data_6UJX
# 
_entry.id   6UJX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UJX         
WWPDB D_1000244713 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UJX 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Lansdon, E.B.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0001-9461-1475 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Commun Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2399-3642 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            2 
_citation.language                  ? 
_citation.page_first                469 
_citation.page_last                 469 
_citation.title                     
'Elucidating molecular interactions ofL-nucleotides with HIV-1 reverse transcriptase and mechanism of M184V-caused drug resistance.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s42003-019-0706-x 
_citation.pdbx_database_id_PubMed   31872074 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hung, M.'       1 ? 
primary 'Tokarsky, E.J.' 2 ? 
primary 'Lagpacan, L.'   3 ? 
primary 'Zhang, L.'      4 ? 
primary 'Suo, Z.'        5 ? 
primary 'Lansdon, E.B.'  6 ? 
# 
_cell.angle_alpha                  90.0 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.0 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.0 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UJX 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     169.804 
_cell.length_a_esd                 ? 
_cell.length_b                     167.685 
_cell.length_b_esd                 ? 
_cell.length_c                     103.309 
_cell.length_c_esd                 ? 
_cell.volume                       2941577.4626 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UJX 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            'C 2c 2' 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'p66 Reverse transcriptase/RNaseH' 65887.328 1   3.4.23.16,2.7.7.49,2.7.7.7,3.1.26.13,3.1.13.2,2.7.7.-,3.1.-.- 
Q845C,C867S ? ? 
2 polymer     man 'p51 Reverse transcriptase/RNaseH' 51382.984 1   3.4.23.16,2.7.7.49,2.7.7.7,3.1.26.13,3.1.13.2,2.7.7.-,3.1.-.- 
C867S       ? ? 
3 polymer     syn 'DNA primer' 6360.099  1   ?                                                             ?           ? ? 
4 polymer     syn 'DNA template' 8448.421  1   ?                                                             ?           ? ? 
5 non-polymer syn 'SULFATE ION' 96.063    4   ?                                                             ?           ? ? 
6 non-polymer syn 'MAGNESIUM ION' 24.305    1   ?                                                             ?           ? ? 
7 non-polymer syn 
;[[(2R,5S)-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
487.186   1   ?                                                             ?           ? ? 
8 water       nat water 18.015    112 ?                                                             ?           ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Exoribonuclease H, p66 RT' 
2 'Exoribonuclease H, p51 RT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVT
LTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
DKLVSAGIRKVL
;
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVT
LTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
DKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(DG)(DC)(DG)(DC)(DC)
(DOC)
;
ACAGTCCCTGTTCGGGCGCCC P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DG)(DG)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGGGGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  PRO n 
1 14  ILE n 
1 15  SER n 
1 16  PRO n 
1 17  ILE n 
1 18  GLU n 
1 19  THR n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LYS n 
1 24  LEU n 
1 25  LYS n 
1 26  PRO n 
1 27  GLY n 
1 28  MET n 
1 29  ASP n 
1 30  GLY n 
1 31  PRO n 
1 32  LYS n 
1 33  VAL n 
1 34  LYS n 
1 35  GLN n 
1 36  TRP n 
1 37  PRO n 
1 38  LEU n 
1 39  THR n 
1 40  GLU n 
1 41  GLU n 
1 42  LYS n 
1 43  ILE n 
1 44  LYS n 
1 45  ALA n 
1 46  LEU n 
1 47  VAL n 
1 48  GLU n 
1 49  ILE n 
1 50  CYS n 
1 51  THR n 
1 52  GLU n 
1 53  MET n 
1 54  GLU n 
1 55  LYS n 
1 56  GLU n 
1 57  GLY n 
1 58  LYS n 
1 59  ILE n 
1 60  SER n 
1 61  LYS n 
1 62  ILE n 
1 63  GLY n 
1 64  PRO n 
1 65  GLU n 
1 66  ASN n 
1 67  PRO n 
1 68  TYR n 
1 69  ASN n 
1 70  THR n 
1 71  PRO n 
1 72  VAL n 
1 73  PHE n 
1 74  ALA n 
1 75  ILE n 
1 76  LYS n 
1 77  LYS n 
1 78  LYS n 
1 79  ASP n 
1 80  SER n 
1 81  THR n 
1 82  LYS n 
1 83  TRP n 
1 84  ARG n 
1 85  LYS n 
1 86  LEU n 
1 87  VAL n 
1 88  ASP n 
1 89  PHE n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  ASN n 
1 94  LYS n 
1 95  ARG n 
1 96  THR n 
1 97  GLN n 
1 98  ASP n 
1 99  PHE n 
1 100 TRP n 
1 101 GLU n 
1 102 VAL n 
1 103 GLN n 
1 104 LEU n 
1 105 GLY n 
1 106 ILE n 
1 107 PRO n 
1 108 HIS n 
1 109 PRO n 
1 110 ALA n 
1 111 GLY n 
1 112 LEU n 
1 113 LYS n 
1 114 LYS n 
1 115 LYS n 
1 116 LYS n 
1 117 SER n 
1 118 VAL n 
1 119 THR n 
1 120 VAL n 
1 121 LEU n 
1 122 ASP n 
1 123 VAL n 
1 124 GLY n 
1 125 ASP n 
1 126 ALA n 
1 127 TYR n 
1 128 PHE n 
1 129 SER n 
1 130 VAL n 
1 131 PRO n 
1 132 LEU n 
1 133 ASP n 
1 134 GLU n 
1 135 ASP n 
1 136 PHE n 
1 137 ARG n 
1 138 LYS n 
1 139 TYR n 
1 140 THR n 
1 141 ALA n 
1 142 PHE n 
1 143 THR n 
1 144 ILE n 
1 145 PRO n 
1 146 SER n 
1 147 ILE n 
1 148 ASN n 
1 149 ASN n 
1 150 GLU n 
1 151 THR n 
1 152 PRO n 
1 153 GLY n 
1 154 ILE n 
1 155 ARG n 
1 156 TYR n 
1 157 GLN n 
1 158 TYR n 
1 159 ASN n 
1 160 VAL n 
1 161 LEU n 
1 162 PRO n 
1 163 GLN n 
1 164 GLY n 
1 165 TRP n 
1 166 LYS n 
1 167 GLY n 
1 168 SER n 
1 169 PRO n 
1 170 ALA n 
1 171 ILE n 
1 172 PHE n 
1 173 GLN n 
1 174 SER n 
1 175 SER n 
1 176 MET n 
1 177 THR n 
1 178 LYS n 
1 179 ILE n 
1 180 LEU n 
1 181 GLU n 
1 182 PRO n 
1 183 PHE n 
1 184 ARG n 
1 185 LYS n 
1 186 GLN n 
1 187 ASN n 
1 188 PRO n 
1 189 ASP n 
1 190 ILE n 
1 191 VAL n 
1 192 ILE n 
1 193 TYR n 
1 194 GLN n 
1 195 TYR n 
1 196 MET n 
1 197 ASP n 
1 198 ASP n 
1 199 LEU n 
1 200 TYR n 
1 201 VAL n 
1 202 GLY n 
1 203 SER n 
1 204 ASP n 
1 205 LEU n 
1 206 GLU n 
1 207 ILE n 
1 208 GLY n 
1 209 GLN n 
1 210 HIS n 
1 211 ARG n 
1 212 THR n 
1 213 LYS n 
1 214 ILE n 
1 215 GLU n 
1 216 GLU n 
1 217 LEU n 
1 218 ARG n 
1 219 GLN n 
1 220 HIS n 
1 221 LEU n 
1 222 LEU n 
1 223 ARG n 
1 224 TRP n 
1 225 GLY n 
1 226 LEU n 
1 227 THR n 
1 228 THR n 
1 229 PRO n 
1 230 ASP n 
1 231 LYS n 
1 232 LYS n 
1 233 HIS n 
1 234 GLN n 
1 235 LYS n 
1 236 GLU n 
1 237 PRO n 
1 238 PRO n 
1 239 PHE n 
1 240 LEU n 
1 241 TRP n 
1 242 MET n 
1 243 GLY n 
1 244 TYR n 
1 245 GLU n 
1 246 LEU n 
1 247 HIS n 
1 248 PRO n 
1 249 ASP n 
1 250 LYS n 
1 251 TRP n 
1 252 THR n 
1 253 VAL n 
1 254 GLN n 
1 255 PRO n 
1 256 ILE n 
1 257 VAL n 
1 258 LEU n 
1 259 PRO n 
1 260 GLU n 
1 261 LYS n 
1 262 ASP n 
1 263 SER n 
1 264 TRP n 
1 265 THR n 
1 266 VAL n 
1 267 ASN n 
1 268 ASP n 
1 269 ILE n 
1 270 CYS n 
1 271 LYS n 
1 272 LEU n 
1 273 VAL n 
1 274 GLY n 
1 275 LYS n 
1 276 LEU n 
1 277 ASN n 
1 278 TRP n 
1 279 ALA n 
1 280 SER n 
1 281 GLN n 
1 282 ILE n 
1 283 TYR n 
1 284 PRO n 
1 285 GLY n 
1 286 ILE n 
1 287 LYS n 
1 288 VAL n 
1 289 ARG n 
1 290 GLN n 
1 291 LEU n 
1 292 SER n 
1 293 LYS n 
1 294 LEU n 
1 295 LEU n 
1 296 ARG n 
1 297 GLY n 
1 298 THR n 
1 299 LYS n 
1 300 ALA n 
1 301 LEU n 
1 302 THR n 
1 303 GLU n 
1 304 VAL n 
1 305 ILE n 
1 306 PRO n 
1 307 LEU n 
1 308 THR n 
1 309 GLU n 
1 310 GLU n 
1 311 ALA n 
1 312 GLU n 
1 313 LEU n 
1 314 GLU n 
1 315 LEU n 
1 316 ALA n 
1 317 GLU n 
1 318 ASN n 
1 319 ARG n 
1 320 GLU n 
1 321 ILE n 
1 322 LEU n 
1 323 LYS n 
1 324 GLU n 
1 325 PRO n 
1 326 VAL n 
1 327 HIS n 
1 328 GLY n 
1 329 VAL n 
1 330 TYR n 
1 331 TYR n 
1 332 ASP n 
1 333 PRO n 
1 334 SER n 
1 335 LYS n 
1 336 ASP n 
1 337 LEU n 
1 338 ILE n 
1 339 ALA n 
1 340 GLU n 
1 341 ILE n 
1 342 GLN n 
1 343 LYS n 
1 344 GLN n 
1 345 GLY n 
1 346 GLN n 
1 347 GLY n 
1 348 GLN n 
1 349 TRP n 
1 350 THR n 
1 351 TYR n 
1 352 GLN n 
1 353 ILE n 
1 354 TYR n 
1 355 GLN n 
1 356 GLU n 
1 357 PRO n 
1 358 PHE n 
1 359 LYS n 
1 360 ASN n 
1 361 LEU n 
1 362 LYS n 
1 363 THR n 
1 364 GLY n 
1 365 LYS n 
1 366 TYR n 
1 367 ALA n 
1 368 ARG n 
1 369 MET n 
1 370 ARG n 
1 371 GLY n 
1 372 ALA n 
1 373 HIS n 
1 374 THR n 
1 375 ASN n 
1 376 ASP n 
1 377 VAL n 
1 378 LYS n 
1 379 GLN n 
1 380 LEU n 
1 381 THR n 
1 382 GLU n 
1 383 ALA n 
1 384 VAL n 
1 385 GLN n 
1 386 LYS n 
1 387 ILE n 
1 388 THR n 
1 389 THR n 
1 390 GLU n 
1 391 SER n 
1 392 ILE n 
1 393 VAL n 
1 394 ILE n 
1 395 TRP n 
1 396 GLY n 
1 397 LYS n 
1 398 THR n 
1 399 PRO n 
1 400 LYS n 
1 401 PHE n 
1 402 LYS n 
1 403 LEU n 
1 404 PRO n 
1 405 ILE n 
1 406 GLN n 
1 407 LYS n 
1 408 GLU n 
1 409 THR n 
1 410 TRP n 
1 411 GLU n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 THR n 
1 416 GLU n 
1 417 TYR n 
1 418 TRP n 
1 419 GLN n 
1 420 ALA n 
1 421 THR n 
1 422 TRP n 
1 423 ILE n 
1 424 PRO n 
1 425 GLU n 
1 426 TRP n 
1 427 GLU n 
1 428 PHE n 
1 429 VAL n 
1 430 ASN n 
1 431 THR n 
1 432 PRO n 
1 433 PRO n 
1 434 LEU n 
1 435 VAL n 
1 436 LYS n 
1 437 LEU n 
1 438 TRP n 
1 439 TYR n 
1 440 GLN n 
1 441 LEU n 
1 442 GLU n 
1 443 LYS n 
1 444 GLU n 
1 445 PRO n 
1 446 ILE n 
1 447 VAL n 
1 448 GLY n 
1 449 ALA n 
1 450 GLU n 
1 451 THR n 
1 452 PHE n 
1 453 TYR n 
1 454 VAL n 
1 455 ASP n 
1 456 GLY n 
1 457 ALA n 
1 458 ALA n 
1 459 ASN n 
1 460 ARG n 
1 461 GLU n 
1 462 THR n 
1 463 LYS n 
1 464 LEU n 
1 465 GLY n 
1 466 LYS n 
1 467 ALA n 
1 468 GLY n 
1 469 TYR n 
1 470 VAL n 
1 471 THR n 
1 472 ASN n 
1 473 ARG n 
1 474 GLY n 
1 475 ARG n 
1 476 GLN n 
1 477 LYS n 
1 478 VAL n 
1 479 VAL n 
1 480 THR n 
1 481 LEU n 
1 482 THR n 
1 483 ASP n 
1 484 THR n 
1 485 THR n 
1 486 ASN n 
1 487 GLN n 
1 488 LYS n 
1 489 THR n 
1 490 GLU n 
1 491 LEU n 
1 492 GLN n 
1 493 ALA n 
1 494 ILE n 
1 495 TYR n 
1 496 LEU n 
1 497 ALA n 
1 498 LEU n 
1 499 GLN n 
1 500 ASP n 
1 501 SER n 
1 502 GLY n 
1 503 LEU n 
1 504 GLU n 
1 505 VAL n 
1 506 ASN n 
1 507 ILE n 
1 508 VAL n 
1 509 THR n 
1 510 ASP n 
1 511 SER n 
1 512 GLN n 
1 513 TYR n 
1 514 ALA n 
1 515 LEU n 
1 516 GLY n 
1 517 ILE n 
1 518 ILE n 
1 519 GLN n 
1 520 ALA n 
1 521 GLN n 
1 522 PRO n 
1 523 ASP n 
1 524 GLN n 
1 525 SER n 
1 526 GLU n 
1 527 SER n 
1 528 GLU n 
1 529 LEU n 
1 530 VAL n 
1 531 ASN n 
1 532 GLN n 
1 533 ILE n 
1 534 ILE n 
1 535 GLU n 
1 536 GLN n 
1 537 LEU n 
1 538 ILE n 
1 539 LYS n 
1 540 LYS n 
1 541 GLU n 
1 542 LYS n 
1 543 VAL n 
1 544 TYR n 
1 545 LEU n 
1 546 ALA n 
1 547 TRP n 
1 548 VAL n 
1 549 PRO n 
1 550 ALA n 
1 551 HIS n 
1 552 LYS n 
1 553 GLY n 
1 554 ILE n 
1 555 GLY n 
1 556 GLY n 
1 557 ASN n 
1 558 GLU n 
1 559 GLN n 
1 560 VAL n 
1 561 ASP n 
1 562 LYS n 
1 563 LEU n 
1 564 VAL n 
1 565 SER n 
1 566 ALA n 
1 567 GLY n 
1 568 ILE n 
1 569 ARG n 
1 570 LYS n 
1 571 VAL n 
1 572 LEU n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
2 429 LEU n 
2 430 GLU n 
2 431 LYS n 
2 432 GLU n 
2 433 PRO n 
2 434 ILE n 
2 435 VAL n 
2 436 GLY n 
2 437 ALA n 
2 438 GLU n 
2 439 THR n 
2 440 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  DG  n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  DOC n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DG  n 
4 6   DG  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 572 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 440 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 21 'Human immunodeficiency virus 1' ? 11676 ? 
4 1 sample 1 27 'Human immunodeficiency virus 1' ? 11676 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1H2 P04585 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
2 UNP POL_HV1H2 P04585 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
3 PDB 6UJX      6UJX   ? 3 ? 1   
4 PDB 6UJX      6UJX   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6UJX A 13 ? 572 ? P04585 588 ? 1147 ? 1   560 
2 2 6UJX B 1  ? 440 ? P04585 588 ? 1027 ? 1   440 
3 3 6UJX P 1  ? 21  ? 6UJX   802 ? 822  ? 802 822 
4 4 6UJX T 1  ? 27  ? 6UJX   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6UJX MET A 1   ? UNP P04585 ?   ?   'initiating methionine' -11 1  
1 6UJX GLY A 2   ? UNP P04585 ?   ?   'expression tag'        -10 2  
1 6UJX SER A 3   ? UNP P04585 ?   ?   'expression tag'        -9  3  
1 6UJX SER A 4   ? UNP P04585 ?   ?   'expression tag'        -8  4  
1 6UJX HIS A 5   ? UNP P04585 ?   ?   'expression tag'        -7  5  
1 6UJX HIS A 6   ? UNP P04585 ?   ?   'expression tag'        -6  6  
1 6UJX HIS A 7   ? UNP P04585 ?   ?   'expression tag'        -5  7  
1 6UJX HIS A 8   ? UNP P04585 ?   ?   'expression tag'        -4  8  
1 6UJX HIS A 9   ? UNP P04585 ?   ?   'expression tag'        -3  9  
1 6UJX HIS A 10  ? UNP P04585 ?   ?   'expression tag'        -2  10 
1 6UJX SER A 11  ? UNP P04585 ?   ?   'expression tag'        -1  11 
1 6UJX SER A 12  ? UNP P04585 ?   ?   'expression tag'        0   12 
1 6UJX CYS A 270 ? UNP P04585 GLN 845 'engineered mutation'   258 13 
1 6UJX SER A 292 ? UNP P04585 CYS 867 'engineered mutation'   280 14 
2 6UJX SER B 280 ? UNP P04585 CYS 867 'engineered mutation'   280 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1RY non-polymer         . 
;[[(2R,5S)-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
? 'C8 H13 F N3 O12 P3 S' 487.186 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'           133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'         121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'      331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'       307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'      347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'       291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P'      322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER ? 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'                 24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'           105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'              96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'          117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UJX 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.78 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.82 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2% PEG 4000, MES pH 6.0, 10mM magnesium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-10 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97395 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97395 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            46.2408981058 
_reflns.entry_id                         6UJX 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.650 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       39743 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.300 
_reflns.pdbx_Rmerge_I_obs                0.11000 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.8000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.65 
_reflns_shell.d_res_low                   2.70 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3373 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.73500 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               43.6637549949 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6UJX 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.70451211695 
_refine.ls_d_res_low                             47.5975379997 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     39631 
_refine.ls_number_reflns_R_free                  3502 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.1107287761 
_refine.ls_percent_reflns_R_free                 5.04589138798 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.199062841517 
_refine.ls_R_factor_R_free                       0.24381306141 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.196688207566 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33617033594 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3KK1 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.3473199799 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3227080861 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.70451211695 
_refine_hist.d_res_low                        47.5975379997 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               8731 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        7750 
_refine_hist.pdbx_number_atoms_nucleic_acid   820 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00960359113798 ? 8947  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.15195166526    ? 12326 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0479562585126  ? 1337  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0060203388258  ? 1400  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 19.4098725555    ? 3426  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.70451211695 2.7416     . . 46  928  31.3687600644 . . . 0.320866536353 . 0.29111523714  . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 2.7416        2.7807     . . 97  1707 57.415658816  . . . 0.325825961193 . 0.290435492638 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 2.7807        2.8222     . . 101 1837 62.2550594282 . . . 0.272311912648 . 0.265494148069 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 2.8222        2.8663     . . 106 1941 65.6510583708 . . . 0.297119164363 . 0.26887641766  . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 2.8663        2.9133     . . 118 2202 74.3113388853 . . . 0.311904733003 . 0.257359240159 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 2.9133        2.9635     . . 133 2411 82.3834196891 . . . 0.319611589129 . 0.254545902922 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 2.9635        3.0174     . . 143 2585 88.256227758  . . . 0.335972382408 . 0.266697551729 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.0174        3.0754     . . 142 2757 92.3542529468 . . . 0.329861200587 . 0.252686373737 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.0754        3.1382     . . 161 2844 95.6701687361 . . . 0.305638232012 . 0.256142328969 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.1382        3.2064     . . 154 2865 97.5129198966 . . . 0.279297439787 . 0.223960341481 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.2064        3.281      . . 154 2889 98.3198707593 . . . 0.288272783939 . 0.23211266721  . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.281         3.363      . . 146 2928 98.0542264753 . . . 0.262468451556 . 0.217153069709 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.363         3.4539     . . 155 2889 98.0354267311 . . . 0.260363042287 . 0.221009890105 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.4539        3.5555     . . 154 2906 98.3922829582 . . . 0.295798713734 . 0.222343986271 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.5555        3.6702     . . 158 2911 98.0511182109 . . . 0.248788137403 . 0.221432526173 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.6702        3.8014     . . 137 2921 98.6451612903 . . . 0.23351133985  . 0.206351453763 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.8014        3.9535     . . 153 2907 97.359210945  . . . 0.268840772784 . 0.194538191009 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 3.9535        4.1333     . . 153 2921 98.683788122  . . . 0.232338936883 . 0.173971811587 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 4.1333        4.3511     . . 160 2899 98.9327296248 . . . 0.201135435886 . 0.172007482745 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 4.3511        4.6235     . . 149 2912 98.5194721596 . . . 0.216788719322 . 0.157318783682 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 4.6235        4.9802     . . 164 2928 98.8807163415 . . . 0.203979396753 . 0.157013118043 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 4.9802        5.4807     . . 144 2960 99.8391765841 . . . 0.214389693946 . 0.153426278197 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 5.4807        6.2722     . . 158 2965 99.9040307102 . . . 0.206267205588 . 0.172911891523 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 6.2722        7.8965     . . 156 2968 99.968        . . . 0.221470146014 . 0.174225189609 . . . . . . . . . . 
. 
'X-RAY DIFFRACTION' 7.8965        47.5975379 . . 160 2920 99.0353697749 . . . 0.198506324884 . 0.172682061672 . . . . . . . . . . 
. 
# 
_struct.entry_id                     6UJX 
_struct.title                        'HIV-1 wild-type reverse transcriptase-DNA complex with (-)-FTC-TP' 
_struct.pdbx_descriptor              'Reverse transcriptase/RNaseH/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UJX 
_struct_keywords.text            'HIV-1 reverse transcriptase NRTI polymerase DNA complex, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 5 ? 
J N N 5 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 39  ? GLU A 56  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE A 89  ? ARG A 95  ? PHE A 77  ARG A 83  1 ? 7  
HELX_P HELX_P3  AA3 HIS A 108 ? LEU A 112 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 126 ? VAL A 130 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 133 ? ALA A 141 ? ASP A 121 ALA A 129 5 ? 9  
HELX_P HELX_P6  AA6 GLY A 167 ? ASN A 187 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  AA7 GLU A 206 ? TRP A 224 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 229 ? LYS A 231 ? PRO A 217 LYS A 219 5 ? 3  
HELX_P HELX_P9  AA9 VAL A 266 ? GLN A 281 ? VAL A 254 GLN A 269 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 288 ? LEU A 295 ? VAL A 276 LEU A 283 1 ? 8  
HELX_P HELX_P11 AB2 THR A 308 ? LYS A 323 ? THR A 296 LYS A 311 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 375 ? TRP A 395 ? ASN A 363 TRP A 383 1 ? 21 
HELX_P HELX_P13 AB4 GLN A 406 ? TYR A 417 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 AB5 THR A 485 ? SER A 501 ? THR A 473 SER A 489 1 ? 17 
HELX_P HELX_P15 AB6 SER A 511 ? GLN A 519 ? SER A 499 GLN A 507 1 ? 9  
HELX_P HELX_P16 AB7 SER A 527 ? LYS A 540 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 GLY A 556 ? SER A 565 ? GLY A 544 SER A 553 1 ? 10 
HELX_P HELX_P18 AB9 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 77  ? ARG B 83  ? PHE B 77  ARG B 83  1 ? 7  
HELX_P HELX_P20 AC2 PRO B 97  ? LYS B 102 ? PRO B 97  LYS B 102 5 ? 6  
HELX_P HELX_P21 AC3 GLY B 112 ? VAL B 118 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P22 AC4 PHE B 124 ? ALA B 129 ? PHE B 124 ALA B 129 5 ? 6  
HELX_P HELX_P23 AC5 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P24 AC6 LYS B 154 ? ASN B 175 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P25 AC7 GLY B 196 ? ARG B 211 ? GLY B 196 ARG B 211 1 ? 16 
HELX_P HELX_P26 AC8 HIS B 235 ? TRP B 239 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P27 AC9 THR B 253 ? TYR B 271 ? THR B 253 TYR B 271 1 ? 19 
HELX_P HELX_P28 AD1 VAL B 276 ? LYS B 281 ? VAL B 276 LYS B 281 1 ? 6  
HELX_P HELX_P29 AD2 LEU B 282 ? ARG B 284 ? LEU B 282 ARG B 284 5 ? 3  
HELX_P HELX_P30 AD3 THR B 296 ? LEU B 310 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P31 AD4 ASN B 363 ? GLY B 384 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P32 AD5 GLN B 394 ? TRP B 402 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P33 AD6 THR B 403 ? TYR B 405 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P34 AD7 LEU B 422 ? TYR B 427 ? LEU B 422 TYR B 427 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 122 OD2   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 110 A MG  603 1_555 ? ? ? ? ? ? ?            2.085 ? 
metalc2  metalc ?    ? A VAL 123 O     ? ? ? 1_555 G MG  .  MG  ? ? A VAL 111 A MG  603 1_555 ? ? ? ? ? ? ?            1.961 ? 
metalc3  metalc ?    ? A ASP 197 OD2   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 185 A MG  603 1_555 ? ? ? ? ? ? ?            2.396 ? 
covale1  covale both ? C DC  20  "O3'" ? ? ? 1_555 C DOC 21 P   ? ? P DC  821 P DOC 822 1_555 ? ? ? ? ? ? ?            1.668 ? 
metalc4  metalc ?    ? G MG  .   MG    ? ? ? 1_555 H 1RY .  OAH B ? A MG  603 A 1RY 604 1_555 ? ? ? ? ? ? ?            2.089 ? 
metalc5  metalc ?    ? G MG  .   MG    ? ? ? 1_555 H 1RY .  OAE B ? A MG  603 A 1RY 604 1_555 ? ? ? ? ? ? ?            2.457 ? 
metalc6  metalc ?    ? G MG  .   MG    ? ? ? 1_555 H 1RY .  OAD A ? A MG  603 A 1RY 604 1_555 ? ? ? ? ? ? ?            2.543 ? 
metalc7  metalc ?    ? G MG  .   MG    ? ? ? 1_555 H 1RY .  OAQ A ? A MG  603 A 1RY 604 1_555 ? ? ? ? ? ? ?            2.461 ? 
hydrog1  hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? C DG  16  N1    ? ? ? 1_555 D DC  11 N3  ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? C DG  16  N2    ? ? ? 1_555 D DC  11 O2  ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? C DG  16  O6    ? ? ? 1_555 D DC  11 N4  ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? C DOC 21  N3    ? ? ? 1_555 D DG  6  N1  ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? C DOC 21  N4    ? ? ? 1_555 D DG  6  O6  ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? C DOC 21  O2    ? ? ? 1_555 D DG  6  N2  ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 237 A . ? PRO 225 A PRO 238 A ? PRO 226 A 1 0.58  
2 PRO 432 A . ? PRO 420 A PRO 433 A ? PRO 421 A 1 -0.82 
3 GLY 555 A . ? GLY 543 A GLY 556 A ? GLY 544 A 1 1.29  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 5 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 59  ? LYS A 61  ? ILE A 47  LYS A 49  
AA1 2 ARG A 155 ? TYR A 158 ? ARG A 143 TYR A 146 
AA1 3 PHE A 142 ? THR A 143 ? PHE A 130 THR A 131 
AA2 1 VAL A 72  ? LYS A 76  ? VAL A 60  LYS A 64  
AA2 2 TRP A 83  ? VAL A 87  ? TRP A 71  VAL A 75  
AA3 1 VAL A 191 ? TYR A 195 ? VAL A 179 TYR A 183 
AA3 2 ASP A 198 ? SER A 203 ? ASP A 186 SER A 191 
AA3 3 SER A 117 ? ASP A 122 ? SER A 105 ASP A 110 
AA3 4 HIS A 233 ? GLN A 234 ? HIS A 221 GLN A 222 
AA4 1 PHE A 239 ? TRP A 241 ? PHE A 227 TRP A 229 
AA4 2 TYR A 244 ? LEU A 246 ? TYR A 232 LEU A 234 
AA4 3 TRP A 251 ? VAL A 253 ? TRP A 239 VAL A 241 
AA5 1 TRP A 264 ? THR A 265 ? TRP A 252 THR A 253 
AA5 2 VAL A 304 ? ILE A 305 ? VAL A 292 ILE A 293 
AA6 1 ASN A 360 ? TYR A 366 ? ASN A 348 TYR A 354 
AA6 2 GLN A 348 ? TYR A 354 ? GLN A 336 TYR A 342 
AA6 3 ILE A 338 ? GLY A 345 ? ILE A 326 GLY A 333 
AA6 4 LYS A 400 ? LEU A 403 ? LYS A 388 LEU A 391 
AA6 5 TRP A 426 ? PHE A 428 ? TRP A 414 PHE A 416 
AA7 1 HIS A 373 ? THR A 374 ? HIS A 361 THR A 362 
AA7 2 GLN A 524 ? SER A 525 ? GLN A 512 SER A 513 
AA8 1 GLN A 476 ? THR A 482 ? GLN A 464 THR A 470 
AA8 2 LEU A 464 ? THR A 471 ? LEU A 452 THR A 459 
AA8 3 GLU A 450 ? ALA A 458 ? GLU A 438 ALA A 446 
AA8 4 GLU A 504 ? THR A 509 ? GLU A 492 THR A 497 
AA8 5 LYS A 542 ? TRP A 547 ? LYS A 530 TRP A 535 
AA9 1 ILE B 47  ? LYS B 49  ? ILE B 47  LYS B 49  
AA9 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
AA9 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
AB1 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
AB1 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
AB2 1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
AB2 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
AB2 3 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
AB3 1 ASN B 348 ? TYR B 354 ? ASN B 348 TYR B 354 
AB3 2 GLN B 336 ? TYR B 342 ? GLN B 336 TYR B 342 
AB3 3 LEU B 325 ? GLY B 333 ? LEU B 325 GLY B 333 
AB3 4 PRO B 387 ? LEU B 391 ? PRO B 387 LEU B 391 
AB3 5 GLU B 413 ? PHE B 416 ? GLU B 413 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 60  ? N SER A 48  O GLN A 157 ? O GLN A 145 
AA1 2 3 O TYR A 156 ? O TYR A 144 N PHE A 142 ? N PHE A 130 
AA2 1 2 N ILE A 75  ? N ILE A 63  O ARG A 84  ? O ARG A 72  
AA3 1 2 N VAL A 191 ? N VAL A 179 O GLY A 202 ? O GLY A 190 
AA3 2 3 O VAL A 201 ? O VAL A 189 N THR A 119 ? N THR A 107 
AA3 3 4 N VAL A 120 ? N VAL A 108 O GLN A 234 ? O GLN A 222 
AA4 1 2 N PHE A 239 ? N PHE A 227 O LEU A 246 ? O LEU A 234 
AA4 2 3 N GLU A 245 ? N GLU A 233 O THR A 252 ? O THR A 240 
AA5 1 2 N TRP A 264 ? N TRP A 252 O ILE A 305 ? O ILE A 293 
AA6 1 2 O LEU A 361 ? O LEU A 349 N ILE A 353 ? N ILE A 341 
AA6 2 3 O TYR A 354 ? O TYR A 342 N ILE A 338 ? N ILE A 326 
AA6 3 4 N ALA A 339 ? N ALA A 327 O LYS A 400 ? O LYS A 388 
AA6 4 5 N PHE A 401 ? N PHE A 389 O GLU A 427 ? O GLU A 415 
AA7 1 2 N THR A 374 ? N THR A 362 O GLN A 524 ? O GLN A 512 
AA8 1 2 O VAL A 479 ? O VAL A 467 N ALA A 467 ? N ALA A 455 
AA8 2 3 O VAL A 470 ? O VAL A 458 N TYR A 453 ? N TYR A 441 
AA8 3 4 N PHE A 452 ? N PHE A 440 O ASN A 506 ? O ASN A 494 
AA8 4 5 N ILE A 507 ? N ILE A 495 O TYR A 544 ? O TYR A 532 
AA9 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
AA9 2 3 O TYR B 144 ? O TYR B 144 N PHE B 130 ? N PHE B 130 
AB1 1 2 N ILE B 63  ? N ILE B 63  O ARG B 72  ? O ARG B 72  
AB2 1 2 N THR B 107 ? N THR B 107 O VAL B 189 ? O VAL B 189 
AB2 2 3 O TYR B 188 ? O TYR B 188 N TYR B 181 ? N TYR B 181 
AB3 1 2 O TYR B 354 ? O TYR B 354 N TRP B 337 ? N TRP B 337 
AB3 2 3 O TYR B 342 ? O TYR B 342 N ILE B 326 ? N ILE B 326 
AB3 3 4 N LEU B 325 ? N LEU B 325 O LYS B 388 ? O LYS B 388 
AB3 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 601 ? 6  'binding site for residue SO4 A 601' 
AC2 Software A SO4 602 ? 3  'binding site for residue SO4 A 602' 
AC3 Software A MG  603 ? 4  'binding site for residue MG A 603'  
AC4 Software A 1RY 604 ? 16 'binding site for residue 1RY A 604' 
AC5 Software P SO4 901 ? 3  'binding site for residue SO4 P 901' 
AC6 Software T SO4 801 ? 1  'binding site for residue SO4 T 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ARG A 218 ? ARG A 206 . ? 8_445 ? 
2  AC1 6  GLY A 448 ? GLY A 436 . ? 1_555 ? 
3  AC1 6  ASN A 472 ? ASN A 460 . ? 1_555 ? 
4  AC1 6  ARG A 473 ? ARG A 461 . ? 1_555 ? 
5  AC1 6  HOH K .   ? HOH A 725 . ? 1_555 ? 
6  AC1 6  ALA B 288 ? ALA B 288 . ? 1_555 ? 
7  AC2 3  GLN A 352 ? GLN A 340 . ? 1_555 ? 
8  AC2 3  HOH K .   ? HOH A 734 . ? 1_555 ? 
9  AC2 3  THR B 200 ? THR B 200 . ? 6_444 ? 
10 AC3 4  ASP A 122 ? ASP A 110 . ? 1_555 ? 
11 AC3 4  VAL A 123 ? VAL A 111 . ? 1_555 ? 
12 AC3 4  ASP A 197 ? ASP A 185 . ? 1_555 ? 
13 AC3 4  1RY H .   ? 1RY A 604 . ? 1_555 ? 
14 AC4 16 LYS A 77  ? LYS A 65  . ? 1_555 ? 
15 AC4 16 ARG A 84  ? ARG A 72  . ? 1_555 ? 
16 AC4 16 ASP A 122 ? ASP A 110 . ? 1_555 ? 
17 AC4 16 VAL A 123 ? VAL A 111 . ? 1_555 ? 
18 AC4 16 GLY A 124 ? GLY A 112 . ? 1_555 ? 
19 AC4 16 ASP A 125 ? ASP A 113 . ? 1_555 ? 
20 AC4 16 ALA A 126 ? ALA A 114 . ? 1_555 ? 
21 AC4 16 TYR A 127 ? TYR A 115 . ? 1_555 ? 
22 AC4 16 GLN A 163 ? GLN A 151 . ? 1_555 ? 
23 AC4 16 ASP A 197 ? ASP A 185 . ? 1_555 ? 
24 AC4 16 LYS A 232 ? LYS A 220 . ? 1_555 ? 
25 AC4 16 MG  G .   ? MG  A 603 . ? 1_555 ? 
26 AC4 16 HOH K .   ? HOH A 713 . ? 1_555 ? 
27 AC4 16 DOC C 21  ? DOC P 822 . ? 1_555 ? 
28 AC4 16 DG  D 5   ? DG  T 705 . ? 1_555 ? 
29 AC4 16 DG  D 6   ? DG  T 706 . ? 1_555 ? 
30 AC5 3  DG  C 15  ? DG  P 816 . ? 1_555 ? 
31 AC5 3  DG  C 16  ? DG  P 817 . ? 1_555 ? 
32 AC5 3  DG  D 10  ? DG  T 710 . ? 1_555 ? 
33 AC6 1  DG  D 6   ? DG  T 706 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UJX 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005889 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005964 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009680 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C   ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
F   ? ? 8.95735 ?       7.27484  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
H   ? ? 0.51345 0.48472 24.73122 6.32584  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG  ? ? 9.41153 2.53737 2.59044  63.03566 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N   ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O   ? ? 7.96527 ?       9.05267  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O1- ? ? 5.12366 3.84317 3.49406  27.47979 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P   ? ? 9.51135 5.44231 1.42069  35.72801 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S   ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 13  ? 10.55300  -39.47100 9.74000   1.000 47.78000  ? 1    PRO A N     1 
ATOM   2    C  CA    . PRO A 1 13  ? 11.11400  -40.59700 10.49600  1.000 48.51000  ? 1    PRO A CA    1 
ATOM   3    C  C     . PRO A 1 13  ? 10.14800  -41.78100 10.50000  1.000 45.87000  ? 1    PRO A C     1 
ATOM   4    O  O     . PRO A 1 13  ? 9.00600   -41.61900 10.06300  1.000 45.56000  ? 1    PRO A O     1 
ATOM   5    C  CB    . PRO A 1 13  ? 11.31400  -40.02200 11.92300  1.000 38.99000  ? 1    PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 13  ? 10.70300  -38.62200 11.90900  1.000 39.98000  ? 1    PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 13  ? 9.87500   -38.51700 10.64000  1.000 46.41000  ? 1    PRO A CD    1 
ATOM   8    N  N     . ILE A 1 14  ? 10.59800  -42.94300 10.97100  1.000 42.96000  ? 2    ILE A N     1 
ATOM   9    C  CA    . ILE A 1 14  ? 9.73600   -44.12000 11.05500  1.000 36.82000  ? 2    ILE A CA    1 
ATOM   10   C  C     . ILE A 1 14  ? 9.13200   -44.25100 12.43600  1.000 43.45000  ? 2    ILE A C     1 
ATOM   11   O  O     . ILE A 1 14  ? 9.86300   -44.26600 13.43800  1.000 49.08000  ? 2    ILE A O     1 
ATOM   12   C  CB    . ILE A 1 14  ? 10.50400  -45.41700 10.75300  1.000 44.66000  ? 2    ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 14  ? 11.04800  -45.42400 9.31900   1.000 47.63000  ? 2    ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 14  ? 9.60000   -46.62300 10.97600  1.000 41.87000  ? 2    ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 14  ? 11.87000  -46.65200 9.00900   1.000 36.25000  ? 2    ILE A CD1   1 
ATOM   16   N  N     . SER A 1 15  ? 7.80400   -44.33900 12.49300  1.000 37.33000  ? 3    SER A N     1 
ATOM   17   C  CA    . SER A 1 15  ? 7.08700   -44.62900 13.73700  1.000 36.62000  ? 3    SER A CA    1 
ATOM   18   C  C     . SER A 1 15  ? 7.64900   -45.88200 14.45500  1.000 41.33000  ? 3    SER A C     1 
ATOM   19   O  O     . SER A 1 15  ? 7.92900   -46.91600 13.81000  1.000 39.53000  ? 3    SER A O     1 
ATOM   20   C  CB    . SER A 1 15  ? 5.58200   -44.81500 13.43200  1.000 37.85000  ? 3    SER A CB    1 
ATOM   21   O  OG    . SER A 1 15  ? 4.79700   -45.01900 14.60400  1.000 35.39000  ? 3    SER A OG    1 
ATOM   22   N  N     . PRO A 1 16  ? 7.84100   -45.78000 15.79000  1.000 38.43000  ? 4    PRO A N     1 
ATOM   23   C  CA    . PRO A 1 16  ? 8.10900   -46.93900 16.63300  1.000 30.01000  ? 4    PRO A CA    1 
ATOM   24   C  C     . PRO A 1 16  ? 6.78800   -47.55700 17.02900  1.000 33.12000  ? 4    PRO A C     1 
ATOM   25   O  O     . PRO A 1 16  ? 6.63800   -47.94900 18.17800  1.000 32.14000  ? 4    PRO A O     1 
ATOM   26   C  CB    . PRO A 1 16  ? 8.76900   -46.32700 17.84700  1.000 31.27000  ? 4    PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 16  ? 7.98700   -45.09600 18.04000  1.000 29.75000  ? 4    PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 16  ? 7.73800   -44.56100 16.61700  1.000 35.71000  ? 4    PRO A CD    1 
ATOM   29   N  N     . ILE A 1 17  ? 5.81600   -47.57800 16.12400  1.000 35.49000  ? 5    ILE A N     1 
ATOM   30   C  CA    . ILE A 1 17  ? 4.55800   -48.23500 16.44700  1.000 33.66000  ? 5    ILE A CA    1 
ATOM   31   C  C     . ILE A 1 17  ? 4.72500   -49.68800 16.08500  1.000 29.53000  ? 5    ILE A C     1 
ATOM   32   O  O     . ILE A 1 17  ? 5.53700   -50.01600 15.20900  1.000 31.89000  ? 5    ILE A O     1 
ATOM   33   C  CB    . ILE A 1 17  ? 3.36700   -47.63000 15.71000  1.000 28.97000  ? 5    ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 17  ? 2.09400   -48.42000 16.04500  1.000 39.48000  ? 5    ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 17  ? 3.61600   -47.63900 14.23900  1.000 32.37000  ? 5    ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 17  ? 0.77600   -47.74500 15.58400  1.000 37.55000  ? 5    ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 18  ? 4.00200   -50.55800 16.77500  1.000 22.38000  ? 6    GLU A N     1 
ATOM   38   C  CA    . GLU A 1 18  ? 4.09800   -51.97200 16.45000  1.000 26.88000  ? 6    GLU A CA    1 
ATOM   39   C  C     . GLU A 1 18  ? 3.55600   -52.22700 15.05200  1.000 24.86000  ? 6    GLU A C     1 
ATOM   40   O  O     . GLU A 1 18  ? 2.52900   -51.66400 14.65600  1.000 24.68000  ? 6    GLU A O     1 
ATOM   41   C  CB    . GLU A 1 18  ? 3.34100   -52.81400 17.46600  1.000 33.78000  ? 6    GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 18  ? 3.58600   -52.39400 18.89400  1.000 40.51000  ? 6    GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 18  ? 3.10300   -53.43300 19.88300  1.000 56.01000  ? 6    GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 18  ? 2.90200   -54.60500 19.47300  1.000 55.24000  ? 6    GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 18  ? 2.92500   -53.07600 21.07000  1.000 58.96000  ? 6    GLU A OE2   1 
ATOM   46   N  N     . THR A 1 19  ? 4.26300   -53.05500 14.30400  1.000 22.53000  ? 7    THR A N     1 
ATOM   47   C  CA    . THR A 1 19  ? 3.78000   -53.50000 13.00700  1.000 22.92000  ? 7    THR A CA    1 
ATOM   48   C  C     . THR A 1 19  ? 2.49700   -54.28600 13.17400  1.000 27.44000  ? 7    THR A C     1 
ATOM   49   O  O     . THR A 1 19  ? 2.21800   -54.78800 14.25700  1.000 36.79000  ? 7    THR A O     1 
ATOM   50   C  CB    . THR A 1 19  ? 4.79400   -54.38800 12.29400  1.000 27.07000  ? 7    THR A CB    1 
ATOM   51   O  OG1   . THR A 1 19  ? 5.19000   -55.44900 13.17800  1.000 22.71000  ? 7    THR A OG1   1 
ATOM   52   C  CG2   . THR A 1 19  ? 6.01400   -53.56400 11.84900  1.000 30.57000  ? 7    THR A CG2   1 
ATOM   53   N  N     . VAL A 1 20  ? 1.72500   -54.39400 12.10400  1.000 27.24000  ? 8    VAL A N     1 
ATOM   54   C  CA    . VAL A 1 20  ? 0.54900   -55.24600 12.09200  1.000 27.21000  ? 8    VAL A CA    1 
ATOM   55   C  C     . VAL A 1 20  ? 0.85300   -56.54200 11.36600  1.000 28.78000  ? 8    VAL A C     1 
ATOM   56   O  O     . VAL A 1 20  ? 1.26200   -56.51500 10.21400  1.000 37.03000  ? 8    VAL A O     1 
ATOM   57   C  CB    . VAL A 1 20  ? -0.63300  -54.55000 11.40300  1.000 30.19000  ? 8    VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 20  ? -1.78400  -55.52500 11.23000  1.000 27.04000  ? 8    VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 20  ? -1.03300  -53.28600 12.18700  1.000 25.60000  ? 8    VAL A CG2   1 
ATOM   60   N  N     . PRO A 1 21  ? 0.66300   -57.67400 12.04200  1.000 29.83000  ? 9    PRO A N     1 
ATOM   61   C  CA    . PRO A 1 21  ? 0.98400   -59.00400 11.50100  1.000 32.57000  ? 9    PRO A CA    1 
ATOM   62   C  C     . PRO A 1 21  ? 0.16100   -59.36700 10.26400  1.000 39.50000  ? 9    PRO A C     1 
ATOM   63   O  O     . PRO A 1 21  ? -1.06500  -59.48200 10.34300  1.000 38.81000  ? 9    PRO A O     1 
ATOM   64   C  CB    . PRO A 1 21  ? 0.63800   -59.95200 12.65900  1.000 23.84000  ? 9    PRO A CB    1 
ATOM   65   C  CG    . PRO A 1 21  ? 0.67900   -59.10400 13.86600  1.000 30.47000  ? 9    PRO A CG    1 
ATOM   66   C  CD    . PRO A 1 21  ? 0.22900   -57.74300 13.44400  1.000 33.05000  ? 9    PRO A CD    1 
ATOM   67   N  N     . VAL A 1 22  ? 0.84400   -59.59000 9.14800   1.000 34.55000  ? 10   VAL A N     1 
ATOM   68   C  CA    . VAL A 1 22  ? 0.18400   -59.99600 7.92400   1.000 32.60000  ? 10   VAL A CA    1 
ATOM   69   C  C     . VAL A 1 22  ? 0.73900   -61.29000 7.32300   1.000 36.38000  ? 10   VAL A C     1 
ATOM   70   O  O     . VAL A 1 22  ? 1.89100   -61.64500 7.55700   1.000 40.16000  ? 10   VAL A O     1 
ATOM   71   C  CB    . VAL A 1 22  ? 0.31800   -58.91300 6.91300   1.000 32.42000  ? 10   VAL A CB    1 
ATOM   72   C  CG1   . VAL A 1 22  ? -0.61300  -57.80500 7.27900   1.000 40.53000  ? 10   VAL A CG1   1 
ATOM   73   C  CG2   . VAL A 1 22  ? 1.73500   -58.41400 6.93000   1.000 31.31000  ? 10   VAL A CG2   1 
ATOM   74   N  N     . LYS A 1 23  ? -0.08300  -61.99800 6.55300   1.000 35.13000  ? 11   LYS A N     1 
ATOM   75   C  CA    . LYS A 1 23  ? 0.39400   -63.19400 5.86900   1.000 37.51000  ? 11   LYS A CA    1 
ATOM   76   C  C     . LYS A 1 23  ? -0.25000  -63.34100 4.51000   1.000 40.93000  ? 11   LYS A C     1 
ATOM   77   O  O     . LYS A 1 23  ? -1.30200  -62.74500 4.24600   1.000 42.83000  ? 11   LYS A O     1 
ATOM   78   C  CB    . LYS A 1 23  ? 0.14200   -64.44900 6.70500   1.000 35.26000  ? 11   LYS A CB    1 
ATOM   79   C  CG    . LYS A 1 23  ? -1.22000  -64.52400 7.33200   1.000 44.90000  ? 11   LYS A CG    1 
ATOM   80   C  CD    . LYS A 1 23  ? -1.29000  -65.65100 8.37300   1.000 52.45000  ? 11   LYS A CD    1 
ATOM   81   C  CE    . LYS A 1 23  ? -2.70700  -65.78100 8.95400   1.000 57.05000  ? 11   LYS A CE    1 
ATOM   82   N  NZ    . LYS A 1 23  ? -3.74300  -65.73900 7.86800   1.000 46.61000  ? 11   LYS A NZ    1 
ATOM   83   N  N     . LEU A 1 24  ? 0.40600   -64.11400 3.64500   1.000 38.16000  ? 12   LEU A N     1 
ATOM   84   C  CA    . LEU A 1 24  ? -0.12900  -64.44500 2.33000   1.000 36.25000  ? 12   LEU A CA    1 
ATOM   85   C  C     . LEU A 1 24  ? -1.34200  -65.37000 2.48100   1.000 38.72000  ? 12   LEU A C     1 
ATOM   86   O  O     . LEU A 1 24  ? -1.57700  -65.92700 3.55300   1.000 40.27000  ? 12   LEU A O     1 
ATOM   87   C  CB    . LEU A 1 24  ? 0.95500   -65.10100 1.46900   1.000 34.97000  ? 12   LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 24  ? 2.16100   -64.26900 0.99800   1.000 36.22000  ? 12   LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 24  ? 3.05200   -65.07900 0.07500   1.000 40.43000  ? 12   LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 24  ? 1.72600   -63.01100 0.27300   1.000 38.60000  ? 12   LEU A CD2   1 
ATOM   91   N  N     . LYS A 1 25  ? -2.14000  -65.53300 1.43900   1.000 40.46000  ? 13   LYS A N     1 
ATOM   92   C  CA    . LYS A 1 25  ? -3.18700  -66.54100 1.53000   1.000 46.33000  ? 13   LYS A CA    1 
ATOM   93   C  C     . LYS A 1 25  ? -2.53100  -67.92300 1.46300   1.000 53.59000  ? 13   LYS A C     1 
ATOM   94   O  O     . LYS A 1 25  ? -1.46700  -68.06700 0.85500   1.000 55.58000  ? 13   LYS A O     1 
ATOM   95   C  CB    . LYS A 1 25  ? -4.21000  -66.36400 0.42500   1.000 44.26000  ? 13   LYS A CB    1 
ATOM   96   C  CG    . LYS A 1 25  ? -5.35900  -65.48400 0.82300   1.000 42.90000  ? 13   LYS A CG    1 
ATOM   97   C  CD    . LYS A 1 25  ? -6.13300  -65.03500 -0.39600  1.000 40.43000  ? 13   LYS A CD    1 
ATOM   98   C  CE    . LYS A 1 25  ? -7.38900  -64.26300 -0.01500  1.000 36.43000  ? 13   LYS A CE    1 
ATOM   99   N  NZ    . LYS A 1 25  ? -7.86200  -63.44200 -1.17700  1.000 48.89000  ? 13   LYS A NZ    1 
ATOM   100  N  N     . PRO A 1 26  ? -3.15100  -68.93900 2.08900   1.000 52.42000  ? 14   PRO A N     1 
ATOM   101  C  CA    . PRO A 1 26  ? -2.54800  -70.26800 2.23600   1.000 49.02000  ? 14   PRO A CA    1 
ATOM   102  C  C     . PRO A 1 26  ? -2.06600  -70.87300 0.91500   1.000 54.19000  ? 14   PRO A C     1 
ATOM   103  O  O     . PRO A 1 26  ? -2.69900  -70.68200 -0.13000  1.000 51.21000  ? 14   PRO A O     1 
ATOM   104  C  CB    . PRO A 1 26  ? -3.68600  -71.10200 2.82300   1.000 43.72000  ? 14   PRO A CB    1 
ATOM   105  C  CG    . PRO A 1 26  ? -4.53100  -70.11800 3.54100   1.000 49.27000  ? 14   PRO A CG    1 
ATOM   106  C  CD    . PRO A 1 26  ? -4.49200  -68.87600 2.69600   1.000 55.94000  ? 14   PRO A CD    1 
ATOM   107  N  N     . GLY A 1 27  ? -0.93700  -71.57800 0.97100   1.000 52.24000  ? 15   GLY A N     1 
ATOM   108  C  CA    . GLY A 1 27  ? -0.40500  -72.26700 -0.18900  1.000 58.41000  ? 15   GLY A CA    1 
ATOM   109  C  C     . GLY A 1 27  ? 0.00800   -71.34000 -1.31700  1.000 58.38000  ? 15   GLY A C     1 
ATOM   110  O  O     . GLY A 1 27  ? 0.36600   -71.78000 -2.41700  1.000 60.87000  ? 15   GLY A O     1 
ATOM   111  N  N     . MET A 1 28  ? -0.04500  -70.04600 -1.04800  1.000 50.56000  ? 16   MET A N     1 
ATOM   112  C  CA    . MET A 1 28  ? 0.35400   -69.05800 -2.02600  1.000 50.05000  ? 16   MET A CA    1 
ATOM   113  C  C     . MET A 1 28  ? 1.76200   -68.60600 -1.72100  1.000 48.61000  ? 16   MET A C     1 
ATOM   114  O  O     . MET A 1 28  ? 2.23000   -68.74000 -0.58500  1.000 44.90000  ? 16   MET A O     1 
ATOM   115  C  CB    . MET A 1 28  ? -0.60700  -67.87500 -2.01100  1.000 54.00000  ? 16   MET A CB    1 
ATOM   116  C  CG    . MET A 1 28  ? -2.06600  -68.26300 -2.18500  1.000 54.49000  ? 16   MET A CG    1 
ATOM   117  S  SD    . MET A 1 28  ? -2.63500  -67.98900 -3.88100  1.000 76.32000  ? 16   MET A SD    1 
ATOM   118  C  CE    . MET A 1 28  ? -4.42600  -67.99300 -3.64400  1.000 59.11000  ? 16   MET A CE    1 
ATOM   119  N  N     . ASP A 1 29  ? 2.43900   -68.07200 -2.72900  1.000 48.30000  ? 17   ASP A N     1 
ATOM   120  C  CA    . ASP A 1 29  ? 3.76700   -67.51400 -2.51300  1.000 52.92000  ? 17   ASP A CA    1 
ATOM   121  C  C     . ASP A 1 29  ? 3.88500   -66.15800 -3.21200  1.000 50.02000  ? 17   ASP A C     1 
ATOM   122  O  O     . ASP A 1 29  ? 3.03300   -65.78800 -4.01500  1.000 53.72000  ? 17   ASP A O     1 
ATOM   123  C  CB    . ASP A 1 29  ? 4.84500   -68.49600 -2.99600  1.000 53.77000  ? 17   ASP A CB    1 
ATOM   124  C  CG    . ASP A 1 29  ? 6.24100   -67.89400 -2.98500  1.000 55.08000  ? 17   ASP A CG    1 
ATOM   125  O  OD1   . ASP A 1 29  ? 6.59300   -67.19400 -2.00500  1.000 48.54000  ? 17   ASP A OD1   1 
ATOM   126  O  OD2   . ASP A 1 29  ? 6.97800   -68.10400 -3.97200  1.000 62.12000  ? 17   ASP A OD2   1 
ATOM   127  N  N     . GLY A 1 30  ? 4.94200   -65.42100 -2.88000  1.000 50.07000  ? 18   GLY A N     1 
ATOM   128  C  CA    . GLY A 1 30  ? 5.17100   -64.09300 -3.40800  1.000 52.88000  ? 18   GLY A CA    1 
ATOM   129  C  C     . GLY A 1 30  ? 5.17900   -63.98400 -4.92100  1.000 52.98000  ? 18   GLY A C     1 
ATOM   130  O  O     . GLY A 1 30  ? 5.18500   -64.98900 -5.62900  1.000 52.08000  ? 18   GLY A O     1 
ATOM   131  N  N     . PRO A 1 31  ? 5.17600   -62.74600 -5.42200  1.000 53.51000  ? 19   PRO A N     1 
ATOM   132  C  CA    . PRO A 1 31  ? 5.04300   -62.50000 -6.85400  1.000 51.05000  ? 19   PRO A CA    1 
ATOM   133  C  C     . PRO A 1 31  ? 6.38900   -62.41300 -7.56800  1.000 56.47000  ? 19   PRO A C     1 
ATOM   134  O  O     . PRO A 1 31  ? 7.36100   -61.82800 -7.06200  1.000 55.16000  ? 19   PRO A O     1 
ATOM   135  C  CB    . PRO A 1 31  ? 4.32000   -61.15800 -6.89200  1.000 49.90000  ? 19   PRO A CB    1 
ATOM   136  C  CG    . PRO A 1 31  ? 4.87000   -60.43000 -5.69800  1.000 45.91000  ? 19   PRO A CG    1 
ATOM   137  C  CD    . PRO A 1 31  ? 5.16600   -61.48900 -4.64800  1.000 48.06000  ? 19   PRO A CD    1 
ATOM   138  N  N     . LYS A 1 32  ? 6.43400   -63.01600 -8.74800  1.000 57.69000  ? 20   LYS A N     1 
ATOM   139  C  CA    . LYS A 1 32  ? 7.57100   -62.86600 -9.64000  1.000 52.73000  ? 20   LYS A CA    1 
ATOM   140  C  C     . LYS A 1 32  ? 7.02200   -62.25600 -10.92500 1.000 54.63000  ? 20   LYS A C     1 
ATOM   141  O  O     . LYS A 1 32  ? 6.27400   -62.91300 -11.65600 1.000 56.47000  ? 20   LYS A O     1 
ATOM   142  C  CB    . LYS A 1 32  ? 8.26400   -64.21500 -9.88200  1.000 53.05000  ? 20   LYS A CB    1 
ATOM   143  C  CG    . LYS A 1 32  ? 8.68300   -64.94800 -8.58300  1.000 50.36000  ? 20   LYS A CG    1 
ATOM   144  C  CD    . LYS A 1 32  ? 8.58800   -66.47900 -8.71700  1.000 53.82000  ? 20   LYS A CD    1 
ATOM   145  C  CE    . LYS A 1 32  ? 8.41000   -67.19600 -7.36200  1.000 52.38000  ? 20   LYS A CE    1 
ATOM   146  N  NZ    . LYS A 1 32  ? 9.66800   -67.81800 -6.82200  1.000 49.09000  ? 20   LYS A NZ    1 
ATOM   147  N  N     . VAL A 1 33  ? 7.34500   -60.98300 -11.16300 1.000 49.30000  ? 21   VAL A N     1 
ATOM   148  C  CA    . VAL A 1 33  ? 6.85400   -60.27500 -12.34000 1.000 46.93000  ? 21   VAL A CA    1 
ATOM   149  C  C     . VAL A 1 33  ? 7.85900   -59.24400 -12.82700 1.000 52.43000  ? 21   VAL A C     1 
ATOM   150  O  O     . VAL A 1 33  ? 8.28300   -58.36500 -12.07400 1.000 52.43000  ? 21   VAL A O     1 
ATOM   151  C  CB    . VAL A 1 33  ? 5.51500   -59.57700 -12.06800 1.000 52.49000  ? 21   VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 33  ? 5.20400   -58.57300 -13.17800 1.000 52.13000  ? 21   VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 33  ? 4.38600   -60.61000 -11.93700 1.000 54.40000  ? 21   VAL A CG2   1 
ATOM   154  N  N     . LYS A 1 34  ? 8.22800   -59.35200 -14.10200 1.000 63.88000  ? 22   LYS A N     1 
ATOM   155  C  CA    . LYS A 1 34  ? 9.28500   -58.51700 -14.68100 1.000 67.36000  ? 22   LYS A CA    1 
ATOM   156  C  C     . LYS A 1 34  ? 8.95900   -57.03200 -14.61700 1.000 55.66000  ? 22   LYS A C     1 
ATOM   157  O  O     . LYS A 1 34  ? 7.83200   -56.61700 -14.89400 1.000 52.07000  ? 22   LYS A O     1 
ATOM   158  C  CB    . LYS A 1 34  ? 9.54900   -58.91600 -16.14400 1.000 77.23000  ? 22   LYS A CB    1 
ATOM   159  C  CG    . LYS A 1 34  ? 9.69000   -60.42600 -16.38600 1.000 85.65000  ? 22   LYS A CG    1 
ATOM   160  C  CD    . LYS A 1 34  ? 10.45500  -60.71600 -17.68600 1.000 95.56000  ? 22   LYS A CD    1 
ATOM   161  C  CE    . LYS A 1 34  ? 10.40000  -62.19900 -18.07400 1.000 91.16000  ? 22   LYS A CE    1 
ATOM   162  N  NZ    . LYS A 1 34  ? 11.15900  -62.48600 -19.33300 1.000 80.04000  ? 22   LYS A NZ    1 
ATOM   163  N  N     . GLN A 1 35  ? 9.95200   -56.23400 -14.25000 1.000 58.53000  ? 23   GLN A N     1 
ATOM   164  C  CA    . GLN A 1 35  ? 9.79800   -54.78700 -14.31100 1.000 61.45000  ? 23   GLN A CA    1 
ATOM   165  C  C     . GLN A 1 35  ? 9.52000   -54.42600 -15.74600 1.000 59.64000  ? 23   GLN A C     1 
ATOM   166  O  O     . GLN A 1 35  ? 10.01000  -55.08400 -16.65900 1.000 61.15000  ? 23   GLN A O     1 
ATOM   167  C  CB    . GLN A 1 35  ? 11.04800  -54.06100 -13.81500 1.000 57.38000  ? 23   GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 35  ? 10.88800  -52.55300 -13.75200 1.000 60.14000  ? 23   GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 35  ? 9.94600   -52.12500 -12.63600 1.000 60.95000  ? 23   GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 35  ? 9.10200   -51.24100 -12.82800 1.000 53.43000  ? 23   GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 35  ? 10.09100  -52.75100 -11.45300 1.000 52.73000  ? 23   GLN A NE2   1 
ATOM   172  N  N     . TRP A 1 36  ? 8.71900   -53.40000 -15.95800 1.000 60.67000  ? 24   TRP A N     1 
ATOM   173  C  CA    . TRP A 1 36  ? 8.46700   -52.98400 -17.31800 1.000 65.68000  ? 24   TRP A CA    1 
