A 1 120 ? 81.74442  28.04789  8.37960   1.000 24.62960 ? 138 ILE A HD12   1 
ATOM   1981 H HD13   . ILE A 1 120 ? 83.15592  28.75796  8.54388   1.000 24.62960 ? 138 ILE A HD13   1 
ATOM   1982 N N      . GLN A 1 121 ? 86.40095  24.06250  10.36026  1.000 17.62999 ? 139 GLN A N      1 
ATOM   1983 C CA     . GLN A 1 121 ? 87.59759  23.63570  11.07608  1.000 17.19820 ? 139 GLN A CA     1 
ATOM   1984 C C      . GLN A 1 121 ? 88.47552  22.76426  10.18752  1.000 15.43426 ? 139 GLN A C      1 
ATOM   1985 O O      . GLN A 1 121 ? 89.69910  22.93754  10.14829  1.000 14.19445 ? 139 GLN A O      1 
ATOM   1986 C CB     . GLN A 1 121 ? 87.21142  22.89608  12.35781  1.000 17.78712 ? 139 GLN A CB     1 
ATOM   1987 C CG     . GLN A 1 121 ? 88.38302  22.62795  13.28829  1.000 19.69599 ? 139 GLN A CG     1 
ATOM   1988 C CD     . GLN A 1 121 ? 87.94489  22.20642  14.68002  1.000 22.86968 ? 139 GLN A CD     1 
ATOM   1989 O OE1    . GLN A 1 121 ? 86.87479  21.62395  14.85829  1.000 25.03449 ? 139 GLN A OE1    1 
ATOM   1990 N NE2    . GLN A 1 121 ? 88.77181  22.50509  15.67792  1.000 23.34398 ? 139 GLN A NE2    1 
ATOM   1991 H H      . GLN A 1 121 ? 85.65756  23.82351  10.72063  1.000 21.15598 ? 139 GLN A H      1 
ATOM   1992 H HA     . GLN A 1 121 ? 88.11028  24.41768  11.33408  1.000 20.63784 ? 139 GLN A HA     1 
ATOM   1993 H HB2    . GLN A 1 121 ? 86.56431  23.43119  12.84341  1.000 21.34454 ? 139 GLN A HB2    1 
ATOM   1994 H HB3    . GLN A 1 121 ? 86.82176  22.04061  12.11855  1.000 21.34454 ? 139 GLN A HB3    1 
ATOM   1995 H HG2    . GLN A 1 121 ? 88.92539  21.91511  12.91603  1.000 23.63518 ? 139 GLN A HG2    1 
ATOM   1996 H HG3    . GLN A 1 121 ? 88.91114  23.43720  13.37257  1.000 23.63518 ? 139 GLN A HG3    1 
ATOM   1997 H HE21   . GLN A 1 121 ? 88.56845  22.28739  16.48468  1.000 28.01278 ? 139 GLN A HE21   1 
ATOM   1998 H HE22   . GLN A 1 121 ? 89.50987  22.91592  15.51644  1.000 28.01278 ? 139 GLN A HE22   1 
ATOM   1999 N N      . ILE A 1 122 ? 87.86524  21.84052  9.44313   1.000 15.35653 ? 140 ILE A N      1 
ATOM   2000 C CA     . ILE A 1 122 ? 88.64171  20.97311  8.56501   1.000 16.45681 ? 140 ILE A CA     1 
ATOM   2001 C C      . ILE A 1 122 ? 89.28742  21.78902  7.45386   1.000 17.11607 ? 140 ILE A C      1 
ATOM   2002 O O      . ILE A 1 122 ? 90.43914  21.54882  7.07701   1.000 15.44489 ? 140 ILE A O      1 
ATOM   2003 C CB     . ILE A 1 122 ? 87.74922  19.85089  7.99992   1.000 17.67749 ? 140 ILE A CB     1 
ATOM   2004 C CG1    . ILE A 1 122 ? 87.21094  18.96110  9.12409   1.000 17.04311 ? 140 ILE A CG1    1 
ATOM   2005 C CG2    . ILE A 1 122 ? 88.51425  19.01614  6.97623   1.000 18.47437 ? 140 ILE A CG2    1 
ATOM   2006 C CD1    . ILE A 1 122 ? 88.27610  18.28648  9.93125   1.000 17.26003 ? 140 ILE A CD1    1 
ATOM   2007 H H      . ILE A 1 122 ? 87.01699  21.69946  9.42967   1.000 18.42784 ? 140 ILE A H      1 
ATOM   2008 H HA     . ILE A 1 122 ? 89.34935  20.55955  9.08378   1.000 19.74817 ? 140 ILE A HA     1 
ATOM   2009 H HB     . ILE A 1 122 ? 86.99441  20.26786  7.55574   1.000 21.21299 ? 140 ILE A HB     1 
ATOM   2010 H HG12   . ILE A 1 122 ? 86.68500  19.50797  9.72843   1.000 20.45173 ? 140 ILE A HG12   1 
ATOM   2011 H HG13   . ILE A 1 122 ? 86.65450  18.26927  8.73339   1.000 20.45173 ? 140 ILE A HG13   1 
ATOM   2012 H HG21   . ILE A 1 122 ? 88.60869  19.52857  6.15806   1.000 22.16924 ? 140 ILE A HG21   1 
ATOM   2013 H HG22   . ILE A 1 122 ? 88.01934  18.20061  6.80049   1.000 22.16924 ? 140 ILE A HG22   1 
ATOM   2014 H HG23   . ILE A 1 122 ? 89.38953  18.80114  7.33477   1.000 22.16924 ? 140 ILE A HG23   1 
ATOM   2015 H HD11   . ILE A 1 122 ? 88.88346  17.82642  9.33095   1.000 20.71204 ? 140 ILE A HD11   1 
ATOM   2016 H HD12   . ILE A 1 122 ? 87.86037  17.64956  10.53325  1.000 20.71204 ? 140 ILE A HD12   1 
ATOM   2017 H HD13   . ILE A 1 122 ? 88.75854  18.95653  10.44035  1.000 20.71204 ? 140 ILE A HD13   1 
ATOM   2018 N N      . TRP A 1 123 ? 88.55799  22.76538  6.91166   1.000 20.19359 ? 141 TRP A N      1 
ATOM   2019 C CA     . TRP A 1 123 ? 89.11235  23.61461  5.86285   1.000 21.70632 ? 141 TRP A CA     1 
ATOM   2020 C C      . TRP A 1 123 ? 90.42138  24.25823  6.31187   1.000 21.93455 ? 141 TRP A C      1 
ATOM   2021 O O      . TRP A 1 123 ? 91.41972  24.23756  5.58252   1.000 21.32446 ? 141 TRP A O      1 
ATOM   2022 C CB     . TRP A 1 123 ? 88.08820  24.67945  5.46743   1.000 21.78270 ? 141 TRP A CB     1 
ATOM   2023 C CG     . TRP A 1 123 ? 88.50003  25.50733  4.28954   1.000 23.53830 ? 141 TRP A CG     1 
ATOM   2024 C CD1    . TRP A 1 123 ? 88.14282  25.31395  2.98538   1.000 24.71914 ? 141 TRP A CD1    1 
ATOM   2025 C CD2    . TRP A 1 123 ? 89.34900  26.66200  4.30536   1.000 24.12966 ? 141 TRP A CD2    1 
ATOM   2026 N NE1    . TRP A 1 123 ? 88.71610  26.27751  2.19107   1.000 25.46180 ? 141 TRP A NE1    1 
ATOM   2027 C CE2    . TRP A 1 123 ? 89.46112  27.11621  2.97757   1.000 25.31533 ? 141 TRP A CE2    1 
ATOM   2028 C CE3    . TRP A 1 123 ? 90.02294  27.35476  5.31340   1.000 24.67276 ? 141 TRP A CE3    1 
ATOM   2029 C CZ2    . TRP A 1 123 ? 90.21772  28.23099  2.63332   1.000 26.65506 ? 141 TRP A CZ2    1 
ATOM   2030 C CZ3    . TRP A 1 123 ? 90.77399  28.46099  4.97028   1.000 25.83428 ? 141 TRP A CZ3    1 
ATOM   2031 C CH2    . TRP A 1 123 ? 90.86484  28.88990  3.64280   1.000 26.67638 ? 141 TRP A CH2    1 
ATOM   2032 H H      . TRP A 1 123 ? 87.74829  22.95365  7.13195   1.000 24.23231 ? 141 TRP A H      1 
ATOM   2033 H HA     . TRP A 1 123 ? 89.30066  23.07253  5.08081   1.000 26.04758 ? 141 TRP A HA     1 
ATOM   2034 H HB2    . TRP A 1 123 ? 87.25302  24.24030  5.24263   1.000 26.13924 ? 141 TRP A HB2    1 
ATOM   2035 H HB3    . TRP A 1 123 ? 87.95614  25.27893  6.21848   1.000 26.13924 ? 141 TRP A HB3    1 
ATOM   2036 H HD1    . TRP A 1 123 ? 87.59194  24.62988  2.67965   1.000 29.66297 ? 141 TRP A HD1    1 
ATOM   2037 H HE1    . TRP A 1 123 ? 88.62246  26.34342  1.33873   1.000 30.55416 ? 141 TRP A HE1    1 
ATOM   2038 H HE3    . TRP A 1 123 ? 89.96683  27.07614  6.19891   1.000 29.60731 ? 141 TRP A HE3    1 
ATOM   2039 H HZ2    . TRP A 1 123 ? 90.28141  28.51763  1.75089   1.000 31.98608 ? 141 TRP A HZ2    1 
ATOM   2040 H HZ3    . TRP A 1 123 ? 91.22742  28.92909  5.63374   1.000 31.00114 ? 141 TRP A HZ3    1 
ATOM   2041 H HH2    . TRP A 1 123 ? 91.37658  29.63987  3.44138   1.000 32.01166 ? 141 TRP A HH2    1 
ATOM   2042 N N      . PHE A 1 124 ? 90.43673  24.82730  7.52245   1.000 22.23043 ? 142 PHE A N      1 
ATOM   2043 C CA     . PHE A 1 124 ? 91.65501  25.45447  8.02983   1.000 22.05323 ? 142 PHE A CA     1 
ATOM   2044 C C      . PHE A 1 124 ? 92.77167  24.43588  8.22672   1.000 20.68622 ? 142 PHE A C      1 
ATOM   2045 O O      . PHE A 1 124 ? 93.94131  24.73076  7.95670   1.000 21.08227 ? 142 PHE A O      1 
ATOM   2046 C CB     . PHE A 1 124 ? 91.36350  26.18337  9.33814   1.000 23.88357 ? 142 PHE A CB     1 
ATOM   2047 C CG     . PHE A 1 124 ? 90.89067  27.59759  9.14822   1.000 25.73525 ? 142 PHE A CG     1 
ATOM   2048 C CD1    . PHE A 1 124 ? 89.54563  27.87543  8.96636   1.000 24.84405 ? 142 PHE A CD1    1 
ATOM   2049 C CD2    . PHE A 1 124 ? 91.79389  28.64845  9.14812   1.000 26.47815 ? 142 PHE A CD2    1 
ATOM   2050 C CE1    . PHE A 1 124 ? 89.11252  29.17017  8.78970   1.000 24.67244 ? 142 PHE A CE1    1 
ATOM   2051 C CE2    . PHE A 1 124 ? 91.36379  29.94674  8.97316   1.000 26.39021 ? 142 PHE A CE2    1 
ATOM   2052 C CZ     . PHE A 1 124 ? 90.02167  30.20853  8.79246   1.000 25.43501 ? 142 PHE A CZ     1 
ATOM   2053 H H      . PHE A 1 124 ? 89.76557  24.86212  8.05904   1.000 26.67651 ? 142 PHE A H      1 
ATOM   2054 H HA     . PHE A 1 124 ? 91.95820  26.10659  7.37890   1.000 26.46388 ? 142 PHE A HA     1 
ATOM   2055 H HB2    . PHE A 1 124 ? 90.67127  25.70107  9.81680   1.000 28.66029 ? 142 PHE A HB2    1 
ATOM   2056 H HB3    . PHE A 1 124 ? 92.17556  26.21088  9.86795   1.000 28.66029 ? 142 PHE A HB3    1 
ATOM   2057 H HD1    . PHE A 1 124 ? 88.92857  27.17964  8.96360   1.000 29.81286 ? 142 PHE A HD1    1 
ATOM   2058 H HD2    . PHE A 1 124 ? 92.69998  28.47619  9.26736   1.000 31.77378 ? 142 PHE A HD2    1 
ATOM   2059 H HE1    . PHE A 1 124 ? 88.20721  29.34516  8.66848   1.000 29.60693 ? 142 PHE A HE1    1 
ATOM   2060 H HE2    . PHE A 1 124 ? 91.97793  30.64511  8.97698   1.000 31.66826 ? 142 PHE A HE2    1 
ATOM   2061 H HZ     . PHE A 1 124 ? 89.72983  31.08339  8.67267   1.000 30.52201 ? 142 PHE A HZ     1 
ATOM   2062 N N      . GLN A 1 125 ? 92.43832  23.23574  8.70551   1.000 19.15247 ? 143 GLN A N      1 
ATOM   2063 C CA     . GLN A 1 125 ? 93.45281  22.19566  8.83029   1.000 18.67977 ? 143 GLN A CA     1 
ATOM   2064 C C      . GLN A 1 125 ? 94.12930  21.94279  7.49092   1.000 19.49461 ? 143 GLN A C      1 
ATOM   2065 O O      . GLN A 1 125 ? 95.36054  21.97577  7.38646   1.000 19.16402 ? 143 GLN A O      1 
ATOM   2066 C CB     . GLN A 1 125 ? 92.83102  20.90657  9.37261   1.000 17.98964 ? 143 GLN A CB     1 
ATOM   2067 C CG     . GLN A 1 125 ? 92.50421  20.94841  10.86195  1.000 18.35576 ? 143 GLN A CG     1 
ATOM   2068 C CD     . GLN A 1 125 ? 92.11819  19.58792  11.42166  1.000 18.68123 ? 143 GLN A CD     1 
ATOM   2069 O OE1    . GLN A 1 125 ? 92.21190  18.57143  10.73240  1.000 19.60347 ? 143 GLN A OE1    1 
ATOM   2070 N NE2    . GLN A 1 125 ? 91.68274  19.56455  12.67984  1.000 18.13950 ? 143 GLN A NE2    1 
ATOM   2071 H H      . GLN A 1 125 ? 91.64938  23.00544  8.95877   1.000 22.98297 ? 143 GLN A H      1 
ATOM   2072 H HA     . GLN A 1 125 ? 94.12522  22.48851  9.46511   1.000 22.41572 ? 143 GLN A HA     1 
ATOM   2073 H HB2    . GLN A 1 125 ? 92.00435  20.73608  8.89464   1.000 21.58757 ? 143 GLN A HB2    1 
ATOM   2074 H HB3    . GLN A 1 125 ? 93.45407  20.17724  9.22845   1.000 21.58757 ? 143 GLN A HB3    1 
ATOM   2075 H HG2    . GLN A 1 125 ? 93.28347  21.26160  11.34731  1.000 22.02691 ? 143 GLN A HG2    1 
ATOM   2076 H HG3    . GLN A 1 125 ? 91.75931  21.55310  11.00468  1.000 22.02691 ? 143 GLN A HG3    1 
ATOM   2077 H HE21   . GLN A 1 125 ? 91.45237  18.81900  13.04136  1.000 21.76740 ? 143 GLN A HE21   1 
ATOM   2078 H HE22   . GLN A 1 125 ? 91.63187  20.29500  13.13090  1.000 21.76740 ? 143 GLN A HE22   1 
ATOM   2079 N N      . ASN A 1 126 ? 93.32946  21.70172  6.44807   1.000 21.16279 ? 144 ASN A N      1 
ATOM   2080 C CA     . ASN A 1 126 ? 93.88044  21.43156  5.12357   1.000 20.27772 ? 144 ASN A CA     1 
ATOM   2081 C C      . ASN A 1 126 ? 94.62218  22.64454  4.57378   1.000 21.17244 ? 144 ASN A C      1 
ATOM   2082 O O      . ASN A 1 126 ? 95.66067  22.50125  3.91879   1.000 21.37253 ? 144 ASN A O      1 
ATOM   2083 C CB     . ASN A 1 126 ? 92.76090  21.02246  4.16548   1.000 18.89163 ? 144 ASN A CB     1 
ATOM   2084 C CG     . ASN A 1 126 ? 92.26112  19.61157  4.40545   1.000 17.73130 ? 144 ASN A CG     1 
ATOM   2085 O OD1    . ASN A 1 126 ? 93.04819  18.66501  4.47497   1.000 17.75925 ? 144 ASN A OD1    1 
ATOM   2086 N ND2    . ASN A 1 126 ? 90.94047  19.46007  4.51278   1.000 16.20215 ? 144 ASN A ND2    1 
ATOM   2087 H H      . ASN A 1 126 ? 92.47024  21.68933  6.48248   1.000 25.39535 ? 144 ASN A H      1 
ATOM   2088 H HA     . ASN A 1 126 ? 94.50927  20.69634  5.19385   1.000 24.33326 ? 144 ASN A HA     1 
ATOM   2089 H HB2    . ASN A 1 126 ? 92.01185  21.62818  4.27923   1.000 22.66995 ? 144 ASN A HB2    1 
ATOM   2090 H HB3    . ASN A 1 126 ? 93.09183  21.07141  3.25499   1.000 22.66995 ? 144 ASN A HB3    1 
ATOM   2091 H HD21   . ASN A 1 126 ? 90.60690  18.67924  4.64926   1.000 19.44257 ? 144 ASN A HD21   1 
ATOM   2092 H HD22   . ASN A 1 126 ? 90.42241  20.14322  4.44552   1.000 19.44257 ? 144 ASN A HD22   1 
ATOM   2093 N N      . ARG A 1 127 ? 94.09901  23.84734  4.81991   1.000 22.43092 ? 145 ARG A N      1 
ATOM   2094 C CA     . ARG A 1 127 ? 94.73478  25.05487  4.29940   1.000 24.86853 ? 145 ARG A CA     1 
ATOM   2095 C C      . ARG A 1 127 ? 96.10643  25.27088  4.93219   1.000 24.54517 ? 145 ARG A C      1 
ATOM   2096 O O      . ARG A 1 127 ? 97.10794  25.44836  4.22687   1.000 22.82402 ? 145 ARG A O      1 
ATOM   2097 C CB     . ARG A 1 127 ? 93.83133  26.26585  4.54293   1.000 26.82067 ? 145 ARG A CB     1 
ATOM   2098 C CG     . ARG A 1 127 ? 94.27753  27.52939  3.83600   1.000 29.56618 ? 145 ARG A CG     1 
ATOM   2099 C CD     . ARG A 1 127 ? 94.05839  27.44064  2.32762   1.000 33.17905 ? 145 ARG A CD     1 
ATOM   2100 N NE     . ARG A 1 127 ? 94.62559  28.59074  1.62488   1.000 36.02472 ? 145 ARG A NE     1 
ATOM   2101 C CZ     . ARG A 1 127 ? 94.52089  28.80796  0.31613   1.000 37.40772 ? 145 ARG A CZ     1 
ATOM   2102 N NH1    . ARG A 1 127 ? 93.86412  27.95882  -0.46444  1.000 36.44497 ? 145 ARG A NH1    1 
ATOM   2103 N NH2    . ARG A 1 127 ? 95.08097  29.88524  -0.21501  1.000 39.23959 ? 145 ARG A NH2    1 
ATOM   2104 H H      . ARG A 1 127 ? 93.38605  23.98876  5.27957   1.000 26.91711 ? 145 ARG A H      1 
ATOM   2105 H HA     . ARG A 1 127 ? 94.85796  24.95669  3.34227   1.000 29.84223 ? 145 ARG A HA     1 
ATOM   2106 H HB2    . ARG A 1 127 ? 92.93815  26.05376  4.22964   1.000 32.18480 ? 145 ARG A HB2    1 
ATOM   2107 H HB3    . ARG A 1 127 ? 93.81349  26.45241  5.49466   1.000 32.18480 ? 145 ARG A HB3    1 
ATOM   2108 H HG2    . ARG A 1 127 ? 93.76760  28.28243  4.17336   1.000 35.47942 ? 145 ARG A HG2    1 
ATOM   2109 H HG3    . ARG A 1 127 ? 95.22352  27.67011  3.99788   1.000 35.47942 ? 145 ARG A HG3    1 
ATOM   2110 H HD2    . ARG A 1 127 ? 94.48524  26.63792  1.98947   1.000 39.81486 ? 145 ARG A HD2    1 
ATOM   2111 H HD3    . ARG A 1 127 ? 93.10630  27.41252  2.14422   1.000 39.81486 ? 145 ARG A HD3    1 
ATOM   2112 H HE     . ARG A 1 127 ? 95.05850  29.16907  2.09148   1.000 43.22966 ? 145 ARG A HE     1 
ATOM   2113 H HH11   . ARG A 1 127 ? 93.49944  27.25745  -0.12579  1.000 43.73397 ? 145 ARG A HH11   1 
ATOM   2114 H HH12   . ARG A 1 127 ? 93.80326  28.10999  -1.30886  1.000 43.73397 ? 145 ARG A HH12   1 
ATOM   2115 H HH21   . ARG A 1 127 ? 95.50871  30.43858  0.28544   1.000 47.08750 ? 145 ARG A HH21   1 
ATOM   2116 H HH22   . ARG A 1 127 ? 95.01669  30.03097  -1.06013  1.000 47.08750 ? 145 ARG A HH22   1 
ATOM   2117 N N      . ARG A 1 128 ? 96.16872  25.27043  6.26643   1.000 25.67558 ? 146 ARG A N      1 
ATOM   2118 C CA     . ARG A 1 128 ? 97.45229  25.39473  6.94867   1.000 25.75958 ? 146 ARG A CA     1 
ATOM   2119 C C      . ARG A 1 128 ? 98.44728  24.35712  6.45276   1.000 27.97652 ? 146 ARG A C      1 
ATOM   2120 O O      . ARG A 1 128 ? 99.64954  24.62795  6.36720   1.000 29.59398 ? 146 ARG A O      1 
ATOM   2121 C CB     . ARG A 1 128 ? 97.26102  25.25235  8.45629   1.000 23.63660 ? 146 ARG A CB     1 
ATOM   2122 C CG     . ARG A 1 128 ? 96.51694  26.40063  9.10289   1.000 22.61243 ? 146 ARG A CG     1 
ATOM   2123 C CD     . ARG A 1 128 ? 96.69666  26.38035  10.61189  1.000 22.20943 ? 146 ARG A CD     1 
ATOM   2124 N NE     . ARG A 1 128 ? 96.27870  25.10665  11.19283  1.000 21.73226 ? 146 ARG A NE     1 
ATOM   2125 C CZ     . ARG A 1 128 ? 95.05879  24.85000  11.65461  1.000 22.11239 ? 146 ARG A CZ     1 
ATOM   2126 N NH1    . ARG A 1 128 ? 94.11128  25.77578  11.61653  1.000 22.45682 ? 146 ARG A NH1    1 
ATOM   2127 N NH2    . ARG A 1 128 ? 94.78582  23.65808  12.16173  1.000 22.99773 ? 146 ARG A NH2    1 
ATOM   2128 H H      . ARG A 1 128 ? 95.49055  25.20035  6.79062   1.000 30.81070 ? 146 ARG A H      1 
ATOM   2129 H HA     . ARG A 1 128 ? 97.81319  26.27654  6.76686   1.000 30.91150 ? 146 ARG A HA     1 
ATOM   2130 H HB2    . ARG A 1 128 ? 96.75704  24.44175  8.62900   1.000 28.36392 ? 146 ARG A HB2    1 
ATOM   2131 H HB3    . ARG A 1 128 ? 98.13420  25.19567  8.87492   1.000 28.36392 ? 146 ARG A HB3    1 
ATOM   2132 H HG2    . ARG A 1 128 ? 96.86117  27.24156  8.76342   1.000 27.13491 ? 146 ARG A HG2    1 
ATOM   2133 H HG3    . ARG A 1 128 ? 95.57035  26.32548  8.90484   1.000 27.13491 ? 146 ARG A HG3    1 
ATOM   2134 H HD2    . ARG A 1 128 ? 97.63309  26.51798  10.82416  1.000 26.65132 ? 146 ARG A HD2    1 
ATOM   2135 H HD3    . ARG A 1 128 ? 96.15984  27.08492  11.00724  1.000 26.65132 ? 146 ARG A HD3    1 
ATOM   2136 H HE     . ARG A 1 128 ? 96.86368  24.47797  11.23940  1.000 26.07872 ? 146 ARG A HE     1 
ATOM   2137 H HH11   . ARG A 1 128 ? 94.28231  26.55296  11.29043  1.000 26.94818 ? 146 ARG A HH11   1 
ATOM   2138 H HH12   . ARG A 1 128 ? 93.32538  25.59937  11.91793  1.000 26.94818 ? 146 ARG A HH12   1 
ATOM   2139 H HH21   . ARG A 1 128 ? 95.39654  23.05333  12.19152  1.000 27.59727 ? 146 ARG A HH21   1 
ATOM   2140 H HH22   . ARG A 1 128 ? 93.99776  23.48849  12.46139  1.000 27.59727 ? 146 ARG A HH22   1 
ATOM   2141 N N      . ALA A 1 129 ? 97.96593  23.15953  6.12226   1.000 29.15151 ? 147 ALA A N      1 
ATOM   2142 C CA     . ALA A 1 129 ? 98.87333  22.10240  5.69616   1.000 30.31341 ? 147 ALA A CA     1 
ATOM   2143 C C      . ALA A 1 129 ? 99.43667  22.37085  4.30922   1.000 30.09274 ? 147 ALA A C      1 
ATOM   2144 O O      . ALA A 1 129 ? 100.57563 21.98555  4.02126   1.000 30.09903 ? 147 ALA A O      1 
ATOM   2145 C CB     . ALA A 1 129 ? 98.15695  20.75027  5.72109   1.000 30.33144 ? 147 ALA A CB     1 
ATOM   2146 H H      . ALA A 1 129 ? 97.13474  22.93924  6.13636   1.000 34.98181 ? 147 ALA A H      1 
ATOM   2147 H HA     . ALA A 1 129 ? 99.61496  22.06171  6.32004   1.000 36.37609 ? 147 ALA A HA     1 
ATOM   2148 H HB1    . ALA A 1 129 ? 98.77633  20.05946  5.43816   1.000 36.39773 ? 147 ALA A HB1    1 
ATOM   2149 H HB2    . ALA A 1 129 ? 97.85175  20.57119  6.62424   1.000 36.39773 ? 147 ALA A HB2    1 
ATOM   2150 H HB3    . ALA A 1 129 ? 97.39929  20.78311  5.11630   1.000 36.39773 ? 147 ALA A HB3    1 
ATOM   2151 N N      . ARG A 1 130 ? 98.66861  23.03163  3.44522   1.000 30.01164 ? 148 ARG A N      1 
ATOM   2152 C CA     . ARG A 1 130 ? 99.03141  23.18599  2.04328   1.000 30.68691 ? 148 ARG A CA     1 
ATOM   2153 C C      . ARG A 1 130 ? 99.45692  24.60508  1.69375   1.000 33.66535 ? 148 ARG A C      1 
ATOM   2154 O O      . ARG A 1 130 ? 99.56328  24.93082  0.50629   1.000 33.69531 ? 148 ARG A O      1 
ATOM   2155 C CB     . ARG A 1 130 ? 97.86284  22.74681  1.15839   1.000 29.21032 ? 148 ARG A CB     1 
ATOM   2156 C CG     . ARG A 1 130 ? 97.60045  21.25429  1.23185   1.000 28.66247 ? 148 ARG A CG     1 
ATOM   2157 C CD     . ARG A 1 130 ? 96.16731  20.90167  0.91178   1.000 28.18981 ? 148 ARG A CD     1 
ATOM   2158 N NE     . ARG A 1 130 ? 95.94764  19.46100  0.99924   1.000 27.97118 ? 148 ARG A NE     1 
ATOM   2159 C CZ     . ARG A 1 130 ? 94.75363  18.87690  0.97194   1.000 27.82365 ? 148 ARG A CZ     1 
ATOM   2160 N NH1    . ARG A 1 130 ? 93.64888  19.60476  0.86685   1.000 26.57975 ? 148 ARG A NH1    1 
ATOM   2161 N NH2    . ARG A 1 130 ? 94.66473  17.55740  1.05429   1.000 28.23328 ? 148 ARG A NH2    1 
ATOM   2162 H H      . ARG A 1 130 ? 97.92181  23.40409  3.65299   1.000 36.01397 ? 148 ARG A H      1 
ATOM   2163 H HA     . ARG A 1 130 ? 99.78798  22.60922  1.85399   1.000 36.82429 ? 148 ARG A HA     1 
ATOM   2164 H HB2    . ARG A 1 130 ? 97.05897  23.20772  1.44520   1.000 35.05239 ? 148 ARG A HB2    1 
ATOM   2165 H HB3    . ARG A 1 130 ? 98.06310  22.97168  0.23631   1.000 35.05239 ? 148 ARG A HB3    1 
ATOM   2166 H HG2    . ARG A 1 130 ? 98.17150  20.79992  0.59283   1.000 34.39497 ? 148 ARG A HG2    1 
ATOM   2167 H HG3    . ARG A 1 130 ? 97.79328  20.94206  2.12976   1.000 34.39497 ? 148 ARG A HG3    1 
ATOM   2168 H HD2    . ARG A 1 130 ? 95.57804  21.34068  1.54497   1.000 33.82777 ? 148 ARG A HD2    1 
ATOM   2169 H HD3    . ARG A 1 130 ? 95.95819  21.18950  0.00938   1.000 33.82777 ? 148 ARG A HD3    1 
ATOM   2170 H HE     . ARG A 1 130 ? 96.63890  18.95482  1.07362   1.000 33.56541 ? 148 ARG A HE     1 
ATOM   2171 H HH11   . ARG A 1 130 ? 93.70170  20.46161  0.81575   1.000 31.89571 ? 148 ARG A HH11   1 
ATOM   2172 H HH12   . ARG A 1 130 ? 92.88015  19.21956  0.84985   1.000 31.89571 ? 148 ARG A HH12   1 
ATOM   2173 H HH21   . ARG A 1 130 ? 95.37785  17.08196  1.12510   1.000 33.87993 ? 148 ARG A HH21   1 
ATOM   2174 H HH22   . ARG A 1 130 ? 93.89390  17.17644  1.03692   1.000 33.87993 ? 148 ARG A HH22   1 
ATOM   2175 N N      . HIS A 1 131 ? 99.71631  25.45394  2.69240   1.000 36.70238 ? 149 HIS A N      1 
ATOM   2176 C CA     . HIS A 1 131 ? 100.14154 26.83562  2.45583   1.000 38.10298 ? 149 HIS A CA     1 
ATOM   2177 C C      . HIS A 1 131 ? 100.95820 27.32936  3.63706   1.000 39.22129 ? 149 HIS A C      1 
ATOM   2178 O O      . HIS A 1 131 ? 100.49155 28.14179  4.44738   1.000 39.01543 ? 149 HIS A O      1 
ATOM   2179 C CB     . HIS A 1 131 ? 98.93318  27.73650  2.21502   1.000 38.70359 ? 149 HIS A CB     1 
ATOM   2180 C CG     . HIS A 1 131 ? 98.19429  27.42411  0.95566   1.000 39.38200 ? 149 HIS A CG     1 
ATOM   2181 N ND1    . HIS A 1 131 ? 97.06205  26.63993  0.93291   1.000 39.78060 ? 149 HIS A ND1    1 
ATOM   2182 C CD2    . HIS A 1 131 ? 98.43811  27.77202  -0.32931  1.000 39.95774 ? 149 HIS A CD2    1 
ATOM   2183 C CE1    . HIS A 1 131 ? 96.63423  26.52657  -0.31144  1.000 40.44236 ? 149 HIS A CE1    1 