ATOM   174  C  C     . TRP A 1 36  ? 9.29200   -51.73500 -17.56400 1.000 69.12000  ? 24   TRP A C     1 
ATOM   175  O  O     . TRP A 1 36  ? 9.91300   -51.22100 -16.63800 1.000 68.29000  ? 24   TRP A O     1 
ATOM   176  C  CB    . TRP A 1 36  ? 6.96800   -52.77300 -17.57400 1.000 68.91000  ? 24   TRP A CB    1 
ATOM   177  C  CG    . TRP A 1 36  ? 6.24100   -51.84200 -16.63200 1.000 73.84000  ? 24   TRP A CG    1 
ATOM   178  C  CD1   . TRP A 1 36  ? 6.68700   -50.63900 -16.13300 1.000 71.49000  ? 24   TRP A CD1   1 
ATOM   179  C  CD2   . TRP A 1 36  ? 4.92100   -52.03400 -16.09300 1.000 65.91000  ? 24   TRP A CD2   1 
ATOM   180  N  NE1   . TRP A 1 36  ? 5.72500   -50.07800 -15.31700 1.000 66.56000  ? 24   TRP A NE1   1 
ATOM   181  C  CE2   . TRP A 1 36  ? 4.63500   -50.91200 -15.27600 1.000 64.88000  ? 24   TRP A CE2   1 
ATOM   182  C  CE3   . TRP A 1 36  ? 3.95800   -53.04100 -16.22100 1.000 59.35000  ? 24   TRP A CE3   1 
ATOM   183  C  CZ2   . TRP A 1 36  ? 3.42800   -50.77700 -14.59100 1.000 60.06000  ? 24   TRP A CZ2   1 
ATOM   184  C  CZ3   . TRP A 1 36  ? 2.76200   -52.90100 -15.54200 1.000 61.40000  ? 24   TRP A CZ3   1 
ATOM   185  C  CH2   . TRP A 1 36  ? 2.50400   -51.77900 -14.74000 1.000 58.06000  ? 24   TRP A CH2   1 
ATOM   186  N  N     . PRO A 1 37  ? 9.34500   -51.27400 -18.82200 1.000 76.49000  ? 25   PRO A N     1 
ATOM   187  C  CA    . PRO A 1 37  ? 10.19100  -50.12700 -19.16300 1.000 73.27000  ? 25   PRO A CA    1 
ATOM   188  C  C     . PRO A 1 37  ? 9.68200   -48.83300 -18.54200 1.000 69.79000  ? 25   PRO A C     1 
ATOM   189  O  O     . PRO A 1 37  ? 8.48500   -48.70700 -18.29100 1.000 70.79000  ? 25   PRO A O     1 
ATOM   190  C  CB    . PRO A 1 37  ? 10.09800  -50.07100 -20.69200 1.000 72.37000  ? 25   PRO A CB    1 
ATOM   191  C  CG    . PRO A 1 37  ? 8.78600   -50.71200 -21.00600 1.000 71.72000  ? 25   PRO A CG    1 
ATOM   192  C  CD    . PRO A 1 37  ? 8.63800   -51.81200 -19.99900 1.000 72.85000  ? 25   PRO A CD    1 
ATOM   193  N  N     . LEU A 1 38  ? 10.58300  -47.88900 -18.30300 1.000 72.92000  ? 26   LEU A N     1 
ATOM   194  C  CA    . LEU A 1 38  ? 10.19600  -46.59400 -17.74800 1.000 77.58000  ? 26   LEU A CA    1 
ATOM   195  C  C     . LEU A 1 38  ? 10.76900  -45.41700 -18.53700 1.000 76.16000  ? 26   LEU A C     1 
ATOM   196  O  O     . LEU A 1 38  ? 11.87600  -45.49700 -19.07900 1.000 76.51000  ? 26   LEU A O     1 
ATOM   197  C  CB    . LEU A 1 38  ? 10.63900  -46.48900 -16.28300 1.000 74.42000  ? 26   LEU A CB    1 
ATOM   198  C  CG    . LEU A 1 38  ? 9.74000   -47.12700 -15.22200 1.000 70.75000  ? 26   LEU A CG    1 
ATOM   199  C  CD1   . LEU A 1 38  ? 10.48700  -47.28800 -13.91300 1.000 60.01000  ? 26   LEU A CD1   1 
ATOM   200  C  CD2   . LEU A 1 38  ? 8.49100   -46.28700 -15.02200 1.000 70.30000  ? 26   LEU A CD2   1 
ATOM   201  N  N     . THR A 1 39  ? 10.00000  -44.33200 -18.59600 1.000 75.01000  ? 27   THR A N     1 
ATOM   202  C  CA    . THR A 1 39  ? 10.48800  -43.04500 -19.07600 1.000 65.94000  ? 27   THR A CA    1 
ATOM   203  C  C     . THR A 1 39  ? 11.79500  -42.71800 -18.38500 1.000 71.86000  ? 27   THR A C     1 
ATOM   204  O  O     . THR A 1 39  ? 12.03000  -43.14400 -17.25600 1.000 72.54000  ? 27   THR A O     1 
ATOM   205  C  CB    . THR A 1 39  ? 9.47800   -41.91000 -18.80000 1.000 70.94000  ? 27   THR A CB    1 
ATOM   206  O  OG1   . THR A 1 39  ? 8.32300   -42.07700 -19.63200 1.000 66.53000  ? 27   THR A OG1   1 
ATOM   207  C  CG2   . THR A 1 39  ? 10.10100  -40.54400 -19.06700 1.000 74.67000  ? 27   THR A CG2   1 
ATOM   208  N  N     . GLU A 1 40  ? 12.64900  -41.96800 -19.06000 1.000 75.03000  ? 28   GLU A N     1 
ATOM   209  C  CA    . GLU A 1 40  ? 13.87500  -41.50800 -18.43800 1.000 72.95000  ? 28   GLU A CA    1 
ATOM   210  C  C     . GLU A 1 40  ? 13.54500  -40.60000 -17.25600 1.000 71.55000  ? 28   GLU A C     1 
ATOM   211  O  O     . GLU A 1 40  ? 14.16100  -40.70300 -16.19600 1.000 67.88000  ? 28   GLU A O     1 
ATOM   212  C  CB    . GLU A 1 40  ? 14.75100  -40.76800 -19.45300 1.000 71.73000  ? 28   GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 40  ? 16.02400  -40.19600 -18.86600 1.000 69.34000  ? 28   GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 40  ? 16.96300  -41.27300 -18.34600 1.000 73.83000  ? 28   GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 40  ? 16.71600  -42.47200 -18.60900 1.000 75.56000  ? 28   GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 40  ? 17.95200  -40.91900 -17.67000 1.000 75.17000  ? 28   GLU A OE2   1 
ATOM   217  N  N     . GLU A 1 41  ? 12.56300  -39.72000 -17.43800 1.000 73.04000  ? 29   GLU A N     1 
ATOM   218  C  CA    . GLU A 1 41  ? 12.23800  -38.74500 -16.40600 1.000 71.59000  ? 29   GLU A CA    1 
ATOM   219  C  C     . GLU A 1 41  ? 11.77800  -39.45200 -15.14400 1.000 74.81000  ? 29   GLU A C     1 
ATOM   220  O  O     . GLU A 1 41  ? 12.22000  -39.11900 -14.04100 1.000 75.38000  ? 29   GLU A O     1 
ATOM   221  C  CB    . GLU A 1 41  ? 11.16200  -37.76700 -16.88000 1.000 73.27000  ? 29   GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 41  ? 11.16500  -36.45700 -16.10000 1.000 75.36000  ? 29   GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 41  ? 9.98500   -35.55700 -16.44000 1.000 83.41000  ? 29   GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 41  ? 9.15900   -35.94800 -17.29500 1.000 80.84000  ? 29   GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 41  ? 9.88600   -34.46000 -15.84200 1.000 79.68000  ? 29   GLU A OE2   1 
ATOM   226  N  N     . LYS A 1 42  ? 10.89400  -40.43500 -15.31800 1.000 71.22000  ? 30   LYS A N     1 
ATOM   227  C  CA    . LYS A 1 42  ? 10.36600  -41.20500 -14.19700 1.000 65.93000  ? 30   LYS A CA    1 
ATOM   228  C  C     . LYS A 1 42  ? 11.47900  -41.96400 -13.47400 1.000 65.86000  ? 30   LYS A C     1 
ATOM   229  O  O     . LYS A 1 42  ? 11.50000  -42.02500 -12.24000 1.000 63.69000  ? 30   LYS A O     1 
ATOM   230  C  CB    . LYS A 1 42  ? 9.28300   -42.17200 -14.68100 1.000 71.37000  ? 30   LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 42  ? 7.90100   -41.52800 -14.82200 1.000 68.94000  ? 30   LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 42  ? 6.91800   -42.44700 -15.54700 1.000 69.04000  ? 30   LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 42  ? 5.51500   -41.85700 -15.53800 1.000 70.02000  ? 30   LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 42  ? 4.52800   -42.73500 -16.22700 1.000 71.85000  ? 30   LYS A NZ    1 
ATOM   235  N  N     . ILE A 1 43  ? 12.40500  -42.52800 -14.24500 1.000 64.56000  ? 31   ILE A N     1 
ATOM   236  C  CA    . ILE A 1 43  ? 13.56900  -43.19500 -13.67500 1.000 62.70000  ? 31   ILE A CA    1 
ATOM   237  C  C     . ILE A 1 43  ? 14.38200  -42.28300 -12.75700 1.000 59.87000  ? 31   ILE A C     1 
ATOM   238  O  O     . ILE A 1 43  ? 14.93200  -42.74400 -11.76800 1.000 62.93000  ? 31   ILE A O     1 
ATOM   239  C  CB    . ILE A 1 43  ? 14.51600  -43.71700 -14.75600 1.000 64.13000  ? 31   ILE A CB    1 
ATOM   240  C  CG1   . ILE A 1 43  ? 13.80300  -44.72600 -15.65400 1.000 72.22000  ? 31   ILE A CG1   1 
ATOM   241  C  CG2   . ILE A 1 43  ? 15.72200  -44.35000 -14.10900 1.000 63.44000  ? 31   ILE A CG2   1 
ATOM   242  C  CD1   . ILE A 1 43  ? 14.52200  -45.00100 -16.96100 1.000 71.15000  ? 31   ILE A CD1   1 
ATOM   243  N  N     . LYS A 1 44  ? 14.46600  -40.99900 -13.08800 1.000 58.07000  ? 32   LYS A N     1 
ATOM   244  C  CA    . LYS A 1 44  ? 15.24200  -40.06100 -12.28100 1.000 62.52000  ? 32   LYS A CA    1 
ATOM   245  C  C     . LYS A 1 44  ? 14.46800  -39.61500 -11.04100 1.000 62.62000  ? 32   LYS A C     1 
ATOM   246  O  O     . LYS A 1 44  ? 15.04400  -39.43500 -9.95700  1.000 55.56000  ? 32   LYS A O     1 
ATOM   247  C  CB    . LYS A 1 44  ? 15.65000  -38.84100 -13.11500 1.000 69.45000  ? 32   LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 44  ? 16.56500  -39.18900 -14.27700 1.000 73.17000  ? 32   LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 44  ? 16.84300  -37.98900 -15.15900 1.000 84.08000  ? 32   LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 44  ? 17.71000  -38.38400 -16.35000 1.000 85.46000  ? 32   LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 44  ? 17.75800  -37.32900 -17.40900 1.000 97.60000  ? 32   LYS A NZ    1 
ATOM   252  N  N     . ALA A 1 45  ? 13.16400  -39.42500 -11.21000 1.000 60.01000  ? 33   ALA A N     1 
ATOM   253  C  CA    . ALA A 1 45  ? 12.31200  -39.16400 -10.07200 1.000 52.25000  ? 33   ALA A CA    1 
ATOM   254  C  C     . ALA A 1 45  ? 12.44300  -40.34400 -9.12500  1.000 52.64000  ? 33   ALA A C     1 
ATOM   255  O  O     . ALA A 1 45  ? 12.60500  -40.17400 -7.91800  1.000 53.87000  ? 33   ALA A O     1 
ATOM   256  C  CB    . ALA A 1 45  ? 10.88900  -38.97100 -10.50200 1.000 57.00000  ? 33   ALA A CB    1 
ATOM   257  N  N     . LEU A 1 46  ? 12.41400  -41.54500 -9.69200  1.000 52.47000  ? 34   LEU A N     1 
ATOM   258  C  CA    . LEU A 1 46  ? 12.46900  -42.76500 -8.89800  1.000 45.33000  ? 34   LEU A CA    1 
ATOM   259  C  C     . LEU A 1 46  ? 13.73200  -42.91200 -8.06600  1.000 51.67000  ? 34   LEU A C     1 
ATOM   260  O  O     . LEU A 1 46  ? 13.62800  -43.19400 -6.87600  1.000 56.25000  ? 34   LEU A O     1 
ATOM   261  C  CB    . LEU A 1 46  ? 12.30600  -43.98500 -9.79200  1.000 48.05000  ? 34   LEU A CB    1 
ATOM   262  C  CG    . LEU A 1 46  ? 10.83000  -44.23700 -10.12500 1.000 52.73000  ? 34   LEU A CG    1 
ATOM   263  C  CD1   . LEU A 1 46  ? 10.62200  -45.67500 -10.54000 1.000 51.00000  ? 34   LEU A CD1   1 
ATOM   264  C  CD2   . LEU A 1 46  ? 9.95300   -43.90600 -8.93600  1.000 43.40000  ? 34   LEU A CD2   1 
ATOM   265  N  N     . VAL A 1 47  ? 14.92000  -42.72700 -8.64600  1.000 52.11000  ? 35   VAL A N     1 
ATOM   266  C  CA    . VAL A 1 47  ? 16.12700  -42.93700 -7.84600  1.000 45.48000  ? 35   VAL A CA    1 
ATOM   267  C  C     . VAL A 1 47  ? 16.39400  -41.77100 -6.90800  1.000 46.36000  ? 35   VAL A C     1 
ATOM   268  O  O     . VAL A 1 47  ? 17.02100  -41.96000 -5.87600  1.000 48.91000  ? 35   VAL A O     1 
ATOM   269  C  CB    . VAL A 1 47  ? 17.38500  -43.17100 -8.69200  1.000 48.46000  ? 35   VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 47  ? 17.01900  -43.66300 -10.07400 1.000 52.19000  ? 35   VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 47  ? 18.23800  -41.92300 -8.73900  1.000 47.89000  ? 35   VAL A CG2   1 
ATOM   272  N  N     . GLU A 1 48  ? 15.91600  -40.57700 -7.22800  1.000 47.82000  ? 36   GLU A N     1 
ATOM   273  C  CA    . GLU A 1 48  ? 16.03000  -39.48800 -6.26400  1.000 53.15000  ? 36   GLU A CA    1 
ATOM   274  C  C     . GLU A 1 48  ? 15.26400  -39.85800 -4.98600  1.000 55.18000  ? 36   GLU A C     1 
ATOM   275  O  O     . GLU A 1 48  ? 15.74200  -39.63500 -3.86100  1.000 45.16000  ? 36   GLU A O     1 
ATOM   276  C  CB    . GLU A 1 48  ? 15.50100  -38.17400 -6.83600  1.000 52.01000  ? 36   GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 48  ? 15.76600  -36.97800 -5.93100  1.000 55.13000  ? 36   GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 48  ? 15.03700  -35.72200 -6.38700  1.000 76.46000  ? 36   GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 48  ? 14.70700  -35.61400 -7.59100  1.000 79.44000  ? 36   GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 48  ? 14.78600  -34.83900 -5.53500  1.000 81.64000  ? 36   GLU A OE2   1 
ATOM   281  N  N     . ILE A 1 49  ? 14.07600  -40.43400 -5.18500  1.000 52.72000  ? 37   ILE A N     1 
ATOM   282  C  CA    . ILE A 1 49  ? 13.22100  -40.88500 -4.09300  1.000 49.31000  ? 37   ILE A CA    1 
ATOM   283  C  C     . ILE A 1 49  ? 13.80600  -42.11400 -3.38900  1.000 47.52000  ? 37   ILE A C     1 
ATOM   284  O  O     . ILE A 1 49  ? 13.80800  -42.20900 -2.16800  1.000 46.21000  ? 37   ILE A O     1 
ATOM   285  C  CB    . ILE A 1 49  ? 11.80200  -41.21000 -4.60600  1.000 46.30000  ? 37   ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 49  ? 10.91200  -39.98300 -4.48900  1.000 45.38000  ? 37   ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 49  ? 11.17600  -42.36100 -3.82100  1.000 42.09000  ? 37   ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 49  ? 9.67700   -40.06400 -5.36400  1.000 45.04000  ? 37   ILE A CD1   1 
ATOM   289  N  N     . CYS A 1 50  ? 14.31600  -43.05400 -4.16300  1.000 42.75000  ? 38   CYS A N     1 
ATOM   290  C  CA    . CYS A 1 50  ? 14.84300  -44.25800 -3.55900  1.000 43.66000  ? 38   CYS A CA    1 
ATOM   291  C  C     . CYS A 1 50  ? 16.16200  -44.05300 -2.81800  1.000 44.30000  ? 38   CYS A C     1 
ATOM   292  O  O     . CYS A 1 50  ? 16.40200  -44.68900 -1.80000  1.000 42.70000  ? 38   CYS A O     1 
ATOM   293  C  CB    . CYS A 1 50  ? 15.01500  -45.33700 -4.62100  1.000 40.49000  ? 38   CYS A CB    1 
ATOM   294  S  SG    . CYS A 1 50  ? 13.57400  -46.34500 -4.73200  1.000 50.77000  ? 38   CYS A SG    1 
ATOM   295  N  N     . THR A 1 51  ? 17.02900  -43.18800 -3.32100  1.000 43.41000  ? 39   THR A N     1 
ATOM   296  C  CA    . THR A 1 51  ? 18.31100  -43.06400 -2.67000  1.000 42.19000  ? 39   THR A CA    1 
ATOM   297  C  C     . THR A 1 51  ? 18.06700  -42.40900 -1.34100  1.000 43.38000  ? 39   THR A C     1 
ATOM   298  O  O     . THR A 1 51  ? 18.88400  -42.50200 -0.44000  1.000 49.27000  ? 39   THR A O     1 
ATOM   299  C  CB    . THR A 1 51  ? 19.32600  -42.24800 -3.47500  1.000 47.52000  ? 39   THR A CB    1 
ATOM   300  O  OG1   . THR A 1 51  ? 18.84000  -40.91400 -3.65900  1.000 58.41000  ? 39   THR A OG1   1 
ATOM   301  C  CG2   . THR A 1 51  ? 19.59100  -42.89800 -4.82900  1.000 49.26000  ? 39   THR A CG2   1 
ATOM   302  N  N     . GLU A 1 52  ? 16.91300  -41.77100 -1.21600  1.000 47.20000  ? 40   GLU A N     1 
ATOM   303  C  CA    . GLU A 1 52  ? 16.59400  -41.05200 -0.00100  1.000 46.87000  ? 40   GLU A CA    1 
ATOM   304  C  C     . GLU A 1 52  ? 15.85100  -41.94200 0.98800   1.000 47.68000  ? 40   GLU A C     1 
ATOM   305  O  O     . GLU A 1 52  ? 16.04200  -41.85200 2.20000   1.000 46.75000  ? 40   GLU A O     1 
ATOM   306  C  CB    . GLU A 1 52  ? 15.76700  -39.82800 -0.32100  1.000 48.48000  ? 40   GLU A CB    1 
ATOM   307  C  CG    . GLU A 1 52  ? 15.94200  -38.74500 0.70700   1.000 59.01000  ? 40   GLU A CG    1 
ATOM   308  C  CD    . GLU A 1 52  ? 14.62900  -38.13300 1.11200   1.000 67.35000  ? 40   GLU A CD    1 
ATOM   309  O  OE1   . GLU A 1 52  ? 13.57000  -38.74500 0.83000   1.000 64.48000  ? 40   GLU A OE1   1 
ATOM   310  O  OE2   . GLU A 1 52  ? 14.65800  -37.04300 1.71900   1.000 73.57000  ? 40   GLU A OE2   1 
ATOM   311  N  N     . MET A 1 53  ? 15.01400  -42.81400 0.45900   1.000 48.47000  ? 41   MET A N     1 
ATOM   312  C  CA    . MET A 1 53  ? 14.27100  -43.73100 1.29500   1.000 42.04000  ? 41   MET A CA    1 
ATOM   313  C  C     . MET A 1 53  ? 15.20800  -44.74200 1.90000   1.000 40.86000  ? 41   MET A C     1 
ATOM   314  O  O     . MET A 1 53  ? 15.10900  -45.09500 3.07500   1.000 41.20000  ? 41   MET A O     1 
ATOM   315  C  CB    . MET A 1 53  ? 13.20300  -44.42800 0.47500   1.000 42.25000  ? 41   MET A CB    1 
ATOM   316  C  CG    . MET A 1 53  ? 11.82200  -44.09900 0.93300   1.000 42.87000  ? 41   MET A CG    1 
ATOM   317  S  SD    . MET A 1 53  ? 10.67800  -44.43400 -0.40000  1.000 44.67000  ? 41   MET A SD    1 
ATOM   318  C  CE    . MET A 1 53  ? 9.60300   -45.62100 0.41000   1.000 44.12000  ? 41   MET A CE    1 
ATOM   319  N  N     . GLU A 1 54  ? 16.11700  -45.20900 1.05600   1.000 44.68000  ? 42   GLU A N     1 
ATOM   320  C  CA    . GLU A 1 54  ? 17.08400  -46.21500 1.43000   1.000 45.82000  ? 42   GLU A CA    1 
ATOM   321  C  C     . GLU A 1 54  ? 17.96100  -45.67100 2.53900   1.000 47.72000  ? 42   GLU A C     1 
ATOM   322  O  O     . GLU A 1 54  ? 18.28400  -46.37600 3.49900   1.000 49.88000  ? 42   GLU A O     1 
ATOM   323  C  CB    . GLU A 1 54  ? 17.90600  -46.60400 0.21500   1.000 41.98000  ? 42   GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 54  ? 18.90200  -47.66900 0.48400   1.000 43.87000  ? 42   GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 54  ? 20.28000  -47.10800 0.63400   1.000 50.79000  ? 42   GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 54  ? 20.96200  -47.52200 1.59300   1.000 54.15000  ? 42   GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 54  ? 20.68400  -46.26500 -0.20800  1.000 50.76000  ? 42   GLU A OE2   1 
ATOM   328  N  N     . LYS A 1 55  ? 18.30300  -44.39200 2.41200   1.000 44.76000  ? 43   LYS A N     1 
ATOM   329  C  CA    . LYS A 1 55  ? 19.14000  -43.73200 3.38400   1.000 45.77000  ? 43   LYS A CA    1 
ATOM   330  C  C     . LYS A 1 55  ? 18.45300  -43.65200 4.73500   1.000 47.53000  ? 43   LYS A C     1 
ATOM   331  O  O     . LYS A 1 55  ? 19.11200  -43.72600 5.76200   1.000 55.72000  ? 43   LYS A O     1 
ATOM   332  C  CB    . LYS A 1 55  ? 19.49900  -42.34000 2.89400   1.000 50.01000  ? 43   LYS A CB    1 
ATOM   333  C  CG    . LYS A 1 55  ? 20.68500  -41.72100 3.58400   1.000 58.49000  ? 43   LYS A CG    1 
ATOM   334  C  CD    . LYS A 1 55  ? 21.31800  -40.67400 2.67000   1.000 68.23000  ? 43   LYS A CD    1 
ATOM   335  C  CE    . LYS A 1 55  ? 21.61100  -41.26100 1.28300   1.000 58.43000  ? 43   LYS A CE    1 
ATOM   336  N  NZ    . LYS A 1 55  ? 22.23500  -40.28600 0.34000   1.000 63.16000  ? 43   LYS A NZ    1 
ATOM   337  N  N     . GLU A 1 56  ? 17.13100  -43.50400 4.72900   1.000 50.06000  ? 44   GLU A N     1 
ATOM   338  C  CA    . GLU A 1 56  ? 16.36700  -43.35800 5.96700   1.000 43.68000  ? 44   GLU A CA    1 
ATOM   339  C  C     . GLU A 1 56  ? 15.85000  -44.69700 6.45900   1.000 41.73000  ? 44   GLU A C     1 
ATOM   340  O  O     . GLU A 1 56  ? 14.99200  -44.76000 7.33900   1.000 50.32000  ? 44   GLU A O     1 
ATOM   341  C  CB    . GLU A 1 56  ? 15.19200  -42.38600 5.77700   1.000 39.41000  ? 44   GLU A CB    1 
ATOM   342  C  CG    . GLU A 1 56  ? 15.59700  -40.91900 5.92500   1.000 50.69000  ? 44   GLU A CG    1 
ATOM   343  C  CD    . GLU A 1 56  ? 14.75600  -39.97700 5.06600   1.000 57.13000  ? 44   GLU A CD    1 
ATOM   344  O  OE1   . GLU A 1 56  ? 13.61200  -40.35300 4.73400   1.000 58.31000  ? 44   GLU A OE1   1 
ATOM   345  O  OE2   . GLU A 1 56  ? 15.24700  -38.87200 4.70700   1.000 54.05000  ? 44   GLU A OE2   1 
ATOM   346  N  N     . GLY A 1 57  ? 16.37200  -45.76900 5.88600   1.000 37.26000  ? 45   GLY A N     1 
ATOM   347  C  CA    . GLY A 1 57  ? 15.98300  -47.10000 6.30200   1.000 35.59000  ? 45   GLY A CA    1 
ATOM   348  C  C     . GLY A 1 57  ? 14.55800  -47.48800 5.94200   1.000 39.81000  ? 45   GLY A C     1 
ATOM   349  O  O     . GLY A 1 57  ? 14.01400  -48.44900 6.48900   1.000 41.41000  ? 45   GLY A O     1 
ATOM   350  N  N     . LYS A 1 58  ? 13.94600  -46.75600 5.02000   1.000 37.54000  ? 46   LYS A N     1 
ATOM   351  C  CA    . LYS A 1 58  ? 12.57300  -47.06200 4.65300   1.000 39.38000  ? 46   LYS A CA    1 
ATOM   352  C  C     . LYS A 1 58  ? 12.54800  -48.19200 3.63800   1.000 41.05000  ? 46   LYS A C     1 
ATOM   353  O  O     . LYS A 1 58  ? 11.53300  -48.87000 3.47000   1.000 40.15000  ? 46   LYS A O     1 
ATOM   354  C  CB    . LYS A 1 58  ? 11.87400  -45.81100 4.13200   1.000 34.83000  ? 46   LYS A CB    1 
ATOM   355  C  CG    . LYS A 1 58  ? 11.66900  -44.81100 5.24700   1.000 38.76000  ? 46   LYS A CG    1 
ATOM   356  C  CD    . LYS A 1 58  ? 11.08100  -43.49200 4.78800   1.000 40.47000  ? 46   LYS A CD    1 
ATOM   357  C  CE    . LYS A 1 58  ? 10.71300  -42.61000 5.99500   1.000 36.11000  ? 46   LYS A CE    1 
ATOM   358  N  NZ    . LYS A 1 58  ? 10.57900  -41.18700 5.57900   1.000 39.43000  ? 46   LYS A NZ    1 
ATOM   359  N  N     . ILE A 1 59  ? 13.68400  -48.39700 2.98800   1.000 42.79000  ? 47   ILE A N     1 
ATOM   360  C  CA    . ILE A 1 59  ? 13.84300  -49.47700 2.02600   1.000 38.78000  ? 47   ILE A CA    1 
ATOM   361  C  C     . ILE A 1 59  ? 15.27100  -49.99800 2.08500   1.000 38.59000  ? 47   ILE A C     1 
ATOM   362  O  O     . ILE A 1 59  ? 16.21800  -49.25500 2.39100   1.000 36.21000  ? 47   ILE A O     1 
ATOM   363  C  CB    . ILE A 1 59  ? 13.52500  -49.03000 0.59200   1.000 39.19000  ? 47   ILE A CB    1 
ATOM   364  C  CG1   . ILE A 1 59  ? 14.44500  -47.88600 0.16200   1.000 37.72000  ? 47   ILE A CG1   1 
ATOM   365  C  CG2   . ILE A 1 59  ? 12.10400  -48.55800 0.49700   1.000 39.82000  ? 47   ILE A CG2   1 
ATOM   366  C  CD1   . ILE A 1 59  ? 14.39900  -47.61900 -1.31300  1.000 36.60000  ? 47   ILE A CD1   1 
ATOM   367  N  N     . SER A 1 60  ? 15.40800  -51.28300 1.79300   1.000 38.94000  ? 48   SER A N     1 
ATOM   368  C  CA    . SER A 1 60  ? 16.67500  -51.97200 1.91100   1.000 34.51000  ? 48   SER A CA    1 
ATOM   369  C  C     . SER A 1 60  ? 17.03400  -52.64300 0.60900   1.000 44.38000  ? 48   SER A C     1 
ATOM   370  O  O     . SER A 1 60  ? 16.19000  -53.28900 -0.02700  1.000 44.10000  ? 48   SER A O     1 
ATOM   371  C  CB    . SER A 1 60  ? 16.62100  -53.01600 3.02100   1.000 31.02000  ? 48   SER A CB    1 
ATOM   372  O  OG    . SER A 1 60  ? 16.42600  -52.38900 4.26800   1.000 32.52000  ? 48   SER A OG    1 
ATOM   373  N  N     . LYS A 1 61  ? 18.29500  -52.47700 0.21400   1.000 47.98000  ? 49   LYS A N     1 
ATOM   374  C  CA    . LYS A 1 61  ? 18.84300  -53.18700 -0.92500  1.000 42.52000  ? 49   LYS A CA    1 
ATOM   375  C  C     . LYS A 1 61  ? 18.74600  -54.68100 -0.62800  1.000 43.54000  ? 49   LYS A C     1 
ATOM   376  O  O     . LYS A 1 61  ? 19.06200  -55.10800 0.48300   1.000 48.31000  ? 49   LYS A O     1 
ATOM   377  C  CB    . LYS A 1 61  ? 20.29500  -52.76100 -1.17300  1.000 42.98000  ? 49   LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 61  ? 20.49400  -51.25300 -1.28000  1.000 42.15000  ? 49   LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 61  ? 21.97200  -50.87300 -1.44900  1.000 46.67000  ? 49   LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 61  ? 22.18800  -49.34700 -1.33500  1.000 52.22000  ? 49   LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 61  ? 22.64900  -48.66600 -2.59500  1.000 46.78000  ? 49   LYS A NZ    1 
ATOM   382  N  N     . ILE A 1 62  ? 18.26700  -55.46100 -1.59300  1.000 44.49000  ? 50   ILE A N     1 
ATOM   383  C  CA    . ILE A 1 62  ? 18.24900  -56.92300 -1.47200  1.000 48.88000  ? 50   ILE A CA    1 
ATOM   384  C  C     . ILE A 1 62  ? 19.24700  -57.56600 -2.44700  1.000 51.40000  ? 50   ILE A C     1 
ATOM   385  O  O     . ILE A 1 62  ? 19.78900  -56.89200 -3.33700  1.000 46.49000  ? 50   ILE A O     1 
ATOM   386  C  CB    . ILE A 1 62  ? 16.83800  -57.53300 -1.74500  1.000 45.40000  ? 50   ILE A CB    1 
ATOM   387  C  CG1   . ILE A 1 62  ? 16.22100  -56.95100 -3.02100  1.000 43.02000  ? 50   ILE A CG1   1 
ATOM   388  C  CG2   . ILE A 1 62  ? 15.91500  -57.33700 -0.55700  1.000 48.40000  ? 50   ILE A CG2   1 
ATOM   389  C  CD1   . ILE A 1 62  ? 14.98400  -57.68500 -3.47300  1.000 46.57000  ? 50   ILE A CD1   1 
ATOM   390  N  N     . GLY A 1 63  ? 19.47100  -58.86500 -2.28000  1.000 47.50000  ? 51   GLY A N     1 
ATOM   391  C  CA    . GLY A 1 63  ? 20.31300  -59.61400 -3.19200  1.000 59.56000  ? 51   GLY A CA    1 
ATOM   392  C  C     . GLY A 1 63  ? 19.60700  -60.74200 -3.93300  1.000 61.61000  ? 51   GLY A C     1 
ATOM   393  O  O     . GLY A 1 63  ? 18.40700  -60.66800 -4.20900  1.000 60.54000  ? 51   GLY A O     1 
ATOM   394  N  N     . PRO A 1 64  ? 20.36400  -61.79000 -4.29400  1.000 64.13000  ? 52   PRO A N     1 
ATOM   395  C  CA    . PRO A 1 64  ? 19.81800  -62.99700 -4.92900  1.000 63.01000  ? 52   PRO A CA    1 
ATOM   396  C  C     . PRO A 1 64  ? 19.01600  -63.85100 -3.95400  1.000 63.10000  ? 52   PRO A C     1 
ATOM   397  O  O     . PRO A 1 64  ? 18.32500  -64.78200 -4.38000  1.000 62.68000  ? 52   PRO A O     1 
ATOM   398  C  CB    . PRO A 1 64  ? 21.06900  -63.74300 -5.40200  1.000 66.84000  ? 52   PRO A CB    1 
ATOM   399  C  CG    . PRO A 1 64  ? 22.15600  -62.69500 -5.43700  1.000 65.14000  ? 52   PRO A CG    1 
ATOM   400  C  CD    . PRO A 1 64  ? 21.83600  -61.77000 -4.31700  1.000 63.09000  ? 52   PRO A CD    1 
ATOM   401  N  N     . GLU A 1 65  ? 19.10300  -63.53600 -2.66000  1.000 57.75000  ? 53   GLU A N     1 
ATOM   402  C  CA    . GLU A 1 65  ? 18.29200  -64.23100 -1.66600  1.000 59.66000  ? 53   GLU A CA    1 
ATOM   403  C  C     . GLU A 1 65  ? 16.81100  -63.83700 -1.78400  1.000 64.30000  ? 53   GLU A C     1 
ATOM   404  O  O     . GLU A 1 65  ? 15.96300  -64.33500 -1.03100  1.000 66.32000  ? 53   GLU A O     1 
ATOM   405  C  CB    . GLU A 1 65  ? 18.80300  -63.94800 -0.24700  1.000 66.42000  ? 53   GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 65  ? 18.54600  -62.53200 0.26900   1.000 67.43000  ? 53   GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 65  ? 19.46100  -61.50000 -0.36500  1.000 65.02000  ? 53   GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 65  ? 20.31700  -61.90600 -1.19200  1.000 59.66000  ? 53   GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 65  ? 19.31900  -60.29300 -0.03200  1.000 57.48000  ? 53   GLU A OE2   1 
ATOM   410  N  N     . ASN A 1 66  ? 16.50600  -62.94800 -2.73000  1.000 60.09000  ? 54   ASN A N     1 
ATOM   411  C  CA    . ASN A 1 66  ? 15.12600  -62.56200 -2.98600  1.000 55.47000  ? 54   ASN A CA    1 
ATOM   412  C  C     . ASN A 1 66  ? 14.67800  -62.87800 -4.41600  1.000 55.84000  ? 54   ASN A C     1 
ATOM   413  O  O     . ASN A 1 66  ? 15.03000  -62.18000 -5.36900  1.000 56.48000  ? 54   ASN A O     1 
ATOM   414  C  CB    . ASN A 1 66  ? 14.92400  -61.07300 -2.68800  1.000 53.78000  ? 54   ASN A CB    1 
ATOM   415  C  CG    . ASN A 1 66  ? 13.47500  -60.73500 -2.37700  1.000 51.64000  ? 54   ASN A CG    1 
ATOM   416  O  OD1   . ASN A 1 66  ? 12.56000  -61.12800 -3.11300  1.000 53.73000  ? 54   ASN A OD1   1 
ATOM   417  N  ND2   . ASN A 1 66  ? 13.25500  -60.02600 -1.26800  1.000 46.69000  ? 54   ASN A ND2   1 
ATOM   418  N  N     . PRO A 1 67  ? 13.88800  -63.94300 -4.55400  1.000 46.95000  ? 55   PRO A N     1 
ATOM   419  C  CA    . PRO A 1 67  ? 13.27900  -64.39500 -5.80500  1.000 49.45000  ? 55   PRO A CA    1 
ATOM   420  C  C     . PRO A 1 67  ? 12.25000  -63.43200 -6.38300  1.000 54.57000  ? 55   PRO A C     1 
ATOM   421  O  O     . PRO A 1 67  ? 12.11500  -63.35700 -7.60700  1.000 61.32000  ? 55   PRO A O     1 
ATOM   422  C  CB    . PRO A 1 67  ? 12.59200  -65.70300 -5.40200  1.000 47.98000  ? 55   PRO A CB    1 
ATOM   423  C  CG    . PRO A 1 67  ? 12.40000  -65.58600 -3.93700  1.000 46.74000  ? 55   PRO A CG    1 
ATOM   424  C  CD    . PRO A 1 67  ? 13.61000  -64.87300 -3.45400  1.000 45.45000  ? 55   PRO A CD    1 
ATOM   425  N  N     . TYR A 1 68  ? 11.54200  -62.70700 -5.52600  1.000 52.81000  ? 56   TYR A N     1 
ATOM   426  C  CA    . TYR A 1 68  ? 10.34800  -61.98100 -5.95300  1.000 48.07000  ? 56   TYR A CA    1 
ATOM   427  C  C     . TYR A 1 68  ? 10.60700  -60.63900 -6.64400  1.000 49.21000  ? 56   TYR A C     1 
ATOM   428  O  O     . TYR A 1 68  ? 11.72100  -60.10100 -6.59500  1.000 50.79000  ? 56   TYR A O     1 
ATOM   429  C  CB    . TYR A 1 68  ? 9.46200   -61.77200 -4.74300  1.000 47.43000  ? 56   TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 68  ? 9.29800   -63.03300 -3.93200  1.000 49.45000  ? 56   TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 68  ? 8.48300   -64.06700 -4.38100  1.000 51.52000  ? 56   TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 68  ? 9.95400   -63.19500 -2.71800  1.000 44.97000  ? 56   TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 68  ? 8.32200   -65.22000 -3.63900  1.000 50.25000  ? 56   TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 68  ? 9.79900   -64.34900 -1.97100  1.000 45.12000  ? 56   TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 68  ? 8.98300   -65.35500 -2.43800  1.000 46.53000  ? 56   TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 68  ? 8.82400   -66.50500 -1.70800  1.000 43.95000  ? 56   TYR A OH    1 
ATOM   437  N  N     . ASN A 1 69  ? 9.57600   -60.11600 -7.31100  1.000 45.79000  ? 57   ASN A N     1 
ATOM   438  C  CA    . ASN A 1 69  ? 9.65200   -58.78200 -7.91000  1.000 44.17000  ? 57   ASN A CA    1 
ATOM   439  C  C     . ASN A 1 69  ? 8.28200   -58.31200 -8.38000  1.000 45.33000  ? 57   ASN A C     1 
ATOM   440  O  O     . ASN A 1 69  ? 7.42800   -59.12800 -8.73300  1.000 48.06000  ? 57   ASN A O     1 
ATOM   441  C  CB    . ASN A 1 69  ? 10.64100  -58.75100 -9.08000  1.000 37.59000  ? 57   ASN A CB    1 
ATOM   442  C  CG    . ASN A 1 69  ? 10.92200  -57.33600 -9.58100  1.000 43.98000  ? 57   ASN A CG    1 
ATOM   443  O  OD1   . ASN A 1 69  ? 11.82500  -56.66700 -9.06900  1.000 45.32000  ? 57   ASN A OD1   1 
ATOM   444  N  ND2   . ASN A 1 69  ? 10.15800  -56.87400 -10.58900 1.000 38.26000  ? 57   ASN A ND2   1 
ATOM   445  N  N     . THR A 1 70  ? 8.09300   -56.99000 -8.39300  1.000 39.85000  ? 58   THR A N     1 
ATOM   446  C  CA    . THR A 1 70  ? 6.82000   -56.37300 -8.74000  1.000 40.75000  ? 58   THR A CA    1 
ATOM   447  C  C     . THR A 1 70  ? 7.08800   -54.99600 -9.37500  1.000 42.93000  ? 58   THR A C     1 
ATOM   448  O  O     . THR A 1 70  ? 7.85900   -54.21000 -8.83500  1.000 47.81000  ? 58   THR A O     1 
ATOM   449  C  CB    . THR A 1 70  ? 5.89700   -56.24100 -7.47300  1.000 41.08000  ? 58   THR A CB    1 
ATOM   450  O  OG1   . THR A 1 70  ? 5.93500   -57.45600 -6.69600  1.000 41.57000  ? 58   THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 70  ? 4.47000   -55.96700 -7.87200  1.000 41.22000  ? 58   THR A CG2   1 
ATOM   452  N  N     . PRO A 1 71  ? 6.47000   -54.71400 -10.53900 1.000 48.80000  ? 59   PRO A N     1 
ATOM   453  C  CA    . PRO A 1 71  ? 6.70800   -53.48700 -11.34000 1.000 47.35000  ? 59   PRO A CA    1 
ATOM   454  C  C     . PRO A 1 71  ? 6.34700   -52.14700 -10.66900 1.000 47.72000  ? 59   PRO A C     1 
ATOM   455  O  O     . PRO A 1 71  ? 5.26800   -52.02500 -10.10000 1.000 54.82000  ? 59   PRO A O     1 
ATOM   456  C  CB    . PRO A 1 71  ? 5.81600   -53.69200 -12.58100 1.000 45.13000  ? 59   PRO A CB    1 
ATOM   457  C  CG    . PRO A 1 71  ? 4.93800   -54.85400 -12.27200 1.000 43.42000  ? 59   PRO A CG    1 
ATOM   458  C  CD    . PRO A 1 71  ? 5.63000   -55.69000 -11.25700 1.000 44.78000  ? 59   PRO A CD    1 
ATOM   459  N  N     . VAL A 1 72  ? 7.22000   -51.14900 -10.77300 1.000 39.09000  ? 60   VAL A N     1 
ATOM   460  C  CA    . VAL A 1 72  ? 6.95100   -49.85700 -10.15300 1.000 39.61000  ? 60   VAL A CA    1 
ATOM   461  C  C     . VAL A 1 72  ? 6.82400   -48.73100 -11.16900 1.000 46.17000  ? 60   VAL A C     1 
ATOM   462  O  O     . VAL A 1 72  ? 7.28200   -48.85800 -12.29500 1.000 55.63000  ? 60   VAL A O     1 
ATOM   463  C  CB    . VAL A 1 72  ? 8.05700   -49.46600 -9.15000  1.000 45.36000  ? 60   VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 72  ? 8.20700   -50.52900 -8.08000  1.000 45.81000  ? 60   VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 72  ? 9.37300   -49.23800 -9.87400  1.000 46.59000  ? 60   VAL A CG2   1 
ATOM   466  N  N     . PHE A 1 73  ? 6.20600   -47.62400 -10.76100 1.000 42.83000  ? 61   PHE A N     1 
ATOM   467  C  CA    . PHE A 1 73  ? 6.11900   -46.43400 -11.59900 1.000 45.52000  ? 61   PHE A CA    1 
ATOM   468  C  C     . PHE A 1 73  ? 5.89100   -45.15800 -10.77300 1.000 48.37000  ? 61   PHE A C     1 
ATOM   469  O  O     . PHE A 1 73  ? 6.11700   -45.13500 -9.56000  1.000 43.42000  ? 61   PHE A O     1 
ATOM   470  C  CB    . PHE A 1 73  ? 5.01800   -46.59100 -12.66100 1.000 49.40000  ? 61   PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 73  ? 3.64500   -46.93600 -12.11600 1.000 49.17000  ? 61   PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 73  ? 3.35800   -48.21200 -11.65600 1.000 46.92000  ? 61   PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 73  ? 2.62100   -45.99900 -12.13000 1.000 52.19000  ? 61   PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 73  ? 2.08900   -48.53700 -11.19000 1.000 39.04000  ? 61   PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 73  ? 1.35400   -46.32500 -11.66200 1.000 49.03000  ? 61   PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 73  ? 1.09300   -47.60200 -11.19600 1.000 38.09000  ? 61   PHE A CZ    1 
ATOM   477  N  N     . ALA A 1 74  ? 5.46300   -44.08400 -11.42600 1.000 47.33000  ? 62   ALA A N     1 
ATOM   478  C  CA    . ALA A 1 74  ? 5.22100   -42.84400 -10.70000 1.000 52.63000  ? 62   ALA A CA    1 
ATOM   479  C  C     . ALA A 1 74  ? 4.31700   -41.90500 -11.48500 1.000 57.48000  ? 62   ALA A C     1 
ATOM   480  O  O     . ALA A 1 74  ? 4.16100   -42.04200 -12.70000 1.000 64.47000  ? 62   ALA A O     1 
ATOM   481  C  CB    . ALA A 1 74  ? 6.54600   -42.15300 -10.35500 1.000 45.85000  ? 62   ALA A CB    1 
ATOM   482  N  N     . ILE A 1 75  ? 3.72300   -40.95500 -10.77700 1.000 53.24000  ? 63   ILE A N     1 
ATOM   483  C  CA    . ILE A 1 75  ? 2.82400   -39.98400 -11.37800 1.000 57.65000  ? 63   ILE A CA    1 
ATOM   484  C  C     . ILE A 1 75  ? 3.00900   -38.65600 -10.65200 1.000 59.01000  ? 63   ILE A C     1 
ATOM   485  O  O     . ILE A 1 75  ? 3.33400   -38.63900 -9.46800  1.000 63.30000  ? 63   ILE A O     1 
ATOM   486  C  CB    . ILE A 1 75  ? 1.35900   -40.45100 -11.28100 1.000 57.81000  ? 63   ILE A CB    1 
ATOM   487  C  CG1   . ILE A 1 75  ? 0.90100   -40.46400 -9.82300  1.000 55.97000  ? 63   ILE A CG1   1 
ATOM   488  C  CG2   . ILE A 1 75  ? 1.20400   -41.84700 -11.85500 1.000 54.79000  ? 63   ILE A CG2   1 
ATOM   489  C  CD1   . ILE A 1 75  ? -0.33200  -41.31000 -9.57800  1.000 48.75000  ? 63   ILE A CD1   1 
ATOM   490  N  N     . LYS A 1 76  ? 2.83100   -37.54100 -11.34700 1.000 61.48000  ? 64   LYS A N     1 
ATOM   491  C  CA    . LYS A 1 76  ? 2.93100   -36.24900 -10.67700 1.000 65.59000  ? 64   LYS A CA    1 
ATOM   492  C  C     . LYS A 1 76  ? 1.79100   -36.12000 -9.67500  1.000 67.70000  ? 64   LYS A C     1 
ATOM   493  O  O     . LYS A 1 76  ? 0.72800   -36.71600 -9.86600  1.000 67.93000  ? 64   LYS A O     1 
ATOM   494  C  CB    . LYS A 1 76  ? 2.89500   -35.09800 -11.68900 1.000 71.26000  ? 64   LYS A CB    1 
ATOM   495  C  CG    . LYS A 1 76  ? 4.23700   -34.79100 -12.36400 1.000 69.74000  ? 64   LYS A CG    1 
ATOM   496  C  CD    . LYS A 1 76  ? 5.23100   -34.19300 -11.38100 1.000 68.91000  ? 64   LYS A CD    1 
ATOM   497  C  CE    . LYS A 1 76  ? 6.23800   -33.28000 -12.07300 1.000 75.38000  ? 64   LYS A CE    1 
ATOM   498  N  NZ    . LYS A 1 76  ? 7.17600   -33.99300 -12.98500 1.000 70.56000  ? 64   LYS A NZ    1 
ATOM   499  N  N     . LYS A 1 77  ? 2.01500   -35.35800 -8.60700  1.000 67.61000  ? 65   LYS A N     1 
ATOM   500  C  CA    . LYS A 1 77  ? 0.97100   -35.10200 -7.61100  1.000 64.28000  ? 65   LYS A CA    1 
ATOM   501  C  C     . LYS A 1 77  ? 0.15100   -33.85200 -7.96100  1.000 77.14000  ? 65   LYS A C     1 
ATOM   502  O  O     . LYS A 1 77  ? 0.28500   -33.30000 -9.06000  1.000 76.46000  ? 65   LYS A O     1 
ATOM   503  C  CB    . LYS A 1 77  ? 1.58100   -34.93600 -6.22200  1.000 54.91000  ? 65   LYS A CB    1 
ATOM   504  C  CG    . LYS A 1 77  ? 2.13400   -36.19600 -5.59300  1.000 50.28000  ? 65   LYS A CG    1 
ATOM   505  C  CD    . LYS A 1 77  ? 2.90700   -35.84400 -4.32200  1.000 53.97000  ? 65   LYS A CD    1 
ATOM   506  C  CE    . LYS A 1 77  ? 3.30600   -37.07400 -3.51300  1.000 52.84000  ? 65   LYS A CE    1 
ATOM   507  N  NZ    . LYS A 1 77  ? 4.15100   -36.71400 -2.33200  1.000 52.60000  ? 65   LYS A NZ    1 
ATOM   508  N  N     . LYS A 1 78  ? -0.68500  -33.41100 -7.01500  1.000 79.69000  ? 66   LYS A N     1 
ATOM   509  C  CA    . LYS A 1 78  ? -1.49500  -32.19100 -7.16200  1.000 82.44000  ? 66   LYS A CA    1 
ATOM   510  C  C     . LYS A 1 78  ? -0.68800  -30.88800 -7.08000  1.000 88.20000  ? 66   LYS A C     1 
ATOM   511  O  O     . LYS A 1 78  ? -1.14400  -29.84100 -7.54300  1.000 82.39000  ? 66   LYS A O     1 
ATOM   512  C  CB    . LYS A 1 78  ? -2.58500  -32.14800 -6.09500  1.000 86.50000  ? 66   LYS A CB    1 
ATOM   513  C  CG    . LYS A 1 78  ? -3.80000  -33.01600 -6.37000  1.000 90.69000  ? 66   LYS A CG    1 
ATOM   514  C  CD    . LYS A 1 78  ? -4.90700  -32.65900 -5.37900  1.000 88.86000  ? 66   LYS A CD    1 
ATOM   515  C  CE    . LYS A 1 78  ? -6.08900  -33.61100 -5.45600  1.000 92.82000  ? 66   LYS A CE    1 
ATOM   516  N  NZ    . LYS A 1 78  ? -7.08200  -33.34500 -4.36000  1.000 76.00000  ? 66   LYS A NZ    1 
ATOM   517  N  N     . ASP A 1 79  ? 0.49200   -30.94900 -6.46500  1.000 93.34000  ? 67   ASP A N     1 
ATOM   518  C  CA    . ASP A 1 79  ? 1.39800   -29.80600 -6.43100  1.000 92.28000  ? 67   ASP A CA    1 
ATOM   519  C  C     . ASP A 1 79  ? 2.29300   -29.80200 -7.65600  1.000 90.18000  ? 67   ASP A C     1 
ATOM   520  O  O     . ASP A 1 79  ? 3.17600   -28.95000 -7.79600  1.000 88.06000  ? 67   ASP A O     1 
ATOM   521  C  CB    . ASP A 1 79  ? 2.24700   -29.81100 -5.16000  1.000 102.99000 ? 67   ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 79  ? 1.61500   -29.00300 -4.03500  1.000 114.81000 ? 67   ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 79  ? 0.90900   -28.00500 -4.32900  1.000 112.52000 ? 67   ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 79  ? 1.83000   -29.37200 -2.85700  1.000 113.48000 ? 67   ASP A OD2   1 
ATOM   525  N  N     . SER A 1 80  ? 2.08100   -30.78400 -8.52700  1.000 88.50000  ? 68   SER A N     1 
ATOM   526  C  CA    . SER A 1 80  ? 2.61600   -30.73800 -9.88400  1.000 92.78000  ? 68   SER A CA    1 
ATOM   527  C  C     . SER A 1 80  ? 4.15800   -30.73000 -9.93500  1.000 89.52000  ? 68   SER A C     1 
ATOM   528  O  O     . SER A 1 80  ? 4.75300   -30.87600 -11.00600 1.000 82.98000  ? 68   SER A O     1 
ATOM   529  C  CB    . SER A 1 80  ? 2.04800   -29.50200 -10.60100 1.000 95.34000  ? 68   SER A CB    1 
ATOM   530  O  OG    . SER A 1 80  ? 1.96700   -29.68800 -12.00300 1.000 103.87000 ? 68   SER A OG    1 
ATOM   531  N  N     . THR A 1 81  ? 4.79700   -30.56200 -8.77800  1.000 90.07000  ? 69   THR A N     1 
ATOM   532  C  CA    . THR A 1 81  ? 6.25300   -30.51200 -8.71200  1.000 84.81000  ? 69   THR A CA    1 
ATOM   533  C  C     . THR A 1 81  ? 6.82500   -31.80900 -8.15800  1.000 81.76000  ? 69   THR A C     1 
ATOM   534  O  O     . THR A 1 81  ? 7.94300   -32.20300 -8.49500  1.000 78.74000  ? 69   THR A O     1 
ATOM   535  C  CB    . THR A 1 81  ? 6.74500   -29.34500 -7.82900  1.000 85.37000  ? 69   THR A CB    1 
ATOM   536  O  OG1   . THR A 1 81  ? 6.11400   -28.12400 -8.23900  1.000 85.34000  ? 69   THR A OG1   1 
ATOM   537  C  CG2   . THR A 1 81  ? 8.26700   -29.20400 -7.92400  1.000 78.62000  ? 69   THR A CG2   1 
ATOM   538  N  N     . LYS A 1 82  ? 6.05500   -32.46900 -7.30000  1.000 79.15000  ? 70   LYS A N     1 
ATOM   539  C  CA    . LYS A 1 82  ? 6.54300   -33.65800 -6.63000  1.000 67.94000  ? 70   LYS A CA    1 
ATOM   540  C  C     . LYS A 1 82  ? 5.93900   -34.92100 -7.24800  1.000 64.79000  ? 70   LYS A C     1 
ATOM   541  O  O     . LYS A 1 82  ? 4.82100   -34.90400 -7.77800  1.000 66.13000  ? 70   LYS A O     1 
ATOM   542  C  CB    . LYS A 1 82  ? 6.23800   -33.57700 -5.13500  1.000 72.00000  ? 70   LYS A CB    1 
ATOM   543  C  CG    . LYS A 1 82  ? 7.15800   -34.42300 -4.24700  1.000 83.38000  ? 70   LYS A CG    1 
ATOM   544  C  CD    . LYS A 1 82  ? 8.57800   -33.84800 -4.13500  1.000 92.16000  ? 70   LYS A CD    1 
ATOM   545  C  CE    . LYS A 1 82  ? 9.49700   -34.30000 -5.28200  1.000 94.45000  ? 70   LYS A CE    1 
ATOM   546  N  NZ    . LYS A 1 82  ? 10.91400  -33.84500 -5.08400  1.000 97.32000  ? 70   LYS A NZ    1 
ATOM   547  N  N     . TRP A 1 83  ? 6.70700   -36.00600 -7.19200  1.000 61.09000  ? 71   TRP A N     1 
ATOM   548  C  CA    . TRP A 1 83  ? 6.33300   -37.29300 -7.77000  1.000 55.82000  ? 71   TRP A CA    1 
ATOM   549  C  C     . TRP A 1 83  ? 5.80700   -38.25700 -6.71600  1.000 51.27000  ? 71   TRP A C     1 
ATOM   550  O  O     . TRP A 1 83  ? 6.29200   -38.26000 -5.58100  1.000 53.74000  ? 71   TRP A O     1 
ATOM   551  C  CB    . TRP A 1 83  ? 7.53900   -37.92800 -8.45500  1.000 55.76000  ? 71   TRP A CB    1 
ATOM   552  C  CG    . TRP A 1 83  ? 7.89800   -37.31300 -9.74900  1.000 59.87000  ? 71   TRP A CG    1 
ATOM   553  C  CD1   . TRP A 1 83  ? 8.80100   -36.31600 -9.96000  1.000 57.70000  ? 71   TRP A CD1   1 
ATOM   554  C  CD2   . TRP A 1 83  ? 7.36700   -37.66100 -11.03900 1.000 63.68000  ? 71   TRP A CD2   1 
ATOM   555  N  NE1   . TRP A 1 83  ? 8.86300   -36.01600 -11.30200 1.000 65.74000  ? 71   TRP A NE1   1 
ATOM   556  C  CE2   . TRP A 1 83  ? 7.99400   -36.82900 -11.98500 1.000 62.63000  ? 71   TRP A CE2   1 
ATOM   557  C  CE3   . TRP A 1 83  ? 6.41700   -38.59300 -11.48000 1.000 60.93000  ? 71   TRP A CE3   1 
ATOM   558  C  CZ2   . TRP A 1 83  ? 7.70400   -36.89800 -13.34500 1.000 62.07000  ? 71   TRP A CZ2   1 
ATOM   559  C  CZ3   . TRP A 1 83  ? 6.13600   -38.66500 -12.83500 1.000 61.77000  ? 71   TRP A CZ3   1 
ATOM   560  C  CH2   . TRP A 1 83  ? 6.77200   -37.81900 -13.74900 1.000 61.84000  ? 71   TRP A CH2   1 
ATOM   561  N  N     . ARG A 1 84  ? 4.84100   -39.09500 -7.08000  1.000 44.51000  ? 72   ARG A N     1 
ATOM   562  C  CA    . ARG A 1 84  ? 4.39200   -40.11600 -6.14800  1.000 42.71000  ? 72   ARG A CA    1 
ATOM   563  C  C     . ARG A 1 84  ? 4.75800   -41.48700 -6.69000  1.000 44.60000  ? 72   ARG A C     1 
ATOM   564  O  O     . ARG A 1 84  ? 4.32600   -41.87800 -7.77700  1.000 44.92000  ? 72   ARG A O     1 
ATOM   565  C  CB    . ARG A 1 84  ? 2.88500   -39.99600 -5.87500  1.000 38.97000  ? 72   ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 84  ? 2.15100   -41.32000 -5.72200  1.000 40.07000  ? 72   ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 84  ? 0.67500   -41.12400 -5.39700  1.000 36.98000  ? 72   ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 84  ? 0.53000   -40.57800 -4.05200  1.000 37.89000  ? 72   ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 84  ? -0.21700  -39.52300 -3.75400  1.000 42.16000  ? 72   ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 84  ? -0.92300  -38.92400 -4.71500  1.000 41.51000  ? 72   ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 84  ? -0.26200  -39.06900 -2.49800  1.000 40.93000  ? 72   ARG A NH2   1 
ATOM   572  N  N     . LYS A 1 85  ? 5.57800   -42.20000 -5.91800  1.000 43.43000  ? 73   LYS A N     1 
ATOM   573  C  CA    . LYS A 1 85  ? 6.05200   -43.54100 -6.25500  1.000 40.50000  ? 73   LYS A CA    1 
ATOM   574  C  C     . LYS A 1 85  ? 4.97700   -44.61700 -6.01200  1.000 38.46000  ? 73   LYS A C     1 
ATOM   575  O  O     . LYS A 1 85  ? 4.43600   -44.70000 -4.91200  1.000 41.94000  ? 73   LYS A O     1 
ATOM   576  C  CB    . LYS A 1 85  ? 7.31800   -43.83500 -5.43800  1.000 33.83000  ? 73   LYS A CB    1 
ATOM   577  C  CG    . LYS A 1 85  ? 7.70400   -45.30300 -5.32000  1.000 32.91000  ? 73   LYS A CG    1 
ATOM   578  C  CD    . LYS A 1 85  ? 9.17100   -45.39900 -4.93600  1.000 40.12000  ? 73   LYS A CD    1 
ATOM   579  C  CE    . LYS A 1 85  ? 9.54800   -46.75000 -4.37900  1.000 37.24000  ? 73   LYS A CE    1 
ATOM   580  N  NZ    . LYS A 1 85  ? 9.08900   -47.89700 -5.21900  1.000 38.90000  ? 73   LYS A NZ    1 
ATOM   581  N  N     . LEU A 1 86  ? 4.67300   -45.43500 -7.02300  1.000 39.04000  ? 74   LEU A N     1 
ATOM   582  C  CA    . LEU A 1 86  ? 3.57800   -46.41700 -6.92800  1.000 36.64000  ? 74   LEU A CA    1 
ATOM   583  C  C     . LEU A 1 86  ? 4.02300   -47.79800 -7.32800  1.000 39.86000  ? 74   LEU A C     1 
ATOM   584  O  O     . LEU A 1 86  ? 4.93200   -47.93800 -8.13000  1.000 44.69000  ? 74   LEU A O     1 
ATOM   585  C  CB    . LEU A 1 86  ? 2.40700   -46.01600 -7.81800  1.000 32.79000  ? 74   LEU A CB    1 
ATOM   586  C  CG    . LEU A 1 86  ? 1.69700   -44.72600 -7.40000  1.000 42.34000  ? 74   LEU A CG    1 
ATOM   587  C  CD1   . LEU A 1 86  ? 0.56200   -44.34300 -8.37300  1.000 44.07000  ? 74   LEU A CD1   1 
ATOM   588  C  CD2   . LEU A 1 86  ? 1.17200   -44.92100 -5.99500  1.000 38.18000  ? 74   LEU A CD2   1 
ATOM   589  N  N     . VAL A 1 87  ? 3.36800   -48.82300 -6.79600  1.000 38.45000  ? 75   VAL A N     1 
ATOM   590  C  CA    . VAL A 1 87  ? 3.72000   -50.20100 -7.13100  1.000 37.92000  ? 75   VAL A CA    1 
ATOM   591  C  C     . VAL A 1 87  ? 2.49800   -51.01500 -7.53100  1.000 38.22000  ? 75   VAL A C     1 
ATOM   592  O  O     . VAL A 1 87  ? 1.56100   -51.17700 -6.75000  1.000 37.08000  ? 75   VAL A O     1 
ATOM   593  C  CB    . VAL A 1 87  ? 4.41600   -50.90900 -5.96900  1.000 31.79000  ? 75   VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 87  ? 4.84700   -52.27000 -6.39800  1.000 36.14000  ? 75   VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 87  ? 5.60100   -50.11500 -5.50700  1.000 32.51000  ? 75   VAL A CG2   1 
ATOM   596  N  N     . ASP A 1 88  ? 2.52500   -51.52600 -8.75500  1.000 41.05000  ? 76   ASP A N     1 
ATOM   597  C  CA    . ASP A 1 88  ? 1.42400   -52.30400 -9.29400  1.000 42.14000  ? 76   ASP A CA    1 
ATOM   598  C  C     . ASP A 1 88  ? 1.38200   -53.67600 -8.62300  1.000 38.76000  ? 76   ASP A C     1 
ATOM   599  O  O     . ASP A 1 88  ? 1.63100   -54.70000 -9.25100  1.000 42.49000  ? 76   ASP A O     1 
ATOM   600  C  CB    . ASP A 1 88  ? 1.56700   -52.42500 -10.81800 1.000 40.99000  ? 76   ASP A CB    1 
ATOM   601  C  CG    . ASP A 1 88  ? 0.43800   -53.22100 -11.46000 1.000 47.58000  ? 76   ASP A CG    1 
ATOM   602  O  OD1   . ASP A 1 88  ? -0.53800  -53.58600 -10.75600 1.000 45.48000  ? 76   ASP A OD1   1 
ATOM   603  O  OD2   . ASP A 1 88  ? 0.53300   -53.48000 -12.68300 1.000 48.52000  ? 76   ASP A OD2   1 
ATOM   604  N  N     . PHE A 1 89  ? 1.04000   -53.68500 -7.34100  1.000 36.91000  ? 77   PHE A N     1 
ATOM   605  C  CA    . PHE A 1 89  ? 1.01700   -54.91700 -6.55600  1.000 36.57000  ? 77   PHE A CA    1 
ATOM   606  C  C     . PHE A 1 89  ? -0.17600  -55.81800 -6.84900  1.000 35.85000  ? 77   PHE A C     1 
ATOM   607  O  O     . PHE A 1 89  ? -0.50000  -56.69300 -6.04500  1.000 31.82000  ? 77   PHE A O     1 
ATOM   608  C  CB    . PHE A 1 89  ? 1.00900   -54.57800 -5.07000  1.000 35.17000  ? 77   PHE A CB    1 
ATOM   609  C  CG    . PHE A 1 89  ? 2.35300   -54.34800 -4.49200  1.000 29.88000  ? 77   PHE A CG    1 
ATOM   610  C  CD1   . PHE A 1 89  ? 3.37400   -55.25400 -4.68500  1.000 37.33000  ? 77   PHE A CD1   1 
ATOM   611  C  CD2   . PHE A 1 89  ? 2.59300   -53.23500 -3.71400  1.000 32.85000  ? 77   PHE A CD2   1 
ATOM   612  C  CE1   . PHE A 1 89  ? 4.63400   -55.03600 -4.12000  1.000 35.44000  ? 77   PHE A CE1   1 
ATOM   613  C  CE2   . PHE A 1 89  ? 3.84900   -53.01500 -3.13800  1.000 33.90000  ? 77   PHE A CE2   1 
ATOM   614  C  CZ    . PHE A 1 89  ? 4.86500   -53.91400 -3.35000  1.000 30.96000  ? 77   PHE A CZ    1 
ATOM   615  N  N     . ARG A 1 90  ? -0.82600  -55.60900 -7.98900  1.000 42.19000  ? 78   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 90  ? -2.07300  -56.30900 -8.28600  1.000 37.61000  ? 78   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 90  ? -1.97700  -57.79700 -8.04000  1.000 36.76000  ? 78   ARG A C     1 
ATOM   618  O  O     . ARG A 1 90  ? -2.95400  -58.41800 -7.63900  1.000 40.44000  ? 78   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 90  ? -2.48800  -56.06900 -9.72300  1.000 37.55000  ? 78   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 90  ? -3.63000  -55.11700 -9.85300  1.000 39.99000  ? 78   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 90  ? -3.92600  -54.85100 -11.30200 1.000 42.56000  ? 78   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 90  ? -2.75100  -54.34600 -11.99900 1.000 51.95000  ? 78   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 90  ? -2.73600  -54.03900 -13.29100 1.000 59.82000  ? 78   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 90  ? -3.84400  -54.20000 -14.01300 1.000 59.42000  ? 78   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 90  ? -1.62300  -53.57600 -13.85400 1.000 53.04000  ? 78   ARG A NH2   1 
ATOM   626  N  N     . GLU A 1 91  ? -0.79700  -58.36300 -8.28000  1.000 38.38000  ? 79   GLU A N     1 
ATOM   627  C  CA    . GLU A 1 91  ? -0.59300  -59.79200 -8.10400  1.000 40.36000  ? 79   GLU A CA    1 
ATOM   628  C  C     . GLU A 1 91  ? -0.45100  -60.19600 -6.63400  1.000 43.46000  ? 79   GLU A C     1 
ATOM   629  O  O     . GLU A 1 91  ? -1.11100  -61.14200 -6.16900  1.000 44.75000  ? 79   GLU A O     1 
ATOM   630  C  CB    . GLU A 1 91  ? 0.63700   -60.24800 -8.87600  1.000 48.53000  ? 79   GLU A CB    1 
ATOM   631  C  CG    . GLU A 1 91  ? 0.72400   -61.75400 -8.97100  1.000 53.73000  ? 79   GLU A CG    1 
ATOM   632  C  CD    . GLU A 1 91  ? -0.47100  -62.32000 -9.70000  1.000 52.41000  ? 79   GLU A CD    1 
ATOM   633  O  OE1   . GLU A 1 91  ? -0.96500  -61.61900 -10.61200 1.000 50.95000  ? 79   GLU A OE1   1 
ATOM   634  O  OE2   . GLU A 1 91  ? -0.92000  -63.44100 -9.35900  1.000 52.51000  ? 79   GLU A OE2   1 
ATOM   635  N  N     . LEU A 1 92  ? 0.41900   -59.49500 -5.90600  1.000 36.53000  ? 80   LEU A N     1 
ATOM   636  C  CA    . LEU A 1 92  ? 0.56800   -59.73400 -4.47200  1.000 35.58000  ? 80   LEU A CA    1 
ATOM   637  C  C     . LEU A 1 92  ? -0.71900  -59.42900 -3.70000  1.000 34.58000  ? 80   LEU A C     1 
ATOM   638  O  O     . LEU A 1 92  ? -1.01600  -60.07300 -2.69500  1.000 34.38000  ? 80   LEU A O     1 
ATOM   639  C  CB    . LEU A 1 92  ? 1.71100   -58.89500 -3.91000  1.000 38.63000  ? 80   LEU A CB    1 
ATOM   640  C  CG    . LEU A 1 92  ? 1.74300   -58.74900 -2.38700  1.000 31.36000  ? 80   LEU A CG    1 
ATOM   641  C  CD1   . LEU A 1 92  ? 2.18200   -60.04400 -1.72000  1.000 27.48000  ? 80   LEU A CD1   1 
ATOM   642  C  CD2   . LEU A 1 92  ? 2.65900   -57.61100 -2.05000  1.000 33.17000  ? 80   LEU A CD2   1 
ATOM   643  N  N     . ASN A 1 93  ? -1.47300  -58.44000 -4.16500  1.000 35.07000  ? 81   ASN A N     1 
ATOM   644  C  CA    . ASN A 1 93  ? -2.77200  -58.14700 -3.58100  1.000 34.21000  ? 81   ASN A CA    1 
ATOM   645  C  C     . ASN A 1 93  ? -3.70400  -59.38800 -3.61900  1.000 42.29000  ? 81   ASN A C     1 
ATOM   646  O  O     . ASN A 1 93  ? -4.40200  -59.67400 -2.63300  1.000 45.73000  ? 81   ASN A O     1 
ATOM   647  C  CB    . ASN A 1 93  ? -3.42300  -56.94600 -4.28800  1.000 30.06000  ? 81   ASN A CB    1 
ATOM   648  C  CG    . ASN A 1 93  ? -2.68900  -55.61400 -4.02300  1.000 36.32000  ? 81   ASN A CG    1 
ATOM   649  O  OD1   . ASN A 1 93  ? -1.97100  -55.46200 -3.03600  1.000 37.04000  ? 81   ASN A OD1   1 
ATOM   650  N  ND2   . ASN A 1 93  ? -2.88600  -54.64400 -4.90300  1.000 32.12000  ? 81   ASN A ND2   1 
ATOM   651  N  N     . LYS A 1 94  ? -3.69800  -60.13100 -4.73200  1.000 37.94000  ? 82   LYS A N     1 
ATOM   652  C  CA    . LYS A 1 94  ? -4.53200  -61.32700 -4.87100  1.000 34.97000  ? 82   LYS A CA    1 
ATOM   653  C  C     . LYS A 1 94  ? -4.15800  -62.39900 -3.85400  1.000 40.67000  ? 82   LYS A C     1 
ATOM   654  O  O     . LYS A 1 94  ? -5.02600  -63.12200 -3.35800  1.000 45.67000  ? 82   LYS A O     1 
ATOM   655  C  CB    . LYS A 1 94  ? -4.41300  -61.91800 -6.28200  1.000 42.53000  ? 82   LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 94  ? -5.33800  -61.32400 -7.33400  1.000 49.02000  ? 82   LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 94  ? -4.73100  -61.42400 -8.75700  1.000 52.54000  ? 82   LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 94  ? -5.77400  -61.09800 -9.85600  1.000 54.80000  ? 82   LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 94  ? -5.18100  -60.57900 -11.13400 1.000 58.55000  ? 82   LYS A NZ    1 
ATOM   660  N  N     . ARG A 1 95  ? -2.86300  -62.50100 -3.55400  1.000 39.90000  ? 83   ARG A N     1 
ATOM   661  C  CA    . ARG A 1 95  ? -2.34600  -63.55100 -2.67100  1.000 36.65000  ? 83   ARG A CA    1 
ATOM   662  C  C     . ARG A 1 95  ? -2.12400  -63.09500 -1.23600  1.000 41.24000  ? 83   ARG A C     1 
ATOM   663  O  O     . ARG A 1 95  ? -1.57600  -63.85400 -0.42300  1.000 41.91000  ? 83   ARG A O     1 
ATOM   664  C  CB    . ARG A 1 95  ? -1.02600  -64.10000 -3.21300  1.000 45.48000  ? 83   ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 95  ? -0.97700  -64.18700 -4.71800  1.000 50.22000  ? 83   ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 95  ? -0.29500  -65.45500 -5.17400  1.000 57.83000  ? 83   ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 95  ? -0.11200  -65.43800 -6.62200  1.000 62.35000  ? 83   ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 95  ? 1.04100   -65.15900 -7.22400  1.000 63.60000  ? 83   ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 95  ? 2.12500   -64.88900 -6.50200  1.000 60.08000  ? 83   ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 95  ? 1.11300   -65.15200 -8.54900  1.000 65.21000  ? 83   ARG A NH2   1 
ATOM   671  N  N     . THR A 1 96  ? -2.52700  -61.85800 -0.93800  1.000 39.04000  ? 84   THR A N     1 
ATOM   672  C  CA    . THR A 1 96  ? -2.50800  -61.34200 0.43100   1.000 35.60000  ? 84   THR A CA    1 
ATOM   673  C  C     . THR A 1 96  ? -3.84500  -61.58800 1.10000   1.000 34.44000  ? 84   THR A C     1 
ATOM   674  O  O     . THR A 1 96  ? -4.88200  -61.45900 0.46400   1.000 44.14000  ? 84   THR A O     1 
ATOM   675  C  CB    . THR A 1 96  ? -2.21500  -59.84200 0.47300   1.000 37.62000  ? 84   THR A CB    1 
ATOM   676  O  OG1   . THR A 1 96  ? -0.95900  -59.57800 -0.15000  1.000 33.47000  ? 84   THR A OG1   1 
ATOM   677  C  CG2   . THR A 1 96  ? -2.17200  -59.35600 1.90600   1.000 34.47000  ? 84   THR A CG2   1 
ATOM   678  N  N     . GLN A 1 97  ? -3.80900  -61.92000 2.38300   1.000 37.17000  ? 85   GLN A N     1 
ATOM   679  C  CA    . GLN A 1 97  ? -5.01000  -62.21100 3.17200   1.000 38.33000  ? 85   GLN A CA    1 
ATOM   680  C  C     . GLN A 1 97  ? -6.09000  -61.12700 3.09300   1.000 34.98000  ? 85   GLN A C     1 
ATOM   681  O  O     . GLN A 1 97  ? -5.84100  -60.02000 2.62600   1.000 35.38000  ? 85   GLN A O     1 
ATOM   682  C  CB    . GLN A 1 97  ? -4.61900  -62.37700 4.63200   1.000 33.71000  ? 85   GLN A CB    1 
ATOM   683  C  CG    . GLN A 1 97  ? -3.91600  -61.13900 5.12200   1.000 30.00000  ? 85   GLN A CG    1 
ATOM   684  C  CD    . GLN A 1 97  ? -3.79800  -61.11200 6.60700   1.000 36.27000  ? 85   GLN A CD    1 
ATOM   685  O  OE1   . GLN A 1 97  ? -2.83100  -61.63900 7.16800   1.000 42.43000  ? 85   GLN A OE1   1 
ATOM   686  N  NE2   . GLN A 1 97  ? -4.77600  -60.50100 7.27500   1.000 30.33000  ? 85   GLN A NE2   1 
ATOM   687  N  N     . ASP A 1 98  ? -7.27900  -61.44000 3.59100   1.000 34.34000  ? 86   ASP A N     1 
ATOM   688  C  CA    . ASP A 1 98  ? -8.31900  -60.43000 3.70300   1.000 31.76000  ? 86   ASP A CA    1 
ATOM   689  C  C     . ASP A 1 98  ? -8.12600  -59.54500 4.92900   1.000 30.71000  ? 86   ASP A C     1 
ATOM   690  O  O     . ASP A 1 98  ? -7.69400  -60.01500 5.97200   1.000 33.71000  ? 86   ASP A O     1 
ATOM   691  C  CB    . ASP A 1 98  ? -9.68700  -61.09500 3.75900   1.000 31.34000  ? 86   ASP A CB    1 
ATOM   692  C  CG    . ASP A 1 98  ? -10.01900 -61.83700 2.48700   1.000 39.93000  ? 86   ASP A CG    1 
ATOM   693  O  OD1   . ASP A 1 98  ? -9.58700  -61.36100 1.39600   1.000 39.67000  ? 86   ASP A OD1   1 
ATOM   694  O  OD2   . ASP A 1 98  ? -10.70400 -62.88900 2.58500   1.000 37.94000  ? 86   ASP A OD2   1 
ATOM   695  N  N     . PHE A 1 99  ? -8.44100  -58.26000 4.78900   1.000 30.80000  ? 87   PHE A N     1 
ATOM   696  C  CA    . PHE A 1 99  ? -8.51800  -57.34400 5.92700   1.000 24.04000  ? 87   PHE A CA    1 
ATOM   697  C  C     . PHE A 1 99  ? -9.95900  -56.95100 6.14500   1.000 29.70000  ? 87   PHE A C     1 
ATOM   698  O  O     . PHE A 1 99  ? -10.79400 -57.11300 5.25600   1.000 33.62000  ? 87   PHE A O     1 
ATOM   699  C  CB    . PHE A 1 99  ? -7.70300  -56.08100 5.69300   1.000 26.47000  ? 87   PHE A CB    1 
ATOM   700  C  CG    . PHE A 1 99  ? -6.27400  -56.33600 5.42500   1.000 27.31000  ? 87   PHE A CG    1 
ATOM   701  C  CD1   . PHE A 1 99  ? -5.83500  -56.57900 4.13600   1.000 29.45000  ? 87   PHE A CD1   1 
ATOM   702  C  CD2   . PHE A 1 99  ? -5.35700  -56.32300 6.44900   1.000 29.93000  ? 87   PHE A CD2   1 
ATOM   703  C  CE1   . PHE A 1 99  ? -4.52200  -56.80300 3.87700   1.000 27.75000  ? 87   PHE A CE1   1 
ATOM   704  C  CE2   . PHE A 1 99  ? -4.01900  -56.55100 6.19200   1.000 30.16000  ? 87   PHE A CE2   1 
ATOM   705  C  CZ    . PHE A 1 99  ? -3.60500  -56.79400 4.90800   1.000 28.84000  ? 87   PHE A CZ    1 
ATOM   706  N  N     . TRP A 1 100 ? -10.26200 -56.42500 7.32400   1.000 34.38000  ? 88   TRP A N     1 
ATOM   707  C  CA    . TRP A 1 100 ? -11.55800 -55.79100 7.52300   1.000 29.45000  ? 88   TRP A CA    1 
ATOM   708  C  C     . TRP A 1 100 ? -11.28800 -54.32000 7.43500   1.000 27.01000  ? 88   TRP A C     1 
ATOM   709  O  O     . TRP A 1 100 ? -10.50600 -53.77400 8.21800   1.000 27.21000  ? 88   TRP A O     1 
ATOM   710  C  CB    . TRP A 1 100 ? -12.20700 -56.15200 8.86000   1.000 26.26000  ? 88   TRP A CB    1 
ATOM   711  C  CG    . TRP A 1 100 ? -13.62000 -55.67000 8.91500   1.000 28.05000  ? 88   TRP A CG    1 
ATOM   712  C  CD1   . TRP A 1 100 ? -14.09100 -54.57400 9.58000   1.000 24.82000  ? 88   TRP A CD1   1 
ATOM   713  C  CD2   . TRP A 1 100 ? -14.74900 -56.24400 8.22800   1.000 25.49000  ? 88   TRP A CD2   1 
ATOM   714  N  NE1   . TRP A 1 100 ? -15.44300 -54.44300 9.36500   1.000 24.33000  ? 88   TRP A NE1   1 
ATOM   715  C  CE2   . TRP A 1 100 ? -15.87200 -55.45200 8.54000   1.000 22.87000  ? 88   TRP A CE2   1 
ATOM   716  C  CE3   . TRP A 1 100 ? -14.91600 -57.34800 7.37700   1.000 23.44000  ? 88   TRP A CE3   1 
ATOM   717  C  CZ2   . TRP A 1 100 ? -17.14600 -55.73300 8.03500   1.000 26.01000  ? 88   TRP A CZ2   1 
ATOM   718  C  CZ3   . TRP A 1 100 ? -16.17900 -57.63500 6.89000   1.000 20.93000  ? 88   TRP A CZ3   1 
ATOM   719  C  CH2   . TRP A 1 100 ? -17.28000 -56.82900 7.21500   1.000 28.25000  ? 88   TRP A CH2   1 
ATOM   720  N  N     . GLU A 1 101 ? -11.88900 -53.69200 6.44400   1.000 27.83000  ? 89   GLU A N     1 
ATOM   721  C  CA    . GLU A 1 101 ? -11.69000 -52.28000 6.23900   1.000 26.80000  ? 89   GLU A CA    1 
ATOM   722  C  C     . GLU A 1 101 ? -12.31900 -51.58300 7.41500   1.000 29.66000  ? 89   GLU A C     1 
ATOM   723  O  O     . GLU A 1 101 ? -13.41200 -51.97700 7.85700   1.000 32.12000  ? 89   GLU A O     1 
ATOM   724  C  CB    . GLU A 1 101 ? -12.29600 -51.84300 4.91700   1.000 22.72000  ? 89   GLU A CB    1 
ATOM   725  C  CG    . GLU A 1 101 ? -11.68800 -52.60400 3.74600   1.000 26.97000  ? 89   GLU A CG    1 
ATOM   726  C  CD    . GLU A 1 101 ? -10.18100 -52.38600 3.60800   1.000 36.16000  ? 89   GLU A CD    1 
ATOM   727  O  OE1   . GLU A 1 101 ? -9.66400  -51.35600 4.13200   1.000 32.59000  ? 89   GLU A OE1   1 
ATOM   728  O  OE2   . GLU A 1 101 ? -9.51700  -53.25000 2.96600   1.000 39.35000  ? 89   GLU A OE2   1 
ATOM   729  N  N     . VAL A 1 102 ? -11.61300 -50.58800 7.94500   1.000 25.26000  ? 90   VAL A N     1 
ATOM   730  C  CA    . VAL A 1 102 ? -12.09800 -49.86600 9.10900   1.000 23.19000  ? 90   VAL A CA    1 
ATOM   731  C  C     . VAL A 1 102 ? -12.76100 -48.53800 8.74300   1.000 24.11000  ? 90   VAL A C     1 
ATOM   732  O  O     . VAL A 1 102 ? -13.51600 -47.99100 9.53200   1.000 24.85000  ? 90   VAL A O     1 
ATOM   733  C  CB    . VAL A 1 102 ? -10.96300 -49.61700 10.10600  1.000 24.15000  ? 90   VAL A CB    1 
ATOM   734  C  CG1   . VAL A 1 102 ? -10.48900 -50.94400 10.62800  1.000 24.74000  ? 90   VAL A CG1   1 
ATOM   735  C  CG2   . VAL A 1 102 ? -9.81000  -48.86300 9.44600   1.000 17.80000  ? 90   VAL A CG2   1 
ATOM   736  N  N     . GLN A 1 103 ? -12.48200 -48.03000 7.55200   1.000 22.32000  ? 91   GLN A N     1 
ATOM   737  C  CA    . GLN A 1 103 ? -13.09900 -46.79500 7.09300   1.000 20.44000  ? 91   GLN A CA    1 
ATOM   738  C  C     . GLN A 1 103 ? -14.53900 -47.05700 6.66100   1.000 24.06000  ? 91   GLN A C     1 
ATOM   739  O  O     . GLN A 1 103 ? -14.77300 -47.74000 5.67300   1.000 27.93000  ? 91   GLN A O     1 
ATOM   740  C  CB    . GLN A 1 103 ? -12.29500 -46.22600 5.93400   1.000 24.57000  ? 91   GLN A CB    1 
ATOM   741  C  CG    . GLN A 1 103 ? -12.71800 -44.86500 5.49400   1.000 24.21000  ? 91   GLN A CG    1 
ATOM   742  C  CD    . GLN A 1 103 ? -12.17800 -43.80400 6.41300   1.000 26.52000  ? 91   GLN A CD    1 
ATOM   743  O  OE1   . GLN A 1 103 ? -11.04100 -43.91800 6.92400   1.000 22.19000  ? 91   GLN A OE1   1 
ATOM   744  N  NE2   . GLN A 1 103 ? -12.98300 -42.76300 6.64900   1.000 21.84000  ? 91   GLN A NE2   1 
ATOM   745  N  N     . LEU A 1 104 ? -15.50900 -46.52400 7.39400   1.000 23.88000  ? 92   LEU A N     1 
ATOM   746  C  CA    . LEU A 1 104 ? -16.89800 -46.94500 7.19600   1.000 22.23000  ? 92   LEU A CA    1 
ATOM   747  C  C     . LEU A 1 104 ? -17.71200 -45.98500 6.32500   1.000 26.61000  ? 92   LEU A C     1 
ATOM   748  O  O     . LEU A 1 104 ? -18.93900 -46.12000 6.22400   1.000 28.82000  ? 92   LEU A O     1 
ATOM   749  C  CB    . LEU A 1 104 ? -17.58500 -47.11200 8.55000   1.000 21.20000  ? 92   LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 104 ? -16.82300 -48.02800 9.51300   1.000 26.84000  ? 92   LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 104 ? -17.62900 -48.38200 10.75900  1.000 21.49000  ? 92   LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 104 ? -16.35800 -49.30100 8.80500   1.000 26.20000  ? 92   LEU A CD2   1 
ATOM   753  N  N     . GLY A 1 105 ? -17.03100 -45.02800 5.70000   1.000 22.57000  ? 93   GLY A N     1 
ATOM   754  C  CA    . GLY A 1 105 ? -17.70000 -43.97000 4.96500   1.000 20.07000  ? 93   GLY A CA    1 
ATOM   755  C  C     . GLY A 1 105 ? -16.90600 -42.67300 4.87800   1.000 23.48000  ? 93   GLY A C     1 
ATOM   756  O  O     . GLY A 1 105 ? -15.73300 -42.62800 5.25400   1.000 22.92000  ? 93   GLY A O     1 
ATOM   757  N  N     . ILE A 1 106 ? -17.56800 -41.60800 4.40900   1.000 24.62000  ? 94   ILE A N     1 
ATOM   758  C  CA    . ILE A 1 106 ? -16.92400 -40.35200 4.06400   1.000 18.93000  ? 94   ILE A CA    1 
ATOM   759  C  C     . ILE A 1 106 ? -17.48500 -39.21400 4.86800   1.000 19.86000  ? 94   ILE A C     1 
ATOM   760  O  O     . ILE A 1 106 ? -18.66800 -38.96600 4.83300   1.000 23.21000  ? 94   ILE A O     1 
ATOM   761  C  CB    . ILE A 1 106 ? -17.11500 -40.02400 2.58500   1.000 20.50000  ? 94   ILE A CB    1 
ATOM   762  C  CG1   . ILE A 1 106 ? -16.90000 -41.26700 1.73500   1.000 24.61000  ? 94   ILE A CG1   1 
ATOM   763  C  CG2   . ILE A 1 106 ? -16.15200 -38.94600 2.14900   1.000 20.46000  ? 94   ILE A CG2   1 
ATOM   764  C  CD1   . ILE A 1 106 ? -15.55500 -41.90300 2.03000   1.000 31.30000  ? 94   ILE A CD1   1 
ATOM   765  N  N     . PRO A 1 107 ? -16.62900 -38.49700 5.59400   1.000 21.78000  ? 95   PRO A N     1 
ATOM   766  C  CA    . PRO A 1 107 ? -17.20800 -37.42200 6.40100   1.000 18.58000  ? 95   PRO A CA    1 
ATOM   767  C  C     . PRO A 1 107 ? -17.79100 -36.31400 5.52700   1.000 22.93000  ? 95   PRO A C     1 
ATOM   768  O  O     . PRO A 1 107 ? -17.28000 -36.05800 4.44200   1.000 21.37000  ? 95   PRO A O     1 
ATOM   769  C  CB    . PRO A 1 107 ? -16.02000 -36.91500 7.23000   1.000 17.46000  ? 95   PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 107 ? -14.80400 -37.43800 6.56000   1.000 17.76000  ? 95   PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 107 ? -15.19300 -38.70000 5.85800   1.000 21.92000  ? 95   PRO A CD    1 
ATOM   772  N  N     . HIS A 1 108 ? -18.84700 -35.66700 6.00000   1.000 26.33000  ? 96   HIS A N     1 
ATOM   773  C  CA    . HIS A 1 108 ? -19.48900 -34.63500 5.21400   1.000 21.63000  ? 96   HIS A CA    1 
ATOM   774  C  C     . HIS A 1 108 ? -19.55100 -33.27900 5.92000   1.000 23.46000  ? 96   HIS A C     1 
ATOM   775  O  O     . HIS A 1 108 ? -19.94900 -33.19800 7.08600   1.000 23.84000  ? 96   HIS A O     1 
ATOM   776  C  CB    . HIS A 1 108 ? -20.89400 -35.07700 4.84200   1.000 19.51000  ? 96   HIS A CB    1 
ATOM   777  C  CG    . HIS A 1 108 ? -21.46600 -34.25600 3.73400   1.000 21.01000  ? 96   HIS A CG    1 
ATOM   778  N  ND1   . HIS A 1 108 ? -21.99800 -33.00200 3.94300   1.000 20.73000  ? 96   HIS A ND1   1 
ATOM   779  C  CD2   . HIS A 1 108 ? -21.51100 -34.48400 2.39600   1.000 18.93000  ? 96   HIS A CD2   1 
ATOM   780  C  CE1   . HIS A 1 108 ? -22.38600 -32.50500 2.77900   1.000 25.95000  ? 96   HIS A CE1   1 
ATOM   781  N  NE2   . HIS A 1 108 ? -22.10700 -33.38500 1.83000   1.000 23.10000  ? 96   HIS A NE2   1 
ATOM   782  N  N     . PRO A 1 109 ? -19.18200 -32.20500 5.21000   1.000 23.51000  ? 97   PRO A N     1 
ATOM   783  C  CA    . PRO A 1 109 ? -19.10100 -30.91400 5.90900   1.000 21.30000  ? 97   PRO A CA    1 
ATOM   784  C  C     . PRO A 1 109 ? -20.39500 -30.56400 6.64200   1.000 20.68000  ? 97   PRO A C     1 
ATOM   785  O  O     . PRO A 1 109 ? -20.33600 -29.90300 7.67500   1.000 23.53000  ? 97   PRO A O     1 
ATOM   786  C  CB    . PRO A 1 109 ? -18.82000 -29.90600 4.77900   1.000 17.88000  ? 97   PRO A CB    1 
ATOM   787  C  CG    . PRO A 1 109 ? -19.12800 -30.62600 3.51300   1.000 19.03000  ? 97   PRO A CG    1 
ATOM   788  C  CD    . PRO A 1 109 ? -18.90300 -32.07600 3.77100   1.000 18.89000  ? 97   PRO A CD    1 
ATOM   789  N  N     . ALA A 1 110 ? -21.53500 -31.02500 6.14300   1.000 19.22000  ? 98   ALA A N     1 
ATOM   790  C  CA    . ALA A 1 110 ? -22.81200 -30.59700 6.72600   1.000 22.18000  ? 98   ALA A CA    1 
ATOM   791  C  C     . ALA A 1 110 ? -23.04400 -31.23400 8.08700   1.000 20.72000  ? 98   ALA A C     1 
ATOM   792  O  O     . ALA A 1 110 ? -24.03500 -30.97700 8.73700   1.000 21.09000  ? 98   ALA A O     1 
ATOM   793  C  CB    . ALA A 1 110 ? -23.96400 -30.93100 5.79400   1.000 21.76000  ? 98   ALA A CB    1 
ATOM   794  N  N     . GLY A 1 111 ? -22.12600 -32.09000 8.50400   1.000 19.26000  ? 99   GLY A N     1 
ATOM   795  C  CA    . GLY A 1 111 ? -22.30000 -32.76400 9.76000   1.000 19.37000  ? 99   GLY A CA    1 
ATOM   796  C  C     . GLY A 1 111 ? -21.41600 -32.12500 10.80300  1.000 21.03000  ? 99   GLY A C     1 
ATOM   797  O  O     . GLY A 1 111 ? -21.44700 -32.51900 11.96500  1.000 23.25000  ? 99   GLY A O     1 
ATOM   798  N  N     . LEU A 1 112 ? -20.61600 -31.15500 10.37300  1.000 17.42000  ? 100  LEU A N     1 
ATOM   799  C  CA    . LEU A 1 112 ? -19.74100 -30.40800 11.26800  1.000 16.43000  ? 100  LEU A CA    1 
ATOM   800  C  C     . LEU A 1 112 ? -20.52700 -29.36700 12.03300  1.000 20.42000  ? 100  LEU A C     1 
ATOM   801  O  O     . LEU A 1 112 ? -21.51200 -28.81800 11.52500  1.000 23.70000  ? 100  LEU A O     1 
ATOM   802  C  CB    . LEU A 1 112 ? -18.64000 -29.71700 10.48000  1.000 19.84000  ? 100  LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 112 ? -17.64400 -30.55600 9.70100   1.000 19.31000  ? 100  LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 112 ? -16.90400 -29.66600 8.73500   1.000 18.81000  ? 100  LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 112 ? -16.69100 -31.21800 10.68300  1.000 19.47000  ? 100  LEU A CD2   1 
ATOM   806  N  N     . LYS A 1 113 ? -20.07800 -29.06900 13.24000  1.000 20.28000  ? 101  LYS A N     1 
ATOM   807  C  CA    . LYS A 1 113 ? -20.76200 -28.07700 14.06000  1.000 23.90000  ? 101  LYS A CA    1 
ATOM   808  C  C     . LYS A 1 113 ? -19.94500 -26.79500 14.07000  1.000 25.54000  ? 101  LYS A C     1 
ATOM   809  O  O     . LYS A 1 113 ? -18.75000 -26.83800 13.79700  1.000 25.49000  ? 101  LYS A O     1 
ATOM   810  C  CB    . LYS A 1 113 ? -20.97300 -28.61700 15.46100  1.000 22.93000  ? 101  LYS A CB    1 
ATOM   811  C  CG    . LYS A 1 113 ? -21.62900 -29.96900 15.44500  1.000 23.92000  ? 101  LYS A CG    1 
ATOM   812  C  CD    . LYS A 1 113 ? -21.72800 -30.57200 16.81300  1.000 19.78000  ? 101  LYS A CD    1 
ATOM   813  C  CE    . LYS A 1 113 ? -22.37400 -31.92000 16.69800  1.000 20.44000  ? 101  LYS A CE    1 
ATOM   814  N  NZ    . LYS A 1 113 ? -22.45000 -32.58300 18.02700  1.000 23.03000  ? 101  LYS A NZ    1 
ATOM   815  N  N     . LYS A 1 114 ? -20.58900 -25.66700 14.35800  1.000 22.95000  ? 102  LYS A N     1 
ATOM   816  C  CA    . LYS A 1 114 ? -19.88500 -24.39500 14.39800  1.000 26.14000  ? 102  LYS A CA    1 
ATOM   817  C  C     . LYS A 1 114 ? -18.75100 -24.44500 15.40800  1.000 27.42000  ? 102  LYS A C     1 
ATOM   818  O  O     . LYS A 1 114 ? -18.94500 -24.82600 16.56200  1.000 21.78000  ? 102  LYS A O     1 
ATOM   819  C  CB    . LYS A 1 114 ? -20.82300 -23.24900 14.74300  1.000 25.74000  ? 102  LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 114 ? -20.96800 -22.22900 13.61400  1.000 36.74000  ? 102  LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 114 ? -22.33800 -22.35500 12.91100  1.000 35.37000  ? 102  LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 114 ? -22.51800 -21.29900 11.80300  1.000 45.80000  ? 102  LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 114 ? -23.56500 -21.69300 10.77000  1.000 49.47000  ? 102  LYS A NZ    1 
ATOM   824  N  N     . LYS A 1 115 ? -17.55300 -24.07900 14.96400  1.000 23.73000  ? 103  LYS A N     1 
ATOM   825  C  CA    . LYS A 1 115 ? -16.41300 -24.14600 15.85500  1.000 25.97000  ? 103  LYS A CA    1 
ATOM   826  C  C     . LYS A 1 115 ? -15.74700 -22.78900 15.94600  1.000 29.31000  ? 103  LYS A C     1 
ATOM   827  O  O     . LYS A 1 115 ? -15.75900 -22.01200 14.99400  1.000 31.31000  ? 103  LYS A O     1 
ATOM   828  C  CB    . LYS A 1 115 ? -15.42800 -25.20800 15.38000  1.000 29.19000  ? 103  LYS A CB    1 
ATOM   829  C  CG    . LYS A 1 115 ? -15.93000 -26.62800 15.57000  1.000 24.97000  ? 103  LYS A CG    1 
ATOM   830  C  CD    . LYS A 1 115 ? -16.07700 -26.92400 17.03900  1.000 25.60000  ? 103  LYS A CD    1 
ATOM   831  C  CE    . LYS A 1 115 ? -16.37800 -28.36400 17.28900  1.000 22.53000  ? 103  LYS A CE    1 
ATOM   832  N  NZ    . LYS A 1 115 ? -16.88500 -28.54300 18.67800  1.000 33.74000  ? 103  LYS A NZ    1 
ATOM   833  N  N     . LYS A 1 116 ? -15.16900 -22.50500 17.09800  1.000 30.10000  ? 104  LYS A N     1 
ATOM   834  C  CA    . LYS A 1 116 ? -14.60400 -21.19100 17.34000  1.000 27.72000  ? 104  LYS A CA    1 
ATOM   835  C  C     . LYS A 1 116 ? -13.21400 -21.08900 16.76500  1.000 25.77000  ? 104  LYS A C     1 
ATOM   836  O  O     . LYS A 1 116 ? -12.77200 -20.02300 16.37000  1.000 33.69000  ? 104  LYS A O     1 
ATOM   837  C  CB    . LYS A 1 116 ? -14.57800 -20.91500 18.83300  1.000 27.91000  ? 104  LYS A CB    1 
ATOM   838  C  CG    . LYS A 1 116 ? -14.21100 -19.51800 19.18000  1.000 35.79000  ? 104  LYS A CG    1 
ATOM   839  C  CD    . LYS A 1 116 ? -14.31000 -19.35700 20.66700  1.000 44.12000  ? 104  LYS A CD    1 
ATOM   840  C  CE    . LYS A 1 116 ? -14.03400 -17.93800 21.10300  1.000 48.19000  ? 104  LYS A CE    1 
ATOM   841  N  NZ    . LYS A 1 116 ? -14.04400 -17.94000 22.59500  1.000 61.95000  ? 104  LYS A NZ    1 
ATOM   842  N  N     . SER A 1 117 ? -12.52100 -22.21400 16.72500  1.000 27.21000  ? 105  SER A N     1 
ATOM   843  C  CA    . SER A 1 117 ? -11.17600 -22.26700 16.16000  1.000 25.23000  ? 105  SER A CA    1 
ATOM   844  C  C     . SER A 1 117 ? -10.96800 -23.56700 15.38300  1.000 24.49000  ? 105  SER A C     1 
ATOM   845  O  O     . SER A 1 117 ? -11.29200 -24.66700 15.85200  1.000 26.60000  ? 105  SER A O     1 
ATOM   846  C  CB    . SER A 1 117 ? -10.13500 -22.13800 17.26800  1.000 28.50000  ? 105  SER A CB    1 
ATOM   847  O  OG    . SER A 1 117 ? -10.28300 -20.92000 17.97800  1.000 28.58000  ? 105  SER A OG    1 
ATOM   848  N  N     . VAL A 1 118 ? -10.40700 -23.42600 14.19700  1.000 18.28000  ? 106  VAL A N     1 
ATOM   849  C  CA    . VAL A 1 118 ? -10.25700 -24.54900 13.30600  1.000 20.96000  ? 106  VAL A CA    1 
ATOM   850  C  C     . VAL A 1 118 ? -8.84500  -24.63300 12.74100  1.000 24.04000  ? 106  VAL A C     1 
ATOM   851  O  O     . VAL A 1 118 ? -8.18700  -23.61700 12.51500  1.000 24.61000  ? 106  VAL A O     1 
ATOM   852  C  CB    . VAL A 1 118 ? -11.26600 -24.44100 12.15300  1.000 25.19000  ? 106  VAL A CB    1 
ATOM   853  C  CG1   . VAL A 1 118 ? -10.98600 -25.47700 11.08700  1.000 23.12000  ? 106  VAL A CG1   1 
ATOM   854  C  CG2   . VAL A 1 118 ? -12.69400 -24.57300 12.68900  1.000 24.27000  ? 106  VAL A CG2   1 
ATOM   855  N  N     . THR A 1 119 ? -8.38000  -25.85400 12.51000  1.000 24.32000  ? 107  THR A N     1 
ATOM   856  C  CA    . THR A 1 119 ? -7.08200  -26.05800 11.90300  1.000 22.22000  ? 107  THR A CA    1 
ATOM   857  C  C     . THR A 1 119 ? -7.13700  -27.25500 10.97500  1.000 27.44000  ? 107  THR A C     1 
ATOM   858  O  O     . THR A 1 119 ? -7.88900  -28.19200 11.23600  1.000 31.25000  ? 107  THR A O     1 
ATOM   859  C  CB    . THR A 1 119 ? -6.00500  -26.29700 12.95700  1.000 22.30000  ? 107  THR A CB    1 
ATOM   860  O  OG1   . THR A 1 119 ? -6.03900  -25.23800 13.92800  1.000 25.79000  ? 107  THR A OG1   1 
ATOM   861  C  CG2   . THR A 1 119 ? -4.65400  -26.35200 12.28800  1.000 24.95000  ? 107  THR A CG2   1 
ATOM   862  N  N     . VAL A 1 120 ? -6.35800  -27.24000 9.89200   1.000 22.99000  ? 108  VAL A N     1 
ATOM   863  C  CA    . VAL A 1 120 ? -6.28400  -28.42500 9.05900   1.000 22.37000  ? 108  VAL A CA    1 
ATOM   864  C  C     . VAL A 1 120 ? -4.82500  -28.76500 8.83800   1.000 28.30000  ? 108  VAL A C     1 
ATOM   865  O  O     . VAL A 1 120 ? -4.03200  -27.89700 8.50700   1.000 29.79000  ? 108  VAL A O     1 
ATOM   866  C  CB    . VAL A 1 120 ? -7.00900  -28.23300 7.73300   1.000 21.08000  ? 108  VAL A CB    1 
ATOM   867  C  CG1   . VAL A 1 120 ? -6.67100  -29.34600 6.80300   1.000 21.89000  ? 108  VAL A CG1   1 
ATOM   868  C  CG2   . VAL A 1 120 ? -8.52100  -28.18700 7.97100   1.000 19.32000  ? 108  VAL A CG2   1 
ATOM   869  N  N     . LEU A 1 121 ? -4.47900  -30.03200 9.05500   1.000 28.53000  ? 109  LEU A N     1 
ATOM   870  C  CA    . LEU A 1 121 ? -3.10300  -30.50400 8.95800   1.000 24.26000  ? 109  LEU A CA    1 
ATOM   871  C  C     . LEU A 1 121 ? -2.98700  -31.77800 8.12900   1.000 31.52000  ? 109  LEU A C     1 
ATOM   872  O  O     . LEU A 1 121 ? -3.77900  -32.70400 8.30100   1.000 28.89000  ? 109  LEU A O     1 
ATOM   873  C  CB    . LEU A 1 121 ? -2.54800  -30.82900 10.32400  1.000 27.64000  ? 109  LEU A CB    1 
ATOM   874  C  CG    . LEU A 1 121 ? -2.58900  -29.93800 11.54000  1.000 28.76000  ? 109  LEU A CG    1 
ATOM   875  C  CD1   . LEU A 1 121 ? -2.64800  -30.84500 12.71800  1.000 18.57000  ? 109  LEU A CD1   1 
ATOM   876  C  CD2   . LEU A 1 121 ? -1.30600  -29.15400 11.58800  1.000 33.09000  ? 109  LEU A CD2   1 
ATOM   877  N  N     . ASP A 1 122 ? -1.96700  -31.83400 7.28500   1.000 32.00000  ? 110  ASP A N     1 
ATOM   878  C  CA    . ASP A 1 122 ? -1.57000  -33.03900 6.58000   1.000 30.04000  ? 110  ASP A CA    1 
ATOM   879  C  C     . ASP A 1 122 ? -0.39500  -33.69300 7.29400   1.000 31.90000  ? 110  ASP A C     1 
ATOM   880  O  O     . ASP A 1 122 ? 0.44900   -32.99400 7.83800   1.000 30.46000  ? 110  ASP A O     1 
ATOM   881  C  CB    . ASP A 1 122 ? -1.17600  -32.68200 5.15000   1.000 34.03000  ? 110  ASP A CB    1 
ATOM   882  C  CG    . ASP A 1 122 ? -1.58400  -33.72900 4.15900   1.000 42.65000  ? 110  ASP A CG    1 
ATOM   883  O  OD1   . ASP A 1 122 ? -2.73400  -33.66400 3.65300   1.000 54.12000  ? 110  ASP A OD1   1 
ATOM   884  O  OD2   . ASP A 1 122 ? -0.75700  -34.61900 3.88100   1.000 43.83000  ? 110  ASP A OD2   1 
ATOM   885  N  N     . VAL A 1 123 ? -0.33900  -35.02400 7.29400   1.000 34.69000  ? 111  VAL A N     1 
ATOM   886  C  CA    . VAL A 1 123 ? 0.85100   -35.74200 7.73400   1.000 30.22000  ? 111  VAL A CA    1 
ATOM   887  C  C     . VAL A 1 123 ? 1.81400   -35.88700 6.56500   1.000 34.53000  ? 111  VAL A C     1 
ATOM   888  O  O     . VAL A 1 123 ? 1.38700   -36.12600 5.43300   1.000 36.94000  ? 111  VAL A O     1 
ATOM   889  C  CB    . VAL A 1 123 ? 0.51700   -37.12200 8.27800   1.000 31.40000  ? 111  VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 123 ? 1.78800   -37.91800 8.43600   1.000 28.05000  ? 111  VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 123 ? -0.21900  -37.00900 9.60100   1.000 30.62000  ? 111  VAL A CG2   1 
ATOM   892  N  N     . GLY A 1 124 ? 3.10600   -35.71800 6.83700   1.000 32.43000  ? 112  GLY A N     1 
ATOM   893  C  CA    . GLY A 1 124 ? 4.09000   -35.70000 5.77700   1.000 29.17000  ? 112  GLY A CA    1 
ATOM   894  C  C     . GLY A 1 124 ? 4.54900   -37.11400 5.53100   1.000 36.13000  ? 112  GLY A C     1 
ATOM   895  O  O     . GLY A 1 124 ? 4.78200   -37.86200 6.49600   1.000 31.59000  ? 112  GLY A O     1 
ATOM   896  N  N     . ASP A 1 125 ? 4.65600   -37.46700 4.24500   1.000 38.98000  ? 113  ASP A N     1 
ATOM   897  C  CA    . ASP A 1 125 ? 4.99700   -38.81500 3.78100   1.000 37.03000  ? 113  ASP A CA    1 
ATOM   898  C  C     . ASP A 1 125 ? 4.43100   -39.91800 4.68500   1.000 35.87000  ? 113  ASP A C     1 
ATOM   899  O  O     . ASP A 1 125 ? 5.15100   -40.82500 5.11500   1.000 35.36000  ? 113  ASP A O     1 
ATOM   900  C  CB    . ASP A 1 125 ? 6.52000   -38.95100 3.64200   1.000 39.57000  ? 113  ASP A CB    1 
ATOM   901  C  CG    . ASP A 1 125 ? 7.03200   -38.41500 2.29500   1.000 50.07000  ? 113  ASP A CG    1 
ATOM   902  O  OD1   . ASP A 1 125 ? 6.46600   -38.80400 1.23900   1.000 49.18000  ? 113  ASP A OD1   1 
ATOM   903  O  OD2   . ASP A 1 125 ? 7.98500   -37.59300 2.28600   1.000 53.13000  ? 113  ASP A OD2   1 
ATOM   904  N  N     . ALA A 1 126 ? 3.12400   -39.82200 4.93600   1.000 35.05000  ? 114  ALA A N     1 
ATOM   905  C  CA    . ALA A 1 126 ? 2.40600   -40.64100 5.91100   1.000 31.55000  ? 114  ALA A CA    1 
ATOM   906  C  C     . ALA A 1 126 ? 2.70200   -42.16700 5.89100   1.000 29.16000  ? 114  ALA A C     1 
ATOM   907  O  O     . ALA A 1 126 ? 3.22300   -42.69900 6.86900   1.000 25.87000  ? 114  ALA A O     1 
ATOM   908  C  CB    . ALA A 1 126 ? 0.92300   -40.40100 5.73800   1.000 29.74000  ? 114  ALA A CB    1 
ATOM   909  N  N     . TYR A 1 127 ? 2.34500   -42.85800 4.80600   1.000 23.38000  ? 115  TYR A N     1 
ATOM   910  C  CA    . TYR A 1 127 ? 2.67100   -44.26800 4.68600   1.000 23.09000  ? 115  TYR A CA    1 
ATOM   911  C  C     . TYR A 1 127 ? 4.12600   -44.57500 5.05300   1.000 28.04000  ? 115  TYR A C     1 
ATOM   912  O  O     . TYR A 1 127 ? 4.38800   -45.50100 5.80300   1.000 29.16000  ? 115  TYR A O     1 
ATOM   913  C  CB    . TYR A 1 127 ? 2.41600   -44.76900 3.27700   1.000 21.07000  ? 115  TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 127 ? 0.97700   -45.06200 2.96000   1.000 26.80000  ? 115  TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 127 ? -0.04400  -44.37900 3.59000   1.000 26.83000  ? 115  TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 127 ? 0.63800   -46.03000 2.01800   1.000 28.39000  ? 115  TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 127 ? -1.34900  -44.63100 3.29000   1.000 25.62000  ? 115  TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 127 ? -0.67000  -46.29800 1.72800   1.000 27.89000  ? 115  TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 127 ? -1.66700  -45.59000 2.36600   1.000 26.07000  ? 115  TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 127 ? -2.99100  -45.83800 2.07500   1.000 27.50000  ? 115  TYR A OH    1 
ATOM   921  N  N     . PHE A 1 128 ? 5.08200   -43.80500 4.53700   1.000 26.94000  ? 116  PHE A N     1 
ATOM   922  C  CA    . PHE A 1 128 ? 6.47400   -44.19200 4.71200   1.000 29.54000  ? 116  PHE A CA    1 
ATOM   923  C  C     . PHE A 1 128 ? 6.92100   -43.93000 6.15300   1.000 31.93000  ? 116  PHE A C     1 
ATOM   924  O  O     . PHE A 1 128 ? 8.10600   -43.97600 6.45600   1.000 34.51000  ? 116  PHE A O     1 
ATOM   925  C  CB    . PHE A 1 128 ? 7.38700   -43.45800 3.71900   1.000 29.97000  ? 116  PHE A CB    1 
ATOM   926  C  CG    . PHE A 1 128 ? 7.02900   -43.69000 2.27500   1.000 33.08000  ? 116  PHE A CG    1 
ATOM   927  C  CD1   . PHE A 1 128 ? 6.28100   -44.80000 1.89100   1.000 37.17000  ? 116  PHE A CD1   1 
ATOM   928  C  CD2   . PHE A 1 128 ? 7.43400   -42.79100 1.29200   1.000 34.16000  ? 116  PHE A CD2   1 
ATOM   929  C  CE1   . PHE A 1 128 ? 5.94900   -44.99800 0.54200   1.000 38.79000  ? 116  PHE A CE1   1 
ATOM   930  C  CE2   . PHE A 1 128 ? 7.10400   -42.98800 -0.05400  1.000 26.50000  ? 116  PHE A CE2   1 
ATOM   931  C  CZ    . PHE A 1 128 ? 6.37100   -44.08000 -0.43000  1.000 29.78000  ? 116  PHE A CZ    1 
ATOM   932  N  N     . SER A 1 129 ? 5.97200   -43.64800 7.03300   1.000 27.86000  ? 117  SER A N     1 
ATOM   933  C  CA    . SER A 1 129 ? 6.28600   -43.48200 8.44100   1.000 27.44000  ? 117  SER A CA    1 
ATOM   934  C  C     . SER A 1 129 ? 5.73000   -44.63700 9.25900   1.000 32.51000  ? 117  SER A C     1 
ATOM   935  O  O     . SER A 1 129 ? 5.81600   -44.63000 10.48500  1.000 38.32000  ? 117  SER A O     1 
ATOM   936  C  CB    . SER A 1 129 ? 5.73700   -42.16100 8.98700   1.000 29.69000  ? 117  SER A CB    1 
ATOM   937  O  OG    . SER A 1 129 ? 6.55700   -41.05600 8.63700   1.000 29.73000  ? 117  SER A OG    1 
ATOM   938  N  N     . VAL A 1 130 ? 5.16200   -45.63700 8.59700   1.000 23.49000  ? 118  VAL A N     1 
ATOM   939  C  CA    . VAL A 1 130 ? 4.57700   -46.72700 9.33500   1.000 24.80000  ? 118  VAL A CA    1 
ATOM   940  C  C     . VAL A 1 130 ? 5.26000   -48.00700 8.93700   1.000 26.10000  ? 118  VAL A C     1 
ATOM   941  O  O     . VAL A 1 130 ? 5.22700   -48.40000 7.78400   1.000 29.13000  ? 118  VAL A O     1 
ATOM   942  C  CB    . VAL A 1 130 ? 3.05000   -46.82000 9.10100   1.000 24.94000  ? 118  VAL A CB    1 
ATOM   943  C  CG1   . VAL A 1 130 ? 2.46300   -47.99200 9.85700   1.000 22.96000  ? 118  VAL A CG1   1 
ATOM   944  C  CG2   . VAL A 1 130 ? 2.37900   -45.53900 9.53600   1.000 17.65000  ? 118  VAL A CG2   1 
ATOM   945  N  N     . PRO A 1 131 ? 5.90000   -48.67700 9.89500   1.000 30.55000  ? 119  PRO A N     1 
ATOM   946  C  CA    . PRO A 1 131 ? 6.70800   -49.81800 9.46000   1.000 24.59000  ? 119  PRO A CA    1 
ATOM   947  C  C     . PRO A 1 131 ? 5.83500   -50.97000 8.99000   1.000 27.83000  ? 119  PRO A C     1 
ATOM   948  O  O     . PRO A 1 131 ? 4.70100   -51.11100 9.46100   1.000 25.31000  ? 119  PRO A O     1 
ATOM   949  C  CB    . PRO A 1 131 ? 7.48300   -50.18600 10.71800  1.000 24.23000  ? 119  PRO A CB    1 
ATOM   950  C  CG    . PRO A 1 131 ? 6.59300   -49.79300 11.83000  1.000 26.79000  ? 119  PRO A CG    1 
ATOM   951  C  CD    . PRO A 1 131 ? 5.83900   -48.56400 11.36500  1.000 32.26000  ? 119  PRO A CD    1 
ATOM   952  N  N     . LEU A 1 132 ? 6.37400   -51.76500 8.06800   1.000 32.45000  ? 120  LEU A N     1 
ATOM   953  C  CA    . LEU A 1 132 ? 5.71800   -52.95600 7.53100   1.000 30.16000  ? 120  LEU A CA    1 
ATOM   954  C  C     . LEU A 1 132 ? 6.29000   -54.21600 8.16900   1.000 29.50000  ? 120  LEU A C     1 
ATOM   955  O  O     . LEU A 1 132 ? 7.49100   -54.34400 8.31000   1.000 33.73000  ? 120  LEU A O     1 
ATOM   956  C  CB    . LEU A 1 132 ? 5.89600   -53.02900 6.01600   1.000 30.49000  ? 120  LEU A CB    1 
ATOM   957  C  CG    . LEU A 1 132 ? 5.41600   -54.32700 5.35800   1.000 26.13000  ? 120  LEU A CG    1 
ATOM   958  C  CD1   . LEU A 1 132 ? 3.91800   -54.34100 5.25200   1.000 25.54000  ? 120  LEU A CD1   1 
ATOM   959  C  CD2   . LEU A 1 132 ? 6.02600   -54.46900 3.99600   1.000 25.55000  ? 120  LEU A CD2   1 
ATOM   960  N  N     . ASP A 1 133 ? 5.41300   -55.13200 8.55100   1.000 31.81000  ? 121  ASP A N     1 
ATOM   961  C  CA    . ASP A 1 133 ? 5.80400   -56.38800 9.17400   1.000 36.55000  ? 121  ASP A CA    1 
ATOM   962  C  C     . ASP A 1 133 ? 7.07600   -56.99000 8.56500   1.000 39.22000  ? 121  ASP A C     1 
ATOM   963  O  O     . ASP A 1 133 ? 7.24700   -56.97800 7.34500   1.000 42.37000  ? 121  ASP A O     1 
ATOM   964  C  CB    . ASP A 1 133 ? 4.64600   -57.37100 9.05200   1.000 32.36000  ? 121  ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 133 ? 4.94600   -58.70400 9.66900   1.000 39.62000  ? 121  ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 133 ? 6.00200   -58.85200 10.33100  1.000 49.78000  ? 121  ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 133 ? 4.10000   -59.60900 9.51000   1.000 43.38000  ? 121  ASP A OD2   1 
ATOM   968  N  N     . GLU A 1 134 ? 7.95400   -57.52500 9.41000   1.000 34.42000  ? 122  GLU A N     1 
ATOM   969  C  CA    . GLU A 1 134 ? 9.24700   -58.02000 8.92700   1.000 41.12000  ? 122  GLU A CA    1 
ATOM   970  C  C     . GLU A 1 134 ? 9.15500   -59.26600 8.06900   1.000 42.25000  ? 122  GLU A C     1 
ATOM   971  O  O     . GLU A 1 134 ? 9.85800   -59.38300 7.06200   1.000 41.17000  ? 122  GLU A O     1 
ATOM   972  C  CB    . GLU A 1 134 ? 10.16800  -58.29300 10.09900  1.000 41.38000  ? 122  GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 134 ? 10.28300  -57.09800 11.00400  1.000 47.42000  ? 122  GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 134 ? 11.69700  -56.88000 11.44000  1.000 65.80000  ? 122  GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 134 ? 11.98000  -55.80700 12.03500  1.000 68.61000  ? 122  GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 134 ? 12.52300  -57.79400 11.17000  1.000 69.53000  ? 122  GLU A OE2   1 
ATOM   977  N  N     . ASP A 1 135 ? 8.29200   -60.19900 8.45700   1.000 39.44000  ? 123  ASP A N     1 
ATOM   978  C  CA    . ASP A 1 135 ? 8.18500   -61.45000 7.71900   1.000 37.57000  ? 123  ASP A CA    1 
ATOM   979  C  C     . ASP A 1 135 ? 7.58500   -61.22600 6.31800   1.000 42.83000  ? 123  ASP A C     1 
ATOM   980  O  O     . ASP A 1 135 ? 7.64800   -62.10200 5.44600   1.000 45.26000  ? 123  ASP A O     1 
ATOM   981  C  CB    . ASP A 1 135 ? 7.35300   -62.45900 8.51400   1.000 41.41000  ? 123  ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 135 ? 8.01400   -62.85400 9.84300   1.000 56.40000  ? 123  ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 135 ? 9.20900   -63.23900 9.83900   1.000 54.36000  ? 123  ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 135 ? 7.34500   -62.77000 10.90000  1.000 60.63000  ? 123  ASP A OD2   1 
ATOM   985  N  N     . PHE A 1 136 ? 7.01100   -60.04700 6.09800   1.000 36.86000  ? 124  PHE A N     1 
ATOM   986  C  CA    . PHE A 1 136 ? 6.29000   -59.80200 4.86300   1.000 33.89000  ? 124  PHE A CA    1 
ATOM   987  C  C     . PHE A 1 136 ? 7.08600   -58.89900 3.93800   1.000 30.34000  ? 124  PHE A C     1 
ATOM   988  O  O     . PHE A 1 136 ? 6.76000   -58.75500 2.77900   1.000 35.29000  ? 124  PHE A O     1 
ATOM   989  C  CB    . PHE A 1 136 ? 4.92900   -59.17900 5.18100   1.000 33.16000  ? 124  PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 136 ? 3.93800   -59.27800 4.07800   1.000 24.32000  ? 124  PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 136 ? 3.14600   -60.40400 3.94800   1.000 31.30000  ? 124  PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 136 ? 3.75800   -58.23800 3.19300   1.000 27.32000  ? 124  PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 136 ? 2.19800   -60.50300 2.93800   1.000 28.77000  ? 124  PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 136 ? 2.81000   -58.32800 2.18100   1.000 27.82000  ? 124  PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 136 ? 2.03000   -59.46100 2.05800   1.000 25.43000  ? 124  PHE A CZ    1 
ATOM   996  N  N     . ARG A 1 137 ? 8.13000   -58.28300 4.45400   1.000 30.61000  ? 125  ARG A N     1 
ATOM   997  C  CA    . ARG A 1 137 ? 8.88600   -57.33200 3.65800   1.000 34.27000  ? 125  ARG A CA    1 
ATOM   998  C  C     . ARG A 1 137 ? 9.39700   -57.93000 2.33800   1.000 38.75000  ? 125  ARG A C     1 
ATOM   999  O  O     . ARG A 1 137 ? 9.40700   -57.24800 1.29600   1.000 41.09000  ? 125  ARG A O     1 
ATOM   1000 C  CB    . ARG A 1 137 ? 10.04900  -56.77600 4.48400   1.000 34.04000  ? 125  ARG A CB    1 
ATOM   1001 C  CG    . ARG A 1 137 ? 9.58400   -55.83200 5.58400   1.000 37.98000  ? 125  ARG A CG    1 
ATOM   1002 C  CD    . ARG A 1 137 ? 10.64200  -55.58300 6.65000   1.000 37.12000  ? 125  ARG A CD    1 
ATOM   1003 N  NE    . ARG A 1 137 ? 10.06600  -54.87400 7.77800   1.000 36.60000  ? 125  ARG A NE    1 
ATOM   1004 C  CZ    . ARG A 1 137 ? 10.70400  -53.96400 8.50800   1.000 40.12000  ? 125  ARG A CZ    1 
ATOM   1005 N  NH1   . ARG A 1 137 ? 11.95900  -53.65400 8.22400   1.000 39.90000  ? 125  ARG A NH1   1 
ATOM   1006 N  NH2   . ARG A 1 137 ? 10.08300  -53.36300 9.52000   1.000 31.12000  ? 125  ARG A NH2   1 
ATOM   1007 N  N     . LYS A 1 138 ? 9.79900   -59.20100 2.37200   1.000 39.95000  ? 126  LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 138 ? 10.45700  -59.77900 1.19900   1.000 41.80000  ? 126  LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 138 ? 9.53600   -59.80500 -0.02200  1.000 39.78000  ? 126  LYS A C     1 
ATOM   1010 O  O     . LYS A 1 138 ? 9.98700   -59.52500 -1.13600  1.000 42.14000  ? 126  LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 138 ? 10.99300  -61.18700 1.49800   1.000 42.19000  ? 126  LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 138 ? 10.04100  -62.13700 2.19800   1.000 39.28000  ? 126  LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 138 ? 10.67600  -63.50900 2.26800   1.000 39.84000  ? 126  LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 138 ? 9.73900   -64.55100 2.84400   1.000 47.10000  ? 126  LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 138 ? 9.55400   -64.37200 4.31800   1.000 56.60000  ? 126  LYS A NZ    1 
ATOM   1016 N  N     . TYR A 1 139 ? 8.25200   -60.09400 0.18700   1.000 34.33000  ? 127  TYR A N     1 
ATOM   1017 C  CA    . TYR A 1 139 ? 7.30100   -60.10100 -0.93000  1.000 37.53000  ? 127  TYR A CA    1 
ATOM   1018 C  C     . TYR A 1 139 ? 7.11200   -58.74800 -1.60100  1.000 35.50000  ? 127  TYR A C     1 
ATOM   1019 O  O     . TYR A 1 139 ? 6.38500   -58.67500 -2.57900  1.000 36.59000  ? 127  TYR A O     1 
ATOM   1020 C  CB    . TYR A 1 139 ? 5.93200   -60.60700 -0.48900  1.000 31.19000  ? 127  TYR A CB    1 
ATOM   1021 C  CG    . TYR A 1 139 ? 5.97800   -61.88800 0.28600   1.000 35.55000  ? 127  TYR A CG    1 
ATOM   1022 C  CD1   . TYR A 1 139 ? 6.52400   -63.04000 -0.25700  1.000 38.88000  ? 127  TYR A CD1   1 
ATOM   1023 C  CD2   . TYR A 1 139 ? 5.46800   -61.94700 1.57500   1.000 38.99000  ? 127  TYR A CD2   1 
ATOM   1024 C  CE1   . TYR A 1 139 ? 6.56800   -64.21900 0.47900   1.000 44.51000  ? 127  TYR A CE1   1 
ATOM   1025 C  CE2   . TYR A 1 139 ? 5.49700   -63.11200 2.31100   1.000 42.12000  ? 127  TYR A CE2   1 
ATOM   1026 C  CZ    . TYR A 1 139 ? 6.04500   -64.24600 1.76800   1.000 44.92000  ? 127  TYR A CZ    1 
ATOM   1027 O  OH    . TYR A 1 139 ? 6.06000   -65.39200 2.53300   1.000 45.97000  ? 127  TYR A OH    1 
ATOM   1028 N  N     . THR A 1 140 ? 7.74800   -57.68400 -1.10200  1.000 35.97000  ? 128  THR A N     1 
ATOM   1029 C  CA    . THR A 1 140 ? 7.56600   -56.37100 -1.74400  1.000 39.23000  ? 128  THR A CA    1 
ATOM   1030 C  C     . THR A 1 140 ? 8.74800   -55.97900 -2.61600  1.000 41.39000  ? 128  THR A C     1 
ATOM   1031 O  O     . THR A 1 140 ? 8.91600   -54.79900 -2.96300  1.000 37.97000  ? 128  THR A O     1 
ATOM   1032 C  CB    . THR A 1 140 ? 7.34300   -55.23000 -0.72200  1.000 34.24000  ? 128  THR A CB    1 
ATOM   1033 O  OG1   . THR A 1 140 ? 8.57900   -54.93500 -0.04100  1.000 37.67000  ? 128  THR A OG1   1 
ATOM   1034 C  CG2   . THR A 1 140 ? 6.29800   -55.63300 0.27500   1.000 33.67000  ? 128  THR A CG2   1 
ATOM   1035 N  N     . ALA A 1 141 ? 9.57300   -56.96200 -2.96600  1.000 45.20000  ? 129  ALA A N     1 
ATOM   1036 C  CA    . ALA A 1 141 ? 10.76300  -56.69000 -3.75900  1.000 41.85000  ? 129  ALA A CA    1 
ATOM   1037 C  C     . ALA A 1 141 ? 10.36200  -55.97800 -5.03200  1.000 37.47000  ? 129  ALA A C     1 
ATOM   1038 O  O     . ALA A 1 141 ? 9.40000   -56.37400 -5.68800  1.000 37.39000  ? 129  ALA A O     1 
ATOM   1039 C  CB    . ALA A 1 141 ? 11.50500  -57.97200 -4.06500  1.000 44.26000  ? 129  ALA A CB    1 
ATOM   1040 N  N     . PHE A 1 142 ? 11.06400  -54.89100 -5.33700  1.000 38.14000  ? 130  PHE A N     1 
ATOM   1041 C  CA    . PHE A 1 142 ? 10.94700  -54.25300 -6.64400  1.000 41.10000  ? 130  PHE A CA    1 
ATOM   1042 C  C     . PHE A 1 142 ? 12.34500  -54.00500 -7.20000  1.000 48.32000  ? 130  PHE A C     1 
ATOM   1043 O  O     . PHE A 1 142 ? 13.33900  -54.34600 -6.55700  1.000 49.59000  ? 130  PHE A O     1 
ATOM   1044 C  CB    . PHE A 1 142 ? 10.12900  -52.95200 -6.58400  1.000 36.11000  ? 130  PHE A CB    1 
ATOM   1045 C  CG    . PHE A 1 142 ? 10.73700  -51.87000 -5.74700  1.000 32.78000  ? 130  PHE A CG    1 
ATOM   1046 C  CD1   . PHE A 1 142 ? 10.70500  -51.93600 -4.36600  1.000 32.85000  ? 130  PHE A CD1   1 
ATOM   1047 C  CD2   . PHE A 1 142 ? 11.30700  -50.75500 -6.34900  1.000 37.70000  ? 130  PHE A CD2   1 
ATOM   1048 C  CE1   . PHE A 1 142 ? 11.26500  -50.92800 -3.59700  1.000 36.17000  ? 130  PHE A CE1   1 
ATOM   1049 C  CE2   . PHE A 1 142 ? 11.86700  -49.73700 -5.58700  1.000 37.35000  ? 130  PHE A CE2   1 
ATOM   1050 C  CZ    . PHE A 1 142 ? 11.84600  -49.82200 -4.20300  1.000 32.88000  ? 130  PHE A CZ    1 
ATOM   1051 N  N     . THR A 1 143 ? 12.41000  -53.44700 -8.40600  1.000 52.57000  ? 131  THR A N     1 
ATOM   1052 C  CA    . THR A 1 143 ? 13.68200  -53.16500 -9.07200  1.000 50.76000  ? 131  THR A CA    1 
ATOM   1053 C  C     . THR A 1 143 ? 13.62700  -51.82700 -9.78000  1.000 51.18000  ? 131  THR A C     1 
ATOM   1054 O  O     . THR A 1 143 ? 12.77100  -51.62900 -10.63900 1.000 60.10000  ? 131  THR A O     1 
ATOM   1055 C  CB    . THR A 1 143 ? 14.02200  -54.24300 -10.11200 1.000 47.12000  ? 131  THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 143 ? 12.82900  -54.58100 -10.81800 1.000 63.99000  ? 131  THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 143 ? 14.49600  -55.47200 -9.44800  1.000 49.53000  ? 131  THR A CG2   1 
ATOM   1058 N  N     . ILE A 1 144 ? 14.52700  -50.91400 -9.42900  1.000 50.43000  ? 132  ILE A N     1 
ATOM   1059 C  CA    . ILE A 1 144 ? 14.67200  -49.67700 -10.19300 1.000 56.71000  ? 132  ILE A CA    1 
ATOM   1060 C  C     . ILE A 1 144 ? 15.69900  -49.85800 -11.30100 1.000 63.72000  ? 132  ILE A C     1 
ATOM   1061 O  O     . ILE A 1 144 ? 16.89200  -50.00800 -11.01700 1.000 70.12000  ? 132  ILE A O     1 
ATOM   1062 C  CB    . ILE A 1 144 ? 15.12600  -48.49100 -9.31800  1.000 60.35000  ? 132  ILE A CB    1 
ATOM   1063 C  CG1   . ILE A 1 144 ? 14.13700  -48.22900 -8.19000  1.000 58.84000  ? 132  ILE A CG1   1 
ATOM   1064 C  CG2   . ILE A 1 144 ? 15.29300  -47.21400 -10.16100 1.000 52.73000  ? 132  ILE A CG2   1 
ATOM   1065 C  CD1   . ILE A 1 144 ? 14.30600  -46.85800 -7.63500  1.000 57.52000  ? 132  ILE A CD1   1 
ATOM   1066 N  N     . PRO A 1 145 ? 15.24900  -49.85600 -12.56600 1.000 67.00000  ? 133  PRO A N     1 
ATOM   1067 C  CA    . PRO A 1 145 ? 16.19400  -49.91100 -13.69100 1.000 66.08000  ? 133  PRO A CA    1 
ATOM   1068 C  C     . PRO A 1 145 ? 16.80000  -48.53700 -13.93800 1.000 70.80000  ? 133  PRO A C     1 
ATOM   1069 O  O     . PRO A 1 145 ? 16.14700  -47.54600 -13.61000 1.000 72.96000  ? 133  PRO A O     1 
ATOM   1070 C  CB    . PRO A 1 145 ? 15.31600  -50.34900 -14.86400 1.000 66.90000  ? 133  PRO A CB    1 
ATOM   1071 C  CG    . PRO A 1 145 ? 13.96500  -49.80500 -14.52000 1.000 70.21000  ? 133  PRO A CG    1 
ATOM   1072 C  CD    . PRO A 1 145 ? 13.84400  -49.88100 -13.01700 1.000 65.88000  ? 133  PRO A CD    1 
ATOM   1073 N  N     . SER A 1 146 ? 18.01500  -48.46900 -14.48600 1.000 76.64000  ? 134  SER A N     1 
ATOM   1074 C  CA    . SER A 1 146 ? 18.62600  -47.17400 -14.81500 1.000 77.85000  ? 134  SER A CA    1 
ATOM   1075 C  C     . SER A 1 146 ? 19.05800  -47.15400 -16.27000 1.000 68.31000  ? 134  SER A C     1 
ATOM   1076 O  O     . SER A 1 146 ? 19.20300  -48.21100 -16.88200 1.000 76.58000  ? 134  SER A O     1 
ATOM   1077 C  CB    . SER A 1 146 ? 19.82600  -46.87100 -13.90100 1.000 81.27000  ? 134  SER A CB    1 
ATOM   1078 O  OG    . SER A 1 146 ? 20.26000  -45.52400 -14.04100 1.000 73.88000  ? 134  SER A OG    1 
ATOM   1079 N  N     . ILE A 1 154 ? 19.15700  -51.31900 -9.64300  1.000 49.26000  ? 142  ILE A N     1 
ATOM   1080 C  CA    . ILE A 1 154 ? 19.14800  -51.46700 -8.17800  1.000 55.34000  ? 142  ILE A CA    1 
ATOM   1081 C  C     . ILE A 1 154 ? 17.88200  -52.13800 -7.64200  1.000 52.86000  ? 142  ILE A C     1 
ATOM   1082 O  O     . ILE A 1 154 ? 16.77500  -51.71800 -7.97800  1.000 56.17000  ? 142  ILE A O     1 
ATOM   1083 C  CB    . ILE A 1 154 ? 19.28800  -50.11200 -7.47800  1.000 49.10000  ? 142  ILE A CB    1 
ATOM   1084 C  CG1   . ILE A 1 154 ? 20.36200  -49.26600 -8.16400  1.000 47.78000  ? 142  ILE A CG1   1 
ATOM   1085 C  CG2   . ILE A 1 154 ? 19.62700  -50.32700 -6.02000  1.000 50.15000  ? 142  ILE A CG2   1 
ATOM   1086 C  CD1   . ILE A 1 154 ? 21.12400  -48.36900 -7.21600  1.000 46.86000  ? 142  ILE A CD1   1 
ATOM   1087 N  N     . ARG A 1 155 ? 18.04500  -53.16700 -6.80500  1.000 52.33000  ? 143  ARG A N     1 
ATOM   1088 C  CA    . ARG A 1 155 ? 16.91000  -53.95500 -6.28000  1.000 46.72000  ? 143  ARG A CA    1 
ATOM   1089 C  C     . ARG A 1 155 ? 16.59500  -53.72000 -4.80000  1.000 46.15000  ? 143  ARG A C     1 
ATOM   1090 O  O     . ARG A 1 155 ? 17.34200  -54.15800 -3.93100  1.000 43.82000  ? 143  ARG A O     1 
ATOM   1091 C  CB    . ARG A 1 155 ? 17.16500  -55.45000 -6.45600  1.000 45.94000  ? 143  ARG A CB    1 
ATOM   1092 C  CG    . ARG A 1 155 ? 17.25700  -55.91700 -7.87100  1.000 47.31000  ? 143  ARG A CG    1 
ATOM   1093 C  CD    . ARG A 1 155 ? 16.42700  -57.17200 -8.09300  1.000 45.78000  ? 143  ARG A CD    1 
ATOM   1094 N  NE    . ARG A 1 155 ? 16.61400  -58.20000 -7.08200  1.000 52.46000  ? 143  ARG A NE    1 
ATOM   1095 C  CZ    . ARG A 1 155 ? 15.63900  -59.00700 -6.66800  1.000 61.90000  ? 143  ARG A CZ    1 
ATOM   1096 N  NH1   . ARG A 1 155 ? 14.41400  -58.87800 -7.17800  1.000 56.60000  ? 143  ARG A NH1   1 
ATOM   1097 N  NH2   . ARG A 1 155 ? 15.87900  -59.93300 -5.74200  1.000 56.97000  ? 143  ARG A NH2   1 
ATOM   1098 N  N     . TYR A 1 156 ? 15.46900  -53.07600 -4.50700  1.000 49.71000  ? 144  TYR A N     1 
ATOM   1099 C  CA    . TYR A 1 156 ? 15.09900  -52.80800 -3.12000  1.000 43.58000  ? 144  TYR A CA    1 
ATOM   1100 C  C     . TYR A 1 156 ? 13.90700  -53.62600 -2.63300  1.000 44.31000  ? 144  TYR A C     1 
ATOM   1101 O  O     . TYR A 1 156 ? 13.24600  -54.32200 -3.40800  1.000 44.59000  ? 144  TYR A O     1 
ATOM   1102 C  CB    . TYR A 1 156 ? 14.75400  -51.34500 -2.92900  1.000 38.19000  ? 144  TYR A CB    1 
ATOM   1103 C  CG    . TYR A 1 156 ? 15.80100  -50.33500 -3.31000  1.000 38.54000  ? 144  TYR A CG    1 
ATOM   1104 C  CD1   . TYR A 1 156 ? 16.83000  -50.00900 -2.43900  1.000 45.64000  ? 144  TYR A CD1   1 
ATOM   1105 C  CD2   . TYR A 1 156 ? 15.71200  -49.64500 -4.50800  1.000 42.63000  ? 144  TYR A CD2   1 
ATOM   1106 C  CE1   . TYR A 1 156 ? 17.76700  -49.04200 -2.76500  1.000 44.92000  ? 144  TYR A CE1   1 
ATOM   1107 C  CE2   . TYR A 1 156 ? 16.63700  -48.67400 -4.84300  1.000 48.50000  ? 144  TYR A CE2   1 
ATOM   1108 C  CZ    . TYR A 1 156 ? 17.66200  -48.37700 -3.96900  1.000 44.58000  ? 144  TYR A CZ    1 
ATOM   1109 O  OH    . TYR A 1 156 ? 18.58200  -47.41900 -4.30600  1.000 49.46000  ? 144  TYR A OH    1 
ATOM   1110 N  N     . GLN A 1 157 ? 13.63800  -53.51300 -1.33300  1.000 44.30000  ? 145  GLN A N     1 
ATOM   1111 C  CA    . GLN A 1 157 ? 12.41100  -54.02500 -0.73100  1.000 39.96000  ? 145  GLN A CA    1 
ATOM   1112 C  C     . GLN A 1 157 ? 11.89100  -53.02900 0.31100   1.000 40.81000  ? 145  GLN A C     1 
ATOM   1113 O  O     . GLN A 1 157 ? 12.67500  -52.23800 0.86900   1.000 38.67000  ? 145  GLN A O     1 
ATOM   1114 C  CB    . GLN A 1 157 ? 12.64500  -55.37600 -0.08500  1.000 41.52000  ? 145  GLN A CB    1 
ATOM   1115 C  CG    . GLN A 1 157 ? 13.07400  -55.27800 1.36000   1.000 39.26000  ? 145  GLN A CG    1 
ATOM   1116 C  CD    . GLN A 1 157 ? 13.24300  -56.64300 1.97900   1.000 43.85000  ? 145  GLN A CD    1 
ATOM   1117 O  OE1   . GLN A 1 157 ? 12.79000  -57.64800 1.42200   1.000 41.54000  ? 145  GLN A OE1   1 
ATOM   1118 N  NE2   . GLN A 1 157 ? 13.89400  -56.69400 3.13900   1.000 43.75000  ? 145  GLN A NE2   1 
ATOM   1119 N  N     . TYR A 1 158 ? 10.57500  -53.06200 0.57200   1.000 37.71000  ? 146  TYR A N     1 
ATOM   1120 C  CA    . TYR A 1 158 ? 9.96100   -52.07300 1.46500   1.000 33.14000  ? 146  TYR A CA    1 
ATOM   1121 C  C     . TYR A 1 158 ? 10.13000  -52.44900 2.94100   1.000 35.07000  ? 146  TYR A C     1 
ATOM   1122 O  O     . TYR A 1 158 ? 9.94800   -53.60700 3.32000   1.000 38.68000  ? 146  TYR A O     1 