ATOM   2184 N NE2    . HIS A 1 131 ? 97.45188  27.20422  -1.09722  1.000 40.39944 ? 149 HIS A NE2    1 
ATOM   2185 H H      . HIS A 1 131 ? 99.65225  25.25002  3.52541   1.000 44.04285 ? 149 HIS A H      1 
ATOM   2186 H HA     . HIS A 1 131 ? 100.71082 26.85549  1.67070   1.000 45.72357 ? 149 HIS A HA     1 
ATOM   2187 H HB2    . HIS A 1 131 ? 98.31454  27.63355  2.95501   1.000 46.44431 ? 149 HIS A HB2    1 
ATOM   2188 H HB3    . HIS A 1 131 ? 99.23551  28.65659  2.16089   1.000 46.44431 ? 149 HIS A HB3    1 
ATOM   2189 H HD2    . HIS A 1 131 ? 99.14200  28.29742  -0.63491  1.000 47.94928 ? 149 HIS A HD2    1 
ATOM   2190 H HE1    . HIS A 1 131 ? 95.88458  26.05049  -0.58762  1.000 48.53083 ? 149 HIS A HE1    1 
ATOM   2191 H HE2    . HIS A 1 131 ? 97.37833  27.27771  -1.95091  1.000 48.47932 ? 149 HIS A HE2    1 
ATOM   2192 N N      . PRO A 1 132 ? 102.20791 26.85886  3.77379   1.000 40.32890 ? 150 PRO A N      1 
ATOM   2193 C CA     . PRO A 1 132 ? 103.11788 27.41964  4.77820   1.000 40.58308 ? 150 PRO A CA     1 
ATOM   2194 C C      . PRO A 1 132 ? 103.43844 28.89406  4.53313   1.000 40.52711 ? 150 PRO A C      1 
ATOM   2195 O O      . PRO A 1 132 ? 102.87189 29.75591  5.20473   1.000 39.55487 ? 150 PRO A O      1 
ATOM   2196 C CB     . PRO A 1 132 ? 104.37724 26.56418  4.62980   1.000 40.19523 ? 150 PRO A CB     1 
ATOM   2197 C CG     . PRO A 1 132 ? 103.91725 25.29765  3.99369   1.000 40.45811 ? 150 PRO A CG     1 
ATOM   2198 C CD     . PRO A 1 132 ? 102.78587 25.68402  3.09717   1.000 40.65100 ? 150 PRO A CD     1 
ATOM   2199 H HA     . PRO A 1 132 ? 102.75035 27.31264  5.66947   1.000 48.69969 ? 150 PRO A HA     1 
ATOM   2200 H HB2    . PRO A 1 132 ? 105.02098 27.02098  4.06603   1.000 48.23428 ? 150 PRO A HB2    1 
ATOM   2201 H HB3    . PRO A 1 132 ? 104.76358 26.39280  5.50288   1.000 48.23428 ? 150 PRO A HB3    1 
ATOM   2202 H HG2    . PRO A 1 132 ? 104.64245 24.90497  3.48301   1.000 48.54973 ? 150 PRO A HG2    1 
ATOM   2203 H HG3    . PRO A 1 132 ? 103.61863 24.67719  4.67688   1.000 48.54973 ? 150 PRO A HG3    1 
ATOM   2204 H HD2    . PRO A 1 132 ? 103.10961 25.91854  2.21337   1.000 48.78120 ? 150 PRO A HD2    1 
ATOM   2205 H HD3    . PRO A 1 132 ? 102.13541 24.96732  3.03284   1.000 48.78120 ? 150 PRO A HD3    1 
ATOM   2206 O "O5'"  . DG  B 2 1   ? 98.62327  19.41246  41.41652  1.000 45.85252 ? 1   DG  B "O5'"  1 
ATOM   2207 C "C5'"  . DG  B 2 1   ? 99.23176  18.57209  40.43305  1.000 44.53642 ? 1   DG  B "C5'"  1 
ATOM   2208 C "C4'"  . DG  B 2 1   ? 98.48507  17.25905  40.31450  1.000 42.14667 ? 1   DG  B "C4'"  1 
ATOM   2209 O "O4'"  . DG  B 2 1   ? 97.05989  17.52747  40.31702  1.000 41.41803 ? 1   DG  B "O4'"  1 
ATOM   2210 C "C3'"  . DG  B 2 1   ? 98.72868  16.48893  39.03073  1.000 40.74960 ? 1   DG  B "C3'"  1 
ATOM   2211 O "O3'"  . DG  B 2 1   ? 98.45624  15.09109  39.21808  1.000 41.37002 ? 1   DG  B "O3'"  1 
ATOM   2212 C "C2'"  . DG  B 2 1   ? 97.74684  17.15814  38.08115  1.000 39.98509 ? 1   DG  B "C2'"  1 
ATOM   2213 C "C1'"  . DG  B 2 1   ? 96.54819  17.42249  38.99448  1.000 38.72297 ? 1   DG  B "C1'"  1 
ATOM   2214 N N9     . DG  B 2 1   ? 95.80025  18.64421  38.68096  1.000 33.14468 ? 1   DG  B N9     1 
ATOM   2215 C C8     . DG  B 2 1   ? 96.30355  19.90233  38.45966  1.000 31.67068 ? 1   DG  B C8     1 
ATOM   2216 N N7     . DG  B 2 1   ? 95.38053  20.79304  38.21058  1.000 31.28820 ? 1   DG  B N7     1 
ATOM   2217 C C5     . DG  B 2 1   ? 94.19325  20.07746  38.27706  1.000 31.16359 ? 1   DG  B C5     1 
ATOM   2218 C C6     . DG  B 2 1   ? 92.85621  20.50467  38.09710  1.000 28.70363 ? 1   DG  B C6     1 
ATOM   2219 O O6     . DG  B 2 1   ? 92.44349  21.64469  37.83378  1.000 27.97668 ? 1   DG  B O6     1 
ATOM   2220 N N1     . DG  B 2 1   ? 91.95337  19.45191  38.25578  1.000 26.95621 ? 1   DG  B N1     1 
ATOM   2221 C C2     . DG  B 2 1   ? 92.30482  18.15444  38.54893  1.000 28.45235 ? 1   DG  B C2     1 
ATOM   2222 N N2     . DG  B 2 1   ? 91.30687  17.27141  38.66323  1.000 28.70519 ? 1   DG  B N2     1 
ATOM   2223 N N3     . DG  B 2 1   ? 93.54842  17.74756  38.71970  1.000 30.62049 ? 1   DG  B N3     1 
ATOM   2224 C C4     . DG  B 2 1   ? 94.43715  18.75779  38.57001  1.000 31.59716 ? 1   DG  B C4     1 
ATOM   2225 H "H5'"  . DG  B 2 1   ? 100.15119 18.39586  40.68698  1.000 53.44370 ? 1   DG  B "H5'"  1 
ATOM   2226 H "H5''" . DG  B 2 1   ? 99.22227  19.02450  39.57506  1.000 53.44370 ? 1   DG  B "H5''" 1 
ATOM   2227 H "H4'"  . DG  B 2 1   ? 98.71849  16.69690  41.06975  1.000 50.57601 ? 1   DG  B "H4'"  1 
ATOM   2228 H "H3'"  . DG  B 2 1   ? 99.64008  16.60200  38.71854  1.000 48.89952 ? 1   DG  B "H3'"  1 
ATOM   2229 H "H2'"  . DG  B 2 1   ? 98.10782  17.98395  37.72250  1.000 47.98211 ? 1   DG  B "H2'"  1 
ATOM   2230 H "H2''" . DG  B 2 1   ? 97.50942  16.57166  37.34592  1.000 47.98211 ? 1   DG  B "H2''" 1 
ATOM   2231 H "H1'"  . DG  B 2 1   ? 95.94328  16.66611  38.94092  1.000 46.46756 ? 1   DG  B "H1'"  1 
ATOM   2232 H H8     . DG  B 2 1   ? 97.21175  20.10095  38.48458  1.000 38.00482 ? 1   DG  B H8     1 
ATOM   2233 H H1     . DG  B 2 1   ? 91.11647  19.62711  38.16357  1.000 32.34745 ? 1   DG  B H1     1 
ATOM   2234 H H21    . DG  B 2 1   ? 90.49274  17.52606  38.55388  1.000 34.44622 ? 1   DG  B H21    1 
ATOM   2235 H H22    . DG  B 2 1   ? 91.47928  16.44895  38.84609  1.000 34.44622 ? 1   DG  B H22    1 
ATOM   2236 H "HO5'" . DG  B 2 1   ? 98.06202  19.09228  41.95279  1.000 55.02302 ? 1   DG  B "HO5'" 1 
ATOM   2237 P P      . DC  B 2 2   ? 98.65924  14.04463  38.01213  1.000 41.60515 ? 2   DC  B P      1 
ATOM   2238 O OP1    . DC  B 2 2   ? 99.41443  12.88724  38.54532  1.000 41.66276 ? 2   DC  B OP1    1 
ATOM   2239 O OP2    . DC  B 2 2   ? 99.17902  14.80854  36.85354  1.000 41.88317 ? 2   DC  B OP2    1 
ATOM   2240 O "O5'"  . DC  B 2 2   ? 97.17379  13.55656  37.66176  1.000 39.51629 ? 2   DC  B "O5'"  1 
ATOM   2241 C "C5'"  . DC  B 2 2   ? 96.44454  12.76850  38.59839  1.000 38.15032 ? 2   DC  B "C5'"  1 
ATOM   2242 C "C4'"  . DC  B 2 2   ? 95.08320  12.36670  38.04611  1.000 37.12169 ? 2   DC  B "C4'"  1 
ATOM   2243 O "O4'"  . DC  B 2 2   ? 94.29943  13.55700  37.75013  1.000 36.83771 ? 2   DC  B "O4'"  1 
ATOM   2244 C "C3'"  . DC  B 2 2   ? 95.11486  11.56977  36.74869  1.000 36.17540 ? 2   DC  B "C3'"  1 
ATOM   2245 O "O3'"  . DC  B 2 2   ? 94.06981  10.61424  36.74249  1.000 35.70777 ? 2   DC  B "O3'"  1 
ATOM   2246 C "C2'"  . DC  B 2 2   ? 94.93049  12.64186  35.68089  1.000 35.77907 ? 2   DC  B "C2'"  1 
ATOM   2247 C "C1'"  . DC  B 2 2   ? 93.97376  13.60431  36.36980  1.000 35.25477 ? 2   DC  B "C1'"  1 
ATOM   2248 N N1     . DC  B 2 2   ? 94.06378  15.03812  35.92968  1.000 32.82268 ? 2   DC  B N1     1 
ATOM   2249 C C2     . DC  B 2 2   ? 92.88765  15.75345  35.66733  1.000 31.92445 ? 2   DC  B C2     1 
ATOM   2250 O O2     . DC  B 2 2   ? 91.79818  15.17704  35.76043  1.000 32.84228 ? 2   DC  B O2     1 
ATOM   2251 N N3     . DC  B 2 2   ? 92.97696  17.05679  35.30470  1.000 30.19726 ? 2   DC  B N3     1 
ATOM   2252 C C4     . DC  B 2 2   ? 94.17078  17.64238  35.21206  1.000 29.37957 ? 2   DC  B C4     1 
ATOM   2253 N N4     . DC  B 2 2   ? 94.20933  18.92923  34.84948  1.000 28.22222 ? 2   DC  B N4     1 
ATOM   2254 C C5     . DC  B 2 2   ? 95.37874  16.93453  35.48823  1.000 29.32420 ? 2   DC  B C5     1 
ATOM   2255 C C6     . DC  B 2 2   ? 95.27807  15.65155  35.84783  1.000 30.59786 ? 2   DC  B C6     1 
ATOM   2256 H "H5'"  . DC  B 2 2   ? 96.31826  13.27971  39.41301  1.000 45.78038 ? 2   DC  B "H5'"  1 
ATOM   2257 H "H5''" . DC  B 2 2   ? 96.95269  11.96810  38.80341  1.000 45.78038 ? 2   DC  B "H5''" 1 
ATOM   2258 H "H4'"  . DC  B 2 2   ? 94.61976  11.84677  38.72123  1.000 44.54603 ? 2   DC  B "H4'"  1 
ATOM   2259 H "H3'"  . DC  B 2 2   ? 95.97418  11.13505  36.63259  1.000 43.41049 ? 2   DC  B "H3'"  1 
ATOM   2260 H "H2'"  . DC  B 2 2   ? 95.77121  13.07288  35.46109  1.000 42.93488 ? 2   DC  B "H2'"  1 
ATOM   2261 H "H2''" . DC  B 2 2   ? 94.54297  12.27416  34.87124  1.000 42.93488 ? 2   DC  B "H2''" 1 
ATOM   2262 H "H1'"  . DC  B 2 2   ? 93.06879  13.29208  36.21346  1.000 42.30573 ? 2   DC  B "H1'"  1 
ATOM   2263 H H41    . DC  B 2 2   ? 93.47856  19.35163  34.68473  1.000 33.86667 ? 2   DC  B H41    1 
ATOM   2264 H H42    . DC  B 2 2   ? 94.96490  19.33425  34.78109  1.000 33.86667 ? 2   DC  B H42    1 
ATOM   2265 H H5     . DC  B 2 2   ? 96.20718  17.35165  35.42030  1.000 35.18903 ? 2   DC  B H5     1 
ATOM   2266 H H6     . DC  B 2 2   ? 96.04859  15.16969  36.04532  1.000 36.71743 ? 2   DC  B H6     1 
ATOM   2267 P P      . DG  B 2 3   ? 94.08648  9.38990   35.70633  1.000 37.52280 ? 3   DG  B P      1 
ATOM   2268 O OP1    . DG  B 2 3   ? 93.78470  8.16123   36.47806  1.000 36.02643 ? 3   DG  B OP1    1 
ATOM   2269 O OP2    . DG  B 2 3   ? 95.31949  9.48074   34.88928  1.000 38.93659 ? 3   DG  B OP2    1 
ATOM   2270 O "O5'"  . DG  B 2 3   ? 92.86955  9.71799   34.72036  1.000 36.19748 ? 3   DG  B "O5'"  1 
ATOM   2271 C "C5'"  . DG  B 2 3   ? 91.59133  10.02293  35.25004  1.000 32.73500 ? 3   DG  B "C5'"  1 
ATOM   2272 C "C4'"  . DG  B 2 3   ? 90.71794  10.68741  34.20484  1.000 30.13902 ? 3   DG  B "C4'"  1 
ATOM   2273 O "O4'"  . DG  B 2 3   ? 91.16464  12.05307  33.99125  1.000 29.80551 ? 3   DG  B "O4'"  1 
ATOM   2274 C "C3'"  . DG  B 2 3   ? 90.72349  10.01689  32.83391  1.000 28.17016 ? 3   DG  B "C3'"  1 
ATOM   2275 O "O3'"  . DG  B 2 3   ? 89.37880  9.83715   32.39168  1.000 26.09372 ? 3   DG  B "O3'"  1 
ATOM   2276 C "C2'"  . DG  B 2 3   ? 91.53095  10.98059  31.95014  1.000 28.54099 ? 3   DG  B "C2'"  1 
ATOM   2277 C "C1'"  . DG  B 2 3   ? 91.27291  12.32184  32.60965  1.000 29.28780 ? 3   DG  B "C1'"  1 
ATOM   2278 N N9     . DG  B 2 3   ? 92.32342  13.32554  32.44118  1.000 29.09984 ? 3   DG  B N9     1 
ATOM   2279 C C8     . DG  B 2 3   ? 93.67861  13.14428  32.56089  1.000 29.48711 ? 3   DG  B C8     1 
ATOM   2280 N N7     . DG  B 2 3   ? 94.36700  14.24441  32.39766  1.000 29.52628 ? 3   DG  B N7     1 
ATOM   2281 C C5     . DG  B 2 3   ? 93.40465  15.21625  32.16998  1.000 28.45010 ? 3   DG  B C5     1 
ATOM   2282 C C6     . DG  B 2 3   ? 93.54783  16.60098  31.92708  1.000 27.00192 ? 3   DG  B C6     1 
ATOM   2283 O O6     . DG  B 2 3   ? 94.59037  17.26655  31.86183  1.000 26.38699 ? 3   DG  B O6     1 
ATOM   2284 N N1     . DG  B 2 3   ? 92.31503  17.22293  31.75291  1.000 26.71865 ? 3   DG  B N1     1 
ATOM   2285 C C2     . DG  B 2 3   ? 91.09950  16.58477  31.80529  1.000 27.40811 ? 3   DG  B C2     1 
ATOM   2286 N N2     . DG  B 2 3   ? 90.01772  17.34914  31.61466  1.000 27.76850 ? 3   DG  B N2     1 
ATOM   2287 N N3     . DG  B 2 3   ? 90.95160  15.29053  32.03348  1.000 28.07122 ? 3   DG  B N3     1 
ATOM   2288 C C4     . DG  B 2 3   ? 92.14276  14.67036  32.20680  1.000 28.74028 ? 3   DG  B C4     1 
ATOM   2289 H "H5'"  . DG  B 2 3   ? 91.69354  10.62009  36.00757  1.000 39.28199 ? 3   DG  B "H5'"  1 
ATOM   2290 H "H5''" . DG  B 2 3   ? 91.16554  9.20411   35.54859  1.000 39.28199 ? 3   DG  B "H5''" 1 
ATOM   2291 H "H4'"  . DG  B 2 3   ? 89.80385  10.71372  34.52833  1.000 36.16682 ? 3   DG  B "H4'"  1 
ATOM   2292 H "H3'"  . DG  B 2 3   ? 91.19122  9.16771   32.86595  1.000 33.80420 ? 3   DG  B "H3'"  1 
ATOM   2293 H "H2'"  . DG  B 2 3   ? 92.47534  10.75932  31.95810  1.000 34.24919 ? 3   DG  B "H2'"  1 
ATOM   2294 H "H2''" . DG  B 2 3   ? 91.21196  10.97057  31.03415  1.000 34.24919 ? 3   DG  B "H2''" 1 
ATOM   2295 H "H1'"  . DG  B 2 3   ? 90.44594  12.67997  32.25081  1.000 35.14536 ? 3   DG  B "H1'"  1 
ATOM   2296 H H8     . DG  B 2 3   ? 94.06932  12.31967  32.74054  1.000 35.38454 ? 3   DG  B H8     1 
ATOM   2297 H H1     . DG  B 2 3   ? 92.31406  18.06945  31.60126  1.000 32.06238 ? 3   DG  B H1     1 
ATOM   2298 H H21    . DG  B 2 3   ? 90.10716  18.19143  31.46583  1.000 33.32220 ? 3   DG  B H21    1 
ATOM   2299 H H22    . DG  B 2 3   ? 89.23308  16.99807  31.64098  1.000 33.32220 ? 3   DG  B H22    1 
ATOM   2300 P P      . DT  B 2 4   ? 89.05583  9.11215   30.99787  1.000 24.88608 ? 4   DT  B P      1 
ATOM   2301 O OP1    . DT  B 2 4   ? 87.67086  8.59960   31.07449  1.000 23.03962 ? 4   DT  B OP1    1 
ATOM   2302 O OP2    . DT  B 2 4   ? 90.17926  8.20686   30.65816  1.000 24.06969 ? 4   DT  B OP2    1 
ATOM   2303 O "O5'"  . DT  B 2 4   ? 89.06813  10.31376  29.95080  1.000 25.34357 ? 4   DT  B "O5'"  1 
ATOM   2304 C "C5'"  . DT  B 2 4   ? 88.13526  11.37763  30.08141  1.000 22.49448 ? 4   DT  B "C5'"  1 
ATOM   2305 C "C4'"  . DT  B 2 4   ? 88.35686  12.41579  29.00080  1.000 20.20007 ? 4   DT  B "C4'"  1 
ATOM   2306 O "O4'"  . DT  B 2 4   ? 89.58673  13.14983  29.27411  1.000 20.06060 ? 4   DT  B "O4'"  1 
ATOM   2307 C "C3'"  . DT  B 2 4   ? 88.52711  11.85641  27.58222  1.000 17.26871 ? 4   DT  B "C3'"  1 
ATOM   2308 O "O3'"  . DT  B 2 4   ? 87.85358  12.68576  26.64102  1.000 16.45020 ? 4   DT  B "O3'"  1 
ATOM   2309 C "C2'"  . DT  B 2 4   ? 90.03186  11.89959  27.39547  1.000 16.69896 ? 4   DT  B "C2'"  1 
ATOM   2310 C "C1'"  . DT  B 2 4   ? 90.32919  13.21422  28.08279  1.000 18.60286 ? 4   DT  B "C1'"  1 
ATOM   2311 N N1     . DT  B 2 4   ? 91.75481  13.48363  28.40245  1.000 19.86054 ? 4   DT  B N1     1 
ATOM   2312 C C2     . DT  B 2 4   ? 92.16608  14.79122  28.48335  1.000 20.05116 ? 4   DT  B C2     1 
ATOM   2313 O O2     . DT  B 2 4   ? 91.41469  15.73698  28.30308  1.000 19.41990 ? 4   DT  B O2     1 
ATOM   2314 N N3     . DT  B 2 4   ? 93.48851  14.95876  28.78478  1.000 20.37098 ? 4   DT  B N3     1 
ATOM   2315 C C4     . DT  B 2 4   ? 94.41939  13.97112  29.01081  1.000 22.69736 ? 4   DT  B C4     1 
ATOM   2316 O O4     . DT  B 2 4   ? 95.59003  14.22533  29.27441  1.000 26.13187 ? 4   DT  B O4     1 
ATOM   2317 C C5     . DT  B 2 4   ? 93.92189  12.61723  28.91598  1.000 21.18351 ? 4   DT  B C5     1 
ATOM   2318 C C7     . DT  B 2 4   ? 94.84185  11.45611  29.14754  1.000 19.92918 ? 4   DT  B C7     1 
ATOM   2319 C C6     . DT  B 2 4   ? 92.62753  12.44070  28.61810  1.000 20.73012 ? 4   DT  B C6     1 
ATOM   2320 H "H5'"  . DT  B 2 4   ? 88.24186  11.79267  30.95163  1.000 26.99337 ? 4   DT  B "H5'"  1 
ATOM   2321 H "H5''" . DT  B 2 4   ? 87.23453  11.02525  30.00779  1.000 26.99337 ? 4   DT  B "H5''" 1 
ATOM   2322 H "H4'"  . DT  B 2 4   ? 87.60997  13.03467  29.00735  1.000 24.24009 ? 4   DT  B "H4'"  1 
ATOM   2323 H "H3'"  . DT  B 2 4   ? 88.19909  10.94512  27.52878  1.000 20.72245 ? 4   DT  B "H3'"  1 
ATOM   2324 H "H2'"  . DT  B 2 4   ? 90.47431  11.15342  27.82948  1.000 20.03876 ? 4   DT  B "H2'"  1 
ATOM   2325 H "H2''" . DT  B 2 4   ? 90.28234  11.91364  26.45847  1.000 20.03876 ? 4   DT  B "H2''" 1 
ATOM   2326 H "H1'"  . DT  B 2 4   ? 90.03530  13.94762  27.52007  1.000 22.32343 ? 4   DT  B "H1'"  1 
ATOM   2327 H H3     . DT  B 2 4   ? 93.76940  15.76978  28.83910  1.000 24.44518 ? 4   DT  B H3     1 
ATOM   2328 H H71    . DT  B 2 4   ? 95.74068  11.78980  29.29471  1.000 23.91502 ? 4   DT  B H71    1 
ATOM   2329 H H72    . DT  B 2 4   ? 94.53975  10.96444  29.92722  1.000 23.91502 ? 4   DT  B H72    1 
ATOM   2330 H H73    . DT  B 2 4   ? 94.82641  10.88042  28.36700  1.000 23.91502 ? 4   DT  B H73    1 
ATOM   2331 H H6     . DT  B 2 4   ? 92.30284  11.57160  28.55389  1.000 24.87615 ? 4   DT  B H6     1 
ATOM   2332 P P      . DA  B 2 5   ? 86.64214  12.12338  25.74789  1.000 15.52747 ? 5   DA  B P      1 
ATOM   2333 O OP1    . DA  B 2 5   ? 85.76630  11.35467  26.66059  1.000 13.87985 ? 5   DA  B OP1    1 
ATOM   2334 O OP2    . DA  B 2 5   ? 87.18090  11.48902  24.52233  1.000 13.63289 ? 5   DA  B OP2    1 
ATOM   2335 O "O5'"  . DA  B 2 5   ? 85.91657  13.45855  25.25390  1.000 16.85413 ? 5   DA  B "O5'"  1 
ATOM   2336 C "C5'"  . DA  B 2 5   ? 85.45828  14.40310  26.20674  1.000 16.09572 ? 5   DA  B "C5'"  1 
ATOM   2337 C "C4'"  . DA  B 2 5   ? 85.78509  15.82671  25.77837  1.000 14.75972 ? 5   DA  B "C4'"  1 
ATOM   2338 O "O4'"  . DA  B 2 5   ? 87.20387  16.08417  25.96604  1.000 15.33354 ? 5   DA  B "O4'"  1 
ATOM   2339 C "C3'"  . DA  B 2 5   ? 85.50791  16.14925  24.31718  1.000 13.16307 ? 5   DA  B "C3'"  1 
ATOM   2340 O "O3'"  . DA  B 2 5   ? 85.09738  17.50390  24.18812  1.000 12.07032 ? 5   DA  B "O3'"  1 
ATOM   2341 C "C2'"  . DA  B 2 5   ? 86.85113  15.87859  23.65110  1.000 14.10433 ? 5   DA  B "C2'"  1 
ATOM   2342 C "C1'"  . DA  B 2 5   ? 87.82895  16.33797  24.71799  1.000 14.21562 ? 5   DA  B "C1'"  1 
ATOM   2343 N N9     . DA  B 2 5   ? 89.09497  15.64114  24.72463  1.000 14.80620 ? 5   DA  B N9     1 
ATOM   2344 C C8     . DA  B 2 5   ? 89.30106  14.29975  24.57104  1.000 16.08635 ? 5   DA  B C8     1 
ATOM   2345 N N7     . DA  B 2 5   ? 90.56118  13.94478  24.66655  1.000 16.70525 ? 5   DA  B N7     1 
ATOM   2346 C C5     . DA  B 2 5   ? 91.21957  15.13652  24.91951  1.000 15.79320 ? 5   DA  B C5     1 
ATOM   2347 C C6     . DA  B 2 5   ? 92.57331  15.44309  25.12811  1.000 15.35840 ? 5   DA  B C6     1 
ATOM   2348 N N6     . DA  B 2 5   ? 93.54217  14.52463  25.10660  1.000 16.35082 ? 5   DA  B N6     1 
ATOM   2349 N N1     . DA  B 2 5   ? 92.89603  16.73259  25.35796  1.000 14.74586 ? 5   DA  B N1     1 
ATOM   2350 C C2     . DA  B 2 5   ? 91.92432  17.64609  25.37306  1.000 15.45224 ? 5   DA  B C2     1 
ATOM   2351 N N3     . DA  B 2 5   ? 90.61579  17.47848  25.19265  1.000 16.94390 ? 5   DA  B N3     1 
ATOM   2352 C C4     . DA  B 2 5   ? 90.32783  16.18789  24.96856  1.000 16.06208 ? 5   DA  B C4     1 
ATOM   2353 H "H5'"  . DA  B 2 5   ? 85.88154  14.22345  27.06083  1.000 19.31486 ? 5   DA  B "H5'"  1 
ATOM   2354 H "H5''" . DA  B 2 5   ? 84.49745  14.31389  26.30547  1.000 19.31486 ? 5   DA  B "H5''" 1 
ATOM   2355 H "H4'"  . DA  B 2 5   ? 85.27781  16.43767  26.33542  1.000 17.71167 ? 5   DA  B "H4'"  1 
ATOM   2356 H "H3'"  . DA  B 2 5   ? 84.83309  15.55572  23.95216  1.000 15.79568 ? 5   DA  B "H3'"  1 
ATOM   2357 H "H2'"  . DA  B 2 5   ? 86.96342  14.93655  23.44898  1.000 16.92520 ? 5   DA  B "H2'"  1 
ATOM   2358 H "H2''" . DA  B 2 5   ? 86.95140  16.39110  22.83368  1.000 16.92520 ? 5   DA  B "H2''" 1 
ATOM   2359 H "H1'"  . DA  B 2 5   ? 87.98663  17.28729  24.59623  1.000 17.05874 ? 5   DA  B "H1'"  1 
ATOM   2360 H H8     . DA  B 2 5   ? 88.61287  13.69438  24.41350  1.000 19.30362 ? 5   DA  B H8     1 
ATOM   2361 H H61    . DA  B 2 5   ? 93.34913  13.69931  24.96109  1.000 19.62098 ? 5   DA  B H61    1 
ATOM   2362 H H62    . DA  B 2 5   ? 94.35926  14.75838  25.23826  1.000 19.62098 ? 5   DA  B H62    1 
ATOM   2363 H H2     . DA  B 2 5   ? 92.19848  18.52054  25.53140  1.000 18.54269 ? 5   DA  B H2     1 
ATOM   2364 P P      . DA  B 2 6   ? 84.78604  18.12588  22.74415  1.000 12.64631 ? 6   DA  B P      1 
ATOM   2365 O OP1    . DA  B 2 6   ? 83.73743  19.15033  22.93272  1.000 12.92662 ? 6   DA  B OP1    1 
ATOM   2366 O OP2    . DA  B 2 6   ? 84.56780  17.00186  21.80644  1.000 13.02724 ? 6   DA  B OP2    1 
ATOM   2367 O "O5'"  . DA  B 2 6   ? 86.15114  18.85372  22.34529  1.000 12.75361 ? 6   DA  B "O5'"  1 
ATOM   2368 C "C5'"  . DA  B 2 6   ? 86.61519  19.93617  23.13715  1.000 13.23748 ? 6   DA  B "C5'"  1 
ATOM   2369 C "C4'"  . DA  B 2 6   ? 87.91124  20.50819  22.59154  1.000 13.12786 ? 6   DA  B "C4'"  1 
ATOM   2370 O "O4'"  . DA  B 2 6   ? 88.99385  19.57481  22.84389  1.000 14.11330 ? 6   DA  B "O4'"  1 
ATOM   2371 C "C3'"  . DA  B 2 6   ? 87.91583  20.78576  21.08900  1.000 13.12922 ? 6   DA  B "C3'"  1 
ATOM   2372 O "O3'"  . DA  B 2 6   ? 88.30805  22.13986  20.85046  1.000 12.80587 ? 6   DA  B "O3'"  1 
ATOM   2373 C "C2'"  . DA  B 2 6   ? 88.90848  19.76413  20.52082  1.000 14.11520 ? 6   DA  B "C2'"  1 
ATOM   2374 C "C1'"  . DA  B 2 6   ? 89.81177  19.46552  21.70708  1.000 14.32244 ? 6   DA  B "C1'"  1 
ATOM   2375 N N9     . DA  B 2 6   ? 90.41216  18.12780  21.69691  1.000 15.35631 ? 6   DA  B N9     1 
ATOM   2376 C C8     . DA  B 2 6   ? 89.76508  16.93743  21.52599  1.000 15.84263 ? 6   DA  B C8     1 
ATOM   2377 N N7     . DA  B 2 6   ? 90.55560  15.89418  21.57017  1.000 16.17173 ? 6   DA  B N7     1 
ATOM   2378 C C5     . DA  B 2 6   ? 91.80958  16.43379  21.79684  1.000 15.93002 ? 6   DA  B C5     1 
ATOM   2379 C C6     . DA  B 2 6   ? 93.08452  15.84632  21.94760  1.000 16.57201 ? 6   DA  B C6     1 
ATOM   2380 N N6     . DA  B 2 6   ? 93.30152  14.52490  21.89368  1.000 15.51667 ? 6   DA  B N6     1 
ATOM   2381 N N1     . DA  B 2 6   ? 94.13084  16.67286  22.16385  1.000 15.63953 ? 6   DA  B N1     1 
ATOM   2382 C C2     . DA  B 2 6   ? 93.90981  17.98761  22.22023  1.000 15.20236 ? 6   DA  B C2     1 
ATOM   2383 N N3     . DA  B 2 6   ? 92.76106  18.65322  22.09352  1.000 15.98863 ? 6   DA  B N3     1 
ATOM   2384 C C4     . DA  B 2 6   ? 91.74027  17.80894  21.88353  1.000 15.48388 ? 6   DA  B C4     1 
ATOM   2385 H "H5'"  . DA  B 2 6   ? 86.76272  19.62528  24.04406  1.000 15.88498 ? 6   DA  B "H5'"  1 
ATOM   2386 H "H5''" . DA  B 2 6   ? 85.94068  20.63317  23.14804  1.000 15.88498 ? 6   DA  B "H5''" 1 