ATOM   1123 C  CB    . TYR A 1 158 ? 8.47700   -51.89400 1.12800   1.000 30.74000  ? 146  TYR A CB    1 
ATOM   1124 C  CG    . TYR A 1 158 ? 8.20900   -50.80700 0.10200   1.000 32.60000  ? 146  TYR A CG    1 
ATOM   1125 C  CD1   . TYR A 1 158 ? 8.23700   -51.07900 -1.25800  1.000 33.50000  ? 146  TYR A CD1   1 
ATOM   1126 C  CD2   . TYR A 1 158 ? 7.93800   -49.50600 0.49400   1.000 34.44000  ? 146  TYR A CD2   1 
ATOM   1127 C  CE1   . TYR A 1 158 ? 8.00400   -50.08000 -2.19900  1.000 34.07000  ? 146  TYR A CE1   1 
ATOM   1128 C  CE2   . TYR A 1 158 ? 7.70600   -48.49900 -0.44000  1.000 33.44000  ? 146  TYR A CE2   1 
ATOM   1129 C  CZ    . TYR A 1 158 ? 7.74300   -48.79100 -1.79000  1.000 37.06000  ? 146  TYR A CZ    1 
ATOM   1130 O  OH    . TYR A 1 158 ? 7.50000   -47.79900 -2.71600  1.000 31.81000  ? 146  TYR A OH    1 
ATOM   1131 N  N     . ASN A 1 159 ? 10.50700  -51.47600 3.76400   1.000 32.89000  ? 147  ASN A N     1 
ATOM   1132 C  CA    . ASN A 1 159 ? 10.46400  -51.64800 5.22000   1.000 35.18000  ? 147  ASN A CA    1 
ATOM   1133 C  C     . ASN A 1 159 ? 9.24800   -50.95700 5.83100   1.000 32.61000  ? 147  ASN A C     1 
ATOM   1134 O  O     . ASN A 1 159 ? 8.98000   -51.10800 7.01500   1.000 35.96000  ? 147  ASN A O     1 
ATOM   1135 C  CB    . ASN A 1 159 ? 11.72400  -51.09400 5.87500   1.000 37.36000  ? 147  ASN A CB    1 
ATOM   1136 C  CG    . ASN A 1 159 ? 12.97100  -51.82500 5.44600   1.000 34.72000  ? 147  ASN A CG    1 
ATOM   1137 O  OD1   . ASN A 1 159 ? 13.00400  -53.05100 5.43100   1.000 34.62000  ? 147  ASN A OD1   1 
ATOM   1138 N  ND2   . ASN A 1 159 ? 14.01200  -51.07000 5.09700   1.000 32.79000  ? 147  ASN A ND2   1 
ATOM   1139 N  N     . VAL A 1 160 ? 8.53900   -50.19400 5.00500   1.000 30.88000  ? 148  VAL A N     1 
ATOM   1140 C  CA    . VAL A 1 160 ? 7.41200   -49.36200 5.42400   1.000 31.44000  ? 148  VAL A CA    1 
ATOM   1141 C  C     . VAL A 1 160 ? 6.23400   -49.70800 4.55400   1.000 28.26000  ? 148  VAL A C     1 
ATOM   1142 O  O     . VAL A 1 160 ? 6.38600   -50.53400 3.67800   1.000 34.38000  ? 148  VAL A O     1 
ATOM   1143 C  CB    . VAL A 1 160 ? 7.72000   -47.87400 5.25700   1.000 33.19000  ? 148  VAL A CB    1 
ATOM   1144 C  CG1   . VAL A 1 160 ? 8.84900   -47.46200 6.17200   1.000 29.92000  ? 148  VAL A CG1   1 
ATOM   1145 C  CG2   . VAL A 1 160 ? 8.07400   -47.60200 3.80400   1.000 30.76000  ? 148  VAL A CG2   1 
ATOM   1146 N  N     . LEU A 1 161 ? 5.08000   -49.07800 4.76000   1.000 23.50000  ? 149  LEU A N     1 
ATOM   1147 C  CA    . LEU A 1 161 ? 3.91900   -49.32800 3.89500   1.000 25.04000  ? 149  LEU A CA    1 
ATOM   1148 C  C     . LEU A 1 161 ? 4.08900   -48.73200 2.50300   1.000 28.11000  ? 149  LEU A C     1 
ATOM   1149 O  O     . LEU A 1 161 ? 4.38700   -47.54000 2.36100   1.000 30.62000  ? 149  LEU A O     1 
ATOM   1150 C  CB    . LEU A 1 161 ? 2.64200   -48.75400 4.48900   1.000 22.12000  ? 149  LEU A CB    1 
ATOM   1151 C  CG    . LEU A 1 161 ? 2.27900   -49.16500 5.90900   1.000 25.26000  ? 149  LEU A CG    1 
ATOM   1152 C  CD1   . LEU A 1 161 ? 1.12700   -48.28300 6.44700   1.000 23.92000  ? 149  LEU A CD1   1 
ATOM   1153 C  CD2   . LEU A 1 161 ? 1.91500   -50.62400 5.91900   1.000 20.14000  ? 149  LEU A CD2   1 
ATOM   1154 N  N     . PRO A 1 162 ? 3.87500   -49.55500 1.46900   1.000 25.21000  ? 150  PRO A N     1 
ATOM   1155 C  CA    . PRO A 1 162 ? 3.97900   -49.11200 0.07900   1.000 29.16000  ? 150  PRO A CA    1 
ATOM   1156 C  C     . PRO A 1 162 ? 2.62700   -48.71100 -0.52000  1.000 29.72000  ? 150  PRO A C     1 
ATOM   1157 O  O     . PRO A 1 162 ? 1.60000   -49.33100 -0.21200  1.000 27.09000  ? 150  PRO A O     1 
ATOM   1158 C  CB    . PRO A 1 162 ? 4.53000   -50.35700 -0.61700  1.000 32.22000  ? 150  PRO A CB    1 
ATOM   1159 C  CG    . PRO A 1 162 ? 3.86800   -51.47800 0.10400   1.000 28.79000  ? 150  PRO A CG    1 
ATOM   1160 C  CD    . PRO A 1 162 ? 3.69200   -51.01500 1.55000   1.000 26.91000  ? 150  PRO A CD    1 
ATOM   1161 N  N     . GLN A 1 163 ? 2.63800   -47.69400 -1.37700  1.000 34.27000  ? 151  GLN A N     1 
ATOM   1162 C  CA    . GLN A 1 163 ? 1.40800   -47.24500 -2.04400  1.000 31.92000  ? 151  GLN A CA    1 
ATOM   1163 C  C     . GLN A 1 163 ? 1.11300   -48.10000 -3.24700  1.000 30.99000  ? 151  GLN A C     1 
ATOM   1164 O  O     . GLN A 1 163 ? 1.79100   -47.98700 -4.25100  1.000 39.97000  ? 151  GLN A O     1 
ATOM   1165 C  CB    . GLN A 1 163 ? 1.53000   -45.78600 -2.45000  1.000 27.66000  ? 151  GLN A CB    1 
ATOM   1166 C  CG    . GLN A 1 163 ? 1.72900   -44.88500 -1.24600  1.000 28.48000  ? 151  GLN A CG    1 
ATOM   1167 C  CD    . GLN A 1 163 ? 2.00700   -43.46500 -1.62900  1.000 33.33000  ? 151  GLN A CD    1 
ATOM   1168 O  OE1   . GLN A 1 163 ? 1.13700   -42.75900 -2.14300  1.000 36.20000  ? 151  GLN A OE1   1 
ATOM   1169 N  NE2   . GLN A 1 163 ? 3.23800   -43.02400 -1.38200  1.000 39.18000  ? 151  GLN A NE2   1 
ATOM   1170 N  N     . GLY A 1 164 ? 0.11900   -48.97300 -3.13900  1.000 31.79000  ? 152  GLY A N     1 
ATOM   1171 C  CA    . GLY A 1 164 ? -0.21900  -49.87600 -4.23400  1.000 32.94000  ? 152  GLY A CA    1 
ATOM   1172 C  C     . GLY A 1 164 ? -0.69000  -51.23200 -3.71100  1.000 38.11000  ? 152  GLY A C     1 
ATOM   1173 O  O     . GLY A 1 164 ? -1.34900  -52.01200 -4.41900  1.000 40.02000  ? 152  GLY A O     1 
ATOM   1174 N  N     . TRP A 1 165 ? -0.34200  -51.51100 -2.45700  1.000 29.92000  ? 153  TRP A N     1 
ATOM   1175 C  CA    . TRP A 1 165 ? -0.71100  -52.75200 -1.78800  1.000 32.36000  ? 153  TRP A CA    1 
ATOM   1176 C  C     . TRP A 1 165 ? -2.09100  -52.58700 -1.11900  1.000 32.01000  ? 153  TRP A C     1 
ATOM   1177 O  O     . TRP A 1 165 ? -2.40800  -51.49800 -0.64700  1.000 28.69000  ? 153  TRP A O     1 
ATOM   1178 C  CB    . TRP A 1 165 ? 0.38600   -53.10200 -0.77700  1.000 28.32000  ? 153  TRP A CB    1 
ATOM   1179 C  CG    . TRP A 1 165 ? 0.17200   -54.31700 0.04900   1.000 26.15000  ? 153  TRP A CG    1 
ATOM   1180 C  CD1   . TRP A 1 165 ? -0.16900  -55.56600 -0.39000  1.000 29.55000  ? 153  TRP A CD1   1 
ATOM   1181 C  CD2   . TRP A 1 165 ? 0.32400   -54.41400 1.46400   1.000 27.27000  ? 153  TRP A CD2   1 
ATOM   1182 N  NE1   . TRP A 1 165 ? -0.25800  -56.42900 0.67100   1.000 29.66000  ? 153  TRP A NE1   1 
ATOM   1183 C  CE2   . TRP A 1 165 ? 0.04100   -55.74500 1.82300   1.000 30.37000  ? 153  TRP A CE2   1 
ATOM   1184 C  CE3   . TRP A 1 165 ? 0.65600   -53.49900 2.47000   1.000 29.01000  ? 153  TRP A CE3   1 
ATOM   1185 C  CZ2   . TRP A 1 165 ? 0.08200   -56.18800 3.15200   1.000 32.08000  ? 153  TRP A CZ2   1 
ATOM   1186 C  CZ3   . TRP A 1 165 ? 0.70100   -53.93700 3.78100   1.000 26.18000  ? 153  TRP A CZ3   1 
ATOM   1187 C  CH2   . TRP A 1 165 ? 0.41400   -55.26900 4.11100   1.000 30.98000  ? 153  TRP A CH2   1 
ATOM   1188 N  N     . LYS A 1 166 ? -2.90700  -53.64600 -1.08400  1.000 29.09000  ? 154  LYS A N     1 
ATOM   1189 C  CA    . LYS A 1 166 ? -4.25100  -53.53300 -0.51100  1.000 29.58000  ? 154  LYS A CA    1 
ATOM   1190 C  C     . LYS A 1 166 ? -4.29300  -53.52800 1.03000   1.000 31.22000  ? 154  LYS A C     1 
ATOM   1191 O  O     . LYS A 1 166 ? -5.34300  -53.27400 1.60600   1.000 33.14000  ? 154  LYS A O     1 
ATOM   1192 C  CB    . LYS A 1 166 ? -5.16200  -54.65700 -1.02600  1.000 28.30000  ? 154  LYS A CB    1 
ATOM   1193 C  CG    . LYS A 1 166 ? -5.07800  -55.95700 -0.24200  1.000 31.17000  ? 154  LYS A CG    1 
ATOM   1194 C  CD    . LYS A 1 166 ? -6.24400  -56.88600 -0.55300  1.000 29.55000  ? 154  LYS A CD    1 
ATOM   1195 C  CE    . LYS A 1 166 ? -5.97100  -58.32000 -0.08100  1.000 32.72000  ? 154  LYS A CE    1 
ATOM   1196 N  NZ    . LYS A 1 166 ? -7.15700  -59.24100 -0.21800  1.000 35.90000  ? 154  LYS A NZ    1 
ATOM   1197 N  N     . GLY A 1 167 ? -3.17700  -53.80200 1.70000   1.000 30.28000  ? 155  GLY A N     1 
ATOM   1198 C  CA    . GLY A 1 167 ? -3.15700  -53.75300 3.15600   1.000 24.83000  ? 155  GLY A CA    1 
ATOM   1199 C  C     . GLY A 1 167 ? -2.90100  -52.35100 3.68500   1.000 26.06000  ? 155  GLY A C     1 
ATOM   1200 O  O     . GLY A 1 167 ? -3.12400  -52.05100 4.84500   1.000 25.67000  ? 155  GLY A O     1 
ATOM   1201 N  N     . SER A 1 168 ? -2.46500  -51.46200 2.80800   1.000 28.44000  ? 156  SER A N     1 
ATOM   1202 C  CA    . SER A 1 168 ? -1.89500  -50.20800 3.25400   1.000 24.11000  ? 156  SER A CA    1 
ATOM   1203 C  C     . SER A 1 168 ? -2.92500  -49.23900 3.81500   1.000 24.51000  ? 156  SER A C     1 
ATOM   1204 O  O     . SER A 1 168 ? -2.66200  -48.59400 4.81600   1.000 27.88000  ? 156  SER A O     1 
ATOM   1205 C  CB    . SER A 1 168 ? -1.13200  -49.54500 2.10800   1.000 28.61000  ? 156  SER A CB    1 
ATOM   1206 O  OG    . SER A 1 168 ? 0.06300   -50.25700 1.82200   1.000 28.03000  ? 156  SER A OG    1 
ATOM   1207 N  N     . PRO A 1 169 ? -4.08500  -49.10900 3.16300   1.000 28.83000  ? 157  PRO A N     1 
ATOM   1208 C  CA    . PRO A 1 169 ? -5.01200  -48.12600 3.72600   1.000 24.72000  ? 157  PRO A CA    1 
ATOM   1209 C  C     . PRO A 1 169 ? -5.51100  -48.51600 5.10600   1.000 23.56000  ? 157  PRO A C     1 
ATOM   1210 O  O     . PRO A 1 169 ? -5.50500  -47.65000 5.97700   1.000 27.60000  ? 157  PRO A O     1 
ATOM   1211 C  CB    . PRO A 1 169 ? -6.16000  -48.10500 2.70900   1.000 21.07000  ? 157  PRO A CB    1 
ATOM   1212 C  CG    . PRO A 1 169 ? -5.50600  -48.42000 1.44600   1.000 25.44000  ? 157  PRO A CG    1 
ATOM   1213 C  CD    . PRO A 1 169 ? -4.46100  -49.47500 1.78700   1.000 30.03000  ? 157  PRO A CD    1 
ATOM   1214 N  N     . ALA A 1 170 ? -5.91000  -49.76500 5.32100   1.000 24.73000  ? 158  ALA A N     1 
ATOM   1215 C  CA    . ALA A 1 170 ? -6.49400  -50.11600 6.62400   1.000 24.72000  ? 158  ALA A CA    1 
ATOM   1216 C  C     . ALA A 1 170 ? -5.43100  -50.13500 7.71600   1.000 23.89000  ? 158  ALA A C     1 
ATOM   1217 O  O     . ALA A 1 170 ? -5.68600  -49.71100 8.84300   1.000 19.53000  ? 158  ALA A O     1 
ATOM   1218 C  CB    . ALA A 1 170 ? -7.20900  -51.46200 6.55600   1.000 22.74000  ? 158  ALA A CB    1 
ATOM   1219 N  N     . ILE A 1 171 ? -4.23800  -50.62400 7.37200   1.000 25.36000  ? 159  ILE A N     1 
ATOM   1220 C  CA    . ILE A 1 171 ? -3.15100  -50.61800 8.33000   1.000 22.58000  ? 159  ILE A CA    1 
ATOM   1221 C  C     . ILE A 1 171 ? -2.77000  -49.20500 8.72700   1.000 24.51000  ? 159  ILE A C     1 
ATOM   1222 O  O     . ILE A 1 171 ? -2.43200  -48.96100 9.89100   1.000 27.22000  ? 159  ILE A O     1 
ATOM   1223 C  CB    . ILE A 1 171 ? -1.91700  -51.31100 7.81100   1.000 21.99000  ? 159  ILE A CB    1 
ATOM   1224 C  CG1   . ILE A 1 171 ? -2.16600  -52.81600 7.74800   1.000 21.41000  ? 159  ILE A CG1   1 
ATOM   1225 C  CG2   . ILE A 1 171 ? -0.73000  -51.02100 8.74100   1.000 20.73000  ? 159  ILE A CG2   1 
ATOM   1226 C  CD1   . ILE A 1 171 ? -0.98500  -53.56900 7.19300   1.000 21.21000  ? 159  ILE A CD1   1 
ATOM   1227 N  N     . PHE A 1 172 ? -2.82100  -48.27600 7.77700   1.000 21.68000  ? 160  PHE A N     1 
ATOM   1228 C  CA    . PHE A 1 172 ? -2.53000  -46.88700 8.12500   1.000 22.44000  ? 160  PHE A CA    1 
ATOM   1229 C  C     . PHE A 1 172 ? -3.65700  -46.29200 8.95400   1.000 21.56000  ? 160  PHE A C     1 
ATOM   1230 O  O     . PHE A 1 172 ? -3.42000  -45.65800 9.96400   1.000 20.32000  ? 160  PHE A O     1 
ATOM   1231 C  CB    . PHE A 1 172 ? -2.30600  -46.01200 6.88700   1.000 20.88000  ? 160  PHE A CB    1 
ATOM   1232 C  CG    . PHE A 1 172 ? -1.90500  -44.61500 7.23400   1.000 20.25000  ? 160  PHE A CG    1 
ATOM   1233 C  CD1   . PHE A 1 172 ? -0.58900  -44.33000 7.58400   1.000 20.09000  ? 160  PHE A CD1   1 
ATOM   1234 C  CD2   . PHE A 1 172 ? -2.84400  -43.59900 7.28000   1.000 19.69000  ? 160  PHE A CD2   1 
ATOM   1235 C  CE1   . PHE A 1 172 ? -0.21000  -43.05600 7.92800   1.000 19.79000  ? 160  PHE A CE1   1 
ATOM   1236 C  CE2   . PHE A 1 172 ? -2.47800  -42.31200 7.64700   1.000 20.34000  ? 160  PHE A CE2   1 
ATOM   1237 C  CZ    . PHE A 1 172 ? -1.15500  -42.03900 7.96400   1.000 22.10000  ? 160  PHE A CZ    1 
ATOM   1238 N  N     . GLN A 1 173 ? -4.88500  -46.50200 8.50900   1.000 21.87000  ? 161  GLN A N     1 
ATOM   1239 C  CA    . GLN A 1 173 ? -6.02500  -45.93800 9.20900   1.000 23.24000  ? 161  GLN A CA    1 
ATOM   1240 C  C     . GLN A 1 173 ? -6.11800  -46.47700 10.63200  1.000 22.37000  ? 161  GLN A C     1 
ATOM   1241 O  O     . GLN A 1 173 ? -6.46000  -45.74400 11.55300  1.000 25.55000  ? 161  GLN A O     1 
ATOM   1242 C  CB    . GLN A 1 173 ? -7.31300  -46.21800 8.44700   1.000 21.16000  ? 161  GLN A CB    1 
ATOM   1243 C  CG    . GLN A 1 173 ? -7.41600  -45.38900 7.18200   1.000 19.90000  ? 161  GLN A CG    1 
ATOM   1244 C  CD    . GLN A 1 173 ? -8.29600  -46.03900 6.16600   1.000 25.91000  ? 161  GLN A CD    1 
ATOM   1245 O  OE1   . GLN A 1 173 ? -8.36600  -45.60100 5.02600   1.000 28.13000  ? 161  GLN A OE1   1 
ATOM   1246 N  NE2   . GLN A 1 173 ? -8.96200  -47.12700 6.56900   1.000 25.39000  ? 161  GLN A NE2   1 
ATOM   1247 N  N     . SER A 1 174 ? -5.78300  -47.74000 10.82800  1.000 20.79000  ? 162  SER A N     1 
ATOM   1248 C  CA    . SER A 1 174 ? -5.84500  -48.26100 12.17000  1.000 20.51000  ? 162  SER A CA    1 
ATOM   1249 C  C     . SER A 1 174 ? -4.67000  -47.73200 12.97200  1.000 22.42000  ? 162  SER A C     1 
ATOM   1250 O  O     . SER A 1 174 ? -4.82000  -47.31100 14.11100  1.000 23.50000  ? 162  SER A O     1 
ATOM   1251 C  CB    . SER A 1 174 ? -5.84100  -49.78000 12.18000  1.000 22.59000  ? 162  SER A CB    1 
ATOM   1252 O  OG    . SER A 1 174 ? -6.05600  -50.22900 13.50100  1.000 34.24000  ? 162  SER A OG    1 
ATOM   1253 N  N     . SER A 1 175 ? -3.49500  -47.74500 12.36900  1.000 24.43000  ? 163  SER A N     1 
ATOM   1254 C  CA    . SER A 1 175 ? -2.31800  -47.25300 13.06900  1.000 26.17000  ? 163  SER A CA    1 
ATOM   1255 C  C     . SER A 1 175 ? -2.52900  -45.84800 13.59000  1.000 23.94000  ? 163  SER A C     1 
ATOM   1256 O  O     . SER A 1 175 ? -2.30000  -45.58600 14.77100  1.000 23.33000  ? 163  SER A O     1 
ATOM   1257 C  CB    . SER A 1 175 ? -1.10300  -47.29500 12.15700  1.000 25.76000  ? 163  SER A CB    1 
ATOM   1258 O  OG    . SER A 1 175 ? -0.65700  -48.63400 12.07000  1.000 31.85000  ? 163  SER A OG    1 
ATOM   1259 N  N     . MET A 1 176 ? -2.99900  -44.97100 12.70500  1.000 26.21000  ? 164  MET A N     1 
ATOM   1260 C  CA    . MET A 1 176 ? -3.31500  -43.58600 13.02800  1.000 21.91000  ? 164  MET A CA    1 
ATOM   1261 C  C     . MET A 1 176 ? -4.30900  -43.49600 14.18300  1.000 24.82000  ? 164  MET A C     1 
ATOM   1262 O  O     . MET A 1 176 ? -4.11600  -42.69800 15.09600  1.000 25.80000  ? 164  MET A O     1 
ATOM   1263 C  CB    . MET A 1 176 ? -3.86600  -42.86800 11.80300  1.000 20.33000  ? 164  MET A CB    1 
ATOM   1264 C  CG    . MET A 1 176 ? -4.26200  -41.42400 12.04300  1.000 25.25000  ? 164  MET A CG    1 
ATOM   1265 S  SD    . MET A 1 176 ? -2.85000  -40.32700 12.32300  1.000 29.69000  ? 164  MET A SD    1 
ATOM   1266 C  CE    . MET A 1 176 ? -2.34800  -40.09400 10.64100  1.000 28.70000  ? 164  MET A CE    1 
ATOM   1267 N  N     . THR A 1 177 ? -5.35800  -44.32100 14.15900  1.000 23.49000  ? 165  THR A N     1 
ATOM   1268 C  CA    . THR A 1 177 ? -6.33700  -44.31000 15.24200  1.000 20.63000  ? 165  THR A CA    1 
ATOM   1269 C  C     . THR A 1 177 ? -5.67700  -44.67900 16.58200  1.000 21.95000  ? 165  THR A C     1 
ATOM   1270 O  O     . THR A 1 177 ? -5.96700  -44.02400 17.58600  1.000 24.02000  ? 165  THR A O     1 
ATOM   1271 C  CB    . THR A 1 177 ? -7.55000  -45.24300 14.91800  1.000 20.66000  ? 165  THR A CB    1 
ATOM   1272 O  OG1   . THR A 1 177 ? -8.13300  -44.81800 13.68400  1.000 23.76000  ? 165  THR A OG1   1 
ATOM   1273 C  CG2   . THR A 1 177 ? -8.62900  -45.17400 15.97800  1.000 11.83000  ? 165  THR A CG2   1 
ATOM   1274 N  N     . LYS A 1 178 ? -4.79100  -45.68800 16.61300  1.000 24.51000  ? 166  LYS A N     1 
ATOM   1275 C  CA    . LYS A 1 178 ? -4.02900  -45.99800 17.84700  1.000 23.08000  ? 166  LYS A CA    1 
ATOM   1276 C  C     . LYS A 1 178 ? -3.31300  -44.75300 18.37500  1.000 26.55000  ? 166  LYS A C     1 
ATOM   1277 O  O     . LYS A 1 178 ? -3.47800  -44.35600 19.52800  1.000 30.96000  ? 166  LYS A O     1 
ATOM   1278 C  CB    . LYS A 1 178 ? -2.95700  -47.07900 17.63700  1.000 22.96000  ? 166  LYS A CB    1 
ATOM   1279 C  CG    . LYS A 1 178 ? -3.41400  -48.37500 17.06600  1.000 31.44000  ? 166  LYS A CG    1 
ATOM   1280 C  CD    . LYS A 1 178 ? -3.99900  -49.32200 18.07700  1.000 43.70000  ? 166  LYS A CD    1 
ATOM   1281 C  CE    . LYS A 1 178 ? -4.49800  -50.60700 17.38600  1.000 48.33000  ? 166  LYS A CE    1 
ATOM   1282 N  NZ    . LYS A 1 178 ? -4.99800  -51.64200 18.36500  1.000 46.16000  ? 166  LYS A NZ    1 
ATOM   1283 N  N     . ILE A 1 179 ? -2.50600  -44.16100 17.50200  1.000 25.20000  ? 167  ILE A N     1 
ATOM   1284 C  CA    . ILE A 1 179 ? -1.69400  -43.01400 17.84300  1.000 20.86000  ? 167  ILE A CA    1 
ATOM   1285 C  C     . ILE A 1 179 ? -2.49900  -41.82800 18.39200  1.000 21.41000  ? 167  ILE A C     1 
ATOM   1286 O  O     . ILE A 1 179 ? -1.97800  -41.01400 19.14500  1.000 23.06000  ? 167  ILE A O     1 
ATOM   1287 C  CB    . ILE A 1 179 ? -0.89800  -42.56800 16.61000  1.000 19.68000  ? 167  ILE A CB    1 
ATOM   1288 C  CG1   . ILE A 1 179 ? 0.19700   -43.58600 16.29800  1.000 18.00000  ? 167  ILE A CG1   1 
ATOM   1289 C  CG2   . ILE A 1 179 ? -0.30900  -41.18300 16.82600  1.000 24.41000  ? 167  ILE A CG2   1 
ATOM   1290 C  CD1   . ILE A 1 179 ? 0.86300   -43.37700 14.97900  1.000 16.92000  ? 167  ILE A CD1   1 
ATOM   1291 N  N     . LEU A 1 180 ? -3.76700  -41.72600 18.02700  1.000 20.44000  ? 168  LEU A N     1 
ATOM   1292 C  CA    . LEU A 1 180 ? -4.53300  -40.55000 18.42900  1.000 23.82000  ? 168  LEU A CA    1 
ATOM   1293 C  C     . LEU A 1 180 ? -5.41000  -40.81800 19.64700  1.000 24.30000  ? 168  LEU A C     1 
ATOM   1294 O  O     . LEU A 1 180 ? -5.90100  -39.88200 20.26900  1.000 26.85000  ? 168  LEU A O     1 
ATOM   1295 C  CB    . LEU A 1 180 ? -5.40800  -40.02800 17.27000  1.000 18.09000  ? 168  LEU A CB    1 
ATOM   1296 C  CG    . LEU A 1 180 ? -4.70500  -39.29500 16.13500  1.000 15.35000  ? 168  LEU A CG    1 
ATOM   1297 C  CD1   . LEU A 1 180 ? -5.63600  -39.16400 14.99400  1.000 16.56000  ? 168  LEU A CD1   1 
ATOM   1298 C  CD2   . LEU A 1 180 ? -4.26400  -37.92700 16.56200  1.000 13.87000  ? 168  LEU A CD2   1 
ATOM   1299 N  N     . GLU A 1 181 ? -5.61200  -42.08700 19.99400  1.000 26.61000  ? 169  GLU A N     1 
ATOM   1300 C  CA    . GLU A 1 181 ? -6.47500  -42.39900 21.12700  1.000 28.73000  ? 169  GLU A CA    1 
ATOM   1301 C  C     . GLU A 1 181 ? -6.04600  -41.68800 22.42100  1.000 31.65000  ? 169  GLU A C     1 
ATOM   1302 O  O     . GLU A 1 181 ? -6.86400  -41.04000 23.07900  1.000 33.61000  ? 169  GLU A O     1 
ATOM   1303 C  CB    . GLU A 1 181 ? -6.52900  -43.89300 21.36900  1.000 27.45000  ? 169  GLU A CB    1 
ATOM   1304 C  CG    . GLU A 1 181 ? -7.55700  -44.26200 22.42300  1.000 38.68000  ? 169  GLU A CG    1 
ATOM   1305 C  CD    . GLU A 1 181 ? -6.91300  -44.70800 23.72900  1.000 47.50000  ? 169  GLU A CD    1 
ATOM   1306 O  OE1   . GLU A 1 181 ? -7.66400  -45.03900 24.67600  1.000 53.60000  ? 169  GLU A OE1   1 
ATOM   1307 O  OE2   . GLU A 1 181 ? -5.66100  -44.73700 23.80900  1.000 44.87000  ? 169  GLU A OE2   1 
ATOM   1308 N  N     . PRO A 1 182 ? -4.76200  -41.81500 22.78800  1.000 27.43000  ? 170  PRO A N     1 
ATOM   1309 C  CA    . PRO A 1 182 ? -4.20400  -41.08100 23.92400  1.000 23.68000  ? 170  PRO A CA    1 
ATOM   1310 C  C     . PRO A 1 182 ? -4.54500  -39.59800 23.91900  1.000 28.75000  ? 170  PRO A C     1 
ATOM   1311 O  O     . PRO A 1 182 ? -4.95400  -39.07300 24.95000  1.000 34.54000  ? 170  PRO A O     1 
ATOM   1312 C  CB    . PRO A 1 182 ? -2.71100  -41.28000 23.74400  1.000 20.46000  ? 170  PRO A CB    1 
ATOM   1313 C  CG    . PRO A 1 182 ? -2.60700  -42.59800 23.17200  1.000 23.85000  ? 170  PRO A CG    1 
ATOM   1314 C  CD    . PRO A 1 182 ? -3.78500  -42.76900 22.24500  1.000 27.14000  ? 170  PRO A CD    1 
ATOM   1315 N  N     . PHE A 1 183 ? -4.37900  -38.92600 22.78600  1.000 28.74000  ? 171  PHE A N     1 
ATOM   1316 C  CA    . PHE A 1 183 ? -4.63600  -37.49100 22.73300  1.000 24.75000  ? 171  PHE A CA    1 
ATOM   1317 C  C     . PHE A 1 183 ? -6.12800  -37.20500 22.77900  1.000 26.48000  ? 171  PHE A C     1 
ATOM   1318 O  O     . PHE A 1 183 ? -6.56400  -36.20800 23.36300  1.000 27.36000  ? 171  PHE A O     1 
ATOM   1319 C  CB    . PHE A 1 183 ? -4.02200  -36.90900 21.48300  1.000 22.39000  ? 171  PHE A CB    1 
ATOM   1320 C  CG    . PHE A 1 183 ? -4.21500  -35.43800 21.32700  1.000 23.76000  ? 171  PHE A CG    1 
ATOM   1321 C  CD1   . PHE A 1 183 ? -5.37200  -34.93400 20.77600  1.000 21.39000  ? 171  PHE A CD1   1 
ATOM   1322 C  CD2   . PHE A 1 183 ? -3.19700  -34.55500 21.65500  1.000 23.08000  ? 171  PHE A CD2   1 
ATOM   1323 C  CE1   . PHE A 1 183 ? -5.52200  -33.57500 20.59800  1.000 21.55000  ? 171  PHE A CE1   1 
ATOM   1324 C  CE2   . PHE A 1 183 ? -3.35100  -33.20700 21.45700  1.000 23.65000  ? 171  PHE A CE2   1 
ATOM   1325 C  CZ    . PHE A 1 183 ? -4.50600  -32.71700 20.93800  1.000 21.22000  ? 171  PHE A CZ    1 
ATOM   1326 N  N     . ARG A 1 184 ? -6.90400  -38.09100 22.16300  1.000 22.88000  ? 172  ARG A N     1 
ATOM   1327 C  CA    . ARG A 1 184 ? -8.34400  -37.93800 22.17900  1.000 22.17000  ? 172  ARG A CA    1 
ATOM   1328 C  C     . ARG A 1 184 ? -8.86300  -38.06300 23.59600  1.000 25.07000  ? 172  ARG A C     1 
ATOM   1329 O  O     . ARG A 1 184 ? -9.62300  -37.22400 24.06400  1.000 28.73000  ? 172  ARG A O     1 
ATOM   1330 C  CB    . ARG A 1 184 ? -9.00500  -38.96600 21.27600  1.000 20.50000  ? 172  ARG A CB    1 
ATOM   1331 C  CG    . ARG A 1 184 ? -9.47200  -38.39600 19.96800  1.000 17.47000  ? 172  ARG A CG    1 
ATOM   1332 C  CD    . ARG A 1 184 ? -9.70900  -39.45800 18.95500  1.000 15.20000  ? 172  ARG A CD    1 
ATOM   1333 N  NE    . ARG A 1 184 ? -10.00300 -38.89800 17.63800  1.000 22.78000  ? 172  ARG A NE    1 
ATOM   1334 C  CZ    . ARG A 1 184 ? -9.51800  -39.39800 16.50400  1.000 20.76000  ? 172  ARG A CZ    1 
ATOM   1335 N  NH1   . ARG A 1 184 ? -8.71500  -40.44800 16.52100  1.000 24.81000  ? 172  ARG A NH1   1 
ATOM   1336 N  NH2   . ARG A 1 184 ? -9.83000  -38.85800 15.34500  1.000 22.22000  ? 172  ARG A NH2   1 
ATOM   1337 N  N     . LYS A 1 185 ? -8.42400  -39.10200 24.28900  1.000 28.48000  ? 173  LYS A N     1 
ATOM   1338 C  CA    . LYS A 1 185 ? -8.85800  -39.32700 25.65500  1.000 29.20000  ? 173  LYS A CA    1 
ATOM   1339 C  C     . LYS A 1 185 ? -8.40800  -38.18200 26.58800  1.000 29.05000  ? 173  LYS A C     1 
ATOM   1340 O  O     . LYS A 1 185 ? -9.15200  -37.74000 27.46000  1.000 27.07000  ? 173  LYS A O     1 
ATOM   1341 C  CB    . LYS A 1 185 ? -8.33200  -40.66400 26.14700  1.000 30.34000  ? 173  LYS A CB    1 
ATOM   1342 C  CG    . LYS A 1 185 ? -9.42800  -41.54800 26.68600  1.000 41.80000  ? 173  LYS A CG    1 
ATOM   1343 C  CD    . LYS A 1 185 ? -9.32200  -42.99200 26.19800  1.000 46.31000  ? 173  LYS A CD    1 
ATOM   1344 C  CE    . LYS A 1 185 ? -10.64700 -43.72800 26.44900  1.000 51.31000  ? 173  LYS A CE    1 
ATOM   1345 N  NZ    . LYS A 1 185 ? -11.28800 -43.29900 27.75500  1.000 44.48000  ? 173  LYS A NZ    1 
ATOM   1346 N  N     . GLN A 1 186 ? -7.20800  -37.66500 26.35900  1.000 27.40000  ? 174  GLN A N     1 
ATOM   1347 C  CA    . GLN A 1 186 ? -6.70300  -36.57400 27.17100  1.000 25.41000  ? 174  GLN A CA    1 
ATOM   1348 C  C     . GLN A 1 186 ? -7.43900  -35.27900 26.86900  1.000 26.35000  ? 174  GLN A C     1 
ATOM   1349 O  O     . GLN A 1 186 ? -7.52300  -34.40400 27.71600  1.000 26.17000  ? 174  GLN A O     1 
ATOM   1350 C  CB    . GLN A 1 186 ? -5.20300  -36.38900 26.94400  1.000 27.38000  ? 174  GLN A CB    1 
ATOM   1351 C  CG    . GLN A 1 186 ? -4.54700  -35.50300 27.97200  1.000 28.68000  ? 174  GLN A CG    1 
ATOM   1352 C  CD    . GLN A 1 186 ? -3.04900  -35.35300 27.75700  1.000 39.37000  ? 174  GLN A CD    1 
ATOM   1353 O  OE1   . GLN A 1 186 ? -2.38200  -36.28000 27.26600  1.000 44.13000  ? 174  GLN A OE1   1 
ATOM   1354 N  NE2   . GLN A 1 186 ? -2.50300  -34.18200 28.13000  1.000 34.37000  ? 174  GLN A NE2   1 
ATOM   1355 N  N     . ASN A 1 187 ? -7.99300  -35.17600 25.66800  1.000 27.08000  ? 175  ASN A N     1 
ATOM   1356 C  CA    . ASN A 1 187 ? -8.55900  -33.93200 25.18000  1.000 22.95000  ? 175  ASN A CA    1 
ATOM   1357 C  C     . ASN A 1 187 ? -9.90300  -34.13700 24.47600  1.000 26.40000  ? 175  ASN A C     1 
ATOM   1358 O  O     . ASN A 1 187 ? -10.08000 -33.76900 23.31200  1.000 27.33000  ? 175  ASN A O     1 
ATOM   1359 C  CB    . ASN A 1 187 ? -7.56400  -33.26000 24.23400  1.000 21.43000  ? 175  ASN A CB    1 
ATOM   1360 C  CG    . ASN A 1 187 ? -6.33900  -32.75600 24.95400  1.000 26.25000  ? 175  ASN A CG    1 
ATOM   1361 O  OD1   . ASN A 1 187 ? -6.39400  -31.72600 25.61000  1.000 31.63000  ? 175  ASN A OD1   1 
ATOM   1362 N  ND2   . ASN A 1 187 ? -5.21800  -33.47100 24.83300  1.000 30.71000  ? 175  ASN A ND2   1 
ATOM   1363 N  N     . PRO A 1 188 ? -10.87300 -34.70800 25.18800  1.000 27.99000  ? 176  PRO A N     1 
ATOM   1364 C  CA    . PRO A 1 188 ? -12.14800 -35.14200 24.60400  1.000 24.59000  ? 176  PRO A CA    1 
ATOM   1365 C  C     . PRO A 1 188 ? -12.96600 -34.04100 23.96000  1.000 30.39000  ? 176  PRO A C     1 
ATOM   1366 O  O     . PRO A 1 188 ? -13.95200 -34.36700 23.30500  1.000 33.65000  ? 176  PRO A O     1 
ATOM   1367 C  CB    . PRO A 1 188 ? -12.90000 -35.69300 25.80800  1.000 23.74000  ? 176  PRO A CB    1 
ATOM   1368 C  CG    . PRO A 1 188 ? -12.34600 -34.95800 26.94200  1.000 26.22000  ? 176  PRO A CG    1 
ATOM   1369 C  CD    . PRO A 1 188 ? -10.88400 -34.84200 26.65000  1.000 32.82000  ? 176  PRO A CD    1 
ATOM   1370 N  N     . ASP A 1 189 ? -12.59600 -32.77900 24.13700  1.000 31.24000  ? 177  ASP A N     1 
ATOM   1371 C  CA    . ASP A 1 189 ? -13.41500 -31.71900 23.56400  1.000 25.14000  ? 177  ASP A CA    1 
ATOM   1372 C  C     . ASP A 1 189 ? -12.73500 -31.00000 22.40200  1.000 27.42000  ? 177  ASP A C     1 
ATOM   1373 O  O     . ASP A 1 189 ? -13.29600 -30.08200 21.82700  1.000 33.21000  ? 177  ASP A O     1 
ATOM   1374 C  CB    . ASP A 1 189 ? -13.85000 -30.75900 24.66900  1.000 28.99000  ? 177  ASP A CB    1 
ATOM   1375 C  CG    . ASP A 1 189 ? -15.07500 -31.32000 25.45600  1.000 49.20000  ? 177  ASP A CG    1 
ATOM   1376 O  OD1   . ASP A 1 189 ? -16.22600 -31.21900 24.93400  1.000 50.98000  ? 177  ASP A OD1   1 
ATOM   1377 O  OD2   . ASP A 1 189 ? -14.90500 -31.90300 26.56700  1.000 37.52000  ? 177  ASP A OD2   1 
ATOM   1378 N  N     . ILE A 1 190 ? -11.54100 -31.44700 22.03900  1.000 26.68000  ? 178  ILE A N     1 
ATOM   1379 C  CA    . ILE A 1 190 ? -10.96200 -31.15700 20.74000  1.000 23.63000  ? 178  ILE A CA    1 
ATOM   1380 C  C     . ILE A 1 190 ? -11.53800 -32.19800 19.77700  1.000 24.71000  ? 178  ILE A C     1 
ATOM   1381 O  O     . ILE A 1 190 ? -11.50900 -33.38700 20.06100  1.000 27.59000  ? 178  ILE A O     1 
ATOM   1382 C  CB    . ILE A 1 190 ? -9.42000  -31.26400 20.75400  1.000 24.04000  ? 178  ILE A CB    1 
ATOM   1383 C  CG1   . ILE A 1 190 ? -8.83500  -30.39300 21.85900  1.000 24.47000  ? 178  ILE A CG1   1 
ATOM   1384 C  CG2   . ILE A 1 190 ? -8.82400  -30.88000 19.42800  1.000 20.01000  ? 178  ILE A CG2   1 
ATOM   1385 C  CD1   . ILE A 1 190 ? -9.10500  -28.94500 21.64900  1.000 24.47000  ? 178  ILE A CD1   1 
ATOM   1386 N  N     . VAL A 1 191 ? -12.07900 -31.76600 18.65200  1.000 21.10000  ? 179  VAL A N     1 
ATOM   1387 C  CA    . VAL A 1 191 ? -12.62700 -32.70100 17.70700  1.000 20.39000  ? 179  VAL A CA    1 
ATOM   1388 C  C     . VAL A 1 191 ? -11.67700 -32.88500 16.53000  1.000 23.66000  ? 179  VAL A C     1 
ATOM   1389 O  O     . VAL A 1 191 ? -11.29600 -31.90900 15.88300  1.000 23.67000  ? 179  VAL A O     1 
ATOM   1390 C  CB    . VAL A 1 191 ? -13.99800 -32.22300 17.19800  1.000 22.81000  ? 179  VAL A CB    1 
ATOM   1391 C  CG1   . VAL A 1 191 ? -13.97100 -30.74800 16.99400  1.000 27.42000  ? 179  VAL A CG1   1 
ATOM   1392 C  CG2   . VAL A 1 191 ? -14.34500 -32.91100 15.88600  1.000 25.34000  ? 179  VAL A CG2   1 
ATOM   1393 N  N     . ILE A 1 192 ? -11.31300 -34.13700 16.24400  1.000 21.99000  ? 180  ILE A N     1 
ATOM   1394 C  CA    . ILE A 1 192 ? -10.35700 -34.43500 15.17800  1.000 17.15000  ? 180  ILE A CA    1 
ATOM   1395 C  C     . ILE A 1 192 ? -10.95400 -35.33000 14.10000  1.000 21.36000  ? 180  ILE A C     1 
ATOM   1396 O  O     . ILE A 1 192 ? -11.10700 -36.53400 14.28600  1.000 24.05000  ? 180  ILE A O     1 
ATOM   1397 C  CB    . ILE A 1 192 ? -9.11000  -35.11100 15.74200  1.000 17.79000  ? 180  ILE A CB    1 
ATOM   1398 C  CG1   . ILE A 1 192 ? -8.57900  -34.33400 16.94900  1.000 18.69000  ? 180  ILE A CG1   1 
ATOM   1399 C  CG2   . ILE A 1 192 ? -8.01700  -35.24100 14.68000  1.000 19.25000  ? 180  ILE A CG2   1 
ATOM   1400 C  CD1   . ILE A 1 192 ? -7.29300  -34.92700 17.51500  1.000 17.20000  ? 180  ILE A CD1   1 
ATOM   1401 N  N     . TYR A 1 193 ? -11.32000 -34.73800 12.97100  1.000 22.28000  ? 181  TYR A N     1 
ATOM   1402 C  CA    . TYR A 1 193 ? -11.85400 -35.53600 11.87500  1.000 18.25000  ? 181  TYR A CA    1 
ATOM   1403 C  C     . TYR A 1 193 ? -10.64200 -36.11100 11.21100  1.000 20.88000  ? 181  TYR A C     1 
ATOM   1404 O  O     . TYR A 1 193 ? -9.74300  -35.36700 10.83800  1.000 25.42000  ? 181  TYR A O     1 
ATOM   1405 C  CB    . TYR A 1 193 ? -12.69100 -34.69200 10.91000  1.000 16.63000  ? 181  TYR A CB    1 
ATOM   1406 C  CG    . TYR A 1 193 ? -14.16400 -34.70800 11.20500  1.000 17.10000  ? 181  TYR A CG    1 
ATOM   1407 C  CD1   . TYR A 1 193 ? -14.69500 -33.97900 12.26100  1.000 16.34000  ? 181  TYR A CD1   1 
ATOM   1408 C  CD2   . TYR A 1 193 ? -15.04100 -35.46600 10.42500  1.000 21.16000  ? 181  TYR A CD2   1 
ATOM   1409 C  CE1   . TYR A 1 193 ? -16.05700 -33.98900 12.53500  1.000 16.80000  ? 181  TYR A CE1   1 
ATOM   1410 C  CE2   . TYR A 1 193 ? -16.40800 -35.49300 10.68200  1.000 17.17000  ? 181  TYR A CE2   1 
ATOM   1411 C  CZ    . TYR A 1 193 ? -16.90900 -34.74600 11.73500  1.000 19.71000  ? 181  TYR A CZ    1 
ATOM   1412 O  OH    . TYR A 1 193 ? -18.26900 -34.75600 11.98500  1.000 20.51000  ? 181  TYR A OH    1 
ATOM   1413 N  N     . GLN A 1 194 ? -10.62300 -37.42500 11.05000  1.000 20.48000  ? 182  GLN A N     1 
ATOM   1414 C  CA    . GLN A 1 194 ? -9.41300  -38.12200 10.66700  1.000 19.06000  ? 182  GLN A CA    1 
ATOM   1415 C  C     . GLN A 1 194 ? -9.63500  -38.93300 9.40600   1.000 22.18000  ? 182  GLN A C     1 
ATOM   1416 O  O     . GLN A 1 194 ? -10.19800 -40.00800 9.47200   1.000 26.46000  ? 182  GLN A O     1 
ATOM   1417 C  CB    . GLN A 1 194 ? -8.98900  -38.99700 11.82600  1.000 20.49000  ? 182  GLN A CB    1 
ATOM   1418 C  CG    . GLN A 1 194 ? -7.89000  -40.00400 11.59100  1.000 20.05000  ? 182  GLN A CG    1 
ATOM   1419 C  CD    . GLN A 1 194 ? -7.96400  -41.07600 12.65600  1.000 21.15000  ? 182  GLN A CD    1 
ATOM   1420 O  OE1   . GLN A 1 194 ? -8.46400  -40.82800 13.76800  1.000 20.67000  ? 182  GLN A OE1   1 
ATOM   1421 N  NE2   . GLN A 1 194 ? -7.52000  -42.27300 12.32600  1.000 22.84000  ? 182  GLN A NE2   1 
ATOM   1422 N  N     . TYR A 1 195 ? -9.20900  -38.41400 8.25500   1.000 24.04000  ? 183  TYR A N     1 
ATOM   1423 C  CA    . TYR A 1 195 ? -9.44100  -39.09500 6.98100   1.000 19.43000  ? 183  TYR A CA    1 
ATOM   1424 C  C     . TYR A 1 195 ? -8.11800  -39.34900 6.27800   1.000 25.71000  ? 183  TYR A C     1 
ATOM   1425 O  O     . TYR A 1 195 ? -7.53700  -38.43300 5.68800   1.000 28.48000  ? 183  TYR A O     1 
ATOM   1426 C  CB    . TYR A 1 195 ? -10.35500 -38.27300 6.08100   1.000 18.93000  ? 183  TYR A CB    1 
ATOM   1427 C  CG    . TYR A 1 195 ? -10.81400 -39.04600 4.87400   1.000 20.48000  ? 183  TYR A CG    1 
ATOM   1428 C  CD1   . TYR A 1 195 ? -11.87900 -39.93300 4.97300   1.000 19.27000  ? 183  TYR A CD1   1 
ATOM   1429 C  CD2   . TYR A 1 195 ? -10.18500 -38.91900 3.66300   1.000 19.10000  ? 183  TYR A CD2   1 
ATOM   1430 C  CE1   . TYR A 1 195 ? -12.30300 -40.65400 3.90800   1.000 20.17000  ? 183  TYR A CE1   1 
ATOM   1431 C  CE2   . TYR A 1 195 ? -10.59600 -39.63900 2.58200   1.000 23.55000  ? 183  TYR A CE2   1 
ATOM   1432 C  CZ    . TYR A 1 195 ? -11.65900 -40.51600 2.70400   1.000 23.41000  ? 183  TYR A CZ    1 
ATOM   1433 O  OH    . TYR A 1 195 ? -12.10000 -41.25200 1.61800   1.000 20.03000  ? 183  TYR A OH    1 
ATOM   1434 N  N     . MET A 1 196 ? -7.64500  -40.59400 6.33900   1.000 23.60000  ? 184  MET A N     1 
ATOM   1435 C  CA    . MET A 1 196 ? -6.27600  -40.92400 5.96500   1.000 23.43000  ? 184  MET A CA    1 
ATOM   1436 C  C     . MET A 1 196 ? -5.28700  -40.14900 6.80700   1.000 25.86000  ? 184  MET A C     1 
ATOM   1437 O  O     . MET A 1 196 ? -5.26600  -40.29800 8.00300   1.000 26.19000  ? 184  MET A O     1 
ATOM   1438 C  CB    . MET A 1 196 ? -6.02500  -40.63600 4.48800   1.000 26.36000  ? 184  MET A CB    1 
ATOM   1439 C  CG    . MET A 1 196 ? -6.49500  -41.75700 3.60000   1.000 34.10000  ? 184  MET A CG    1 
ATOM   1440 S  SD    . MET A 1 196 ? -5.72600  -43.36900 3.95100   1.000 39.76000  ? 184  MET A SD    1 
ATOM   1441 C  CE    . MET A 1 196 ? -6.91800  -44.32600 3.02600   1.000 25.65000  ? 184  MET A CE    1 
ATOM   1442 N  N     . ASP A 1 197 ? -4.47400  -39.31700 6.17800   1.000 27.34000  ? 185  ASP A N     1 
ATOM   1443 C  CA    . ASP A 1 197 ? -3.47600  -38.55500 6.92100   1.000 31.10000  ? 185  ASP A CA    1 
ATOM   1444 C  C     . ASP A 1 197 ? -3.89400  -37.09100 7.07500   1.000 31.56000  ? 185  ASP A C     1 
ATOM   1445 O  O     . ASP A 1 197 ? -3.10000  -36.24700 7.45400   1.000 30.05000  ? 185  ASP A O     1 
ATOM   1446 C  CB    . ASP A 1 197 ? -2.14900  -38.63000 6.20400   1.000 29.86000  ? 185  ASP A CB    1 
ATOM   1447 C  CG    . ASP A 1 197 ? -2.23100  -38.04400 4.82500   1.000 34.50000  ? 185  ASP A CG    1 
ATOM   1448 O  OD1   . ASP A 1 197 ? -3.35900  -37.85500 4.30900   1.000 32.25000  ? 185  ASP A OD1   1 
ATOM   1449 O  OD2   . ASP A 1 197 ? -1.17100  -37.75400 4.25900   1.000 45.64000  ? 185  ASP A OD2   1 
ATOM   1450 N  N     . ASP A 1 198 ? -5.14200  -36.81800 6.73300   1.000 30.19000  ? 186  ASP A N     1 
ATOM   1451 C  CA    . ASP A 1 198 ? -5.72400  -35.49600 6.79400   1.000 25.59000  ? 186  ASP A CA    1 
ATOM   1452 C  C     . ASP A 1 198 ? -6.39300  -35.27100 8.13700   1.000 25.74000  ? 186  ASP A C     1 
ATOM   1453 O  O     . ASP A 1 198 ? -7.22800  -36.07200 8.52900   1.000 32.72000  ? 186  ASP A O     1 
ATOM   1454 C  CB    . ASP A 1 198 ? -6.76100  -35.36600 5.69200   1.000 31.85000  ? 186  ASP A CB    1 
ATOM   1455 C  CG    . ASP A 1 198 ? -6.95000  -33.96200 5.23200   1.000 38.98000  ? 186  ASP A CG    1 
ATOM   1456 O  OD1   . ASP A 1 198 ? -5.96500  -33.18300 5.26300   1.000 41.95000  ? 186  ASP A OD1   1 
ATOM   1457 O  OD2   . ASP A 1 198 ? -8.08500  -33.65300 4.79400   1.000 40.07000  ? 186  ASP A OD2   1 
ATOM   1458 N  N     . LEU A 1 199 ? -6.06400  -34.19400 8.83000   1.000 26.75000  ? 187  LEU A N     1 
ATOM   1459 C  CA    . LEU A 1 199 ? -6.72100  -33.91200 10.10400  1.000 23.59000  ? 187  LEU A CA    1 
ATOM   1460 C  C     . LEU A 1 199 ? -7.44600  -32.55500 10.15700  1.000 26.50000  ? 187  LEU A C     1 
ATOM   1461 O  O     . LEU A 1 199 ? -6.81700  -31.49900 9.98900   1.000 33.82000  ? 187  LEU A O     1 
ATOM   1462 C  CB    . LEU A 1 199 ? -5.69600  -33.96600 11.23500  1.000 21.91000  ? 187  LEU A CB    1 
ATOM   1463 C  CG    . LEU A 1 199 ? -4.92800  -35.27800 11.39100  1.000 24.22000  ? 187  LEU A CG    1 
ATOM   1464 C  CD1   . LEU A 1 199 ? -3.83600  -35.10200 12.43500  1.000 20.14000  ? 187  LEU A CD1   1 
ATOM   1465 C  CD2   . LEU A 1 199 ? -5.85500  -36.40900 11.77500  1.000 20.05000  ? 187  LEU A CD2   1 
ATOM   1466 N  N     . TYR A 1 200 ? -8.75500  -32.57100 10.38700  1.000 19.32000  ? 188  TYR A N     1 
ATOM   1467 C  CA    . TYR A 1 200 ? -9.47300  -31.34600 10.75200  1.000 21.20000  ? 188  TYR A CA    1 
ATOM   1468 C  C     . TYR A 1 200 ? -9.56300  -31.24200 12.28700  1.000 21.26000  ? 188  TYR A C     1 
ATOM   1469 O  O     . TYR A 1 200 ? -10.10500 -32.12600 12.94000  1.000 22.41000  ? 188  TYR A O     1 
ATOM   1470 C  CB    . TYR A 1 200 ? -10.86300 -31.33900 10.09500  1.000 24.10000  ? 188  TYR A CB    1 
ATOM   1471 C  CG    . TYR A 1 200 ? -11.86900 -30.32000 10.61700  1.000 23.72000  ? 188  TYR A CG    1 
ATOM   1472 C  CD1   . TYR A 1 200 ? -12.44300 -30.45900 11.87300  1.000 22.24000  ? 188  TYR A CD1   1 
ATOM   1473 C  CD2   . TYR A 1 200 ? -12.30000 -29.26900 9.81500   1.000 22.01000  ? 188  TYR A CD2   1 
ATOM   1474 C  CE1   . TYR A 1 200 ? -13.37200 -29.57700 12.33800  1.000 22.48000  ? 188  TYR A CE1   1 
ATOM   1475 C  CE2   . TYR A 1 200 ? -13.22900 -28.36200 10.26900  1.000 24.48000  ? 188  TYR A CE2   1 
ATOM   1476 C  CZ    . TYR A 1 200 ? -13.77100 -28.52500 11.54400  1.000 30.30000  ? 188  TYR A CZ    1 
ATOM   1477 O  OH    . TYR A 1 200 ? -14.71400 -27.64100 12.04000  1.000 33.57000  ? 188  TYR A OH    1 
ATOM   1478 N  N     . VAL A 1 201 ? -9.00300  -30.19300 12.86900  1.000 21.84000  ? 189  VAL A N     1 
ATOM   1479 C  CA    . VAL A 1 201 ? -9.00700  -30.05700 14.31500  1.000 18.50000  ? 189  VAL A CA    1 
ATOM   1480 C  C     . VAL A 1 201 ? -9.81500  -28.84800 14.72800  1.000 24.00000  ? 189  VAL A C     1 
ATOM   1481 O  O     . VAL A 1 201 ? -9.48900  -27.72000 14.32000  1.000 24.93000  ? 189  VAL A O     1 
ATOM   1482 C  CB    . VAL A 1 201 ? -7.61200  -29.88200 14.89200  1.000 20.52000  ? 189  VAL A CB    1 
ATOM   1483 C  CG1   . VAL A 1 201 ? -7.69800  -29.77200 16.42100  1.000 18.72000  ? 189  VAL A CG1   1 
ATOM   1484 C  CG2   . VAL A 1 201 ? -6.71300  -31.03100 14.48100  1.000 21.85000  ? 189  VAL A CG2   1 
ATOM   1485 N  N     . GLY A 1 202 ? -10.84700 -29.06500 15.54700  1.000 21.32000  ? 190  GLY A N     1 
ATOM   1486 C  CA    . GLY A 1 202 ? -11.73800 -27.98100 15.92300  1.000 23.76000  ? 190  GLY A CA    1 
ATOM   1487 C  C     . GLY A 1 202 ? -11.91400 -27.85400 17.41900  1.000 24.45000  ? 190  GLY A C     1 
ATOM   1488 O  O     . GLY A 1 202 ? -11.88900 -28.85700 18.13200  1.000 26.67000  ? 190  GLY A O     1 
ATOM   1489 N  N     . SER A 1 203 ? -12.07500 -26.63400 17.90800  1.000 24.02000  ? 191  SER A N     1 
ATOM   1490 C  CA    . SER A 1 203 ? -12.17500 -26.42400 19.35500  1.000 21.64000  ? 191  SER A CA    1 
ATOM   1491 C  C     . SER A 1 203 ? -12.99000 -25.19300 19.65600  1.000 27.48000  ? 191  SER A C     1 
ATOM   1492 O  O     . SER A 1 203 ? -13.13700 -24.32300 18.79900  1.000 32.93000  ? 191  SER A O     1 
ATOM   1493 C  CB    . SER A 1 203 ? -10.80700 -26.26900 19.99100  1.000 24.70000  ? 191  SER A CB    1 
ATOM   1494 O  OG    . SER A 1 203 ? -10.31200 -24.96900 19.75000  1.000 28.69000  ? 191  SER A OG    1 
ATOM   1495 N  N     . ASP A 1 204 ? -13.50300 -25.11900 20.88300  1.000 25.04000  ? 192  ASP A N     1 
ATOM   1496 C  CA    . ASP A 1 204 ? -14.21900 -23.92900 21.31000  1.000 27.26000  ? 192  ASP A CA    1 
ATOM   1497 C  C     . ASP A 1 204 ? -13.35100 -22.99600 22.15000  1.000 27.84000  ? 192  ASP A C     1 
ATOM   1498 O  O     . ASP A 1 204 ? -13.85700 -22.29700 23.01400  1.000 32.55000  ? 192  ASP A O     1 
ATOM   1499 C  CB    . ASP A 1 204 ? -15.45000 -24.31100 22.09700  1.000 27.69000  ? 192  ASP A CB    1 
ATOM   1500 C  CG    . ASP A 1 204 ? -16.50500 -24.94200 21.23300  1.000 37.67000  ? 192  ASP A CG    1 
ATOM   1501 O  OD1   . ASP A 1 204 ? -17.08600 -24.21700 20.38700  1.000 34.58000  ? 192  ASP A OD1   1 
ATOM   1502 O  OD2   . ASP A 1 204 ? -16.76400 -26.15700 21.41700  1.000 44.36000  ? 192  ASP A OD2   1 
ATOM   1503 N  N     . LEU A 1 205 ? -12.04900 -22.99700 21.88100  1.000 23.90000  ? 193  LEU A N     1 
ATOM   1504 C  CA    . LEU A 1 205 ? -11.08800 -22.20800 22.62000  1.000 25.33000  ? 193  LEU A CA    1 
ATOM   1505 C  C     . LEU A 1 205 ? -10.80100 -20.92900 21.89100  1.000 29.51000  ? 193  LEU A C     1 
ATOM   1506 O  O     . LEU A 1 205 ? -11.11200 -20.81200 20.71200  1.000 29.50000  ? 193  LEU A O     1 
ATOM   1507 C  CB    . LEU A 1 205 ? -9.79600  -22.99800 22.80600  1.000 31.32000  ? 193  LEU A CB    1 
ATOM   1508 C  CG    . LEU A 1 205 ? -10.04300 -24.37200 23.42300  1.000 25.26000  ? 193  LEU A CG    1 
ATOM   1509 C  CD1   . LEU A 1 205 ? -8.83400  -25.25600 23.33000  1.000 21.09000  ? 193  LEU A CD1   1 
ATOM   1510 C  CD2   . LEU A 1 205 ? -10.46600 -24.18000 24.87100  1.000 25.01000  ? 193  LEU A CD2   1 
ATOM   1511 N  N     . GLU A 1 206 ? -10.20000 -19.96400 22.57800  1.000 39.42000  ? 194  GLU A N     1 
ATOM   1512 C  CA    . GLU A 1 206 ? -9.79200  -18.73500 21.90100  1.000 37.38000  ? 194  GLU A CA    1 
ATOM   1513 C  C     . GLU A 1 206 ? -8.49900  -19.04800 21.14400  1.000 35.88000  ? 194  GLU A C     1 
ATOM   1514 O  O     . GLU A 1 206 ? -7.76900  -19.97600 21.51100  1.000 36.49000  ? 194  GLU A O     1 
ATOM   1515 C  CB    . GLU A 1 206 ? -9.63000  -17.57800 22.89600  1.000 45.33000  ? 194  GLU A CB    1 
ATOM   1516 C  CG    . GLU A 1 206 ? -10.40200 -16.30000 22.49000  1.000 56.31000  ? 194  GLU A CG    1 
ATOM   1517 C  CD    . GLU A 1 206 ? -11.53500 -15.90200 23.46500  1.000 63.90000  ? 194  GLU A CD    1 
ATOM   1518 O  OE1   . GLU A 1 206 ? -11.34100 -16.00400 24.70500  1.000 69.41000  ? 194  GLU A OE1   1 
ATOM   1519 O  OE2   . GLU A 1 206 ? -12.61900 -15.47900 22.98600  1.000 54.73000  ? 194  GLU A OE2   1 
ATOM   1520 N  N     . ILE A 1 207 ? -8.23100  -18.29400 20.08200  1.000 36.59000  ? 195  ILE A N     1 
ATOM   1521 C  CA    . ILE A 1 207 ? -7.17700  -18.62900 19.10900  1.000 34.51000  ? 195  ILE A CA    1 
ATOM   1522 C  C     . ILE A 1 207 ? -5.78200  -18.89500 19.71600  1.000 35.11000  ? 195  ILE A C     1 
ATOM   1523 O  O     . ILE A 1 207 ? -4.97700  -19.61200 19.12900  1.000 32.79000  ? 195  ILE A O     1 
ATOM   1524 C  CB    . ILE A 1 207 ? -7.05000  -17.50400 18.04600  1.000 33.82000  ? 195  ILE A CB    1 
ATOM   1525 C  CG1   . ILE A 1 207 ? -8.44800  -17.08800 17.57100  1.000 56.31000  ? 195  ILE A CG1   1 
ATOM   1526 C  CG2   . ILE A 1 207 ? -6.25400  -17.99000 16.86200  1.000 35.64000  ? 195  ILE A CG2   1 
ATOM   1527 C  CD1   . ILE A 1 207 ? -8.74100  -15.57100 17.60600  1.000 55.42000  ? 195  ILE A CD1   1 
ATOM   1528 N  N     . GLY A 1 208 ? -5.49000  -18.31700 20.87600  1.000 35.11000  ? 196  GLY A N     1 
ATOM   1529 C  CA    . GLY A 1 208 ? -4.19800  -18.54000 21.49800  1.000 26.34000  ? 196  GLY A CA    1 
ATOM   1530 C  C     . GLY A 1 208 ? -4.12200  -19.89200 22.17400  1.000 29.46000  ? 196  GLY A C     1 
ATOM   1531 O  O     . GLY A 1 208 ? -3.15500  -20.63300 22.00900  1.000 37.14000  ? 196  GLY A O     1 
ATOM   1532 N  N     . GLN A 1 209 ? -5.15700  -20.21500 22.94200  1.000 35.14000  ? 197  GLN A N     1 
ATOM   1533 C  CA    . GLN A 1 209 ? -5.28900  -21.53000 23.56900  1.000 35.05000  ? 197  GLN A CA    1 
ATOM   1534 C  C     . GLN A 1 209 ? -5.38400  -22.66200 22.54600  1.000 36.52000  ? 197  GLN A C     1 
ATOM   1535 O  O     . GLN A 1 209 ? -4.79800  -23.72900 22.73300  1.000 34.25000  ? 197  GLN A O     1 
ATOM   1536 C  CB    . GLN A 1 209 ? -6.51900  -21.55800 24.45300  1.000 31.83000  ? 197  GLN A CB    1 
ATOM   1537 C  CG    . GLN A 1 209 ? -6.24400  -21.90400 25.88100  1.000 45.15000  ? 197  GLN A CG    1 
ATOM   1538 C  CD    . GLN A 1 209 ? -7.22100  -21.20600 26.79500  1.000 52.56000  ? 197  GLN A CD    1 
ATOM   1539 O  OE1   . GLN A 1 209 ? -8.08900  -20.45200 26.32200  1.000 49.93000  ? 197  GLN A OE1   1 
ATOM   1540 N  NE2   . GLN A 1 209 ? -7.09700  -21.44100 28.10800  1.000 49.54000  ? 197  GLN A NE2   1 
ATOM   1541 N  N     . HIS A 1 210 ? -6.14700  -22.43200 21.47900  1.000 30.22000  ? 198  HIS A N     1 
ATOM   1542 C  CA    . HIS A 1 210 ? -6.27900  -23.42300 20.44500  1.000 24.40000  ? 198  HIS A CA    1 
ATOM   1543 C  C     . HIS A 1 210 ? -4.89000  -23.71000 19.88700  1.000 29.73000  ? 198  HIS A C     1 
ATOM   1544 O  O     . HIS A 1 210 ? -4.45800  -24.86800 19.84500  1.000 29.39000  ? 198  HIS A O     1 
ATOM   1545 C  CB    . HIS A 1 210 ? -7.24500  -22.93200 19.36700  1.000 27.54000  ? 198  HIS A CB    1 
ATOM   1546 C  CG    . HIS A 1 210 ? -7.33400  -23.82700 18.17600  1.000 23.48000  ? 198  HIS A CG    1 
ATOM   1547 N  ND1   . HIS A 1 210 ? -8.16500  -24.92500 18.13200  1.000 25.78000  ? 198  HIS A ND1   1 
ATOM   1548 C  CD2   . HIS A 1 210 ? -6.70200  -23.78300 16.97700  1.000 25.13000  ? 198  HIS A CD2   1 
ATOM   1549 C  CE1   . HIS A 1 210 ? -8.03500  -25.52700 16.95900  1.000 26.58000  ? 198  HIS A CE1   1 
ATOM   1550 N  NE2   . HIS A 1 210 ? -7.15700  -24.84900 16.23500  1.000 27.55000  ? 198  HIS A NE2   1 
ATOM   1551 N  N     . ARG A 1 211 ? -4.16500  -22.65700 19.51000  1.000 31.09000  ? 199  ARG A N     1 
ATOM   1552 C  CA    . ARG A 1 211 ? -2.87900  -22.85400 18.84000  1.000 31.74000  ? 199  ARG A CA    1 
ATOM   1553 C  C     . ARG A 1 211 ? -1.93300  -23.60500 19.74600  1.000 28.41000  ? 199  ARG A C     1 
ATOM   1554 O  O     . ARG A 1 211 ? -1.08300  -24.36000 19.30100  1.000 29.07000  ? 199  ARG A O     1 
ATOM   1555 C  CB    . ARG A 1 211 ? -2.25900  -21.53300 18.40500  1.000 28.57000  ? 199  ARG A CB    1 
ATOM   1556 C  CG    . ARG A 1 211 ? -2.93000  -20.88400 17.18200  1.000 36.99000  ? 199  ARG A CG    1 
ATOM   1557 C  CD    . ARG A 1 211 ? -1.96400  -19.85300 16.55800  1.000 48.54000  ? 199  ARG A CD    1 
ATOM   1558 N  NE    . ARG A 1 211 ? -2.61600  -18.87400 15.68400  1.000 53.00000  ? 199  ARG A NE    1 
ATOM   1559 C  CZ    . ARG A 1 211 ? -3.28400  -19.19000 14.57400  1.000 49.29000  ? 199  ARG A CZ    1 
ATOM   1560 N  NH1   . ARG A 1 211 ? -3.40800  -20.46500 14.21400  1.000 47.39000  ? 199  ARG A NH1   1 
ATOM   1561 N  NH2   . ARG A 1 211 ? -3.84300  -18.23500 13.84000  1.000 42.83000  ? 199  ARG A NH2   1 
ATOM   1562 N  N     . THR A 1 212 ? -2.09300  -23.40900 21.03700  1.000 28.24000  ? 200  THR A N     1 
ATOM   1563 C  CA    . THR A 1 212 ? -1.28400  -24.15000 21.97300  1.000 30.51000  ? 200  THR A CA    1 
ATOM   1564 C  C     . THR A 1 212 ? -1.62400  -25.64100 21.93500  1.000 30.66000  ? 200  THR A C     1 
ATOM   1565 O  O     . THR A 1 212 ? -0.75100  -26.48600 22.10400  1.000 31.56000  ? 200  THR A O     1 
ATOM   1566 C  CB    . THR A 1 212 ? -1.47000  -23.59800 23.38600  1.000 29.67000  ? 200  THR A CB    1 
ATOM   1567 O  OG1   . THR A 1 212 ? -0.37400  -22.72700 23.68200  1.000 24.98000  ? 200  THR A OG1   1 
ATOM   1568 C  CG2   . THR A 1 212 ? -1.54200  -24.73800 24.40300  1.000 21.58000  ? 200  THR A CG2   1 
ATOM   1569 N  N     . LYS A 1 213 ? -2.89500  -25.95400 21.69700  1.000 26.40000  ? 201  LYS A N     1 
ATOM   1570 C  CA    . LYS A 1 213 ? -3.33900  -27.33800 21.67500  1.000 27.26000  ? 201  LYS A CA    1 
ATOM   1571 C  C     . LYS A 1 213 ? -2.89300  -28.03200 20.40300  1.000 27.60000  ? 201  LYS A C     1 
ATOM   1572 O  O     . LYS A 1 213 ? -2.54600  -29.21300 20.43300  1.000 30.86000  ? 201  LYS A O     1 
ATOM   1573 C  CB    . LYS A 1 213 ? -4.85700  -27.42300 21.81000  1.000 25.46000  ? 201  LYS A CB    1 
ATOM   1574 C  CG    . LYS A 1 213 ? -5.34000  -27.36100 23.24500  1.000 29.12000  ? 201  LYS A CG    1 
ATOM   1575 C  CD    . LYS A 1 213 ? -5.46800  -28.75900 23.84100  1.000 28.84000  ? 201  LYS A CD    1 
ATOM   1576 C  CE    . LYS A 1 213 ? -4.86700  -28.83500 25.23100  1.000 28.15000  ? 201  LYS A CE    1 
ATOM   1577 N  NZ    . LYS A 1 213 ? -5.46000  -27.81900 26.09200  1.000 28.29000  ? 201  LYS A NZ    1 
ATOM   1578 N  N     . ILE A 1 214 ? -2.92200  -27.30100 19.29600  1.000 30.61000  ? 202  ILE A N     1 
ATOM   1579 C  CA    . ILE A 1 214 ? -2.40300  -27.79800 18.03100  1.000 28.16000  ? 202  ILE A CA    1 
ATOM   1580 C  C     . ILE A 1 214 ? -0.92900  -28.16200 18.16500  1.000 24.63000  ? 202  ILE A C     1 
ATOM   1581 O  O     . ILE A 1 214 ? -0.49900  -29.16200 17.60900  1.000 27.24000  ? 202  ILE A O     1 
ATOM   1582 C  CB    . ILE A 1 214 ? -2.57800  -26.76400 16.87700  1.000 23.88000  ? 202  ILE A CB    1 
ATOM   1583 C  CG1   . ILE A 1 214 ? -4.05400  -26.51400 16.62800  1.000 26.87000  ? 202  ILE A CG1   1 
ATOM   1584 C  CG2   . ILE A 1 214 ? -1.96000  -27.27900 15.60800  1.000 20.27000  ? 202  ILE A CG2   1 
ATOM   1585 C  CD1   . ILE A 1 214 ? -4.87100  -27.78600 16.49200  1.000 23.68000  ? 202  ILE A CD1   1 
ATOM   1586 N  N     . GLU A 1 215 ? -0.15600  -27.36800 18.90200  1.000 24.36000  ? 203  GLU A N     1 
ATOM   1587 C  CA    . GLU A 1 215 ? 1.26500   -27.70000 19.08600  1.000 29.60000  ? 203  GLU A CA    1 
ATOM   1588 C  C     . GLU A 1 215 ? 1.40600   -29.00900 19.84900  1.000 29.83000  ? 203  GLU A C     1 
ATOM   1589 O  O     . GLU A 1 215 ? 2.22100   -29.85100 19.49200  1.000 27.84000  ? 203  GLU A O     1 
ATOM   1590 C  CB    . GLU A 1 215 ? 2.02500   -26.58800 19.81300  1.000 28.29000  ? 203  GLU A CB    1 
ATOM   1591 C  CG    . GLU A 1 215 ? 2.59000   -25.51400 18.89600  1.000 32.95000  ? 203  GLU A CG    1 
ATOM   1592 C  CD    . GLU A 1 215 ? 3.26700   -26.09500 17.66800  1.000 43.59000  ? 203  GLU A CD    1 
ATOM   1593 O  OE1   . GLU A 1 215 ? 4.31800   -26.78200 17.83100  1.000 44.45000  ? 203  GLU A OE1   1 
ATOM   1594 O  OE2   . GLU A 1 215 ? 2.73100   -25.87200 16.54600  1.000 37.31000  ? 203  GLU A OE2   1 
ATOM   1595 N  N     . GLU A 1 216 ? 0.58900   -29.17000 20.88700  1.000 30.30000  ? 204  GLU A N     1 
ATOM   1596 C  CA    . GLU A 1 216 ? 0.54600   -30.40800 21.64400  1.000 26.60000  ? 204  GLU A CA    1 
ATOM   1597 C  C     . GLU A 1 216 ? 0.18600   -31.57000 20.72600  1.000 29.32000  ? 204  GLU A C     1 
ATOM   1598 O  O     . GLU A 1 216 ? 0.73300   -32.67600 20.86200  1.000 34.77000  ? 204  GLU A O     1 
ATOM   1599 C  CB    . GLU A 1 216 ? -0.45500  -30.30800 22.79300  1.000 25.66000  ? 204  GLU A CB    1 
ATOM   1600 C  CG    . GLU A 1 216 ? -0.41400  -31.49600 23.74300  1.000 32.62000  ? 204  GLU A CG    1 
ATOM   1601 C  CD    . GLU A 1 216 ? -1.47100  -31.42100 24.83700  1.000 40.22000  ? 204  GLU A CD    1 
ATOM   1602 O  OE1   . GLU A 1 216 ? -1.79100  -30.28200 25.27700  1.000 44.46000  ? 204  GLU A OE1   1 