ATOM   2387 H "H4'"  . DA  B 2 6   ? 88.11333  21.33810  23.05122  1.000 15.75343 ? 6   DA  B "H4'"  1 
ATOM   2388 H "H3'"  . DA  B 2 6   ? 87.04064  20.60999  20.70947  1.000 15.75507 ? 6   DA  B "H3'"  1 
ATOM   2389 H "H2'"  . DA  B 2 6   ? 88.45229  18.96361  20.21757  1.000 16.93824 ? 6   DA  B "H2'"  1 
ATOM   2390 H "H2''" . DA  B 2 6   ? 89.41289  20.13920  19.78204  1.000 16.93824 ? 6   DA  B "H2''" 1 
ATOM   2391 H "H1'"  . DA  B 2 6   ? 90.52429  20.12297  21.73833  1.000 17.18692 ? 6   DA  B "H1'"  1 
ATOM   2392 H H8     . DA  B 2 6   ? 88.84721  16.87345  21.39063  1.000 19.01116 ? 6   DA  B H8     1 
ATOM   2393 H H61    . DA  B 2 6   ? 92.64500  13.98656  21.75668  1.000 18.62000 ? 6   DA  B H61    1 
ATOM   2394 H H62    . DA  B 2 6   ? 94.09730  14.21529  21.99607  1.000 18.62000 ? 6   DA  B H62    1 
ATOM   2395 H H2     . DA  B 2 6   ? 94.66232  18.51352  22.36869  1.000 18.24283 ? 6   DA  B H2     1 
ATOM   2396 P P      . DT  B 2 7   ? 88.41120  22.72541  19.36045  1.000 11.67476 ? 7   DT  B P      1 
ATOM   2397 O OP1    . DT  B 2 7   ? 88.29901  24.19674  19.48134  1.000 13.13063 ? 7   DT  B OP1    1 
ATOM   2398 O OP2    . DT  B 2 7   ? 87.41622  22.01887  18.51888  1.000 12.89006 ? 7   DT  B OP2    1 
ATOM   2399 O "O5'"  . DT  B 2 7   ? 89.91284  22.35389  18.91444  1.000 9.39956  ? 7   DT  B "O5'"  1 
ATOM   2400 C "C5'"  . DT  B 2 7   ? 91.00727  22.87393  19.66861  1.000 10.90142 ? 7   DT  B "C5'"  1 
ATOM   2401 C "C4'"  . DT  B 2 7   ? 92.34809  22.30743  19.21935  1.000 14.03646 ? 7   DT  B "C4'"  1 
ATOM   2402 O "O4'"  . DT  B 2 7   ? 92.43700  20.91034  19.55037  1.000 15.97006 ? 7   DT  B "O4'"  1 
ATOM   2403 C "C3'"  . DT  B 2 7   ? 92.62079  22.37563  17.72104  1.000 17.46038 ? 7   DT  B "C3'"  1 
ATOM   2404 O "O3'"  . DT  B 2 7   ? 93.45814  23.46593  17.42697  1.000 20.83194 ? 7   DT  B "O3'"  1 
ATOM   2405 C "C2'"  . DT  B 2 7   ? 93.29179  21.03147  17.37933  1.000 17.14823 ? 7   DT  B "C2'"  1 
ATOM   2406 C "C1'"  . DT  B 2 7   ? 93.42766  20.34436  18.72971  1.000 16.50910 ? 7   DT  B "C1'"  1 
ATOM   2407 N N1     . DT  B 2 7   ? 93.23740  18.88340  18.68592  1.000 17.05008 ? 7   DT  B N1     1 
ATOM   2408 C C2     . DT  B 2 7   ? 94.33061  18.07027  18.84949  1.000 18.18543 ? 7   DT  B C2     1 
ATOM   2409 O O2     . DT  B 2 7   ? 95.46575  18.49618  19.01471  1.000 19.29875 ? 7   DT  B O2     1 
ATOM   2410 N N3     . DT  B 2 7   ? 94.05502  16.73235  18.80137  1.000 16.42615 ? 7   DT  B N3     1 
ATOM   2411 C C4     . DT  B 2 7   ? 92.82507  16.13819  18.61785  1.000 15.19294 ? 7   DT  B C4     1 
ATOM   2412 O O4     . DT  B 2 7   ? 92.68738  14.92050  18.59002  1.000 15.07454 ? 7   DT  B O4     1 
ATOM   2413 C C5     . DT  B 2 7   ? 91.71535  17.04549  18.45802  1.000 15.61693 ? 7   DT  B C5     1 
ATOM   2414 C C7     . DT  B 2 7   ? 90.32787  16.50702  18.24908  1.000 15.04990 ? 7   DT  B C7     1 
ATOM   2415 C C6     . DT  B 2 7   ? 91.96913  18.36336  18.50213  1.000 16.26727 ? 7   DT  B C6     1 
ATOM   2416 H "H5'"  . DT  B 2 7   ? 90.87361  22.65634  20.60440  1.000 13.08170 ? 7   DT  B "H5'"  1 
ATOM   2417 H "H5''" . DT  B 2 7   ? 91.02590  23.83854  19.56822  1.000 13.08170 ? 7   DT  B "H5''" 1 
ATOM   2418 H "H4'"  . DT  B 2 7   ? 93.04679  22.78596  19.69235  1.000 16.84375 ? 7   DT  B "H4'"  1 
ATOM   2419 H "H3'"  . DT  B 2 7   ? 91.77689  22.44050  17.24720  1.000 20.95245 ? 7   DT  B "H3'"  1 
ATOM   2420 H "H2'"  . DT  B 2 7   ? 92.73877  20.50945  16.77719  1.000 20.57787 ? 7   DT  B "H2'"  1 
ATOM   2421 H "H2''" . DT  B 2 7   ? 94.16033  21.17001  16.97026  1.000 20.57787 ? 7   DT  B "H2''" 1 
ATOM   2422 H "H1'"  . DT  B 2 7   ? 94.30435  20.52928  19.10136  1.000 19.81092 ? 7   DT  B "H1'"  1 
ATOM   2423 H H3     . DT  B 2 7   ? 94.72477  16.20130  18.89634  1.000 19.71138 ? 7   DT  B H3     1 
ATOM   2424 H H71    . DT  B 2 7   ? 90.31685  15.56475  18.47910  1.000 18.05988 ? 7   DT  B H71    1 
ATOM   2425 H H72    . DT  B 2 7   ? 89.71124  16.99366  18.81815  1.000 18.05988 ? 7   DT  B H72    1 
ATOM   2426 H H73    . DT  B 2 7   ? 90.08088  16.62320  17.31828  1.000 18.05988 ? 7   DT  B H73    1 
ATOM   2427 H H6     . DT  B 2 7   ? 91.25803  18.95469  18.40441  1.000 19.52072 ? 7   DT  B H6     1 
ATOM   2428 P P      . DC  B 2 8   ? 93.72186  23.86735  15.90010  1.000 24.26986 ? 8   DC  B P      1 
ATOM   2429 O OP1    . DC  B 2 8   ? 94.04929  25.31029  15.86489  1.000 26.67817 ? 8   DC  B OP1    1 
ATOM   2430 O OP2    . DC  B 2 8   ? 92.57694  23.34003  15.12070  1.000 25.90920 ? 8   DC  B OP2    1 
ATOM   2431 O "O5'"  . DC  B 2 8   ? 95.01117  23.01577  15.50929  1.000 22.86839 ? 8   DC  B "O5'"  1 
ATOM   2432 C "C5'"  . DC  B 2 8   ? 96.16866  23.06966  16.32700  1.000 21.95415 ? 8   DC  B "C5'"  1 
ATOM   2433 C "C4'"  . DC  B 2 8   ? 97.17056  22.01390  15.90857  1.000 21.69425 ? 8   DC  B "C4'"  1 
ATOM   2434 O "O4'"  . DC  B 2 8   ? 96.76996  20.74413  16.44630  1.000 20.74765 ? 8   DC  B "O4'"  1 
ATOM   2435 C "C3'"  . DC  B 2 8   ? 97.27520  21.79453  14.40584  1.000 23.48070 ? 8   DC  B "C3'"  1 
ATOM   2436 O "O3'"  . DC  B 2 8   ? 98.31972  22.57548  13.84539  1.000 25.67536 ? 8   DC  B "O3'"  1 
ATOM   2437 C "C2'"  . DC  B 2 8   ? 97.53647  20.29241  14.25718  1.000 22.70622 ? 8   DC  B "C2'"  1 
ATOM   2438 C "C1'"  . DC  B 2 8   ? 97.29644  19.71405  15.64588  1.000 21.54665 ? 8   DC  B "C1'"  1 
ATOM   2439 N N1     . DC  B 2 8   ? 96.34701  18.57864  15.67064  1.000 22.11587 ? 8   DC  B N1     1 
ATOM   2440 C C2     . DC  B 2 8   ? 96.83914  17.27671  15.72082  1.000 22.11033 ? 8   DC  B C2     1 
ATOM   2441 O O2     . DC  B 2 8   ? 98.05961  17.10341  15.72041  1.000 23.13507 ? 8   DC  B O2     1 
ATOM   2442 N N3     . DC  B 2 8   ? 95.96490  16.24356  15.76149  1.000 21.65199 ? 8   DC  B N3     1 
ATOM   2443 C C4     . DC  B 2 8   ? 94.65301  16.47903  15.75972  1.000 22.82833 ? 8   DC  B C4     1 
ATOM   2444 N N4     . DC  B 2 8   ? 93.82890  15.42820  15.80222  1.000 22.63094 ? 8   DC  B N4     1 
ATOM   2445 C C5     . DC  B 2 8   ? 94.12786  17.80437  15.71676  1.000 24.27088 ? 8   DC  B C5     1 
ATOM   2446 C C6     . DC  B 2 8   ? 95.00503  18.81590  15.67882  1.000 23.89799 ? 8   DC  B C6     1 
ATOM   2447 H "H5'"  . DC  B 2 8   ? 95.91473  22.92148  17.25137  1.000 26.34498 ? 8   DC  B "H5'"  1 
ATOM   2448 H "H5''" . DC  B 2 8   ? 96.57583  23.94652  16.24802  1.000 26.34498 ? 8   DC  B "H5''" 1 
ATOM   2449 H "H4'"  . DC  B 2 8   ? 98.04453  22.24843  16.25796  1.000 26.03310 ? 8   DC  B "H4'"  1 
ATOM   2450 H "H3'"  . DC  B 2 8   ? 96.42542  22.01898  13.99546  1.000 28.17684 ? 8   DC  B "H3'"  1 
ATOM   2451 H "H2'"  . DC  B 2 8   ? 96.92755  19.90020  13.61196  1.000 27.24746 ? 8   DC  B "H2'"  1 
ATOM   2452 H "H2''" . DC  B 2 8   ? 98.44860  20.12930  13.97028  1.000 27.24746 ? 8   DC  B "H2''" 1 
ATOM   2453 H "H1'"  . DC  B 2 8   ? 98.14973  19.43285  16.01156  1.000 25.85598 ? 8   DC  B "H1'"  1 
ATOM   2454 H H41    . DC  B 2 8   ? 94.14990  14.63082  15.82956  1.000 27.15713 ? 8   DC  B H41    1 
ATOM   2455 H H42    . DC  B 2 8   ? 92.97746  15.54921  15.80223  1.000 27.15713 ? 8   DC  B H42    1 
ATOM   2456 H H5     . DC  B 2 8   ? 93.21103  17.96035  15.71516  1.000 29.12505 ? 8   DC  B H5     1 
ATOM   2457 H H6     . DC  B 2 8   ? 94.69405  19.69211  15.65777  1.000 28.67759 ? 8   DC  B H6     1 
ATOM   2458 P P      . DT  B 2 9   ? 98.59670  22.50119  12.26577  1.000 27.35271 ? 9   DT  B P      1 
ATOM   2459 O OP1    . DT  B 2 9   ? 99.40232  23.68157  11.88233  1.000 29.04584 ? 9   DT  B OP1    1 
ATOM   2460 O OP2    . DT  B 2 9   ? 97.28584  22.24507  11.61858  1.000 24.85682 ? 9   DT  B OP2    1 
ATOM   2461 O "O5'"  . DT  B 2 9   ? 99.50063  21.18675  12.08863  1.000 27.16336 ? 9   DT  B "O5'"  1 
ATOM   2462 C "C5'"  . DT  B 2 9   ? 100.69092 21.03033  12.85082  1.000 26.42014 ? 9   DT  B "C5'"  1 
ATOM   2463 C "C4'"  . DT  B 2 9   ? 101.44547 19.77900  12.43836  1.000 27.13396 ? 9   DT  B "C4'"  1 
ATOM   2464 O "O4'"  . DT  B 2 9   ? 100.66806 18.59842  12.78541  1.000 26.66694 ? 9   DT  B "O4'"  1 
ATOM   2465 C "C3'"  . DT  B 2 9   ? 101.73405 19.66581  10.94585  1.000 29.24150 ? 9   DT  B "C3'"  1 
ATOM   2466 O "O3'"  . DT  B 2 9   ? 103.04113 19.12165  10.73340  1.000 32.94852 ? 9   DT  B "O3'"  1 
ATOM   2467 C "C2'"  . DT  B 2 9   ? 100.62420 18.74527  10.44363  1.000 27.76698 ? 9   DT  B "C2'"  1 
ATOM   2468 C "C1'"  . DT  B 2 9   ? 100.41189 17.81812  11.62946  1.000 24.84160 ? 9   DT  B "C1'"  1 
ATOM   2469 N N1     . DT  B 2 9   ? 99.03022  17.24437  11.75729  1.000 20.95471 ? 9   DT  B N1     1 
ATOM   2470 C C2     . DT  B 2 9   ? 98.87620  15.88014  11.88933  1.000 20.76730 ? 9   DT  B C2     1 
ATOM   2471 O O2     . DT  B 2 9   ? 99.80610  15.09318  11.86568  1.000 20.44654 ? 9   DT  B O2     1 
ATOM   2472 N N3     . DT  B 2 9   ? 97.57970  15.46210  12.03692  1.000 21.11253 ? 9   DT  B N3     1 
ATOM   2473 C C4     . DT  B 2 9   ? 96.44842  16.24781  12.07666  1.000 20.98845 ? 9   DT  B C4     1 
ATOM   2474 O O4     . DT  B 2 9   ? 95.32714  15.77745  12.21484  1.000 21.43643 ? 9   DT  B O4     1 
ATOM   2475 C C5     . DT  B 2 9   ? 96.67369  17.66193  11.94458  1.000 20.82819 ? 9   DT  B C5     1 
ATOM   2476 C C7     . DT  B 2 9   ? 95.50822  18.60333  11.96895  1.000 20.76563 ? 9   DT  B C7     1 
ATOM   2477 C C6     . DT  B 2 9   ? 97.94091  18.09332  11.80092  1.000 20.31422 ? 9   DT  B C6     1 
ATOM   2478 H "H5'"  . DT  B 2 9   ? 100.46100 20.96806  13.79112  1.000 31.70417 ? 9   DT  B "H5'"  1 
ATOM   2479 H "H5''" . DT  B 2 9   ? 101.25973 21.80428  12.71538  1.000 31.70417 ? 9   DT  B "H5''" 1 
ATOM   2480 H "H4'"  . DT  B 2 9   ? 102.28549 19.74430  12.92215  1.000 32.56075 ? 9   DT  B "H4'"  1 
ATOM   2481 H "H3'"  . DT  B 2 9   ? 101.65687 20.53275  10.51764  1.000 35.08980 ? 9   DT  B "H3'"  1 
ATOM   2482 H "H2'"  . DT  B 2 9   ? 99.81840  19.24379  10.23608  1.000 33.32038 ? 9   DT  B "H2'"  1 
ATOM   2483 H "H2''" . DT  B 2 9   ? 100.90282 18.25306  9.65560   1.000 33.32038 ? 9   DT  B "H2''" 1 
ATOM   2484 H "H1'"  . DT  B 2 9   ? 101.04385 17.08539  11.56134  1.000 29.80992 ? 9   DT  B "H1'"  1 
ATOM   2485 H H3     . DT  B 2 9   ? 97.45839  14.61413  12.11333  1.000 25.33504 ? 9   DT  B H3     1 
ATOM   2486 H H71    . DT  B 2 9   ? 94.78155  18.21970  11.45350  1.000 24.91876 ? 9   DT  B H71    1 
ATOM   2487 H H72    . DT  B 2 9   ? 95.22804  18.73531  12.88818  1.000 24.91876 ? 9   DT  B H72    1 
ATOM   2488 H H73    . DT  B 2 9   ? 95.77815  19.45021  11.58059  1.000 24.91876 ? 9   DT  B H73    1 
ATOM   2489 H H6     . DT  B 2 9   ? 98.09054  19.00825  11.72740  1.000 24.37706 ? 9   DT  B H6     1 
ATOM   2490 P P      . DA  B 2 10  ? 103.75830 19.22975  9.29811   1.000 34.25904 ? 10  DA  B P      1 
ATOM   2491 O OP1    . DA  B 2 10  ? 105.19949 19.45940  9.55209   1.000 34.13586 ? 10  DA  B OP1    1 
ATOM   2492 O OP2    . DA  B 2 10  ? 102.98168 20.16999  8.45846   1.000 34.24884 ? 10  DA  B OP2    1 
ATOM   2493 O "O5'"  . DA  B 2 10  ? 103.57852 17.76796  8.68373   1.000 33.77514 ? 10  DA  B "O5'"  1 
ATOM   2494 C "C5'"  . DA  B 2 10  ? 104.02054 16.64436  9.42363   1.000 32.64452 ? 10  DA  B "C5'"  1 
ATOM   2495 C "C4'"  . DA  B 2 10  ? 103.68021 15.35097  8.71071   1.000 31.30263 ? 10  DA  B "C4'"  1 
ATOM   2496 O "O4'"  . DA  B 2 10  ? 102.32343 14.96853  9.04383   1.000 30.29803 ? 10  DA  B "O4'"  1 
ATOM   2497 C "C3'"  . DA  B 2 10  ? 103.76366 15.41243  7.18393   1.000 31.36091 ? 10  DA  B "C3'"  1 
ATOM   2498 O "O3'"  . DA  B 2 10  ? 104.56741 14.33357  6.69400   1.000 33.06279 ? 10  DA  B "O3'"  1 
ATOM   2499 C "C2'"  . DA  B 2 10  ? 102.30387 15.33875  6.71628   1.000 30.34174 ? 10  DA  B "C2'"  1 
ATOM   2500 C "C1'"  . DA  B 2 10  ? 101.58726 14.66108  7.87937   1.000 29.62390 ? 10  DA  B "C1'"  1 
ATOM   2501 N N9     . DA  B 2 10  ? 100.21381 15.11246  8.09780   1.000 27.89767 ? 10  DA  B N9     1 
ATOM   2502 C C8     . DA  B 2 10  ? 99.76140  16.40433  8.11085   1.000 27.28682 ? 10  DA  B C8     1 
ATOM   2503 N N7     . DA  B 2 10  ? 98.47938  16.51397  8.36385   1.000 27.25495 ? 10  DA  B N7     1 
ATOM   2504 C C5     . DA  B 2 10  ? 98.06313  15.20487  8.54346   1.000 27.17060 ? 10  DA  B C5     1 
ATOM   2505 C C6     . DA  B 2 10  ? 96.80786  14.64207  8.84512   1.000 25.35026 ? 10  DA  B C6     1 
ATOM   2506 N N6     . DA  B 2 10  ? 95.70064  15.36724  9.01793   1.000 24.68696 ? 10  DA  B N6     1 
ATOM   2507 N N1     . DA  B 2 10  ? 96.73429  13.30041  8.95589   1.000 24.53062 ? 10  DA  B N1     1 
ATOM   2508 C C2     . DA  B 2 10  ? 97.84365  12.57725  8.77728   1.000 24.88656 ? 10  DA  B C2     1 
ATOM   2509 N N3     . DA  B 2 10  ? 99.07893  12.99226  8.49377   1.000 26.37951 ? 10  DA  B N3     1 
ATOM   2510 C C4     . DA  B 2 10  ? 99.12089  14.32888  8.39053   1.000 27.17427 ? 10  DA  B C4     1 
ATOM   2511 H "H5'"  . DA  B 2 10  ? 103.59430 16.64925  10.29495  1.000 39.17342 ? 10  DA  B "H5'"  1 
ATOM   2512 H "H5''" . DA  B 2 10  ? 104.98173 16.69922  9.54197   1.000 39.17342 ? 10  DA  B "H5''" 1 
ATOM   2513 H "H4'"  . DA  B 2 10  ? 104.27499 14.64658  9.01234   1.000 37.56316 ? 10  DA  B "H4'"  1 
ATOM   2514 H "H3'"  . DA  B 2 10  ? 104.13140 16.26549  6.90471   1.000 37.63309 ? 10  DA  B "H3'"  1 
ATOM   2515 H "H2'"  . DA  B 2 10  ? 101.94475 16.22529  6.55507   1.000 36.41009 ? 10  DA  B "H2'"  1 
ATOM   2516 H "H2''" . DA  B 2 10  ? 102.22436 14.81343  5.90473   1.000 36.41009 ? 10  DA  B "H2''" 1 
ATOM   2517 H "H1'"  . DA  B 2 10  ? 101.59056 13.70424  7.72012   1.000 35.54868 ? 10  DA  B "H1'"  1 
ATOM   2518 H H8     . DA  B 2 10  ? 100.31258 17.13693  7.95465   1.000 32.74418 ? 10  DA  B H8     1 
ATOM   2519 H H61    . DA  B 2 10  ? 95.73280  16.22397  8.95020   1.000 29.62435 ? 10  DA  B H61    1 
ATOM   2520 H H62    . DA  B 2 10  ? 94.95510  14.97774  9.19698   1.000 29.62435 ? 10  DA  B H62    1 
ATOM   2521 H H2     . DA  B 2 10  ? 97.73995  11.65698  8.86249   1.000 29.86388 ? 10  DA  B H2     1 
ATOM   2522 P P      . DA  B 2 11  ? 104.73375 14.07700  5.11779   1.000 34.87284 ? 11  DA  B P      1 
ATOM   2523 O OP1    . DA  B 2 11  ? 106.03862 13.41757  4.91049   1.000 35.93967 ? 11  DA  B OP1    1 
ATOM   2524 O OP2    . DA  B 2 11  ? 104.42886 15.33759  4.40677   1.000 36.16791 ? 11  DA  B OP2    1 
ATOM   2525 O "O5'"  . DA  B 2 11  ? 103.58472 13.01235  4.79631   1.000 34.23227 ? 11  DA  B "O5'"  1 
ATOM   2526 C "C5'"  . DA  B 2 11  ? 103.49626 11.83088  5.57212   1.000 31.77525 ? 11  DA  B "C5'"  1 
ATOM   2527 C "C4'"  . DA  B 2 11  ? 102.19722 11.09573  5.31352   1.000 30.41595 ? 11  DA  B "C4'"  1 
ATOM   2528 O "O4'"  . DA  B 2 11  ? 101.08382 11.90000  5.75928   1.000 29.79515 ? 11  DA  B "O4'"  1 
ATOM   2529 C "C3'"  . DA  B 2 11  ? 101.91530 10.76804  3.84381   1.000 31.30175 ? 11  DA  B "C3'"  1 
ATOM   2530 O "O3'"  . DA  B 2 11  ? 101.94014 9.35350   3.65185   1.000 32.79123 ? 11  DA  B "O3'"  1 
ATOM   2531 C "C2'"  . DA  B 2 11  ? 100.52629 11.38620  3.56633   1.000 30.47152 ? 11  DA  B "C2'"  1 
ATOM   2532 C "C1'"  . DA  B 2 11  ? 99.96467  11.59324  4.96294   1.000 28.72148 ? 11  DA  B "C1'"  1 
ATOM   2533 N N9     . DA  B 2 11  ? 98.99948  12.68131  5.10475   1.000 25.57356 ? 11  DA  B N9     1 
ATOM   2534 C C8     . DA  B 2 11  ? 99.25371  14.02079  5.00697   1.000 24.12009 ? 11  DA  B C8     1 
ATOM   2535 N N7     . DA  B 2 11  ? 98.20183  14.77857  5.22113   1.000 23.45797 ? 11  DA  B N7     1 
ATOM   2536 C C5     . DA  B 2 11  ? 97.19230  13.87506  5.49795   1.000 23.02016 ? 11  DA  B C5     1 
ATOM   2537 C C6     . DA  B 2 11  ? 95.82988  14.04453  5.81088   1.000 20.86636 ? 11  DA  B C6     1 
ATOM   2538 N N6     . DA  B 2 11  ? 95.24171  15.23971  5.90356   1.000 20.52372 ? 11  DA  B N6     1 
ATOM   2539 N N1     . DA  B 2 11  ? 95.09658  12.93667  6.03509   1.000 19.56919 ? 11  DA  B N1     1 
ATOM   2540 C C2     . DA  B 2 11  ? 95.68889  11.74164  5.94444   1.000 20.17059 ? 11  DA  B C2     1 
ATOM   2541 N N3     . DA  B 2 11  ? 96.96085  11.45515  5.65763   1.000 22.15244 ? 11  DA  B N3     1 
ATOM   2542 C C4     . DA  B 2 11  ? 97.66633  12.57699  5.44284   1.000 23.76281 ? 11  DA  B C4     1 
ATOM   2543 H "H5'"  . DA  B 2 11  ? 103.54734 12.06395  6.51232   1.000 38.13030 ? 11  DA  B "H5'"  1 
ATOM   2544 H "H5''" . DA  B 2 11  ? 104.23991 11.24897  5.35016   1.000 38.13030 ? 11  DA  B "H5''" 1 
ATOM   2545 H "H4'"  . DA  B 2 11  ? 102.20109 10.26851  5.82008   1.000 36.49914 ? 11  DA  B "H4'"  1 
ATOM   2546 H "H3'"  . DA  B 2 11  ? 102.56639 11.20705  3.27438   1.000 37.56210 ? 11  DA  B "H3'"  1 
ATOM   2547 H "H2'"  . DA  B 2 11  ? 100.60494 12.22801  3.09086   1.000 36.56583 ? 11  DA  B "H2'"  1 
ATOM   2548 H "H2''" . DA  B 2 11  ? 99.96985  10.78252  3.04976   1.000 36.56583 ? 11  DA  B "H2''" 1 
ATOM   2549 H "H1'"  . DA  B 2 11  ? 99.53255  10.77408  5.25129   1.000 34.46577 ? 11  DA  B "H1'"  1 
ATOM   2550 H H8     . DA  B 2 11  ? 100.09446 14.36444  4.80711   1.000 28.94410 ? 11  DA  B H8     1 
ATOM   2551 H H61    . DA  B 2 11  ? 95.69752  15.95532  5.76307   1.000 24.62847 ? 11  DA  B H61    1 
ATOM   2552 H H62    . DA  B 2 11  ? 94.40709  15.29386  6.10375   1.000 24.62847 ? 11  DA  B H62    1 
ATOM   2553 H H2     . DA  B 2 11  ? 95.13892  11.00866  6.10310   1.000 24.20471 ? 11  DA  B H2     1 
ATOM   2554 P P      . DT  B 2 12  ? 101.87646 8.72692   2.17661   1.000 35.05610 ? 12  DT  B P      1 
ATOM   2555 O OP1    . DT  B 2 12  ? 102.55675 7.41522   2.21977   1.000 35.75458 ? 12  DT  B OP1    1 
ATOM   2556 O OP2    . DT  B 2 12  ? 102.33335 9.76469   1.22302   1.000 36.74573 ? 12  DT  B OP2    1 
ATOM   2557 O "O5'"  . DT  B 2 12  ? 100.31993 8.46713   1.95423   1.000 33.64994 ? 12  DT  B "O5'"  1 
ATOM   2558 C "C5'"  . DT  B 2 12  ? 99.61323  7.71046   2.90902   1.000 33.24082 ? 12  DT  B "C5'"  1 
ATOM   2559 C "C4'"  . DT  B 2 12  ? 98.11833  7.83542   2.71128   1.000 33.36549 ? 12  DT  B "C4'"  1 
ATOM   2560 O "O4'"  . DT  B 2 12  ? 97.68647  9.17641   3.05557   1.000 32.28983 ? 12  DT  B "O4'"  1 
ATOM   2561 C "C3'"  . DT  B 2 12  ? 97.62648  7.59519   1.27511   1.000 34.54890 ? 12  DT  B "C3'"  1 
ATOM   2562 O "O3'"  . DT  B 2 12  ? 96.66282  6.55180   1.26087   1.000 37.78474 ? 12  DT  B "O3'"  1 
ATOM   2563 C "C2'"  . DT  B 2 12  ? 97.02884  8.94029   0.86295   1.000 32.15037 ? 12  DT  B "C2'"  1 
ATOM   2564 C "C1'"  . DT  B 2 12  ? 96.62495  9.51200   2.20591   1.000 30.35561 ? 12  DT  B "C1'"  1 
ATOM   2565 N N1     . DT  B 2 12  ? 96.40584  10.99514  2.23330   1.000 25.93298 ? 12  DT  B N1     1 
ATOM   2566 C C2     . DT  B 2 12  ? 95.17935  11.46822  2.62174   1.000 23.57150 ? 12  DT  B C2     1 
ATOM   2567 O O2     . DT  B 2 12  ? 94.25651  10.74116  2.93852   1.000 21.87213 ? 12  DT  B O2     1 
ATOM   2568 N N3     . DT  B 2 12  ? 95.06335  12.82855  2.62081   1.000 23.91508 ? 12  DT  B N3     1 
ATOM   2569 C C4     . DT  B 2 12  ? 96.03319  13.74755  2.28411   1.000 23.20346 ? 12  DT  B C4     1 
ATOM   2570 O O4     . DT  B 2 12  ? 95.82893  14.95824  2.31796   1.000 23.26963 ? 12  DT  B O4     1 
ATOM   2571 C C5     . DT  B 2 12  ? 97.30007  13.19012  1.88818   1.000 22.10005 ? 12  DT  B C5     1 
ATOM   2572 C C7     . DT  B 2 12  ? 98.42522  14.10030  1.50122   1.000 21.67420 ? 12  DT  B C7     1 
ATOM   2573 C C6     . DT  B 2 12  ? 97.42918  11.85378  1.88240   1.000 23.42014 ? 12  DT  B C6     1 
ATOM   2574 H "H5'"  . DT  B 2 12  ? 99.84377  8.02434   3.79741   1.000 39.88898 ? 12  DT  B "H5'"  1 
ATOM   2575 H "H5''" . DT  B 2 12  ? 99.86788  6.77803   2.82756   1.000 39.88898 ? 12  DT  B "H5''" 1 
ATOM   2576 H "H4'"  . DT  B 2 12  ? 97.67384  7.20748   3.30206   1.000 40.03859 ? 12  DT  B "H4'"  1 
ATOM   2577 H "H3'"  . DT  B 2 12  ? 98.37508  7.38351   0.69572   1.000 41.45868 ? 12  DT  B "H3'"  1 
ATOM   2578 H "H2'"  . DT  B 2 12  ? 97.68420  9.50092   0.41898   1.000 38.58044 ? 12  DT  B "H2'"  1 
ATOM   2579 H "H2''" . DT  B 2 12  ? 96.26297  8.82647   0.27867   1.000 38.58044 ? 12  DT  B "H2''" 1 
ATOM   2580 H "H1'"  . DT  B 2 12  ? 95.79933  9.10190   2.50770   1.000 36.42673 ? 12  DT  B "H1'"  1 
ATOM   2581 H H3     . DT  B 2 12  ? 94.30016  13.14725  2.85657   1.000 28.69810 ? 12  DT  B H3     1 
ATOM   2582 H H71    . DT  B 2 12  ? 98.12075  15.01965  1.55581   1.000 26.00904 ? 12  DT  B H71    1 
ATOM   2583 H H72    . DT  B 2 12  ? 99.16763  13.96103  2.10978   1.000 26.00904 ? 12  DT  B H72    1 
ATOM   2584 H H73    . DT  B 2 12  ? 98.69886  13.89582  0.59336   1.000 26.00904 ? 12  DT  B H73    1 
ATOM   2585 H H6     . DT  B 2 12  ? 98.24656  11.48890  1.63012   1.000 28.10417 ? 12  DT  B H6     1 
ATOM   2586 P P      . DC  B 2 13  ? 96.18394  5.89295   -0.12046  1.000 40.20354 ? 13  DC  B P      1 
ATOM   2587 O OP1    . DC  B 2 13  ? 96.39746  4.43777   0.04723   1.000 41.28645 ? 13  DC  B OP1    1 
ATOM   2588 O OP2    . DC  B 2 13  ? 96.79269  6.62287   -1.25747  1.000 40.42122 ? 13  DC  B OP2    1 
ATOM   2589 O "O5'"  . DC  B 2 13  ? 94.61359  6.17663   -0.14569  1.000 39.56520 ? 13  DC  B "O5'"  1 
ATOM   2590 C "C5'"  . DC  B 2 13  ? 93.80919  5.67645   0.89941   1.000 39.35180 ? 13  DC  B "C5'"  1 
ATOM   2591 C "C4'"  . DC  B 2 13  ? 92.48726  6.41117   0.97776   1.000 39.52337 ? 13  DC  B "C4'"  1 
ATOM   2592 O "O4'"  . DC  B 2 13  ? 92.72535  7.83349   1.15852   1.000 39.91360 ? 13  DC  B "O4'"  1 
ATOM   2593 C "C3'"  . DC  B 2 13  ? 91.59667  6.29415   -0.26111  1.000 39.02833 ? 13  DC  B "C3'"  1 
ATOM   2594 O "O3'"  . DC  B 2 13  ? 90.26127  6.04439   0.14847   1.000 38.25398 ? 13  DC  B "O3'"  1 
ATOM   2595 C "C2'"  . DC  B 2 13  ? 91.76158  7.65349   -0.94781  1.000 39.27939 ? 13  DC  B "C2'"  1 
ATOM   2596 C "C1'"  . DC  B 2 13  ? 91.92427  8.56356   0.24803   1.000 39.28243 ? 13  DC  B "C1'"  1 
ATOM   2597 N N1     . DC  B 2 13  ? 92.59427  9.87174   -0.00577  1.000 37.68250 ? 13  DC  B N1     1 
ATOM   2598 C C2     . DC  B 2 13  ? 91.88064  11.05682  0.18943   1.000 37.72993 ? 13  DC  B C2     1 
ATOM   2599 O O2     . DC  B 2 13  ? 90.69058  10.99182  0.51736   1.000 38.37876 ? 13  DC  B O2     1 
ATOM   2600 N N3     . DC  B 2 13  ? 92.50938  12.24018  0.00278   1.000 36.86237 ? 13  DC  B N3     1 
ATOM   2601 C C4     . DC  B 2 13  ? 93.79480  12.26450  -0.34498  1.000 36.27171 ? 13  DC  B C4     1 
ATOM   2602 N N4     . DC  B 2 13  ? 94.37370  13.45931  -0.51994  1.000 35.41660 ? 13  DC  B N4     1 
ATOM   2603 C C5     . DC  B 2 13  ? 94.54378  11.06543  -0.52994  1.000 36.19118 ? 13  DC  B C5     1 
ATOM   2604 C C6     . DC  B 2 13  ? 93.91067  9.90448   -0.34209  1.000 36.46489 ? 13  DC  B C6     1 
ATOM   2605 H "H5'"  . DC  B 2 13  ? 94.28069  5.78039   1.74071   1.000 47.22216 ? 13  DC  B "H5'"  1 
ATOM   2606 H "H5''" . DC  B 2 13  ? 93.63999  4.73363   0.74660   1.000 47.22216 ? 13  DC  B "H5''" 1 
ATOM   2607 H "H4'"  . DC  B 2 13  ? 91.99476  6.07895   1.74455   1.000 47.42804 ? 13  DC  B "H4'"  1 
ATOM   2608 H "H3'"  . DC  B 2 13  ? 91.91337  5.59728   -0.85691  1.000 46.83399 ? 13  DC  B "H3'"  1 
ATOM   2609 H "H2'"  . DC  B 2 13  ? 92.54357  7.67251   -1.52143  1.000 47.13527 ? 13  DC  B "H2'"  1 
ATOM   2610 H "H2''" . DC  B 2 13  ? 90.97962  7.88719   -1.47204  1.000 47.13527 ? 13  DC  B "H2''" 1 
ATOM   2611 H "H1'"  . DC  B 2 13  ? 91.04490  8.75053   0.61225   1.000 47.13892 ? 13  DC  B "H1'"  1 
ATOM   2612 H H41    . DC  B 2 13  ? 93.91670  14.17913  -0.40758  1.000 42.49992 ? 13  DC  B H41    1 
ATOM   2613 H H42    . DC  B 2 13  ? 95.20246  13.50681  -0.74465  1.000 42.49992 ? 13  DC  B H42    1 
ATOM   2614 H H5     . DC  B 2 13  ? 95.44117  11.09079  -0.77272  1.000 43.42942 ? 13  DC  B H5     1 
ATOM   2615 H H6     . DC  B 2 13  ? 94.37763  9.10656   -0.44295  1.000 43.75787 ? 13  DC  B H6     1 
ATOM   2616 P P      . DA  B 2 14  ? 89.16397  5.49690   -0.88216  1.000 37.23232 ? 14  DA  B P      1 
ATOM   2617 O OP1    . DA  B 2 14  ? 88.11273  4.85029   -0.06216  1.000 37.62328 ? 14  DA  B OP1    1 
ATOM   2618 O OP2    . DA  B 2 14  ? 89.85378  4.74953   -1.95742  1.000 35.62657 ? 14  DA  B OP2    1 
ATOM   2619 O "O5'"  . DA  B 2 14  ? 88.54851  6.82605   -1.50783  1.000 35.97443 ? 14  DA  B "O5'"  1 
ATOM   2620 C "C5'"  . DA  B 2 14  ? 87.93133  7.76446   -0.65537  1.000 34.05680 ? 14  DA  B "C5'"  1 
ATOM   2621 C "C4'"  . DA  B 2 14  ? 87.46163  8.97741   -1.42701  1.000 31.54036 ? 14  DA  B "C4'"  1 
ATOM   2622 O "O4'"  . DA  B 2 14  ? 88.54740  9.93954   -1.56192  1.000 30.00300 ? 14  DA  B "O4'"  1 
ATOM   2623 C "C3'"  . DA  B 2 14  ? 86.99785  8.69959   -2.85396  1.000 31.42206 ? 14  DA  B "C3'"  1 
ATOM   2624 O "O3'"  . DA  B 2 14  ? 85.88797  9.50261   -3.13398  1.000 33.32257 ? 14  DA  B "O3'"  1 
ATOM   2625 C "C2'"  . DA  B 2 14  ? 88.21483  9.09636   -3.68444  1.000 29.64338 ? 14  DA  B "C2'"  1 
ATOM   2626 C "C1'"  . DA  B 2 14  ? 88.64370  10.32574  -2.92175  1.000 28.21335 ? 14  DA  B "C1'"  1 
ATOM   2627 N N9     . DA  B 2 14  ? 89.99286  10.81386  -3.18023  1.000 24.75011 ? 14  DA  B N9     1 
ATOM   2628 C C8     . DA  B 2 14  ? 91.11542  10.08885  -3.45847  1.000 23.59223 ? 14  DA  B C8     1 
ATOM   2629 N N7     . DA  B 2 14  ? 92.19437  10.82822  -3.61073  1.000 23.03055 ? 14  DA  B N7     1 
ATOM   2630 C C5     . DA  B 2 14  ? 91.74312  12.12212  -3.40708  1.000 23.16711 ? 14  DA  B C5     1 
ATOM   2631 C C6     . DA  B 2 14  ? 92.38814  13.37940  -3.42595  1.000 22.73394 ? 14  DA  B C6     1 
ATOM   2632 N N6     . DA  B 2 14  ? 93.68976  13.54529  -3.66854  1.000 23.67737 ? 14  DA  B N6     1 
ATOM   2633 N N1     . DA  B 2 14  ? 91.63552  14.46805  -3.18080  1.000 21.88450 ? 14  DA  B N1     1 
ATOM   2634 C C2     . DA  B 2 14  ? 90.33088  14.31209  -2.93334  1.000 22.90215 ? 14  DA  B C2     1 
ATOM   2635 N N3     . DA  B 2 14  ? 89.61575  13.19346  -2.88801  1.000 23.23060 ? 14  DA  B N3     1 
ATOM   2636 C C4     . DA  B 2 14  ? 90.39008  12.12495  -3.13656  1.000 23.69581 ? 14  DA  B C4     1 
ATOM   2637 H "H5'"  . DA  B 2 14  ? 88.56616  8.04457   0.02244   1.000 40.86816 ? 14  DA  B "H5'"  1 
ATOM   2638 H "H5''" . DA  B 2 14  ? 87.16978  7.34830   -0.22207  1.000 40.86816 ? 14  DA  B "H5''" 1 
ATOM   2639 H "H4'"  . DA  B 2 14  ? 86.73871  9.39134   -0.93007  1.000 37.84844 ? 14  DA  B "H4'"  1 
ATOM   2640 H "H3'"  . DA  B 2 14  ? 86.79604  7.76031   -2.98787  1.000 37.70647 ? 14  DA  B "H3'"  1 
ATOM   2641 H "H2'"  . DA  B 2 14  ? 88.89854  8.40830   -3.68058  1.000 35.57205 ? 14  DA  B "H2'"  1 
ATOM   2642 H "H2''" . DA  B 2 14  ? 87.97824  9.30132   -4.60254  1.000 35.57205 ? 14  DA  B "H2''" 1 
ATOM   2643 H "H1'"  . DA  B 2 14  ? 88.04197  11.05680  -3.13240  1.000 33.85602 ? 14  DA  B "H1'"  1 
ATOM   2644 H H8     . DA  B 2 14  ? 91.11799  9.16187   -3.53330  1.000 28.31067 ? 14  DA  B H8     1 
ATOM   2645 H H61    . DA  B 2 14  ? 94.18798  12.86256  -3.82746  1.000 28.41284 ? 14  DA  B H61    1 
ATOM   2646 H H62    . DA  B 2 14  ? 94.03043  14.33493  -3.66596  1.000 28.41284 ? 14  DA  B H62    1 
ATOM   2647 H H2     . DA  B 2 14  ? 89.85806  15.09613  -2.77019  1.000 27.48258 ? 14  DA  B H2     1 
ATOM   2648 P P      . DA  B 2 15  ? 84.74679  9.01661   -4.13957  1.000 34.95257 ? 15  DA  B P      1 
ATOM   2649 O OP1    . DA  B 2 15  ? 83.86750  8.09621   -3.37971  1.000 35.73041 ? 15  DA  B OP1    1 
ATOM   2650 O OP2    . DA  B 2 15  ? 85.40355  8.57012   -5.39227  1.000 35.63324 ? 15  DA  B OP2    1 
ATOM   2651 O "O5'"  . DA  B 2 15  ? 83.94136  10.36340  -4.42415  1.000 32.15782 ? 15  DA  B "O5'"  1 
ATOM   2652 C "C5'"  . DA  B 2 15  ? 83.47483  11.12025  -3.33208  1.000 31.75338 ? 15  DA  B "C5'"  1 
ATOM   2653 C "C4'"  . DA  B 2 15  ? 83.38360  12.59419  -3.67629  1.000 31.15913 ? 15  DA  B "C4'"  1 
ATOM   2654 O "O4'"  . DA  B 2 15  ? 84.71472  13.15672  -3.82233  1.000 30.45384 ? 15  DA  B "O4'"  1 
ATOM   2655 C "C3'"  . DA  B 2 15  ? 82.67643  12.90868  -4.97698  1.000 30.82362 ? 15  DA  B "C3'"  1 
ATOM   2656 O "O3'"  . DA  B 2 15  ? 82.00035  14.13242  -4.85140  1.000 32.04414 ? 15  DA  B "O3'"  1 
ATOM   2657 C "C2'"  . DA  B 2 15  ? 83.82360  12.96614  -5.98428  1.000 29.74467 ? 15  DA  B "C2'"  1 
ATOM   2658 C "C1'"  . DA  B 2 15  ? 84.91349  13.61883  -5.15402  1.000 29.30210 ? 15  DA  B "C1'"  1 
ATOM   2659 N N9     . DA  B 2 15  ? 86.28651  13.28987  -5.52596  1.000 26.54775 ? 15  DA  B N9     1 
ATOM   2660 C C8     . DA  B 2 15  ? 86.82413  12.04520  -5.68624  1.000 25.53171 ? 15  DA  B C8     1 
ATOM   2661 N N7     . DA  B 2 15  ? 88.10715  12.05570  -5.96183  1.000 25.20791 ? 15  DA  B N7     1 
ATOM   2662 C C5     . DA  B 2 15  ? 88.43850  13.40045  -5.95631  1.000 25.33009 ? 15  DA  B C5     1 
ATOM   2663 C C6     . DA  B 2 15  ? 89.65312  14.08257  -6.17472  1.000 24.14594 ? 15  DA  B C6     1 
ATOM   2664 N N6     . DA  B 2 15  ? 90.80608  13.46696  -6.45629  1.000 23.39574 ? 15  DA  B N6     1 
ATOM   2665 N N1     . DA  B 2 15  ? 89.63665  15.42801  -6.09170  1.000 24.37011 ? 15  DA  B N1     1 
ATOM   2666 C C2     . DA  B 2 15  ? 88.48282  16.04504  -5.80976  1.000 24.93236 ? 15  DA  B C2     1 
ATOM   2667 N N3     . DA  B 2 15  ? 87.28211  15.51285  -5.58612  1.000 25.56632 ? 15  DA  B N3     1 
ATOM   2668 C C4     . DA  B 2 15  ? 87.33014  14.17377  -5.67627  1.000 25.55392 ? 15  DA  B C4     1 
ATOM   2669 H "H5'"  . DA  B 2 15  ? 84.08246  11.00623  -2.58462  1.000 38.10406 ? 15  DA  B "H5'"  1 
ATOM   2670 H "H5''" . DA  B 2 15  ? 82.59589  10.79938  -3.07633  1.000 38.10406 ? 15  DA  B "H5''" 1 
ATOM   2671 H "H4'"  . DA  B 2 15  ? 82.93136  13.04919  -2.94872  1.000 37.39096 ? 15  DA  B "H4'"  1 
ATOM   2672 H "H3'"  . DA  B 2 15  ? 82.06202  12.20129  -5.22798  1.000 36.98834 ? 15  DA  B "H3'"  1 
ATOM   2673 H "H2'"  . DA  B 2 15  ? 84.08301  12.07999  -6.28150  1.000 35.69361 ? 15  DA  B "H2'"  1 
ATOM   2674 H "H2''" . DA  B 2 15  ? 83.59327  13.50391  -6.75801  1.000 35.69361 ? 15  DA  B "H2''" 1 
ATOM   2675 H "H1'"  . DA  B 2 15  ? 84.80100  14.58003  -5.21989  1.000 35.16252 ? 15  DA  B "H1'"  1 
ATOM   2676 H H8     . DA  B 2 15  ? 86.32746  11.26289  -5.60747  1.000 30.63806 ? 15  DA  B H8     1 
ATOM   2677 H H61    . DA  B 2 15  ? 90.83297  12.60923  -6.51269  1.000 28.07489 ? 15  DA  B H61    1 
ATOM   2678 H H62    . DA  B 2 15  ? 91.52081  13.92870  -6.58100  1.000 28.07489 ? 15  DA  B H62    1 
ATOM   2679 H H2     . DA  B 2 15  ? 88.52510  16.97294  -5.76363  1.000 29.91884 ? 15  DA  B H2     1 
ATOM   2680 P P      . DC  B 2 16  ? 80.84340  14.52061  -5.88256  1.000 35.46939 ? 16  DC  B P      1 
ATOM   2681 O OP1    . DC  B 2 16  ? 79.68088  15.00321  -5.09848  1.000 34.84928 ? 16  DC  B OP1    1 
ATOM   2682 O OP2    . DC  B 2 16  ? 80.71691  13.38498  -6.82400  1.000 36.25660 ? 16  DC  B OP2    1 
ATOM   2683 O "O5'"  . DC  B 2 16  ? 81.46738  15.73912  -6.69678  1.000 35.99314 ? 16  DC  B "O5'"  1 
ATOM   2684 C "C5'"  . DC  B 2 16  ? 82.07556  16.80140  -6.00238  1.000 36.57949 ? 16  DC  B "C5'"  1 
ATOM   2685 C "C4'"  . DC  B 2 16  ? 82.90790  17.64507  -6.94102  1.000 37.93901 ? 16  DC  B "C4'"  1 
ATOM   2686 O "O4'"  . DC  B 2 16  ? 84.22359  17.03599  -7.12348  1.000 37.87082 ? 16  DC  B "O4'"  1 
ATOM   2687 C "C3'"  . DC  B 2 16  ? 82.33210  17.79457  -8.35284  1.000 38.45352 ? 16  DC  B "C3'"  1 
ATOM   2688 O "O3'"  . DC  B 2 16  ? 82.53469  19.11484  -8.82340  1.000 39.60580 ? 16  DC  B "O3'"  1 
ATOM   2689 C "C2'"  . DC  B 2 16  ? 83.13944  16.77968  -9.14525  1.000 37.63168 ? 16  DC  B "C2'"  1 
ATOM   2690 C "C1'"  . DC  B 2 16  ? 84.49721  16.98528  -8.50767  1.000 36.88564 ? 16  DC  B "C1'"  1 
ATOM   2691 N N1     . DC  B 2 16  ? 85.51245  15.92903  -8.77481  1.000 34.42083 ? 16  DC  B N1     1 
ATOM   2692 C C2     . DC  B 2 16  ? 86.84540  16.30589  -8.92029  1.000 33.29037 ? 16  DC  B C2     1 
ATOM   2693 O O2     . DC  B 2 16  ? 87.13720  17.50345  -8.82413  1.000 32.99556 ? 16  DC  B O2     1 
ATOM   2694 N N3     . DC  B 2 16  ? 87.77704  15.35340  -9.15608  1.000 32.32615 ? 16  DC  B N3     1 
ATOM   2695 C C4     . DC  B 2 16  ? 87.41357  14.07586  -9.24601  1.000 32.17730 ? 16  DC  B C4     1 
ATOM   2696 N N4     . DC  B 2 16  ? 88.36867  13.17058  -9.47749  1.000 32.73398 ? 16  DC  B N4     1 
ATOM   2697 C C5     . DC  B 2 16  ? 86.05603  13.66918  -9.09937  1.000 32.95500 ? 16  DC  B C5     1 
ATOM   2698 C C6     . DC  B 2 16  ? 85.14668  14.62039  -8.86583  1.000 34.01499 ? 16  DC  B C6     1 
ATOM   2699 H "H5'"  . DC  B 2 16  ? 82.64485  16.44312  -5.30349  1.000 43.89538 ? 16  DC  B "H5'"  1 
ATOM   2700 H "H5''" . DC  B 2 16  ? 81.38903  17.35454  -5.59789  1.000 43.89538 ? 16  DC  B "H5''" 1 
ATOM   2701 H "H4'"  . DC  B 2 16  ? 83.02488  18.52413  -6.54799  1.000 45.52681 ? 16  DC  B "H4'"  1 
ATOM   2702 H "H3'"  . DC  B 2 16  ? 81.38917  17.56755  -8.36834  1.000 46.14422 ? 16  DC  B "H3'"  1 
ATOM   2703 H "H2'"  . DC  B 2 16  ? 82.81149  15.87558  -9.01900  1.000 45.15801 ? 16  DC  B "H2'"  1 
ATOM   2704 H "H2''" . DC  B 2 16  ? 83.14850  16.98277  -10.09371 1.000 45.15801 ? 16  DC  B "H2''" 1 
ATOM   2705 H "H1'"  . DC  B 2 16  ? 84.88108  17.81913  -8.82110  1.000 44.26276 ? 16  DC  B "H1'"  1 
ATOM   2706 H H41    . DC  B 2 16  ? 89.18690  13.42109  -9.56318  1.000 39.28078 ? 16  DC  B H41    1 
ATOM   2707 H H42    . DC  B 2 16  ? 88.16517  12.33741  -9.54078  1.000 39.28078 ? 16  DC  B H42    1 
ATOM   2708 H H5     . DC  B 2 16  ? 85.81149  12.77422  -9.16383  1.000 39.54600 ? 16  DC  B H5     1 
ATOM   2709 H H6     . DC  B 2 16  ? 84.25257  14.38557  -8.76417  1.000 40.81799 ? 16  DC  B H6     1 
ATOM   2710 P P      . DA  B 2 17  ? 81.32569  19.95302  -9.45772  1.000 40.36723 ? 17  DA  B P      1 
ATOM   2711 O OP1    . DA  B 2 17  ? 80.57433  20.56647  -8.33902  1.000 40.36673 ? 17  DA  B OP1    1 
ATOM   2712 O OP2    . DA  B 2 17  ? 80.64424  19.06692  -10.43125 1.000 40.32806 ? 17  DA  B OP2    1 
ATOM   2713 O "O5'"  . DA  B 2 17  ? 82.06391  21.11176  -10.27545 1.000 39.04513 ? 17  DA  B "O5'"  1 
ATOM   2714 C "C5'"  . DA  B 2 17  ? 83.08312  21.88248  -9.65356  1.000 37.89285 ? 17  DA  B "C5'"  1 
ATOM   2715 C "C4'"  . DA  B 2 17  ? 84.29689  22.00276  -10.55743 1.000 36.90665 ? 17  DA  B "C4'"  1 
ATOM   2716 O "O4'"  . DA  B 2 17  ? 85.02107  20.74476  -10.56434 1.000 35.23499 ? 17  DA  B "O4'"  1 
ATOM   2717 C "C3'"  . DA  B 2 17  ? 83.96995  22.32082  -12.01967 1.000 37.01519 ? 17  DA  B "C3'"  1 
ATOM   2718 O "O3'"  . DA  B 2 17  ? 84.64325  23.49806  -12.44129 1.000 38.51363 ? 17  DA  B "O3'"  1 
ATOM   2719 C "C2'"  . DA  B 2 17  ? 84.43062  21.08383  -12.78755 1.000 35.31220 ? 17  DA  B "C2'"  1 
ATOM   2720 C "C1'"  . DA  B 2 17  ? 85.46894  20.47436  -11.86543 1.000 33.86885 ? 17  DA  B "C1'"  1 
ATOM   2721 N N9     . DA  B 2 17  ? 85.61845  19.03334  -12.01960 1.000 32.01518 ? 17  DA  B N9     1 
ATOM   2722 C C8     . DA  B 2 17  ? 84.62313  18.10189  -11.99685 1.000 31.55336 ? 17  DA  B C8     1 
ATOM   2723 N N7     . DA  B 2 17  ? 85.04333  16.86962  -12.15886 1.000 30.56662 ? 17  DA  B N7     1 
ATOM   2724 C C5     . DA  B 2 17  ? 86.40951  17.00060  -12.29895 1.000 31.11684 ? 17  DA  B C5     1 
ATOM   2725 C C6     . DA  B 2 17  ? 87.42871  16.05653  -12.50148 1.000 31.50660 ? 17  DA  B C6     1 
ATOM   2726 N N6     . DA  B 2 17  ? 87.19633  14.74455  -12.59777 1.000 32.00105 ? 17  DA  B N6     1 
ATOM   2727 N N1     . DA  B 2 17  ? 88.69688  16.51040  -12.60081 1.000 31.04036 ? 17  DA  B N1     1 
ATOM   2728 C C2     . DA  B 2 17  ? 88.91978  17.82718  -12.50316 1.000 31.72890 ? 17  DA  B C2     1 
ATOM   2729 N N3     . DA  B 2 17  ? 88.04010  18.81682  -12.30987 1.000 32.03126 ? 17  DA  B N3     1 
ATOM   2730 C C4     . DA  B 2 17  ? 86.78810  18.32800  -12.21536 1.000 31.95921 ? 17  DA  B C4     1 
ATOM   2731 H "H5'"  . DA  B 2 17  ? 83.34442  21.45583  -8.82254  1.000 45.47142 ? 17  DA  B "H5'"  1 
ATOM   2732 H "H5''" . DA  B 2 17  ? 82.74012  22.76877  -9.45930  1.000 45.47142 ? 17  DA  B "H5''" 1 
ATOM   2733 H "H4'"  . DA  B 2 17  ? 84.88993  22.68984  -10.21521 1.000 44.28798 ? 17  DA  B "H4'"  1 
ATOM   2734 H "H3'"  . DA  B 2 17  ? 83.01045  22.42229  -12.11946 1.000 44.41822 ? 17  DA  B "H3'"  1 
ATOM   2735 H "HO3'" . DA  B 2 17  ? 85.03064  23.51632  -13.18641 1.000 46.21636 ? 17  DA  B "HO3'" 1 
ATOM   2736 H "H2'"  . DA  B 2 17  ? 83.69403  20.47118  -12.93924 1.000 42.37464 ? 17  DA  B "H2'"  1 
ATOM   2737 H "H2''" . DA  B 2 17  ? 84.82033  21.32683  -13.64194 1.000 42.37464 ? 17  DA  B "H2''" 1 
ATOM   2738 H "H1'"  . DA  B 2 17  ? 86.33031  20.89537  -12.01272 1.000 40.64262 ? 17  DA  B "H1'"  1 
ATOM   2739 H H8     . DA  B 2 17  ? 83.72709  18.32032  -11.87726 1.000 37.86404 ? 17  DA  B H8     1 
ATOM   2740 H H61    . DA  B 2 17  ? 86.39274  14.44452  -12.53599 1.000 38.40127 ? 17  DA  B H61    1 
ATOM   2741 H H62    . DA  B 2 17  ? 87.85033  14.19997  -12.72155 1.000 38.40127 ? 17  DA  B H62    1 
ATOM   2742 H H2     . DA  B 2 17  ? 89.80848  18.09014  -12.58032 1.000 38.07468 ? 17  DA  B H2     1 
ATOM   2743 O "O5'"  . DT  C 3 1   ? 95.63178  12.98183  -16.97259 1.000 54.97734 ? 1   DT  C "O5'"  1 
ATOM   2744 C "C5'"  . DT  C 3 1   ? 96.31089  12.99780  -15.71357 1.000 54.32452 ? 1   DT  C "C5'"  1 
ATOM   2745 C "C4'"  . DT  C 3 1   ? 96.26927  14.38371  -15.09200 1.000 52.92435 ? 1   DT  C "C4'"  1 
ATOM   2746 O "O4'"  . DT  C 3 1   ? 94.88311  14.81475  -14.97396 1.000 52.18742 ? 1   DT  C "O4'"  1 
ATOM   2747 C "C3'"  . DT  C 3 1   ? 96.85604  14.48306  -13.68507 1.000 51.89185 ? 1   DT  C "C3'"  1 
ATOM   2748 O "O3'"  . DT  C 3 1   ? 97.52081  15.74081  -13.49968 1.000 51.16072 ? 1   DT  C "O3'"  1 
ATOM   2749 C "C2'"  . DT  C 3 1   ? 95.62876  14.32912  -12.79674 1.000 51.47729 ? 1   DT  C "C2'"  1 
ATOM   2750 C "C1'"  . DT  C 3 1   ? 94.54572  15.01989  -13.61436 1.000 50.18202 ? 1   DT  C "C1'"  1 
ATOM   2751 N N1     . DT  C 3 1   ? 93.16965  14.49003  -13.38205 1.000 46.89857 ? 1   DT  C N1     1 
ATOM   2752 C C2     . DT  C 3 1   ? 92.14949  15.36871  -13.09651 1.000 46.46577 ? 1   DT  C C2     1 
ATOM   2753 O O2     . DT  C 3 1   ? 92.30912  16.57387  -13.01302 1.000 46.68889 ? 1   DT  C O2     1 
ATOM   2754 N N3     . DT  C 3 1   ? 90.92691  14.78133  -12.90750 1.000 45.66497 ? 1   DT  C N3     1 
ATOM   2755 C C4     . DT  C 3 1   ? 90.63084  13.43466  -12.97844 1.000 45.32109 ? 1   DT  C C4     1 
ATOM   2756 O O4     . DT  C 3 1   ? 89.50085  13.00082  -12.79352 1.000 45.73287 ? 1   DT  C O4     1 
ATOM   2757 C C5     . DT  C 3 1   ? 91.74427  12.57151  -13.28515 1.000 44.75496 ? 1   DT  C C5     1 
ATOM   2758 C C7     . DT  C 3 1   ? 91.54175  11.08919  -13.38810 1.000 44.52827 ? 1   DT  C C7     1 
ATOM   2759 C C6     . DT  C 3 1   ? 92.94434  13.13309  -13.47361 1.000 45.25061 ? 1   DT  C C6     1 
ATOM   2760 H "H5'"  . DT  C 3 1   ? 97.23513  12.73479  -15.84590 1.000 65.18943 ? 1   DT  C "H5'"  1 
ATOM   2761 H "H5''" . DT  C 3 1   ? 95.88552  12.36567  -15.11325 1.000 65.18943 ? 1   DT  C "H5''" 1 
ATOM   2762 H "H4'"  . DT  C 3 1   ? 96.74405  15.00325  -15.66790 1.000 63.50921 ? 1   DT  C "H4'"  1 
ATOM   2763 H "H3'"  . DT  C 3 1   ? 97.47699  13.75569  -13.52304 1.000 62.27022 ? 1   DT  C "H3'"  1 
ATOM   2764 H "H2'"  . DT  C 3 1   ? 95.41617  13.39461  -12.64708 1.000 61.77274 ? 1   DT  C "H2'"  1 
ATOM   2765 H "H2''" . DT  C 3 1   ? 95.75628  14.76516  -11.93970 1.000 61.77274 ? 1   DT  C "H2''" 1 
ATOM   2766 H "H1'"  . DT  C 3 1   ? 94.55426  15.96899  -13.41426 1.000 60.21842 ? 1   DT  C "H1'"  1 
ATOM   2767 H H3     . DT  C 3 1   ? 90.27250  15.30855  -12.72477 1.000 54.79796 ? 1   DT  C H3     1 
ATOM   2768 H H71    . DT  C 3 1   ? 90.62556  10.87829  -13.14931 1.000 53.43392 ? 1   DT  C H71    1 
ATOM   2769 H H72    . DT  C 3 1   ? 91.71893  10.80881  -14.29963 1.000 53.43392 ? 1   DT  C H72    1 
ATOM   2770 H H73    . DT  C 3 1   ? 92.15282  10.64401  -12.78039 1.000 53.43392 ? 1   DT  C H73    1 
ATOM   2771 H H6     . DT  C 3 1   ? 93.66336  12.57936  -13.67682 1.000 54.30073 ? 1   DT  C H6     1 
ATOM   2772 H "HO5'" . DT  C 3 1   ? 95.42690  13.70475  -17.34837 1.000 65.97281 ? 1   DT  C "HO5'" 1 
ATOM   2773 P P      . DG  C 3 2   ? 98.13990  16.13842  -12.06958 1.000 50.65060 ? 2   DG  C P      1 
ATOM   2774 O OP1    . DG  C 3 2   ? 99.50252  16.67499  -12.28783 1.000 51.41771 ? 2   DG  C OP1    1 
ATOM   2775 O OP2    . DG  C 3 2   ? 97.92750  15.00464  -11.14153 1.000 50.73692 ? 2   DG  C OP2    1 
ATOM   2776 O "O5'"  . DG  C 3 2   ? 97.24864  17.37591  -11.61178 1.000 47.18962 ? 2   DG  C "O5'"  1 
ATOM   2777 C "C5'"  . DG  C 3 2   ? 97.16788  18.51204  -12.44665 1.000 43.64445 ? 2   DG  C "C5'"  1 
ATOM   2778 C "C4'"  . DG  C 3 2   ? 96.38523  19.61920  -11.77859 1.000 40.09628 ? 2   DG  C "C4'"  1 
ATOM   2779 O "O4'"  . DG  C 3 2   ? 95.01333  19.18672  -11.57012 1.000 39.61228 ? 2   DG  C "O4'"  1 
ATOM   2780 C "C3'"  . DG  C 3 2   ? 96.89672  20.02605  -10.41199 1.000 38.14529 ? 2   DG  C "C3'"  1 
ATOM   2781 O "O3'"  . DG  C 3 2   ? 96.67474  21.40977  -10.20556 1.000 36.98343 ? 2   DG  C "O3'"  1 
ATOM   2782 C "C2'"  . DG  C 3 2   ? 96.09396  19.13521  -9.45916  1.000 38.37659 ? 2   DG  C "C2'"  1 
ATOM   2783 C "C1'"  . DG  C 3 2   ? 94.76203  18.95612  -10.18921 1.000 37.79169 ? 2   DG  C "C1'"  1 
ATOM   2784 N N9     . DG  C 3 2   ? 94.15594  17.62212  -10.05053 1.000 32.88006 ? 2   DG  C N9     1 
ATOM   2785 C C8     . DG  C 3 2   ? 94.79452  16.40664  -10.08956 1.000 31.22163 ? 2   DG  C C8     1 
ATOM   2786 N N7     . DG  C 3 2   ? 93.98687  15.38890  -9.95707  1.000 30.55815 ? 2   DG  C N7     1 
ATOM   2787 C C5     . DG  C 3 2   ? 92.73129  15.96500  -9.82939  1.000 30.69452 ? 2   DG  C C5     1 
ATOM   2788 C C6     . DG  C 3 2   ? 91.45850  15.35988  -9.65609  1.000 28.75084 ? 2   DG  C C6     1 
ATOM   2789 O O6     . DG  C 3 2   ? 91.18150  14.15184  -9.57850  1.000 27.20485 ? 2   DG  C O6     1 
ATOM   2790 N N1     . DG  C 3 2   ? 90.44420  16.31182  -9.57041  1.000 28.03448 ? 2   DG  C N1     1 
ATOM   2791 C C2     . DG  C 3 2   ? 90.63541  17.67096  -9.64187  1.000 29.26836 ? 2   DG  C C2     1 
ATOM   2792 N N2     . DG  C 3 2   ? 89.54211  18.43353  -9.54141  1.000 30.16519 ? 2   DG  C N2     1 