ATOM   1603 O  OE2   . GLU A 1 216 ? -1.99100  -32.49400 25.24100  1.000 39.48000  ? 204  GLU A OE2   1 
ATOM   1604 N  N     . LEU A 1 217 ? -0.73200  -31.33200 19.78600  1.000 27.19000  ? 205  LEU A N     1 
ATOM   1605 C  CA    . LEU A 1 217 ? -1.12500  -32.40600 18.88600  1.000 25.50000  ? 205  LEU A CA    1 
ATOM   1606 C  C     . LEU A 1 217 ? 0.01600   -32.72000 17.94100  1.000 23.72000  ? 205  LEU A C     1 
ATOM   1607 O  O     . LEU A 1 217 ? 0.26600   -33.87800 17.64500  1.000 24.54000  ? 205  LEU A O     1 
ATOM   1608 C  CB    . LEU A 1 217 ? -2.37600  -32.05800 18.09400  1.000 27.65000  ? 205  LEU A CB    1 
ATOM   1609 C  CG    . LEU A 1 217 ? -2.81400  -33.10300 17.04300  1.000 23.62000  ? 205  LEU A CG    1 
ATOM   1610 C  CD1   . LEU A 1 217 ? -3.14300  -34.43600 17.68700  1.000 19.21000  ? 205  LEU A CD1   1 
ATOM   1611 C  CD2   . LEU A 1 217 ? -4.00500  -32.58900 16.27900  1.000 22.04000  ? 205  LEU A CD2   1 
ATOM   1612 N  N     . ARG A 1 218 ? 0.71400   -31.69100 17.47600  1.000 24.22000  ? 206  ARG A N     1 
ATOM   1613 C  CA    . ARG A 1 218 ? 1.80200   -31.90500 16.53500  1.000 21.05000  ? 206  ARG A CA    1 
ATOM   1614 C  C     . ARG A 1 218 ? 2.96600   -32.62200 17.22400  1.000 26.33000  ? 206  ARG A C     1 
ATOM   1615 O  O     . ARG A 1 218 ? 3.62000   -33.44000 16.59300  1.000 29.69000  ? 206  ARG A O     1 
ATOM   1616 C  CB    . ARG A 1 218 ? 2.25300   -30.59200 15.92000  1.000 24.94000  ? 206  ARG A CB    1 
ATOM   1617 C  CG    . ARG A 1 218 ? 1.22400   -30.00300 14.97000  1.000 25.94000  ? 206  ARG A CG    1 
ATOM   1618 C  CD    . ARG A 1 218 ? 1.72300   -28.78300 14.19400  1.000 20.58000  ? 206  ARG A CD    1 
ATOM   1619 N  NE    . ARG A 1 218 ? 2.99200   -29.07400 13.56500  1.000 24.66000  ? 206  ARG A NE    1 
ATOM   1620 C  CZ    . ARG A 1 218 ? 4.14100   -28.54900 13.96200  1.000 30.97000  ? 206  ARG A CZ    1 
ATOM   1621 N  NH1   . ARG A 1 218 ? 4.16600   -27.67500 14.96000  1.000 31.65000  ? 206  ARG A NH1   1 
ATOM   1622 N  NH2   . ARG A 1 218 ? 5.26400   -28.88700 13.34900  1.000 32.71000  ? 206  ARG A NH2   1 
ATOM   1623 N  N     . GLN A 1 219 ? 3.20200   -32.35400 18.50800  1.000 25.16000  ? 207  GLN A N     1 
ATOM   1624 C  CA    . GLN A 1 219 ? 4.28500   -33.02800 19.23400  1.000 27.91000  ? 207  GLN A CA    1 
ATOM   1625 C  C     . GLN A 1 219 ? 3.93900   -34.47300 19.49600  1.000 30.96000  ? 207  GLN A C     1 
ATOM   1626 O  O     . GLN A 1 219 ? 4.84600   -35.33300 19.54600  1.000 28.87000  ? 207  GLN A O     1 
ATOM   1627 C  CB    . GLN A 1 219 ? 4.58400   -32.36900 20.59700  1.000 29.53000  ? 207  GLN A CB    1 
ATOM   1628 C  CG    . GLN A 1 219 ? 5.45300   -31.13500 20.54800  1.000 28.26000  ? 207  GLN A CG    1 
ATOM   1629 C  CD    . GLN A 1 219 ? 6.85900   -31.44500 20.11200  1.000 40.10000  ? 207  GLN A CD    1 
ATOM   1630 O  OE1   . GLN A 1 219 ? 7.64600   -32.02700 20.87700  1.000 50.58000  ? 207  GLN A OE1   1 
ATOM   1631 N  NE2   . GLN A 1 219 ? 7.19800   -31.05800 18.88100  1.000 37.22000  ? 207  GLN A NE2   1 
ATOM   1632 N  N     . HIS A 1 220 ? 2.64600   -34.73100 19.71900  1.000 26.76000  ? 208  HIS A N     1 
ATOM   1633 C  CA    . HIS A 1 220 ? 2.19300   -36.08200 20.01100  1.000 22.71000  ? 208  HIS A CA    1 
ATOM   1634 C  C     . HIS A 1 220 ? 2.50100   -36.89100 18.78600  1.000 24.82000  ? 208  HIS A C     1 
ATOM   1635 O  O     . HIS A 1 220 ? 3.25900   -37.83900 18.82500  1.000 30.72000  ? 208  HIS A O     1 
ATOM   1636 C  CB    . HIS A 1 220 ? 0.70000   -36.11800 20.34100  1.000 24.89000  ? 208  HIS A CB    1 
ATOM   1637 C  CG    . HIS A 1 220 ? 0.20400   -37.47400 20.75200  1.000 29.74000  ? 208  HIS A CG    1 
ATOM   1638 N  ND1   . HIS A 1 220 ? 0.14500   -37.87700 22.07200  1.000 28.09000  ? 208  HIS A ND1   1 
ATOM   1639 C  CD2   . HIS A 1 220 ? -0.24500  -38.52300 20.02000  1.000 29.06000  ? 208  HIS A CD2   1 
ATOM   1640 C  CE1   . HIS A 1 220 ? -0.31800  -39.11300 22.13200  1.000 26.13000  ? 208  HIS A CE1   1 
ATOM   1641 N  NE2   . HIS A 1 220 ? -0.56000  -39.53000 20.90300  1.000 25.18000  ? 208  HIS A NE2   1 
ATOM   1642 N  N     . LEU A 1 221 ? 1.91800   -36.46400 17.68000  1.000 27.68000  ? 209  LEU A N     1 
ATOM   1643 C  CA    . LEU A 1 221 ? 2.20700   -37.02200 16.37800  1.000 27.06000  ? 209  LEU A CA    1 
ATOM   1644 C  C     . LEU A 1 221 ? 3.72100   -37.19100 16.11900  1.000 28.10000  ? 209  LEU A C     1 
ATOM   1645 O  O     . LEU A 1 221 ? 4.14500   -38.21400 15.59100  1.000 31.44000  ? 209  LEU A O     1 
ATOM   1646 C  CB    . LEU A 1 221 ? 1.56600   -36.13100 15.31300  1.000 24.05000  ? 209  LEU A CB    1 
ATOM   1647 C  CG    . LEU A 1 221 ? 0.28900   -36.54700 14.57600  1.000 25.44000  ? 209  LEU A CG    1 
ATOM   1648 C  CD1   . LEU A 1 221 ? -0.47100  -37.62000 15.29100  1.000 24.59000  ? 209  LEU A CD1   1 
ATOM   1649 C  CD2   . LEU A 1 221 ? -0.61600  -35.32800 14.31100  1.000 21.77000  ? 209  LEU A CD2   1 
ATOM   1650 N  N     . LEU A 1 222 ? 4.53400   -36.21300 16.49000  1.000 27.25000  ? 210  LEU A N     1 
ATOM   1651 C  CA    . LEU A 1 222 ? 5.96900   -36.29400 16.18200  1.000 25.60000  ? 210  LEU A CA    1 
ATOM   1652 C  C     . LEU A 1 222 ? 6.70000   -37.29300 17.08200  1.000 27.80000  ? 210  LEU A C     1 
ATOM   1653 O  O     . LEU A 1 222 ? 7.71200   -37.87600 16.68600  1.000 29.69000  ? 210  LEU A O     1 
ATOM   1654 C  CB    . LEU A 1 222 ? 6.62700   -34.92700 16.30300  1.000 25.18000  ? 210  LEU A CB    1 
ATOM   1655 C  CG    . LEU A 1 222 ? 8.13000   -34.78900 16.05000  1.000 24.45000  ? 210  LEU A CG    1 
ATOM   1656 C  CD1   . LEU A 1 222 ? 8.52000   -35.27100 14.64400  1.000 23.76000  ? 210  LEU A CD1   1 
ATOM   1657 C  CD2   . LEU A 1 222 ? 8.52900   -33.33900 16.23500  1.000 28.22000  ? 210  LEU A CD2   1 
ATOM   1658 N  N     . ARG A 1 223 ? 6.17500   -37.50100 18.28400  1.000 26.89000  ? 211  ARG A N     1 
ATOM   1659 C  CA    . ARG A 1 223 ? 6.69100   -38.54500 19.16200  1.000 24.63000  ? 211  ARG A CA    1 
ATOM   1660 C  C     . ARG A 1 223 ? 6.54600   -39.92400 18.52800  1.000 25.26000  ? 211  ARG A C     1 
ATOM   1661 O  O     . ARG A 1 223 ? 7.38900   -40.79300 18.74200  1.000 28.78000  ? 211  ARG A O     1 
ATOM   1662 C  CB    . ARG A 1 223 ? 5.97800   -38.49300 20.51300  1.000 24.64000  ? 211  ARG A CB    1 
ATOM   1663 C  CG    . ARG A 1 223 ? 6.34700   -39.57500 21.50300  1.000 25.93000  ? 211  ARG A CG    1 
ATOM   1664 C  CD    . ARG A 1 223 ? 5.41600   -40.74700 21.37100  1.000 28.71000  ? 211  ARG A CD    1 
ATOM   1665 N  NE    . ARG A 1 223 ? 5.61100   -41.75100 22.41400  1.000 29.26000  ? 211  ARG A NE    1 
ATOM   1666 C  CZ    . ARG A 1 223 ? 6.45400   -42.78100 22.30700  1.000 36.05000  ? 211  ARG A CZ    1 
ATOM   1667 N  NH1   . ARG A 1 223 ? 7.20100   -42.92700 21.21500  1.000 30.83000  ? 211  ARG A NH1   1 
ATOM   1668 N  NH2   . ARG A 1 223 ? 6.55800   -43.67000 23.29000  1.000 41.61000  ? 211  ARG A NH2   1 
ATOM   1669 N  N     . TRP A 1 224 ? 5.49000   -40.11500 17.73000  1.000 30.08000  ? 212  TRP A N     1 
ATOM   1670 C  CA    . TRP A 1 224 ? 5.22600   -41.40600 17.06900  1.000 26.64000  ? 212  TRP A CA    1 
ATOM   1671 C  C     . TRP A 1 224 ? 5.74700   -41.47700 15.66000  1.000 26.52000  ? 212  TRP A C     1 
ATOM   1672 O  O     . TRP A 1 224 ? 5.38900   -42.38800 14.93600  1.000 29.10000  ? 212  TRP A O     1 
ATOM   1673 C  CB    . TRP A 1 224 ? 3.72100   -41.72400 17.04900  1.000 23.97000  ? 212  TRP A CB    1 
ATOM   1674 C  CG    . TRP A 1 224 ? 3.24600   -42.07400 18.41900  1.000 29.76000  ? 212  TRP A CG    1 
ATOM   1675 C  CD1   . TRP A 1 224 ? 2.56900   -41.26000 19.28200  1.000 26.59000  ? 212  TRP A CD1   1 
ATOM   1676 C  CD2   . TRP A 1 224 ? 3.49300   -43.30100 19.13000  1.000 26.78000  ? 212  TRP A CD2   1 
ATOM   1677 N  NE1   . TRP A 1 224 ? 2.34700   -41.91800 20.46100  1.000 30.21000  ? 212  TRP A NE1   1 
ATOM   1678 C  CE2   . TRP A 1 224 ? 2.90200   -43.17000 20.39900  1.000 23.82000  ? 212  TRP A CE2   1 
ATOM   1679 C  CE3   . TRP A 1 224 ? 4.14300   -44.49600 18.80800  1.000 25.67000  ? 212  TRP A CE3   1 
ATOM   1680 C  CZ2   . TRP A 1 224 ? 2.93500   -44.18300 21.34200  1.000 23.86000  ? 212  TRP A CZ2   1 
ATOM   1681 C  CZ3   . TRP A 1 224 ? 4.16100   -45.49800 19.73800  1.000 25.06000  ? 212  TRP A CZ3   1 
ATOM   1682 C  CH2   . TRP A 1 224 ? 3.56400   -45.33700 20.99600  1.000 23.82000  ? 212  TRP A CH2   1 
ATOM   1683 N  N     . GLY A 1 225 ? 6.58800   -40.52000 15.27800  1.000 30.24000  ? 213  GLY A N     1 
ATOM   1684 C  CA    . GLY A 1 225 ? 7.25300   -40.54000 13.98100  1.000 29.30000  ? 213  GLY A CA    1 
ATOM   1685 C  C     . GLY A 1 225 ? 6.47900   -39.87200 12.85400  1.000 32.06000  ? 213  GLY A C     1 
ATOM   1686 O  O     . GLY A 1 225 ? 6.88200   -39.96600 11.69400  1.000 30.15000  ? 213  GLY A O     1 
ATOM   1687 N  N     . LEU A 1 226 ? 5.37600   -39.19500 13.18900  1.000 24.43000  ? 214  LEU A N     1 
ATOM   1688 C  CA    . LEU A 1 226 ? 4.54300   -38.56700 12.17800  1.000 23.28000  ? 214  LEU A CA    1 
ATOM   1689 C  C     . LEU A 1 226 ? 4.68100   -37.04700 12.17700  1.000 26.67000  ? 214  LEU A C     1 
ATOM   1690 O  O     . LEU A 1 226 ? 4.14700   -36.36700 13.05000  1.000 27.54000  ? 214  LEU A O     1 
ATOM   1691 C  CB    . LEU A 1 226 ? 3.09000   -38.94700 12.38300  1.000 28.19000  ? 214  LEU A CB    1 
ATOM   1692 C  CG    . LEU A 1 226 ? 2.77800   -40.43900 12.24400  1.000 26.63000  ? 214  LEU A CG    1 
ATOM   1693 C  CD1   . LEU A 1 226 ? 1.34000   -40.71800 12.59200  1.000 20.64000  ? 214  LEU A CD1   1 
ATOM   1694 C  CD2   . LEU A 1 226 ? 3.09200   -40.90200 10.84500  1.000 25.79000  ? 214  LEU A CD2   1 
ATOM   1695 N  N     . THR A 1 227 ? 5.39700   -36.54000 11.17300  1.000 26.20000  ? 215  THR A N     1 
ATOM   1696 C  CA    . THR A 1 227 ? 5.66300   -35.11700 10.99000  1.000 24.81000  ? 215  THR A CA    1 
ATOM   1697 C  C     . THR A 1 227 ? 4.46300   -34.39900 10.38400  1.000 31.46000  ? 215  THR A C     1 
ATOM   1698 O  O     . THR A 1 227 ? 3.72800   -34.97000 9.55400   1.000 29.57000  ? 215  THR A O     1 
ATOM   1699 C  CB    . THR A 1 227 ? 6.87800   -34.87300 10.04300  1.000 25.45000  ? 215  THR A CB    1 
ATOM   1700 O  OG1   . THR A 1 227 ? 6.57500   -35.41900 8.74600   1.000 25.11000  ? 215  THR A OG1   1 
ATOM   1701 C  CG2   . THR A 1 227 ? 8.13100   -35.53600 10.56900  1.000 21.23000  ? 215  THR A CG2   1 
ATOM   1702 N  N     . THR A 1 228 ? 4.27600   -33.14000 10.76800  1.000 29.20000  ? 216  THR A N     1 
ATOM   1703 C  CA    . THR A 1 228 ? 3.23900   -32.31900 10.15000  1.000 26.11000  ? 216  THR A CA    1 
ATOM   1704 C  C     . THR A 1 228 ? 3.83900   -31.05500 9.55600   1.000 26.46000  ? 216  THR A C     1 
ATOM   1705 O  O     . THR A 1 228 ? 4.03200   -30.07500 10.26200  1.000 30.42000  ? 216  THR A O     1 
ATOM   1706 C  CB    . THR A 1 228 ? 2.14500   -31.94500 11.16300  1.000 26.98000  ? 216  THR A CB    1 
ATOM   1707 O  OG1   . THR A 1 228 ? 2.75500   -31.39400 12.33300  1.000 26.04000  ? 216  THR A OG1   1 
ATOM   1708 C  CG2   . THR A 1 228 ? 1.38100   -33.17900 11.55900  1.000 26.35000  ? 216  THR A CG2   1 
ATOM   1709 N  N     . PRO A 1 229 ? 4.12900   -31.06700 8.25000   1.000 28.97000  ? 217  PRO A N     1 
ATOM   1710 C  CA    . PRO A 1 229 ? 4.85200   -29.94300 7.64100   1.000 27.69000  ? 217  PRO A CA    1 
ATOM   1711 C  C     . PRO A 1 229 ? 4.01800   -28.68900 7.64900   1.000 33.59000  ? 217  PRO A C     1 
ATOM   1712 O  O     . PRO A 1 229 ? 2.82900   -28.76200 7.31400   1.000 30.15000  ? 217  PRO A O     1 
ATOM   1713 C  CB    . PRO A 1 229 ? 5.08300   -30.40000 6.20600   1.000 22.47000  ? 217  PRO A CB    1 
ATOM   1714 C  CG    . PRO A 1 229 ? 4.72900   -31.84800 6.19300   1.000 25.43000  ? 217  PRO A CG    1 
ATOM   1715 C  CD    . PRO A 1 229 ? 3.70000   -32.03500 7.23000   1.000 26.80000  ? 217  PRO A CD    1 
ATOM   1716 N  N     . ASP A 1 230 ? 4.62500   -27.56500 8.02600   1.000 31.16000  ? 218  ASP A N     1 
ATOM   1717 C  CA    . ASP A 1 230 ? 3.93000   -26.28900 8.00600   1.000 30.00000  ? 218  ASP A CA    1 
ATOM   1718 C  C     . ASP A 1 230 ? 3.34600   -25.97200 6.63100   1.000 30.91000  ? 218  ASP A C     1 
ATOM   1719 O  O     . ASP A 1 230 ? 2.33600   -25.29400 6.53800   1.000 34.94000  ? 218  ASP A O     1 
ATOM   1720 C  CB    . ASP A 1 230 ? 4.86000   -25.16500 8.45300   1.000 30.17000  ? 218  ASP A CB    1 
ATOM   1721 C  CG    . ASP A 1 230 ? 4.11700   -23.85900 8.70900   1.000 38.74000  ? 218  ASP A CG    1 
ATOM   1722 O  OD1   . ASP A 1 230 ? 3.36800   -23.79100 9.71000   1.000 46.12000  ? 218  ASP A OD1   1 
ATOM   1723 O  OD2   . ASP A 1 230 ? 4.28300   -22.88700 7.93000   1.000 41.58000  ? 218  ASP A OD2   1 
ATOM   1724 N  N     . LYS A 1 231 ? 3.97900   -26.48000 5.57500   1.000 30.39000  ? 219  LYS A N     1 
ATOM   1725 C  CA    . LYS A 1 231 ? 3.56900   -26.19400 4.20700   1.000 29.58000  ? 219  LYS A CA    1 
ATOM   1726 C  C     . LYS A 1 231 ? 2.13100   -26.62100 3.99800   1.000 34.64000  ? 219  LYS A C     1 
ATOM   1727 O  O     . LYS A 1 231 ? 1.41500   -26.07200 3.16300   1.000 42.79000  ? 219  LYS A O     1 
ATOM   1728 C  CB    . LYS A 1 231 ? 4.49800   -26.90700 3.21100   1.000 32.12000  ? 219  LYS A CB    1 
ATOM   1729 C  CG    . LYS A 1 231 ? 4.10900   -26.80800 1.74200   1.000 46.41000  ? 219  LYS A CG    1 
ATOM   1730 C  CD    . LYS A 1 231 ? 4.90200   -27.83400 0.88800   1.000 55.14000  ? 219  LYS A CD    1 
ATOM   1731 C  CE    . LYS A 1 231 ? 4.35600   -27.94300 -0.54000  1.000 59.38000  ? 219  LYS A CE    1 
ATOM   1732 N  NZ    . LYS A 1 231 ? 4.87100   -29.15600 -1.23700  1.000 77.85000  ? 219  LYS A NZ    1 
ATOM   1733 N  N     . LYS A 1 232 ? 1.70600   -27.59300 4.78400   1.000 32.57000  ? 220  LYS A N     1 
ATOM   1734 C  CA    . LYS A 1 232 ? 0.41200   -28.21200 4.58900   1.000 30.58000  ? 220  LYS A CA    1 
ATOM   1735 C  C     . LYS A 1 232 ? -0.50900  -27.94200 5.78300   1.000 27.16000  ? 220  LYS A C     1 
ATOM   1736 O  O     . LYS A 1 232 ? -1.52800  -28.59600 5.97300   1.000 29.26000  ? 220  LYS A O     1 
ATOM   1737 C  CB    . LYS A 1 232 ? 0.59800   -29.71300 4.36400   1.000 31.45000  ? 220  LYS A CB    1 
ATOM   1738 C  CG    . LYS A 1 232 ? 0.06800   -30.20200 3.05100   1.000 39.41000  ? 220  LYS A CG    1 
ATOM   1739 C  CD    . LYS A 1 232 ? 1.17900   -30.45900 2.07300   1.000 43.63000  ? 220  LYS A CD    1 
ATOM   1740 C  CE    . LYS A 1 232 ? 0.64800   -31.30100 0.91100   1.000 51.12000  ? 220  LYS A CE    1 
ATOM   1741 N  NZ    . LYS A 1 232 ? -0.10800  -32.52000 1.37500   1.000 45.06000  ? 220  LYS A NZ    1 
ATOM   1742 N  N     . HIS A 1 233 ? -0.13600  -26.94500 6.56900   1.000 30.97000  ? 221  HIS A N     1 
ATOM   1743 C  CA    . HIS A 1 233 ? -0.81900  -26.58000 7.80900   1.000 25.89000  ? 221  HIS A CA    1 
ATOM   1744 C  C     . HIS A 1 233 ? -1.62900  -25.29400 7.59100   1.000 24.68000  ? 221  HIS A C     1 
ATOM   1745 O  O     . HIS A 1 233 ? -1.07400  -24.19900 7.55600   1.000 33.56000  ? 221  HIS A O     1 
ATOM   1746 C  CB    . HIS A 1 233 ? 0.24200   -26.42600 8.91800   1.000 27.27000  ? 221  HIS A CB    1 
ATOM   1747 C  CG    . HIS A 1 233 ? -0.28000  -25.97600 10.24700  1.000 26.91000  ? 221  HIS A CG    1 
ATOM   1748 N  ND1   . HIS A 1 233 ? 0.50700   -25.97200 11.37100  1.000 30.51000  ? 221  HIS A ND1   1 
ATOM   1749 C  CD2   . HIS A 1 233 ? -1.49000  -25.49300 10.63700  1.000 35.06000  ? 221  HIS A CD2   1 
ATOM   1750 C  CE1   . HIS A 1 233 ? -0.18600  -25.51600 12.39800  1.000 28.02000  ? 221  HIS A CE1   1 
ATOM   1751 N  NE2   . HIS A 1 233 ? -1.39800  -25.20800 11.98300  1.000 25.84000  ? 221  HIS A NE2   1 
ATOM   1752 N  N     . GLN A 1 234 ? -2.93000  -25.44100 7.41400   1.000 25.90000  ? 222  GLN A N     1 
ATOM   1753 C  CA    . GLN A 1 234 ? -3.81200  -24.30400 7.16500   1.000 25.81000  ? 222  GLN A CA    1 
ATOM   1754 C  C     . GLN A 1 234 ? -4.24600  -23.64900 8.46200   1.000 30.93000  ? 222  GLN A C     1 
ATOM   1755 O  O     . GLN A 1 234 ? -4.78700  -24.32100 9.33500   1.000 31.44000  ? 222  GLN A O     1 
ATOM   1756 C  CB    . GLN A 1 234 ? -5.04300  -24.75500 6.39000   1.000 22.53000  ? 222  GLN A CB    1 
ATOM   1757 C  CG    . GLN A 1 234 ? -4.72300  -25.70100 5.24800   1.000 22.11000  ? 222  GLN A CG    1 
ATOM   1758 C  CD    . GLN A 1 234 ? -5.96700  -26.09900 4.53700   1.000 23.54000  ? 222  GLN A CD    1 
ATOM   1759 O  OE1   . GLN A 1 234 ? -6.92700  -25.34400 4.53000   1.000 34.90000  ? 222  GLN A OE1   1 
ATOM   1760 N  NE2   . GLN A 1 234 ? -5.99200  -27.28700 3.96400   1.000 24.02000  ? 222  GLN A NE2   1 
ATOM   1761 N  N     . LYS A 1 235 ? -4.01800  -22.34100 8.58400   1.000 35.51000  ? 223  LYS A N     1 
ATOM   1762 C  CA    . LYS A 1 235 ? -4.32800  -21.61600 9.81600   1.000 31.89000  ? 223  LYS A CA    1 
ATOM   1763 C  C     . LYS A 1 235 ? -5.51700  -20.66300 9.70400   1.000 35.39000  ? 223  LYS A C     1 
ATOM   1764 O  O     . LYS A 1 235 ? -6.03100  -20.21900 10.72300  1.000 35.63000  ? 223  LYS A O     1 
ATOM   1765 C  CB    . LYS A 1 235 ? -3.12100  -20.80800 10.27800  1.000 35.98000  ? 223  LYS A CB    1 
ATOM   1766 C  CG    . LYS A 1 235 ? -1.92900  -21.61100 10.75400  1.000 36.66000  ? 223  LYS A CG    1 
ATOM   1767 C  CD    . LYS A 1 235 ? -0.69100  -21.23500 9.93600   1.000 40.11000  ? 223  LYS A CD    1 
ATOM   1768 C  CE    . LYS A 1 235 ? 0.59000   -21.71500 10.59500  1.000 42.66000  ? 223  LYS A CE    1 
ATOM   1769 N  NZ    . LYS A 1 235 ? 1.57100   -22.07000 9.52800   1.000 44.83000  ? 223  LYS A NZ    1 
ATOM   1770 N  N     . GLU A 1 236 ? -5.93300  -20.32300 8.48600   1.000 35.39000  ? 224  GLU A N     1 
ATOM   1771 C  CA    . GLU A 1 236 ? -6.93400  -19.26900 8.31600   1.000 35.14000  ? 224  GLU A CA    1 
ATOM   1772 C  C     . GLU A 1 236 ? -7.96000  -19.64700 7.27300   1.000 33.56000  ? 224  GLU A C     1 
ATOM   1773 O  O     . GLU A 1 236 ? -7.63300  -20.31100 6.29500   1.000 31.46000  ? 224  GLU A O     1 
ATOM   1774 C  CB    . GLU A 1 236 ? -6.28200  -17.93900 7.90800   1.000 37.85000  ? 224  GLU A CB    1 
ATOM   1775 C  CG    . GLU A 1 236 ? -5.07600  -17.49000 8.75300   1.000 47.85000  ? 224  GLU A CG    1 
ATOM   1776 C  CD    . GLU A 1 236 ? -5.45700  -16.83200 10.09500  1.000 57.49000  ? 224  GLU A CD    1 
ATOM   1777 O  OE1   . GLU A 1 236 ? -6.63400  -16.95700 10.52200  1.000 59.02000  ? 224  GLU A OE1   1 
ATOM   1778 O  OE2   . GLU A 1 236 ? -4.57000  -16.18800 10.72200  1.000 54.53000  ? 224  GLU A OE2   1 
ATOM   1779 N  N     . PRO A 1 237 ? -9.20600  -19.18500 7.45200   1.000 31.44000  ? 225  PRO A N     1 
ATOM   1780 C  CA    . PRO A 1 237 ? -10.25300 -19.53700 6.49500   1.000 26.73000  ? 225  PRO A CA    1 
ATOM   1781 C  C     . PRO A 1 237 ? -9.99300  -18.84300 5.18400   1.000 33.23000  ? 225  PRO A C     1 
ATOM   1782 O  O     . PRO A 1 237 ? -9.36700  -17.78100 5.18700   1.000 34.35000  ? 225  PRO A O     1 
ATOM   1783 C  CB    . PRO A 1 237 ? -11.53300 -19.00000 7.14500   1.000 22.37000  ? 225  PRO A CB    1 
ATOM   1784 C  CG    . PRO A 1 237 ? -11.13200 -18.58900 8.52900   1.000 25.18000  ? 225  PRO A CG    1 
ATOM   1785 C  CD    . PRO A 1 237 ? -9.69200  -18.22400 8.44500   1.000 27.46000  ? 225  PRO A CD    1 
ATOM   1786 N  N     . PRO A 1 238 ? -10.48300 -19.41600 4.08300   1.000 34.04000  ? 226  PRO A N     1 
ATOM   1787 C  CA    . PRO A 1 238 ? -11.25400 -20.66000 4.13300   1.000 31.66000  ? 226  PRO A CA    1 
ATOM   1788 C  C     . PRO A 1 238 ? -10.34100 -21.88100 4.10700   1.000 32.29000  ? 226  PRO A C     1 
ATOM   1789 O  O     . PRO A 1 238 ? -9.23900  -21.81200 3.56600   1.000 33.55000  ? 226  PRO A O     1 
ATOM   1790 C  CB    . PRO A 1 238 ? -12.08200 -20.58600 2.86300   1.000 27.06000  ? 226  PRO A CB    1 
ATOM   1791 C  CG    . PRO A 1 238 ? -11.14200 -19.93200 1.90100   1.000 31.71000  ? 226  PRO A CG    1 
ATOM   1792 C  CD    . PRO A 1 238 ? -10.35900 -18.91200 2.70200   1.000 25.59000  ? 226  PRO A CD    1 
ATOM   1793 N  N     . PHE A 1 239 ? -10.80500 -22.98500 4.67000   1.000 29.18000  ? 227  PHE A N     1 
ATOM   1794 C  CA    . PHE A 1 239 ? -10.00500 -24.19300 4.70200   1.000 26.73000  ? 227  PHE A CA    1 
ATOM   1795 C  C     . PHE A 1 239 ? -10.33100 -25.13400 3.56400   1.000 27.64000  ? 227  PHE A C     1 
ATOM   1796 O  O     . PHE A 1 239 ? -11.49700 -25.29400 3.18500   1.000 32.20000  ? 227  PHE A O     1 
ATOM   1797 C  CB    . PHE A 1 239 ? -10.20800 -24.89600 6.02400   1.000 27.44000  ? 227  PHE A CB    1 
ATOM   1798 C  CG    . PHE A 1 239 ? -9.78800  -24.08200 7.18700   1.000 21.57000  ? 227  PHE A CG    1 
ATOM   1799 C  CD1   . PHE A 1 239 ? -8.48900  -24.09800 7.60800   1.000 21.19000  ? 227  PHE A CD1   1 
ATOM   1800 C  CD2   . PHE A 1 239 ? -10.69100 -23.30200 7.85500   1.000 22.53000  ? 227  PHE A CD2   1 
ATOM   1801 C  CE1   . PHE A 1 239 ? -8.09800  -23.35400 8.69300   1.000 24.82000  ? 227  PHE A CE1   1 
ATOM   1802 C  CE2   . PHE A 1 239 ? -10.30300 -22.56500 8.94000   1.000 23.78000  ? 227  PHE A CE2   1 
ATOM   1803 C  CZ    . PHE A 1 239 ? -9.00200  -22.58800 9.35300   1.000 24.80000  ? 227  PHE A CZ    1 
ATOM   1804 N  N     . LEU A 1 240 ? -9.29700  -25.74400 3.00600   1.000 24.27000  ? 228  LEU A N     1 
ATOM   1805 C  CA    . LEU A 1 240 ? -9.48800  -26.71100 1.95400   1.000 27.14000  ? 228  LEU A CA    1 
ATOM   1806 C  C     . LEU A 1 240 ? -9.55900  -28.09400 2.57400   1.000 29.08000  ? 228  LEU A C     1 
ATOM   1807 O  O     . LEU A 1 240 ? -8.56400  -28.57200 3.12200   1.000 31.07000  ? 228  LEU A O     1 
ATOM   1808 C  CB    . LEU A 1 240 ? -8.34800  -26.62700 0.94000   1.000 36.17000  ? 228  LEU A CB    1 
ATOM   1809 C  CG    . LEU A 1 240 ? -8.52400  -25.70400 -0.27800  1.000 41.47000  ? 228  LEU A CG    1 
ATOM   1810 C  CD1   . LEU A 1 240 ? -9.30600  -24.44300 0.08000   1.000 37.99000  ? 228  LEU A CD1   1 
ATOM   1811 C  CD2   . LEU A 1 240 ? -7.16000  -25.33500 -0.87400  1.000 35.38000  ? 228  LEU A CD2   1 
ATOM   1812 N  N     . TRP A 1 241 ? -10.72100 -28.73500 2.48000   1.000 23.67000  ? 229  TRP A N     1 
ATOM   1813 C  CA    . TRP A 1 241 ? -10.96800 -29.99500 3.17600   1.000 20.84000  ? 229  TRP A CA    1 
ATOM   1814 C  C     . TRP A 1 241 ? -11.91600 -30.92400 2.41700   1.000 21.59000  ? 229  TRP A C     1 
ATOM   1815 O  O     . TRP A 1 241 ? -13.04800 -30.57100 2.12800   1.000 22.83000  ? 229  TRP A O     1 
ATOM   1816 C  CB    . TRP A 1 241 ? -11.53800 -29.68400 4.54300   1.000 19.12000  ? 229  TRP A CB    1 
ATOM   1817 C  CG    . TRP A 1 241 ? -11.76200 -30.86100 5.40800   1.000 25.56000  ? 229  TRP A CG    1 
ATOM   1818 C  CD1   . TRP A 1 241 ? -10.81000 -31.58800 6.08600   1.000 23.94000  ? 229  TRP A CD1   1 
ATOM   1819 C  CD2   . TRP A 1 241 ? -13.02500 -31.44100 5.75000   1.000 25.09000  ? 229  TRP A CD2   1 
ATOM   1820 N  NE1   . TRP A 1 241 ? -11.41100 -32.58800 6.80900   1.000 21.73000  ? 229  TRP A NE1   1 
ATOM   1821 C  CE2   . TRP A 1 241 ? -12.76700 -32.52100 6.61700   1.000 20.46000  ? 229  TRP A CE2   1 
ATOM   1822 C  CE3   . TRP A 1 241 ? -14.34700 -31.15800 5.39500   1.000 23.51000  ? 229  TRP A CE3   1 
ATOM   1823 C  CZ2   . TRP A 1 241 ? -13.77800 -33.30900 7.13300   1.000 17.57000  ? 229  TRP A CZ2   1 
ATOM   1824 C  CZ3   . TRP A 1 241 ? -15.34300 -31.94200 5.90300   1.000 19.77000  ? 229  TRP A CZ3   1 
ATOM   1825 C  CH2   . TRP A 1 241 ? -15.05800 -33.00000 6.77300   1.000 21.53000  ? 229  TRP A CH2   1 
ATOM   1826 N  N     . MET A 1 242 ? -11.43100 -32.10800 2.07400   1.000 22.45000  ? 230  MET A N     1 
ATOM   1827 C  CA    . MET A 1 242 ? -12.26400 -33.16500 1.48400   1.000 23.87000  ? 230  MET A CA    1 
ATOM   1828 C  C     . MET A 1 242 ? -13.00800 -32.73700 0.21500   1.000 27.26000  ? 230  MET A C     1 
ATOM   1829 O  O     . MET A 1 242 ? -14.06800 -33.30000 -0.13900  1.000 25.35000  ? 230  MET A O     1 
ATOM   1830 C  CB    . MET A 1 242 ? -13.27200 -33.67300 2.52400   1.000 22.22000  ? 230  MET A CB    1 
ATOM   1831 C  CG    . MET A 1 242 ? -12.62400 -34.24500 3.76500   1.000 21.32000  ? 230  MET A CG    1 
ATOM   1832 S  SD    . MET A 1 242 ? -11.73800 -35.75900 3.35400   1.000 22.86000  ? 230  MET A SD    1 
ATOM   1833 C  CE    . MET A 1 242 ? -13.08100 -36.82700 2.84600   1.000 17.41000  ? 230  MET A CE    1 
ATOM   1834 N  N     . GLY A 1 243 ? -12.44000 -31.74800 -0.46800  1.000 24.37000  ? 231  GLY A N     1 
ATOM   1835 C  CA    . GLY A 1 243 ? -12.98000 -31.28500 -1.73000  1.000 25.65000  ? 231  GLY A CA    1 
ATOM   1836 C  C     . GLY A 1 243 ? -13.85900 -30.06900 -1.53200  1.000 29.59000  ? 231  GLY A C     1 
ATOM   1837 O  O     . GLY A 1 243 ? -14.54900 -29.63400 -2.45500  1.000 32.70000  ? 231  GLY A O     1 
ATOM   1838 N  N     . TYR A 1 244 ? -13.83700 -29.51800 -0.31900  1.000 26.98000  ? 232  TYR A N     1 
ATOM   1839 C  CA    . TYR A 1 244 ? -14.68900 -28.38300 0.01300   1.000 27.40000  ? 232  TYR A CA    1 
ATOM   1840 C  C     . TYR A 1 244 ? -13.87300 -27.17800 0.41200   1.000 29.32000  ? 232  TYR A C     1 
ATOM   1841 O  O     . TYR A 1 244 ? -12.65600 -27.24000 0.54000   1.000 32.28000  ? 232  TYR A O     1 
ATOM   1842 C  CB    . TYR A 1 244 ? -15.65000 -28.73200 1.15600   1.000 22.64000  ? 232  TYR A CB    1 
ATOM   1843 C  CG    . TYR A 1 244 ? -16.45800 -29.99400 0.94500   1.000 24.75000  ? 232  TYR A CG    1 
ATOM   1844 C  CD1   . TYR A 1 244 ? -17.63200 -29.96900 0.20100   1.000 22.09000  ? 232  TYR A CD1   1 
ATOM   1845 C  CD2   . TYR A 1 244 ? -16.04700 -31.20600 1.48900   1.000 21.52000  ? 232  TYR A CD2   1 
ATOM   1846 C  CE1   . TYR A 1 244 ? -18.36800 -31.09800 0.00300   1.000 18.76000  ? 232  TYR A CE1   1 
ATOM   1847 C  CE2   . TYR A 1 244 ? -16.77900 -32.35500 1.29700   1.000 21.06000  ? 232  TYR A CE2   1 
ATOM   1848 C  CZ    . TYR A 1 244 ? -17.95300 -32.29200 0.55400   1.000 23.17000  ? 232  TYR A CZ    1 
ATOM   1849 O  OH    . TYR A 1 244 ? -18.72100 -33.41900 0.36600   1.000 21.96000  ? 232  TYR A OH    1 
ATOM   1850 N  N     . GLU A 1 245 ? -14.56200 -26.07300 0.61900   1.000 28.35000  ? 233  GLU A N     1 
ATOM   1851 C  CA    . GLU A 1 245 ? -13.93900 -24.89400 1.17300   1.000 29.42000  ? 233  GLU A CA    1 
ATOM   1852 C  C     . GLU A 1 245 ? -14.72400 -24.55600 2.41600   1.000 28.30000  ? 233  GLU A C     1 
ATOM   1853 O  O     . GLU A 1 245 ? -15.91500 -24.26100 2.32600   1.000 33.04000  ? 233  GLU A O     1 
ATOM   1854 C  CB    . GLU A 1 245 ? -13.95600 -23.74300 0.17400   1.000 32.19000  ? 233  GLU A CB    1 
ATOM   1855 C  CG    . GLU A 1 245 ? -12.67200 -23.61500 -0.63500  1.000 39.42000  ? 233  GLU A CG    1 
ATOM   1856 C  CD    . GLU A 1 245 ? -12.74100 -22.47800 -1.65500  1.000 54.44000  ? 233  GLU A CD    1 
ATOM   1857 O  OE1   . GLU A 1 245 ? -12.57500 -21.29900 -1.25100  1.000 55.45000  ? 233  GLU A OE1   1 
ATOM   1858 O  OE2   . GLU A 1 245 ? -12.97300 -22.76400 -2.85700  1.000 56.37000  ? 233  GLU A OE2   1 
ATOM   1859 N  N     . LEU A 1 246 ? -14.09700 -24.62600 3.57900   1.000 22.85000  ? 234  LEU A N     1 
ATOM   1860 C  CA    . LEU A 1 246 ? -14.85900 -24.31700 4.78700   1.000 29.93000  ? 234  LEU A CA    1 
ATOM   1861 C  C     . LEU A 1 246 ? -14.63500 -22.85200 5.18800   1.000 30.03000  ? 234  LEU A C     1 
ATOM   1862 O  O     . LEU A 1 246 ? -13.55300 -22.45200 5.62900   1.000 28.12000  ? 234  LEU A O     1 
ATOM   1863 C  CB    . LEU A 1 246 ? -14.50300 -25.27000 5.93900   1.000 23.00000  ? 234  LEU A CB    1 
ATOM   1864 C  CG    . LEU A 1 246 ? -14.39100 -26.75000 5.54800   1.000 21.99000  ? 234  LEU A CG    1 
ATOM   1865 C  CD1   . LEU A 1 246 ? -13.76100 -27.56800 6.67300   1.000 19.99000  ? 234  LEU A CD1   1 
ATOM   1866 C  CD2   . LEU A 1 246 ? -15.73900 -27.34500 5.13000   1.000 20.20000  ? 234  LEU A CD2   1 
ATOM   1867 N  N     . HIS A 1 247 ? -15.66200 -22.04300 4.97200   1.000 31.64000  ? 235  HIS A N     1 
ATOM   1868 C  CA    . HIS A 1 247 ? -15.67500 -20.70000 5.51100   1.000 30.56000  ? 235  HIS A CA    1 
ATOM   1869 C  C     . HIS A 1 247 ? -16.30300 -20.80800 6.88900   1.000 33.57000  ? 235  HIS A C     1 
ATOM   1870 O  O     . HIS A 1 247 ? -16.73200 -21.89400 7.29000   1.000 35.96000  ? 235  HIS A O     1 
ATOM   1871 C  CB    . HIS A 1 247 ? -16.44900 -19.75000 4.61800   1.000 27.35000  ? 235  HIS A CB    1 
ATOM   1872 C  CG    . HIS A 1 247 ? -16.03100 -19.79700 3.18300   1.000 25.65000  ? 235  HIS A CG    1 
ATOM   1873 N  ND1   . HIS A 1 247 ? -15.10200 -18.92800 2.64800   1.000 31.70000  ? 235  HIS A ND1   1 
ATOM   1874 C  CD2   . HIS A 1 247 ? -16.41800 -20.60100 2.16600   1.000 26.10000  ? 235  HIS A CD2   1 
ATOM   1875 C  CE1   . HIS A 1 247 ? -14.93900 -19.19300 1.36300   1.000 34.25000  ? 235  HIS A CE1   1 
ATOM   1876 N  NE2   . HIS A 1 247 ? -15.72700 -20.20600 1.04400   1.000 30.25000  ? 235  HIS A NE2   1 
ATOM   1877 N  N     . PRO A 1 248 ? -16.35500 -19.70100 7.62900   1.000 33.51000  ? 236  PRO A N     1 
ATOM   1878 C  CA    . PRO A 1 248 ? -16.73700 -19.88700 9.03800   1.000 31.94000  ? 236  PRO A CA    1 
ATOM   1879 C  C     . PRO A 1 248 ? -18.22400 -20.16100 9.23400   1.000 36.38000  ? 236  PRO A C     1 
ATOM   1880 O  O     . PRO A 1 248 ? -18.57700 -20.93800 10.10600  1.000 38.73000  ? 236  PRO A O     1 
ATOM   1881 C  CB    . PRO A 1 248 ? -16.33000 -18.55400 9.68800   1.000 32.10000  ? 236  PRO A CB    1 
ATOM   1882 C  CG    . PRO A 1 248 ? -15.32800 -17.94700 8.73700   1.000 33.02000  ? 236  PRO A CG    1 
ATOM   1883 C  CD    . PRO A 1 248 ? -15.78400 -18.37000 7.36800   1.000 32.18000  ? 236  PRO A CD    1 
ATOM   1884 N  N     . ASP A 1 249 ? -19.07300 -19.52900 8.43400   1.000 39.20000  ? 237  ASP A N     1 
ATOM   1885 C  CA    . ASP A 1 249 ? -20.51900 -19.65400 8.59400   1.000 35.97000  ? 237  ASP A CA    1 
ATOM   1886 C  C     . ASP A 1 249 ? -21.13800 -20.49300 7.48700   1.000 37.27000  ? 237  ASP A C     1 
ATOM   1887 O  O     . ASP A 1 249 ? -22.35100 -20.71600 7.47400   1.000 38.95000  ? 237  ASP A O     1 
ATOM   1888 C  CB    . ASP A 1 249 ? -21.18100 -18.27200 8.58700   1.000 45.33000  ? 237  ASP A CB    1 
ATOM   1889 C  CG    . ASP A 1 249 ? -21.35200 -17.69500 9.98100   1.000 61.66000  ? 237  ASP A CG    1 
ATOM   1890 O  OD1   . ASP A 1 249 ? -20.43300 -17.88300 10.81700  1.000 60.20000  ? 237  ASP A OD1   1 
ATOM   1891 O  OD2   . ASP A 1 249 ? -22.41300 -17.05200 10.23200  1.000 60.62000  ? 237  ASP A OD2   1 
ATOM   1892 N  N     . LYS A 1 250 ? -20.31000 -20.93000 6.54200   1.000 32.92000  ? 238  LYS A N     1 
ATOM   1893 C  CA    . LYS A 1 250 ? -20.83100 -21.60100 5.36300   1.000 30.51000  ? 238  LYS A CA    1 
ATOM   1894 C  C     . LYS A 1 250 ? -19.75200 -22.45800 4.70700   1.000 28.56000  ? 238  LYS A C     1 
ATOM   1895 O  O     . LYS A 1 250 ? -18.56700 -22.26700 4.94900   1.000 29.46000  ? 238  LYS A O     1 
ATOM   1896 C  CB    . LYS A 1 250 ? -21.39400 -20.56600 4.37200   1.000 33.66000  ? 238  LYS A CB    1 
ATOM   1897 C  CG    . LYS A 1 250 ? -20.33600 -19.82100 3.55900   1.000 31.73000  ? 238  LYS A CG    1 
ATOM   1898 C  CD    . LYS A 1 250 ? -20.87800 -18.52300 2.95200   1.000 41.25000  ? 238  LYS A CD    1 
ATOM   1899 C  CE    . LYS A 1 250 ? -19.80200 -17.79000 2.11500   1.000 46.94000  ? 238  LYS A CE    1 
ATOM   1900 N  NZ    . LYS A 1 250 ? -19.54000 -18.45500 0.78100   1.000 44.67000  ? 238  LYS A NZ    1 
ATOM   1901 N  N     . TRP A 1 251 ? -20.17400 -23.42700 3.90100   1.000 26.11000  ? 239  TRP A N     1 
ATOM   1902 C  CA    . TRP A 1 251 ? -19.21300 -24.25800 3.19600   1.000 28.50000  ? 239  TRP A CA    1 
ATOM   1903 C  C     . TRP A 1 251 ? -19.61600 -24.32100 1.75500   1.000 29.08000  ? 239  TRP A C     1 
ATOM   1904 O  O     . TRP A 1 251 ? -20.75400 -24.02300 1.41800   1.000 31.76000  ? 239  TRP A O     1 
ATOM   1905 C  CB    . TRP A 1 251 ? -19.11400 -25.68100 3.79800   1.000 26.77000  ? 239  TRP A CB    1 
ATOM   1906 C  CG    . TRP A 1 251 ? -20.40200 -26.48000 3.81500   1.000 24.26000  ? 239  TRP A CG    1 
ATOM   1907 C  CD1   . TRP A 1 251 ? -21.30100 -26.55600 4.84400   1.000 23.24000  ? 239  TRP A CD1   1 
ATOM   1908 C  CD2   . TRP A 1 251 ? -20.90000 -27.33400 2.78100   1.000 22.94000  ? 239  TRP A CD2   1 
ATOM   1909 N  NE1   . TRP A 1 251 ? -22.33600 -27.38100 4.50300   1.000 22.54000  ? 239  TRP A NE1   1 
ATOM   1910 C  CE2   . TRP A 1 251 ? -22.11600 -27.87300 3.24100   1.000 18.98000  ? 239  TRP A CE2   1 
ATOM   1911 C  CE3   . TRP A 1 251 ? -20.44200 -27.69100 1.50700   1.000 26.03000  ? 239  TRP A CE3   1 
ATOM   1912 C  CZ2   . TRP A 1 251 ? -22.87800 -28.74900 2.47900   1.000 19.46000  ? 239  TRP A CZ2   1 
ATOM   1913 C  CZ3   . TRP A 1 251 ? -21.20900 -28.55100 0.74600   1.000 24.37000  ? 239  TRP A CZ3   1 
ATOM   1914 C  CH2   . TRP A 1 251 ? -22.41700 -29.07500 1.23800   1.000 24.22000  ? 239  TRP A CH2   1 
ATOM   1915 N  N     . THR A 1 252 ? -18.67700 -24.73000 0.91500   1.000 29.61000  ? 240  THR A N     1 
ATOM   1916 C  CA    . THR A 1 252 ? -18.87200 -24.70500 -0.52500  1.000 32.58000  ? 240  THR A CA    1 
ATOM   1917 C  C     . THR A 1 252 ? -18.02000 -25.78300 -1.19500  1.000 34.17000  ? 240  THR A C     1 
ATOM   1918 O  O     . THR A 1 252 ? -16.97500 -26.18000 -0.67000  1.000 33.17000  ? 240  THR A O     1 
ATOM   1919 C  CB    . THR A 1 252 ? -18.52300 -23.31600 -1.10200  1.000 36.36000  ? 240  THR A CB    1 
ATOM   1920 O  OG1   . THR A 1 252 ? -19.73500 -22.60500 -1.38800  1.000 40.73000  ? 240  THR A OG1   1 
ATOM   1921 C  CG2   . THR A 1 252 ? -17.66600 -23.45000 -2.36800  1.000 35.70000  ? 240  THR A CG2   1 
ATOM   1922 N  N     . VAL A 1 253 ? -18.48800 -26.28000 -2.33400  1.000 31.42000  ? 241  VAL A N     1 
ATOM   1923 C  CA    . VAL A 1 253 ? -17.78800 -27.35200 -3.00500  1.000 30.75000  ? 241  VAL A CA    1 
ATOM   1924 C  C     . VAL A 1 253 ? -16.92200 -26.70900 -4.03700  1.000 34.82000  ? 241  VAL A C     1 
ATOM   1925 O  O     . VAL A 1 253 ? -17.33200 -25.75500 -4.70800  1.000 37.02000  ? 241  VAL A O     1 
ATOM   1926 C  CB    . VAL A 1 253 ? -18.73600 -28.39000 -3.66500  1.000 32.23000  ? 241  VAL A CB    1 
ATOM   1927 C  CG1   . VAL A 1 253 ? -19.41400 -27.82300 -4.92900  1.000 34.17000  ? 241  VAL A CG1   1 
ATOM   1928 C  CG2   . VAL A 1 253 ? -17.96000 -29.64000 -4.02100  1.000 33.75000  ? 241  VAL A CG2   1 
ATOM   1929 N  N     . GLN A 1 254 ? -15.70400 -27.20800 -4.13900  1.000 39.86000  ? 242  GLN A N     1 
ATOM   1930 C  CA    . GLN A 1 254 ? -14.76600 -26.66200 -5.09500  1.000 46.00000  ? 242  GLN A CA    1 
ATOM   1931 C  C     . GLN A 1 254 ? -15.38000 -26.87900 -6.47900  1.000 47.62000  ? 242  GLN A C     1 
ATOM   1932 O  O     . GLN A 1 254 ? -16.04000 -27.88800 -6.72100  1.000 50.30000  ? 242  GLN A O     1 
ATOM   1933 C  CB    . GLN A 1 254 ? -13.38600 -27.32100 -4.92700  1.000 46.02000  ? 242  GLN A CB    1 
ATOM   1934 C  CG    . GLN A 1 254 ? -12.82200 -27.19700 -3.48400  1.000 41.59000  ? 242  GLN A CG    1 
ATOM   1935 C  CD    . GLN A 1 254 ? -11.47000 -27.89600 -3.28400  1.000 43.56000  ? 242  GLN A CD    1 
ATOM   1936 O  OE1   . GLN A 1 254 ? -10.90900 -28.47800 -4.22900  1.000 47.83000  ? 242  GLN A OE1   1 
ATOM   1937 N  NE2   . GLN A 1 254 ? -10.93900 -27.84400 -2.05200  1.000 31.19000  ? 242  GLN A NE2   1 
ATOM   1938 N  N     . PRO A 1 255 ? -15.16100 -25.93100 -7.39300  1.000 51.99000  ? 243  PRO A N     1 
ATOM   1939 C  CA    . PRO A 1 255 ? -15.91900 -25.79400 -8.64700  1.000 48.61000  ? 243  PRO A CA    1 
ATOM   1940 C  C     . PRO A 1 255 ? -16.02400 -27.07900 -9.45300  1.000 53.04000  ? 243  PRO A C     1 
ATOM   1941 O  O     . PRO A 1 255 ? -15.04600 -27.83400 -9.54600  1.000 51.69000  ? 243  PRO A O     1 
ATOM   1942 C  CB    . PRO A 1 255 ? -15.11200 -24.76000 -9.42300  1.000 50.20000  ? 243  PRO A CB    1 
ATOM   1943 C  CG    . PRO A 1 255 ? -13.71600 -24.92000 -8.89500  1.000 56.51000  ? 243  PRO A CG    1 
ATOM   1944 C  CD    . PRO A 1 255 ? -13.88400 -25.19200 -7.43900  1.000 52.47000  ? 243  PRO A CD    1 
ATOM   1945 N  N     . ILE A 1 256 ? -17.19700 -27.30700 -10.03800 1.000 53.50000  ? 244  ILE A N     1 
ATOM   1946 C  CA    . ILE A 1 256 ? -17.43800 -28.49200 -10.86200 1.000 51.02000  ? 244  ILE A CA    1 
ATOM   1947 C  C     . ILE A 1 256 ? -17.55000 -28.12900 -12.34100 1.000 55.42000  ? 244  ILE A C     1 
ATOM   1948 O  O     . ILE A 1 256 ? -18.36300 -27.28800 -12.72300 1.000 58.20000  ? 244  ILE A O     1 
ATOM   1949 C  CB    . ILE A 1 256 ? -18.72000 -29.22200 -10.42500 1.000 51.44000  ? 244  ILE A CB    1 
ATOM   1950 C  CG1   . ILE A 1 256 ? -18.59800 -29.67900 -8.97000  1.000 45.15000  ? 244  ILE A CG1   1 
ATOM   1951 C  CG2   . ILE A 1 256 ? -19.00100 -30.40700 -11.34200 1.000 49.53000  ? 244  ILE A CG2   1 
ATOM   1952 C  CD1   . ILE A 1 256 ? -19.87000 -30.23900 -8.40900  1.000 38.20000  ? 244  ILE A CD1   1 
ATOM   1953 N  N     . VAL A 1 257 ? -16.73500 -28.76600 -13.17200 1.000 58.47000  ? 245  VAL A N     1 
ATOM   1954 C  CA    . VAL A 1 257 ? -16.68300 -28.42400 -14.58700 1.000 56.75000  ? 245  VAL A CA    1 
ATOM   1955 C  C     . VAL A 1 257 ? -17.22100 -29.57200 -15.40400 1.000 58.24000  ? 245  VAL A C     1 
ATOM   1956 O  O     . VAL A 1 257 ? -16.73000 -30.69900 -15.29900 1.000 59.65000  ? 245  VAL A O     1 
ATOM   1957 C  CB    . VAL A 1 257 ? -15.24000 -28.08200 -15.04300 1.000 53.24000  ? 245  VAL A CB    1 
ATOM   1958 C  CG1   . VAL A 1 257 ? -14.69400 -26.90900 -14.24000 1.000 47.51000  ? 245  VAL A CG1   1 
ATOM   1959 C  CG2   . VAL A 1 257 ? -14.32400 -29.27900 -14.88200 1.000 59.42000  ? 245  VAL A CG2   1 
ATOM   1960 N  N     . LEU A 1 258 ? -18.24200 -29.29900 -16.20900 1.000 58.28000  ? 246  LEU A N     1 
ATOM   1961 C  CA    . LEU A 1 258 ? -18.82900 -30.34100 -17.05000 1.000 60.29000  ? 246  LEU A CA    1 
ATOM   1962 C  C     . LEU A 1 258 ? -18.29200 -30.31500 -18.47200 1.000 70.09000  ? 246  LEU A C     1 
ATOM   1963 O  O     . LEU A 1 258 ? -18.33500 -29.27200 -19.13600 1.000 73.24000  ? 246  LEU A O     1 
ATOM   1964 C  CB    . LEU A 1 258 ? -20.33900 -30.20100 -17.09600 1.000 60.93000  ? 246  LEU A CB    1 
ATOM   1965 C  CG    . LEU A 1 258 ? -21.04900 -30.36200 -15.76100 1.000 60.35000  ? 246  LEU A CG    1 
ATOM   1966 C  CD1   . LEU A 1 258 ? -22.53900 -30.15100 -15.96600 1.000 50.53000  ? 246  LEU A CD1   1 
ATOM   1967 C  CD2   . LEU A 1 258 ? -20.75700 -31.74500 -15.20100 1.000 51.50000  ? 246  LEU A CD2   1 
ATOM   1968 N  N     . PRO A 1 259 ? -17.79800 -31.47200 -18.94900 1.000 69.51000  ? 247  PRO A N     1 
ATOM   1969 C  CA    . PRO A 1 259 ? -17.31300 -31.65500 -20.32600 1.000 71.94000  ? 247  PRO A CA    1 
ATOM   1970 C  C     . PRO A 1 259 ? -18.25200 -31.03900 -21.37300 1.000 75.43000  ? 247  PRO A C     1 
ATOM   1971 O  O     . PRO A 1 259 ? -19.44300 -30.84200 -21.10000 1.000 73.69000  ? 247  PRO A O     1 
ATOM   1972 C  CB    . PRO A 1 259 ? -17.25400 -33.17900 -20.46700 1.000 70.41000  ? 247  PRO A CB    1 
ATOM   1973 C  CG    . PRO A 1 259 ? -16.96000 -33.65900 -19.07900 1.000 66.63000  ? 247  PRO A CG    1 
ATOM   1974 C  CD    . PRO A 1 259 ? -17.65000 -32.69700 -18.13800 1.000 63.58000  ? 247  PRO A CD    1 
ATOM   1975 N  N     . GLU A 1 260 ? -17.72400 -30.73100 -22.55300 1.000 74.89000  ? 248  GLU A N     1 
ATOM   1976 C  CA    . GLU A 1 260 ? -18.55500 -30.15400 -23.61000 1.000 76.44000  ? 248  GLU A CA    1 
ATOM   1977 C  C     . GLU A 1 260 ? -18.38000 -30.84300 -24.95800 1.000 79.24000  ? 248  GLU A C     1 
ATOM   1978 O  O     . GLU A 1 260 ? -18.52000 -30.19900 -26.00200 1.000 79.51000  ? 248  GLU A O     1 
ATOM   1979 C  CB    . GLU A 1 260 ? -18.26000 -28.66300 -23.76200 1.000 74.08000  ? 248  GLU A CB    1 
ATOM   1980 C  CG    . GLU A 1 260 ? -19.35700 -27.76700 -23.23300 1.000 74.06000  ? 248  GLU A CG    1 
ATOM   1981 C  CD    . GLU A 1 260 ? -18.81600 -26.42000 -22.79000 1.000 80.83000  ? 248  GLU A CD    1 
ATOM   1982 O  OE1   . GLU A 1 260 ? -19.59100 -25.62000 -22.21500 1.000 74.21000  ? 248  GLU A OE1   1 
ATOM   1983 O  OE2   . GLU A 1 260 ? -17.60900 -26.16300 -23.01600 1.000 80.35000  ? 248  GLU A OE2   1 
ATOM   1984 N  N     . LYS A 1 261 ? -18.08100 -32.14300 -24.93500 1.000 78.26000  ? 249  LYS A N     1 
ATOM   1985 C  CA    . LYS A 1 261 ? -18.01700 -32.94300 -26.16100 1.000 75.02000  ? 249  LYS A CA    1 
ATOM   1986 C  C     . LYS A 1 261 ? -19.27300 -32.70900 -27.00500 1.000 79.50000  ? 249  LYS A C     1 
ATOM   1987 O  O     . LYS A 1 261 ? -20.32700 -32.30900 -26.48600 1.000 79.24000  ? 249  LYS A O     1 
ATOM   1988 C  CB    . LYS A 1 261 ? -17.88500 -34.44300 -25.84800 1.000 71.87000  ? 249  LYS A CB    1 
ATOM   1989 C  CG    . LYS A 1 261 ? -17.02300 -34.80100 -24.64300 1.000 76.31000  ? 249  LYS A CG    1 
ATOM   1990 C  CD    . LYS A 1 261 ? -15.53800 -34.66600 -24.95100 1.000 89.70000  ? 249  LYS A CD    1 
ATOM   1991 C  CE    . LYS A 1 261 ? -14.68000 -34.87000 -23.70300 1.000 89.98000  ? 249  LYS A CE    1 
ATOM   1992 N  NZ    . LYS A 1 261 ? -13.23100 -34.75000 -24.01900 1.000 84.74000  ? 249  LYS A NZ    1 
ATOM   1993 N  N     . ASP A 1 262 ? -19.16700 -32.94600 -28.30600 1.000 79.89000  ? 250  ASP A N     1 
ATOM   1994 C  CA    . ASP A 1 262 ? -20.34600 -32.90900 -29.16100 1.000 78.72000  ? 250  ASP A CA    1 
ATOM   1995 C  C     . ASP A 1 262 ? -20.55700 -34.31000 -29.72400 1.000 75.87000  ? 250  ASP A C     1 
ATOM   1996 O  O     . ASP A 1 262 ? -21.54500 -34.60300 -30.39100 1.000 76.90000  ? 250  ASP A O     1 
ATOM   1997 C  CB    . ASP A 1 262 ? -20.19500 -31.84300 -30.25100 1.000 81.58000  ? 250  ASP A CB    1 
ATOM   1998 C  CG    . ASP A 1 262 ? -20.30600 -30.41900 -29.68800 1.000 89.64000  ? 250  ASP A CG    1 
ATOM   1999 O  OD1   . ASP A 1 262 ? -20.05100 -30.22400 -28.47700 1.000 90.00000  ? 250  ASP A OD1   1 
ATOM   2000 O  OD2   . ASP A 1 262 ? -20.65500 -29.49200 -30.44600 1.000 86.53000  ? 250  ASP A OD2   1 
ATOM   2001 N  N     . SER A 1 263 ? -19.60500 -35.17400 -29.41100 1.000 75.88000  ? 251  SER A N     1 
ATOM   2002 C  CA    . SER A 1 263 ? -19.75400 -36.60800 -29.58600 1.000 73.06000  ? 251  SER A CA    1 
ATOM   2003 C  C     . SER A 1 263 ? -19.44000 -37.28300 -28.24000 1.000 73.08000  ? 251  SER A C     1 
ATOM   2004 O  O     . SER A 1 263 ? -18.36300 -37.09500 -27.66200 1.000 75.70000  ? 251  SER A O     1 
ATOM   2005 C  CB    . SER A 1 263 ? -18.83500 -37.12000 -30.69800 1.000 67.41000  ? 251  SER A CB    1 
ATOM   2006 O  OG    . SER A 1 263 ? -18.69900 -38.52900 -30.63300 1.000 64.91000  ? 251  SER A OG    1 
ATOM   2007 N  N     . TRP A 1 264 ? -20.38600 -38.06000 -27.73500 1.000 67.52000  ? 252  TRP A N     1 
ATOM   2008 C  CA    . TRP A 1 264 ? -20.24500 -38.63300 -26.40600 1.000 62.96000  ? 252  TRP A CA    1 
ATOM   2009 C  C     . TRP A 1 264 ? -20.07800 -40.14200 -26.45400 1.000 62.32000  ? 252  TRP A C     1 
ATOM   2010 O  O     . TRP A 1 264 ? -20.85400 -40.83000 -27.11500 1.000 66.89000  ? 252  TRP A O     1 
ATOM   2011 C  CB    . TRP A 1 264 ? -21.46600 -38.28400 -25.55100 1.000 57.91000  ? 252  TRP A CB    1 
ATOM   2012 C  CG    . TRP A 1 264 ? -21.73400 -36.82200 -25.43400 1.000 56.77000  ? 252  TRP A CG    1 
ATOM   2013 C  CD1   . TRP A 1 264 ? -22.32600 -36.02500 -26.36300 1.000 61.75000  ? 252  TRP A CD1   1 
ATOM   2014 C  CD2   . TRP A 1 264 ? -21.44000 -35.98100 -24.31000 1.000 59.70000  ? 252  TRP A CD2   1 
ATOM   2015 N  NE1   . TRP A 1 264 ? -22.41400 -34.73400 -25.89700 1.000 64.65000  ? 252  TRP A NE1   1 
ATOM   2016 C  CE2   . TRP A 1 264 ? -21.87500 -34.67900 -24.64000 1.000 57.45000  ? 252  TRP A CE2   1 
ATOM   2017 C  CE3   . TRP A 1 264 ? -20.85100 -36.19900 -23.06000 1.000 51.98000  ? 252  TRP A CE3   1 
ATOM   2018 C  CZ2   . TRP A 1 264 ? -21.73200 -33.60400 -23.77500 1.000 55.97000  ? 252  TRP A CZ2   1 
ATOM   2019 C  CZ3   . TRP A 1 264 ? -20.71300 -35.13000 -22.19900 1.000 54.33000  ? 252  TRP A CZ3   1 
ATOM   2020 C  CH2   . TRP A 1 264 ? -21.15100 -33.85000 -22.55900 1.000 61.20000  ? 252  TRP A CH2   1 
ATOM   2021 N  N     . THR A 1 265 ? -19.08000 -40.65700 -25.74000 1.000 60.05000  ? 253  THR A N     1 
ATOM   2022 C  CA    . THR A 1 265 ? -18.95700 -42.09900 -25.53600 1.000 56.89000  ? 253  THR A CA    1 
ATOM   2023 C  C     . THR A 1 265 ? -19.54000 -42.51700 -24.19400 1.000 56.12000  ? 253  THR A C     1 
ATOM   2024 O  O     . THR A 1 265 ? -19.71600 -41.68500 -23.30300 1.000 58.32000  ? 253  THR A O     1 
ATOM   2025 C  CB    . THR A 1 265 ? -17.50200 -42.55300 -25.57400 1.000 58.95000  ? 253  THR A CB    1 
ATOM   2026 O  OG1   . THR A 1 265 ? -16.82300 -42.04900 -24.41700 1.000 60.07000  ? 253  THR A OG1   1 
ATOM   2027 C  CG2   . THR A 1 265 ? -16.82000 -42.04000 -26.82200 1.000 64.20000  ? 253  THR A CG2   1 
ATOM   2028 N  N     . VAL A 1 266 ? -19.83100 -43.80900 -24.05700 1.000 52.61000  ? 254  VAL A N     1 
ATOM   2029 C  CA    . VAL A 1 266 ? -20.17000 -44.40200 -22.76600 1.000 54.21000  ? 254  VAL A CA    1 
ATOM   2030 C  C     . VAL A 1 266 ? -19.31900 -43.84000 -21.63000 1.000 53.24000  ? 254  VAL A C     1 
ATOM   2031 O  O     . VAL A 1 266 ? -19.85600 -43.37700 -20.63000 1.000 58.00000  ? 254  VAL A O     1 
ATOM   2032 C  CB    . VAL A 1 266 ? -20.00100 -45.93200 -22.78900 1.000 59.42000  ? 254  VAL A CB    1 
ATOM   2033 C  CG1   . VAL A 1 266 ? -19.71600 -46.44700 -21.39600 1.000 55.67000  ? 254  VAL A CG1   1 
ATOM   2034 C  CG2   . VAL A 1 266 ? -21.23900 -46.59900 -23.37000 1.000 60.46000  ? 254  VAL A CG2   1 
ATOM   2035 N  N     . ASN A 1 267 ? -18.00200 -43.86000 -21.79500 1.000 52.55000  ? 255  ASN A N     1 
ATOM   2036 C  CA    . ASN A 1 267 ? -17.10300 -43.31800 -20.78000 1.000 58.30000  ? 255  ASN A CA    1 
ATOM   2037 C  C     . ASN A 1 267 ? -17.32400 -41.82500 -20.55100 1.000 56.63000  ? 255  ASN A C     1 
ATOM   2038 O  O     . ASN A 1 267 ? -17.33500 -41.36200 -19.41400 1.000 56.02000  ? 255  ASN A O     1 
ATOM   2039 C  CB    . ASN A 1 267 ? -15.64300 -43.57300 -21.16200 1.000 63.67000  ? 255  ASN A CB    1 
ATOM   2040 C  CG    . ASN A 1 267 ? -14.66400 -43.06600 -20.10900 1.000 65.43000  ? 255  ASN A CG    1 
ATOM   2041 O  OD1   . ASN A 1 267 ? -14.45600 -43.71400 -19.08000 1.000 66.11000  ? 255  ASN A OD1   1 
ATOM   2042 N  ND2   . ASN A 1 267 ? -14.04800 -41.91000 -20.37000 1.000 63.09000  ? 255  ASN A ND2   1 
ATOM   2043 N  N     . ASP A 1 268 ? -17.48400 -41.07600 -21.63400 1.000 55.03000  ? 256  ASP A N     1 
ATOM   2044 C  CA    . ASP A 1 268 ? -17.86500 -39.67500 -21.53300 1.000 57.30000  ? 256  ASP A CA    1 
ATOM   2045 C  C     . ASP A 1 268 ? -19.10400 -39.51300 -20.66100 1.000 56.97000  ? 256  ASP A C     1 
ATOM   2046 O  O     . ASP A 1 268 ? -19.11300 -38.71700 -19.71800 1.000 54.74000  ? 256  ASP A O     1 
ATOM   2047 C  CB    . ASP A 1 268 ? -18.14200 -39.07900 -22.92000 1.000 65.52000  ? 256  ASP A CB    1 
ATOM   2048 C  CG    . ASP A 1 268 ? -16.87500 -38.84600 -23.72900 1.000 74.24000  ? 256  ASP A CG    1 
ATOM   2049 O  OD1   . ASP A 1 268 ? -15.94300 -38.17500 -23.22200 1.000 73.32000  ? 256  ASP A OD1   1 
ATOM   2050 O  OD2   . ASP A 1 268 ? -16.82400 -39.33900 -24.88100 1.000 75.05000  ? 256  ASP A OD2   1 
ATOM   2051 N  N     . ILE A 1 269 ? -20.15200 -40.26400 -20.98900 1.000 53.52000  ? 257  ILE A N     1 
ATOM   2052 C  CA    . ILE A 1 269 ? -21.40400 -40.20400 -20.24200 1.000 49.97000  ? 257  ILE A CA    1 
ATOM   2053 C  C     . ILE A 1 269 ? -21.19900 -40.56400 -18.77400 1.000 51.26000  ? 257  ILE A C     1 
ATOM   2054 O  O     . ILE A 1 269 ? -21.54600 -39.77700 -17.87900 1.000 46.57000  ? 257  ILE A O     1 
ATOM   2055 C  CB    . ILE A 1 269 ? -22.45500 -41.14900 -20.83600 1.000 50.03000  ? 257  ILE A CB    1 
ATOM   2056 C  CG1   . ILE A 1 269 ? -22.78900 -40.72500 -22.25800 1.000 49.32000  ? 257  ILE A CG1   1 
ATOM   2057 C  CG2   . ILE A 1 269 ? -23.72400 -41.11200 -20.01000 1.000 49.34000  ? 257  ILE A CG2   1 
ATOM   2058 C  CD1   . ILE A 1 269 ? -23.42700 -39.38100 -22.31000 1.000 54.29000  ? 257  ILE A CD1   1 
ATOM   2059 N  N     . CYS A 1 270 ? -20.63100 -41.75300 -18.53500 1.000 50.47000  ? 258  CYS A N     1 
ATOM   2060 C  CA    . CYS A 1 270 ? -20.34000 -42.22900 -17.18600 1.000 42.75000  ? 258  CYS A CA    1 
ATOM   2061 C  C     . CYS A 1 270 ? -19.56500 -41.19300 -16.39400 1.000 44.67000  ? 258  CYS A C     1 
ATOM   2062 O  O     . CYS A 1 270 ? -19.62900 -41.16600 -15.16900 1.000 50.97000  ? 258  CYS A O     1 
ATOM   2063 C  CB    . CYS A 1 270 ? -19.54400 -43.53000 -17.23000 1.000 39.87000  ? 258  CYS A CB    1 
ATOM   2064 S  SG    . CYS A 1 270 ? -20.50500 -45.00300 -16.88600 1.000 48.22000  ? 258  CYS A SG    1 
ATOM   2065 N  N     . LYS A 1 271 ? -18.83900 -40.33400 -17.09100 1.000 42.15000  ? 259  LYS A N     1 
ATOM   2066 C  CA    . LYS A 1 271 ? -18.00400 -39.35400 -16.42500 1.000 42.40000  ? 259  LYS A CA    1 
ATOM   2067 C  C     . LYS A 1 271 ? -18.80500 -38.09900 -16.13100 1.000 41.66000  ? 259  LYS A C     1 
ATOM   2068 O  O     . LYS A 1 271 ? -18.41200 -37.26900 -15.32000 1.000 43.61000  ? 259  LYS A O     1 
ATOM   2069 C  CB    . LYS A 1 271 ? -16.77100 -39.05600 -17.28400 1.000 43.71000  ? 259  LYS A CB    1 
ATOM   2070 C  CG    . LYS A 1 271 ? -15.84400 -38.01900 -16.73900 1.000 44.46000  ? 259  LYS A CG    1 
ATOM   2071 C  CD    . LYS A 1 271 ? -14.63700 -37.87300 -17.66100 1.000 59.18000  ? 259  LYS A CD    1 
ATOM   2072 C  CE    . LYS A 1 271 ? -14.15400 -36.41700 -17.74400 1.000 70.75000  ? 259  LYS A CE    1 
ATOM   2073 N  NZ    . LYS A 1 271 ? -14.22500 -35.86700 -19.14900 1.000 77.30000  ? 259  LYS A NZ    1 
ATOM   2074 N  N     . LEU A 1 272 ? -19.95500 -37.97300 -16.77600 1.000 45.31000  ? 260  LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 272 ? -20.79200 -36.79800 -16.57200 1.000 41.33000  ? 260  LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 272 ? -21.85600 -37.05500 -15.52300 1.000 39.29000  ? 260  LEU A C     1 
ATOM   2077 O  O     . LEU A 1 272 ? -22.27300 -36.13900 -14.82800 1.000 40.32000  ? 260  LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 272 ? -21.44400 -36.38500 -17.88100 1.000 52.00000  ? 260  LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 272 ? -22.55700 -35.33600 -17.84800 1.000 46.58000  ? 260  LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 272 ? -21.99700 -33.92500 -17.63900 1.000 45.35000  ? 260  LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 272 ? -23.33800 -35.43200 -19.14000 1.000 40.16000  ? 260  LEU A CD2   1 
ATOM   2082 N  N     . VAL A 1 273 ? -22.29900 -38.30600 -15.42400 1.000 40.75000  ? 261  VAL A N     1 