ATOM   2793 N N3     . DG  C 3 2   ? 91.81900  18.24814  -9.80634  1.000 29.83508 ? 2   DG  C N3     1 
ATOM   2794 C C4     . DG  C 3 2   ? 92.81749  17.33810  -9.89139  1.000 30.99900 ? 2   DG  C C4     1 
ATOM   2795 H "H5'"  . DG  C 3 2   ? 96.72993  18.26761  -13.27692 1.000 52.37334 ? 2   DG  C "H5'"  1 
ATOM   2796 H "H5''" . DG  C 3 2   ? 98.06364  18.82806  -12.64324 1.000 52.37334 ? 2   DG  C "H5''" 1 
ATOM   2797 H "H4'"  . DG  C 3 2   ? 96.38196  20.39748  -12.35752 1.000 48.11553 ? 2   DG  C "H4'"  1 
ATOM   2798 H "H3'"  . DG  C 3 2   ? 97.84046  19.82215  -10.31885 1.000 45.77435 ? 2   DG  C "H3'"  1 
ATOM   2799 H "H2'"  . DG  C 3 2   ? 96.53535  18.28242  -9.32190  1.000 46.05191 ? 2   DG  C "H2'"  1 
ATOM   2800 H "H2''" . DG  C 3 2   ? 95.96688  19.56694  -8.59988  1.000 46.05191 ? 2   DG  C "H2''" 1 
ATOM   2801 H "H1'"  . DG  C 3 2   ? 94.14084  19.62092  -9.85295  1.000 45.35003 ? 2   DG  C "H1'"  1 
ATOM   2802 H H8     . DG  C 3 2   ? 95.71361  16.31703  -10.19972 1.000 37.46595 ? 2   DG  C H8     1 
ATOM   2803 H H1     . DG  C 3 2   ? 89.63931  16.02784  -9.46505  1.000 33.64138 ? 2   DG  C H1     1 
ATOM   2804 H H21    . DG  C 3 2   ? 88.77109  18.06782  -9.43468  1.000 36.19822 ? 2   DG  C H21    1 
ATOM   2805 H H22    . DG  C 3 2   ? 89.60976  19.28983  -9.58350  1.000 36.19822 ? 2   DG  C H22    1 
ATOM   2806 P P      . DT  C 3 3   ? 96.98399  22.07332  -8.78113  1.000 36.92654 ? 3   DT  C P      1 
ATOM   2807 O OP1    . DT  C 3 3   ? 97.32869  23.49559  -9.01240  1.000 36.30271 ? 3   DT  C OP1    1 
ATOM   2808 O OP2    . DT  C 3 3   ? 97.92260  21.16097  -8.08538  1.000 36.92398 ? 3   DT  C OP2    1 
ATOM   2809 O "O5'"  . DT  C 3 3   ? 95.57341  22.01169  -8.02997  1.000 36.83782 ? 3   DT  C "O5'"  1 
ATOM   2810 C "C5'"  . DT  C 3 3   ? 94.41975  22.56701  -8.65843  1.000 34.59276 ? 3   DT  C "C5'"  1 
ATOM   2811 C "C4'"  . DT  C 3 3   ? 93.20154  22.46300  -7.76456  1.000 31.63536 ? 3   DT  C "C4'"  1 
ATOM   2812 O "O4'"  . DT  C 3 3   ? 92.73370  21.09119  -7.74319  1.000 31.43622 ? 3   DT  C "O4'"  1 
ATOM   2813 C "C3'"  . DT  C 3 3   ? 93.43273  22.85359  -6.30592  1.000 29.73939 ? 3   DT  C "C3'"  1 
ATOM   2814 O "O3'"  . DT  C 3 3   ? 92.38552  23.70523  -5.87097  1.000 27.67726 ? 3   DT  C "O3'"  1 
ATOM   2815 C "C2'"  . DT  C 3 3   ? 93.45781  21.50718  -5.56712  1.000 30.01808 ? 3   DT  C "C2'"  1 
ATOM   2816 C "C1'"  . DT  C 3 3   ? 92.51074  20.67609  -6.41060  1.000 29.81882 ? 3   DT  C "C1'"  1 
ATOM   2817 N N1     . DT  C 3 3   ? 92.70908  19.20486  -6.37839  1.000 28.01468 ? 3   DT  C N1     1 
ATOM   2818 C C2     . DT  C 3 3   ? 91.60382  18.39568  -6.34112  1.000 27.95751 ? 3   DT  C C2     1 
ATOM   2819 O O2     . DT  C 3 3   ? 90.47004  18.82529  -6.26577  1.000 30.11111 ? 3   DT  C O2     1 
ATOM   2820 N N3     . DT  C 3 3   ? 91.86771  17.05840  -6.37255  1.000 26.12198 ? 3   DT  C N3     1 
ATOM   2821 C C4     . DT  C 3 3   ? 93.10666  16.45554  -6.45695  1.000 25.99666 ? 3   DT  C C4     1 
ATOM   2822 O O4     . DT  C 3 3   ? 93.24227  15.23465  -6.47728  1.000 25.87313 ? 3   DT  C O4     1 
ATOM   2823 C C5     . DT  C 3 3   ? 94.22745  17.36065  -6.52004  1.000 26.18967 ? 3   DT  C C5     1 
ATOM   2824 C C7     . DT  C 3 3   ? 95.62120  16.82522  -6.61415  1.000 26.39543 ? 3   DT  C C7     1 
ATOM   2825 C C6     . DT  C 3 3   ? 93.97744  18.67937  -6.49227  1.000 27.60073 ? 3   DT  C C6     1 
ATOM   2826 H "H5'"  . DT  C 3 3   ? 94.24834  22.09054  -9.48577  1.000 41.51131 ? 3   DT  C "H5'"  1 
ATOM   2827 H "H5''" . DT  C 3 3   ? 94.58666  23.50091  -8.86058  1.000 41.51131 ? 3   DT  C "H5''" 1 
ATOM   2828 H "H4'"  . DT  C 3 3   ? 92.49633  23.02356  -8.12423  1.000 37.96244 ? 3   DT  C "H4'"  1 
ATOM   2829 H "H3'"  . DT  C 3 3   ? 94.29387  23.28665  -6.19734  1.000 35.68727 ? 3   DT  C "H3'"  1 
ATOM   2830 H "H2'"  . DT  C 3 3   ? 94.34955  21.12571  -5.55318  1.000 36.02169 ? 3   DT  C "H2'"  1 
ATOM   2831 H "H2''" . DT  C 3 3   ? 93.13787  21.59561  -4.65569  1.000 36.02169 ? 3   DT  C "H2''" 1 
ATOM   2832 H "H1'"  . DT  C 3 3   ? 91.60794  20.86541  -6.11059  1.000 35.78258 ? 3   DT  C "H1'"  1 
ATOM   2833 H H3     . DT  C 3 3   ? 91.18789  16.53296  -6.33578  1.000 31.34638 ? 3   DT  C H3     1 
ATOM   2834 H H71    . DT  C 3 3   ? 95.59305  15.85791  -6.54774  1.000 31.67451 ? 3   DT  C H71    1 
ATOM   2835 H H72    . DT  C 3 3   ? 96.00331  17.08730  -7.46633  1.000 31.67451 ? 3   DT  C H72    1 
ATOM   2836 H H73    . DT  C 3 3   ? 96.14988  17.19139  -5.88798  1.000 31.67451 ? 3   DT  C H73    1 
ATOM   2837 H H6     . DT  C 3 3   ? 94.69573  19.26699  -6.55287  1.000 33.12087 ? 3   DT  C H6     1 
ATOM   2838 P P      . DT  C 3 4   ? 92.44783  24.41831  -4.43739  1.000 26.63927 ? 4   DT  C P      1 
ATOM   2839 O OP1    . DT  C 3 4   ? 91.77504  25.73380  -4.55354  1.000 23.46600 ? 4   DT  C OP1    1 
ATOM   2840 O OP2    . DT  C 3 4   ? 93.83876  24.33437  -3.93887  1.000 28.00029 ? 4   DT  C OP2    1 
ATOM   2841 O "O5'"  . DT  C 3 4   ? 91.56267  23.46313  -3.51834  1.000 24.53313 ? 4   DT  C "O5'"  1 
ATOM   2842 C "C5'"  . DT  C 3 4   ? 90.23665  23.17906  -3.88619  1.000 22.22526 ? 4   DT  C "C5'"  1 
ATOM   2843 C "C4'"  . DT  C 3 4   ? 89.68007  22.03887  -3.05960  1.000 21.69723 ? 4   DT  C "C4'"  1 
ATOM   2844 O "O4'"  . DT  C 3 4   ? 90.34851  20.79941  -3.43172  1.000 21.67606 ? 4   DT  C "O4'"  1 
ATOM   2845 C "C3'"  . DT  C 3 4   ? 89.87512  22.16437  -1.54048  1.000 20.83686 ? 4   DT  C "C3'"  1 
ATOM   2846 O "O3'"  . DT  C 3 4   ? 88.70929  21.75302  -0.86080  1.000 21.66793 ? 4   DT  C "O3'"  1 
ATOM   2847 C "C2'"  . DT  C 3 4   ? 91.02997  21.21681  -1.27605  1.000 20.58727 ? 4   DT  C "C2'"  1 
ATOM   2848 C "C1'"  . DT  C 3 4   ? 90.68591  20.11867  -2.25085  1.000 20.91501 ? 4   DT  C "C1'"  1 
ATOM   2849 N N1     . DT  C 3 4   ? 91.76163  19.13456  -2.52230  1.000 20.49180 ? 4   DT  C N1     1 
ATOM   2850 C C2     . DT  C 3 4   ? 91.39899  17.84316  -2.77274  1.000 20.50712 ? 4   DT  C C2     1 
ATOM   2851 O O2     . DT  C 3 4   ? 90.24138  17.47172  -2.79596  1.000 20.60905 ? 4   DT  C O2     1 
ATOM   2852 N N3     . DT  C 3 4   ? 92.43201  16.98817  -2.99970  1.000 21.21195 ? 4   DT  C N3     1 
ATOM   2853 C C4     . DT  C 3 4   ? 93.77702  17.28401  -2.99882  1.000 20.64884 ? 4   DT  C C4     1 
ATOM   2854 O O4     . DT  C 3 4   ? 94.62769  16.43086  -3.22114  1.000 20.86449 ? 4   DT  C O4     1 
ATOM   2855 C C5     . DT  C 3 4   ? 94.10310  18.66207  -2.72623  1.000 20.47375 ? 4   DT  C C5     1 
ATOM   2856 C C7     . DT  C 3 4   ? 95.53204  19.10665  -2.69993  1.000 20.95831 ? 4   DT  C C7     1 
ATOM   2857 C C6     . DT  C 3 4   ? 93.08834  19.51748  -2.50037  1.000 20.76779 ? 4   DT  C C6     1 
ATOM   2858 H "H5'"  . DT  C 3 4   ? 90.21049  22.93579  -4.82482  1.000 26.67032 ? 4   DT  C "H5'"  1 
ATOM   2859 H "H5''" . DT  C 3 4   ? 89.69079  23.96913  -3.74939  1.000 26.67032 ? 4   DT  C "H5''" 1 
ATOM   2860 H "H4'"  . DT  C 3 4   ? 88.73118  21.95902  -3.24437  1.000 26.03667 ? 4   DT  C "H4'"  1 
ATOM   2861 H "H3'"  . DT  C 3 4   ? 90.11066  23.07486  -1.30291  1.000 25.00423 ? 4   DT  C "H3'"  1 
ATOM   2862 H "H2'"  . DT  C 3 4   ? 91.88723  21.62436  -1.47581  1.000 24.70473 ? 4   DT  C "H2'"  1 
ATOM   2863 H "H2''" . DT  C 3 4   ? 91.03700  20.89970  -0.35937  1.000 24.70473 ? 4   DT  C "H2''" 1 
ATOM   2864 H "H1'"  . DT  C 3 4   ? 89.92983  19.60890  -1.92011  1.000 25.09801 ? 4   DT  C "H1'"  1 
ATOM   2865 H H3     . DT  C 3 4   ? 92.22151  16.17030  -3.16213  1.000 25.45434 ? 4   DT  C H3     1 
ATOM   2866 H H71    . DT  C 3 4   ? 96.10625  18.32893  -2.77947  1.000 25.14998 ? 4   DT  C H71    1 
ATOM   2867 H H72    . DT  C 3 4   ? 95.68855  19.71072  -3.44256  1.000 25.14998 ? 4   DT  C H72    1 
ATOM   2868 H H73    . DT  C 3 4   ? 95.70580  19.56172  -1.86110  1.000 25.14998 ? 4   DT  C H73    1 
ATOM   2869 H H6     . DT  C 3 4   ? 93.29011  20.40749  -2.32127  1.000 24.92135 ? 4   DT  C H6     1 
ATOM   2870 P P      . DG  C 3 5   ? 88.07303  22.65347  0.30027   1.000 24.31409 ? 5   DG  C P      1 
ATOM   2871 O OP1    . DG  C 3 5   ? 87.36662  23.76905  -0.36850  1.000 24.79989 ? 5   DG  C OP1    1 
ATOM   2872 O OP2    . DG  C 3 5   ? 89.11697  22.92850  1.31442   1.000 24.96232 ? 5   DG  C OP2    1 
ATOM   2873 O "O5'"  . DG  C 3 5   ? 87.01438  21.67401  0.99125   1.000 23.56833 ? 5   DG  C "O5'"  1 
ATOM   2874 C "C5'"  . DG  C 3 5   ? 85.94830  21.13764  0.23281   1.000 21.13516 ? 5   DG  C "C5'"  1 
ATOM   2875 C "C4'"  . DG  C 3 5   ? 85.72267  19.67693  0.57079   1.000 19.24552 ? 5   DG  C "C4'"  1 
ATOM   2876 O "O4'"  . DG  C 3 5   ? 86.84735  18.89470  0.09019   1.000 18.41865 ? 5   DG  C "O4'"  1 
ATOM   2877 C "C3'"  . DG  C 3 5   ? 85.60466  19.36486  2.06699   1.000 19.22826 ? 5   DG  C "C3'"  1 
ATOM   2878 O "O3'"  . DG  C 3 5   ? 84.53336  18.44507  2.30556   1.000 19.47521 ? 5   DG  C "O3'"  1 
ATOM   2879 C "C2'"  . DG  C 3 5   ? 86.96340  18.76869  2.40647   1.000 18.84776 ? 5   DG  C "C2'"  1 
ATOM   2880 C "C1'"  . DG  C 3 5   ? 87.30778  18.05433  1.12302   1.000 18.09125 ? 5   DG  C "C1'"  1 
ATOM   2881 N N9     . DG  C 3 5   ? 88.72468  17.81601  0.92733   1.000 18.04271 ? 5   DG  C N9     1 
ATOM   2882 C C8     . DG  C 3 5   ? 89.72466  18.75301  0.86136   1.000 17.99727 ? 5   DG  C C8     1 
ATOM   2883 N N7     . DG  C 3 5   ? 90.90686  18.23656  0.65792   1.000 17.49277 ? 5   DG  C N7     1 
ATOM   2884 C C5     . DG  C 3 5   ? 90.66789  16.87209  0.57501   1.000 18.34710 ? 5   DG  C C5     1 
ATOM   2885 C C6     . DG  C 3 5   ? 91.56085  15.80122  0.36292   1.000 19.25649 ? 5   DG  C C6     1 
ATOM   2886 O O6     . DG  C 3 5   ? 92.78620  15.84405  0.20140   1.000 21.99660 ? 5   DG  C O6     1 
ATOM   2887 N N1     . DG  C 3 5   ? 90.90307  14.57759  0.34651   1.000 17.72609 ? 5   DG  C N1     1 
ATOM   2888 C C2     . DG  C 3 5   ? 89.55391  14.40657  0.51762   1.000 18.03180 ? 5   DG  C C2     1 
ATOM   2889 N N2     . DG  C 3 5   ? 89.09972  13.14528  0.47216   1.000 18.73683 ? 5   DG  C N2     1 
ATOM   2890 N N3     . DG  C 3 5   ? 88.70345  15.39893  0.71612   1.000 17.89987 ? 5   DG  C N3     1 
ATOM   2891 C C4     . DG  C 3 5   ? 89.32883  16.60011  0.73372   1.000 18.57274 ? 5   DG  C C4     1 
ATOM   2892 H "H5'"  . DG  C 3 5   ? 86.15604  21.21835  -0.71124  1.000 25.36219 ? 5   DG  C "H5'"  1 
ATOM   2893 H "H5''" . DG  C 3 5   ? 85.13891  21.63767  0.42193   1.000 25.36219 ? 5   DG  C "H5''" 1 
ATOM   2894 H "H4'"  . DG  C 3 5   ? 84.91573  19.37049  0.12826   1.000 23.09463 ? 5   DG  C "H4'"  1 
ATOM   2895 H "H3'"  . DG  C 3 5   ? 85.46584  20.18248  2.57011   1.000 23.07391 ? 5   DG  C "H3'"  1 
ATOM   2896 H "H2'"  . DG  C 3 5   ? 87.61280  19.45813  2.61589   1.000 22.61732 ? 5   DG  C "H2'"  1 
ATOM   2897 H "H2''" . DG  C 3 5   ? 86.90555  18.15210  3.15304   1.000 22.61732 ? 5   DG  C "H2''" 1 
ATOM   2898 H "H1'"  . DG  C 3 5   ? 86.84730  17.20106  1.09509   1.000 21.70950 ? 5   DG  C "H1'"  1 
ATOM   2899 H H8     . DG  C 3 5   ? 89.57533  19.66639  0.95258   1.000 21.59673 ? 5   DG  C H8     1 
ATOM   2900 H H1     . DG  C 3 5   ? 91.37927  13.87288  0.21912   1.000 21.27131 ? 5   DG  C H1     1 
ATOM   2901 H H21    . DG  C 3 5   ? 89.64787  12.49525  0.34334   1.000 22.48420 ? 5   DG  C H21    1 
ATOM   2902 H H22    . DG  C 3 5   ? 88.26038  12.98663  0.57184   1.000 22.48420 ? 5   DG  C H22    1 
ATOM   2903 P P      . DA  C 3 6   ? 84.28708  17.84151  3.77316   1.000 18.00747 ? 6   DA  C P      1 
ATOM   2904 O OP1    . DA  C 3 6   ? 82.84504  17.53368  3.88090   1.000 17.29696 ? 6   DA  C OP1    1 
ATOM   2905 O OP2    . DA  C 3 6   ? 84.93053  18.74655  4.74655   1.000 19.39448 ? 6   DA  C OP2    1 
ATOM   2906 O "O5'"  . DA  C 3 6   ? 85.12975  16.48241  3.78483   1.000 16.24947 ? 6   DA  C "O5'"  1 
ATOM   2907 C "C5'"  . DA  C 3 6   ? 84.67986  15.36733  3.03359   1.000 15.79959 ? 6   DA  C "C5'"  1 
ATOM   2908 C "C4'"  . DA  C 3 6   ? 85.39036  14.09701  3.45970   1.000 13.37903 ? 6   DA  C "C4'"  1 
ATOM   2909 O "O4'"  . DA  C 3 6   ? 86.78444  14.17760  3.07527   1.000 12.99975 ? 6   DA  C "O4'"  1 
ATOM   2910 C "C3'"  . DA  C 3 6   ? 85.35947  13.82870  4.95830   1.000 14.06569 ? 6   DA  C "C3'"  1 
ATOM   2911 O "O3'"  . DA  C 3 6   ? 84.86847  12.51826  5.21193   1.000 14.31276 ? 6   DA  C "O3'"  1 
ATOM   2912 C "C2'"  . DA  C 3 6   ? 86.80921  14.01987  5.41973   1.000 14.21942 ? 6   DA  C "C2'"  1 
ATOM   2913 C "C1'"  . DA  C 3 6   ? 87.62247  13.82214  4.15054   1.000 13.43136 ? 6   DA  C "C1'"  1 
ATOM   2914 N N9     . DA  C 3 6   ? 88.83170  14.64711  4.07645   1.000 13.80753 ? 6   DA  C N9     1 
ATOM   2915 C C8     . DA  C 3 6   ? 88.91556  16.00483  4.22863   1.000 14.35027 ? 6   DA  C C8     1 
ATOM   2916 N N7     . DA  C 3 6   ? 90.13102  16.47983  4.09513   1.000 14.08500 ? 6   DA  C N7     1 
ATOM   2917 C C5     . DA  C 3 6   ? 90.89475  15.35848  3.82803   1.000 14.11840 ? 6   DA  C C5     1 
ATOM   2918 C C6     . DA  C 3 6   ? 92.26896  15.18773  3.58490   1.000 15.02836 ? 6   DA  C C6     1 
ATOM   2919 N N6     . DA  C 3 6   ? 93.14147  16.20086  3.57137   1.000 15.77823 ? 6   DA  C N6     1 
ATOM   2920 N N1     . DA  C 3 6   ? 92.71303  13.93394  3.35050   1.000 14.10804 ? 6   DA  C N1     1 
ATOM   2921 C C2     . DA  C 3 6   ? 91.83251  12.92464  3.36372   1.000 13.89785 ? 6   DA  C C2     1 
ATOM   2922 N N3     . DA  C 3 6   ? 90.52112  12.96310  3.58002   1.000 14.55484 ? 6   DA  C N3     1 
ATOM   2923 C C4     . DA  C 3 6   ? 90.11092  14.22205  3.80777   1.000 13.95233 ? 6   DA  C C4     1 
ATOM   2924 H "H5'"  . DA  C 3 6   ? 84.85125  15.52752  2.09239   1.000 18.95951 ? 6   DA  C "H5'"  1 
ATOM   2925 H "H5''" . DA  C 3 6   ? 83.72526  15.25809  3.16663   1.000 18.95951 ? 6   DA  C "H5''" 1 
ATOM   2926 H "H4'"  . DA  C 3 6   ? 85.00022  13.33342  3.00625   1.000 16.05483 ? 6   DA  C "H4'"  1 
ATOM   2927 H "H3'"  . DA  C 3 6   ? 84.80654  14.49409  5.39696   1.000 16.87883 ? 6   DA  C "H3'"  1 
ATOM   2928 H "H2'"  . DA  C 3 6   ? 86.94376  14.90881  5.78384   1.000 17.06331 ? 6   DA  C "H2'"  1 
ATOM   2929 H "H2''" . DA  C 3 6   ? 87.04938  13.36344  6.09228   1.000 17.06331 ? 6   DA  C "H2''" 1 
ATOM   2930 H "H1'"  . DA  C 3 6   ? 87.86808  12.88637  4.08045   1.000 16.11763 ? 6   DA  C "H1'"  1 
ATOM   2931 H H8     . DA  C 3 6   ? 88.17810  16.54160  4.41011   1.000 17.22032 ? 6   DA  C H8     1 
ATOM   2932 H H61    . DA  C 3 6   ? 92.87063  17.00359  3.71922   1.000 18.93388 ? 6   DA  C H61    1 
ATOM   2933 H H62    . DA  C 3 6   ? 93.97349  16.04973  3.41481   1.000 18.93388 ? 6   DA  C H62    1 
ATOM   2934 H H2     . DA  C 3 6   ? 92.18718  12.08087  3.19895   1.000 16.67742 ? 6   DA  C H2     1 
ATOM   2935 P P      . DT  C 3 7   ? 84.56294  12.04560  6.71297   1.000 15.47006 ? 7   DT  C P      1 
ATOM   2936 O OP1    . DT  C 3 7   ? 83.45003  11.07275  6.64197   1.000 16.82370 ? 7   DT  C OP1    1 
ATOM   2937 O OP2    . DT  C 3 7   ? 84.47055  13.24092  7.58398   1.000 15.88131 ? 7   DT  C OP2    1 
ATOM   2938 O "O5'"  . DT  C 3 7   ? 85.86783  11.23273  7.11020   1.000 16.68268 ? 7   DT  C "O5'"  1 
ATOM   2939 C "C5'"  . DT  C 3 7   ? 86.22375  10.11442  6.33640   1.000 18.40272 ? 7   DT  C "C5'"  1 
ATOM   2940 C "C4'"  . DT  C 3 7   ? 87.62011  9.65825   6.65775   1.000 20.02808 ? 7   DT  C "C4'"  1 
ATOM   2941 O "O4'"  . DT  C 3 7   ? 88.55678  10.70887  6.35539   1.000 20.83871 ? 7   DT  C "O4'"  1 
ATOM   2942 C "C3'"  . DT  C 3 7   ? 87.85291  9.30896   8.12701   1.000 21.01709 ? 7   DT  C "C3'"  1 
ATOM   2943 O "O3'"  . DT  C 3 7   ? 88.03257  7.91988   8.25686   1.000 22.06885 ? 7   DT  C "O3'"  1 
ATOM   2944 C "C2'"  . DT  C 3 7   ? 89.10604  10.11059  8.52450   1.000 20.30180 ? 7   DT  C "C2'"  1 
ATOM   2945 C "C1'"  . DT  C 3 7   ? 89.67717  10.53146  7.17812   1.000 20.36320 ? 7   DT  C "C1'"  1 
ATOM   2946 N N1     . DT  C 3 7   ? 90.46235  11.79616  7.17624   1.000 19.08863 ? 7   DT  C N1     1 
ATOM   2947 C C2     . DT  C 3 7   ? 91.79703  11.75753  6.85720   1.000 17.72454 ? 7   DT  C C2     1 
ATOM   2948 O O2     . DT  C 3 7   ? 92.39408  10.73005  6.60592   1.000 16.99992 ? 7   DT  C O2     1 
ATOM   2949 N N3     . DT  C 3 7   ? 92.42053  12.97523  6.85804   1.000 17.91971 ? 7   DT  C N3     1 
ATOM   2950 C C4     . DT  C 3 7   ? 91.84975  14.20680  7.13011   1.000 17.06807 ? 7   DT  C C4     1 
ATOM   2951 O O4     . DT  C 3 7   ? 92.49544  15.24602  7.10554   1.000 16.69611 ? 7   DT  C O4     1 
ATOM   2952 C C5     . DT  C 3 7   ? 90.44462  14.17770  7.44346   1.000 17.75079 ? 7   DT  C C5     1 
ATOM   2953 C C7     . DT  C 3 7   ? 89.71269  15.44597  7.75477   1.000 17.86035 ? 7   DT  C C7     1 
ATOM   2954 C C6     . DT  C 3 7   ? 89.82250  12.98852  7.44268   1.000 19.36306 ? 7   DT  C C6     1 
ATOM   2955 H "H5'"  . DT  C 3 7   ? 86.17290  10.34784  5.39628   1.000 22.08326 ? 7   DT  C "H5'"  1 
ATOM   2956 H "H5''" . DT  C 3 7   ? 85.60268  9.39136   6.51630   1.000 22.08326 ? 7   DT  C "H5''" 1 
ATOM   2957 H "H4'"  . DT  C 3 7   ? 87.83550  8.88768   6.10935   1.000 24.03370 ? 7   DT  C "H4'"  1 
ATOM   2958 H "H3'"  . DT  C 3 7   ? 87.10779  9.61778   8.66583   1.000 25.22051 ? 7   DT  C "H3'"  1 
ATOM   2959 H "H2'"  . DT  C 3 7   ? 88.87321  10.88216  9.06428   1.000 24.36216 ? 7   DT  C "H2'"  1 
ATOM   2960 H "H2''" . DT  C 3 7   ? 89.73470  9.55929   9.01620   1.000 24.36216 ? 7   DT  C "H2''" 1 
ATOM   2961 H "H1'"  . DT  C 3 7   ? 90.25518  9.82701   6.84564   1.000 24.43585 ? 7   DT  C "H1'"  1 
ATOM   2962 H H3     . DT  C 3 7   ? 93.25943  12.97571  6.66871   1.000 21.50365 ? 7   DT  C H3     1 
ATOM   2963 H H71    . DT  C 3 7   ? 90.33895  16.18629  7.72976   1.000 21.43241 ? 7   DT  C H71    1 
ATOM   2964 H H72    . DT  C 3 7   ? 89.01629  15.57932  7.09285   1.000 21.43241 ? 7   DT  C H72    1 
ATOM   2965 H H73    . DT  C 3 7   ? 89.31964  15.37493  8.63872   1.000 21.43241 ? 7   DT  C H73    1 
ATOM   2966 H H6     . DT  C 3 7   ? 88.91217  12.96739  7.63174   1.000 23.23567 ? 7   DT  C H6     1 
ATOM   2967 P P      . DT  C 3 8   ? 87.98027  7.22565   9.69624   1.000 22.27823 ? 8   DT  C P      1 
ATOM   2968 O OP1    . DT  C 3 8   ? 87.30390  5.91947   9.51523   1.000 20.42091 ? 8   DT  C OP1    1 
ATOM   2969 O OP2    . DT  C 3 8   ? 87.43956  8.21717   10.65417  1.000 22.85505 ? 8   DT  C OP2    1 
ATOM   2970 O "O5'"  . DT  C 3 8   ? 89.52448  6.99680   10.04795  1.000 20.63197 ? 8   DT  C "O5'"  1 
ATOM   2971 C "C5'"  . DT  C 3 8   ? 90.36027  6.29526   9.13874   1.000 17.72344 ? 8   DT  C "C5'"  1 
ATOM   2972 C "C4'"  . DT  C 3 8   ? 91.82474  6.60245   9.39015   1.000 17.05707 ? 8   DT  C "C4'"  1 
ATOM   2973 O "O4'"  . DT  C 3 8   ? 92.10174  7.96881   9.04115   1.000 16.09236 ? 8   DT  C "O4'"  1 
ATOM   2974 C "C3'"  . DT  C 3 8   ? 92.28005  6.47168   10.84074  1.000 18.89977 ? 8   DT  C "C3'"  1 
ATOM   2975 O "O3'"  . DT  C 3 8   ? 92.84662  5.18451   11.06983  1.000 21.19870 ? 8   DT  C "O3'"  1 
ATOM   2976 C "C2'"  . DT  C 3 8   ? 93.30506  7.60880   11.02106  1.000 17.72913 ? 8   DT  C "C2'"  1 
ATOM   2977 C "C1'"  . DT  C 3 8   ? 93.29161  8.34838   9.68268   1.000 16.46444 ? 8   DT  C "C1'"  1 
ATOM   2978 N N1     . DT  C 3 8   ? 93.31992  9.84860   9.78739   1.000 16.28595 ? 8   DT  C N1     1 
ATOM   2979 C C2     . DT  C 3 8   ? 94.48691  10.52688  9.50485   1.000 17.41231 ? 8   DT  C C2     1 
ATOM   2980 O O2     . DT  C 3 8   ? 95.52744  9.97435   9.18490   1.000 18.62412 ? 8   DT  C O2     1 
ATOM   2981 N N3     . DT  C 3 8   ? 94.40066  11.88506  9.61832   1.000 17.03787 ? 8   DT  C N3     1 
ATOM   2982 C C4     . DT  C 3 8   ? 93.28743  12.62643  9.97152   1.000 15.92695 ? 8   DT  C C4     1 
ATOM   2983 O O4     . DT  C 3 8   ? 93.30901  13.85642  10.04170  1.000 14.55747 ? 8   DT  C O4     1 
ATOM   2984 C C5     . DT  C 3 8   ? 92.09917  11.85485  10.24819  1.000 15.30586 ? 8   DT  C C5     1 
ATOM   2985 C C7     . DT  C 3 8   ? 90.82922  12.54491  10.64415  1.000 14.34092 ? 8   DT  C C7     1 
ATOM   2986 C C6     . DT  C 3 8   ? 92.17197  10.51934  10.14040  1.000 15.78898 ? 8   DT  C C6     1 
ATOM   2987 H "H5'"  . DT  C 3 8   ? 90.13197  6.55400   8.23219   1.000 21.26813 ? 8   DT  C "H5'"  1 
ATOM   2988 H "H5''" . DT  C 3 8   ? 90.21289  5.34206   9.24170   1.000 21.26813 ? 8   DT  C "H5''" 1 
ATOM   2989 H "H4'"  . DT  C 3 8   ? 92.35863  6.01417   8.83356   1.000 20.46848 ? 8   DT  C "H4'"  1 
ATOM   2990 H "H3'"  . DT  C 3 8   ? 91.52832  6.62461   11.43440  1.000 22.67973 ? 8   DT  C "H3'"  1 
ATOM   2991 H "H2'"  . DT  C 3 8   ? 93.04214  8.19916   11.74442  1.000 21.27496 ? 8   DT  C "H2'"  1 
ATOM   2992 H "H2''" . DT  C 3 8   ? 94.18712  7.25189   11.20946  1.000 21.27496 ? 8   DT  C "H2''" 1 
ATOM   2993 H "H1'"  . DT  C 3 8   ? 94.05806  8.06369   9.16077   1.000 19.75733 ? 8   DT  C "H1'"  1 
ATOM   2994 H H3     . DT  C 3 8   ? 95.11822  12.32882  9.45165   1.000 20.44544 ? 8   DT  C H3     1 
ATOM   2995 H H71    . DT  C 3 8   ? 90.96641  13.50445  10.60709  1.000 17.20911 ? 8   DT  C H71    1 
ATOM   2996 H H72    . DT  C 3 8   ? 90.12486  12.28747  10.02894  1.000 17.20911 ? 8   DT  C H72    1 