ATOM   2083 C  CA    . VAL A 1 273 ? -23.28800 -38.68600 -14.41700 1.000 42.52000  ? 261  VAL A CA    1 
ATOM   2084 C  C     . VAL A 1 273 ? -22.66800 -38.68200 -13.01900 1.000 43.66000  ? 261  VAL A C     1 
ATOM   2085 O  O     . VAL A 1 273 ? -23.33800 -38.39600 -12.01800 1.000 41.06000  ? 261  VAL A O     1 
ATOM   2086 C  CB    . VAL A 1 273 ? -23.87800 -40.07200 -14.69400 1.000 37.33000  ? 261  VAL A CB    1 
ATOM   2087 C  CG1   . VAL A 1 273 ? -24.91500 -40.40900 -13.65600 1.000 36.61000  ? 261  VAL A CG1   1 
ATOM   2088 C  CG2   . VAL A 1 273 ? -24.49900 -40.10000 -16.07000 1.000 43.00000  ? 261  VAL A CG2   1 
ATOM   2089 N  N     . GLY A 1 274 ? -21.38100 -39.00500 -12.96400 1.000 39.99000  ? 262  GLY A N     1 
ATOM   2090 C  CA    . GLY A 1 274 ? -20.65000 -38.95400 -11.71800 1.000 34.65000  ? 262  GLY A CA    1 
ATOM   2091 C  C     . GLY A 1 274 ? -20.52800 -37.53300 -11.21600 1.000 36.75000  ? 262  GLY A C     1 
ATOM   2092 O  O     . GLY A 1 274 ? -20.87800 -37.26500 -10.07500 1.000 39.05000  ? 262  GLY A O     1 
ATOM   2093 N  N     . LYS A 1 275 ? -20.03300 -36.62600 -12.05800 1.000 38.04000  ? 263  LYS A N     1 
ATOM   2094 C  CA    . LYS A 1 275 ? -19.86800 -35.23400 -11.64200 1.000 30.91000  ? 263  LYS A CA    1 
ATOM   2095 C  C     . LYS A 1 275 ? -21.20300 -34.61700 -11.25800 1.000 33.38000  ? 263  LYS A C     1 
ATOM   2096 O  O     . LYS A 1 275 ? -21.25500 -33.74600 -10.39500 1.000 37.08000  ? 263  LYS A O     1 
ATOM   2097 C  CB    . LYS A 1 275 ? -19.20900 -34.40500 -12.74500 1.000 34.26000  ? 263  LYS A CB    1 
ATOM   2098 C  CG    . LYS A 1 275 ? -17.83400 -34.89600 -13.12600 1.000 39.24000  ? 263  LYS A CG    1 
ATOM   2099 C  CD    . LYS A 1 275 ? -17.19700 -34.04400 -14.20500 1.000 36.50000  ? 263  LYS A CD    1 
ATOM   2100 C  CE    . LYS A 1 275 ? -15.70300 -33.88900 -13.94900 1.000 42.82000  ? 263  LYS A CE    1 
ATOM   2101 N  NZ    . LYS A 1 275 ? -15.38500 -32.73200 -13.03400 1.000 46.73000  ? 263  LYS A NZ    1 
ATOM   2102 N  N     . LEU A 1 276 ? -22.28400 -35.06200 -11.88900 1.000 33.73000  ? 264  LEU A N     1 
ATOM   2103 C  CA    . LEU A 1 276 ? -23.59600 -34.55700 -11.51600 1.000 32.35000  ? 264  LEU A CA    1 
ATOM   2104 C  C     . LEU A 1 276 ? -24.00800 -35.10400 -10.13100 1.000 36.60000  ? 264  LEU A C     1 
ATOM   2105 O  O     . LEU A 1 276 ? -24.38600 -34.31700 -9.23900  1.000 32.83000  ? 264  LEU A O     1 
ATOM   2106 C  CB    . LEU A 1 276 ? -24.63400 -34.89300 -12.58900 1.000 33.69000  ? 264  LEU A CB    1 
ATOM   2107 C  CG    . LEU A 1 276 ? -24.53400 -34.02300 -13.86400 1.000 36.68000  ? 264  LEU A CG    1 
ATOM   2108 C  CD1   . LEU A 1 276 ? -25.30400 -34.61300 -15.04200 1.000 35.44000  ? 264  LEU A CD1   1 
ATOM   2109 C  CD2   . LEU A 1 276 ? -24.98900 -32.60100 -13.61700 1.000 31.68000  ? 264  LEU A CD2   1 
ATOM   2110 N  N     . ASN A 1 277 ? -23.91800 -36.43100 -9.95000  1.000 31.39000  ? 265  ASN A N     1 
ATOM   2111 C  CA    . ASN A 1 277 ? -24.16300 -37.04900 -8.64800  1.000 28.89000  ? 265  ASN A CA    1 
ATOM   2112 C  C     . ASN A 1 277 ? -23.39700 -36.33300 -7.55400  1.000 30.79000  ? 265  ASN A C     1 
ATOM   2113 O  O     . ASN A 1 277 ? -23.94300 -35.94300 -6.52100  1.000 31.75000  ? 265  ASN A O     1 
ATOM   2114 C  CB    . ASN A 1 277 ? -23.76200 -38.52400 -8.64300  1.000 33.10000  ? 265  ASN A CB    1 
ATOM   2115 C  CG    . ASN A 1 277 ? -24.67100 -39.39900 -9.52000  1.000 41.06000  ? 265  ASN A CG    1 
ATOM   2116 O  OD1   . ASN A 1 277 ? -25.82500 -39.06400 -9.79900  1.000 31.19000  ? 265  ASN A OD1   1 
ATOM   2117 N  ND2   . ASN A 1 277 ? -24.14000 -40.54700 -9.93800  1.000 44.89000  ? 265  ASN A ND2   1 
ATOM   2118 N  N     . TRP A 1 278 ? -22.11300 -36.15100 -7.79200  1.000 30.90000  ? 266  TRP A N     1 
ATOM   2119 C  CA    . TRP A 1 278 ? -21.28800 -35.37400 -6.88700  1.000 29.59000  ? 266  TRP A CA    1 
ATOM   2120 C  C     . TRP A 1 278 ? -21.93000 -34.01600 -6.63600  1.000 31.99000  ? 266  TRP A C     1 
ATOM   2121 O  O     . TRP A 1 278 ? -22.05700 -33.59800 -5.48300  1.000 32.22000  ? 266  TRP A O     1 
ATOM   2122 C  CB    . TRP A 1 278 ? -19.87900 -35.23400 -7.45700  1.000 27.25000  ? 266  TRP A CB    1 
ATOM   2123 C  CG    . TRP A 1 278 ? -19.00700 -34.30700 -6.71100  1.000 25.87000  ? 266  TRP A CG    1 
ATOM   2124 C  CD1   . TRP A 1 278 ? -18.55400 -33.09800 -7.13700  1.000 28.61000  ? 266  TRP A CD1   1 
ATOM   2125 C  CD2   . TRP A 1 278 ? -18.46600 -34.50400 -5.40700  1.000 31.86000  ? 266  TRP A CD2   1 
ATOM   2126 N  NE1   . TRP A 1 278 ? -17.76400 -32.51900 -6.17900  1.000 30.24000  ? 266  TRP A NE1   1 
ATOM   2127 C  CE2   . TRP A 1 278 ? -17.68400 -33.36400 -5.10600  1.000 33.39000  ? 266  TRP A CE2   1 
ATOM   2128 C  CE3   . TRP A 1 278 ? -18.55900 -35.52700 -4.46100  1.000 28.56000  ? 266  TRP A CE3   1 
ATOM   2129 C  CZ2   . TRP A 1 278 ? -17.00600 -33.22000 -3.90400  1.000 26.17000  ? 266  TRP A CZ2   1 
ATOM   2130 C  CZ3   . TRP A 1 278 ? -17.88100 -35.38500 -3.27200  1.000 25.59000  ? 266  TRP A CZ3   1 
ATOM   2131 C  CH2   . TRP A 1 278 ? -17.11900 -34.24700 -3.00100  1.000 26.98000  ? 266  TRP A CH2   1 
ATOM   2132 N  N     . ALA A 1 279 ? -22.36800 -33.34800 -7.70700  1.000 31.96000  ? 267  ALA A N     1 
ATOM   2133 C  CA    . ALA A 1 279 ? -22.91400 -32.00600 -7.57500  1.000 26.62000  ? 267  ALA A CA    1 
ATOM   2134 C  C     . ALA A 1 279 ? -24.20300 -31.96300 -6.75000  1.000 28.03000  ? 267  ALA A C     1 
ATOM   2135 O  O     . ALA A 1 279 ? -24.50800 -30.94300 -6.12000  1.000 30.56000  ? 267  ALA A O     1 
ATOM   2136 C  CB    . ALA A 1 279 ? -23.16100 -31.41800 -8.92400  1.000 32.04000  ? 267  ALA A CB    1 
ATOM   2137 N  N     . SER A 1 280 ? -24.95500 -33.05700 -6.74700  1.000 24.91000  ? 268  SER A N     1 
ATOM   2138 C  CA    . SER A 1 280 ? -26.32200 -32.98800 -6.22800  1.000 30.06000  ? 268  SER A CA    1 
ATOM   2139 C  C     . SER A 1 280 ? -26.39200 -32.83900 -4.68900  1.000 27.60000  ? 268  SER A C     1 
ATOM   2140 O  O     . SER A 1 280 ? -27.43000 -32.46300 -4.14200  1.000 27.78000  ? 268  SER A O     1 
ATOM   2141 C  CB    . SER A 1 280 ? -27.12200 -34.21100 -6.67700  1.000 25.61000  ? 268  SER A CB    1 
ATOM   2142 O  OG    . SER A 1 280 ? -26.57800 -35.39700 -6.13700  1.000 26.02000  ? 268  SER A OG    1 
ATOM   2143 N  N     . GLN A 1 281 ? -25.28200 -33.09600 -4.00800  1.000 26.25000  ? 269  GLN A N     1 
ATOM   2144 C  CA    . GLN A 1 281 ? -25.19400 -32.92700 -2.56000  1.000 22.36000  ? 269  GLN A CA    1 
ATOM   2145 C  C     . GLN A 1 281 ? -25.43300 -31.49900 -2.08500  1.000 22.26000  ? 269  GLN A C     1 
ATOM   2146 O  O     . GLN A 1 281 ? -25.68600 -31.27900 -0.91100  1.000 25.39000  ? 269  GLN A O     1 
ATOM   2147 C  CB    . GLN A 1 281 ? -23.82600 -33.37800 -2.05200  1.000 20.47000  ? 269  GLN A CB    1 
ATOM   2148 C  CG    . GLN A 1 281 ? -22.72700 -32.55400 -2.61400  1.000 19.25000  ? 269  GLN A CG    1 
ATOM   2149 C  CD    . GLN A 1 281 ? -21.40700 -32.87900 -2.02000  1.000 22.21000  ? 269  GLN A CD    1 
ATOM   2150 O  OE1   . GLN A 1 281 ? -21.13900 -32.52200 -0.87800  1.000 24.01000  ? 269  GLN A OE1   1 
ATOM   2151 N  NE2   . GLN A 1 281 ? -20.54400 -33.54400 -2.78800  1.000 26.61000  ? 269  GLN A NE2   1 
ATOM   2152 N  N     . ILE A 1 282 ? -25.34400 -30.52200 -2.98200  1.000 26.68000  ? 270  ILE A N     1 
ATOM   2153 C  CA    . ILE A 1 282 ? -25.60300 -29.13500 -2.58200  1.000 28.25000  ? 270  ILE A CA    1 
ATOM   2154 C  C     . ILE A 1 282 ? -26.30800 -28.30200 -3.67400  1.000 27.95000  ? 270  ILE A C     1 
ATOM   2155 O  O     . ILE A 1 282 ? -26.82800 -27.22000 -3.39100  1.000 25.26000  ? 270  ILE A O     1 
ATOM   2156 C  CB    . ILE A 1 282 ? -24.28800 -28.43700 -2.16500  1.000 27.81000  ? 270  ILE A CB    1 
ATOM   2157 C  CG1   . ILE A 1 282 ? -24.55500 -27.04000 -1.60600  1.000 32.76000  ? 270  ILE A CG1   1 
ATOM   2158 C  CG2   . ILE A 1 282 ? -23.34600 -28.38200 -3.34000  1.000 28.06000  ? 270  ILE A CG2   1 
ATOM   2159 C  CD1   . ILE A 1 282 ? -25.59200 -26.98600 -0.49400  1.000 23.44000  ? 270  ILE A CD1   1 
ATOM   2160 N  N     . TYR A 1 283 ? -26.32200 -28.82300 -4.90200  1.000 30.88000  ? 271  TYR A N     1 
ATOM   2161 C  CA    . TYR A 1 283 ? -27.07500 -28.24200 -6.02600  1.000 29.73000  ? 271  TYR A CA    1 
ATOM   2162 C  C     . TYR A 1 283 ? -28.47700 -28.83900 -6.15500  1.000 29.82000  ? 271  TYR A C     1 
ATOM   2163 O  O     . TYR A 1 283 ? -28.63300 -29.94300 -6.66500  1.000 32.58000  ? 271  TYR A O     1 
ATOM   2164 C  CB    . TYR A 1 283 ? -26.33100 -28.47200 -7.34200  1.000 31.01000  ? 271  TYR A CB    1 
ATOM   2165 C  CG    . TYR A 1 283 ? -25.23400 -27.48500 -7.60600  1.000 34.10000  ? 271  TYR A CG    1 
ATOM   2166 C  CD1   . TYR A 1 283 ? -25.52500 -26.22700 -8.12300  1.000 35.13000  ? 271  TYR A CD1   1 
ATOM   2167 C  CD2   . TYR A 1 283 ? -23.89900 -27.80400 -7.34500  1.000 34.40000  ? 271  TYR A CD2   1 
ATOM   2168 C  CE1   . TYR A 1 283 ? -24.52900 -25.30600 -8.36700  1.000 41.96000  ? 271  TYR A CE1   1 
ATOM   2169 C  CE2   . TYR A 1 283 ? -22.89000 -26.88800 -7.58800  1.000 37.99000  ? 271  TYR A CE2   1 
ATOM   2170 C  CZ    . TYR A 1 283 ? -23.21400 -25.63800 -8.09600  1.000 47.78000  ? 271  TYR A CZ    1 
ATOM   2171 O  OH    . TYR A 1 283 ? -22.22800 -24.71200 -8.33400  1.000 49.88000  ? 271  TYR A OH    1 
ATOM   2172 N  N     . PRO A 1 284 ? -29.50500 -28.11500 -5.71000  1.000 28.00000  ? 272  PRO A N     1 
ATOM   2173 C  CA    . PRO A 1 284 ? -30.84500 -28.70900 -5.75800  1.000 29.35000  ? 272  PRO A CA    1 
ATOM   2174 C  C     . PRO A 1 284 ? -31.36100 -28.87800 -7.17400  1.000 30.94000  ? 272  PRO A C     1 
ATOM   2175 O  O     . PRO A 1 284 ? -31.03200 -28.05200 -8.01900  1.000 40.51000  ? 272  PRO A O     1 
ATOM   2176 C  CB    . PRO A 1 284 ? -31.70500 -27.69500 -5.00000  1.000 27.44000  ? 272  PRO A CB    1 
ATOM   2177 C  CG    . PRO A 1 284 ? -30.98000 -26.42500 -5.14100  1.000 30.98000  ? 272  PRO A CG    1 
ATOM   2178 C  CD    . PRO A 1 284 ? -29.52100 -26.78400 -5.08500  1.000 32.30000  ? 272  PRO A CD    1 
ATOM   2179 N  N     . GLY A 1 285 ? -32.14700 -29.92300 -7.42300  1.000 31.45000  ? 273  GLY A N     1 
ATOM   2180 C  CA    . GLY A 1 285 ? -32.84300 -30.07400 -8.68600  1.000 26.72000  ? 273  GLY A CA    1 
ATOM   2181 C  C     . GLY A 1 285 ? -32.11100 -30.80800 -9.79100  1.000 34.29000  ? 273  GLY A C     1 
ATOM   2182 O  O     . GLY A 1 285 ? -32.52500 -30.76700 -10.94500 1.000 44.24000  ? 273  GLY A O     1 
ATOM   2183 N  N     . ILE A 1 286 ? -31.02400 -31.48900 -9.46100  1.000 37.06000  ? 274  ILE A N     1 
ATOM   2184 C  CA    . ILE A 1 286 ? -30.26800 -32.21000 -10.47800 1.000 30.98000  ? 274  ILE A CA    1 
ATOM   2185 C  C     . ILE A 1 286 ? -30.99300 -33.49600 -10.91500 1.000 35.28000  ? 274  ILE A C     1 
ATOM   2186 O  O     . ILE A 1 286 ? -31.63400 -34.16800 -10.10000 1.000 39.99000  ? 274  ILE A O     1 
ATOM   2187 C  CB    . ILE A 1 286 ? -28.87500 -32.54200 -9.96700  1.000 28.58000  ? 274  ILE A CB    1 
ATOM   2188 C  CG1   . ILE A 1 286 ? -28.12000 -31.25300 -9.67900  1.000 32.94000  ? 274  ILE A CG1   1 
ATOM   2189 C  CG2   . ILE A 1 286 ? -28.09800 -33.32000 -11.00700 1.000 35.06000  ? 274  ILE A CG2   1 
ATOM   2190 C  CD1   . ILE A 1 286 ? -27.33200 -30.77200 -10.86300 1.000 33.16000  ? 274  ILE A CD1   1 
ATOM   2191 N  N     . LYS A 1 287 ? -30.89200 -33.83100 -12.19700 1.000 34.41000  ? 275  LYS A N     1 
ATOM   2192 C  CA    . LYS A 1 287 ? -31.57000 -35.00800 -12.75200 1.000 36.24000  ? 275  LYS A CA    1 
ATOM   2193 C  C     . LYS A 1 287 ? -30.66200 -35.75500 -13.73900 1.000 37.00000  ? 275  LYS A C     1 
ATOM   2194 O  O     . LYS A 1 287 ? -29.92100 -35.14300 -14.50400 1.000 36.39000  ? 275  LYS A O     1 
ATOM   2195 C  CB    . LYS A 1 287 ? -32.88200 -34.59200 -13.43100 1.000 35.67000  ? 275  LYS A CB    1 
ATOM   2196 C  CG    . LYS A 1 287 ? -33.90700 -33.99800 -12.47200 1.000 42.19000  ? 275  LYS A CG    1 
ATOM   2197 C  CD    . LYS A 1 287 ? -34.87200 -33.04700 -13.15500 1.000 46.25000  ? 275  LYS A CD    1 
ATOM   2198 C  CE    . LYS A 1 287 ? -35.52400 -33.68200 -14.36800 1.000 54.28000  ? 275  LYS A CE    1 
ATOM   2199 N  NZ    . LYS A 1 287 ? -36.29100 -32.67200 -15.15100 1.000 57.78000  ? 275  LYS A NZ    1 
ATOM   2200 N  N     . VAL A 1 288 ? -30.71300 -37.08100 -13.71800 1.000 35.10000  ? 276  VAL A N     1 
ATOM   2201 C  CA    . VAL A 1 288 ? -29.86000 -37.84900 -14.59900 1.000 31.98000  ? 276  VAL A CA    1 
ATOM   2202 C  C     . VAL A 1 288 ? -30.53400 -39.11500 -15.07200 1.000 35.51000  ? 276  VAL A C     1 
ATOM   2203 O  O     . VAL A 1 288 ? -29.87800 -40.08000 -15.42400 1.000 40.28000  ? 276  VAL A O     1 
ATOM   2204 C  CB    . VAL A 1 288 ? -28.53900 -38.20000 -13.92100 1.000 37.77000  ? 276  VAL A CB    1 
ATOM   2205 C  CG1   . VAL A 1 288 ? -27.84400 -36.93100 -13.44400 1.000 33.02000  ? 276  VAL A CG1   1 
ATOM   2206 C  CG2   . VAL A 1 288 ? -28.77000 -39.14500 -12.76400 1.000 35.20000  ? 276  VAL A CG2   1 
ATOM   2207 N  N     . ARG A 1 289 ? -31.85600 -39.10800 -15.10200 1.000 40.30000  ? 277  ARG A N     1 
ATOM   2208 C  CA    . ARG A 1 289 ? -32.58400 -40.25400 -15.62500 1.000 42.55000  ? 277  ARG A CA    1 
ATOM   2209 C  C     . ARG A 1 289 ? -32.28100 -40.45200 -17.10400 1.000 43.50000  ? 277  ARG A C     1 
ATOM   2210 O  O     . ARG A 1 289 ? -31.89000 -41.53200 -17.51800 1.000 45.90000  ? 277  ARG A O     1 
ATOM   2211 C  CB    . ARG A 1 289 ? -34.09000 -40.07200 -15.41400 1.000 41.23000  ? 277  ARG A CB    1 
ATOM   2212 C  CG    . ARG A 1 289 ? -34.97300 -40.88000 -16.37200 1.000 46.94000  ? 277  ARG A CG    1 
ATOM   2213 C  CD    . ARG A 1 289 ? -35.04700 -42.35600 -15.99200 1.000 49.05000  ? 277  ARG A CD    1 
ATOM   2214 N  NE    . ARG A 1 289 ? -35.57500 -42.52100 -14.63900 1.000 51.46000  ? 277  ARG A NE    1 
ATOM   2215 C  CZ    . ARG A 1 289 ? -34.86500 -42.96000 -13.60400 1.000 50.21000  ? 277  ARG A CZ    1 
ATOM   2216 N  NH1   . ARG A 1 289 ? -33.59200 -43.31600 -13.75800 1.000 47.79000  ? 277  ARG A NH1   1 
ATOM   2217 N  NH2   . ARG A 1 289 ? -35.43700 -43.05900 -12.41600 1.000 57.04000  ? 277  ARG A NH2   1 
ATOM   2218 N  N     . GLN A 1 290 ? -32.45500 -39.39200 -17.88500 1.000 43.25000  ? 278  GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 290 ? -32.37900 -39.47600 -19.34400 1.000 48.83000  ? 278  GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 290 ? -30.95800 -39.73100 -19.85900 1.000 48.95000  ? 278  GLN A C     1 
ATOM   2221 O  O     . GLN A 1 290 ? -30.75900 -40.48000 -20.82900 1.000 48.42000  ? 278  GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 290 ? -32.95300 -38.19700 -19.97300 1.000 52.40000  ? 278  GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 290 ? -34.46900 -38.07000 -19.85100 1.000 49.59000  ? 278  GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 290 ? -35.20200 -39.31300 -20.33500 1.000 50.30000  ? 278  GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 290 ? -34.85100 -39.90200 -21.36000 1.000 51.84000  ? 278  GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 290 ? -36.21700 -39.72700 -19.58500 1.000 55.32000  ? 278  GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 291 ? -29.97400 -39.11100 -19.21000 1.000 45.61000  ? 279  LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 291 ? -28.58200 -39.46900 -19.43600 1.000 39.39000  ? 279  LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 291 ? -28.32900 -40.93700 -19.09800 1.000 44.18000  ? 279  LEU A C     1 
ATOM   2230 O  O     . LEU A 1 291 ? -27.77000 -41.69500 -19.89400 1.000 46.66000  ? 279  LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 291 ? -27.68800 -38.57600 -18.61000 1.000 33.14000  ? 279  LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 291 ? -27.89200 -37.14700 -19.06000 1.000 37.91000  ? 279  LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 291 ? -27.46300 -36.17300 -17.99000 1.000 43.44000  ? 279  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 291 ? -27.08500 -36.94900 -20.33300 1.000 43.07000  ? 279  LEU A CD2   1 
ATOM   2235 N  N     . SER A 1 292 ? -28.76000 -41.33800 -17.90900 1.000 42.54000  ? 280  SER A N     1 
ATOM   2236 C  CA    . SER A 1 292 ? -28.54000 -42.69300 -17.44500 1.000 42.47000  ? 280  SER A CA    1 
ATOM   2237 C  C     . SER A 1 292 ? -29.08800 -43.74900 -18.39900 1.000 47.02000  ? 280  SER A C     1 
ATOM   2238 O  O     . SER A 1 292 ? -28.45700 -44.79100 -18.57800 1.000 55.05000  ? 280  SER A O     1 
ATOM   2239 C  CB    . SER A 1 292 ? -29.15400 -42.87700 -16.05600 1.000 49.45000  ? 280  SER A CB    1 
ATOM   2240 O  OG    . SER A 1 292 ? -28.15200 -42.79900 -15.05700 1.000 50.84000  ? 280  SER A OG    1 
ATOM   2241 N  N     . LYS A 1 293 ? -30.24700 -43.50100 -19.01000 1.000 47.27000  ? 281  LYS A N     1 
ATOM   2242 C  CA    . LYS A 1 293 ? -30.83100 -44.49400 -19.91300 1.000 50.56000  ? 281  LYS A CA    1 
ATOM   2243 C  C     . LYS A 1 293 ? -29.89900 -44.82300 -21.07900 1.000 54.82000  ? 281  LYS A C     1 
ATOM   2244 O  O     . LYS A 1 293 ? -29.84700 -45.96300 -21.51100 1.000 59.82000  ? 281  LYS A O     1 
ATOM   2245 C  CB    . LYS A 1 293 ? -32.18400 -44.03600 -20.45700 1.000 51.03000  ? 281  LYS A CB    1 
ATOM   2246 C  CG    . LYS A 1 293 ? -33.37200 -44.56700 -19.65500 1.000 56.39000  ? 281  LYS A CG    1 
ATOM   2247 C  CD    . LYS A 1 293 ? -34.58300 -44.82500 -20.53100 1.000 59.30000  ? 281  LYS A CD    1 
ATOM   2248 C  CE    . LYS A 1 293 ? -35.12100 -43.55300 -21.17200 1.000 59.21000  ? 281  LYS A CE    1 
ATOM   2249 N  NZ    . LYS A 1 293 ? -36.25700 -43.87200 -22.09500 1.000 67.49000  ? 281  LYS A NZ    1 
ATOM   2250 N  N     . LEU A 1 294 ? -29.16400 -43.83400 -21.58100 1.000 47.68000  ? 282  LEU A N     1 
ATOM   2251 C  CA    . LEU A 1 294 ? -28.19000 -44.08300 -22.64200 1.000 46.15000  ? 282  LEU A CA    1 
ATOM   2252 C  C     . LEU A 1 294 ? -27.29400 -45.28900 -22.35300 1.000 53.20000  ? 282  LEU A C     1 
ATOM   2253 O  O     . LEU A 1 294 ? -26.99400 -46.09300 -23.23300 1.000 57.63000  ? 282  LEU A O     1 
ATOM   2254 C  CB    . LEU A 1 294 ? -27.31700 -42.84800 -22.85100 1.000 45.79000  ? 282  LEU A CB    1 
ATOM   2255 C  CG    . LEU A 1 294 ? -27.93300 -41.74500 -23.69600 1.000 45.52000  ? 282  LEU A CG    1 
ATOM   2256 C  CD1   . LEU A 1 294 ? -29.40700 -41.63900 -23.39900 1.000 54.12000  ? 282  LEU A CD1   1 
ATOM   2257 C  CD2   . LEU A 1 294 ? -27.25900 -40.42400 -23.43400 1.000 45.30000  ? 282  LEU A CD2   1 
ATOM   2258 N  N     . LEU A 1 295 ? -26.88200 -45.40700 -21.10100 1.000 55.17000  ? 283  LEU A N     1 
ATOM   2259 C  CA    . LEU A 1 295 ? -25.94300 -46.43300 -20.68900 1.000 54.68000  ? 283  LEU A CA    1 
ATOM   2260 C  C     . LEU A 1 295 ? -26.43900 -47.85700 -20.78600 1.000 63.03000  ? 283  LEU A C     1 
ATOM   2261 O  O     . LEU A 1 295 ? -25.80900 -48.75400 -20.22400 1.000 66.62000  ? 283  LEU A O     1 
ATOM   2262 C  CB    . LEU A 1 295 ? -25.53300 -46.20000 -19.25200 1.000 43.34000  ? 283  LEU A CB    1 
ATOM   2263 C  CG    . LEU A 1 295 ? -24.86300 -44.86100 -19.06100 1.000 53.24000  ? 283  LEU A CG    1 
ATOM   2264 C  CD1   . LEU A 1 295 ? -24.58300 -44.65900 -17.58100 1.000 47.59000  ? 283  LEU A CD1   1 
ATOM   2265 C  CD2   . LEU A 1 295 ? -23.58300 -44.82900 -19.87000 1.000 50.22000  ? 283  LEU A CD2   1 
ATOM   2266 N  N     . ARG A 1 296 ? -27.56300 -48.08900 -21.45100 1.000 59.63000  ? 284  ARG A N     1 
ATOM   2267 C  CA    . ARG A 1 296 ? -28.09700 -49.44600 -21.50100 1.000 61.66000  ? 284  ARG A CA    1 
ATOM   2268 C  C     . ARG A 1 296 ? -27.63800 -50.17900 -22.74400 1.000 68.21000  ? 284  ARG A C     1 
ATOM   2269 O  O     . ARG A 1 296 ? -27.67200 -49.62300 -23.83900 1.000 74.36000  ? 284  ARG A O     1 
ATOM   2270 C  CB    . ARG A 1 296 ? -29.61200 -49.42700 -21.46700 1.000 60.54000  ? 284  ARG A CB    1 
ATOM   2271 C  CG    . ARG A 1 296 ? -30.16400 -48.43300 -20.51800 1.000 58.67000  ? 284  ARG A CG    1 
ATOM   2272 C  CD    . ARG A 1 296 ? -30.90000 -49.14500 -19.46100 1.000 61.98000  ? 284  ARG A CD    1 
ATOM   2273 N  NE    . ARG A 1 296 ? -31.99200 -48.34900 -18.92800 1.000 67.89000  ? 284  ARG A NE    1 
ATOM   2274 C  CZ    . ARG A 1 296 ? -32.79200 -48.76600 -17.95100 1.000 67.51000  ? 284  ARG A CZ    1 
ATOM   2275 N  NH1   . ARG A 1 296 ? -32.59300 -49.96800 -17.40700 1.000 64.77000  ? 284  ARG A NH1   1 
ATOM   2276 N  NH2   . ARG A 1 296 ? -33.77600 -47.98400 -17.51300 1.000 62.45000  ? 284  ARG A NH2   1 
ATOM   2277 N  N     . GLY A 1 297 ? -27.21300 -51.42800 -22.57600 1.000 74.51000  ? 285  GLY A N     1 
ATOM   2278 C  CA    . GLY A 1 297 ? -26.81700 -52.25200 -23.70500 1.000 75.76000  ? 285  GLY A CA    1 
ATOM   2279 C  C     . GLY A 1 297 ? -25.41100 -52.06600 -24.24200 1.000 84.23000  ? 285  GLY A C     1 
ATOM   2280 O  O     . GLY A 1 297 ? -24.83100 -52.99800 -24.79600 1.000 98.28000  ? 285  GLY A O     1 
ATOM   2281 N  N     . THR A 1 298 ? -24.88400 -50.85400 -24.11000 1.000 73.17000  ? 286  THR A N     1 
ATOM   2282 C  CA    . THR A 1 298 ? -23.52800 -50.47200 -24.51200 1.000 78.96000  ? 286  THR A CA    1 
ATOM   2283 C  C     . THR A 1 298 ? -22.47500 -51.44300 -23.97800 1.000 82.32000  ? 286  THR A C     1 
ATOM   2284 O  O     . THR A 1 298 ? -22.21900 -51.47500 -22.77600 1.000 81.64000  ? 286  THR A O     1 
ATOM   2285 C  CB    . THR A 1 298 ? -23.22600 -49.08200 -23.98100 1.000 78.07000  ? 286  THR A CB    1 
ATOM   2286 O  OG1   . THR A 1 298 ? -23.05200 -49.17100 -22.55800 1.000 80.03000  ? 286  THR A OG1   1 
ATOM   2287 C  CG2   . THR A 1 298 ? -24.40300 -48.16700 -24.25700 1.000 69.87000  ? 286  THR A CG2   1 
ATOM   2288 N  N     . LYS A 1 299 ? -21.85300 -52.21700 -24.85700 1.000 78.17000  ? 287  LYS A N     1 
ATOM   2289 C  CA    . LYS A 1 299 ? -20.97100 -53.28100 -24.39800 1.000 77.81000  ? 287  LYS A CA    1 
ATOM   2290 C  C     . LYS A 1 299 ? -19.53000 -52.83400 -24.14800 1.000 76.83000  ? 287  LYS A C     1 
ATOM   2291 O  O     . LYS A 1 299 ? -18.66600 -53.66800 -23.90100 1.000 80.97000  ? 287  LYS A O     1 
ATOM   2292 C  CB    . LYS A 1 299 ? -20.97100 -54.44000 -25.39700 1.000 81.25000  ? 287  LYS A CB    1 
ATOM   2293 C  CG    . LYS A 1 299 ? -22.28900 -55.19700 -25.47000 1.000 81.93000  ? 287  LYS A CG    1 
ATOM   2294 C  CD    . LYS A 1 299 ? -22.06600 -56.61600 -25.96600 1.000 77.25000  ? 287  LYS A CD    1 
ATOM   2295 C  CE    . LYS A 1 299 ? -21.25500 -56.63200 -27.25200 1.000 69.22000  ? 287  LYS A CE    1 
ATOM   2296 N  NZ    . LYS A 1 299 ? -22.12500 -56.80200 -28.44400 1.000 60.46000  ? 287  LYS A NZ    1 
ATOM   2297 N  N     . ALA A 1 300 ? -19.25800 -51.53400 -24.20200 1.000 73.50000  ? 288  ALA A N     1 
ATOM   2298 C  CA    . ALA A 1 300 ? -17.89200 -51.08600 -23.95100 1.000 70.39000  ? 288  ALA A CA    1 
ATOM   2299 C  C     . ALA A 1 300 ? -17.75200 -49.57000 -23.80600 1.000 69.88000  ? 288  ALA A C     1 
ATOM   2300 O  O     . ALA A 1 300 ? -18.41700 -48.78500 -24.48900 1.000 62.57000  ? 288  ALA A O     1 
ATOM   2301 C  CB    . ALA A 1 300 ? -16.96900 -51.58700 -25.05200 1.000 72.12000  ? 288  ALA A CB    1 
ATOM   2302 N  N     . LEU A 1 301 ? -16.85400 -49.18500 -22.90300 1.000 71.18000  ? 289  LEU A N     1 
ATOM   2303 C  CA    . LEU A 1 301 ? -16.62700 -47.79600 -22.53300 1.000 65.82000  ? 289  LEU A CA    1 
ATOM   2304 C  C     . LEU A 1 301 ? -16.41100 -46.90800 -23.73400 1.000 64.61000  ? 289  LEU A C     1 
ATOM   2305 O  O     . LEU A 1 301 ? -16.74900 -45.73000 -23.72700 1.000 64.90000  ? 289  LEU A O     1 
ATOM   2306 C  CB    . LEU A 1 301 ? -15.41100 -47.69000 -21.61500 1.000 66.01000  ? 289  LEU A CB    1 
ATOM   2307 C  CG    . LEU A 1 301 ? -15.47600 -48.54800 -20.35800 1.000 74.73000  ? 289  LEU A CG    1 
ATOM   2308 C  CD1   . LEU A 1 301 ? -14.23700 -48.30400 -19.50400 1.000 67.86000  ? 289  LEU A CD1   1 
ATOM   2309 C  CD2   . LEU A 1 301 ? -16.77400 -48.27200 -19.58700 1.000 66.43000  ? 289  LEU A CD2   1 
ATOM   2310 N  N     . THR A 1 302 ? -15.83000 -47.47300 -24.77100 1.000 67.94000  ? 290  THR A N     1 
ATOM   2311 C  CA    . THR A 1 302 ? -15.43800 -46.66000 -25.89200 1.000 67.47000  ? 290  THR A CA    1 
ATOM   2312 C  C     . THR A 1 302 ? -16.60400 -46.44200 -26.85700 1.000 67.73000  ? 290  THR A C     1 
ATOM   2313 O  O     . THR A 1 302 ? -16.53400 -45.57000 -27.72700 1.000 68.17000  ? 290  THR A O     1 
ATOM   2314 C  CB    . THR A 1 302 ? -14.24100 -47.28800 -26.61800 1.000 70.70000  ? 290  THR A CB    1 
ATOM   2315 O  OG1   . THR A 1 302 ? -13.97800 -46.55800 -27.82600 1.000 80.23000  ? 290  THR A OG1   1 
ATOM   2316 C  CG2   . THR A 1 302 ? -14.51400 -48.75900 -26.92900 1.000 69.84000  ? 290  THR A CG2   1 
ATOM   2317 N  N     . GLU A 1 303 ? -17.67700 -47.21600 -26.68600 1.000 65.22000  ? 291  GLU A N     1 
ATOM   2318 C  CA    . GLU A 1 303 ? -18.85700 -47.09400 -27.54300 1.000 62.54000  ? 291  GLU A CA    1 
ATOM   2319 C  C     . GLU A 1 303 ? -19.36200 -45.67200 -27.55800 1.000 60.65000  ? 291  GLU A C     1 
ATOM   2320 O  O     . GLU A 1 303 ? -19.41200 -45.01100 -26.52700 1.000 68.38000  ? 291  GLU A O     1 
ATOM   2321 C  CB    . GLU A 1 303 ? -19.97700 -48.02700 -27.08500 1.000 69.28000  ? 291  GLU A CB    1 
ATOM   2322 C  CG    . GLU A 1 303 ? -20.30800 -49.12000 -28.08200 1.000 71.41000  ? 291  GLU A CG    1 
ATOM   2323 C  CD    . GLU A 1 303 ? -21.43400 -50.01500 -27.61200 1.000 81.86000  ? 291  GLU A CD    1 
ATOM   2324 O  OE1   . GLU A 1 303 ? -22.60900 -49.68600 -27.90100 1.000 86.12000  ? 291  GLU A OE1   1 
ATOM   2325 O  OE2   . GLU A 1 303 ? -21.13900 -51.04600 -26.96000 1.000 79.66000  ? 291  GLU A OE2   1 
ATOM   2326 N  N     . VAL A 1 304 ? -19.72400 -45.19500 -28.73800 1.000 63.04000  ? 292  VAL A N     1 
ATOM   2327 C  CA    . VAL A 1 304 ? -20.23800 -43.84800 -28.86700 1.000 60.91000  ? 292  VAL A CA    1 
ATOM   2328 C  C     . VAL A 1 304 ? -21.74700 -43.90500 -28.94600 1.000 61.97000  ? 292  VAL A C     1 
ATOM   2329 O  O     . VAL A 1 304 ? -22.30600 -44.84200 -29.51300 1.000 59.70000  ? 292  VAL A O     1 
ATOM   2330 C  CB    . VAL A 1 304 ? -19.66800 -43.15000 -30.09600 1.000 59.69000  ? 292  VAL A CB    1 
ATOM   2331 C  CG1   . VAL A 1 304 ? -20.39700 -41.83000 -30.35700 1.000 56.96000  ? 292  VAL A CG1   1 
ATOM   2332 C  CG2   . VAL A 1 304 ? -18.18000 -42.93400 -29.90500 1.000 58.53000  ? 292  VAL A CG2   1 
ATOM   2333 N  N     . ILE A 1 305 ? -22.40400 -42.92000 -28.34200 1.000 63.92000  ? 293  ILE A N     1 
ATOM   2334 C  CA    . ILE A 1 305 ? -23.85400 -42.85500 -28.38700 1.000 61.08000  ? 293  ILE A CA    1 
ATOM   2335 C  C     . ILE A 1 305 ? -24.35000 -41.44300 -28.66100 1.000 65.80000  ? 293  ILE A C     1 
ATOM   2336 O  O     . ILE A 1 305 ? -23.76600 -40.45100 -28.19400 1.000 59.80000  ? 293  ILE A O     1 
ATOM   2337 C  CB    . ILE A 1 305 ? -24.48500 -43.35600 -27.08800 1.000 58.51000  ? 293  ILE A CB    1 
ATOM   2338 C  CG1   . ILE A 1 305 ? -23.69000 -44.54200 -26.54100 1.000 64.51000  ? 293  ILE A CG1   1 
ATOM   2339 C  CG2   . ILE A 1 305 ? -25.92900 -43.75000 -27.33200 1.000 65.60000  ? 293  ILE A CG2   1 
ATOM   2340 C  CD1   . ILE A 1 305 ? -24.44400 -45.36400 -25.53300 1.000 58.73000  ? 293  ILE A CD1   1 
ATOM   2341 N  N     . PRO A 1 306 ? -25.41800 -41.35100 -29.46500 1.000 67.83000  ? 294  PRO A N     1 
ATOM   2342 C  CA    . PRO A 1 306 ? -26.08400 -40.07500 -29.74300 1.000 65.30000  ? 294  PRO A CA    1 
ATOM   2343 C  C     . PRO A 1 306 ? -27.10200 -39.73500 -28.65300 1.000 62.73000  ? 294  PRO A C     1 
ATOM   2344 O  O     . PRO A 1 306 ? -27.93400 -40.56600 -28.26700 1.000 55.22000  ? 294  PRO A O     1 
ATOM   2345 C  CB    . PRO A 1 306 ? -26.77100 -40.31800 -31.10500 1.000 60.98000  ? 294  PRO A CB    1 
ATOM   2346 C  CG    . PRO A 1 306 ? -26.20000 -41.63800 -31.62000 1.000 60.97000  ? 294  PRO A CG    1 
ATOM   2347 C  CD    . PRO A 1 306 ? -25.85800 -42.41500 -30.38500 1.000 59.12000  ? 294  PRO A CD    1 
ATOM   2348 N  N     . LEU A 1 307 ? -27.01700 -38.50900 -28.15500 1.000 60.01000  ? 295  LEU A N     1 
ATOM   2349 C  CA    . LEU A 1 307 ? -27.95300 -38.04700 -27.15000 1.000 59.74000  ? 295  LEU A CA    1 
ATOM   2350 C  C     . LEU A 1 307 ? -29.37000 -38.08000 -27.67800 1.000 60.97000  ? 295  LEU A C     1 
ATOM   2351 O  O     . LEU A 1 307 ? -29.65300 -37.51500 -28.73400 1.000 71.81000  ? 295  LEU A O     1 
ATOM   2352 C  CB    . LEU A 1 307 ? -27.60600 -36.62400 -26.70100 1.000 56.67000  ? 295  LEU A CB    1 
ATOM   2353 C  CG    . LEU A 1 307 ? -26.31300 -36.49800 -25.89700 1.000 58.43000  ? 295  LEU A CG    1 
ATOM   2354 C  CD1   . LEU A 1 307 ? -26.27100 -35.17600 -25.15800 1.000 55.70000  ? 295  LEU A CD1   1 
ATOM   2355 C  CD2   . LEU A 1 307 ? -26.14300 -37.67900 -24.93500 1.000 56.85000  ? 295  LEU A CD2   1 
ATOM   2356 N  N     . THR A 1 308 ? -30.26500 -38.73400 -26.94400 1.000 60.52000  ? 296  THR A N     1 
ATOM   2357 C  CA    . THR A 1 308 ? -31.68700 -38.60600 -27.23000 1.000 58.78000  ? 296  THR A CA    1 
ATOM   2358 C  C     . THR A 1 308 ? -32.11400 -37.14900 -27.03800 1.000 62.38000  ? 296  THR A C     1 
ATOM   2359 O  O     . THR A 1 308 ? -31.37700 -36.33900 -26.46600 1.000 55.24000  ? 296  THR A O     1 
ATOM   2360 C  CB    . THR A 1 308 ? -32.53400 -39.52200 -26.34500 1.000 57.66000  ? 296  THR A CB    1 
ATOM   2361 O  OG1   . THR A 1 308 ? -32.35800 -39.16200 -24.96400 1.000 60.03000  ? 296  THR A OG1   1 
ATOM   2362 C  CG2   . THR A 1 308 ? -32.12200 -40.97800 -26.56900 1.000 47.82000  ? 296  THR A CG2   1 
ATOM   2363 N  N     . GLU A 1 309 ? -33.29600 -36.82200 -27.54300 1.000 70.78000  ? 297  GLU A N     1 
ATOM   2364 C  CA    . GLU A 1 309 ? -33.76300 -35.44400 -27.55900 1.000 65.50000  ? 297  GLU A CA    1 
ATOM   2365 C  C     . GLU A 1 309 ? -34.04700 -34.97000 -26.14500 1.000 63.04000  ? 297  GLU A C     1 
ATOM   2366 O  O     . GLU A 1 309 ? -33.87500 -33.79600 -25.83100 1.000 64.43000  ? 297  GLU A O     1 
ATOM   2367 C  CB    . GLU A 1 309 ? -35.01100 -35.31300 -28.43500 1.000 68.46000  ? 297  GLU A CB    1 
ATOM   2368 C  CG    . GLU A 1 309 ? -35.46800 -33.87400 -28.65200 1.000 80.80000  ? 297  GLU A CG    1 
ATOM   2369 C  CD    . GLU A 1 309 ? -36.42700 -33.71600 -29.83800 1.000 81.62000  ? 297  GLU A CD    1 
ATOM   2370 O  OE1   . GLU A 1 309 ? -36.00000 -33.99900 -30.98900 1.000 81.08000  ? 297  GLU A OE1   1 
ATOM   2371 O  OE2   . GLU A 1 309 ? -37.59700 -33.29900 -29.61500 1.000 73.50000  ? 297  GLU A OE2   1 
ATOM   2372 N  N     . GLU A 1 310 ? -34.47100 -35.90400 -25.29800 1.000 63.62000  ? 298  GLU A N     1 
ATOM   2373 C  CA    . GLU A 1 310 ? -34.84200 -35.59800 -23.92200 1.000 60.01000  ? 298  GLU A CA    1 
ATOM   2374 C  C     . GLU A 1 310 ? -33.61200 -35.63500 -23.01100 1.000 61.00000  ? 298  GLU A C     1 
ATOM   2375 O  O     . GLU A 1 310 ? -33.51300 -34.85500 -22.05600 1.000 61.28000  ? 298  GLU A O     1 
ATOM   2376 C  CB    . GLU A 1 310 ? -35.92000 -36.56900 -23.42200 1.000 56.35000  ? 298  GLU A CB    1 
ATOM   2377 C  CG    . GLU A 1 310 ? -35.92800 -37.93100 -24.10600 1.000 67.32000  ? 298  GLU A CG    1 
ATOM   2378 C  CD    . GLU A 1 310 ? -36.65200 -37.92900 -25.45600 1.000 78.34000  ? 298  GLU A CD    1 
ATOM   2379 O  OE1   . GLU A 1 310 ? -37.85000 -37.54800 -25.49200 1.000 73.86000  ? 298  GLU A OE1   1 
ATOM   2380 O  OE2   . GLU A 1 310 ? -36.01800 -38.31100 -26.47700 1.000 73.80000  ? 298  GLU A OE2   1 
ATOM   2381 N  N     . ALA A 1 311 ? -32.67700 -36.53100 -23.31400 1.000 55.76000  ? 299  ALA A N     1 
ATOM   2382 C  CA    . ALA A 1 311 ? -31.36600 -36.48700 -22.67600 1.000 52.31000  ? 299  ALA A CA    1 
ATOM   2383 C  C     . ALA A 1 311 ? -30.71400 -35.14200 -22.97200 1.000 55.20000  ? 299  ALA A C     1 
ATOM   2384 O  O     . ALA A 1 311 ? -30.21600 -34.45900 -22.07900 1.000 52.94000  ? 299  ALA A O     1 
ATOM   2385 C  CB    . ALA A 1 311 ? -30.49200 -37.62800 -23.16400 1.000 53.21000  ? 299  ALA A CB    1 
ATOM   2386 N  N     . GLU A 1 312 ? -30.72600 -34.78400 -24.25300 1.000 63.27000  ? 300  GLU A N     1 
ATOM   2387 C  CA    . GLU A 1 312 ? -30.28200 -33.48400 -24.74300 1.000 57.90000  ? 300  GLU A CA    1 
ATOM   2388 C  C     . GLU A 1 312 ? -30.78200 -32.36000 -23.83400 1.000 56.39000  ? 300  GLU A C     1 
ATOM   2389 O  O     . GLU A 1 312 ? -29.99700 -31.57800 -23.29300 1.000 52.62000  ? 300  GLU A O     1 
ATOM   2390 C  CB    . GLU A 1 312 ? -30.79000 -33.30100 -26.18200 1.000 65.95000  ? 300  GLU A CB    1 
ATOM   2391 C  CG    . GLU A 1 312 ? -30.20900 -32.13900 -26.97900 1.000 72.36000  ? 300  GLU A CG    1 
ATOM   2392 C  CD    . GLU A 1 312 ? -30.65700 -32.17300 -28.43700 1.000 77.32000  ? 300  GLU A CD    1 
ATOM   2393 O  OE1   . GLU A 1 312 ? -30.56300 -33.25400 -29.06700 1.000 74.45000  ? 300  GLU A OE1   1 
ATOM   2394 O  OE2   . GLU A 1 312 ? -31.12000 -31.12700 -28.94800 1.000 82.76000  ? 300  GLU A OE2   1 
ATOM   2395 N  N     . LEU A 1 313 ? -32.09700 -32.31100 -23.65500 1.000 55.08000  ? 301  LEU A N     1 
ATOM   2396 C  CA    . LEU A 1 313 ? -32.74100 -31.26000 -22.88700 1.000 56.34000  ? 301  LEU A CA    1 
ATOM   2397 C  C     . LEU A 1 313 ? -32.33000 -31.27900 -21.41800 1.000 58.74000  ? 301  LEU A C     1 
ATOM   2398 O  O     . LEU A 1 313 ? -32.16200 -30.21800 -20.79700 1.000 53.39000  ? 301  LEU A O     1 
ATOM   2399 C  CB    . LEU A 1 313 ? -34.26100 -31.38900 -23.00300 1.000 65.01000  ? 301  LEU A CB    1 
ATOM   2400 C  CG    . LEU A 1 313 ? -35.08500 -30.53900 -22.03000 1.000 70.35000  ? 301  LEU A CG    1 
ATOM   2401 C  CD1   . LEU A 1 313 ? -35.20000 -29.09900 -22.50800 1.000 66.22000  ? 301  LEU A CD1   1 
ATOM   2402 C  CD2   . LEU A 1 313 ? -36.45900 -31.15200 -21.80900 1.000 72.71000  ? 301  LEU A CD2   1 
ATOM   2403 N  N     . GLU A 1 314 ? -32.17500 -32.49000 -20.87800 1.000 57.91000  ? 302  GLU A N     1 
ATOM   2404 C  CA    . GLU A 1 314 ? -31.85800 -32.70200 -19.45900 1.000 51.96000  ? 302  GLU A CA    1 
ATOM   2405 C  C     . GLU A 1 314 ? -30.50000 -32.12200 -19.07600 1.000 47.98000  ? 302  GLU A C     1 
ATOM   2406 O  O     . GLU A 1 314 ? -30.38200 -31.32400 -18.13700 1.000 44.14000  ? 302  GLU A O     1 
ATOM   2407 C  CB    . GLU A 1 314 ? -31.89900 -34.19700 -19.13200 1.000 46.85000  ? 302  GLU A CB    1 
ATOM   2408 C  CG    . GLU A 1 314 ? -31.61500 -34.55400 -17.67100 1.000 47.87000  ? 302  GLU A CG    1 
ATOM   2409 C  CD    . GLU A 1 314 ? -31.86200 -36.02800 -17.37400 1.000 49.72000  ? 302  GLU A CD    1 
ATOM   2410 O  OE1   . GLU A 1 314 ? -30.98000 -36.85100 -17.72900 1.000 46.33000  ? 302  GLU A OE1   1 
ATOM   2411 O  OE2   . GLU A 1 314 ? -32.93900 -36.35800 -16.80100 1.000 49.60000  ? 302  GLU A OE2   1 
ATOM   2412 N  N     . LEU A 1 315 ? -29.48000 -32.53900 -19.81400 1.000 47.05000  ? 303  LEU A N     1 
ATOM   2413 C  CA    . LEU A 1 315 ? -28.14100 -32.00900 -19.65100 1.000 47.76000  ? 303  LEU A CA    1 
ATOM   2414 C  C     . LEU A 1 315 ? -28.15200 -30.48000 -19.61500 1.000 49.69000  ? 303  LEU A C     1 
ATOM   2415 O  O     . LEU A 1 315 ? -27.43700 -29.85000 -18.82800 1.000 52.36000  ? 303  LEU A O     1 
ATOM   2416 C  CB    . LEU A 1 315 ? -27.24300 -32.51300 -20.78000 1.000 46.29000  ? 303  LEU A CB    1 
ATOM   2417 C  CG    . LEU A 1 315 ? -25.83300 -31.93800 -20.75000 1.000 52.61000  ? 303  LEU A CG    1 
ATOM   2418 C  CD1   . LEU A 1 315 ? -25.31600 -31.95100 -19.32000 1.000 51.00000  ? 303  LEU A CD1   1 
ATOM   2419 C  CD2   . LEU A 1 315 ? -24.91200 -32.72900 -21.65800 1.000 52.97000  ? 303  LEU A CD2   1 
ATOM   2420 N  N     . ALA A 1 316 ? -28.99000 -29.89000 -20.45800 1.000 55.94000  ? 304  ALA A N     1 
ATOM   2421 C  CA    . ALA A 1 316 ? -29.13400 -28.44600 -20.49800 1.000 50.42000  ? 304  ALA A CA    1 
ATOM   2422 C  C     . ALA A 1 316 ? -29.67300 -27.90700 -19.18000 1.000 47.67000  ? 304  ALA A C     1 
ATOM   2423 O  O     . ALA A 1 316 ? -29.20000 -26.88000 -18.69400 1.000 53.36000  ? 304  ALA A O     1 
ATOM   2424 C  CB    . ALA A 1 316 ? -30.03800 -28.05000 -21.63600 1.000 54.54000  ? 304  ALA A CB    1 
ATOM   2425 N  N     . GLU A 1 317 ? -30.66100 -28.59000 -18.60500 1.000 48.65000  ? 305  GLU A N     1 
ATOM   2426 C  CA    . GLU A 1 317 ? -31.27100 -28.12500 -17.35100 1.000 51.68000  ? 305  GLU A CA    1 
ATOM   2427 C  C     . GLU A 1 317 ? -30.25300 -28.10900 -16.23000 1.000 48.57000  ? 305  GLU A C     1 
ATOM   2428 O  O     . GLU A 1 317 ? -30.18700 -27.16100 -15.44100 1.000 44.61000  ? 305  GLU A O     1 
ATOM   2429 C  CB    . GLU A 1 317 ? -32.44700 -29.00700 -16.94400 1.000 53.65000  ? 305  GLU A CB    1 
ATOM   2430 C  CG    . GLU A 1 317 ? -33.54100 -29.12700 -17.98300 1.000 65.89000  ? 305  GLU A CG    1 
ATOM   2431 C  CD    . GLU A 1 317 ? -34.73600 -29.90100 -17.45800 1.000 72.77000  ? 305  GLU A CD    1 
ATOM   2432 O  OE1   . GLU A 1 317 ? -35.52200 -30.43000 -18.28200 1.000 72.41000  ? 305  GLU A OE1   1 
ATOM   2433 O  OE2   . GLU A 1 317 ? -34.88300 -29.97600 -16.21400 1.000 74.22000  ? 305  GLU A OE2   1 
ATOM   2434 N  N     . ASN A 1 318 ? -29.46700 -29.18100 -16.17400 1.000 48.61000  ? 306  ASN A N     1 
ATOM   2435 C  CA    . ASN A 1 318 ? -28.38800 -29.30300 -15.20300 1.000 43.97000  ? 306  ASN A CA    1 
ATOM   2436 C  C     . ASN A 1 318 ? -27.31800 -28.24700 -15.41200 1.000 46.70000  ? 306  ASN A C     1 
ATOM   2437 O  O     . ASN A 1 318 ? -26.85900 -27.65100 -14.43700 1.000 49.87000  ? 306  ASN A O     1 
ATOM   2438 C  CB    . ASN A 1 318 ? -27.77000 -30.70300 -15.27100 1.000 41.70000  ? 306  ASN A CB    1 
ATOM   2439 C  CG    . ASN A 1 318 ? -28.68300 -31.76200 -14.70100 1.000 36.84000  ? 306  ASN A CG    1 
ATOM   2440 O  OD1   . ASN A 1 318 ? -29.31700 -31.55700 -13.66800 1.000 41.22000  ? 306  ASN A OD1   1 
ATOM   2441 N  ND2   . ASN A 1 318 ? -28.76700 -32.89400 -15.37300 1.000 34.43000  ? 306  ASN A ND2   1 
ATOM   2442 N  N     . ARG A 1 319 ? -26.92800 -28.01200 -16.67100 1.000 43.83000  ? 307  ARG A N     1 
ATOM   2443 C  CA    . ARG A 1 319 ? -25.94200 -26.96600 -16.96800 1.000 44.67000  ? 307  ARG A CA    1 
ATOM   2444 C  C     . ARG A 1 319 ? -26.39300 -25.60500 -16.43800 1.000 46.54000  ? 307  ARG A C     1 
ATOM   2445 O  O     . ARG A 1 319 ? -25.57200 -24.81700 -15.97000 1.000 48.52000  ? 307  ARG A O     1 
ATOM   2446 C  CB    . ARG A 1 319 ? -25.67000 -26.86900 -18.46600 1.000 43.61000  ? 307  ARG A CB    1 
ATOM   2447 C  CG    . ARG A 1 319 ? -24.65500 -27.87200 -18.97500 1.000 50.13000  ? 307  ARG A CG    1 
ATOM   2448 C  CD    . ARG A 1 319 ? -24.50300 -27.78900 -20.48600 1.000 53.05000  ? 307  ARG A CD    1 
ATOM   2449 N  NE    . ARG A 1 319 ? -23.66100 -28.85500 -21.03400 1.000 54.04000  ? 307  ARG A NE    1 
ATOM   2450 C  CZ    . ARG A 1 319 ? -22.34400 -28.92600 -20.86600 1.000 62.21000  ? 307  ARG A CZ    1 
ATOM   2451 N  NH1   . ARG A 1 319 ? -21.71100 -27.99900 -20.14300 1.000 60.30000  ? 307  ARG A NH1   1 
ATOM   2452 N  NH2   . ARG A 1 319 ? -21.66100 -29.92700 -21.40900 1.000 61.92000  ? 307  ARG A NH2   1 
ATOM   2453 N  N     . GLU A 1 320 ? -27.69400 -25.33900 -16.49000 1.000 42.63000  ? 308  GLU A N     1 
ATOM   2454 C  CA    . GLU A 1 320 ? -28.18700 -24.06600 -16.00600 1.000 47.03000  ? 308  GLU A CA    1 
ATOM   2455 C  C     . GLU A 1 320 ? -28.10200 -24.01600 -14.50400 1.000 46.75000  ? 308  GLU A C     1 
ATOM   2456 O  O     . GLU A 1 320 ? -27.81900 -22.97000 -13.92300 1.000 44.83000  ? 308  GLU A O     1 
ATOM   2457 C  CB    . GLU A 1 320 ? -29.62300 -23.81800 -16.46300 1.000 48.90000  ? 308  GLU A CB    1 
ATOM   2458 C  CG    . GLU A 1 320 ? -29.71500 -23.38300 -17.91200 1.000 55.92000  ? 308  GLU A CG    1 
ATOM   2459 C  CD    . GLU A 1 320 ? -28.61500 -22.38600 -18.29100 1.000 60.20000  ? 308  GLU A CD    1 
ATOM   2460 O  OE1   . GLU A 1 320 ? -27.68700 -22.77200 -19.04600 1.000 56.73000  ? 308  GLU A OE1   1 
ATOM   2461 O  OE2   . GLU A 1 320 ? -28.66900 -21.22200 -17.82900 1.000 58.83000  ? 308  GLU A OE2   1 
ATOM   2462 N  N     . ILE A 1 321 ? -28.34500 -25.16400 -13.88300 1.000 50.19000  ? 309  ILE A N     1 
ATOM   2463 C  CA    . ILE A 1 321 ? -28.31500 -25.27800 -12.43000 1.000 49.46000  ? 309  ILE A CA    1 
ATOM   2464 C  C     . ILE A 1 321 ? -26.92400 -25.00100 -11.86800 1.000 45.98000  ? 309  ILE A C     1 
ATOM   2465 O  O     . ILE A 1 321 ? -26.78000 -24.26700 -10.88500 1.000 47.38000  ? 309  ILE A O     1 
ATOM   2466 C  CB    . ILE A 1 321 ? -28.77900 -26.67200 -11.97700 1.000 47.58000  ? 309  ILE A CB    1 
ATOM   2467 C  CG1   . ILE A 1 321 ? -30.26500 -26.85200 -12.29900 1.000 40.77000  ? 309  ILE A CG1   1 
ATOM   2468 C  CG2   . ILE A 1 321 ? -28.52900 -26.85300 -10.47700 1.000 44.56000  ? 309  ILE A CG2   1 
ATOM   2469 C  CD1   . ILE A 1 321 ? -30.78700 -28.23400 -12.06700 1.000 37.98000  ? 309  ILE A CD1   1 
ATOM   2470 N  N     . LEU A 1 322 ? -25.90600 -25.56300 -12.50600 1.000 44.60000  ? 310  LEU A N     1 
ATOM   2471 C  CA    . LEU A 1 322 ? -24.53700 -25.39100 -12.03200 1.000 48.13000  ? 310  LEU A CA    1 
ATOM   2472 C  C     . LEU A 1 322 ? -24.07000 -23.93600 -12.07200 1.000 48.85000  ? 310  LEU A C     1 
ATOM   2473 O  O     . LEU A 1 322 ? -23.22200 -23.52900 -11.26700 1.000 54.47000  ? 310  LEU A O     1 
ATOM   2474 C  CB    . LEU A 1 322 ? -23.58500 -26.26900 -12.84600 1.000 46.08000  ? 310  LEU A CB    1 
ATOM   2475 C  CG    . LEU A 1 322 ? -23.77900 -27.78500 -12.65500 1.000 47.80000  ? 310  LEU A CG    1 
ATOM   2476 C  CD1   . LEU A 1 322 ? -22.71000 -28.57300 -13.38200 1.000 47.58000  ? 310  LEU A CD1   1 
ATOM   2477 C  CD2   . LEU A 1 322 ? -23.78600 -28.15600 -11.18700 1.000 41.70000  ? 310  LEU A CD2   1 
ATOM   2478 N  N     . LYS A 1 323 ? -24.62100 -23.15000 -12.99300 1.000 50.98000  ? 311  LYS A N     1 
ATOM   2479 C  CA    . LYS A 1 323 ? -24.21700 -21.74900 -13.12200 1.000 51.15000  ? 311  LYS A CA    1 
ATOM   2480 C  C     . LYS A 1 323 ? -24.51800 -20.94600 -11.86900 1.000 43.63000  ? 311  LYS A C     1 
ATOM   2481 O  O     . LYS A 1 323 ? -23.88200 -19.94100 -11.61800 1.000 44.41000  ? 311  LYS A O     1 
ATOM   2482 C  CB    . LYS A 1 323 ? -24.91000 -21.08400 -14.31700 1.000 52.20000  ? 311  LYS A CB    1 
ATOM   2483 C  CG    . LYS A 1 323 ? -24.28200 -21.38900 -15.65800 1.000 50.26000  ? 311  LYS A CG    1 
ATOM   2484 C  CD    . LYS A 1 323 ? -25.01000 -20.68700 -16.80700 1.000 51.85000  ? 311  LYS A CD    1 
ATOM   2485 C  CE    . LYS A 1 323 ? -24.29300 -20.95400 -18.13600 1.000 56.67000  ? 311  LYS A CE    1 
ATOM   2486 N  NZ    . LYS A 1 323 ? -25.25000 -21.20400 -19.25000 1.000 53.44000  ? 311  LYS A NZ    1 
ATOM   2487 N  N     . GLU A 1 324 ? -25.50100 -21.38400 -11.09900 1.000 50.17000  ? 312  GLU A N     1 
ATOM   2488 C  CA    . GLU A 1 324 ? -25.97800 -20.60500 -9.96100  1.000 54.81000  ? 312  GLU A CA    1 
ATOM   2489 C  C     . GLU A 1 324 ? -25.02200 -20.74500 -8.79100  1.000 56.57000  ? 312  GLU A C     1 
ATOM   2490 O  O     . GLU A 1 324 ? -24.28300 -21.72900 -8.69200  1.000 58.06000  ? 312  GLU A O     1 
ATOM   2491 C  CB    . GLU A 1 324 ? -27.38600 -21.04800 -9.54800  1.000 58.62000  ? 312  GLU A CB    1 
ATOM   2492 C  CG    . GLU A 1 324 ? -28.37000 -21.19000 -10.70800 1.000 63.15000  ? 312  GLU A CG    1 
ATOM   2493 C  CD    . GLU A 1 324 ? -28.87500 -19.85900 -11.20500 1.000 74.41000  ? 312  GLU A CD    1 
ATOM   2494 O  OE1   . GLU A 1 324 ? -29.03000 -18.94800 -10.35700 1.000 82.02000  ? 312  GLU A OE1   1 
ATOM   2495 O  OE2   . GLU A 1 324 ? -29.11300 -19.72800 -12.43200 1.000 69.97000  ? 312  GLU A OE2   1 
ATOM   2496 N  N     . PRO A 1 325 ? -25.01700 -19.74900 -7.90200  1.000 52.23000  ? 313  PRO A N     1 
ATOM   2497 C  CA    . PRO A 1 325 ? -24.08800 -19.77500 -6.77400  1.000 51.41000  ? 313  PRO A CA    1 
ATOM   2498 C  C     . PRO A 1 325 ? -24.76200 -20.38100 -5.56600  1.000 50.71000  ? 313  PRO A C     1 
ATOM   2499 O  O     . PRO A 1 325 ? -25.88500 -19.99800 -5.23300  1.000 53.06000  ? 313  PRO A O     1 
ATOM   2500 C  CB    . PRO A 1 325 ? -23.76200 -18.29200 -6.55000  1.000 50.71000  ? 313  PRO A CB    1 
ATOM   2501 C  CG    . PRO A 1 325 ? -24.76800 -17.51000 -7.41900  1.000 50.88000  ? 313  PRO A CG    1 
ATOM   2502 C  CD    . PRO A 1 325 ? -25.77000 -18.49100 -7.94600  1.000 50.80000  ? 313  PRO A CD    1 
ATOM   2503 N  N     . VAL A 1 326 ? -24.09200 -21.32000 -4.91600  1.000 44.71000  ? 314  VAL A N     1 
ATOM   2504 C  CA    . VAL A 1 326 ? -24.75100 -22.06100 -3.85900  1.000 38.99000  ? 314  VAL A CA    1 
ATOM   2505 C  C     . VAL A 1 326 ? -23.78100 -22.48400 -2.74800  1.000 38.82000  ? 314  VAL A C     1 
ATOM   2506 O  O     . VAL A 1 326 ? -22.61800 -22.77700 -3.00000  1.000 37.87000  ? 314  VAL A O     1 
ATOM   2507 C  CB    . VAL A 1 326 ? -25.46200 -23.29700 -4.44300  1.000 38.77000  ? 314  VAL A CB    1 
ATOM   2508 C  CG1   . VAL A 1 326 ? -24.44100 -24.26800 -5.04300  1.000 42.59000  ? 314  VAL A CG1   1 
ATOM   2509 C  CG2   . VAL A 1 326 ? -26.28300 -23.97600 -3.36900  1.000 44.21000  ? 314  VAL A CG2   1 
ATOM   2510 N  N     . HIS A 1 327 ? -24.27100 -22.49200 -1.51900  1.000 34.57000  ? 315  HIS A N     1 
ATOM   2511 C  CA    . HIS A 1 327 ? -23.47400 -22.92000 -0.39800  1.000 28.72000  ? 315  HIS A CA    1 
ATOM   2512 C  C     . HIS A 1 327 ? -24.31800 -23.75700 0.54400   1.000 32.17000  ? 315  HIS A C     1 
ATOM   2513 O  O     . HIS A 1 327 ? -25.51500 -23.90100 0.34400   1.000 40.47000  ? 315  HIS A O     1 
ATOM   2514 C  CB    . HIS A 1 327 ? -22.90300 -21.72600 0.33200   1.000 28.13000  ? 315  HIS A CB    1 
ATOM   2515 C  CG    . HIS A 1 327 ? -23.94800 -20.80100 0.88400   1.000 39.66000  ? 315  HIS A CG    1 
ATOM   2516 N  ND1   . HIS A 1 327 ? -24.26500 -20.74800 2.22900   1.000 40.28000  ? 315  HIS A ND1   1 
ATOM   2517 C  CD2   . HIS A 1 327 ? -24.74100 -19.88400 0.27400   1.000 38.79000  ? 315  HIS A CD2   1 
ATOM   2518 C  CE1   . HIS A 1 327 ? -25.20800 -19.84000 2.42600   1.000 33.32000  ? 315  HIS A CE1   1 
ATOM   2519 N  NE2   . HIS A 1 327 ? -25.51300 -19.30200 1.25700   1.000 40.78000  ? 315  HIS A NE2   1 
ATOM   2520 N  N     . GLY A 1 328 ? -23.68700 -24.32500 1.56400   1.000 29.89000  ? 316  GLY A N     1 
ATOM   2521 C  CA    . GLY A 1 328 ? -24.41100 -25.02000 2.61100   1.000 27.14000  ? 316  GLY A CA    1 
ATOM   2522 C  C     . GLY A 1 328 ? -23.94900 -24.45800 3.94200   1.000 28.60000  ? 316  GLY A C     1 
ATOM   2523 O  O     . GLY A 1 328 ? -22.92300 -23.75400 3.98900   1.000 30.40000  ? 316  GLY A O     1 
ATOM   2524 N  N     . VAL A 1 329 ? -24.69000 -24.76500 5.00700   1.000 23.84000  ? 317  VAL A N     1 
ATOM   2525 C  CA    . VAL A 1 329 ? -24.36000 -24.29300 6.35200   1.000 24.98000  ? 317  VAL A CA    1 
ATOM   2526 C  C     . VAL A 1 329 ? -23.99600 -25.45600 7.26900   1.000 23.77000  ? 317  VAL A C     1 
ATOM   2527 O  O     . VAL A 1 329 ? -24.21000 -26.60600 6.91200   1.000 27.61000  ? 317  VAL A O     1 
ATOM   2528 C  CB    . VAL A 1 329 ? -25.52900 -23.52200 6.96300   1.000 24.69000  ? 317  VAL A CB    1 
ATOM   2529 C  CG1   . VAL A 1 329 ? -25.93200 -22.42000 6.02100   1.000 22.76000  ? 317  VAL A CG1   1 
ATOM   2530 C  CG2   . VAL A 1 329 ? -26.67800 -24.45100 7.20400   1.000 19.61000  ? 317  VAL A CG2   1 
ATOM   2531 N  N     . TYR A 1 330 ? -23.44800 -25.16600 8.44400   1.000 22.63000  ? 318  TYR A N     1 
ATOM   2532 C  CA    . TYR A 1 330 ? -23.04600 -26.21600 9.35600   1.000 17.50000  ? 318  TYR A CA    1 
ATOM   2533 C  C     . TYR A 1 330 ? -24.20500 -26.62600 10.24200  1.000 20.66000  ? 318  TYR A C     1 
ATOM   2534 O  O     . TYR A 1 330 ? -25.30100 -26.15700 10.04500  1.000 28.01000  ? 318  TYR A O     1 
ATOM   2535 C  CB    . TYR A 1 330 ? -21.85700 -25.75100 10.17800  1.000 23.77000  ? 318  TYR A CB    1 
ATOM   2536 C  CG    . TYR A 1 330 ? -20.66000 -25.40400 9.31500   1.000 21.33000  ? 318  TYR A CG    1 
ATOM   2537 C  CD1   . TYR A 1 330 ? -20.02600 -26.36600 8.54000   1.000 22.16000  ? 318  TYR A CD1   1 
ATOM   2538 C  CD2   . TYR A 1 330 ? -20.16000 -24.13000 9.28200   1.000 24.63000  ? 318  TYR A CD2   1 
ATOM   2539 C  CE1   . TYR A 1 330 ? -18.94200 -26.04400 7.75800   1.000 22.67000  ? 318  TYR A CE1   1 
ATOM   2540 C  CE2   . TYR A 1 330 ? -19.07500 -23.81400 8.50200   1.000 26.97000  ? 318  TYR A CE2   1 
ATOM   2541 C  CZ    . TYR A 1 330 ? -18.47500 -24.76200 7.74400   1.000 25.31000  ? 318  TYR A CZ    1 
ATOM   2542 O  OH    . TYR A 1 330 ? -17.39100 -24.41100 6.96800   1.000 32.90000  ? 318  TYR A OH    1 
ATOM   2543 N  N     . TYR A 1 331 ? -23.97100 -27.48700 11.22500  1.000 25.00000  ? 319  TYR A N     1 
ATOM   2544 C  CA    . TYR A 1 331 ? -25.06100 -28.12000 11.97700  1.000 20.64000  ? 319  TYR A CA    1 
ATOM   2545 C  C     . TYR A 1 331 ? -25.19700 -27.62500 13.40500  1.000 21.73000  ? 319  TYR A C     1 
ATOM   2546 O  O     . TYR A 1 331 ? -24.22000 -27.59600 14.14200  1.000 24.29000  ? 319  TYR A O     1 
ATOM   2547 C  CB    . TYR A 1 331 ? -24.84500 -29.62600 11.98500  1.000 21.59000  ? 319  TYR A CB    1 
ATOM   2548 C  CG    . TYR A 1 331 ? -25.78900 -30.44200 12.83500  1.000 22.66000  ? 319  TYR A CG    1 
ATOM   2549 C  CD1   . TYR A 1 331 ? -27.17500 -30.24900 12.78600  1.000 24.54000  ? 319  TYR A CD1   1 
ATOM   2550 C  CD2   . TYR A 1 331 ? -25.30200 -31.45000 13.64400  1.000 18.07000  ? 319  TYR A CD2   1 
ATOM   2551 C  CE1   . TYR A 1 331 ? -28.04100 -31.02500 13.55600  1.000 19.56000  ? 319  TYR A CE1   1 
ATOM   2552 C  CE2   . TYR A 1 331 ? -26.14700 -32.21800 14.40400  1.000 22.88000  ? 319  TYR A CE2   1 
ATOM   2553 C  CZ    . TYR A 1 331 ? -27.51900 -32.01200 14.36500  1.000 22.47000  ? 319  TYR A CZ    1 
ATOM   2554 O  OH    . TYR A 1 331 ? -28.33400 -32.81300 15.14700  1.000 20.50000  ? 319  TYR A OH    1 
ATOM   2555 N  N     . ASP A 1 332 ? -26.41900 -27.23800 13.78000  1.000 24.61000  ? 320  ASP A N     1 
ATOM   2556 C  CA    . ASP A 1 332 ? -26.74200 -26.82600 15.14600  1.000 24.40000  ? 320  ASP A CA    1 
ATOM   2557 C  C     . ASP A 1 332 ? -27.63700 -27.86200 15.84700  1.000 27.12000  ? 320  ASP A C     1 
ATOM   2558 O  O     . ASP A 1 332 ? -28.82000 -27.98000 15.54400  1.000 26.45000  ? 320  ASP A O     1 
ATOM   2559 C  CB    . ASP A 1 332 ? -27.42100 -25.46100 15.11800  1.000 28.58000  ? 320  ASP A CB    1 
ATOM   2560 C  CG    . ASP A 1 332 ? -27.77700 -24.94200 16.50400  1.000 32.87000  ? 320  ASP A CG    1 