ATOM   2997 H H73    . DT  C 3 8   ? 90.59355  12.27908  11.54675  1.000 17.20911 ? 8   DT  C H73    1 
ATOM   2998 H H6     . DT  C 3 8   ? 91.40607  10.02098  10.31344  1.000 18.94678 ? 8   DT  C H6     1 
ATOM   2999 P P      . DA  C 3 9   ? 93.32508  4.73857   12.53915  1.000 23.26896 ? 9   DA  C P      1 
ATOM   3000 O OP1    . DA  C 3 9   ? 93.32749  3.25705   12.53736  1.000 24.57633 ? 9   DA  C OP1    1 
ATOM   3001 O OP2    . DA  C 3 9   ? 92.53157  5.46998   13.55197  1.000 22.92372 ? 9   DA  C OP2    1 
ATOM   3002 O "O5'"  . DA  C 3 9   ? 94.84230  5.25023   12.62104  1.000 23.00642 ? 9   DA  C "O5'"  1 
ATOM   3003 C "C5'"  . DA  C 3 9   ? 95.75625  4.87577   11.60335  1.000 23.24642 ? 9   DA  C "C5'"  1 
ATOM   3004 C "C4'"  . DA  C 3 9   ? 97.13138  5.47834   11.83148  1.000 23.79843 ? 9   DA  C "C4'"  1 
ATOM   3005 O "O4'"  . DA  C 3 9   ? 97.07531  6.91590   11.64202  1.000 23.83700 ? 9   DA  C "O4'"  1 
ATOM   3006 C "C3'"  . DA  C 3 9   ? 97.71603  5.25831   13.22110  1.000 24.95170 ? 9   DA  C "C3'"  1 
ATOM   3007 O "O3'"  . DA  C 3 9   ? 99.10406  4.97891   13.11879  1.000 26.56148 ? 9   DA  C "O3'"  1 
ATOM   3008 C "C2'"  . DA  C 3 9   ? 97.42931  6.57294   13.94246  1.000 24.71831 ? 9   DA  C "C2'"  1 
ATOM   3009 C "C1'"  . DA  C 3 9   ? 97.50405  7.59014   12.81388  1.000 24.29792 ? 9   DA  C "C1'"  1 
ATOM   3010 N N9     . DA  C 3 9   ? 96.64675  8.75577   12.97638  1.000 23.27402 ? 9   DA  C N9     1 
ATOM   3011 C C8     . DA  C 3 9   ? 95.31579  8.75777   13.27294  1.000 22.72127 ? 9   DA  C C8     1 
ATOM   3012 N N7     . DA  C 3 9   ? 94.78464  9.95350   13.31162  1.000 22.52766 ? 9   DA  C N7     1 
ATOM   3013 C C5     . DA  C 3 9   ? 95.83688  10.79384  12.99893  1.000 23.23975 ? 9   DA  C C5     1 
ATOM   3014 C C6     . DA  C 3 9   ? 95.92514  12.19241  12.87546  1.000 23.39911 ? 9   DA  C C6     1 
ATOM   3015 N N6     . DA  C 3 9   ? 94.88375  13.00796  13.06021  1.000 23.20910 ? 9   DA  C N6     1 
ATOM   3016 N N1     . DA  C 3 9   ? 97.12772  12.71906  12.55564  1.000 22.63670 ? 9   DA  C N1     1 
ATOM   3017 C C2     . DA  C 3 9   ? 98.16257  11.89310  12.37065  1.000 22.74887 ? 9   DA  C C2     1 
ATOM   3018 N N3     . DA  C 3 9   ? 98.20016  10.56348  12.45921  1.000 23.51270 ? 9   DA  C N3     1 
ATOM   3019 C C4     . DA  C 3 9   ? 96.99208  10.07225  12.78094  1.000 23.33192 ? 9   DA  C C4     1 
ATOM   3020 H "H5'"  . DA  C 3 9   ? 95.41672  5.17882   10.74674  1.000 27.89570 ? 9   DA  C "H5'"  1 
ATOM   3021 H "H5''" . DA  C 3 9   ? 95.83354  3.90898   11.58830  1.000 27.89570 ? 9   DA  C "H5''" 1 
ATOM   3022 H "H4'"  . DA  C 3 9   ? 97.74583  5.10815   11.17855  1.000 28.55811 ? 9   DA  C "H4'"  1 
ATOM   3023 H "H3'"  . DA  C 3 9   ? 97.25477  4.53715   13.67725  1.000 29.94205 ? 9   DA  C "H3'"  1 
ATOM   3024 H "H2'"  . DA  C 3 9   ? 96.55048  6.56558   14.35296  1.000 29.66197 ? 9   DA  C "H2'"  1 
ATOM   3025 H "H2''" . DA  C 3 9   ? 98.09496  6.75341   14.62454  1.000 29.66197 ? 9   DA  C "H2''" 1 
ATOM   3026 H "H1'"  . DA  C 3 9   ? 98.42573  7.88072   12.73041  1.000 29.15751 ? 9   DA  C "H1'"  1 
ATOM   3027 H H8     . DA  C 3 9   ? 94.83009  7.98100   13.43300  1.000 27.26552 ? 9   DA  C H8     1 
ATOM   3028 H H61    . DA  C 3 9   ? 94.11401  12.68308  13.26403  1.000 27.85092 ? 9   DA  C H61    1 
ATOM   3029 H H62    . DA  C 3 9   ? 94.98293  13.85800  12.97535  1.000 27.85092 ? 9   DA  C H62    1 
ATOM   3030 H H2     . DA  C 3 9   ? 98.96765  12.30282  12.14960  1.000 27.29865 ? 9   DA  C H2     1 
ATOM   3031 P P      . DG  C 3 10  ? 99.95290  4.55466   14.40954  1.000 28.84502 ? 10  DG  C P      1 
ATOM   3032 O OP1    . DG  C 3 10  ? 101.13979 3.82773   13.90979  1.000 29.69998 ? 10  DG  C OP1    1 
ATOM   3033 O OP2    . DG  C 3 10  ? 99.04502  3.92219   15.39140  1.000 29.56837 ? 10  DG  C OP2    1 
ATOM   3034 O "O5'"  . DG  C 3 10  ? 100.45018 5.94817   14.99371  1.000 28.55971 ? 10  DG  C "O5'"  1 
ATOM   3035 C "C5'"  . DG  C 3 10  ? 101.21626 6.80646   14.16855  1.000 28.06933 ? 10  DG  C "C5'"  1 
ATOM   3036 C "C4'"  . DG  C 3 10  ? 101.48168 8.13049   14.85703  1.000 27.34737 ? 10  DG  C "C4'"  1 
ATOM   3037 O "O4'"  . DG  C 3 10  ? 100.30007 8.97908   14.76524  1.000 25.91695 ? 10  DG  C "O4'"  1 
ATOM   3038 C "C3'"  . DG  C 3 10  ? 101.80035 8.02846   16.35621  1.000 27.30739 ? 10  DG  C "C3'"  1 
ATOM   3039 O "O3'"  . DG  C 3 10  ? 102.90264 8.85701   16.69118  1.000 29.72310 ? 10  DG  C "O3'"  1 
ATOM   3040 C "C2'"  . DG  C 3 10  ? 100.51731 8.51953   17.00775  1.000 25.28506 ? 10  DG  C "C2'"  1 
ATOM   3041 C "C1'"  . DG  C 3 10  ? 100.10451 9.57852   16.01920  1.000 24.56959 ? 10  DG  C "C1'"  1 
ATOM   3042 N N9     . DG  C 3 10  ? 98.73028  10.04252  16.14389  1.000 23.72845 ? 10  DG  C N9     1 
ATOM   3043 C C8     . DG  C 3 10  ? 97.60365  9.30465   16.41670  1.000 23.28653 ? 10  DG  C C8     1 
ATOM   3044 N N7     . DG  C 3 10  ? 96.51459  10.02806  16.47496  1.000 23.18247 ? 10  DG  C N7     1 
ATOM   3045 C C5     . DG  C 3 10  ? 96.95868  11.32432  16.21942  1.000 23.75489 ? 10  DG  C C5     1 
ATOM   3046 C C6     . DG  C 3 10  ? 96.24657  12.54905  16.14789  1.000 23.35950 ? 10  DG  C C6     1 
ATOM   3047 O O6     . DG  C 3 10  ? 95.03472  12.74775  16.29726  1.000 22.35574 ? 10  DG  C O6     1 
ATOM   3048 N N1     . DG  C 3 10  ? 97.09491  13.62085  15.86906  1.000 23.89846 ? 10  DG  C N1     1 
ATOM   3049 C C2     . DG  C 3 10  ? 98.45388  13.52087  15.68646  1.000 24.17788 ? 10  DG  C C2     1 
ATOM   3050 N N2     . DG  C 3 10  ? 99.11483  14.65488  15.42522  1.000 24.32357 ? 10  DG  C N2     1 
ATOM   3051 N N3     . DG  C 3 10  ? 99.12276  12.38874  15.75091  1.000 24.33927 ? 10  DG  C N3     1 
ATOM   3052 C C4     . DG  C 3 10  ? 98.31701  11.33823  16.01760  1.000 23.96026 ? 10  DG  C C4     1 
ATOM   3053 H "H5'"  . DG  C 3 10  ? 100.73452 6.96781   13.34224  1.000 33.68320 ? 10  DG  C "H5'"  1 
ATOM   3054 H "H5''" . DG  C 3 10  ? 102.06231 6.37907   13.96258  1.000 33.68320 ? 10  DG  C "H5''" 1 
ATOM   3055 H "H4'"  . DG  C 3 10  ? 102.21764 8.57460   14.40755  1.000 32.81684 ? 10  DG  C "H4'"  1 
ATOM   3056 H "H3'"  . DG  C 3 10  ? 101.97957 7.10626   16.59775  1.000 32.76887 ? 10  DG  C "H3'"  1 
ATOM   3057 H "H2'"  . DG  C 3 10  ? 99.85534  7.81411   17.07905  1.000 30.34207 ? 10  DG  C "H2'"  1 
ATOM   3058 H "H2''" . DG  C 3 10  ? 100.67890 8.89122   17.88902  1.000 30.34207 ? 10  DG  C "H2''" 1 
ATOM   3059 H "H1'"  . DG  C 3 10  ? 100.67016 10.36122  16.11040  1.000 29.48350 ? 10  DG  C "H1'"  1 
ATOM   3060 H H8     . DG  C 3 10  ? 97.61401  8.38386   16.54685  1.000 27.94384 ? 10  DG  C H8     1 
ATOM   3061 H H1     . DG  C 3 10  ? 96.74144  14.40237  15.80674  1.000 28.67815 ? 10  DG  C H1     1 
ATOM   3062 H H21    . DG  C 3 10  ? 98.68862  15.40050  15.38066  1.000 29.18828 ? 10  DG  C H21    1 
ATOM   3063 H H22    . DG  C 3 10  ? 99.96578  14.63797  15.30191  1.000 29.18828 ? 10  DG  C H22    1 
ATOM   3064 P P      . DC  C 3 11  ? 104.40693 8.42016   16.34192  1.000 31.13358 ? 11  DC  C P      1 
ATOM   3065 O OP1    . DC  C 3 11  ? 105.22325 9.64441   16.50193  1.000 30.51033 ? 11  DC  C OP1    1 
ATOM   3066 O OP2    . DC  C 3 11  ? 104.41749 7.68226   15.05874  1.000 30.84326 ? 11  DC  C OP2    1 
ATOM   3067 O "O5'"  . DC  C 3 11  ? 104.78000 7.37634   17.49133  1.000 32.82949 ? 11  DC  C "O5'"  1 
ATOM   3068 C "C5'"  . DC  C 3 11  ? 104.53594 7.69731   18.85020  1.000 33.88731 ? 11  DC  C "C5'"  1 
ATOM   3069 C "C4'"  . DC  C 3 11  ? 105.13870 6.64984   19.75997  1.000 35.58374 ? 11  DC  C "C4'"  1 
ATOM   3070 O "O4'"  . DC  C 3 11  ? 104.48553 5.37063   19.52139  1.000 36.53671 ? 11  DC  C "O4'"  1 
ATOM   3071 C "C3'"  . DC  C 3 11  ? 106.62601 6.41425   19.54443  1.000 37.22699 ? 11  DC  C "C3'"  1 
ATOM   3072 O "O3'"  . DC  C 3 11  ? 107.29577 6.22279   20.77615  1.000 38.28069 ? 11  DC  C "O3'"  1 
ATOM   3073 C "C2'"  . DC  C 3 11  ? 106.67005 5.17386   18.66545  1.000 37.70775 ? 11  DC  C "C2'"  1 
ATOM   3074 C "C1'"  . DC  C 3 11  ? 105.42109 4.41105   19.07371  1.000 37.68548 ? 11  DC  C "C1'"  1 
ATOM   3075 N N1     . DC  C 3 11  ? 104.82078 3.63438   17.94998  1.000 39.20696 ? 11  DC  C N1     1 
ATOM   3076 C C2     . DC  C 3 11  ? 105.16129 2.28648   17.77699  1.000 39.22482 ? 11  DC  C C2     1 
ATOM   3077 O O2     . DC  C 3 11  ? 105.93986 1.75379   18.57400  1.000 39.49680 ? 11  DC  C O2     1 
ATOM   3078 N N3     . DC  C 3 11  ? 104.62082 1.60095   16.74105  1.000 39.25404 ? 11  DC  C N3     1 
ATOM   3079 C C4     . DC  C 3 11  ? 103.78027 2.20893   15.90408  1.000 39.75356 ? 11  DC  C C4     1 
ATOM   3080 N N4     . DC  C 3 11  ? 103.27318 1.49000   14.89829  1.000 40.24365 ? 11  DC  C N4     1 
ATOM   3081 C C5     . DC  C 3 11  ? 103.42630 3.58173   16.05832  1.000 39.82570 ? 11  DC  C C5     1 
ATOM   3082 C C6     . DC  C 3 11  ? 103.96891 4.25068   17.08197  1.000 39.79404 ? 11  DC  C C6     1 
ATOM   3083 H "H5'"  . DC  C 3 11  ? 103.57900 7.74216   19.00240  1.000 40.66478 ? 11  DC  C "H5'"  1 
ATOM   3084 H "H5''" . DC  C 3 11  ? 104.92852 8.56122   19.05131  1.000 40.66478 ? 11  DC  C "H5''" 1 
ATOM   3085 H "H4'"  . DC  C 3 11  ? 104.99169 6.89774   20.68616  1.000 42.70048 ? 11  DC  C "H4'"  1 
ATOM   3086 H "H3'"  . DC  C 3 11  ? 107.00805 7.16905   19.06984  1.000 44.67239 ? 11  DC  C "H3'"  1 
ATOM   3087 H "H2'"  . DC  C 3 11  ? 106.64309 5.41075   17.72520  1.000 45.24930 ? 11  DC  C "H2'"  1 
ATOM   3088 H "H2''" . DC  C 3 11  ? 107.46972 4.65230   18.83691  1.000 45.24930 ? 11  DC  C "H2''" 1 
ATOM   3089 H "H1'"  . DC  C 3 11  ? 105.62655 3.81287   19.80915  1.000 45.22257 ? 11  DC  C "H1'"  1 
ATOM   3090 H H41    . DC  C 3 11  ? 103.49193 0.66323   14.80769  1.000 48.29238 ? 11  DC  C H41    1 
ATOM   3091 H H42    . DC  C 3 11  ? 102.72809 1.85407   14.34158  1.000 48.29238 ? 11  DC  C H42    1 
ATOM   3092 H H5     . DC  C 3 11  ? 102.83934 3.99705   15.46850  1.000 47.79084 ? 11  DC  C H5     1 
ATOM   3093 H H6     . DC  C 3 11  ? 103.76202 5.14922   17.20327  1.000 47.75285 ? 11  DC  C H6     1 
ATOM   3094 P P      . DC  C 3 12  ? 108.78021 6.79853   20.97139  1.000 38.39449 ? 12  DC  C P      1 
ATOM   3095 O OP1    . DC  C 3 12  ? 108.70864 8.27566   20.91256  1.000 37.61742 ? 12  DC  C OP1    1 
ATOM   3096 O OP2    . DC  C 3 12  ? 109.67752 6.05134   20.06496  1.000 38.70027 ? 12  DC  C OP2    1 
ATOM   3097 O "O5'"  . DC  C 3 12  ? 109.13804 6.40139   22.46374  1.000 41.88486 ? 12  DC  C "O5'"  1 
ATOM   3098 C "C5'"  . DC  C 3 12  ? 108.50015 7.06534   23.51859  1.000 46.34080 ? 12  DC  C "C5'"  1 
ATOM   3099 C "C4'"  . DC  C 3 12  ? 108.42628 6.17477   24.72918  1.000 50.40072 ? 12  DC  C "C4'"  1 
ATOM   3100 O "O4'"  . DC  C 3 12  ? 107.73965 4.95439   24.39260  1.000 51.83929 ? 12  DC  C "O4'"  1 
ATOM   3101 C "C3'"  . DC  C 3 12  ? 109.76241 5.70562   25.25489  1.000 52.99716 ? 12  DC  C "C3'"  1 
ATOM   3102 O "O3'"  . DC  C 3 12  ? 110.35977 6.69391   26.08664  1.000 54.22691 ? 12  DC  C "O3'"  1 
ATOM   3103 C "C2'"  . DC  C 3 12  ? 109.38886 4.43487   26.01841  1.000 53.77640 ? 12  DC  C "C2'"  1 
ATOM   3104 C "C1'"  . DC  C 3 12  ? 108.08518 3.97033   25.34647  1.000 53.99629 ? 12  DC  C "C1'"  1 
ATOM   3105 N N1     . DC  C 3 12  ? 108.19525 2.61764   24.68614  1.000 56.58285 ? 12  DC  C N1     1 
ATOM   3106 C C2     . DC  C 3 12  ? 108.00751 2.47104   23.29863  1.000 57.84516 ? 12  DC  C C2     1 
ATOM   3107 O O2     . DC  C 3 12  ? 107.75441 3.46308   22.60522  1.000 58.82734 ? 12  DC  C O2     1 
ATOM   3108 N N3     . DC  C 3 12  ? 108.11234 1.23291   22.75264  1.000 57.81340 ? 12  DC  C N3     1 
ATOM   3109 C C4     . DC  C 3 12  ? 108.38748 0.18039   23.52452  1.000 58.07865 ? 12  DC  C C4     1 
ATOM   3110 N N4     . DC  C 3 12  ? 108.48219 -1.01737  22.93871  1.000 58.38274 ? 12  DC  C N4     1 
ATOM   3111 C C5     . DC  C 3 12  ? 108.57813 0.30821   24.93089  1.000 58.13656 ? 12  DC  C C5     1 
ATOM   3112 C C6     . DC  C 3 12  ? 108.47297 1.52961   25.46262  1.000 57.53809 ? 12  DC  C C6     1 
ATOM   3113 H "H5'"  . DC  C 3 12  ? 107.60275 7.31355   23.24663  1.000 55.60895 ? 12  DC  C "H5'"  1 
ATOM   3114 H "H5''" . DC  C 3 12  ? 108.99658 7.86871   23.74008  1.000 55.60895 ? 12  DC  C "H5''" 1 
ATOM   3115 H "H4'"  . DC  C 3 12  ? 107.94084 6.64487   25.42506  1.000 60.48086 ? 12  DC  C "H4'"  1 
ATOM   3116 H "H3'"  . DC  C 3 12  ? 110.36160 5.49382   24.52208  1.000 63.59660 ? 12  DC  C "H3'"  1 
ATOM   3117 H "H2'"  . DC  C 3 12  ? 110.08234 3.76203   25.93317  1.000 64.53168 ? 12  DC  C "H2'"  1 
ATOM   3118 H "H2''" . DC  C 3 12  ? 109.24640 4.62414   26.95904  1.000 64.53168 ? 12  DC  C "H2''" 1 
ATOM   3119 H "H1'"  . DC  C 3 12  ? 107.37312 3.93348   26.00413  1.000 64.79555 ? 12  DC  C "H1'"  1 
ATOM   3120 H H41    . DC  C 3 12  ? 108.36677 -1.09114  22.08969  1.000 70.05929 ? 12  DC  C H41    1 
ATOM   3121 H H42    . DC  C 3 12  ? 108.65855 -1.71422  23.41084  1.000 70.05929 ? 12  DC  C H42    1 
ATOM   3122 H H5     . DC  C 3 12  ? 108.76903 -0.43236  25.46006  1.000 69.76387 ? 12  DC  C H5     1 
ATOM   3123 H H6     . DC  C 3 12  ? 108.59112 1.64053   26.37839  1.000 69.04571 ? 12  DC  C H6     1 
ATOM   3124 P P      . DC  C 3 13  ? 111.88579 6.53543   26.56537  1.000 55.84278 ? 13  DC  C P      1 
ATOM   3125 O OP1    . DC  C 3 13  ? 112.63295 7.72347   26.08850  1.000 56.01495 ? 13  DC  C OP1    1 
ATOM   3126 O OP2    . DC  C 3 13  ? 112.35279 5.17451   26.21135  1.000 55.97591 ? 13  DC  C OP2    1 
ATOM   3127 O "O5'"  . DC  C 3 13  ? 111.78556 6.57062   28.15786  1.000 55.48069 ? 13  DC  C "O5'"  1 
ATOM   3128 C "C5'"  . DC  C 3 13  ? 110.93993 7.51206   28.80063  1.000 54.74443 ? 13  DC  C "C5'"  1 
ATOM   3129 C "C4'"  . DC  C 3 13  ? 110.98936 7.32590   30.30066  1.000 53.43060 ? 13  DC  C "C4'"  1 
ATOM   3130 O "O4'"  . DC  C 3 13  ? 110.27642 6.10891   30.65647  1.000 53.62840 ? 13  DC  C "O4'"  1 
ATOM   3131 C "C3'"  . DC  C 3 13  ? 112.39495 7.17506   30.86866  1.000 51.63366 ? 13  DC  C "C3'"  1 
ATOM   3132 O "O3'"  . DC  C 3 13  ? 112.50034 7.82724   32.12908  1.000 48.57312 ? 13  DC  C "O3'"  1 
ATOM   3133 C "C2'"  . DC  C 3 13  ? 112.57073 5.66442   30.97311  1.000 52.76310 ? 13  DC  C "C2'"  1 
ATOM   3134 C "C1'"  . DC  C 3 13  ? 111.15818 5.17460   31.25251  1.000 54.12905 ? 13  DC  C "C1'"  1 
ATOM   3135 N N1     . DC  C 3 13  ? 110.87177 3.82811   30.68820  1.000 56.31475 ? 13  DC  C N1     1 
ATOM   3136 C C2     . DC  C 3 13  ? 110.82935 2.71182   31.53289  1.000 57.36479 ? 13  DC  C C2     1 
ATOM   3137 O O2     . DC  C 3 13  ? 111.03142 2.86200   32.74580  1.000 57.49866 ? 13  DC  C O2     1 
ATOM   3138 N N3     . DC  C 3 13  ? 110.56529 1.49370   30.99554  1.000 57.89936 ? 13  DC  C N3     1 
ATOM   3139 C C4     . DC  C 3 13  ? 110.35276 1.37410   29.68323  1.000 58.12044 ? 13  DC  C C4     1 
ATOM   3140 N N4     . DC  C 3 13  ? 110.09773 0.15560   29.19905  1.000 58.41183 ? 13  DC  C N4     1 
ATOM   3141 C C5     . DC  C 3 13  ? 110.39316 2.49896   28.80922  1.000 57.81689 ? 13  DC  C C5     1 
ATOM   3142 C C6     . DC  C 3 13  ? 110.65342 3.69410   29.34909  1.000 57.28246 ? 13  DC  C C6     1 
ATOM   3143 H "H5'"  . DC  C 3 13  ? 110.02877 7.38972   28.49124  1.000 65.69331 ? 13  DC  C "H5'"  1 
ATOM   3144 H "H5''" . DC  C 3 13  ? 111.23104 8.41023   28.57826  1.000 65.69331 ? 13  DC  C "H5''" 1 
ATOM   3145 H "H4'"  . DC  C 3 13  ? 110.55360 8.07432   30.73757  1.000 64.11672 ? 13  DC  C "H4'"  1 
ATOM   3146 H "H3'"  . DC  C 3 13  ? 113.04710 7.53898   30.24966  1.000 61.96039 ? 13  DC  C "H3'"  1 
ATOM   3147 H "H2'"  . DC  C 3 13  ? 112.91335 5.29312   30.14507  1.000 63.31573 ? 13  DC  C "H2'"  1 
ATOM   3148 H "H2''" . DC  C 3 13  ? 113.17263 5.43059   31.69695  1.000 63.31573 ? 13  DC  C "H2''" 1 
ATOM   3149 H "H1'"  . DC  C 3 13  ? 111.00856 5.16176   32.21081  1.000 64.95486 ? 13  DC  C "H1'"  1 
ATOM   3150 H H41    . DC  C 3 13  ? 110.07444 -0.52142  29.72886  1.000 70.09419 ? 13  DC  C H41    1 
ATOM   3151 H H42    . DC  C 3 13  ? 109.95681 0.04811   28.35752  1.000 70.09419 ? 13  DC  C H42    1 
ATOM   3152 H H5     . DC  C 3 13  ? 110.24386 2.40508   27.89610  1.000 69.38027 ? 13  DC  C H5     1 
ATOM   3153 H H6     . DC  C 3 13  ? 110.68603 4.44586   28.80257  1.000 68.73896 ? 13  DC  C H6     1 
ATOM   3154 P P      . DA  C 3 14  ? 113.82192 8.65475   32.51974  1.000 45.80171 ? 14  DA  C P      1 
ATOM   3155 O OP1    . DA  C 3 14  ? 114.76530 8.68869   31.38164  1.000 46.45660 ? 14  DA  C OP1    1 
ATOM   3156 O OP2    . DA  C 3 14  ? 114.25881 8.11791   33.82561  1.000 46.43639 ? 14  DA  C OP2    1 
ATOM   3157 O "O5'"  . DA  C 3 14  ? 113.29075 10.14156  32.72465  1.000 42.02879 ? 14  DA  C "O5'"  1 
ATOM   3158 C "C5'"  . DA  C 3 14  ? 112.20899 10.38975  33.59700  1.000 39.64167 ? 14  DA  C "C5'"  1 
ATOM   3159 C "C4'"  . DA  C 3 14  ? 112.43501 11.66995  34.36655  1.000 37.76626 ? 14  DA  C "C4'"  1 
ATOM   3160 O "O4'"  . DA  C 3 14  ? 113.64495 11.53833  35.13920  1.000 36.34727 ? 14  DA  C "O4'"  1 
ATOM   3161 C "C3'"  . DA  C 3 14  ? 112.64061 12.89551  33.49918  1.000 37.80896 ? 14  DA  C "C3'"  1 
ATOM   3162 O "O3'"  . DA  C 3 14  ? 111.40216 13.53689  33.23850  1.000 39.45855 ? 14  DA  C "O3'"  1 
ATOM   3163 C "C2'"  . DA  C 3 14  ? 113.59160 13.76960  34.31607  1.000 35.87774 ? 14  DA  C "C2'"  1 
ATOM   3164 C "C1'"  . DA  C 3 14  ? 114.28383 12.79276  35.26490  1.000 33.41170 ? 14  DA  C "C1'"  1 
ATOM   3165 N N9     . DA  C 3 14  ? 115.71021 12.61109  35.00604  1.000 28.09944 ? 14  DA  C N9     1 
ATOM   3166 C C8     . DA  C 3 14  ? 116.35606 11.43954  34.71432  1.000 26.88024 ? 14  DA  C C8     1 
ATOM   3167 N N7     . DA  C 3 14  ? 117.65355 11.57441  34.55692  1.000 26.35916 ? 14  DA  C N7     1 
ATOM   3168 C C5     . DA  C 3 14  ? 117.87074 12.92704  34.76210  1.000 26.64597 ? 14  DA  C C5     1 
ATOM   3169 C C6     . DA  C 3 14  ? 119.03250 13.71371  34.73796  1.000 25.40848 ? 14  DA  C C6     1 
ATOM   3170 N N6     . DA  C 3 14  ? 120.24730 13.22308  34.48065  1.000 25.46059 ? 14  DA  C N6     1 
ATOM   3171 N N1     . DA  C 3 14  ? 118.89987 15.03053  34.98894  1.000 25.70422 ? 14  DA  C N1     1 
ATOM   3172 C C2     . DA  C 3 14  ? 117.68706 15.52152  35.24643  1.000 26.06738 ? 14  DA  C C2     1 
ATOM   3173 N N3     . DA  C 3 14  ? 116.52319 14.88359  35.29893  1.000 27.00520 ? 14  DA  C N3     1 
ATOM   3174 C C4     . DA  C 3 14  ? 116.68508 13.57706  35.04556  1.000 27.02713 ? 14  DA  C C4     1 
ATOM   3175 H "H5'"  . DA  C 3 14  ? 112.12264 9.65130   34.22001  1.000 47.57000 ? 14  DA  C "H5'"  1 
ATOM   3176 H "H5''" . DA  C 3 14  ? 111.39097 10.46505  33.08118  1.000 47.57000 ? 14  DA  C "H5''" 1 
ATOM   3177 H "H4'"  . DA  C 3 14  ? 111.68829 11.82782  34.96521  1.000 45.31951 ? 14  DA  C "H4'"  1 
ATOM   3178 H "H3'"  . DA  C 3 14  ? 113.07095 12.64053  32.66811  1.000 45.37075 ? 14  DA  C "H3'"  1 
ATOM   3179 H "H2'"  . DA  C 3 14  ? 114.23750 14.20846  33.74065  1.000 43.05329 ? 14  DA  C "H2'"  1 
ATOM   3180 H "H2''" . DA  C 3 14  ? 113.10107 14.44369  34.81193  1.000 43.05329 ? 14  DA  C "H2''" 1 
ATOM   3181 H "H1'"  . DA  C 3 14  ? 114.15823 13.11650  36.17061  1.000 40.09404 ? 14  DA  C "H1'"  1 
ATOM   3182 H H8     . DA  C 3 14  ? 115.91689 10.62362  34.63491  1.000 32.25628 ? 14  DA  C H8     1 
ATOM   3183 H H61    . DA  C 3 14  ? 120.34685 12.38436  34.31867  1.000 30.55271 ? 14  DA  C H61    1 
ATOM   3184 H H62    . DA  C 3 14  ? 120.93021 13.74578  34.47689  1.000 30.55271 ? 14  DA  C H62    1 
ATOM   3185 H H2     . DA  C 3 14  ? 117.65123 16.43597  35.41194  1.000 31.28086 ? 14  DA  C H2     1 
ATOM   3186 P P      . DT  C 3 15  ? 111.15367 14.24261  31.81718  1.000 40.83784 ? 15  DT  C P      1 
ATOM   3187 O OP1    . DT  C 3 15  ? 109.72332 14.63228  31.73010  1.000 40.26902 ? 15  DT  C OP1    1 
ATOM   3188 O OP2    . DT  C 3 15  ? 111.78760 13.38949  30.78013  1.000 41.33876 ? 15  DT  C OP2    1 
ATOM   3189 O "O5'"  . DT  C 3 15  ? 111.99942 15.58328  31.92260  1.000 36.66917 ? 15  DT  C "O5'"  1 
ATOM   3190 C "C5'"  . DT  C 3 15  ? 111.77775 16.44364  33.00797  1.000 33.52051 ? 15  DT  C "C5'"  1 
ATOM   3191 C "C4'"  . DT  C 3 15  ? 112.71502 17.61767  32.94637  1.000 30.06654 ? 15  DT  C "C4'"  1 
ATOM   3192 O "O4'"  . DT  C 3 15  ? 114.07316 17.15050  33.13376  1.000 28.28544 ? 15  DT  C "O4'"  1 
ATOM   3193 C "C3'"  . DT  C 3 15  ? 112.70580 18.36069  31.61777  1.000 29.77431 ? 15  DT  C "C3'"  1 
ATOM   3194 O "O3'"  . DT  C 3 15  ? 112.80183 19.75149  31.83726  1.000 31.41023 ? 15  DT  C "O3'"  1 
ATOM   3195 C "C2'"  . DT  C 3 15  ? 113.91957 17.79551  30.89529  1.000 28.33836 ? 15  DT  C "C2'"  1 
ATOM   3196 C "C1'"  . DT  C 3 15  ? 114.87539 17.55789  32.04671  1.000 26.53427 ? 15  DT  C "C1'"  1 
ATOM   3197 N N1     . DT  C 3 15  ? 115.90172 16.50990  31.80537  1.000 22.04456 ? 15  DT  C N1     1 
ATOM   3198 C C2     . DT  C 3 15  ? 117.22734 16.85309  31.86982  1.000 21.04879 ? 15  DT  C C2     1 
ATOM   3199 O O2     . DT  C 3 15  ? 117.61164 17.98794  32.08846  1.000 21.10323 ? 15  DT  C O2     1 
ATOM   3200 N N3     . DT  C 3 15  ? 118.09639 15.81944  31.65670  1.000 20.70482 ? 15  DT  C N3     1 
ATOM   3201 C C4     . DT  C 3 15  ? 117.77573 14.50311  31.40241  1.000 19.44939 ? 15  DT  C C4     1 
ATOM   3202 O O4     . DT  C 3 15  ? 118.63139 13.64726  31.22640  1.000 19.04740 ? 15  DT  C O4     1 
ATOM   3203 C C5     . DT  C 3 15  ? 116.36317 14.20840  31.35721  1.000 18.68002 ? 15  DT  C C5     1 
ATOM   3204 C C7     . DT  C 3 15  ? 115.89097 12.81326  31.08626  1.000 18.42040 ? 15  DT  C C7     1 
ATOM   3205 C C6     . DT  C 3 15  ? 115.50418 15.21340  31.56405  1.000 19.82752 ? 15  DT  C C6     1 
ATOM   3206 H "H5'"  . DT  C 3 15  ? 111.92237 15.96000  33.83626  1.000 40.22462 ? 15  DT  C "H5'"  1 
ATOM   3207 H "H5''" . DT  C 3 15  ? 110.86179 16.76197  32.98394  1.000 40.22462 ? 15  DT  C "H5''" 1 
ATOM   3208 H "H4'"  . DT  C 3 15  ? 112.50254 18.24330  33.65654  1.000 36.07984 ? 15  DT  C "H4'"  1 
ATOM   3209 H "H3'"  . DT  C 3 15  ? 111.90210 18.15344  31.11576  1.000 35.72917 ? 15  DT  C "H3'"  1 
ATOM   3210 H "H2'"  . DT  C 3 15  ? 113.70637 16.96971  30.43323  1.000 34.00603 ? 15  DT  C "H2'"  1 
ATOM   3211 H "H2''" . DT  C 3 15  ? 114.28155 18.43005  30.25714  1.000 34.00603 ? 15  DT  C "H2''" 1 
ATOM   3212 H "H1'"  . DT  C 3 15  ? 115.33029 18.38945  32.25279  1.000 31.84113 ? 15  DT  C "H1'"  1 
ATOM   3213 H H3     . DT  C 3 15  ? 118.93426 16.01133  31.68429  1.000 24.84578 ? 15  DT  C H3     1 
ATOM   3214 H H71    . DT  C 3 15  ? 116.65951 12.24851  30.90929  1.000 22.10448 ? 15  DT  C H71    1 
ATOM   3215 H H72    . DT  C 3 15  ? 115.41163 12.48559  31.86329  1.000 22.10448 ? 15  DT  C H72    1 
ATOM   3216 H H73    . DT  C 3 15  ? 115.30305 12.82307  30.31479  1.000 22.10448 ? 15  DT  C H73    1 
ATOM   3217 H H6     . DT  C 3 15  ? 114.59324 15.02716  31.54386  1.000 23.79302 ? 15  DT  C H6     1 
ATOM   3218 P P      . DT  C 3 16  ? 112.68761 20.77172  30.60778  1.000 33.33083 ? 16  DT  C P      1 
ATOM   3219 O OP1    . DT  C 3 16  ? 111.92147 21.94330  31.09123  1.000 33.46174 ? 16  DT  C OP1    1 
ATOM   3220 O OP2    . DT  C 3 16  ? 112.24713 20.01481  29.41452  1.000 32.07422 ? 16  DT  C OP2    1 
ATOM   3221 O "O5'"  . DT  C 3 16  ? 114.19875 21.21159  30.35157  1.000 33.17649 ? 16  DT  C "O5'"  1 
ATOM   3222 C "C5'"  . DT  C 3 16  ? 115.00967 21.57781  31.44801  1.000 31.36344 ? 16  DT  C "C5'"  1 
ATOM   3223 C "C4'"  . DT  C 3 16  ? 116.35614 22.09494  30.98057  1.000 29.44524 ? 16  DT  C "C4'"  1 
ATOM   3224 O "O4'"  . DT  C 3 16  ? 117.27226 20.98045  30.79037  1.000 29.38214 ? 16  DT  C "O4'"  1 
ATOM   3225 C "C3'"  . DT  C 3 16  ? 116.33544 22.84548  29.65452  1.000 27.97991 ? 16  DT  C "C3'"  1 
ATOM   3226 O "O3'"  . DT  C 3 16  ? 117.18816 23.95640  29.72697  1.000 28.39887 ? 16  DT  C "O3'"  1 
ATOM   3227 C "C2'"  . DT  C 3 16  ? 116.82381 21.80648  28.65363  1.000 27.70113 ? 16  DT  C "C2'"  1 
ATOM   3228 C "C1'"  . DT  C 3 16  ? 117.82393 21.02955  29.48952  1.000 27.55243 ? 16  DT  C "C1'"  1 
ATOM   3229 N N1     . DT  C 3 16  ? 118.08665 19.62423  29.04862  1.000 24.37756 ? 16  DT  C N1     1 
ATOM   3230 C C2     . DT  C 3 16  ? 119.38210 19.15607  29.05671  1.000 23.17632 ? 16  DT  C C2     1 
ATOM   3231 O O2     . DT  C 3 16  ? 120.34098 19.84136  29.37158  1.000 21.92063 ? 16  DT  C O2     1 
ATOM   3232 N N3     . DT  C 3 16  ? 119.52164 17.85290  28.66667  1.000 23.79053 ? 16  DT  C N3     1 
ATOM   3233 C C4     . DT  C 3 16  ? 118.51928 16.98430  28.28651  1.000 23.40065 ? 16  DT  C C4     1 
ATOM   3234 O O4     . DT  C 3 16  ? 118.74878 15.82791  27.95498  1.000 23.25335 ? 16  DT  C O4     1 
ATOM   3235 C C5     . DT  C 3 16  ? 117.18370 17.53311  28.30891  1.000 23.11580 ? 16  DT  C C5     1 
ATOM   3236 C C7     . DT  C 3 16  ? 116.01434 16.68205  27.91818  1.000 22.35617 ? 16  DT  C C7     1 
ATOM   3237 C C6     . DT  C 3 16  ? 117.03156 18.80965  28.69362  1.000 23.32808 ? 16  DT  C C6     1 
ATOM   3238 H "H5'"  . DT  C 3 16  ? 115.14530 20.80391  32.01685  1.000 37.63613 ? 16  DT  C "H5'"  1 
ATOM   3239 H "H5''" . DT  C 3 16  ? 114.56183 22.27041  31.95855  1.000 37.63613 ? 16  DT  C "H5''" 1 
ATOM   3240 H "H4'"  . DT  C 3 16  ? 116.72010 22.67958  31.66368  1.000 35.33429 ? 16  DT  C "H4'"  1 
ATOM   3241 H "H3'"  . DT  C 3 16  ? 115.43214 23.11672  29.42786  1.000 33.57589 ? 16  DT  C "H3'"  1 
ATOM   3242 H "H2'"  . DT  C 3 16  ? 116.09935 21.23947  28.34614  1.000 33.24135 ? 16  DT  C "H2'"  1 
ATOM   3243 H "H2''" . DT  C 3 16  ? 117.24711 22.22207  27.88616  1.000 33.24135 ? 16  DT  C "H2''" 1 
ATOM   3244 H "H1'"  . DT  C 3 16  ? 118.66680 21.50957  29.48251  1.000 33.06291 ? 16  DT  C "H1'"  1 
ATOM   3245 H H3     . DT  C 3 16  ? 120.32270 17.54014  28.65728  1.000 28.54863 ? 16  DT  C H3     1 
ATOM   3246 H H71    . DT  C 3 16  ? 116.33920 15.82275  27.60679  1.000 26.82740 ? 16  DT  C H71    1 
ATOM   3247 H H72    . DT  C 3 16  ? 115.44128 16.55873  28.69103  1.000 26.82740 ? 16  DT  C H72    1 
ATOM   3248 H H73    . DT  C 3 16  ? 115.52306 17.12647  27.20964  1.000 26.82740 ? 16  DT  C H73    1 
ATOM   3249 H H6     . DT  C 3 16  ? 116.17172 19.16284  28.72234  1.000 27.99370 ? 16  DT  C H6     1 
ATOM   3250 P P      . DA  C 3 17  ? 117.05136 25.15938  28.68020  1.000 28.81983 ? 17  DA  C P      1 
ATOM   3251 O OP1    . DA  C 3 17  ? 116.95163 26.39170  29.48969  1.000 29.95722 ? 17  DA  C OP1    1 
ATOM   3252 O OP2    . DA  C 3 17  ? 116.02704 24.81133  27.66656  1.000 28.68491 ? 17  DA  C OP2    1 
ATOM   3253 O "O5'"  . DA  C 3 17  ? 118.44437 25.14643  27.91034  1.000 28.34153 ? 17  DA  C "O5'"  1 
ATOM   3254 C "C5'"  . DA  C 3 17  ? 119.64420 24.97621  28.63020  1.000 27.41880 ? 17  DA  C "C5'"  1 
ATOM   3255 C "C4'"  . DA  C 3 17  ? 120.71066 24.38224  27.74350  1.000 26.50053 ? 17  DA  C "C4'"  1 
ATOM   3256 O "O4'"  . DA  C 3 17  ? 120.45618 22.96091  27.55464  1.000 26.61002 ? 17  DA  C "O4'"  1 
ATOM   3257 C "C3'"  . DA  C 3 17  ? 120.77153 24.97136  26.33791  1.000 27.66667 ? 17  DA  C "C3'"  1 
ATOM   3258 O "O3'"  . DA  C 3 17  ? 122.09929 25.14026  25.94782  1.000 31.95306 ? 17  DA  C "O3'"  1 
ATOM   3259 C "C2'"  . DA  C 3 17  ? 120.06940 23.92457  25.49866  1.000 26.00230 ? 17  DA  C "C2'"  1 
ATOM   3260 C "C1'"  . DA  C 3 17  ? 120.55245 22.67362  26.17937  1.000 25.06553 ? 17  DA  C "C1'"  1 
ATOM   3261 N N9     . DA  C 3 17  ? 119.79013 21.47614  25.86217  1.000 22.58267 ? 17  DA  C N9     1 
ATOM   3262 C C8     . DA  C 3 17  ? 118.45100 21.37987  25.59532  1.000 21.07303 ? 17  DA  C C8     1 
ATOM   3263 N N7     . DA  C 3 17  ? 118.05217 20.15827  25.32992  1.000 19.97308 ? 17  DA  C N7     1 
ATOM   3264 C C5     . DA  C 3 17  ? 119.21278 19.40481  25.42482  1.000 21.62471 ? 17  DA  C C5     1 
ATOM   3265 C C6     . DA  C 3 17  ? 119.47326 18.03241  25.25673  1.000 22.14480 ? 17  DA  C C6     1 
ATOM   3266 N N6     . DA  C 3 17  ? 118.53551 17.14010  24.94178  1.000 22.84555 ? 17  DA  C N6     1 
ATOM   3267 N N1     . DA  C 3 17  ? 120.74552 17.61133  25.42600  1.000 22.39412 ? 17  DA  C N1     1 
ATOM   3268 C C2     . DA  C 3 17  ? 121.69042 18.50976  25.74079  1.000 20.93416 ? 17  DA  C C2     1 
ATOM   3269 N N3     . DA  C 3 17  ? 121.56779 19.82027  25.92408  1.000 20.16555 ? 17  DA  C N3     1 
ATOM   3270 C C4     . DA  C 3 17  ? 120.29173 20.20672  25.74904  1.000 21.68855 ? 17  DA  C C4     1 
ATOM   3271 H "H5'"  . DA  C 3 17  ? 119.48624 24.38515  29.38292  1.000 32.90257 ? 17  DA  C "H5'"  1 
ATOM   3272 H "H5''" . DA  C 3 17  ? 119.94471 25.83673  28.96200  1.000 32.90257 ? 17  DA  C "H5''" 1 
ATOM   3273 H "H4'"  . DA  C 3 17  ? 121.57340 24.49014  28.17356  1.000 31.80064 ? 17  DA  C "H4'"  1 
ATOM   3274 H "H3'"  . DA  C 3 17  ? 120.28987 25.81249  26.30042  1.000 33.20000 ? 17  DA  C "H3'"  1 
ATOM   3275 H "H2'"  . DA  C 3 17  ? 119.10442 24.01177  25.54454  1.000 31.20277 ? 17  DA  C "H2'"  1 
ATOM   3276 H "H2''" . DA  C 3 17  ? 120.34594 23.96067  24.56961  1.000 31.20277 ? 17  DA  C "H2''" 1 
ATOM   3277 H "H1'"  . DA  C 3 17  ? 121.47547 22.49244  25.94248  1.000 30.07863 ? 17  DA  C "H1'"  1 
ATOM   3278 H H8     . DA  C 3 17  ? 117.87743 22.11191  25.60153  1.000 25.28764 ? 17  DA  C H8     1 
ATOM   3279 H H61    . DA  C 3 17  ? 117.72111 17.39316  24.83082  1.000 27.41466 ? 17  DA  C H61    1 
ATOM   3280 H H62    . DA  C 3 17  ? 118.74456 16.31103  24.84941  1.000 27.41466 ? 17  DA  C H62    1 
ATOM   3281 H H2     . DA  C 3 17  ? 122.54933 18.16876  25.84511  1.000 25.12099 ? 17  DA  C H2     1 
ATOM   3282 P P      . DC  C 3 18  ? 122.83794 26.53005  26.22579  1.000 36.73194 ? 18  DC  C P      1 
ATOM   3283 O OP1    . DC  C 3 18  ? 122.60617 26.93296  27.63358  1.000 37.37854 ? 18  DC  C OP1    1 
ATOM   3284 O OP2    . DC  C 3 18  ? 122.45108 27.41940  25.10584  1.000 37.42437 ? 18  DC  C OP2    1 
ATOM   3285 O "O5'"  . DC  C 3 18  ? 124.37428 26.16335  26.07739  1.000 36.05149 ? 18  DC  C "O5'"  1 
ATOM   3286 C "C5'"  . DC  C 3 18  ? 124.89500 25.97300  24.80972  1.000 36.20073 ? 18  DC  C "C5'"  1 
ATOM   3287 C "C4'"  . DC  C 3 18  ? 125.48946 24.59491  24.66810  1.000 36.72045 ? 18  DC  C "C4'"  1 
ATOM   3288 O "O4'"  . DC  C 3 18  ? 124.43285 23.59951  24.63821  1.000 35.14362 ? 18  DC  C "O4'"  1 
ATOM   3289 C "C3'"  . DC  C 3 18  ? 126.28788 24.40923  23.38129  1.000 38.01374 ? 18  DC  C "C3'"  1 
ATOM   3290 O "O3'"  . DC  C 3 18  ? 127.60208 23.98217  23.67076  1.000 39.75401 ? 18  DC  C "O3'"  1 
ATOM   3291 C "C2'"  . DC  C 3 18  ? 125.49987 23.36993  22.59129  1.000 36.50096 ? 18  DC  C "C2'"  1 
ATOM   3292 C "C1'"  . DC  C 3 18  ? 124.75867 22.62622  23.67298  1.000 34.30426 ? 18  DC  C "C1'"  1 
ATOM   3293 N N1     . DC  C 3 18  ? 123.51607 21.95794  23.21211  1.000 31.78628 ? 18  DC  C N1     1 
ATOM   3294 C C2     . DC  C 3 18  ? 123.51380 20.57398  22.99556  1.000 31.35412 ? 18  DC  C C2     1 
ATOM   3295 O O2     . DC  C 3 18  ? 124.55556 19.93092  23.17406  1.000 31.50981 ? 18  DC  C O2     1 
ATOM   3296 N N3     . DC  C 3 18  ? 122.36523 19.97572  22.59805  1.000 29.40067 ? 18  DC  C N3     1 
ATOM   3297 C C4     . DC  C 3 18  ? 121.26432 20.70174  22.41655  1.000 27.58820 ? 18  DC  C C4     1 
ATOM   3298 N N4     . DC  C 3 18  ? 120.16271 20.06715  22.01843  1.000 27.84679 ? 18  DC  C N4     1 
ATOM   3299 C C5     . DC  C 3 18  ? 121.24529 22.10891  22.63076  1.000 27.77048 ? 18  DC  C C5     1 
ATOM   3300 C C6     . DC  C 3 18  ? 122.38267 22.69075  23.02512  1.000 29.74002 ? 18  DC  C C6     1 
ATOM   3301 H "H5'"  . DC  C 3 18  ? 125.58412 26.63563  24.64557  1.000 43.44088 ? 18  DC  C "H5'"  1 
ATOM   3302 H "H5''" . DC  C 3 18  ? 124.18797 26.08380  24.15494  1.000 43.44088 ? 18  DC  C "H5''" 1 
ATOM   3303 H "H4'"  . DC  C 3 18  ? 126.05240 24.39794  25.43308  1.000 44.06454 ? 18  DC  C "H4'"  1 
ATOM   3304 H "H3'"  . DC  C 3 18  ? 126.29996 25.24302  22.88575  1.000 45.61649 ? 18  DC  C "H3'"  1 
ATOM   3305 H "H2'"  . DC  C 3 18  ? 124.88596 23.79134  21.96966  1.000 43.80116 ? 18  DC  C "H2'"  1 
ATOM   3306 H "H2''" . DC  C 3 18  ? 126.09118 22.77890  22.09942  1.000 43.80116 ? 18  DC  C "H2''" 1 
ATOM   3307 H "H1'"  . DC  C 3 18  ? 125.33516 21.95225  24.06581  1.000 41.16511 ? 18  DC  C "H1'"  1 
ATOM   3308 H H41    . DC  C 3 18  ? 120.17949 19.21730  21.88776  1.000 33.41614 ? 18  DC  C H41    1 
ATOM   3309 H H42    . DC  C 3 18  ? 119.43479 20.50734  21.89208  1.000 33.41614 ? 18  DC  C H42    1 
ATOM   3310 H H5     . DC  C 3 18  ? 120.46978 22.60557  22.50108  1.000 33.32458 ? 18  DC  C H5     1 
ATOM   3311 H H6     . DC  C 3 18  ? 122.40045 23.60859  23.17391  1.000 35.68802 ? 18  DC  C H6     1 
ATOM   3312 P P      . DG  C 3 19  ? 128.83758 24.61362  22.86885  1.000 41.95153 ? 19  DG  C P      1 
ATOM   3313 O OP1    . DG  C 3 19  ? 129.75072 25.19567  23.87955  1.000 43.55548 ? 19  DG  C OP1    1 
ATOM   3314 O OP2    . DG  C 3 19  ? 128.29868 25.48327  21.79877  1.000 41.19220 ? 19  DG  C OP2    1 
ATOM   3315 O "O5'"  . DG  C 3 19  ? 129.51318 23.34690  22.16315  1.000 42.30741 ? 19  DG  C "O5'"  1 
ATOM   3316 C "C5'"  . DG  C 3 19  ? 129.99438 22.26418  22.95265  1.000 42.15300 ? 19  DG  C "C5'"  1 
ATOM   3317 C "C4'"  . DG  C 3 19  ? 130.19418 21.01838  22.10447  1.000 41.71052 ? 19  DG  C "C4'"  1 
ATOM   3318 O "O4'"  . DG  C 3 19  ? 128.89648 20.44014  21.77334  1.000 40.68009 ? 19  DG  C "O4'"  1 
ATOM   3319 C "C3'"  . DG  C 3 19  ? 130.90358 21.25918  20.77206  1.000 41.81626 ? 19  DG  C "C3'"  1 
ATOM   3320 O "O3'"  . DG  C 3 19  ? 131.83923 20.21906  20.50291  1.000 41.79055 ? 19  DG  C "O3'"  1 
ATOM   3321 C "C2'"  . DG  C 3 19  ? 129.75968 21.29232  19.76209  1.000 41.47013 ? 19  DG  C "C2'"  1 
ATOM   3322 C "C1'"  . DG  C 3 19  ? 128.75958 20.31742  20.36802  1.000 40.15074 ? 19  DG  C "C1'"  1 
ATOM   3323 N N9     . DG  C 3 19  ? 127.36326 20.58009  20.01745  1.000 38.13147 ? 19  DG  C N9     1 
ATOM   3324 C C8     . DG  C 3 19  ? 126.73805 21.80302  19.95154  1.000 37.17739 ? 19  DG  C C8     1 
ATOM   3325 N N7     . DG  C 3 19  ? 125.47461 21.72656  19.63128  1.000 36.50830 ? 19  DG  C N7     1 
ATOM   3326 C C5     . DG  C 3 19  ? 125.24688 20.36517  19.47003  1.000 36.90555 ? 19  DG  C C5     1 
ATOM   3327 C C6     . DG  C 3 19  ? 124.06447 19.67394  19.11864  1.000 35.73218 ? 19  DG  C C6     1 
ATOM   3328 O O6     . DG  C 3 19  ? 122.94611 20.14136  18.87435  1.000 35.52862 ? 19  DG  C O6     1 
ATOM   3329 N N1     . DG  C 3 19  ? 124.26893 18.30001  19.06418  1.000 35.63617 ? 19  DG  C N1     1 
ATOM   3330 C C2     . DG  C 3 19  ? 125.46555 17.67133  19.31768  1.000 35.34254 ? 19  DG  C C2     1 
ATOM   3331 N N2     . DG  C 3 19  ? 125.46744 16.33517  19.21779  1.000 34.59567 ? 19  DG  C N2     1 
ATOM   3332 N N3     . DG  C 3 19  ? 126.58029 18.30494  19.64954  1.000 35.96051 ? 19  DG  C N3     1 
ATOM   3333 C C4     . DG  C 3 19  ? 126.39857 19.64562  19.70621  1.000 37.15371 ? 19  DG  C C4     1 
ATOM   3334 H "H5'"  . DG  C 3 19  ? 129.35389 22.07238  23.65543  1.000 50.58360 ? 19  DG  C "H5'"  1 
ATOM   3335 H "H5''" . DG  C 3 19  ? 130.84024 22.51462  23.35600  1.000 50.58360 ? 19  DG  C "H5''" 1 
ATOM   3336 H "H4'"  . DG  C 3 19  ? 130.69898 20.36361  22.61177  1.000 50.05262 ? 19  DG  C "H4'"  1 
ATOM   3337 H "H3'"  . DG  C 3 19  ? 131.35376 22.11828  20.78624  1.000 50.17951 ? 19  DG  C "H3'"  1 
ATOM   3338 H "H2'"  . DG  C 3 19  ? 129.38244 22.18265  19.68528  1.000 49.76416 ? 19  DG  C "H2'"  1 
ATOM   3339 H "H2''" . DG  C 3 19  ? 130.05373 20.99727  18.88608  1.000 49.76416 ? 19  DG  C "H2''" 1 
ATOM   3340 H "H1'"  . DG  C 3 19  ? 128.98666 19.41738  20.08650  1.000 48.18089 ? 19  DG  C "H1'"  1 
ATOM   3341 H H8     . DG  C 3 19  ? 127.17345 22.60755  20.11905  1.000 44.61287 ? 19  DG  C H8     1 
ATOM   3342 H H1     . DG  C 3 19  ? 123.59644 17.80591  18.85630  1.000 42.76341 ? 19  DG  C H1     1 
ATOM   3343 H H21    . DG  C 3 19  ? 124.74624 15.91903  19.00262  1.000 41.51480 ? 19  DG  C H21    1 
ATOM   3344 H H22    . DG  C 3 19  ? 126.18986 15.89370  19.36885  1.000 41.51480 ? 19  DG  C H22    1 
ATOM   3345 P P      . DC  C 3 20  ? 132.83801 20.33482  19.24939  1.000 42.73319 ? 20  DC  C P      1 
ATOM   3346 O OP1    . DC  C 3 20  ? 134.10590 19.67314  19.64392  1.000 42.47165 ? 20  DC  C OP1    1 
ATOM   3347 O OP2    . DC  C 3 20  ? 132.81695 21.73442  18.76066  1.000 41.32279 ? 20  DC  C OP2    1 
ATOM   3348 O "O5'"  . DC  C 3 20  ? 132.14976 19.43365  18.12717  1.000 43.24875 ? 20  DC  C "O5'"  1 
ATOM   3349 C "C5'"  . DC  C 3 20  ? 132.10349 18.02738  18.28931  1.000 42.91023 ? 20  DC  C "C5'"  1 
ATOM   3350 C "C4'"  . DC  C 3 20  ? 131.03181 17.42193  17.40902  1.000 42.15361 ? 20  DC  C "C4'"  1 
ATOM   3351 O "O4'"  . DC  C 3 20  ? 129.75432 17.99894  17.73992  1.000 39.85693 ? 20  DC  C "O4'"  1 
ATOM   3352 C "C3'"  . DC  C 3 20  ? 131.19762 17.68736  15.92458  1.000 43.08583 ? 20  DC  C "C3'"  1 
ATOM   3353 O "O3'"  . DC  C 3 20  ? 132.04488 16.69873  15.32198  1.000 43.12054 ? 20  DC  C "O3'"  1 
ATOM   3354 C "C2'"  . DC  C 3 20  ? 129.75929 17.63616  15.39375  1.000 42.07904 ? 20  DC  C "C2'"  1 
ATOM   3355 C "C1'"  . DC  C 3 20  ? 128.88556 17.84544  16.63998  1.000 39.91045 ? 20  DC  C "C1'"  1 
ATOM   3356 N N1     . DC  C 3 20  ? 127.99983 19.04769  16.55969  1.000 37.41410 ? 20  DC  C N1     1 
ATOM   3357 C C2     . DC  C 3 20  ? 126.64767 18.89268  16.23516  1.000 35.21852 ? 20  DC  C C2     1 
ATOM   3358 O O2     . DC  C 3 20  ? 126.20595 17.75636  16.01879  1.000 35.29378 ? 20  DC  C O2     1 
ATOM   3359 N N3     . DC  C 3 20  ? 125.85943 19.99406  16.16821  1.000 33.12334 ? 20  DC  C N3     1 
ATOM   3360 C C4     . DC  C 3 20  ? 126.37481 21.19930  16.40945  1.000 31.93457 ? 20  DC  C C4     1 
ATOM   3361 N N4     . DC  C 3 20  ? 125.56084 22.25550  16.33038  1.000 30.52077 ? 20  DC  C N4     1 
ATOM   3362 C C5     . DC  C 3 20  ? 127.74865 21.37573  16.74088  1.000 33.60797 ? 20  DC  C C5     1 
ATOM   3363 C C6     . DC  C 3 20  ? 128.51653 20.28418  16.80313  1.000 35.62252 ? 20  DC  C C6     1 
ATOM   3364 H "H5'"  . DC  C 3 20  ? 131.91187 17.81816  19.21690  1.000 51.49228 ? 20  DC  C "H5'"  1 
ATOM   3365 H "H5''" . DC  C 3 20  ? 132.96451 17.64917  18.05163  1.000 51.49228 ? 20  DC  C "H5''" 1 
ATOM   3366 H "H4'"  . DC  C 3 20  ? 131.00572 16.46515  17.56646  1.000 50.58433 ? 20  DC  C "H4'"  1 
ATOM   3367 H "H3'"  . DC  C 3 20  ? 131.56806 18.57263  15.78328  1.000 51.70300 ? 20  DC  C "H3'"  1 
ATOM   3368 H "HO3'" . DC  C 3 20  ? 131.85714 16.39073  14.56337  1.000 51.74465 ? 20  DC  C "HO3'" 1 
ATOM   3369 H "H2'"  . DC  C 3 20  ? 129.60621 18.33868  14.74264  1.000 50.49485 ? 20  DC  C "H2'"  1 
ATOM   3370 H "H2''" . DC  C 3 20  ? 129.57349 16.77785  14.98182  1.000 50.49485 ? 20  DC  C "H2''" 1 
ATOM   3371 H "H1'"  . DC  C 3 20  ? 128.34347 17.05307  16.77852  1.000 47.89254 ? 20  DC  C "H1'"  1 
ATOM   3372 H H41    . DC  C 3 20  ? 124.73203 22.14552  16.12892  1.000 36.62493 ? 20  DC  C H41    1 
ATOM   3373 H H42    . DC  C 3 20  ? 125.86560 23.04547  16.48092  1.000 36.62493 ? 20  DC  C H42    1 
ATOM   3374 H H5     . DC  C 3 20  ? 128.09887 22.22089  16.90807  1.000 40.32957 ? 20  DC  C H5     1 
ATOM   3375 H H6     . DC  C 3 20  ? 129.41777 20.36997  17.01597  1.000 42.74703 ? 20  DC  C H6     1 
HETATM 3376 C C1     . EDO D 4 .   ? 97.22916  28.54251  18.73588  1.000 51.35832 ? 201 EDO A C1     1 
HETATM 3377 O O1     . EDO D 4 .   ? 98.59398  28.46549  18.31105  1.000 51.15604 ? 201 EDO A O1     1 
HETATM 3378 C C2     . EDO D 4 .   ? 96.73665  29.98189  18.68952  1.000 51.48216 ? 201 EDO A C2     1 
HETATM 3379 O O2     . EDO D 4 .   ? 95.33484  29.98214  18.97917  1.000 51.70274 ? 201 EDO A O2     1 
HETATM 3380 H H11    . EDO D 4 .   ? 97.14017  28.15757  19.75390  1.000 61.62998 ? 201 EDO A H11    1 
HETATM 3381 H H12    . EDO D 4 .   ? 96.60796  27.92177  18.08683  1.000 61.62998 ? 201 EDO A H12    1 
HETATM 3382 H HO1    . EDO D 4 .   ? 98.89092  27.54586  18.34568  1.000 61.38725 ? 201 EDO A HO1    1 
HETATM 3383 H H21    . EDO D 4 .   ? 96.91782  30.41094  17.70182  1.000 61.77859 ? 201 EDO A H21    1 
HETATM 3384 H H22    . EDO D 4 .   ? 97.27336  30.58801  19.42234  1.000 61.77859 ? 201 EDO A H22    1 
HETATM 3385 H HO2    . EDO D 4 .   ? 95.17780  30.44852  19.81159  1.000 62.04329 ? 201 EDO A HO2    1 
HETATM 3386 C C1     . EDO E 4 .   ? 90.54844  26.03418  -1.33330  1.000 28.27577 ? 202 EDO A C1     1 
HETATM 3387 O O1     . EDO E 4 .   ? 89.15815  26.29066  -1.08583  1.000 27.69999 ? 202 EDO A O1     1 
HETATM 3388 C C2     . EDO E 4 .   ? 91.31371  25.91424  -0.01598  1.000 28.77431 ? 202 EDO A C2     1 
HETATM 3389 O O2     . EDO E 4 .   ? 92.57788  25.27310  -0.22090  1.000 28.79782 ? 202 EDO A O2     1 
HETATM 3390 H H11    . EDO E 4 .   ? 90.97024  26.84622  -1.92924  1.000 33.93092 ? 202 EDO A H11    1 
HETATM 3391 H H12    . EDO E 4 .   ? 90.65429  25.10913  -1.90387  1.000 33.93092 ? 202 EDO A H12    1 
HETATM 3392 H HO1    . EDO E 4 .   ? 88.69044  26.37194  -1.92829  1.000 33.23999 ? 202 EDO A HO1    1 
HETATM 3393 H H21    . EDO E 4 .   ? 90.72296  25.33706  0.69840   1.000 34.52917 ? 202 EDO A H21    1 
HETATM 3394 H H22    . EDO E 4 .   ? 91.47268  26.90880  0.40597   1.000 34.52917 ? 202 EDO A H22    1 
HETATM 3395 H HO2    . EDO E 4 .   ? 93.10775  25.34022  0.58521   1.000 34.55739 ? 202 EDO A HO2    1 
HETATM 3396 O O      . HOH F 5 .   ? 93.48121  21.50450  1.28617   1.000 15.90033 ? 301 HOH A O      1 
HETATM 3397 O O      . HOH F 5 .   ? 94.41654  24.63797  -0.04061  1.000 25.79195 ? 302 HOH A O      1 
HETATM 3398 O O      . HOH F 5 .   ? 76.91323  4.39491   8.72342   1.000 16.14045 ? 303 HOH A O      1 
HETATM 3399 O O      . HOH F 5 .   ? 100.35693 27.49185  17.34813  1.000 23.25428 ? 304 HOH A O      1 
HETATM 3400 O O      . HOH F 5 .   ? 71.64000  8.23836   27.01750  0.500 8.58536  ? 305 HOH A O      1 
HETATM 3401 O O      . HOH F 5 .   ? 91.92869  31.55340  20.26203  1.000 21.81790 ? 306 HOH A O      1 
HETATM 3402 O O      . HOH F 5 .   ? 104.65126 30.34036  6.65094   1.000 36.52597 ? 307 HOH A O      1 