ATOM   2561 O  OD1   . ASP A 1 332 ? -27.39100 -25.55800 17.52700  1.000 28.37000  ? 320  ASP A OD1   1 
ATOM   2562 O  OD2   . ASP A 1 332 ? -28.44600 -23.89200 16.56600  1.000 35.40000  ? 320  ASP A OD2   1 
ATOM   2563 N  N     . PRO A 1 333 ? -27.06600 -28.63200 16.78500  1.000 24.37000  ? 321  PRO A N     1 
ATOM   2564 C  CA    . PRO A 1 333 ? -27.83400 -29.73200 17.39700  1.000 25.81000  ? 321  PRO A CA    1 
ATOM   2565 C  C     . PRO A 1 333 ? -28.99400 -29.28500 18.30000  1.000 31.96000  ? 321  PRO A C     1 
ATOM   2566 O  O     . PRO A 1 333 ? -29.86500 -30.08800 18.63300  1.000 30.88000  ? 321  PRO A O     1 
ATOM   2567 C  CB    . PRO A 1 333 ? -26.78300 -30.47800 18.20800  1.000 18.61000  ? 321  PRO A CB    1 
ATOM   2568 C  CG    . PRO A 1 333 ? -25.64100 -29.53700 18.33200  1.000 19.92000  ? 321  PRO A CG    1 
ATOM   2569 C  CD    . PRO A 1 333 ? -25.63900 -28.70300 17.11800  1.000 19.49000  ? 321  PRO A CD    1 
ATOM   2570 N  N     . SER A 1 334 ? -28.99600 -28.02300 18.69800  1.000 33.53000  ? 322  SER A N     1 
ATOM   2571 C  CA    . SER A 1 334 ? -30.06600 -27.48400 19.52700  1.000 31.71000  ? 322  SER A CA    1 
ATOM   2572 C  C     . SER A 1 334 ? -31.37000 -27.40200 18.73500  1.000 37.01000  ? 322  SER A C     1 
ATOM   2573 O  O     . SER A 1 334 ? -32.45900 -27.42200 19.30700  1.000 43.38000  ? 322  SER A O     1 
ATOM   2574 C  CB    . SER A 1 334 ? -29.69200 -26.09200 20.02100  1.000 37.46000  ? 322  SER A CB    1 
ATOM   2575 O  OG    . SER A 1 334 ? -29.67900 -25.17400 18.92600  1.000 38.26000  ? 322  SER A OG    1 
ATOM   2576 N  N     . LYS A 1 335 ? -31.24600 -27.28000 17.41600  1.000 34.68000  ? 323  LYS A N     1 
ATOM   2577 C  CA    . LYS A 1 335 ? -32.40400 -27.12700 16.55100  1.000 31.70000  ? 323  LYS A CA    1 
ATOM   2578 C  C     . LYS A 1 335 ? -32.81300 -28.45300 15.93400  1.000 34.28000  ? 323  LYS A C     1 
ATOM   2579 O  O     . LYS A 1 335 ? -32.29400 -29.50600 16.29100  1.000 44.33000  ? 323  LYS A O     1 
ATOM   2580 C  CB    . LYS A 1 335 ? -32.11800 -26.11600 15.45800  1.000 31.38000  ? 323  LYS A CB    1 
ATOM   2581 C  CG    . LYS A 1 335 ? -31.78600 -24.74400 15.98300  1.000 37.63000  ? 323  LYS A CG    1 
ATOM   2582 C  CD    . LYS A 1 335 ? -31.54000 -23.78100 14.84000  1.000 41.82000  ? 323  LYS A CD    1 
ATOM   2583 C  CE    . LYS A 1 335 ? -31.74900 -22.34700 15.29700  1.000 46.83000  ? 323  LYS A CE    1 
ATOM   2584 N  NZ    . LYS A 1 335 ? -31.02100 -22.10200 16.58100  1.000 48.28000  ? 323  LYS A NZ    1 
ATOM   2585 N  N     . ASP A 1 336 ? -33.75500 -28.40200 15.01100  1.000 34.34000  ? 324  ASP A N     1 
ATOM   2586 C  CA    . ASP A 1 336 ? -34.25700 -29.63000 14.43100  1.000 34.36000  ? 324  ASP A CA    1 
ATOM   2587 C  C     . ASP A 1 336 ? -33.68700 -29.91100 13.04900  1.000 36.33000  ? 324  ASP A C     1 
ATOM   2588 O  O     . ASP A 1 336 ? -33.12200 -29.02800 12.39100  1.000 36.26000  ? 324  ASP A O     1 
ATOM   2589 C  CB    . ASP A 1 336 ? -35.77700 -29.58600 14.37300  1.000 34.58000  ? 324  ASP A CB    1 
ATOM   2590 C  CG    . ASP A 1 336 ? -36.39900 -30.69300 15.19600  1.000 49.99000  ? 324  ASP A CG    1 
ATOM   2591 O  OD1   . ASP A 1 336 ? -35.98500 -31.87400 14.99700  1.000 51.40000  ? 324  ASP A OD1   1 
ATOM   2592 O  OD2   . ASP A 1 336 ? -37.26200 -30.38000 16.05800  1.000 39.99000  ? 324  ASP A OD2   1 
ATOM   2593 N  N     . LEU A 1 337 ? -33.81300 -31.15800 12.62600  1.000 32.19000  ? 325  LEU A N     1 
ATOM   2594 C  CA    . LEU A 1 337 ? -33.42200 -31.53100 11.28200  1.000 27.51000  ? 325  LEU A CA    1 
ATOM   2595 C  C     . LEU A 1 337 ? -34.68000 -31.70000 10.45100  1.000 29.95000  ? 325  LEU A C     1 
ATOM   2596 O  O     . LEU A 1 337 ? -35.56000 -32.50600 10.78000  1.000 29.04000  ? 325  LEU A O     1 
ATOM   2597 C  CB    . LEU A 1 337 ? -32.61600 -32.82200 11.27600  1.000 26.34000  ? 325  LEU A CB    1 
ATOM   2598 C  CG    . LEU A 1 337 ? -31.10300 -32.76700 11.12100  1.000 27.49000  ? 325  LEU A CG    1 
ATOM   2599 C  CD1   . LEU A 1 337 ? -30.57400 -34.19100 11.08500  1.000 27.72000  ? 325  LEU A CD1   1 
ATOM   2600 C  CD2   . LEU A 1 337 ? -30.69100 -32.04800 9.87000   1.000 21.46000  ? 325  LEU A CD2   1 
ATOM   2601 N  N     . ILE A 1 338 ? -34.76000 -30.93500 9.37500   1.000 25.36000  ? 326  ILE A N     1 
ATOM   2602 C  CA    . ILE A 1 338 ? -35.92900 -30.99500 8.52800   1.000 27.06000  ? 326  ILE A CA    1 
ATOM   2603 C  C     . ILE A 1 338 ? -35.53500 -31.39800 7.12200   1.000 26.20000  ? 326  ILE A C     1 
ATOM   2604 O  O     . ILE A 1 338 ? -34.57300 -30.88400 6.54300   1.000 29.05000  ? 326  ILE A O     1 
ATOM   2605 C  CB    . ILE A 1 338 ? -36.65800 -29.64800 8.50100   1.000 29.73000  ? 326  ILE A CB    1 
ATOM   2606 C  CG1   . ILE A 1 338 ? -37.08800 -29.27500 9.91300   1.000 24.60000  ? 326  ILE A CG1   1 
ATOM   2607 C  CG2   . ILE A 1 338 ? -37.86000 -29.71100 7.58500   1.000 30.08000  ? 326  ILE A CG2   1 
ATOM   2608 C  CD1   . ILE A 1 338 ? -37.38700 -27.84100 10.05400  1.000 24.77000  ? 326  ILE A CD1   1 
ATOM   2609 N  N     . ALA A 1 339 ? -36.28800 -32.32900 6.57300   1.000 24.45000  ? 327  ALA A N     1 
ATOM   2610 C  CA    . ALA A 1 339 ? -36.01000 -32.81500 5.24800   1.000 23.28000  ? 327  ALA A CA    1 
ATOM   2611 C  C     . ALA A 1 339 ? -37.23200 -32.53100 4.41200   1.000 24.95000  ? 327  ALA A C     1 
ATOM   2612 O  O     . ALA A 1 339 ? -38.35500 -32.77100 4.85500   1.000 31.33000  ? 327  ALA A O     1 
ATOM   2613 C  CB    . ALA A 1 339 ? -35.70300 -34.28900 5.28200   1.000 23.62000  ? 327  ALA A CB    1 
ATOM   2614 N  N     . GLU A 1 340 ? -37.01300 -32.00900 3.21500   1.000 21.70000  ? 328  GLU A N     1 
ATOM   2615 C  CA    . GLU A 1 340 ? -38.10300 -31.61700 2.33800   1.000 24.95000  ? 328  GLU A CA    1 
ATOM   2616 C  C     . GLU A 1 340 ? -37.94000 -32.31500 1.00500   1.000 30.21000  ? 328  GLU A C     1 
ATOM   2617 O  O     . GLU A 1 340 ? -36.84400 -32.33300 0.44700   1.000 30.45000  ? 328  GLU A O     1 
ATOM   2618 C  CB    . GLU A 1 340 ? -38.07700 -30.12200 2.14800   1.000 31.17000  ? 328  GLU A CB    1 
ATOM   2619 C  CG    . GLU A 1 340 ? -39.38000 -29.46500 1.82500   1.000 38.20000  ? 328  GLU A CG    1 
ATOM   2620 C  CD    . GLU A 1 340 ? -39.17000 -27.96700 1.67900   1.000 50.30000  ? 328  GLU A CD    1 
ATOM   2621 O  OE1   . GLU A 1 340 ? -39.99100 -27.19600 2.22900   1.000 50.65000  ? 328  GLU A OE1   1 
ATOM   2622 O  OE2   . GLU A 1 340 ? -38.15100 -27.57500 1.04300   1.000 49.50000  ? 328  GLU A OE2   1 
ATOM   2623 N  N     . ILE A 1 341 ? -39.01600 -32.89800 0.49300   1.000 23.22000  ? 329  ILE A N     1 
ATOM   2624 C  CA    . ILE A 1 341 ? -38.91800 -33.70300 -0.71900  1.000 24.99000  ? 329  ILE A CA    1 
ATOM   2625 C  C     . ILE A 1 341 ? -39.75900 -33.14900 -1.86800  1.000 31.81000  ? 329  ILE A C     1 
ATOM   2626 O  O     . ILE A 1 341 ? -40.93800 -32.81100 -1.67600  1.000 34.31000  ? 329  ILE A O     1 
ATOM   2627 C  CB    . ILE A 1 341 ? -39.36400 -35.14300 -0.45100  1.000 27.21000  ? 329  ILE A CB    1 
ATOM   2628 C  CG1   . ILE A 1 341 ? -38.53100 -35.77400 0.65800   1.000 25.52000  ? 329  ILE A CG1   1 
ATOM   2629 C  CG2   . ILE A 1 341 ? -39.25400 -35.97400 -1.70200  1.000 21.97000  ? 329  ILE A CG2   1 
ATOM   2630 C  CD1   . ILE A 1 341 ? -38.57700 -37.28100 0.61400   1.000 23.27000  ? 329  ILE A CD1   1 
ATOM   2631 N  N     . GLN A 1 342 ? -39.15600 -33.07400 -3.05400  1.000 28.25000  ? 330  GLN A N     1 
ATOM   2632 C  CA    . GLN A 1 342 ? -39.83800 -32.61100 -4.26700  1.000 27.10000  ? 330  GLN A CA    1 
ATOM   2633 C  C     . GLN A 1 342 ? -39.94200 -33.69900 -5.33600  1.000 28.38000  ? 330  GLN A C     1 
ATOM   2634 O  O     . GLN A 1 342 ? -38.95300 -34.32700 -5.69000  1.000 29.32000  ? 330  GLN A O     1 
ATOM   2635 C  CB    . GLN A 1 342 ? -39.11300 -31.40200 -4.86300  1.000 30.19000  ? 330  GLN A CB    1 
ATOM   2636 C  CG    . GLN A 1 342 ? -39.59100 -30.04900 -4.34700  1.000 36.88000  ? 330  GLN A CG    1 
ATOM   2637 C  CD    . GLN A 1 342 ? -38.74300 -29.51400 -3.20500  1.000 43.26000  ? 330  GLN A CD    1 
ATOM   2638 O  OE1   . GLN A 1 342 ? -37.50400 -29.57400 -3.24900  1.000 40.17000  ? 330  GLN A OE1   1 
ATOM   2639 N  NE2   . GLN A 1 342 ? -39.40900 -29.00000 -2.15900  1.000 45.64000  ? 330  GLN A NE2   1 
ATOM   2640 N  N     . LYS A 1 343 ? -41.13900 -33.91000 -5.86900  1.000 32.22000  ? 331  LYS A N     1 
ATOM   2641 C  CA    . LYS A 1 343 ? -41.31300 -34.86200 -6.96100  1.000 28.41000  ? 331  LYS A CA    1 
ATOM   2642 C  C     . LYS A 1 343 ? -40.81700 -34.26500 -8.27100  1.000 34.66000  ? 331  LYS A C     1 
ATOM   2643 O  O     . LYS A 1 343 ? -41.17000 -33.13900 -8.59600  1.000 38.56000  ? 331  LYS A O     1 
ATOM   2644 C  CB    . LYS A 1 343 ? -42.76800 -35.26500 -7.09200  1.000 27.39000  ? 331  LYS A CB    1 
ATOM   2645 C  CG    . LYS A 1 343 ? -43.00200 -36.21000 -8.23600  1.000 31.32000  ? 331  LYS A CG    1 
ATOM   2646 C  CD    . LYS A 1 343 ? -44.47700 -36.51500 -8.39100  1.000 29.34000  ? 331  LYS A CD    1 
ATOM   2647 C  CE    . LYS A 1 343 ? -44.68500 -37.54400 -9.47900  1.000 34.39000  ? 331  LYS A CE    1 
ATOM   2648 N  NZ    . LYS A 1 343 ? -46.10700 -37.97600 -9.59700  1.000 44.32000  ? 331  LYS A NZ    1 
ATOM   2649 N  N     . GLN A 1 344 ? -40.01100 -35.01900 -9.02100  1.000 39.61000  ? 332  GLN A N     1 
ATOM   2650 C  CA    . GLN A 1 344 ? -39.34400 -34.50700 -10.23000 1.000 38.99000  ? 332  GLN A CA    1 
ATOM   2651 C  C     . GLN A 1 344 ? -39.87300 -35.10700 -11.52500 1.000 43.87000  ? 332  GLN A C     1 
ATOM   2652 O  O     . GLN A 1 344 ? -39.56300 -34.61800 -12.60400 1.000 47.09000  ? 332  GLN A O     1 
ATOM   2653 C  CB    . GLN A 1 344 ? -37.84000 -34.77500 -10.17100 1.000 38.86000  ? 332  GLN A CB    1 
ATOM   2654 C  CG    . GLN A 1 344 ? -37.08500 -33.90500 -9.17900  1.000 41.67000  ? 332  GLN A CG    1 
ATOM   2655 C  CD    . GLN A 1 344 ? -36.97900 -32.47300 -9.64100  1.000 47.48000  ? 332  GLN A CD    1 
ATOM   2656 O  OE1   . GLN A 1 344 ? -36.78600 -32.21400 -10.82900 1.000 62.01000  ? 332  GLN A OE1   1 
ATOM   2657 N  NE2   . GLN A 1 344 ? -37.11000 -31.53200 -8.70800  1.000 47.19000  ? 332  GLN A NE2   1 
ATOM   2658 N  N     . GLY A 1 345 ? -40.64800 -36.17600 -11.41900 1.000 42.61000  ? 333  GLY A N     1 
ATOM   2659 C  CA    . GLY A 1 345 ? -41.19400 -36.82800 -12.58500 1.000 37.53000  ? 333  GLY A CA    1 
ATOM   2660 C  C     . GLY A 1 345 ? -40.38600 -38.05000 -12.95700 1.000 44.65000  ? 333  GLY A C     1 
ATOM   2661 O  O     . GLY A 1 345 ? -39.18200 -38.09000 -12.71700 1.000 47.51000  ? 333  GLY A O     1 
ATOM   2662 N  N     . GLN A 1 346 ? -41.05700 -39.05200 -13.52600 1.000 47.63000  ? 334  GLN A N     1 
ATOM   2663 C  CA    . GLN A 1 346 ? -40.40500 -40.26200 -14.03000 1.000 46.47000  ? 334  GLN A CA    1 
ATOM   2664 C  C     . GLN A 1 346 ? -39.61700 -41.05800 -12.99200 1.000 47.55000  ? 334  GLN A C     1 
ATOM   2665 O  O     . GLN A 1 346 ? -38.68100 -41.79400 -13.34400 1.000 49.93000  ? 334  GLN A O     1 
ATOM   2666 C  CB    . GLN A 1 346 ? -39.45400 -39.91300 -15.17000 1.000 56.56000  ? 334  GLN A CB    1 
ATOM   2667 C  CG    . GLN A 1 346 ? -40.13700 -39.60100 -16.47400 1.000 58.98000  ? 334  GLN A CG    1 
ATOM   2668 C  CD    . GLN A 1 346 ? -39.82100 -38.20300 -16.93200 1.000 64.27000  ? 334  GLN A CD    1 
ATOM   2669 O  OE1   . GLN A 1 346 ? -40.69000 -37.33000 -16.92600 1.000 66.00000  ? 334  GLN A OE1   1 
ATOM   2670 N  NE2   . GLN A 1 346 ? -38.56100 -37.97200 -17.31900 1.000 65.02000  ? 334  GLN A NE2   1 
ATOM   2671 N  N     . GLY A 1 347 ? -39.97600 -40.92100 -11.72400 1.000 41.22000  ? 335  GLY A N     1 
ATOM   2672 C  CA    . GLY A 1 347 ? -39.29100 -41.68900 -10.70100 1.000 41.62000  ? 335  GLY A CA    1 
ATOM   2673 C  C     . GLY A 1 347 ? -38.02600 -41.00300 -10.23100 1.000 40.10000  ? 335  GLY A C     1 
ATOM   2674 O  O     . GLY A 1 347 ? -37.04700 -41.67000 -9.86900  1.000 39.67000  ? 335  GLY A O     1 
ATOM   2675 N  N     . GLN A 1 348 ? -38.06800 -39.66700 -10.24400 1.000 36.41000  ? 336  GLN A N     1 
ATOM   2676 C  CA    . GLN A 1 348 ? -36.96800 -38.82400 -9.79400  1.000 36.00000  ? 336  GLN A CA    1 
ATOM   2677 C  C     . GLN A 1 348 ? -37.40900 -37.92700 -8.64500  1.000 35.70000  ? 336  GLN A C     1 
ATOM   2678 O  O     . GLN A 1 348 ? -38.50400 -37.36800 -8.68400  1.000 36.45000  ? 336  GLN A O     1 
ATOM   2679 C  CB    . GLN A 1 348 ? -36.44700 -37.95900 -10.93600 1.000 33.05000  ? 336  GLN A CB    1 
ATOM   2680 C  CG    . GLN A 1 348 ? -36.11100 -38.74400 -12.16300 1.000 38.56000  ? 336  GLN A CG    1 
ATOM   2681 C  CD    . GLN A 1 348 ? -35.11300 -38.02100 -13.02200 1.000 42.81000  ? 336  GLN A CD    1 
ATOM   2682 O  OE1   . GLN A 1 348 ? -35.48800 -37.33600 -13.97300 1.000 50.41000  ? 336  GLN A OE1   1 
ATOM   2683 N  NE2   . GLN A 1 348 ? -33.82200 -38.15300 -12.69200 1.000 41.14000  ? 336  GLN A NE2   1 
ATOM   2684 N  N     . TRP A 1 349 ? -36.55100 -37.78200 -7.63700  1.000 28.01000  ? 337  TRP A N     1 
ATOM   2685 C  CA    . TRP A 1 349 ? -36.88100 -37.00100 -6.46000  1.000 27.71000  ? 337  TRP A CA    1 
ATOM   2686 C  C     . TRP A 1 349 ? -35.70300 -36.13600 -6.01500  1.000 29.46000  ? 337  TRP A C     1 
ATOM   2687 O  O     . TRP A 1 349 ? -34.55600 -36.54700 -6.11500  1.000 28.31000  ? 337  TRP A O     1 
ATOM   2688 C  CB    . TRP A 1 349 ? -37.33800 -37.95000 -5.32700  1.000 29.67000  ? 337  TRP A CB    1 
ATOM   2689 C  CG    . TRP A 1 349 ? -38.42600 -38.87400 -5.79700  1.000 25.60000  ? 337  TRP A CG    1 
ATOM   2690 C  CD1   . TRP A 1 349 ? -38.27700 -39.96800 -6.58700  1.000 26.57000  ? 337  TRP A CD1   1 
ATOM   2691 C  CD2   . TRP A 1 349 ? -39.82400 -38.75800 -5.54000  1.000 21.55000  ? 337  TRP A CD2   1 
ATOM   2692 N  NE1   . TRP A 1 349 ? -39.48400 -40.55100 -6.83800  1.000 29.30000  ? 337  TRP A NE1   1 
ATOM   2693 C  CE2   . TRP A 1 349 ? -40.45800 -39.83000 -6.20700  1.000 25.82000  ? 337  TRP A CE2   1 
ATOM   2694 C  CE3   . TRP A 1 349 ? -40.60400 -37.86400 -4.80100  1.000 22.56000  ? 337  TRP A CE3   1 
ATOM   2695 C  CZ2   . TRP A 1 349 ? -41.82900 -40.03400 -6.15400  1.000 23.30000  ? 337  TRP A CZ2   1 
ATOM   2696 C  CZ3   . TRP A 1 349 ? -41.96000 -38.06300 -4.74700  1.000 23.69000  ? 337  TRP A CZ3   1 
ATOM   2697 C  CH2   . TRP A 1 349 ? -42.56300 -39.14100 -5.42400  1.000 28.43000  ? 337  TRP A CH2   1 
ATOM   2698 N  N     . THR A 1 350 ? -35.99100 -34.92900 -5.54200  1.000 26.91000  ? 338  THR A N     1 
ATOM   2699 C  CA    . THR A 1 350 ? -34.95400 -34.06200 -5.00800  1.000 24.94000  ? 338  THR A CA    1 
ATOM   2700 C  C     . THR A 1 350 ? -35.28500 -33.77400 -3.55800  1.000 29.85000  ? 338  THR A C     1 
ATOM   2701 O  O     . THR A 1 350 ? -36.46100 -33.68400 -3.19300  1.000 28.84000  ? 338  THR A O     1 
ATOM   2702 C  CB    . THR A 1 350 ? -34.83700 -32.73400 -5.78500  1.000 27.44000  ? 338  THR A CB    1 
ATOM   2703 O  OG1   . THR A 1 350 ? -34.15500 -32.96900 -7.01900  1.000 34.43000  ? 338  THR A OG1   1 
ATOM   2704 C  CG2   . THR A 1 350 ? -34.01300 -31.72000 -4.99400  1.000 26.81000  ? 338  THR A CG2   1 
ATOM   2705 N  N     . TYR A 1 351 ? -34.26200 -33.63600 -2.71100  1.000 31.42000  ? 339  TYR A N     1 
ATOM   2706 C  CA    . TYR A 1 351 ? -34.54000 -33.27400 -1.33100  1.000 29.85000  ? 339  TYR A CA    1 
ATOM   2707 C  C     . TYR A 1 351 ? -33.55000 -32.23800 -0.81400  1.000 28.90000  ? 339  TYR A C     1 
ATOM   2708 O  O     . TYR A 1 351 ? -32.41100 -32.15100 -1.26800  1.000 30.32000  ? 339  TYR A O     1 
ATOM   2709 C  CB    . TYR A 1 351 ? -34.55900 -34.52500 -0.42800  1.000 25.31000  ? 339  TYR A CB    1 
ATOM   2710 C  CG    . TYR A 1 351 ? -33.25900 -35.29500 -0.33800  1.000 24.07000  ? 339  TYR A CG    1 
ATOM   2711 C  CD1   . TYR A 1 351 ? -32.29100 -34.93700 0.58400   1.000 25.68000  ? 339  TYR A CD1   1 
ATOM   2712 C  CD2   . TYR A 1 351 ? -33.02100 -36.40000 -1.14000  1.000 23.45000  ? 339  TYR A CD2   1 
ATOM   2713 C  CE1   . TYR A 1 351 ? -31.11300 -35.62600 0.68800   1.000 21.57000  ? 339  TYR A CE1   1 
ATOM   2714 C  CE2   . TYR A 1 351 ? -31.84100 -37.10900 -1.03300  1.000 23.13000  ? 339  TYR A CE2   1 
ATOM   2715 C  CZ    . TYR A 1 351 ? -30.89300 -36.70200 -0.11800  1.000 24.01000  ? 339  TYR A CZ    1 
ATOM   2716 O  OH    . TYR A 1 351 ? -29.70300 -37.36700 0.01400   1.000 33.04000  ? 339  TYR A OH    1 
ATOM   2717 N  N     . GLN A 1 352 ? -34.01000 -31.43700 0.12800   1.000 23.65000  ? 340  GLN A N     1 
ATOM   2718 C  CA    . GLN A 1 352 ? -33.15700 -30.48900 0.79800   1.000 26.10000  ? 340  GLN A CA    1 
ATOM   2719 C  C     . GLN A 1 352 ? -33.30800 -30.67800 2.28700   1.000 25.29000  ? 340  GLN A C     1 
ATOM   2720 O  O     . GLN A 1 352 ? -34.41600 -30.73800 2.79600   1.000 28.22000  ? 340  GLN A O     1 
ATOM   2721 C  CB    . GLN A 1 352 ? -33.51900 -29.07300 0.39600   1.000 25.22000  ? 340  GLN A CB    1 
ATOM   2722 C  CG    . GLN A 1 352 ? -34.63500 -29.06800 -0.57600  1.000 34.28000  ? 340  GLN A CG    1 
ATOM   2723 C  CD    . GLN A 1 352 ? -34.48700 -27.98400 -1.58600  1.000 46.19000  ? 340  GLN A CD    1 
ATOM   2724 O  OE1   . GLN A 1 352 ? -33.70500 -27.04300 -1.39300  1.000 49.05000  ? 340  GLN A OE1   1 
ATOM   2725 N  NE2   . GLN A 1 352 ? -35.22600 -28.09800 -2.68600  1.000 46.19000  ? 340  GLN A NE2   1 
ATOM   2726 N  N     . ILE A 1 353 ? -32.18200 -30.78700 2.97500   1.000 23.65000  ? 341  ILE A N     1 
ATOM   2727 C  CA    . ILE A 1 353 ? -32.17100 -30.98800 4.41400   1.000 22.94000  ? 341  ILE A CA    1 
ATOM   2728 C  C     . ILE A 1 353 ? -31.74100 -29.66900 5.07800   1.000 26.12000  ? 341  ILE A C     1 
ATOM   2729 O  O     . ILE A 1 353 ? -30.76700 -29.02200 4.64700   1.000 24.86000  ? 341  ILE A O     1 
ATOM   2730 C  CB    . ILE A 1 353 ? -31.22200 -32.15200 4.78400   1.000 21.18000  ? 341  ILE A CB    1 
ATOM   2731 C  CG1   . ILE A 1 353 ? -31.62300 -33.41000 4.03000   1.000 17.79000  ? 341  ILE A CG1   1 
ATOM   2732 C  CG2   . ILE A 1 353 ? -31.22100 -32.40600 6.25500   1.000 18.96000  ? 341  ILE A CG2   1 
ATOM   2733 C  CD1   . ILE A 1 353 ? -30.90900 -34.62000 4.48800   1.000 22.45000  ? 341  ILE A CD1   1 
ATOM   2734 N  N     . TYR A 1 354 ? -32.46700 -29.24500 6.10200   1.000 25.12000  ? 342  TYR A N     1 
ATOM   2735 C  CA    . TYR A 1 354 ? -32.20500 -27.92600 6.66900   1.000 24.70000  ? 342  TYR A CA    1 
ATOM   2736 C  C     . TYR A 1 354 ? -32.66600 -27.81100 8.10400   1.000 27.31000  ? 342  TYR A C     1 
ATOM   2737 O  O     . TYR A 1 354 ? -33.23900 -28.74200 8.66300   1.000 30.29000  ? 342  TYR A O     1 
ATOM   2738 C  CB    . TYR A 1 354 ? -32.87100 -26.82900 5.83200   1.000 23.99000  ? 342  TYR A CB    1 
ATOM   2739 C  CG    . TYR A 1 354 ? -34.38800 -26.86500 5.70400   1.000 26.35000  ? 342  TYR A CG    1 
ATOM   2740 C  CD1   . TYR A 1 354 ? -35.20200 -26.29100 6.66300   1.000 31.17000  ? 342  TYR A CD1   1 
ATOM   2741 C  CD2   . TYR A 1 354 ? -35.00300 -27.40300 4.57400   1.000 30.71000  ? 342  TYR A CD2   1 
ATOM   2742 C  CE1   . TYR A 1 354 ? -36.59600 -26.29600 6.53200   1.000 31.99000  ? 342  TYR A CE1   1 
ATOM   2743 C  CE2   . TYR A 1 354 ? -36.39200 -27.40700 4.42700   1.000 30.19000  ? 342  TYR A CE2   1 
ATOM   2744 C  CZ    . TYR A 1 354 ? -37.18300 -26.85400 5.41200   1.000 34.31000  ? 342  TYR A CZ    1 
ATOM   2745 O  OH    . TYR A 1 354 ? -38.55700 -26.84900 5.28300   1.000 34.22000  ? 342  TYR A OH    1 
ATOM   2746 N  N     . GLN A 1 355 ? -32.40900 -26.66300 8.69800   1.000 26.62000  ? 343  GLN A N     1 
ATOM   2747 C  CA    . GLN A 1 355 ? -32.79200 -26.43800 10.07600  1.000 30.94000  ? 343  GLN A CA    1 
ATOM   2748 C  C     . GLN A 1 355 ? -33.56400 -25.13400 10.21100  1.000 36.98000  ? 343  GLN A C     1 
ATOM   2749 O  O     . GLN A 1 355 ? -34.49300 -25.03900 11.01700  1.000 33.80000  ? 343  GLN A O     1 
ATOM   2750 C  CB    . GLN A 1 355 ? -31.56500 -26.40300 10.97400  1.000 25.54000  ? 343  GLN A CB    1 
ATOM   2751 C  CG    . GLN A 1 355 ? -30.83900 -27.68900 10.99600  1.000 23.00000  ? 343  GLN A CG    1 
ATOM   2752 C  CD    . GLN A 1 355 ? -29.88300 -27.76200 12.14300  1.000 24.22000  ? 343  GLN A CD    1 
ATOM   2753 O  OE1   . GLN A 1 355 ? -28.78600 -27.19100 12.09000  1.000 21.71000  ? 343  GLN A OE1   1 
ATOM   2754 N  NE2   . GLN A 1 355 ? -30.29000 -28.46100 13.21100  1.000 25.19000  ? 343  GLN A NE2   1 
ATOM   2755 N  N     . GLU A 1 356 ? -33.12300 -24.13500 9.44000   1.000 34.01000  ? 344  GLU A N     1 
ATOM   2756 C  CA    . GLU A 1 356 ? -33.77200 -22.84300 9.30900   1.000 36.78000  ? 344  GLU A CA    1 
ATOM   2757 C  C     . GLU A 1 356 ? -34.09400 -22.62900 7.83900   1.000 38.93000  ? 344  GLU A C     1 
ATOM   2758 O  O     . GLU A 1 356 ? -33.27500 -22.95300 6.97300   1.000 42.77000  ? 344  GLU A O     1 
ATOM   2759 C  CB    . GLU A 1 356 ? -32.87600 -21.72600 9.82900   1.000 44.33000  ? 344  GLU A CB    1 
ATOM   2760 C  CG    . GLU A 1 356 ? -33.24700 -20.33700 9.29200   1.000 58.45000  ? 344  GLU A CG    1 
ATOM   2761 C  CD    . GLU A 1 356 ? -33.13000 -19.24100 10.35100  1.000 67.47000  ? 344  GLU A CD    1 
ATOM   2762 O  OE1   . GLU A 1 356 ? -32.32700 -19.42400 11.30300  1.000 72.92000  ? 344  GLU A OE1   1 
ATOM   2763 O  OE2   . GLU A 1 356 ? -33.84900 -18.21300 10.23300  1.000 55.15000  ? 344  GLU A OE2   1 
ATOM   2764 N  N     . PRO A 1 357 ? -35.27400 -22.07200 7.53600   1.000 40.11000  ? 345  PRO A N     1 
ATOM   2765 C  CA    . PRO A 1 357 ? -35.66900 -22.17600 6.12600   1.000 43.13000  ? 345  PRO A CA    1 
ATOM   2766 C  C     . PRO A 1 357 ? -34.71300 -21.45900 5.16300   1.000 44.42000  ? 345  PRO A C     1 
ATOM   2767 O  O     . PRO A 1 357 ? -34.14000 -20.42400 5.49300   1.000 44.69000  ? 345  PRO A O     1 
ATOM   2768 C  CB    . PRO A 1 357 ? -37.05900 -21.54100 6.11900   1.000 40.15000  ? 345  PRO A CB    1 
ATOM   2769 C  CG    . PRO A 1 357 ? -37.56500 -21.77000 7.51500   1.000 38.57000  ? 345  PRO A CG    1 
ATOM   2770 C  CD    . PRO A 1 357 ? -36.34900 -21.51000 8.36700   1.000 41.18000  ? 345  PRO A CD    1 
ATOM   2771 N  N     . PHE A 1 358 ? -34.50900 -22.05200 3.99600   1.000 43.67000  ? 346  PHE A N     1 
ATOM   2772 C  CA    . PHE A 1 358 ? -33.65700 -21.44800 2.96600   1.000 43.84000  ? 346  PHE A CA    1 
ATOM   2773 C  C     . PHE A 1 358 ? -32.19300 -21.39300 3.33300   1.000 39.79000  ? 346  PHE A C     1 
ATOM   2774 O  O     . PHE A 1 358 ? -31.42000 -20.69600 2.68400   1.000 43.08000  ? 346  PHE A O     1 
ATOM   2775 C  CB    . PHE A 1 358 ? -34.14200 -20.03700 2.63100   1.000 46.09000  ? 346  PHE A CB    1 
ATOM   2776 C  CG    . PHE A 1 358 ? -35.41300 -20.02700 1.83800   1.000 49.14000  ? 346  PHE A CG    1 
ATOM   2777 C  CD1   . PHE A 1 358 ? -35.38800 -20.31100 0.48200   1.000 45.77000  ? 346  PHE A CD1   1 
ATOM   2778 C  CD2   . PHE A 1 358 ? -36.63800 -19.78100 2.45100   1.000 48.64000  ? 346  PHE A CD2   1 
ATOM   2779 C  CE1   . PHE A 1 358 ? -36.55400 -20.32900 -0.25600  1.000 41.98000  ? 346  PHE A CE1   1 
ATOM   2780 C  CE2   . PHE A 1 358 ? -37.81500 -19.79800 1.71000   1.000 42.81000  ? 346  PHE A CE2   1 
ATOM   2781 C  CZ    . PHE A 1 358 ? -37.76800 -20.07200 0.35400   1.000 35.98000  ? 346  PHE A CZ    1 
ATOM   2782 N  N     . LYS A 1 359 ? -31.81000 -22.14200 4.36300   1.000 38.26000  ? 347  LYS A N     1 
ATOM   2783 C  CA    . LYS A 1 359 ? -30.40100 -22.36300 4.63700   1.000 31.95000  ? 347  LYS A CA    1 
ATOM   2784 C  C     . LYS A 1 359 ? -30.10600 -23.85500 4.67100   1.000 33.57000  ? 347  LYS A C     1 
ATOM   2785 O  O     . LYS A 1 359 ? -29.92100 -24.43100 5.75000   1.000 34.71000  ? 347  LYS A O     1 
ATOM   2786 C  CB    . LYS A 1 359 ? -29.99900 -21.72800 5.96100   1.000 33.76000  ? 347  LYS A CB    1 
ATOM   2787 C  CG    . LYS A 1 359 ? -30.13500 -20.22700 6.02900   1.000 34.90000  ? 347  LYS A CG    1 
ATOM   2788 C  CD    . LYS A 1 359 ? -29.85400 -19.77200 7.43700   1.000 40.53000  ? 347  LYS A CD    1 
ATOM   2789 C  CE    . LYS A 1 359 ? -30.07300 -18.29100 7.61400   1.000 51.62000  ? 347  LYS A CE    1 
ATOM   2790 N  NZ    . LYS A 1 359 ? -30.01900 -17.94600 9.06800   1.000 51.36000  ? 347  LYS A NZ    1 
ATOM   2791 N  N     . ASN A 1 360 ? -30.06700 -24.48100 3.50400   1.000 25.51000  ? 348  ASN A N     1 
ATOM   2792 C  CA    . ASN A 1 360 ? -29.72600 -25.89500 3.41800   1.000 21.96000  ? 348  ASN A CA    1 
ATOM   2793 C  C     . ASN A 1 360 ? -28.48600 -26.33900 4.19100   1.000 28.13000  ? 348  ASN A C     1 
ATOM   2794 O  O     . ASN A 1 360 ? -27.47300 -25.63800 4.22400   1.000 31.93000  ? 348  ASN A O     1 
ATOM   2795 C  CB    . ASN A 1 360 ? -29.53700 -26.27200 1.96200   1.000 21.45000  ? 348  ASN A CB    1 
ATOM   2796 C  CG    . ASN A 1 360 ? -30.82700 -26.22200 1.20600   1.000 21.31000  ? 348  ASN A CG    1 
ATOM   2797 O  OD1   . ASN A 1 360 ? -31.89900 -26.08500 1.80500   1.000 25.64000  ? 348  ASN A OD1   1 
ATOM   2798 N  ND2   . ASN A 1 360 ? -30.74800 -26.33900 -0.10200  1.000 18.14000  ? 348  ASN A ND2   1 
ATOM   2799 N  N     . LEU A 1 361 ? -28.58500 -27.50500 4.81900   1.000 25.63000  ? 349  LEU A N     1 
ATOM   2800 C  CA    . LEU A 1 361 ? -27.41100 -28.19100 5.30600   1.000 18.05000  ? 349  LEU A CA    1 
ATOM   2801 C  C     . LEU A 1 361 ? -26.83300 -28.91300 4.10500   1.000 24.63000  ? 349  LEU A C     1 
ATOM   2802 O  O     . LEU A 1 361 ? -25.63300 -28.85100 3.81200   1.000 25.74000  ? 349  LEU A O     1 
ATOM   2803 C  CB    . LEU A 1 361 ? -27.76800 -29.16500 6.40400   1.000 22.59000  ? 349  LEU A CB    1 
ATOM   2804 C  CG    . LEU A 1 361 ? -27.83100 -28.61600 7.82900   1.000 24.92000  ? 349  LEU A CG    1 
ATOM   2805 C  CD1   . LEU A 1 361 ? -28.41300 -29.65700 8.73800   1.000 24.06000  ? 349  LEU A CD1   1 
ATOM   2806 C  CD2   . LEU A 1 361 ? -26.43600 -28.30100 8.27400   1.000 26.93000  ? 349  LEU A CD2   1 
ATOM   2807 N  N     . LYS A 1 362 ? -27.70900 -29.58300 3.37600   1.000 22.73000  ? 350  LYS A N     1 
ATOM   2808 C  CA    . LYS A 1 362 ? -27.28800 -30.19500 2.14300   1.000 23.07000  ? 350  LYS A CA    1 
ATOM   2809 C  C     . LYS A 1 362 ? -28.53100 -30.58500 1.33500   1.000 26.62000  ? 350  LYS A C     1 
ATOM   2810 O  O     . LYS A 1 362 ? -29.68700 -30.37800 1.77500   1.000 23.11000  ? 350  LYS A O     1 
ATOM   2811 C  CB    . LYS A 1 362 ? -26.40600 -31.42600 2.43200   1.000 26.06000  ? 350  LYS A CB    1 
ATOM   2812 C  CG    . LYS A 1 362 ? -27.18300 -32.70800 2.74400   1.000 22.11000  ? 350  LYS A CG    1 
ATOM   2813 C  CD    . LYS A 1 362 ? -26.26100 -33.79900 3.22400   1.000 21.68000  ? 350  LYS A CD    1 
ATOM   2814 C  CE    . LYS A 1 362 ? -25.35800 -34.28200 2.12800   1.000 21.69000  ? 350  LYS A CE    1 
ATOM   2815 N  NZ    . LYS A 1 362 ? -26.16600 -34.93000 1.05000   1.000 25.88000  ? 350  LYS A NZ    1 
ATOM   2816 N  N     . THR A 1 363 ? -28.28500 -31.16400 0.16400   1.000 21.92000  ? 351  THR A N     1 
ATOM   2817 C  CA    . THR A 1 363 ? -29.36000 -31.59200 -0.70100  1.000 23.16000  ? 351  THR A CA    1 
ATOM   2818 C  C     . THR A 1 363 ? -29.00500 -32.94700 -1.28400  1.000 25.22000  ? 351  THR A C     1 
ATOM   2819 O  O     . THR A 1 363 ? -27.95300 -33.50500 -0.95100  1.000 27.46000  ? 351  THR A O     1 
ATOM   2820 C  CB    . THR A 1 363 ? -29.59800 -30.58200 -1.83400  1.000 27.36000  ? 351  THR A CB    1 
ATOM   2821 O  OG1   . THR A 1 363 ? -28.46500 -30.57400 -2.71300  1.000 25.79000  ? 351  THR A OG1   1 
ATOM   2822 C  CG2   . THR A 1 363 ? -29.79900 -29.18700 -1.26100  1.000 21.96000  ? 351  THR A CG2   1 
ATOM   2823 N  N     . GLY A 1 364 ? -29.86800 -33.47100 -2.15500  1.000 25.54000  ? 352  GLY A N     1 
ATOM   2824 C  CA    . GLY A 1 364 ? -29.62900 -34.74400 -2.80900  1.000 22.14000  ? 352  GLY A CA    1 
ATOM   2825 C  C     . GLY A 1 364 ? -30.75800 -35.17400 -3.74000  1.000 23.47000  ? 352  GLY A C     1 
ATOM   2826 O  O     . GLY A 1 364 ? -31.77500 -34.49200 -3.86800  1.000 27.27000  ? 352  GLY A O     1 
ATOM   2827 N  N     . LYS A 1 365 ? -30.58900 -36.32000 -4.38200  1.000 21.80000  ? 353  LYS A N     1 
ATOM   2828 C  CA    . LYS A 1 365 ? -31.63500 -36.89400 -5.19600  1.000 21.41000  ? 353  LYS A CA    1 
ATOM   2829 C  C     . LYS A 1 365 ? -31.78900 -38.40500 -4.99900  1.000 28.83000  ? 353  LYS A C     1 
ATOM   2830 O  O     . LYS A 1 365 ? -30.87600 -39.08400 -4.53800  1.000 36.17000  ? 353  LYS A O     1 
ATOM   2831 C  CB    . LYS A 1 365 ? -31.37200 -36.60300 -6.66800  1.000 26.45000  ? 353  LYS A CB    1 
ATOM   2832 C  CG    . LYS A 1 365 ? -30.03000 -37.06300 -7.13500  1.000 24.67000  ? 353  LYS A CG    1 
ATOM   2833 C  CD    . LYS A 1 365 ? -30.02600 -37.29000 -8.63500  1.000 36.51000  ? 353  LYS A CD    1 
ATOM   2834 C  CE    . LYS A 1 365 ? -29.12800 -38.48100 -9.01900  1.000 39.18000  ? 353  LYS A CE    1 
ATOM   2835 N  NZ    . LYS A 1 365 ? -27.66900 -38.17500 -8.76500  1.000 34.22000  ? 353  LYS A NZ    1 
ATOM   2836 N  N     . TYR A 1 366 ? -32.96000 -38.91700 -5.35500  1.000 32.70000  ? 354  TYR A N     1 
ATOM   2837 C  CA    . TYR A 1 366 ? -33.25900 -40.34200 -5.35700  1.000 28.05000  ? 354  TYR A CA    1 
ATOM   2838 C  C     . TYR A 1 366 ? -33.90500 -40.71200 -6.69200  1.000 32.59000  ? 354  TYR A C     1 
ATOM   2839 O  O     . TYR A 1 366 ? -34.95400 -40.18400 -7.05200  1.000 36.78000  ? 354  TYR A O     1 
ATOM   2840 C  CB    . TYR A 1 366 ? -34.19500 -40.69600 -4.20600  1.000 25.08000  ? 354  TYR A CB    1 
ATOM   2841 C  CG    . TYR A 1 366 ? -34.55300 -42.15200 -4.18100  1.000 28.31000  ? 354  TYR A CG    1 
ATOM   2842 C  CD1   . TYR A 1 366 ? -33.58500 -43.10600 -3.87800  1.000 25.66000  ? 354  TYR A CD1   1 
ATOM   2843 C  CD2   . TYR A 1 366 ? -35.85100 -42.58400 -4.44600  1.000 26.42000  ? 354  TYR A CD2   1 
ATOM   2844 C  CE1   . TYR A 1 366 ? -33.88400 -44.45100 -3.85300  1.000 26.97000  ? 354  TYR A CE1   1 
ATOM   2845 C  CE2   . TYR A 1 366 ? -36.16900 -43.94700 -4.41900  1.000 28.55000  ? 354  TYR A CE2   1 
ATOM   2846 C  CZ    . TYR A 1 366 ? -35.17100 -44.87000 -4.12500  1.000 34.96000  ? 354  TYR A CZ    1 
ATOM   2847 O  OH    . TYR A 1 366 ? -35.43900 -46.22000 -4.08500  1.000 39.64000  ? 354  TYR A OH    1 
ATOM   2848 N  N     . ALA A 1 367 ? -33.28900 -41.59600 -7.45600  1.000 37.81000  ? 355  ALA A N     1 
ATOM   2849 C  CA    . ALA A 1 367 ? -33.85100 -41.88200 -8.77100  1.000 39.97000  ? 355  ALA A CA    1 
ATOM   2850 C  C     . ALA A 1 367 ? -33.78500 -43.35700 -9.09800  1.000 44.03000  ? 355  ALA A C     1 
ATOM   2851 O  O     . ALA A 1 367 ? -33.69100 -43.74500 -10.25900 1.000 49.64000  ? 355  ALA A O     1 
ATOM   2852 C  CB    . ALA A 1 367 ? -33.13600 -41.08700 -9.82600  1.000 41.84000  ? 355  ALA A CB    1 
ATOM   2853 N  N     . ARG A 1 368 ? -33.84700 -44.18100 -8.06200  1.000 41.31000  ? 356  ARG A N     1 
ATOM   2854 C  CA    . ARG A 1 368 ? -33.61500 -45.59600 -8.21700  1.000 41.68000  ? 356  ARG A CA    1 
ATOM   2855 C  C     . ARG A 1 368 ? -34.90300 -46.29300 -8.60200  1.000 43.30000  ? 356  ARG A C     1 
ATOM   2856 O  O     . ARG A 1 368 ? -35.85700 -46.33300 -7.83500  1.000 50.19000  ? 356  ARG A O     1 
ATOM   2857 C  CB    . ARG A 1 368 ? -33.03300 -46.16700 -6.92200  1.000 46.93000  ? 356  ARG A CB    1 
ATOM   2858 C  CG    . ARG A 1 368 ? -33.07600 -47.67600 -6.81200  1.000 52.31000  ? 356  ARG A CG    1 
ATOM   2859 C  CD    . ARG A 1 368 ? -31.75400 -48.31300 -7.16900  1.000 54.08000  ? 356  ARG A CD    1 
ATOM   2860 N  NE    . ARG A 1 368 ? -31.80600 -49.75200 -6.91300  1.000 69.61000  ? 356  ARG A NE    1 
ATOM   2861 C  CZ    . ARG A 1 368 ? -31.52200 -50.30600 -5.73700  1.000 65.33000  ? 356  ARG A CZ    1 
ATOM   2862 N  NH1   . ARG A 1 368 ? -31.16700 -49.53400 -4.71800  1.000 62.50000  ? 356  ARG A NH1   1 
ATOM   2863 N  NH2   . ARG A 1 368 ? -31.59400 -51.62200 -5.58200  1.000 62.65000  ? 356  ARG A NH2   1 
ATOM   2864 N  N     . MET A 1 369 ? -34.93200 -46.82800 -9.81000  1.000 48.03000  ? 357  MET A N     1 
ATOM   2865 C  CA    . MET A 1 369 ? -36.05800 -47.63700 -10.24300 1.000 47.75000  ? 357  MET A CA    1 
ATOM   2866 C  C     . MET A 1 369 ? -35.93800 -49.05200 -9.66000  1.000 50.22000  ? 357  MET A C     1 
ATOM   2867 O  O     . MET A 1 369 ? -35.09800 -49.84400 -10.10300 1.000 53.03000  ? 357  MET A O     1 
ATOM   2868 C  CB    . MET A 1 369 ? -36.11200 -47.67800 -11.77500 1.000 50.33000  ? 357  MET A CB    1 
ATOM   2869 C  CG    . MET A 1 369 ? -37.49700 -47.44300 -12.39300 1.000 66.14000  ? 357  MET A CG    1 
ATOM   2870 S  SD    . MET A 1 369 ? -38.20500 -45.80900 -12.05800 1.000 58.99000  ? 357  MET A SD    1 
ATOM   2871 C  CE    . MET A 1 369 ? -38.81900 -46.08700 -10.37200 1.000 50.21000  ? 357  MET A CE    1 
ATOM   2872 N  N     . ARG A 1 370 ? -36.74600 -49.36700 -8.65300  1.000 44.23000  ? 358  ARG A N     1 
ATOM   2873 C  CA    . ARG A 1 370 ? -36.77500 -50.73300 -8.13900  1.000 40.96000  ? 358  ARG A CA    1 
ATOM   2874 C  C     . ARG A 1 370 ? -38.18000 -51.34100 -8.18400  1.000 43.88000  ? 358  ARG A C     1 
ATOM   2875 O  O     . ARG A 1 370 ? -39.13900 -50.82300 -7.60400  1.000 46.08000  ? 358  ARG A O     1 
ATOM   2876 C  CB    . ARG A 1 370 ? -36.21200 -50.79300 -6.72300  1.000 49.43000  ? 358  ARG A CB    1 
ATOM   2877 C  CG    . ARG A 1 370 ? -36.72400 -49.74100 -5.78700  1.000 48.38000  ? 358  ARG A CG    1 
ATOM   2878 C  CD    . ARG A 1 370 ? -36.07100 -49.91100 -4.43700  1.000 53.64000  ? 358  ARG A CD    1 
ATOM   2879 N  NE    . ARG A 1 370 ? -36.26300 -51.26100 -3.91300  1.000 55.33000  ? 358  ARG A NE    1 
ATOM   2880 C  CZ    . ARG A 1 370 ? -35.27700 -52.02600 -3.44900  1.000 60.30000  ? 358  ARG A CZ    1 
ATOM   2881 N  NH1   . ARG A 1 370 ? -34.03200 -51.57400 -3.44700  1.000 62.50000  ? 358  ARG A NH1   1 
ATOM   2882 N  NH2   . ARG A 1 370 ? -35.53600 -53.24300 -2.98200  1.000 64.90000  ? 358  ARG A NH2   1 
ATOM   2883 N  N     . GLY A 1 371 ? -38.28600 -52.45700 -8.89600  1.000 43.12000  ? 359  GLY A N     1 
ATOM   2884 C  CA    . GLY A 1 371 ? -39.56400 -53.05500 -9.19000  1.000 38.77000  ? 359  GLY A CA    1 
ATOM   2885 C  C     . GLY A 1 371 ? -39.92500 -52.91300 -10.65500 1.000 35.12000  ? 359  GLY A C     1 
ATOM   2886 O  O     . GLY A 1 371 ? -39.79400 -51.84900 -11.24800 1.000 37.86000  ? 359  GLY A O     1 
ATOM   2887 N  N     . ALA A 1 372 ? -40.38100 -54.00600 -11.24100 1.000 36.95000  ? 360  ALA A N     1 
ATOM   2888 C  CA    . ALA A 1 372 ? -40.91900 -53.98000 -12.58900 1.000 33.34000  ? 360  ALA A CA    1 
ATOM   2889 C  C     . ALA A 1 372 ? -42.05000 -52.97300 -12.67700 1.000 33.87000  ? 360  ALA A C     1 
ATOM   2890 O  O     . ALA A 1 372 ? -42.11000 -52.16400 -13.59900 1.000 36.81000  ? 360  ALA A O     1 
ATOM   2891 C  CB    . ALA A 1 372 ? -41.41600 -55.35800 -12.97600 1.000 36.15000  ? 360  ALA A CB    1 
ATOM   2892 N  N     . HIS A 1 373 ? -42.95200 -53.04900 -11.70000 1.000 30.15000  ? 361  HIS A N     1 
ATOM   2893 C  CA    . HIS A 1 373 ? -44.09900 -52.16100 -11.62300 1.000 25.65000  ? 361  HIS A CA    1 
ATOM   2894 C  C     . HIS A 1 373 ? -44.05500 -51.47600 -10.27800 1.000 26.96000  ? 361  HIS A C     1 
ATOM   2895 O  O     . HIS A 1 373 ? -43.62500 -52.07200 -9.30000  1.000 30.87000  ? 361  HIS A O     1 
ATOM   2896 C  CB    . HIS A 1 373 ? -45.40100 -52.94000 -11.80500 1.000 25.00000  ? 361  HIS A CB    1 
ATOM   2897 C  CG    . HIS A 1 373 ? -45.26200 -54.11200 -12.72000 1.000 31.32000  ? 361  HIS A CG    1 
ATOM   2898 N  ND1   . HIS A 1 373 ? -45.24300 -53.98500 -14.09700 1.000 33.23000  ? 361  HIS A ND1   1 
ATOM   2899 C  CD2   . HIS A 1 373 ? -45.09100 -55.43300 -12.46300 1.000 31.81000  ? 361  HIS A CD2   1 
ATOM   2900 C  CE1   . HIS A 1 373 ? -45.07900 -55.18000 -14.64300 1.000 32.19000  ? 361  HIS A CE1   1 
ATOM   2901 N  NE2   . HIS A 1 373 ? -44.98100 -56.07500 -13.67400 1.000 34.26000  ? 361  HIS A NE2   1 
ATOM   2902 N  N     . THR A 1 374 ? -44.49000 -50.22600 -10.23100 1.000 27.48000  ? 362  THR A N     1 
ATOM   2903 C  CA    . THR A 1 374 ? -44.51800 -49.47000 -8.98500  1.000 23.67000  ? 362  THR A CA    1 
ATOM   2904 C  C     . THR A 1 374 ? -45.42400 -48.23600 -9.12200  1.000 26.49000  ? 362  THR A C     1 
ATOM   2905 O  O     . THR A 1 374 ? -46.03300 -48.00800 -10.16600 1.000 25.42000  ? 362  THR A O     1 
ATOM   2906 C  CB    . THR A 1 374 ? -43.10200 -49.03200 -8.57800  1.000 21.54000  ? 362  THR A CB    1 
ATOM   2907 O  OG1   . THR A 1 374 ? -43.19200 -48.07500 -7.53500  1.000 32.83000  ? 362  THR A OG1   1 
ATOM   2908 C  CG2   . THR A 1 374 ? -42.42500 -48.37600 -9.71900  1.000 21.69000  ? 362  THR A CG2   1 
ATOM   2909 N  N     . ASN A 1 375 ? -45.50600 -47.44000 -8.06600  1.000 29.24000  ? 363  ASN A N     1 
ATOM   2910 C  CA    . ASN A 1 375 ? -46.25000 -46.19600 -8.12600  1.000 28.42000  ? 363  ASN A CA    1 
ATOM   2911 C  C     . ASN A 1 375 ? -45.58100 -45.13400 -7.27300  1.000 28.22000  ? 363  ASN A C     1 
ATOM   2912 O  O     . ASN A 1 375 ? -44.60300 -45.42200 -6.58800  1.000 27.55000  ? 363  ASN A O     1 
ATOM   2913 C  CB    . ASN A 1 375 ? -47.69300 -46.41200 -7.69400  1.000 25.48000  ? 363  ASN A CB    1 
ATOM   2914 C  CG    . ASN A 1 375 ? -47.82300 -46.83600 -6.25500  1.000 26.27000  ? 363  ASN A CG    1 
ATOM   2915 O  OD1   . ASN A 1 375 ? -47.03200 -46.44200 -5.39400  1.000 27.45000  ? 363  ASN A OD1   1 
ATOM   2916 N  ND2   . ASN A 1 375 ? -48.84800 -47.63200 -5.97200  1.000 28.03000  ? 363  ASN A ND2   1 
ATOM   2917 N  N     . ASP A 1 376 ? -46.11000 -43.91600 -7.32300  1.000 28.11000  ? 364  ASP A N     1 
ATOM   2918 C  CA    . ASP A 1 376 ? -45.51000 -42.78500 -6.61700  1.000 26.89000  ? 364  ASP A CA    1 
ATOM   2919 C  C     . ASP A 1 376 ? -45.39800 -42.92600 -5.11500  1.000 28.10000  ? 364  ASP A C     1 
ATOM   2920 O  O     . ASP A 1 376 ? -44.38600 -42.51400 -4.54800  1.000 26.88000  ? 364  ASP A O     1 
ATOM   2921 C  CB    . ASP A 1 376 ? -46.29800 -41.52300 -6.88500  1.000 30.89000  ? 364  ASP A CB    1 
ATOM   2922 C  CG    . ASP A 1 376 ? -46.06500 -41.01100 -8.24600  1.000 41.10000  ? 364  ASP A CG    1 
ATOM   2923 O  OD1   . ASP A 1 376 ? -45.05600 -41.46500 -8.84100  1.000 40.49000  ? 364  ASP A OD1   1 
ATOM   2924 O  OD2   . ASP A 1 376 ? -46.88100 -40.16900 -8.71000  1.000 48.59000  ? 364  ASP A OD2   1 
ATOM   2925 N  N     . VAL A 1 377 ? -46.43700 -43.46500 -4.46800  1.000 26.03000  ? 365  VAL A N     1 
ATOM   2926 C  CA    . VAL A 1 377 ? -46.40300 -43.56100 -3.01200  1.000 25.01000  ? 365  VAL A CA    1 
ATOM   2927 C  C     . VAL A 1 377 ? -45.30200 -44.51100 -2.54700  1.000 23.52000  ? 365  VAL A C     1 
ATOM   2928 O  O     . VAL A 1 377 ? -44.63900 -44.23500 -1.55900  1.000 23.71000  ? 365  VAL A O     1 
ATOM   2929 C  CB    . VAL A 1 377 ? -47.73500 -44.01600 -2.42200  1.000 25.83000  ? 365  VAL A CB    1 
ATOM   2930 C  CG1   . VAL A 1 377 ? -47.66200 -43.94400 -0.91800  1.000 20.65000  ? 365  VAL A CG1   1 
ATOM   2931 C  CG2   . VAL A 1 377 ? -48.85400 -43.12900 -2.93800  1.000 20.83000  ? 365  VAL A CG2   1 
ATOM   2932 N  N     . LYS A 1 378 ? -45.08800 -45.60000 -3.28300  1.000 24.63000  ? 366  LYS A N     1 
ATOM   2933 C  CA    . LYS A 1 378 ? -43.96300 -46.48700 -2.99800  1.000 22.49000  ? 366  LYS A CA    1 
ATOM   2934 C  C     . LYS A 1 378 ? -42.63400 -45.74300 -3.08200  1.000 26.99000  ? 366  LYS A C     1 
ATOM   2935 O  O     . LYS A 1 378 ? -41.81300 -45.78700 -2.15500  1.000 33.25000  ? 366  LYS A O     1 
ATOM   2936 C  CB    . LYS A 1 378 ? -43.93700 -47.66600 -3.96000  1.000 23.98000  ? 366  LYS A CB    1 
ATOM   2937 C  CG    . LYS A 1 378 ? -44.88500 -48.79700 -3.61800  1.000 25.04000  ? 366  LYS A CG    1 
ATOM   2938 C  CD    . LYS A 1 378 ? -44.65600 -49.95500 -4.57400  1.000 25.62000  ? 366  LYS A CD    1 
ATOM   2939 C  CE    . LYS A 1 378 ? -45.64100 -51.08200 -4.34300  1.000 29.64000  ? 366  LYS A CE    1 
ATOM   2940 N  NZ    . LYS A 1 378 ? -45.59300 -52.11300 -5.44500  1.000 27.67000  ? 366  LYS A NZ    1 
ATOM   2941 N  N     . GLN A 1 379 ? -42.40800 -45.06500 -4.19700  1.000 25.76000  ? 367  GLN A N     1 
ATOM   2942 C  CA    . GLN A 1 379 ? -41.09900 -44.47300 -4.39000  1.000 29.15000  ? 367  GLN A CA    1 
ATOM   2943 C  C     . GLN A 1 379 ? -40.86200 -43.42000 -3.34100  1.000 28.89000  ? 367  GLN A C     1 
ATOM   2944 O  O     . GLN A 1 379 ? -39.73900 -43.23600 -2.88700  1.000 34.69000  ? 367  GLN A O     1 
ATOM   2945 C  CB    . GLN A 1 379 ? -40.96300 -43.86000 -5.76900  1.000 25.99000  ? 367  GLN A CB    1 
ATOM   2946 C  CG    . GLN A 1 379 ? -41.29200 -44.81400 -6.87800  1.000 31.98000  ? 367  GLN A CG    1 
ATOM   2947 C  CD    . GLN A 1 379 ? -41.26500 -44.11600 -8.21700  1.000 41.55000  ? 367  GLN A CD    1 
ATOM   2948 O  OE1   . GLN A 1 379 ? -40.33100 -43.37100 -8.51300  1.000 47.82000  ? 367  GLN A OE1   1 
ATOM   2949 N  NE2   . GLN A 1 379 ? -42.30500 -44.32100 -9.01700  1.000 36.32000  ? 367  GLN A NE2   1 
ATOM   2950 N  N     . LEU A 1 380 ? -41.91900 -42.72200 -2.96100  1.000 26.24000  ? 368  LEU A N     1 
ATOM   2951 C  CA    . LEU A 1 380 ? -41.79000 -41.69700 -1.95300  1.000 22.65000  ? 368  LEU A CA    1 
ATOM   2952 C  C     . LEU A 1 380 ? -41.32200 -42.36100 -0.66700  1.000 30.88000  ? 368  LEU A C     1 
ATOM   2953 O  O     . LEU A 1 380 ? -40.43600 -41.84900 0.02200   1.000 33.54000  ? 368  LEU A O     1 
ATOM   2954 C  CB    . LEU A 1 380 ? -43.11100 -40.98200 -1.75700  1.000 20.94000  ? 368  LEU A CB    1 
ATOM   2955 C  CG    . LEU A 1 380 ? -43.10200 -39.87300 -0.72000  1.000 20.47000  ? 368  LEU A CG    1 
ATOM   2956 C  CD1   . LEU A 1 380 ? -42.34000 -38.69400 -1.27200  1.000 23.54000  ? 368  LEU A CD1   1 
ATOM   2957 C  CD2   . LEU A 1 380 ? -44.52300 -39.50200 -0.32800  1.000 20.16000  ? 368  LEU A CD2   1 
ATOM   2958 N  N     . THR A 1 381 ? -41.90100 -43.52600 -0.37000  1.000 28.30000  ? 369  THR A N     1 
ATOM   2959 C  CA    . THR A 1 381 ? -41.51200 -44.28900 0.79700   1.000 28.35000  ? 369  THR A CA    1 
ATOM   2960 C  C     . THR A 1 381 ? -40.04600 -44.71000 0.68600   1.000 31.78000  ? 369  THR A C     1 
ATOM   2961 O  O     . THR A 1 381 ? -39.31300 -44.72300 1.68100   1.000 36.57000  ? 369  THR A O     1 
ATOM   2962 C  CB    . THR A 1 381 ? -42.41500 -45.53600 1.00300   1.000 29.67000  ? 369  THR A CB    1 
ATOM   2963 O  OG1   . THR A 1 381 ? -43.77000 -45.13000 1.29400   1.000 29.79000  ? 369  THR A OG1   1 
ATOM   2964 C  CG2   . THR A 1 381 ? -41.90700 -46.34900 2.17900   1.000 31.13000  ? 369  THR A CG2   1 
ATOM   2965 N  N     . GLU A 1 382 ? -39.59300 -45.02800 -0.52100  1.000 28.84000  ? 370  GLU A N     1 
ATOM   2966 C  CA    . GLU A 1 382 ? -38.19400 -45.40100 -0.68700  1.000 28.47000  ? 370  GLU A CA    1 
ATOM   2967 C  C     . GLU A 1 382 ? -37.23400 -44.19800 -0.55400  1.000 30.54000  ? 370  GLU A C     1 
ATOM   2968 O  O     . GLU A 1 382 ? -36.10200 -44.33400 -0.06000  1.000 32.17000  ? 370  GLU A O     1 
ATOM   2969 C  CB    . GLU A 1 382 ? -38.01900 -46.10600 -2.02300  1.000 27.95000  ? 370  GLU A CB    1 
ATOM   2970 C  CG    . GLU A 1 382 ? -38.80500 -47.39100 -2.07000  1.000 34.80000  ? 370  GLU A CG    1 
ATOM   2971 C  CD    . GLU A 1 382 ? -39.00600 -47.93600 -3.47800  1.000 44.52000  ? 370  GLU A CD    1 
ATOM   2972 O  OE1   . GLU A 1 382 ? -39.91700 -48.79100 -3.64000  1.000 49.63000  ? 370  GLU A OE1   1 
ATOM   2973 O  OE2   . GLU A 1 382 ? -38.26200 -47.53000 -4.41100  1.000 33.25000  ? 370  GLU A OE2   1 
ATOM   2974 N  N     . ALA A 1 383 ? -37.69400 -43.02600 -0.97500  1.000 26.90000  ? 371  ALA A N     1 
ATOM   2975 C  CA    . ALA A 1 383 ? -36.93300 -41.80100 -0.80900  1.000 23.64000  ? 371  ALA A CA    1 
ATOM   2976 C  C     . ALA A 1 383 ? -36.77800 -41.44100 0.67000   1.000 27.56000  ? 371  ALA A C     1 
ATOM   2977 O  O     . ALA A 1 383 ? -35.69000 -41.09000 1.12200   1.000 26.71000  ? 371  ALA A O     1 
ATOM   2978 C  CB    . ALA A 1 383 ? -37.59800 -40.69400 -1.54500  1.000 22.76000  ? 371  ALA A CB    1 
ATOM   2979 N  N     . VAL A 1 384 ? -37.88200 -41.52100 1.41200   1.000 29.57000  ? 372  VAL A N     1 
ATOM   2980 C  CA    . VAL A 1 384 ? -37.87000 -41.27300 2.84700   1.000 25.04000  ? 372  VAL A CA    1 
ATOM   2981 C  C     . VAL A 1 384 ? -36.89100 -42.22600 3.53700   1.000 27.08000  ? 372  VAL A C     1 
ATOM   2982 O  O     . VAL A 1 384 ? -36.13500 -41.82200 4.41600   1.000 29.73000  ? 372  VAL A O     1 
ATOM   2983 C  CB    . VAL A 1 384 ? -39.28900 -41.42500 3.48000   1.000 25.60000  ? 372  VAL A CB    1 
ATOM   2984 C  CG1   . VAL A 1 384 ? -39.22300 -41.26700 4.97800   1.000 21.59000  ? 372  VAL A CG1   1 
ATOM   2985 C  CG2   . VAL A 1 384 ? -40.23900 -40.38500 2.91600   1.000 24.54000  ? 372  VAL A CG2   1 
ATOM   2986 N  N     . GLN A 1 385 ? -36.88500 -43.49300 3.13600   1.000 28.90000  ? 373  GLN A N     1 
ATOM   2987 C  CA    . GLN A 1 385 ? -35.97900 -44.43000 3.79600   1.000 27.73000  ? 373  GLN A CA    1 
ATOM   2988 C  C     . GLN A 1 385 ? -34.52200 -44.10300 3.48200   1.000 27.94000  ? 373  GLN A C     1 
ATOM   2989 O  O     . GLN A 1 385 ? -33.69300 -44.10700 4.38200   1.000 30.05000  ? 373  GLN A O     1 
ATOM   2990 C  CB    . GLN A 1 385 ? -36.29500 -45.86600 3.41700   1.000 28.32000  ? 373  GLN A CB    1 
ATOM   2991 C  CG    . GLN A 1 385 ? -37.38800 -46.45100 4.30000   1.000 35.83000  ? 373  GLN A CG    1 
ATOM   2992 C  CD    . GLN A 1 385 ? -38.30400 -47.45500 3.56900   1.000 36.37000  ? 373  GLN A CD    1 
ATOM   2993 O  OE1   . GLN A 1 385 ? -39.45000 -47.64800 3.97200   1.000 35.64000  ? 373  GLN A OE1   1 
ATOM   2994 N  NE2   . GLN A 1 385 ? -37.79300 -48.10000 2.51500   1.000 35.54000  ? 373  GLN A NE2   1 
ATOM   2995 N  N     . LYS A 1 386 ? -34.20600 -43.78500 2.22900   1.000 27.12000  ? 374  LYS A N     1 
ATOM   2996 C  CA    . LYS A 1 386 ? -32.83900 -43.41500 1.92700   1.000 21.97000  ? 374  LYS A CA    1 
ATOM   2997 C  C     . LYS A 1 386 ? -32.39800 -42.17600 2.70000   1.000 24.52000  ? 374  LYS A C     1 
ATOM   2998 O  O     . LYS A 1 386 ? -31.34000 -42.18200 3.30400   1.000 26.87000  ? 374  LYS A O     1 
ATOM   2999 C  CB    . LYS A 1 386 ? -32.65700 -43.16600 0.44300   1.000 21.42000  ? 374  LYS A CB    1 
ATOM   3000 C  CG    . LYS A 1 386 ? -31.26300 -42.70900 0.13000   1.000 28.49000  ? 374  LYS A CG    1 
ATOM   3001 C  CD    . LYS A 1 386 ? -31.12400 -42.36900 -1.35400  1.000 36.90000  ? 374  LYS A CD    1 
ATOM   3002 C  CE    . LYS A 1 386 ? -30.34100 -41.06800 -1.54500  1.000 38.97000  ? 374  LYS A CE    1 
ATOM   3003 N  NZ    . LYS A 1 386 ? -29.10900 -41.03500 -0.68500  1.000 43.90000  ? 374  LYS A NZ    1 
ATOM   3004 N  N     . ILE A 1 387 ? -33.20100 -41.11400 2.67900   1.000 23.46000  ? 375  ILE A N     1 
ATOM   3005 C  CA    . ILE A 1 387 ? -32.84500 -39.90900 3.39800   1.000 18.92000  ? 375  ILE A CA    1 
ATOM   3006 C  C     . ILE A 1 387 ? -32.66300 -40.15900 4.90500   1.000 21.19000  ? 375  ILE A C     1 
ATOM   3007 O  O     . ILE A 1 387 ? -31.81700 -39.55200 5.54600   1.000 19.76000  ? 375  ILE A O     1 
ATOM   3008 C  CB    . ILE A 1 387 ? -33.90700 -38.83700 3.19000   1.000 23.37000  ? 375  ILE A CB    1 
ATOM   3009 C  CG1   . ILE A 1 387 ? -34.11200 -38.58400 1.69600   1.000 20.59000  ? 375  ILE A CG1   1 
ATOM   3010 C  CG2   . ILE A 1 387 ? -33.53000 -37.54300 3.89500   1.000 19.86000  ? 375  ILE A CG2   1 
ATOM   3011 C  CD1   . ILE A 1 387 ? -35.08400 -37.47600 1.43600   1.000 18.75000  ? 375  ILE A CD1   1 
ATOM   3012 N  N     . THR A 1 388 ? -33.45500 -41.06600 5.46700   1.000 23.38000  ? 376  THR A N     1 
ATOM   3013 C  CA    . THR A 1 388 ? -33.35500 -41.38000 6.87800   1.000 20.58000  ? 376  THR A CA    1 
ATOM   3014 C  C     . THR A 1 388 ? -32.01900 -42.04300 7.22200   1.000 21.58000  ? 376  THR A C     1 
ATOM   3015 O  O     . THR A 1 388 ? -31.33900 -41.63900 8.16800   1.000 21.29000  ? 376  THR A O     1 
ATOM   3016 C  CB    . THR A 1 388 ? -34.50500 -42.28700 7.31300   1.000 23.23000  ? 376  THR A CB    1 
ATOM   3017 O  OG1   . THR A 1 388 ? -35.70100 -41.51400 7.33500   1.000 24.75000  ? 376  THR A OG1   1 
ATOM   3018 C  CG2   . THR A 1 388 ? -34.26100 -42.85300 8.70200   1.000 19.88000  ? 376  THR A CG2   1 
ATOM   3019 N  N     . THR A 1 389 ? -31.64700 -43.04900 6.45000   1.000 19.43000  ? 377  THR A N     1 
ATOM   3020 C  CA    . THR A 1 389 ? -30.39000 -43.74600 6.66100   1.000 20.40000  ? 377  THR A CA    1 
ATOM   3021 C  C     . THR A 1 389 ? -29.19300 -42.82800 6.53900   1.000 20.61000  ? 377  THR A C     1 
ATOM   3022 O  O     . THR A 1 389 ? -28.19700 -42.97500 7.26500   1.000 21.83000  ? 377  THR A O     1 
ATOM   3023 C  CB    . THR A 1 389 ? -30.21500 -44.87600 5.65400   1.000 24.34000  ? 377  THR A CB    1 
ATOM   3024 O  OG1   . THR A 1 389 ? -31.26900 -45.82200 5.85300   1.000 34.70000  ? 377  THR A OG1   1 
ATOM   3025 C  CG2   . THR A 1 389 ? -28.89200 -45.54900 5.85600   1.000 20.67000  ? 377  THR A CG2   1 
ATOM   3026 N  N     . GLU A 1 390 ? -29.29400 -41.88100 5.62200   1.000 21.26000  ? 378  GLU A N     1 
ATOM   3027 C  CA    . GLU A 1 390 ? -28.22200 -40.92900 5.40100   1.000 19.73000  ? 378  GLU A CA    1 
ATOM   3028 C  C     . GLU A 1 390 ? -28.14700 -39.87000 6.50700   1.000 20.48000  ? 378  GLU A C     1 
ATOM   3029 O  O     . GLU A 1 390 ? -27.06800 -39.42300 6.87500   1.000 19.61000  ? 378  GLU A O     1 
ATOM   3030 C  CB    . GLU A 1 390 ? -28.40200 -40.28100 4.04400   1.000 19.28000  ? 378  GLU A CB    1 
ATOM   3031 C  CG    . GLU A 1 390 ? -27.52500 -39.09000 3.80800   1.000 27.03000  ? 378  GLU A CG    1 
ATOM   3032 C  CD    . GLU A 1 390 ? -27.88700 -38.41300 2.50500   1.000 37.50000  ? 378  GLU A CD    1 
ATOM   3033 O  OE1   . GLU A 1 390 ? -27.46500 -37.25100 2.28200   1.000 42.74000  ? 378  GLU A OE1   1 
ATOM   3034 O  OE2   . GLU A 1 390 ? -28.61600 -39.05100 1.70300   1.000 37.31000  ? 378  GLU A OE2   1 
ATOM   3035 N  N     . SER A 1 391 ? -29.29100 -39.47400 7.05000   1.000 21.56000  ? 379  SER A N     1 
ATOM   3036 C  CA    . SER A 1 391 ? -29.25900 -38.50400 8.13400   1.000 20.75000  ? 379  SER A CA    1 
ATOM   3037 C  C     . SER A 1 391 ? -28.66300 -39.15300 9.35700   1.000 20.33000  ? 379  SER A C     1 
ATOM   3038 O  O     . SER A 1 391 ? -28.12000 -38.47100 10.22000  1.000 22.80000  ? 379  SER A O     1 
ATOM   3039 C  CB    . SER A 1 391 ? -30.65300 -37.96700 8.46700   1.000 20.33000  ? 379  SER A CB    1 
ATOM   3040 O  OG    . SER A 1 391 ? -31.33100 -37.60500 7.28300   1.000 27.75000  ? 379  SER A OG    1 