HETATM 3403 O O      . HOH F 5 .   ? 87.80915  22.59304  26.15077  1.000 8.25605  ? 308 HOH A O      1 
HETATM 3404 O O      . HOH F 5 .   ? 77.81053  20.40050  -0.30322  1.000 20.89538 ? 309 HOH A O      1 
HETATM 3405 O O      . HOH F 5 .   ? 76.88137  15.57550  27.57914  1.000 24.29546 ? 310 HOH A O      1 
HETATM 3406 O O      . HOH F 5 .   ? 100.81363 31.51624  5.10866   1.000 21.71753 ? 311 HOH A O      1 
HETATM 3407 O O      . HOH F 5 .   ? 97.47116  35.14070  9.71599   1.000 31.91739 ? 312 HOH A O      1 
HETATM 3408 O O      . HOH F 5 .   ? 83.44966  8.25375   7.82205   1.000 13.18503 ? 313 HOH A O      1 
HETATM 3409 O O      . HOH F 5 .   ? 96.54403  31.43054  1.57338   1.000 17.60341 ? 314 HOH A O      1 
HETATM 3410 O O      . HOH F 5 .   ? 91.63166  11.20472  24.13142  1.000 21.61715 ? 315 HOH A O      1 
HETATM 3411 O O      . HOH F 5 .   ? 71.59497  11.65087  26.43329  1.000 44.39451 ? 316 HOH A O      1 
HETATM 3412 O O      . HOH F 5 .   ? 77.05733  12.90161  4.04513   1.000 15.47014 ? 317 HOH A O      1 
HETATM 3413 O O      . HOH F 5 .   ? 92.64012  36.59500  0.00000   0.500 26.97978 ? 318 HOH A O      1 
HETATM 3414 O O      . HOH F 5 .   ? 91.37216  8.84822   13.11518  1.000 5.68173  ? 319 HOH A O      1 
HETATM 3415 O O      . HOH F 5 .   ? 86.77237  12.80697  21.91381  1.000 6.71120  ? 320 HOH A O      1 
HETATM 3416 O O      . HOH F 5 .   ? 85.12143  6.15998   11.73393  1.000 9.12625  ? 321 HOH A O      1 
HETATM 3417 O O      . HOH F 5 .   ? 77.73338  5.90243   6.18466   1.000 37.15233 ? 322 HOH A O      1 
HETATM 3418 O O      . HOH F 5 .   ? 78.42077  18.65383  28.07972  1.000 13.64175 ? 323 HOH A O      1 
HETATM 3419 O O      . HOH F 5 .   ? 77.62753  24.84254  12.47014  1.000 9.96672  ? 324 HOH A O      1 
HETATM 3420 O O      . HOH F 5 .   ? 87.21466  5.48839   3.19394   1.000 15.81781 ? 325 HOH A O      1 
HETATM 3421 O O      . HOH F 5 .   ? 92.26470  -5.62245  28.16678  1.000 33.88868 ? 326 HOH A O      1 
HETATM 3422 O O      . HOH F 5 .   ? 88.70775  32.87861  18.24431  1.000 30.26085 ? 327 HOH A O      1 
HETATM 3423 O O      . HOH F 5 .   ? 78.46076  19.66182  5.08293   1.000 21.59790 ? 328 HOH A O      1 
HETATM 3424 O O      . HOH F 5 .   ? 98.93675  32.31804  5.76826   1.000 30.99388 ? 329 HOH A O      1 
HETATM 3425 O O      . HOH F 5 .   ? 98.37332  33.98063  8.12831   1.000 24.90126 ? 330 HOH A O      1 
HETATM 3426 O O      . HOH F 5 .   ? 89.59280  19.22139  15.90456  1.000 20.44836 ? 331 HOH A O      1 
HETATM 3427 O O      . HOH F 5 .   ? 87.64556  5.78684   5.03857   1.000 18.15170 ? 332 HOH A O      1 
HETATM 3428 O O      . HOH F 5 .   ? 91.55755  4.81857   5.32504   1.000 28.82924 ? 333 HOH A O      1 
HETATM 3429 O O      . HOH F 5 .   ? 75.55781  11.43594  3.94005   1.000 37.03583 ? 334 HOH A O      1 
HETATM 3430 O O      . HOH F 5 .   ? 104.06647 19.71292  2.09163   1.000 24.24595 ? 335 HOH A O      1 
HETATM 3431 O O      . HOH F 5 .   ? 93.12909  1.44912   6.76489   1.000 29.77039 ? 336 HOH A O      1 
HETATM 3432 O O      . HOH G 5 .   ? 95.78056  7.78346   -2.53772  1.000 32.41160 ? 101 HOH B O      1 
HETATM 3433 O O      . HOH G 5 .   ? 91.48404  3.70093   -2.67613  1.000 22.43268 ? 102 HOH B O      1 
HETATM 3434 O O      . HOH G 5 .   ? 101.16147 19.45727  7.52247   1.000 35.32764 ? 103 HOH B O      1 
HETATM 3435 O O      . HOH G 5 .   ? 84.14839  14.86806  21.29115  1.000 13.86475 ? 104 HOH B O      1 
HETATM 3436 O O      . HOH G 5 .   ? 92.64857  9.40562   3.87242   1.000 37.66602 ? 105 HOH B O      1 
HETATM 3437 O O      . HOH G 5 .   ? 100.18486 10.40576  0.37965   1.000 21.09954 ? 106 HOH B O      1 
HETATM 3438 O O      . HOH G 5 .   ? 96.61650  18.11224  7.92775   1.000 10.67519 ? 107 HOH B O      1 
HETATM 3439 O O      . HOH G 5 .   ? 99.94790  17.32685  17.38147  1.000 28.81186 ? 108 HOH B O      1 
HETATM 3440 O O      . HOH G 5 .   ? 81.52024  20.68888  22.63249  1.000 12.85821 ? 109 HOH B O      1 
HETATM 3441 O O      . HOH G 5 .   ? 95.97378  18.03290  5.43363   1.000 9.00775  ? 110 HOH B O      1 
HETATM 3442 O O      . HOH G 5 .   ? 87.27264  19.28690  17.42655  1.000 11.26767 ? 111 HOH B O      1 
HETATM 3443 O O      . HOH G 5 .   ? 91.16773  12.82051  17.18994  1.000 29.48655 ? 112 HOH B O      1 
HETATM 3444 O O      . HOH G 5 .   ? 101.72439 12.64733  0.60054   1.000 26.68406 ? 113 HOH B O      1 
HETATM 3445 O O      . HOH G 5 .   ? 103.80477 18.75049  -0.62190  1.000 20.11830 ? 114 HOH B O      1 
HETATM 3446 O O      . HOH H 5 .   ? 85.47321  14.98529  8.52042   1.000 29.24449 ? 101 HOH C O      1 
HETATM 3447 O O      . HOH H 5 .   ? 114.14470 9.84746   29.35318  1.000 33.37325 ? 102 HOH C O      1 
HETATM 3448 O O      . HOH H 5 .   ? 92.88238  11.67670  16.73933  1.000 20.49653 ? 103 HOH C O      1 
HETATM 3449 O O      . HOH H 5 .   ? 86.24144  20.81483  4.96783   1.000 18.92554 ? 104 HOH C O      1 
HETATM 3450 O O      . HOH H 5 .   ? 93.16038  7.21416   15.22352  1.000 30.61669 ? 105 HOH C O      1 
HETATM 3451 O O      . HOH H 5 .   ? 91.41091  23.60564  2.08159   1.000 6.10299  ? 106 HOH C O      1 
HETATM 3452 O O      . HOH H 5 .   ? 106.49080 9.85008   21.86738  1.000 27.31595 ? 107 HOH C O      1 
HETATM 3453 O O      . HOH H 5 .   ? 126.30320 27.78974  27.74063  1.000 16.04828 ? 108 HOH C O      1 
HETATM 3454 O O      . HOH H 5 .   ? 97.38917  15.85642  -2.05600  1.000 10.41967 ? 109 HOH C O      1 
HETATM 3455 O O      . HOH H 5 .   ? 100.95127 10.60099  10.91759  1.000 29.73751 ? 110 HOH C O      1 
HETATM 3456 O O      . HOH H 5 .   ? 115.02372 9.82729   26.14648  1.000 29.54749 ? 111 HOH C O      1 
HETATM 3457 O O      . HOH H 5 .   ? 93.41246  7.26751   5.50145   1.000 13.52516 ? 112 HOH C O      1 
HETATM 3458 O O      . HOH H 5 .   ? 92.50953  2.02336   8.95067   1.000 46.58570 ? 113 HOH C O      1 
HETATM 3459 O O      . HOH H 5 .   ? 99.01896  16.49871  -4.38357  1.000 22.37977 ? 114 HOH C O      1 
HETATM 3460 O O      . HOH H 5 .   ? 114.76924 12.74543  27.18591  1.000 28.11630 ? 115 HOH C O      1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   19  19  GLY GLY A . n 
A 1 2   ARG 2   20  20  ARG ARG A . n 
A 1 3   ARG 3   21  21  ARG ARG A . n 
A 1 4   ARG 4   22  22  ARG ARG A . n 
A 1 5   ARG 5   23  23  ARG ARG A . n 
A 1 6   LEU 6   24  24  LEU LEU A . n 
A 1 7   VAL 7   25  25  VAL VAL A . n 
A 1 8   TRP 8   26  26  TRP TRP A . n 
A 1 9   THR 9   27  27  THR THR A . n 
A 1 10  PRO 10  28  28  PRO PRO A . n 
A 1 11  SER 11  29  29  SER SER A . n 
A 1 12  GLN 12  30  30  GLN GLN A . n 
A 1 13  SER 13  31  31  SER SER A . n 
A 1 14  GLU 14  32  32  GLU GLU A . n 
A 1 15  ALA 15  33  33  ALA ALA A . n 
A 1 16  LEU 16  34  34  LEU LEU A . n 
A 1 17  ARG 17  35  35  ARG ARG A . n 
A 1 18  ALA 18  36  36  ALA ALA A . n 
A 1 19  CYS 19  37  37  CYS CYS A . n 
A 1 20  PHE 20  38  38  PHE PHE A . n 
A 1 21  GLU 21  39  39  GLU GLU A . n 
A 1 22  ARG 22  40  40  ARG ARG A . n 
A 1 23  ASN 23  41  41  ASN ASN A . n 
A 1 24  PRO 24  42  42  PRO PRO A . n 
A 1 25  TYR 25  43  43  TYR TYR A . n 
A 1 26  PRO 26  44  44  PRO PRO A . n 
A 1 27  GLY 27  45  45  GLY GLY A . n 
A 1 28  ILE 28  46  46  ILE ILE A . n 
A 1 29  ALA 29  47  47  ALA ALA A . n 
A 1 30  THR 30  48  48  THR THR A . n 
A 1 31  ARG 31  49  49  ARG ARG A . n 
A 1 32  GLU 32  50  50  GLU GLU A . n 
A 1 33  ARG 33  51  51  ARG ARG A . n 
A 1 34  LEU 34  52  52  LEU LEU A . n 
A 1 35  ALA 35  53  53  ALA ALA A . n 
A 1 36  GLN 36  54  54  GLN GLN A . n 
A 1 37  ALA 37  55  55  ALA ALA A . n 
A 1 38  ILE 38  56  56  ILE ILE A . n 
A 1 39  GLY 39  57  57  GLY GLY A . n 
A 1 40  ILE 40  58  58  ILE ILE A . n 
A 1 41  PRO 41  59  59  PRO PRO A . n 
A 1 42  GLU 42  60  60  GLU GLU A . n 
A 1 43  PRO 43  61  61  PRO PRO A . n 
A 1 44  ARG 44  62  62  ARG ARG A . n 
A 1 45  VAL 45  63  63  VAL VAL A . n 
A 1 46  GLN 46  64  64  GLN GLN A . n 
A 1 47  ILE 47  65  65  ILE ILE A . n 
A 1 48  TRP 48  66  66  TRP TRP A . n 
A 1 49  PHE 49  67  67  PHE PHE A . n 
A 1 50  GLN 50  68  68  GLN GLN A . n 
A 1 51  ASN 51  69  69  ASN ASN A . n 
A 1 52  GLU 52  70  70  GLU GLU A . n 
A 1 53  ARG 53  71  71  ARG ARG A . n 
A 1 54  SER 54  72  72  SER SER A . n 
A 1 55  ARG 55  73  73  ARG ARG A . n 
A 1 56  GLN 56  74  74  GLN GLN A . n 
A 1 57  LEU 57  75  75  LEU LEU A . n 
A 1 58  ARG 58  76  76  ARG ARG A . n 
A 1 59  GLN 59  77  77  GLN GLN A . n 
A 1 60  HIS 60  78  78  HIS HIS A . n 
A 1 61  ARG 61  79  79  ARG ARG A . n 
A 1 62  ARG 62  80  80  ARG ARG A . n 
A 1 63  GLU 63  81  81  GLU GLU A . n 
A 1 64  SER 64  82  82  SER SER A . n 
A 1 65  ARG 65  83  83  ARG ARG A . n 
A 1 66  PRO 66  84  84  PRO PRO A . n 
A 1 67  TRP 67  85  85  TRP TRP A . n 
A 1 68  PRO 68  86  86  PRO PRO A . n 
A 1 69  GLY 69  87  87  GLY GLY A . n 
A 1 70  ARG 70  88  88  ARG ARG A . n 
A 1 71  ARG 71  89  89  ARG ARG A . n 
A 1 72  GLY 72  90  90  GLY GLY A . n 
A 1 73  PRO 73  91  91  PRO PRO A . n 
A 1 74  PRO 74  92  92  PRO PRO A . n 
A 1 75  GLU 75  93  93  GLU GLU A . n 
A 1 76  GLY 76  94  94  GLY GLY A . n 
A 1 77  ARG 77  95  95  ARG ARG A . n 
A 1 78  ARG 78  96  96  ARG ARG A . n 
A 1 79  LYS 79  97  97  LYS LYS A . n 
A 1 80  ARG 80  98  98  ARG ARG A . n 
A 1 81  THR 81  99  99  THR THR A . n 
A 1 82  ALA 82  100 100 ALA ALA A . n 
A 1 83  VAL 83  101 101 VAL VAL A . n 
A 1 84  THR 84  102 102 THR THR A . n 
A 1 85  GLY 85  103 103 GLY GLY A . n 
A 1 86  SER 86  104 104 SER SER A . n 
A 1 87  GLN 87  105 105 GLN GLN A . n 
A 1 88  THR 88  106 106 THR THR A . n 
A 1 89  ALA 89  107 107 ALA ALA A . n 
A 1 90  LEU 90  108 108 LEU LEU A . n 
A 1 91  LEU 91  109 109 LEU LEU A . n 
A 1 92  LEU 92  110 110 LEU LEU A . n 
A 1 93  ARG 93  111 111 ARG ARG A . n 
A 1 94  ALA 94  112 112 ALA ALA A . n 
A 1 95  PHE 95  113 113 PHE PHE A . n 
A 1 96  GLU 96  114 114 GLU GLU A . n 
A 1 97  LYS 97  115 115 LYS LYS A . n 
A 1 98  ASP 98  116 116 ASP ASP A . n 
A 1 99  ARG 99  117 117 ARG ARG A . n 
A 1 100 PHE 100 118 118 PHE PHE A . n 
A 1 101 PRO 101 119 119 PRO PRO A . n 
A 1 102 GLY 102 120 120 GLY GLY A . n 
A 1 103 ILE 103 121 121 ILE ILE A . n 
A 1 104 ALA 104 122 122 ALA ALA A . n 
A 1 105 ALA 105 123 123 ALA ALA A . n 
A 1 106 ARG 106 124 124 ARG ARG A . n 
A 1 107 GLU 107 125 125 GLU GLU A . n 
A 1 108 GLU 108 126 126 GLU GLU A . n 
A 1 109 LEU 109 127 127 LEU LEU A . n 
A 1 110 ALA 110 128 128 ALA ALA A . n 
A 1 111 ARG 111 129 129 ARG ARG A . n 
A 1 112 GLU 112 130 130 GLU GLU A . n 
A 1 113 THR 113 131 131 THR THR A . n 
A 1 114 GLY 114 132 132 GLY GLY A . n 
A 1 115 LEU 115 133 133 LEU LEU A . n 
A 1 116 PRO 116 134 134 PRO PRO A . n 
A 1 117 GLU 117 135 135 GLU GLU A . n 
A 1 118 SER 118 136 136 SER SER A . n 
A 1 119 ARG 119 137 137 ARG ARG A . n 
A 1 120 ILE 120 138 138 ILE ILE A . n 
A 1 121 GLN 121 139 139 GLN GLN A . n 
A 1 122 ILE 122 140 140 ILE ILE A . n 
A 1 123 TRP 123 141 141 TRP TRP A . n 
A 1 124 PHE 124 142 142 PHE PHE A . n 
A 1 125 GLN 125 143 143 GLN GLN A . n 
A 1 126 ASN 126 144 144 ASN ASN A . n 
A 1 127 ARG 127 145 145 ARG ARG A . n 
A 1 128 ARG 128 146 146 ARG ARG A . n 
A 1 129 ALA 129 147 147 ALA ALA A . n 
A 1 130 ARG 130 148 148 ARG ARG A . n 
A 1 131 HIS 131 149 149 HIS HIS A . n 
A 1 132 PRO 132 150 150 PRO PRO A . n 
B 2 1   DG  1   1   1   DG  DG  B . n 
B 2 2   DC  2   2   2   DC  DC  B . n 
B 2 3   DG  3   3   3   DG  DG  B . n 
B 2 4   DT  4   4   4   DT  DT  B . n 
B 2 5   DA  5   5   5   DA  DA  B . n 
B 2 6   DA  6   6   6   DA  DA  B . n 
B 2 7   DT  7   7   7   DT  DT  B . n 
B 2 8   DC  8   8   8   DC  DC  B . n 
B 2 9   DT  9   9   9   DT  DT  B . n 
B 2 10  DA  10  10  10  DA  DA  B . n 
B 2 11  DA  11  11  11  DA  DA  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DC  13  13  13  DC  DC  B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
B 2 15  DA  15  15  15  DA  DA  B . n 
B 2 16  DC  16  16  16  DC  DC  B . n 
B 2 17  DA  17  17  17  DA  DA  B . n 
C 3 1   DT  1   1   1   DT  DT  C . n 
C 3 2   DG  2   2   2   DG  DG  C . n 
C 3 3   DT  3   3   3   DT  DT  C . n 
C 3 4   DT  4   4   4   DT  DT  C . n 
C 3 5   DG  5   5   5   DG  DG  C . n 
C 3 6   DA  6   6   6   DA  DA  C . n 
C 3 7   DT  7   7   7   DT  DT  C . n 
C 3 8   DT  8   8   8   DT  DT  C . n 
C 3 9   DA  9   9   9   DA  DA  C . n 
C 3 10  DG  10  10  10  DG  DG  C . n 
C 3 11  DC  11  11  11  DC  DC  C . n 
C 3 12  DC  12  12  12  DC  DC  C . n 
C 3 13  DC  13  13  13  DC  DC  C . n 
C 3 14  DA  14  14  14  DA  DA  C . n 
C 3 15  DT  15  15  15  DT  DT  C . n 
C 3 16  DT  16  16  16  DT  DT  C . n 
C 3 17  DA  17  17  17  DA  DA  C . n 
C 3 18  DC  18  18  18  DC  DC  C . n 
C 3 19  DG  19  19  19  DG  DG  C . n 
C 3 20  DC  20  20  20  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 EDO 1  201 201 EDO EDO A . 
E 4 EDO 1  202 202 EDO EDO A . 
F 5 HOH 1  301 53  HOH HOH A . 
F 5 HOH 2  302 46  HOH HOH A . 
F 5 HOH 3  303 1   HOH HOH A . 
F 5 HOH 4  304 36  HOH HOH A . 
F 5 HOH 5  305 45  HOH HOH A . 
F 5 HOH 6  306 48  HOH HOH A . 
F 5 HOH 7  307 62  HOH HOH A . 
F 5 HOH 8  308 7   HOH HOH A . 
F 5 HOH 9  309 4   HOH HOH A . 
F 5 HOH 10 310 2   HOH HOH A . 
F 5 HOH 11 311 56  HOH HOH A . 
F 5 HOH 12 312 13  HOH HOH A . 
F 5 HOH 13 313 10  HOH HOH A . 
F 5 HOH 14 314 12  HOH HOH A . 
F 5 HOH 15 315 5   HOH HOH A . 
F 5 HOH 16 316 51  HOH HOH A . 
F 5 HOH 17 317 14  HOH HOH A . 
F 5 HOH 18 318 61  HOH HOH A . 
F 5 HOH 19 319 54  HOH HOH A . 
F 5 HOH 20 320 3   HOH HOH A . 
F 5 HOH 21 321 11  HOH HOH A . 
F 5 HOH 22 322 6   HOH HOH A . 
F 5 HOH 23 323 38  HOH HOH A . 
F 5 HOH 24 324 8   HOH HOH A . 
F 5 HOH 25 325 27  HOH HOH A . 
F 5 HOH 26 326 43  HOH HOH A . 
F 5 HOH 27 327 63  HOH HOH A . 
F 5 HOH 28 328 59  HOH HOH A . 
F 5 HOH 29 329 58  HOH HOH A . 
F 5 HOH 30 330 16  HOH HOH A . 
F 5 HOH 31 331 47  HOH HOH A . 
F 5 HOH 32 332 15  HOH HOH A . 
F 5 HOH 33 333 42  HOH HOH A . 
F 5 HOH 34 334 52  HOH HOH A . 
F 5 HOH 35 335 17  HOH HOH A . 
F 5 HOH 36 336 18  HOH HOH A . 
G 5 HOH 1  101 55  HOH HOH B . 
G 5 HOH 2  102 19  HOH HOH B . 
G 5 HOH 3  103 50  HOH HOH B . 
G 5 HOH 4  104 21  HOH HOH B . 
G 5 HOH 5  105 60  HOH HOH B . 
G 5 HOH 6  106 20  HOH HOH B . 
G 5 HOH 7  107 24  HOH HOH B . 
G 5 HOH 8  108 23  HOH HOH B . 
G 5 HOH 9  109 22  HOH HOH B . 
G 5 HOH 10 110 9   HOH HOH B . 
G 5 HOH 11 111 26  HOH HOH B . 
G 5 HOH 12 112 25  HOH HOH B . 
G 5 HOH 13 113 64  HOH HOH B . 
G 5 HOH 14 114 28  HOH HOH B . 
H 5 HOH 1  101 31  HOH HOH C . 
H 5 HOH 2  102 37  HOH HOH C . 
H 5 HOH 3  103 29  HOH HOH C . 
H 5 HOH 4  104 32  HOH HOH C . 
H 5 HOH 5  105 30  HOH HOH C . 
H 5 HOH 6  106 49  HOH HOH C . 
H 5 HOH 7  107 39  HOH HOH C . 
H 5 HOH 8  108 41  HOH HOH C . 
H 5 HOH 9  109 33  HOH HOH C . 
H 5 HOH 10 110 65  HOH HOH C . 
H 5 HOH 11 111 44  HOH HOH C . 
H 5 HOH 12 112 40  HOH HOH C . 
H 5 HOH 13 113 34  HOH HOH C . 
H 5 HOH 14 114 35  HOH HOH C . 
H 5 HOH 15 115 57  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_855 -x+3,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 214.9200000000 0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 54.0350000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 305 ? F HOH . 
2 1 A HOH 318 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-02-19 
2 'Structure model' 1 1 2020-02-26 
3 'Structure model' 1 2 2020-03-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations' 
2 3 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_struct_assembly      
2 2 'Structure model' pdbx_struct_assembly_gen  
3 2 'Structure model' pdbx_struct_assembly_prop 
4 2 'Structure model' pdbx_struct_oper_list     
5 3 'Structure model' citation                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_struct_assembly.details'             
2 2 'Structure model' '_pdbx_struct_assembly.method_details'      
3 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count'    
4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details'  
5 2 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 
6 3 'Structure model' '_citation.journal_volume'                  
7 3 'Structure model' '_citation.page_first'                      
8 3 'Structure model' '_citation.page_last'                       
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? .           4 
# 
_pdbx_entry_details.entry_id                 6U81 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HH11 A ARG 148 ? ? O A HOH 301 ? ? 1.17 
2  1 O    A HOH 325 ? ? O A HOH 332 ? ? 1.92 
3  1 NH1  A ARG 148 ? ? O A HOH 301 ? ? 1.95 
4  1 O2   A EDO 202 ? ? O A HOH 302 ? ? 1.95 
5  1 OP2  B DC  13  ? ? O B HOH 101 ? ? 2.00 
6  1 OP2  B DA  14  ? ? O B HOH 102 ? ? 2.07 
7  1 O    A HOH 317 ? ? O A HOH 334 ? ? 2.10 
8  1 O    B HOH 112 ? ? O C HOH 103 ? ? 2.11 
9  1 O    A HOH 311 ? ? O A HOH 329 ? ? 2.14 
10 1 O    A HOH 312 ? ? O A HOH 330 ? ? 2.16 
11 1 OP2  B DA  10  ? ? O B HOH 103 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     316 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     316 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_755 
_pdbx_validate_symm_contact.dist              1.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DG 10 ? ? "C1'" C DG 10 ? ? N9 C DG 10 ? ? 110.13 108.30 1.83 0.30 N 
2 1 "O4'" C DC 12 ? ? "C1'" C DC 12 ? ? N1 C DC 12 ? ? 110.28 108.30 1.98 0.30 N 
3 1 "O4'" C DA 17 ? ? "C1'" C DA 17 ? ? N9 C DA 17 ? ? 110.19 108.30 1.89 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 88  ? ? -69.08  99.06  
2 1 ARG A 98  ? ? -52.48  103.99 
3 1 PHE A 118 ? ? -112.60 68.52  
4 1 HIS A 149 ? ? -153.53 73.69  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       114 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.11 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 22 ? CG  ? A ARG 4 CG  
2 1 Y 1 A ARG 22 ? CD  ? A ARG 4 CD  
3 1 Y 1 A ARG 22 ? NE  ? A ARG 4 NE  
4 1 Y 1 A ARG 22 ? CZ  ? A ARG 4 CZ  
5 1 Y 1 A ARG 22 ? NH1 ? A ARG 4 NH1 
6 1 Y 1 A ARG 22 ? NH2 ? A ARG 4 NH2 
# 
_ndb_struct_conf_na.entry_id   6U81 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 8  1_555 C DG 10 1_555 0.174  -0.134 0.113  -3.963 -9.176  2.921  1  B_DC8:DG10_C B 8  ? C 10 ? 19 1 
1 B DT 9  1_555 C DA 9  1_555 -0.179 -0.150 0.317  -1.865 -7.759  -2.233 2  B_DT9:DA9_C  B 9  ? C 9  ? 20 1 
1 B DA 10 1_555 C DT 8  1_555 0.060  -0.140 0.187  1.534  -8.215  1.039  3  B_DA10:DT8_C B 10 ? C 8  ? 20 1 
1 B DA 11 1_555 C DT 7  1_555 0.047  -0.162 0.291  1.451  -8.530  0.449  4  B_DA11:DT7_C B 11 ? C 7  ? 20 1 
1 B DT 12 1_555 C DA 6  1_555 -0.276 -0.166 0.141  4.600  -11.365 8.614  5  B_DT12:DA6_C B 12 ? C 6  ? 20 1 
1 B DC 13 1_555 C DG 5  1_555 0.217  -0.158 0.048  -1.847 -8.789  2.141  6  B_DC13:DG5_C B 13 ? C 5  ? 19 1 
1 B DA 14 1_555 C DT 4  1_555 -0.034 -0.228 -0.161 -8.376 -7.042  8.265  7  B_DA14:DT4_C B 14 ? C 4  ? 20 1 
1 B DA 15 1_555 C DT 3  1_555 0.017  -0.157 -0.045 -4.445 -7.161  2.594  8  B_DA15:DT3_C B 15 ? C 3  ? 20 1 
1 B DC 16 1_555 C DG 2  1_555 0.241  -0.138 -0.021 0.061  -8.366  2.828  9  B_DC16:DG2_C B 16 ? C 2  ? 19 1 
1 B DA 17 1_555 C DT 1  1_555 0.113  -0.144 0.291  4.259  -2.473  -2.737 10 B_DA17:DT1_C B 17 ? C 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 8  1_555 C DG 10 1_555 B DT 9  1_555 C DA 9 1_555 -0.916 -0.358 3.394 -0.652 4.858  29.115 -1.769 1.654  3.311 9.578  1.286 
29.516 1 BB_DC8DT9:DA9DG10_CC  B 8  ? C 10 ? B 9  ? C 9 ? 
1 B DT 9  1_555 C DA 9  1_555 B DA 10 1_555 C DT 8 1_555 0.216  0.299  3.326 -0.946 5.915  38.079 -0.296 -0.447 3.328 8.998  1.439 
38.530 2 BB_DT9DA10:DT8DA9_CC  B 9  ? C 9  ? B 10 ? C 8 ? 
1 B DA 10 1_555 C DT 8  1_555 B DA 11 1_555 C DT 7 1_555 0.181  -0.661 3.152 -1.231 1.922  30.753 -1.602 -0.571 3.096 3.618  2.318 
30.836 3 BB_DA10DA11:DT7DT8_CC B 10 ? C 8  ? B 11 ? C 7 ? 
1 B DA 11 1_555 C DT 7  1_555 B DT 12 1_555 C DA 6 1_555 0.524  -0.692 3.279 0.645  0.810  28.669 -1.579 -0.912 3.269 1.635  
-1.301 28.687 4 BB_DA11DT12:DA6DT7_CC B 11 ? C 7  ? B 12 ? C 6 ? 
1 B DT 12 1_555 C DA 6  1_555 B DC 13 1_555 C DG 5 1_555 -0.520 -0.511 3.319 -2.105 0.978  41.647 -0.823 0.505  3.328 1.375  2.958 
41.709 5 BB_DT12DC13:DG5DA6_CC B 12 ? C 6  ? B 13 ? C 5 ? 
1 B DC 13 1_555 C DG 5  1_555 B DA 14 1_555 C DT 4 1_555 1.083  0.163  3.448 5.654  5.140  35.891 -0.505 -0.883 3.561 8.226  
-9.049 36.669 6 BB_DC13DA14:DT4DG5_CC B 13 ? C 5  ? B 14 ? C 4 ? 
1 B DA 14 1_555 C DT 4  1_555 B DA 15 1_555 C DT 3 1_555 -1.523 0.592  3.155 -5.882 2.398  36.641 0.607  1.600  3.381 3.780  9.270 
37.169 7 BB_DA14DA15:DT3DT4_CC B 14 ? C 4  ? B 15 ? C 3 ? 
1 B DA 15 1_555 C DT 3  1_555 B DC 16 1_555 C DG 2 1_555 -0.015 -0.091 3.226 0.365  0.173  32.917 -0.190 0.087  3.225 0.305  
-0.644 32.920 8 BB_DA15DC16:DG2DT3_CC B 15 ? C 3  ? B 16 ? C 2 ? 
1 B DC 16 1_555 C DG 2  1_555 B DA 17 1_555 C DT 1 1_555 0.019  0.806  3.206 -2.081 -2.974 40.703 1.472  -0.249 3.138 -4.265 2.985 
40.857 9 BB_DC16DA17:DT1DG2_CC B 16 ? C 2  ? B 17 ? C 1 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM118047 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        EDO 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   EDO 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 1,2-ETHANEDIOL EDO 
5 water          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                'Trimer: A,B,C chains' 
#