ATOM   3041 N  N     . ILE A 1 392 ? -28.78200 -40.47100 9.44600   1.000 20.10000  ? 380  ILE A N     1 
ATOM   3042 C  CA    . ILE A 1 392 ? -28.33700 -41.13600 10.65300  1.000 19.53000  ? 380  ILE A CA    1 
ATOM   3043 C  C     . ILE A 1 392 ? -26.81600 -41.25900 10.60700  1.000 23.00000  ? 380  ILE A C     1 
ATOM   3044 O  O     . ILE A 1 392 ? -26.13900 -41.08500 11.63400  1.000 21.66000  ? 380  ILE A O     1 
ATOM   3045 C  CB    . ILE A 1 392 ? -28.99200 -42.48300 10.81900  1.000 21.14000  ? 380  ILE A CB    1 
ATOM   3046 C  CG1   . ILE A 1 392 ? -30.45200 -42.29600 11.25700  1.000 17.41000  ? 380  ILE A CG1   1 
ATOM   3047 C  CG2   . ILE A 1 392 ? -28.23100 -43.30100 11.86400  1.000 22.15000  ? 380  ILE A CG2   1 
ATOM   3048 C  CD1   . ILE A 1 392 ? -31.28200 -43.57700 11.23800  1.000 10.67000  ? 380  ILE A CD1   1 
ATOM   3049 N  N     . VAL A 1 393 ? -26.28200 -41.52400 9.41100   1.000 21.31000  ? 381  VAL A N     1 
ATOM   3050 C  CA    . VAL A 1 393 ? -24.83500 -41.50800 9.21700   1.000 18.77000  ? 381  VAL A CA    1 
ATOM   3051 C  C     . VAL A 1 393 ? -24.24900 -40.11900 9.48100   1.000 19.20000  ? 381  VAL A C     1 
ATOM   3052 O  O     . VAL A 1 393 ? -23.26500 -39.98300 10.19500  1.000 23.08000  ? 381  VAL A O     1 
ATOM   3053 C  CB    . VAL A 1 393 ? -24.43700 -41.93800 7.80300   1.000 18.96000  ? 381  VAL A CB    1 
ATOM   3054 C  CG1   . VAL A 1 393 ? -22.98900 -41.68300 7.58100   1.000 16.04000  ? 381  VAL A CG1   1 
ATOM   3055 C  CG2   . VAL A 1 393 ? -24.75700 -43.39300 7.58400   1.000 19.47000  ? 381  VAL A CG2   1 
ATOM   3056 N  N     . ILE A 1 394 ? -24.85800 -39.08100 8.92700   1.000 20.43000  ? 382  ILE A N     1 
ATOM   3057 C  CA    . ILE A 1 394 ? -24.26800 -37.74600 9.00900   1.000 19.71000  ? 382  ILE A CA    1 
ATOM   3058 C  C     . ILE A 1 394 ? -24.55000 -37.01600 10.32900  1.000 21.54000  ? 382  ILE A C     1 
ATOM   3059 O  O     . ILE A 1 394 ? -23.64100 -36.44100 10.91100  1.000 20.78000  ? 382  ILE A O     1 
ATOM   3060 C  CB    . ILE A 1 394 ? -24.74800 -36.87300 7.85100   1.000 20.50000  ? 382  ILE A CB    1 
ATOM   3061 C  CG1   . ILE A 1 394 ? -24.07200 -37.32600 6.56100   1.000 17.32000  ? 382  ILE A CG1   1 
ATOM   3062 C  CG2   . ILE A 1 394 ? -24.43000 -35.41900 8.11300   1.000 20.51000  ? 382  ILE A CG2   1 
ATOM   3063 C  CD1   . ILE A 1 394 ? -24.70100 -36.74600 5.34600   1.000 17.49000  ? 382  ILE A CD1   1 
ATOM   3064 N  N     . TRP A 1 395 ? -25.79000 -37.03700 10.80600  1.000 21.01000  ? 383  TRP A N     1 
ATOM   3065 C  CA    . TRP A 1 395 ? -26.08300 -36.37500 12.07900  1.000 21.72000  ? 383  TRP A CA    1 
ATOM   3066 C  C     . TRP A 1 395 ? -26.43500 -37.32700 13.21900  1.000 20.54000  ? 383  TRP A C     1 
ATOM   3067 O  O     . TRP A 1 395 ? -26.49100 -36.89800 14.36300  1.000 26.58000  ? 383  TRP A O     1 
ATOM   3068 C  CB    . TRP A 1 395 ? -27.22200 -35.37000 11.91300  1.000 21.67000  ? 383  TRP A CB    1 
ATOM   3069 C  CG    . TRP A 1 395 ? -26.94700 -34.41900 10.83400  1.000 23.35000  ? 383  TRP A CG    1 
ATOM   3070 C  CD1   . TRP A 1 395 ? -26.09100 -33.34200 10.87200  1.000 20.62000  ? 383  TRP A CD1   1 
ATOM   3071 C  CD2   . TRP A 1 395 ? -27.49000 -34.45900 9.51500   1.000 20.37000  ? 383  TRP A CD2   1 
ATOM   3072 N  NE1   . TRP A 1 395 ? -26.08800 -32.70700 9.65600   1.000 20.68000  ? 383  TRP A NE1   1 
ATOM   3073 C  CE2   . TRP A 1 395 ? -26.93900 -33.37500 8.80300   1.000 21.11000  ? 383  TRP A CE2   1 
ATOM   3074 C  CE3   . TRP A 1 395 ? -28.40000 -35.29400 8.87300   1.000 20.86000  ? 383  TRP A CE3   1 
ATOM   3075 C  CZ2   . TRP A 1 395 ? -27.26500 -33.11500 7.48100   1.000 21.12000  ? 383  TRP A CZ2   1 
ATOM   3076 C  CZ3   . TRP A 1 395 ? -28.72400 -35.03600 7.56200   1.000 20.97000  ? 383  TRP A CZ3   1 
ATOM   3077 C  CH2   . TRP A 1 395 ? -28.16300 -33.95400 6.88000   1.000 21.34000  ? 383  TRP A CH2   1 
ATOM   3078 N  N     . GLY A 1 396 ? -26.68600 -38.60200 12.91500  1.000 21.70000  ? 384  GLY A N     1 
ATOM   3079 C  CA    . GLY A 1 396 ? -26.97100 -39.58600 13.94300  1.000 18.48000  ? 384  GLY A CA    1 
ATOM   3080 C  C     . GLY A 1 396 ? -28.37100 -39.46400 14.49700  1.000 22.69000  ? 384  GLY A C     1 
ATOM   3081 O  O     . GLY A 1 396 ? -28.62500 -39.79000 15.65500  1.000 24.69000  ? 384  GLY A O     1 
ATOM   3082 N  N     . LYS A 1 397 ? -29.29800 -39.00700 13.67100  1.000 23.63000  ? 385  LYS A N     1 
ATOM   3083 C  CA    . LYS A 1 397 ? -30.68600 -38.94500 14.07900  1.000 19.58000  ? 385  LYS A CA    1 
ATOM   3084 C  C     . LYS A 1 397 ? -31.52700 -38.75400 12.84100  1.000 21.19000  ? 385  LYS A C     1 
ATOM   3085 O  O     . LYS A 1 397 ? -31.04200 -38.29600 11.81400  1.000 23.21000  ? 385  LYS A O     1 
ATOM   3086 C  CB    . LYS A 1 397 ? -30.91700 -37.81200 15.06500  1.000 22.59000  ? 385  LYS A CB    1 
ATOM   3087 C  CG    . LYS A 1 397 ? -30.82800 -36.43200 14.45200  1.000 22.91000  ? 385  LYS A CG    1 
ATOM   3088 C  CD    . LYS A 1 397 ? -31.01300 -35.35300 15.49900  1.000 24.45000  ? 385  LYS A CD    1 
ATOM   3089 C  CE    . LYS A 1 397 ? -32.46700 -34.92200 15.60900  1.000 30.13000  ? 385  LYS A CE    1 
ATOM   3090 N  NZ    . LYS A 1 397 ? -32.60900 -33.85600 16.64300  1.000 42.36000  ? 385  LYS A NZ    1 
ATOM   3091 N  N     . THR A 1 398 ? -32.79000 -39.11200 12.93900  1.000 23.50000  ? 386  THR A N     1 
ATOM   3092 C  CA    . THR A 1 398 ? -33.73900 -38.95600 11.85600  1.000 19.69000  ? 386  THR A CA    1 
ATOM   3093 C  C     . THR A 1 398 ? -34.21300 -37.51700 11.72700  1.000 20.16000  ? 386  THR A C     1 
ATOM   3094 O  O     . THR A 1 398 ? -34.30100 -36.82000 12.71400  1.000 23.89000  ? 386  THR A O     1 
ATOM   3095 C  CB    . THR A 1 398 ? -34.94200 -39.84400 12.11200  1.000 21.62000  ? 386  THR A CB    1 
ATOM   3096 O  OG1   . THR A 1 398 ? -34.48700 -41.19600 12.24800  1.000 25.82000  ? 386  THR A OG1   1 
ATOM   3097 C  CG2   . THR A 1 398 ? -35.93200 -39.74000 10.97800  1.000 26.93000  ? 386  THR A CG2   1 
ATOM   3098 N  N     . PRO A 1 399 ? -34.52300 -37.07200 10.51300  1.000 21.34000  ? 387  PRO A N     1 
ATOM   3099 C  CA    . PRO A 1 399 ? -35.11600 -35.74100 10.35200  1.000 24.31000  ? 387  PRO A CA    1 
ATOM   3100 C  C     . PRO A 1 399 ? -36.65000 -35.74300 10.36600  1.000 25.04000  ? 387  PRO A C     1 
ATOM   3101 O  O     . PRO A 1 399 ? -37.27800 -36.78900 10.35500  1.000 24.98000  ? 387  PRO A O     1 
ATOM   3102 C  CB    . PRO A 1 399 ? -34.59600 -35.29900 8.98700   1.000 27.06000  ? 387  PRO A CB    1 
ATOM   3103 C  CG    . PRO A 1 399 ? -34.46500 -36.58400 8.23000   1.000 21.77000  ? 387  PRO A CG    1 
ATOM   3104 C  CD    . PRO A 1 399 ? -34.07900 -37.64100 9.22500   1.000 23.20000  ? 387  PRO A CD    1 
ATOM   3105 N  N     . LYS A 1 400 ? -37.23400 -34.55500 10.41600  1.000 29.69000  ? 388  LYS A N     1 
ATOM   3106 C  CA    . LYS A 1 400 ? -38.67100 -34.39400 10.28500  1.000 28.63000  ? 388  LYS A CA    1 
ATOM   3107 C  C     . LYS A 1 400 ? -38.97600 -34.24100 8.80300   1.000 29.01000  ? 388  LYS A C     1 
ATOM   3108 O  O     . LYS A 1 400 ? -38.17300 -33.67100 8.06900   1.000 32.27000  ? 388  LYS A O     1 
ATOM   3109 C  CB    . LYS A 1 400 ? -39.15100 -33.19200 11.10900  1.000 32.44000  ? 388  LYS A CB    1 
ATOM   3110 C  CG    . LYS A 1 400 ? -39.22900 -33.53600 12.59100  1.000 38.93000  ? 388  LYS A CG    1 
ATOM   3111 C  CD    . LYS A 1 400 ? -39.55800 -32.40700 13.54800  1.000 44.05000  ? 388  LYS A CD    1 
ATOM   3112 C  CE    . LYS A 1 400 ? -39.21400 -32.89700 14.98000  1.000 54.59000  ? 388  LYS A CE    1 
ATOM   3113 N  NZ    . LYS A 1 400 ? -39.76300 -32.13000 16.15700  1.000 47.49000  ? 388  LYS A NZ    1 
ATOM   3114 N  N     . PHE A 1 401 ? -40.10200 -34.75200 8.31900   1.000 28.35000  ? 389  PHE A N     1 
ATOM   3115 C  CA    . PHE A 1 401 ? -40.31500 -34.59700 6.87900   1.000 30.67000  ? 389  PHE A CA    1 
ATOM   3116 C  C     . PHE A 1 401 ? -41.38800 -33.59700 6.45800   1.000 30.04000  ? 389  PHE A C     1 
ATOM   3117 O  O     . PHE A 1 401 ? -42.37600 -33.37500 7.15200   1.000 32.09000  ? 389  PHE A O     1 
ATOM   3118 C  CB    . PHE A 1 401 ? -40.61900 -35.95200 6.26000   1.000 25.83000  ? 389  PHE A CB    1 
ATOM   3119 C  CG    . PHE A 1 401 ? -39.44900 -36.84800 6.24000   1.000 25.50000  ? 389  PHE A CG    1 
ATOM   3120 C  CD1   . PHE A 1 401 ? -39.14700 -37.64100 7.35000   1.000 27.78000  ? 389  PHE A CD1   1 
ATOM   3121 C  CD2   . PHE A 1 401 ? -38.60700 -36.87400 5.14900   1.000 19.47000  ? 389  PHE A CD2   1 
ATOM   3122 C  CE1   . PHE A 1 401 ? -38.03500 -38.47700 7.34800   1.000 23.39000  ? 389  PHE A CE1   1 
ATOM   3123 C  CE2   . PHE A 1 401 ? -37.49200 -37.69300 5.15000   1.000 20.43000  ? 389  PHE A CE2   1 
ATOM   3124 C  CZ    . PHE A 1 401 ? -37.20800 -38.49800 6.25100   1.000 20.61000  ? 389  PHE A CZ    1 
ATOM   3125 N  N     . LYS A 1 402 ? -41.15600 -32.98400 5.30900   1.000 27.09000  ? 390  LYS A N     1 
ATOM   3126 C  CA    . LYS A 1 402 ? -42.18400 -32.23600 4.62600   1.000 28.81000  ? 390  LYS A CA    1 
ATOM   3127 C  C     . LYS A 1 402 ? -42.39000 -32.90300 3.27100   1.000 29.29000  ? 390  LYS A C     1 
ATOM   3128 O  O     . LYS A 1 402 ? -41.46300 -32.93300 2.47300   1.000 32.33000  ? 390  LYS A O     1 
ATOM   3129 C  CB    . LYS A 1 402 ? -41.77200 -30.78100 4.48500   1.000 33.20000  ? 390  LYS A CB    1 
ATOM   3130 C  CG    . LYS A 1 402 ? -41.33100 -30.13700 5.80100   1.000 36.66000  ? 390  LYS A CG    1 
ATOM   3131 C  CD    . LYS A 1 402 ? -42.49200 -29.45300 6.49300   1.000 40.84000  ? 390  LYS A CD    1 
ATOM   3132 C  CE    . LYS A 1 402 ? -42.04200 -28.55600 7.63800   1.000 47.69000  ? 390  LYS A CE    1 
ATOM   3133 N  NZ    . LYS A 1 402 ? -41.88900 -29.30100 8.92300   1.000 44.53000  ? 390  LYS A NZ    1 
ATOM   3134 N  N     . LEU A 1 403 ? -43.56500 -33.46500 3.01100   1.000 25.56000  ? 391  LEU A N     1 
ATOM   3135 C  CA    . LEU A 1 403 ? -43.76300 -34.22300 1.77900   1.000 25.18000  ? 391  LEU A CA    1 
ATOM   3136 C  C     . LEU A 1 403 ? -44.96800 -33.73300 0.96000   1.000 26.58000  ? 391  LEU A C     1 
ATOM   3137 O  O     . LEU A 1 403 ? -45.97500 -33.31100 1.51600   1.000 32.97000  ? 391  LEU A O     1 
ATOM   3138 C  CB    . LEU A 1 403 ? -43.93900 -35.71200 2.11500   1.000 27.86000  ? 391  LEU A CB    1 
ATOM   3139 C  CG    . LEU A 1 403 ? -43.07100 -36.28400 3.24800   1.000 28.15000  ? 391  LEU A CG    1 
ATOM   3140 C  CD1   . LEU A 1 403 ? -43.55300 -37.66700 3.69800   1.000 29.69000  ? 391  LEU A CD1   1 
ATOM   3141 C  CD2   . LEU A 1 403 ? -41.61200 -36.35500 2.83700   1.000 27.49000  ? 391  LEU A CD2   1 
ATOM   3142 N  N     . PRO A 1 404 ? -44.88100 -33.80100 -0.36700  1.000 26.02000  ? 392  PRO A N     1 
ATOM   3143 C  CA    . PRO A 1 404 ? -46.02400 -33.38900 -1.18900  1.000 28.98000  ? 392  PRO A CA    1 
ATOM   3144 C  C     . PRO A 1 404 ? -47.08700 -34.48700 -1.28500  1.000 30.79000  ? 392  PRO A C     1 
ATOM   3145 O  O     . PRO A 1 404 ? -47.39800 -34.94900 -2.39800  1.000 28.72000  ? 392  PRO A O     1 
ATOM   3146 C  CB    . PRO A 1 404 ? -45.40200 -33.13500 -2.57500  1.000 26.47000  ? 392  PRO A CB    1 
ATOM   3147 C  CG    . PRO A 1 404 ? -43.92200 -33.33400 -2.40700  1.000 27.55000  ? 392  PRO A CG    1 
ATOM   3148 C  CD    . PRO A 1 404 ? -43.72000 -34.17000 -1.19100  1.000 27.65000  ? 392  PRO A CD    1 
ATOM   3149 N  N     . ILE A 1 405 ? -47.61400 -34.91100 -0.14500  1.000 24.25000  ? 393  ILE A N     1 
ATOM   3150 C  CA    . ILE A 1 405 ? -48.62400 -35.95100 -0.12700  1.000 28.45000  ? 393  ILE A CA    1 
ATOM   3151 C  C     . ILE A 1 405 ? -49.60000 -35.66700 0.99900   1.000 29.81000  ? 393  ILE A C     1 
ATOM   3152 O  O     . ILE A 1 405 ? -49.19800 -35.52400 2.14700   1.000 31.76000  ? 393  ILE A O     1 
ATOM   3153 C  CB    . ILE A 1 405 ? -47.99500 -37.37000 0.03900   1.000 25.84000  ? 393  ILE A CB    1 
ATOM   3154 C  CG1   . ILE A 1 405 ? -49.04600 -38.47100 -0.07800  1.000 28.64000  ? 393  ILE A CG1   1 
ATOM   3155 C  CG2   . ILE A 1 405 ? -47.30800 -37.51800 1.36800   1.000 25.00000  ? 393  ILE A CG2   1 
ATOM   3156 C  CD1   . ILE A 1 405 ? -48.44600 -39.85400 -0.09600  1.000 28.12000  ? 393  ILE A CD1   1 
ATOM   3157 N  N     . GLN A 1 406 ? -50.88400 -35.57100 0.68300   1.000 29.88000  ? 394  GLN A N     1 
ATOM   3158 C  CA    . GLN A 1 406 ? -51.85500 -35.28900 1.73600   1.000 34.91000  ? 394  GLN A CA    1 
ATOM   3159 C  C     . GLN A 1 406 ? -51.96100 -36.43600 2.71300   1.000 32.61000  ? 394  GLN A C     1 
ATOM   3160 O  O     . GLN A 1 406 ? -51.82700 -37.59300 2.33700   1.000 34.02000  ? 394  GLN A O     1 
ATOM   3161 C  CB    . GLN A 1 406 ? -53.21600 -35.01400 1.14300   1.000 33.68000  ? 394  GLN A CB    1 
ATOM   3162 C  CG    . GLN A 1 406 ? -53.14500 -34.19300 -0.09800  1.000 38.64000  ? 394  GLN A CG    1 
ATOM   3163 C  CD    . GLN A 1 406 ? -54.26300 -33.18800 -0.15400  1.000 50.90000  ? 394  GLN A CD    1 
ATOM   3164 O  OE1   . GLN A 1 406 ? -54.29200 -32.24000 0.63300   1.000 57.63000  ? 394  GLN A OE1   1 
ATOM   3165 N  NE2   . GLN A 1 406 ? -55.21000 -33.39800 -1.07200  1.000 49.18000  ? 394  GLN A NE2   1 
ATOM   3166 N  N     . LYS A 1 407 ? -52.20300 -36.09800 3.97000   1.000 35.26000  ? 395  LYS A N     1 
ATOM   3167 C  CA    . LYS A 1 407 ? -52.45700 -37.09300 4.99700   1.000 31.21000  ? 395  LYS A CA    1 
ATOM   3168 C  C     . LYS A 1 407 ? -53.48500 -38.15100 4.54500   1.000 38.49000  ? 395  LYS A C     1 
ATOM   3169 O  O     . LYS A 1 407 ? -53.31300 -39.33600 4.83000   1.000 41.68000  ? 395  LYS A O     1 
ATOM   3170 C  CB    . LYS A 1 407 ? -52.93500 -36.39500 6.27200   1.000 36.08000  ? 395  LYS A CB    1 
ATOM   3171 C  CG    . LYS A 1 407 ? -51.95700 -36.44200 7.44500   1.000 39.37000  ? 395  LYS A CG    1 
ATOM   3172 C  CD    . LYS A 1 407 ? -50.62400 -35.81800 7.11400   1.000 34.61000  ? 395  LYS A CD    1 
ATOM   3173 C  CE    . LYS A 1 407 ? -49.68700 -35.80500 8.33100   1.000 39.89000  ? 395  LYS A CE    1 
ATOM   3174 N  NZ    . LYS A 1 407 ? -49.04900 -37.12100 8.66400   1.000 38.03000  ? 395  LYS A NZ    1 
ATOM   3175 N  N     . GLU A 1 408 ? -54.53100 -37.73700 3.82600   1.000 42.18000  ? 396  GLU A N     1 
ATOM   3176 C  CA    . GLU A 1 408 ? -55.59300 -38.67200 3.42000   1.000 38.00000  ? 396  GLU A CA    1 
ATOM   3177 C  C     . GLU A 1 408 ? -55.10800 -39.65200 2.36900   1.000 36.74000  ? 396  GLU A C     1 
ATOM   3178 O  O     . GLU A 1 408 ? -55.51600 -40.81200 2.36700   1.000 37.10000  ? 396  GLU A O     1 
ATOM   3179 C  CB    . GLU A 1 408 ? -56.82800 -37.93500 2.88400   1.000 36.74000  ? 396  GLU A CB    1 
ATOM   3180 C  CG    . GLU A 1 408 ? -57.53800 -37.07600 3.92100   1.000 57.92000  ? 396  GLU A CG    1 
ATOM   3181 C  CD    . GLU A 1 408 ? -56.88800 -35.68800 4.12600   1.000 75.39000  ? 396  GLU A CD    1 
ATOM   3182 O  OE1   . GLU A 1 408 ? -56.12900 -35.21800 3.23000   1.000 66.12000  ? 396  GLU A OE1   1 
ATOM   3183 O  OE2   . GLU A 1 408 ? -57.14700 -35.06800 5.19100   1.000 78.21000  ? 396  GLU A OE2   1 
ATOM   3184 N  N     . THR A 1 409 ? -54.25100 -39.18100 1.46800   1.000 37.01000  ? 397  THR A N     1 
ATOM   3185 C  CA    . THR A 1 409 ? -53.71100 -40.05600 0.43400   1.000 33.70000  ? 397  THR A CA    1 
ATOM   3186 C  C     . THR A 1 409 ? -52.89200 -41.17700 1.07200   1.000 36.48000  ? 397  THR A C     1 
ATOM   3187 O  O     . THR A 1 409 ? -53.06200 -42.36200 0.74300   1.000 33.66000  ? 397  THR A O     1 
ATOM   3188 C  CB    . THR A 1 409 ? -52.81800 -39.30300 -0.57300  1.000 27.37000  ? 397  THR A CB    1 
ATOM   3189 O  OG1   . THR A 1 409 ? -53.57300 -38.27700 -1.21000  1.000 31.82000  ? 397  THR A OG1   1 
ATOM   3190 C  CG2   . THR A 1 409 ? -52.31000 -40.25500 -1.64100  1.000 25.35000  ? 397  THR A CG2   1 
ATOM   3191 N  N     . TRP A 1 410 ? -52.00100 -40.78100 1.97700   1.000 30.02000  ? 398  TRP A N     1 
ATOM   3192 C  CA    . TRP A 1 410 ? -51.15900 -41.73200 2.64400   1.000 29.06000  ? 398  TRP A CA    1 
ATOM   3193 C  C     . TRP A 1 410 ? -52.01500 -42.71000 3.43400   1.000 33.72000  ? 398  TRP A C     1 
ATOM   3194 O  O     . TRP A 1 410 ? -51.79900 -43.91100 3.39000   1.000 34.39000  ? 398  TRP A O     1 
ATOM   3195 C  CB    . TRP A 1 410 ? -50.18600 -41.03100 3.57100   1.000 30.81000  ? 398  TRP A CB    1 
ATOM   3196 C  CG    . TRP A 1 410 ? -49.50500 -42.01200 4.37600   1.000 32.37000  ? 398  TRP A CG    1 
ATOM   3197 C  CD1   . TRP A 1 410 ? -49.78300 -42.34700 5.66100   1.000 36.66000  ? 398  TRP A CD1   1 
ATOM   3198 C  CD2   . TRP A 1 410 ? -48.46700 -42.88400 3.94500   1.000 29.81000  ? 398  TRP A CD2   1 
ATOM   3199 N  NE1   . TRP A 1 410 ? -48.95600 -43.35800 6.07400   1.000 35.92000  ? 398  TRP A NE1   1 
ATOM   3200 C  CE2   . TRP A 1 410 ? -48.13100 -43.70200 5.03400   1.000 34.45000  ? 398  TRP A CE2   1 
ATOM   3201 C  CE3   . TRP A 1 410 ? -47.77300 -43.03600 2.75000   1.000 30.10000  ? 398  TRP A CE3   1 
ATOM   3202 C  CZ2   . TRP A 1 410 ? -47.13400 -44.65400 4.96400   1.000 35.42000  ? 398  TRP A CZ2   1 
ATOM   3203 C  CZ3   . TRP A 1 410 ? -46.77800 -43.97800 2.68100   1.000 33.20000  ? 398  TRP A CZ3   1 
ATOM   3204 C  CH2   . TRP A 1 410 ? -46.47000 -44.77800 3.77700   1.000 38.10000  ? 398  TRP A CH2   1 
ATOM   3205 N  N     . GLU A 1 411 ? -53.00200 -42.17300 4.14200   1.000 35.69000  ? 399  GLU A N     1 
ATOM   3206 C  CA    . GLU A 1 411 ? -53.94000 -42.98700 4.89900   1.000 37.22000  ? 399  GLU A CA    1 
ATOM   3207 C  C     . GLU A 1 411 ? -54.67400 -44.01800 4.06100   1.000 38.36000  ? 399  GLU A C     1 
ATOM   3208 O  O     . GLU A 1 411 ? -54.79000 -45.16900 4.47400   1.000 41.41000  ? 399  GLU A O     1 
ATOM   3209 C  CB    . GLU A 1 411 ? -54.95400 -42.09200 5.59500   1.000 40.94000  ? 399  GLU A CB    1 
ATOM   3210 C  CG    . GLU A 1 411 ? -54.52600 -41.71500 6.99300   1.000 46.69000  ? 399  GLU A CG    1 
ATOM   3211 C  CD    . GLU A 1 411 ? -55.03200 -42.70900 8.00100   1.000 52.49000  ? 399  GLU A CD    1 
ATOM   3212 O  OE1   . GLU A 1 411 ? -55.85100 -43.56300 7.59400   1.000 48.85000  ? 399  GLU A OE1   1 
ATOM   3213 O  OE2   . GLU A 1 411 ? -54.62600 -42.63100 9.18700   1.000 65.32000  ? 399  GLU A OE2   1 
ATOM   3214 N  N     . THR A 1 412 ? -55.17700 -43.61000 2.90000   1.000 35.27000  ? 400  THR A N     1 
ATOM   3215 C  CA    . THR A 1 412 ? -55.80300 -44.56100 1.98500   1.000 35.35000  ? 400  THR A CA    1 
ATOM   3216 C  C     . THR A 1 412 ? -54.83900 -45.69500 1.63200   1.000 40.07000  ? 400  THR A C     1 
ATOM   3217 O  O     . THR A 1 412 ? -55.17500 -46.87100 1.80900   1.000 38.04000  ? 400  THR A O     1 
ATOM   3218 C  CB    . THR A 1 412 ? -56.26800 -43.88700 0.68300   1.000 36.23000  ? 400  THR A CB    1 
ATOM   3219 O  OG1   . THR A 1 412 ? -57.19400 -42.84800 0.99200   1.000 39.75000  ? 400  THR A OG1   1 
ATOM   3220 C  CG2   . THR A 1 412 ? -56.93600 -44.89100 -0.24500  1.000 29.79000  ? 400  THR A CG2   1 
ATOM   3221 N  N     . TRP A 1 413 ? -53.64400 -45.32700 1.15300   1.000 35.51000  ? 401  TRP A N     1 
ATOM   3222 C  CA    . TRP A 1 413 ? -52.66900 -46.29900 0.66100   1.000 36.08000  ? 401  TRP A CA    1 
ATOM   3223 C  C     . TRP A 1 413 ? -52.29400 -47.32300 1.71600   1.000 38.36000  ? 401  TRP A C     1 
ATOM   3224 O  O     . TRP A 1 413 ? -52.36800 -48.53100 1.48400   1.000 38.80000  ? 401  TRP A O     1 
ATOM   3225 C  CB    . TRP A 1 413 ? -51.42300 -45.58200 0.16900   1.000 33.51000  ? 401  TRP A CB    1 
ATOM   3226 C  CG    . TRP A 1 413 ? -50.25300 -46.47300 -0.04800  1.000 31.91000  ? 401  TRP A CG    1 
ATOM   3227 C  CD1   . TRP A 1 413 ? -49.10400 -46.50900 0.68900   1.000 34.13000  ? 401  TRP A CD1   1 
ATOM   3228 C  CD2   . TRP A 1 413 ? -50.09900 -47.46000 -1.08500  1.000 32.98000  ? 401  TRP A CD2   1 
ATOM   3229 N  NE1   . TRP A 1 413 ? -48.23400 -47.44900 0.17100   1.000 34.60000  ? 401  TRP A NE1   1 
ATOM   3230 C  CE2   . TRP A 1 413 ? -48.82400 -48.05400 -0.90800  1.000 29.04000  ? 401  TRP A CE2   1 
ATOM   3231 C  CE3   . TRP A 1 413 ? -50.91000 -47.90000 -2.13700  1.000 33.56000  ? 401  TRP A CE3   1 
ATOM   3232 C  CZ2   . TRP A 1 413 ? -48.34900 -49.05200 -1.74100  1.000 30.08000  ? 401  TRP A CZ2   1 
ATOM   3233 C  CZ3   . TRP A 1 413 ? -50.43900 -48.89700 -2.96600  1.000 30.32000  ? 401  TRP A CZ3   1 
ATOM   3234 C  CH2   . TRP A 1 413 ? -49.16900 -49.46400 -2.76900  1.000 33.50000  ? 401  TRP A CH2   1 
ATOM   3235 N  N     . TRP A 1 414 ? -51.90300 -46.82900 2.88200   1.000 39.84000  ? 402  TRP A N     1 
ATOM   3236 C  CA    . TRP A 1 414 ? -51.64800 -47.67000 4.04300   1.000 39.67000  ? 402  TRP A CA    1 
ATOM   3237 C  C     . TRP A 1 414 ? -52.82100 -48.59300 4.35800   1.000 47.44000  ? 402  TRP A C     1 
ATOM   3238 O  O     . TRP A 1 414 ? -52.63500 -49.74300 4.73900   1.000 55.01000  ? 402  TRP A O     1 
ATOM   3239 C  CB    . TRP A 1 414 ? -51.33100 -46.79000 5.25200   1.000 41.27000  ? 402  TRP A CB    1 
ATOM   3240 C  CG    . TRP A 1 414 ? -51.47000 -47.47200 6.54600   1.000 45.14000  ? 402  TRP A CG    1 
ATOM   3241 C  CD1   . TRP A 1 414 ? -50.50400 -48.15700 7.21500   1.000 44.01000  ? 402  TRP A CD1   1 
ATOM   3242 C  CD2   . TRP A 1 414 ? -52.64800 -47.53800 7.35300   1.000 50.13000  ? 402  TRP A CD2   1 
ATOM   3243 N  NE1   . TRP A 1 414 ? -51.00600 -48.65800 8.38800   1.000 43.42000  ? 402  TRP A NE1   1 
ATOM   3244 C  CE2   . TRP A 1 414 ? -52.32100 -48.28900 8.50000   1.000 49.43000  ? 402  TRP A CE2   1 
ATOM   3245 C  CE3   . TRP A 1 414 ? -53.95600 -47.05100 7.20600   1.000 47.95000  ? 402  TRP A CE3   1 
ATOM   3246 C  CZ2   . TRP A 1 414 ? -53.25000 -48.56400 9.50500   1.000 53.12000  ? 402  TRP A CZ2   1 
ATOM   3247 C  CZ3   . TRP A 1 414 ? -54.87500 -47.31300 8.20100   1.000 47.94000  ? 402  TRP A CZ3   1 
ATOM   3248 C  CH2   . TRP A 1 414 ? -54.51800 -48.06600 9.34100   1.000 57.67000  ? 402  TRP A CH2   1 
ATOM   3249 N  N     . THR A 1 415 ? -54.03500 -48.08600 4.18900   1.000 48.83000  ? 403  THR A N     1 
ATOM   3250 C  CA    . THR A 1 415 ? -55.23100 -48.84700 4.51300   1.000 45.22000  ? 403  THR A CA    1 
ATOM   3251 C  C     . THR A 1 415 ? -55.44300 -50.04800 3.60900   1.000 47.10000  ? 403  THR A C     1 
ATOM   3252 O  O     . THR A 1 415 ? -55.86800 -51.10100 4.07300   1.000 58.77000  ? 403  THR A O     1 
ATOM   3253 C  CB    . THR A 1 415 ? -56.48700 -47.96000 4.43000   1.000 46.39000  ? 403  THR A CB    1 
ATOM   3254 O  OG1   . THR A 1 415 ? -56.65500 -47.25100 5.67100   1.000 47.54000  ? 403  THR A OG1   1 
ATOM   3255 C  CG2   . THR A 1 415 ? -57.71800 -48.81500 4.16600   1.000 43.07000  ? 403  THR A CG2   1 
ATOM   3256 N  N     . GLU A 1 416 ? -55.14400 -49.88400 2.32400   1.000 44.39000  ? 404  GLU A N     1 
ATOM   3257 C  CA    . GLU A 1 416 ? -55.45000 -50.88200 1.30000   1.000 41.77000  ? 404  GLU A CA    1 
ATOM   3258 C  C     . GLU A 1 416 ? -54.22700 -51.59000 0.70400   1.000 48.72000  ? 404  GLU A C     1 
ATOM   3259 O  O     . GLU A 1 416 ? -54.32700 -52.24000 -0.34900  1.000 46.58000  ? 404  GLU A O     1 
ATOM   3260 C  CB    . GLU A 1 416 ? -56.20100 -50.21700 0.16100   1.000 49.60000  ? 404  GLU A CB    1 
ATOM   3261 C  CG    . GLU A 1 416 ? -55.27700 -49.45900 -0.80100  1.000 47.19000  ? 404  GLU A CG    1 
ATOM   3262 C  CD    . GLU A 1 416 ? -56.01000 -48.35000 -1.53700  1.000 58.89000  ? 404  GLU A CD    1 
ATOM   3263 O  OE1   . GLU A 1 416 ? -57.24800 -48.23400 -1.34600  1.000 61.68000  ? 404  GLU A OE1   1 
ATOM   3264 O  OE2   . GLU A 1 416 ? -55.36000 -47.59100 -2.30000  1.000 58.31000  ? 404  GLU A OE2   1 
ATOM   3265 N  N     . TYR A 1 417 ? -53.07200 -51.43800 1.34200   1.000 50.12000  ? 405  TYR A N     1 
ATOM   3266 C  CA    . TYR A 1 417 ? -51.86700 -52.13500 0.89600   1.000 43.01000  ? 405  TYR A CA    1 
ATOM   3267 C  C     . TYR A 1 417 ? -51.58000 -53.23800 1.89100   1.000 39.14000  ? 405  TYR A C     1 
ATOM   3268 O  O     . TYR A 1 417 ? -51.60100 -53.01900 3.09500   1.000 41.67000  ? 405  TYR A O     1 
ATOM   3269 C  CB    . TYR A 1 417 ? -50.69100 -51.16700 0.77800   1.000 39.97000  ? 405  TYR A CB    1 
ATOM   3270 C  CG    . TYR A 1 417 ? -49.44300 -51.72000 0.12400   1.000 38.30000  ? 405  TYR A CG    1 
ATOM   3271 C  CD1   . TYR A 1 417 ? -49.50500 -52.55600 -0.98500  1.000 38.06000  ? 405  TYR A CD1   1 
ATOM   3272 C  CD2   . TYR A 1 417 ? -48.19100 -51.36100 0.60100   1.000 37.79000  ? 405  TYR A CD2   1 
ATOM   3273 C  CE1   . TYR A 1 417 ? -48.35000 -53.02300 -1.57200  1.000 32.80000  ? 405  TYR A CE1   1 
ATOM   3274 C  CE2   . TYR A 1 417 ? -47.04800 -51.82600 0.02500   1.000 30.97000  ? 405  TYR A CE2   1 
ATOM   3275 C  CZ    . TYR A 1 417 ? -47.13000 -52.64800 -1.05400  1.000 31.08000  ? 405  TYR A CZ    1 
ATOM   3276 O  OH    . TYR A 1 417 ? -45.95400 -53.08600 -1.59900  1.000 45.51000  ? 405  TYR A OH    1 
ATOM   3277 N  N     . TRP A 1 418 ? -51.34400 -54.43000 1.36500   1.000 41.66000  ? 406  TRP A N     1 
ATOM   3278 C  CA    . TRP A 1 418 ? -51.26400 -55.62700 2.17800   1.000 39.42000  ? 406  TRP A CA    1 
ATOM   3279 C  C     . TRP A 1 418 ? -49.89000 -55.77600 2.78100   1.000 38.71000  ? 406  TRP A C     1 
ATOM   3280 O  O     . TRP A 1 418 ? -49.48500 -56.87600 3.12600   1.000 42.29000  ? 406  TRP A O     1 
ATOM   3281 C  CB    . TRP A 1 418 ? -51.59300 -56.85800 1.33400   1.000 45.63000  ? 406  TRP A CB    1 
ATOM   3282 C  CG    . TRP A 1 418 ? -50.69000 -57.01100 0.13500   1.000 46.49000  ? 406  TRP A CG    1 
ATOM   3283 C  CD1   . TRP A 1 418 ? -49.45100 -57.58200 0.10700   1.000 49.47000  ? 406  TRP A CD1   1 
ATOM   3284 C  CD2   . TRP A 1 418 ? -50.96100 -56.56800 -1.20500  1.000 53.12000  ? 406  TRP A CD2   1 
ATOM   3285 N  NE1   . TRP A 1 418 ? -48.92900 -57.52500 -1.16400  1.000 55.80000  ? 406  TRP A NE1   1 
ATOM   3286 C  CE2   . TRP A 1 418 ? -49.83600 -56.90700 -1.98900  1.000 53.90000  ? 406  TRP A CE2   1 
ATOM   3287 C  CE3   . TRP A 1 418 ? -52.04400 -55.91800 -1.81700  1.000 52.81000  ? 406  TRP A CE3   1 
ATOM   3288 C  CZ2   . TRP A 1 418 ? -49.76600 -56.62700 -3.36000  1.000 53.99000  ? 406  TRP A CZ2   1 
ATOM   3289 C  CZ3   . TRP A 1 418 ? -51.97300 -55.64200 -3.17700  1.000 49.08000  ? 406  TRP A CZ3   1 
ATOM   3290 C  CH2   . TRP A 1 418 ? -50.84100 -55.99700 -3.93300  1.000 51.53000  ? 406  TRP A CH2   1 
ATOM   3291 N  N     . GLN A 1 419 ? -49.16500 -54.67400 2.88800   1.000 36.26000  ? 407  GLN A N     1 
ATOM   3292 C  CA    . GLN A 1 419 ? -47.82400 -54.73000 3.43500   1.000 32.90000  ? 407  GLN A CA    1 
ATOM   3293 C  C     . GLN A 1 419 ? -47.60700 -53.75100 4.56900   1.000 34.70000  ? 407  GLN A C     1 
ATOM   3294 O  O     . GLN A 1 419 ? -48.28100 -52.72100 4.66800   1.000 35.68000  ? 407  GLN A O     1 
ATOM   3295 C  CB    . GLN A 1 419 ? -46.80300 -54.45800 2.34600   1.000 33.13000  ? 407  GLN A CB    1 
ATOM   3296 C  CG    . GLN A 1 419 ? -46.52100 -55.64400 1.47400   1.000 35.20000  ? 407  GLN A CG    1 
ATOM   3297 C  CD    . GLN A 1 419 ? -45.06100 -55.68900 1.09800   1.000 44.14000  ? 407  GLN A CD    1 
ATOM   3298 O  OE1   . GLN A 1 419 ? -44.46700 -54.65900 0.71600   1.000 44.31000  ? 407  GLN A OE1   1 
ATOM   3299 N  NE2   . GLN A 1 419 ? -44.45200 -56.87200 1.22800   1.000 39.49000  ? 407  GLN A NE2   1 
ATOM   3300 N  N     . ALA A 1 420 ? -46.66300 -54.08300 5.43200   1.000 34.26000  ? 408  ALA A N     1 
ATOM   3301 C  CA    . ALA A 1 420 ? -46.24200 -53.13600 6.44300   1.000 35.31000  ? 408  ALA A CA    1 
ATOM   3302 C  C     . ALA A 1 420 ? -45.51800 -51.99300 5.75600   1.000 36.21000  ? 408  ALA A C     1 
ATOM   3303 O  O     . ALA A 1 420 ? -44.52300 -52.21200 5.06400   1.000 38.10000  ? 408  ALA A O     1 
ATOM   3304 C  CB    . ALA A 1 420 ? -45.33100 -53.79800 7.46700   1.000 35.26000  ? 408  ALA A CB    1 
ATOM   3305 N  N     . THR A 1 421 ? -46.01000 -50.77800 5.93600   1.000 36.53000  ? 409  THR A N     1 
ATOM   3306 C  CA    . THR A 1 421 ? -45.30700 -49.63300 5.39400   1.000 30.63000  ? 409  THR A CA    1 
ATOM   3307 C  C     . THR A 1 421 ? -45.50900 -48.49600 6.35900   1.000 32.34000  ? 409  THR A C     1 
ATOM   3308 O  O     . THR A 1 421 ? -46.45200 -48.52700 7.14200   1.000 38.40000  ? 409  THR A O     1 
ATOM   3309 C  CB    . THR A 1 421 ? -45.78800 -49.27100 3.97000   1.000 29.91000  ? 409  THR A CB    1 
ATOM   3310 O  OG1   . THR A 1 421 ? -44.90900 -48.29600 3.41700   1.000 35.65000  ? 409  THR A OG1   1 
ATOM   3311 C  CG2   . THR A 1 421 ? -47.19600 -48.75000 3.96900   1.000 29.41000  ? 409  THR A CG2   1 
ATOM   3312 N  N     . TRP A 1 422 ? -44.60500 -47.52400 6.34000   1.000 34.11000  ? 410  TRP A N     1 
ATOM   3313 C  CA    . TRP A 1 422 ? -44.62000 -46.45200 7.34100   1.000 36.02000  ? 410  TRP A CA    1 
ATOM   3314 C  C     . TRP A 1 422 ? -43.62500 -45.34400 7.00600   1.000 39.63000  ? 410  TRP A C     1 
ATOM   3315 O  O     . TRP A 1 422 ? -42.55700 -45.59600 6.43500   1.000 35.20000  ? 410  TRP A O     1 
ATOM   3316 C  CB    . TRP A 1 422 ? -44.31000 -47.02100 8.73800   1.000 36.54000  ? 410  TRP A CB    1 
ATOM   3317 C  CG    . TRP A 1 422 ? -44.40500 -46.03100 9.88500   1.000 36.86000  ? 410  TRP A CG    1 
ATOM   3318 C  CD1   . TRP A 1 422 ? -45.54800 -45.54600 10.46900  1.000 38.37000  ? 410  TRP A CD1   1 
ATOM   3319 C  CD2   . TRP A 1 422 ? -43.31700 -45.45700 10.61200  1.000 35.74000  ? 410  TRP A CD2   1 
ATOM   3320 N  NE1   . TRP A 1 422 ? -45.23600 -44.68500 11.49500  1.000 33.01000  ? 410  TRP A NE1   1 
ATOM   3321 C  CE2   . TRP A 1 422 ? -43.87200 -44.61300 11.60400  1.000 36.29000  ? 410  TRP A CE2   1 
ATOM   3322 C  CE3   . TRP A 1 422 ? -41.93000 -45.56200 10.51600  1.000 34.40000  ? 410  TRP A CE3   1 
ATOM   3323 C  CZ2   . TRP A 1 422 ? -43.08500 -43.89100 12.49100  1.000 26.36000  ? 410  TRP A CZ2   1 
ATOM   3324 C  CZ3   . TRP A 1 422 ? -41.15100 -44.84100 11.39900  1.000 36.33000  ? 410  TRP A CZ3   1 
ATOM   3325 C  CH2   . TRP A 1 422 ? -41.73500 -44.01400 12.37600  1.000 28.15000  ? 410  TRP A CH2   1 
ATOM   3326 N  N     . ILE A 1 423 ? -43.99900 -44.12200 7.36700   1.000 33.64000  ? 411  ILE A N     1 
ATOM   3327 C  CA    . ILE A 1 423 ? -43.10400 -42.98800 7.27400   1.000 32.93000  ? 411  ILE A CA    1 
ATOM   3328 C  C     . ILE A 1 423 ? -43.00400 -42.28900 8.62700   1.000 35.47000  ? 411  ILE A C     1 
ATOM   3329 O  O     . ILE A 1 423 ? -43.99900 -42.13800 9.33500   1.000 37.49000  ? 411  ILE A O     1 
ATOM   3330 C  CB    . ILE A 1 423 ? -43.58300 -41.97300 6.24100   1.000 38.17000  ? 411  ILE A CB    1 
ATOM   3331 C  CG1   . ILE A 1 423 ? -43.89100 -42.64800 4.92500   1.000 30.34000  ? 411  ILE A CG1   1 
ATOM   3332 C  CG2   . ILE A 1 423 ? -42.53300 -40.89000 6.01100   1.000 42.43000  ? 411  ILE A CG2   1 
ATOM   3333 C  CD1   . ILE A 1 423 ? -44.49000 -41.66100 3.97300   1.000 34.99000  ? 411  ILE A CD1   1 
ATOM   3334 N  N     . PRO A 1 424 ? -41.79700 -41.84000 8.98600   1.000 34.78000  ? 412  PRO A N     1 
ATOM   3335 C  CA    . PRO A 1 424 ? -41.66800 -41.17300 10.27700  1.000 31.06000  ? 412  PRO A CA    1 
ATOM   3336 C  C     . PRO A 1 424 ? -42.44600 -39.87300 10.29200  1.000 37.56000  ? 412  PRO A C     1 
ATOM   3337 O  O     . PRO A 1 424 ? -43.19100 -39.59000 9.35400   1.000 38.87000  ? 412  PRO A O     1 
ATOM   3338 C  CB    . PRO A 1 424 ? -40.16300 -40.92700 10.39800  1.000 36.73000  ? 412  PRO A CB    1 
ATOM   3339 C  CG    . PRO A 1 424 ? -39.62200 -41.01700 9.01100   1.000 31.59000  ? 412  PRO A CG    1 
ATOM   3340 C  CD    . PRO A 1 424 ? -40.50600 -41.97000 8.28800   1.000 36.77000  ? 412  PRO A CD    1 
ATOM   3341 N  N     . GLU A 1 425 ? -42.27200 -39.09500 11.35700  1.000 44.87000  ? 413  GLU A N     1 
ATOM   3342 C  CA    . GLU A 1 425 ? -43.01700 -37.85300 11.52000  1.000 45.56000  ? 413  GLU A CA    1 
ATOM   3343 C  C     . GLU A 1 425 ? -42.91000 -36.94000 10.29200  1.000 41.93000  ? 413  GLU A C     1 
ATOM   3344 O  O     . GLU A 1 425 ? -41.79400 -36.58600 9.85100   1.000 37.01000  ? 413  GLU A O     1 
ATOM   3345 C  CB    . GLU A 1 425 ? -42.53500 -37.10300 12.75700  1.000 44.69000  ? 413  GLU A CB    1 
ATOM   3346 C  CG    . GLU A 1 425 ? -43.29100 -35.80500 12.97300  1.000 54.57000  ? 413  GLU A CG    1 
ATOM   3347 C  CD    . GLU A 1 425 ? -42.47500 -34.77100 13.71400  1.000 60.96000  ? 413  GLU A CD    1 
ATOM   3348 O  OE1   . GLU A 1 425 ? -42.83300 -33.56600 13.62700  1.000 59.35000  ? 413  GLU A OE1   1 
ATOM   3349 O  OE2   . GLU A 1 425 ? -41.48100 -35.16700 14.37600  1.000 61.98000  ? 413  GLU A OE2   1 
ATOM   3350 N  N     . TRP A 1 426 ? -44.06500 -36.55600 9.74300   1.000 37.22000  ? 414  TRP A N     1 
ATOM   3351 C  CA    . TRP A 1 426 ? -44.07400 -35.70900 8.55000   1.000 36.32000  ? 414  TRP A CA    1 
ATOM   3352 C  C     . TRP A 1 426 ? -45.27200 -34.77100 8.48000   1.000 36.71000  ? 414  TRP A C     1 
ATOM   3353 O  O     . TRP A 1 426 ? -46.32400 -35.05300 9.04800   1.000 44.38000  ? 414  TRP A O     1 
ATOM   3354 C  CB    . TRP A 1 426 ? -44.03400 -36.57500 7.29400   1.000 34.54000  ? 414  TRP A CB    1 
ATOM   3355 C  CG    . TRP A 1 426 ? -45.24400 -37.41700 7.14900   1.000 37.64000  ? 414  TRP A CG    1 
ATOM   3356 C  CD1   . TRP A 1 426 ? -45.56400 -38.52800 7.87200   1.000 38.76000  ? 414  TRP A CD1   1 
ATOM   3357 C  CD2   . TRP A 1 426 ? -46.30700 -37.21600 6.22700   1.000 31.90000  ? 414  TRP A CD2   1 
ATOM   3358 N  NE1   . TRP A 1 426 ? -46.76900 -39.03300 7.44700   1.000 33.38000  ? 414  TRP A NE1   1 
ATOM   3359 C  CE2   . TRP A 1 426 ? -47.24200 -38.24700 6.43600   1.000 28.39000  ? 414  TRP A CE2   1 
ATOM   3360 C  CE3   . TRP A 1 426 ? -46.55600 -36.27000 5.24400   1.000 28.48000  ? 414  TRP A CE3   1 
ATOM   3361 C  CZ2   . TRP A 1 426 ? -48.40000 -38.35500 5.70600   1.000 30.68000  ? 414  TRP A CZ2   1 
ATOM   3362 C  CZ3   . TRP A 1 426 ? -47.70200 -36.37600 4.52200   1.000 31.21000  ? 414  TRP A CZ3   1 
ATOM   3363 C  CH2   . TRP A 1 426 ? -48.61600 -37.41000 4.75000   1.000 33.50000  ? 414  TRP A CH2   1 
ATOM   3364 N  N     . GLU A 1 427 ? -45.09300 -33.65900 7.77700   1.000 32.67000  ? 415  GLU A N     1 
ATOM   3365 C  CA    . GLU A 1 427 ? -46.14200 -32.67600 7.56600   1.000 31.28000  ? 415  GLU A CA    1 
ATOM   3366 C  C     . GLU A 1 427 ? -46.31100 -32.38400 6.08700   1.000 33.15000  ? 415  GLU A C     1 
ATOM   3367 O  O     . GLU A 1 427 ? -45.33200 -32.32500 5.34700   1.000 39.95000  ? 415  GLU A O     1 
ATOM   3368 C  CB    . GLU A 1 427 ? -45.82800 -31.38000 8.31000   1.000 38.95000  ? 415  GLU A CB    1 
ATOM   3369 C  CG    . GLU A 1 427 ? -46.54400 -30.17000 7.72300   1.000 46.38000  ? 415  GLU A CG    1 
ATOM   3370 C  CD    . GLU A 1 427 ? -46.20700 -28.88100 8.46100   1.000 64.39000  ? 415  GLU A CD    1 
ATOM   3371 O  OE1   . GLU A 1 427 ? -47.03400 -28.43600 9.30500   1.000 66.88000  ? 415  GLU A OE1   1 
ATOM   3372 O  OE2   . GLU A 1 427 ? -45.11900 -28.31300 8.19000   1.000 58.11000  ? 415  GLU A OE2   1 
ATOM   3373 N  N     . PHE A 1 428 ? -47.55000 -32.19600 5.65600   1.000 30.44000  ? 416  PHE A N     1 
ATOM   3374 C  CA    . PHE A 1 428 ? -47.85500 -31.98400 4.24300   1.000 30.24000  ? 416  PHE A CA    1 
ATOM   3375 C  C     . PHE A 1 428 ? -47.34100 -30.62800 3.71800   1.000 33.95000  ? 416  PHE A C     1 
ATOM   3376 O  O     . PHE A 1 428 ? -47.32700 -29.63300 4.43100   1.000 42.75000  ? 416  PHE A O     1 
ATOM   3377 C  CB    . PHE A 1 428 ? -49.36900 -32.11400 4.05300   1.000 28.76000  ? 416  PHE A CB    1 
ATOM   3378 C  CG    . PHE A 1 428 ? -49.86800 -31.59700 2.74200   1.000 33.05000  ? 416  PHE A CG    1 
ATOM   3379 C  CD1   . PHE A 1 428 ? -49.30800 -32.01900 1.55500   1.000 36.68000  ? 416  PHE A CD1   1 
ATOM   3380 C  CD2   . PHE A 1 428 ? -50.92500 -30.72300 2.69000   1.000 37.52000  ? 416  PHE A CD2   1 
ATOM   3381 C  CE1   . PHE A 1 428 ? -49.78200 -31.55400 0.35200   1.000 38.03000  ? 416  PHE A CE1   1 
ATOM   3382 C  CE2   . PHE A 1 428 ? -51.39700 -30.26100 1.48700   1.000 38.91000  ? 416  PHE A CE2   1 
ATOM   3383 C  CZ    . PHE A 1 428 ? -50.83000 -30.67600 0.32200   1.000 39.26000  ? 416  PHE A CZ    1 
ATOM   3384 N  N     . VAL A 1 429 ? -46.92200 -30.58200 2.46600   1.000 34.38000  ? 417  VAL A N     1 
ATOM   3385 C  CA    . VAL A 1 429 ? -46.42000 -29.34600 1.87100   1.000 35.74000  ? 417  VAL A CA    1 
ATOM   3386 C  C     . VAL A 1 429 ? -47.02500 -29.14300 0.49200   1.000 39.94000  ? 417  VAL A C     1 
ATOM   3387 O  O     . VAL A 1 429 ? -46.62100 -29.85600 -0.42000  1.000 41.18000  ? 417  VAL A O     1 
ATOM   3388 C  CB    . VAL A 1 429 ? -44.89700 -29.40800 1.71300   1.000 34.45000  ? 417  VAL A CB    1 
ATOM   3389 C  CG1   . VAL A 1 429 ? -44.33900 -28.07800 1.31600   1.000 40.91000  ? 417  VAL A CG1   1 
ATOM   3390 C  CG2   . VAL A 1 429 ? -44.26900 -29.86800 2.97700   1.000 39.92000  ? 417  VAL A CG2   1 
ATOM   3391 N  N     . ASN A 1 430 ? -47.96700 -28.21900 0.28000   1.000 40.45000  ? 418  ASN A N     1 
ATOM   3392 C  CA    . ASN A 1 430 ? -48.59300 -28.23400 -1.05500  1.000 50.00000  ? 418  ASN A CA    1 
ATOM   3393 C  C     . ASN A 1 430 ? -47.74000 -27.57100 -2.11000  1.000 48.14000  ? 418  ASN A C     1 
ATOM   3394 O  O     . ASN A 1 430 ? -48.13500 -26.58400 -2.69700  1.000 55.12000  ? 418  ASN A O     1 
ATOM   3395 C  CB    . ASN A 1 430 ? -50.01300 -27.61500 -1.11900  1.000 57.22000  ? 418  ASN A CB    1 
ATOM   3396 C  CG    . ASN A 1 430 ? -50.29500 -26.58000 -0.04800  1.000 71.56000  ? 418  ASN A CG    1 
ATOM   3397 O  OD1   . ASN A 1 430 ? -49.40600 -26.14100 0.69000   1.000 82.39000  ? 418  ASN A OD1   1 
ATOM   3398 N  ND2   . ASN A 1 430 ? -51.57000 -26.17400 0.03400   1.000 67.76000  ? 418  ASN A ND2   1 
ATOM   3399 N  N     . THR A 1 431 ? -46.58700 -28.16600 -2.37000  1.000 41.27000  ? 419  THR A N     1 
ATOM   3400 C  CA    . THR A 1 431 ? -45.72700 -27.75500 -3.45300  1.000 39.56000  ? 419  THR A CA    1 
ATOM   3401 C  C     . THR A 1 431 ? -45.79900 -28.79300 -4.56400  1.000 42.69000  ? 419  THR A C     1 
ATOM   3402 O  O     . THR A 1 431 ? -45.04500 -29.75700 -4.53900  1.000 41.86000  ? 419  THR A O     1 
ATOM   3403 C  CB    . THR A 1 431 ? -44.26600 -27.62100 -2.97500  1.000 43.12000  ? 419  THR A CB    1 
ATOM   3404 O  OG1   . THR A 1 431 ? -43.67000 -28.92100 -2.86100  1.000 44.40000  ? 419  THR A OG1   1 
ATOM   3405 C  CG2   . THR A 1 431 ? -44.22100 -26.97400 -1.61100  1.000 46.85000  ? 419  THR A CG2   1 
ATOM   3406 N  N     . PRO A 1 432 ? -46.70800 -28.61400 -5.54600  1.000 47.28000  ? 420  PRO A N     1 
ATOM   3407 C  CA    . PRO A 1 432 ? -46.79100 -29.64300 -6.59500  1.000 37.57000  ? 420  PRO A CA    1 
ATOM   3408 C  C     . PRO A 1 432 ? -45.49500 -29.83800 -7.34600  1.000 32.41000  ? 420  PRO A C     1 
ATOM   3409 O  O     . PRO A 1 432 ? -44.56000 -29.04800 -7.18900  1.000 38.86000  ? 420  PRO A O     1 
ATOM   3410 C  CB    . PRO A 1 432 ? -47.85600 -29.09400 -7.55300  1.000 38.91000  ? 420  PRO A CB    1 
ATOM   3411 C  CG    . PRO A 1 432 ? -47.83600 -27.64900 -7.34400  1.000 44.63000  ? 420  PRO A CG    1 
ATOM   3412 C  CD    . PRO A 1 432 ? -47.61100 -27.48900 -5.84600  1.000 48.57000  ? 420  PRO A CD    1 
ATOM   3413 N  N     . PRO A 1 433 ? -45.44500 -30.87700 -8.17600  1.000 27.44000  ? 421  PRO A N     1 
ATOM   3414 C  CA    . PRO A 1 433 ? -46.56800 -31.81500 -8.36100  1.000 35.05000  ? 421  PRO A CA    1 
ATOM   3415 C  C     . PRO A 1 433 ? -46.80800 -32.77600 -7.16600  1.000 32.91000  ? 421  PRO A C     1 
ATOM   3416 O  O     . PRO A 1 433 ? -45.91600 -33.54000 -6.80300  1.000 30.65000  ? 421  PRO A O     1 
ATOM   3417 C  CB    . PRO A 1 433 ? -46.17100 -32.59800 -9.63500  1.000 30.74000  ? 421  PRO A CB    1 
ATOM   3418 C  CG    . PRO A 1 433 ? -44.71100 -32.41200 -9.78400  1.000 29.28000  ? 421  PRO A CG    1 
ATOM   3419 C  CD    . PRO A 1 433 ? -44.35100 -31.09500 -9.13500  1.000 28.45000  ? 421  PRO A CD    1 
ATOM   3420 N  N     . LEU A 1 434 ? -48.00500 -32.71700 -6.57800  1.000 33.10000  ? 422  LEU A N     1 
ATOM   3421 C  CA    . LEU A 1 434 ? -48.38100 -33.57500 -5.45600  1.000 32.99000  ? 422  LEU A CA    1 
ATOM   3422 C  C     . LEU A 1 434 ? -48.33600 -35.06900 -5.78900  1.000 36.97000  ? 422  LEU A C     1 
ATOM   3423 O  O     . LEU A 1 434 ? -48.49000 -35.46600 -6.94100  1.000 41.14000  ? 422  LEU A O     1 
ATOM   3424 C  CB    . LEU A 1 434 ? -49.79000 -33.22700 -4.96400  1.000 27.84000  ? 422  LEU A CB    1 
ATOM   3425 C  CG    . LEU A 1 434 ? -49.97900 -31.82800 -4.39400  1.000 32.28000  ? 422  LEU A CG    1 
ATOM   3426 C  CD1   . LEU A 1 434 ? -51.21100 -31.75000 -3.52500  1.000 23.74000  ? 422  LEU A CD1   1 
ATOM   3427 C  CD2   . LEU A 1 434 ? -48.75000 -31.40800 -3.60800  1.000 39.15000  ? 422  LEU A CD2   1 
ATOM   3428 N  N     . VAL A 1 435 ? -48.12300 -35.89600 -4.77300  1.000 36.59000  ? 423  VAL A N     1 
ATOM   3429 C  CA    . VAL A 1 435 ? -48.08400 -37.33100 -4.98500  1.000 34.82000  ? 423  VAL A CA    1 
ATOM   3430 C  C     . VAL A 1 435 ? -49.47600 -37.88000 -4.78100  1.000 31.92000  ? 423  VAL A C     1 
ATOM   3431 O  O     . VAL A 1 435 ? -50.10700 -37.61000 -3.76800  1.000 33.65000  ? 423  VAL A O     1 
ATOM   3432 C  CB    . VAL A 1 435 ? -47.11600 -38.03400 -4.00900  1.000 36.28000  ? 423  VAL A CB    1 
ATOM   3433 C  CG1   . VAL A 1 435 ? -47.03400 -39.50700 -4.34500  1.000 36.28000  ? 423  VAL A CG1   1 
ATOM   3434 C  CG2   . VAL A 1 435 ? -45.72800 -37.39100 -4.05200  1.000 30.20000  ? 423  VAL A CG2   1 
ATOM   3435 N  N     . LYS A 1 436 ? -49.96900 -38.66000 -5.72200  1.000 33.68000  ? 424  LYS A N     1 
ATOM   3436 C  CA    . LYS A 1 436 ? -51.32500 -39.15900 -5.56000  1.000 35.48000  ? 424  LYS A CA    1 
ATOM   3437 C  C     . LYS A 1 436 ? -51.49200 -40.57700 -6.08600  1.000 35.02000  ? 424  LYS A C     1 
ATOM   3438 O  O     . LYS A 1 436 ? -50.59400 -41.13300 -6.71000  1.000 37.28000  ? 424  LYS A O     1 
ATOM   3439 C  CB    . LYS A 1 436 ? -52.32400 -38.21800 -6.25200  1.000 33.03000  ? 424  LYS A CB    1 
ATOM   3440 C  CG    . LYS A 1 436 ? -52.01400 -37.95800 -7.71300  1.000 43.91000  ? 424  LYS A CG    1 
ATOM   3441 C  CD    . LYS A 1 436 ? -53.23200 -37.45800 -8.49400  1.000 50.55000  ? 424  LYS A CD    1 
ATOM   3442 C  CE    . LYS A 1 436 ? -52.87800 -37.27700 -9.97900  1.000 59.85000  ? 424  LYS A CE    1 
ATOM   3443 N  NZ    . LYS A 1 436 ? -54.06900 -37.16200 -10.85500 1.000 57.88000  ? 424  LYS A NZ    1 
ATOM   3444 N  N     . LEU A 1 437 ? -52.65300 -41.15600 -5.79900  1.000 38.71000  ? 425  LEU A N     1 
ATOM   3445 C  CA    . LEU A 1 437 ? -53.05500 -42.45100 -6.32300  1.000 31.52000  ? 425  LEU A CA    1 
ATOM   3446 C  C     . LEU A 1 437 ? -53.92500 -42.18800 -7.52400  1.000 33.41000  ? 425  LEU A C     1 
ATOM   3447 O  O     . LEU A 1 437 ? -54.89700 -41.45400 -7.42700  1.000 38.21000  ? 425  LEU A O     1 
ATOM   3448 C  CB    . LEU A 1 437 ? -53.79900 -43.25400 -5.26400  1.000 29.75000  ? 425  LEU A CB    1 
ATOM   3449 C  CG    . LEU A 1 437 ? -52.91200 -43.67200 -4.09200  1.000 31.06000  ? 425  LEU A CG    1 
ATOM   3450 C  CD1   . LEU A 1 437 ? -53.72200 -44.20900 -2.90900  1.000 35.33000  ? 425  LEU A CD1   1 
ATOM   3451 C  CD2   . LEU A 1 437 ? -51.94600 -44.71900 -4.58800  1.000 28.05000  ? 425  LEU A CD2   1 
ATOM   3452 N  N     . TRP A 1 438 ? -53.56900 -42.75800 -8.66400  1.000 32.46000  ? 426  TRP A N     1 
ATOM   3453 C  CA    . TRP A 1 438 ? -54.19700 -42.35100 -9.91000  1.000 30.92000  ? 426  TRP A CA    1 
ATOM   3454 C  C     . TRP A 1 438 ? -55.48400 -43.11800 -10.21100 1.000 34.84000  ? 426  TRP A C     1 
ATOM   3455 O  O     . TRP A 1 438 ? -56.24400 -42.75000 -11.11600 1.000 32.67000  ? 426  TRP A O     1 
ATOM   3456 C  CB    . TRP A 1 438 ? -53.20500 -42.49800 -11.04700 1.000 33.04000  ? 426  TRP A CB    1 
ATOM   3457 C  CG    . TRP A 1 438 ? -52.12800 -41.47000 -11.01200 1.000 36.58000  ? 426  TRP A CG    1 
ATOM   3458 C  CD1   . TRP A 1 438 ? -51.09900 -41.39700 -10.13600 1.000 41.62000  ? 426  TRP A CD1   1 
ATOM   3459 C  CD2   . TRP A 1 438 ? -51.96600 -40.36900 -11.91100 1.000 55.67000  ? 426  TRP A CD2   1 
ATOM   3460 N  NE1   . TRP A 1 438 ? -50.29600 -40.31400 -10.41700 1.000 44.42000  ? 426  TRP A NE1   1 
ATOM   3461 C  CE2   . TRP A 1 438 ? -50.80700 -39.66600 -11.50900 1.000 56.95000  ? 426  TRP A CE2   1 
ATOM   3462 C  CE3   . TRP A 1 438 ? -52.68100 -39.91200 -13.02700 1.000 58.90000  ? 426  TRP A CE3   1 
ATOM   3463 C  CZ2   . TRP A 1 438 ? -50.35000 -38.53300 -12.17700 1.000 55.36000  ? 426  TRP A CZ2   1 
ATOM   3464 C  CZ3   . TRP A 1 438 ? -52.21800 -38.78300 -13.69600 1.000 63.22000  ? 426  TRP A CZ3   1 
ATOM   3465 C  CH2   . TRP A 1 438 ? -51.06600 -38.10900 -13.26400 1.000 62.51000  ? 426  TRP A CH2   1 
ATOM   3466 N  N     . TYR A 1 439 ? -55.73000 -44.18100 -9.45200  1.000 33.68000  ? 427  TYR A N     1 
ATOM   3467 C  CA    . TYR A 1 439 ? -56.99000 -44.90400 -9.53200  1.000 28.51000  ? 427  TYR A CA    1 
ATOM   3468 C  C     . TYR A 1 439 ? -57.14300 -45.73500 -8.30400  1.000 33.27000  ? 427  TYR A C     1 
ATOM   3469 O  O     . TYR A 1 439 ? -56.18900 -45.96600 -7.59100  1.000 35.32000  ? 427  TYR A O     1 
ATOM   3470 C  CB    . TYR A 1 439 ? -57.06200 -45.81000 -10.74400 1.000 29.62000  ? 427  TYR A CB    1 
ATOM   3471 C  CG    . TYR A 1 439 ? -55.96100 -46.83500 -10.80300 1.000 30.32000  ? 427  TYR A CG    1 
ATOM   3472 C  CD1   . TYR A 1 439 ? -56.07400 -48.04400 -10.15100 1.000 29.07000  ? 427  TYR A CD1   1 
ATOM   3473 C  CD2   . TYR A 1 439 ? -54.81000 -46.58600 -11.53400 1.000 29.59000  ? 427  TYR A CD2   1 
ATOM   3474 C  CE1   . TYR A 1 439 ? -55.05600 -48.97200 -10.21600 1.000 27.61000  ? 427  TYR A CE1   1 
ATOM   3475 C  CE2   . TYR A 1 439 ? -53.80400 -47.49400 -11.60600 1.000 24.18000  ? 427  TYR A CE2   1 
ATOM   3476 C  CZ    . TYR A 1 439 ? -53.92500 -48.68700 -10.94100 1.000 26.66000  ? 427  TYR A CZ    1 
ATOM   3477 O  OH    . TYR A 1 439 ? -52.90100 -49.57600 -11.03500 1.000 31.48000  ? 427  TYR A OH    1 
ATOM   3478 N  N     . GLN A 1 440 ? -58.35100 -46.22000 -8.08600  1.000 34.85000  ? 428  GLN A N     1 
ATOM   3479 C  CA    . GLN A 1 440 ? -58.68900 -46.86700 -6.84600  1.000 34.88000  ? 428  GLN A CA    1 
ATOM   3480 C  C     . GLN A 1 440 ? -59.67200 -47.99000 -7.14100  1.000 37.68000  ? 428  GLN A C     1 
ATOM   3481 O  O     . GLN A 1 440 ? -60.83000 -47.73100 -7.45400  1.000 41.85000  ? 428  GLN A O     1 
ATOM   3482 C  CB    . GLN A 1 440 ? -59.26900 -45.83000 -5.88100  1.000 43.10000  ? 428  GLN A CB    1 
ATOM   3483 C  CG    . GLN A 1 440 ? -59.71400 -46.34700 -4.53900  1.000 50.04000  ? 428  GLN A CG    1 
ATOM   3484 C  CD    . GLN A 1 440 ? -58.55300 -46.64500 -3.62500  1.000 58.00000  ? 428  GLN A CD    1 
ATOM   3485 O  OE1   . GLN A 1 440 ? -57.53800 -45.92700 -3.62600  1.000 58.77000  ? 428  GLN A OE1   1 
ATOM   3486 N  NE2   . GLN A 1 440 ? -58.67800 -47.72100 -2.84300  1.000 52.62000  ? 428  GLN A NE2   1 
ATOM   3487 N  N     . LEU A 1 441 ? -59.20400 -49.23100 -7.07900  1.000 31.97000  ? 429  LEU A N     1 
ATOM   3488 C  CA    . LEU A 1 441 ? -60.08700 -50.38100 -7.23600  1.000 27.43000  ? 429  LEU A CA    1 
ATOM   3489 C  C     . LEU A 1 441 ? -61.17000 -50.37000 -6.16600  1.000 32.76000  ? 429  LEU A C     1 
ATOM   3490 O  O     . LEU A 1 441 ? -60.99100 -49.81900 -5.08500  1.000 40.18000  ? 429  LEU A O     1 
ATOM   3491 C  CB    . LEU A 1 441 ? -59.28800 -51.68200 -7.16400  1.000 33.49000  ? 429  LEU A CB    1 
ATOM   3492 C  CG    . LEU A 1 441 ? -58.01800 -51.79100 -8.03300  1.000 28.99000  ? 429  LEU A CG    1 
ATOM   3493 C  CD1   . LEU A 1 441 ? -57.36400 -53.10800 -7.82100  1.000 21.20000  ? 429  LEU A CD1   1 
ATOM   3494 C  CD2   . LEU A 1 441 ? -58.30300 -51.60600 -9.50000  1.000 24.74000  ? 429  LEU A CD2   1 
ATOM   3495 N  N     . GLU A 1 442 ? -62.30600 -50.97400 -6.46500  1.000 34.78000  ? 430  GLU A N     1 
ATOM   3496 C  CA    . GLU A 1 442 ? -63.39900 -51.04400 -5.49500  1.000 36.87000  ? 430  GLU A CA    1 
ATOM   3497 C  C     . GLU A 1 442 ? -63.25400 -52.24500 -4.57400  1.000 30.54000  ? 430  GLU A C     1 
ATOM   3498 O  O     . GLU A 1 442 ? -62.71200 -53.26100 -4.96600  1.000 32.45000  ? 430  GLU A O     1 
ATOM   3499 C  CB    . GLU A 1 442 ? -64.74200 -51.11700 -6.22100  1.000 33.33000  ? 430  GLU A CB    1 
ATOM   3500 C  CG    . GLU A 1 442 ? -65.04400 -49.92100 -7.07600  1.000 29.35000  ? 430  GLU A CG    1 
ATOM   3501 C  CD    . GLU A 1 442 ? -65.51300 -48.74100 -6.25900  1.000 40.48000  ? 430  GLU A CD    1 
ATOM   3502 O  OE1   . GLU A 1 442 ? -64.94900 -47.63500 -6.44300  1.000 41.17000  ? 430  GLU A OE1   1 
ATOM   3503 O  OE2   . GLU A 1 442 ? -66.44600 -48.91700 -5.43700  1.000 42.81000  ? 430  GLU A OE2   1 
ATOM   3504 N  N     . LYS A 1 443 ? -63.76600 -52.13500 -3.35900  1.000 36.44000  ? 431  LYS A N     1 
ATOM   3505 C  CA    . LYS A 1 443 ? -63.72100 -53.25200 -2.41800  1.000 36.72000  ? 431  LYS A CA    1 
ATOM   3506 C  C     . LYS A 1 443 ? -64.90100 -54.21000 -2.61400  1.000 32.42000  ? 431  LYS A C     1 
ATOM   3507 O  O     . LYS A 1 443 ? -64.77100 -55.39800 -2.36600  1.000 36.18000  ? 431  LYS A O     1 
ATOM   3508 C  CB    . LYS A 1 443 ? -63.69100 -52.73500 -0.98000  1.000 44.19000  ? 431  LYS A CB    1 
ATOM   3509 C  CG    . LYS A 1 443 ? -62.92800 -51.42100 -0.81600  1.000 52.87000  ? 431  LYS A CG    1 
ATOM   3510 C  CD    . LYS A 1 443 ? -62.62200 -51.10700 0.64400   1.000 66.64000  ? 431  LYS A CD    1 
ATOM   3511 C  CE    . LYS A 1 443 ? -63.88000 -51.11800 1.51200   1.000 77.51000  ? 431  LYS A CE    1 
ATOM   3512 N  NZ    . LYS A 1 443 ? -63.55000 -51.07500 2.97400   1.000 77.94000  ? 431  LYS A NZ    1 
ATOM   3513 N  N     . GLU A 1 444 ? -66.04000 -53.69600 -3.06700  1.000 32.17000  ? 432  GLU A N     1 
ATOM   3514 C  CA    . GLU A 1 444 ? -67.20500 -54.54000 -3.33400  1.000 29.28000  ? 432  GLU A CA    1 
ATOM   3515 C  C     . GLU A 1 444 ? -67.59100 -54.43800 -4.79600  1.000 29.89000  ? 432  GLU A C     1 
ATOM   3516 O  O     . GLU A 1 444 ? -67.38600 -53.39500 -5.39400  1.000 34.92000  ? 432  GLU A O     1 
ATOM   3517 C  CB    . GLU A 1 444 ? -68.38500 -54.12700 -2.46600  1.000 33.02000  ? 432  GLU A CB    1 
ATOM   3518 C  CG    . GLU A 1 444 ? -68.05900 -53.93500 -1.00300  1.000 37.03000  ? 432  GLU A CG    1 
ATOM   3519 C  CD    . GLU A 1 444 ? -67.62000 -55.22100 -0.33000  1.000 47.01000  ? 432  GLU A CD    1 
ATOM   3520 O  OE1   . GLU A 1 444 ? -68.10700 -56.30600 -0.75300  1.000 43.26000  ? 432  GLU A OE1   1 
ATOM   3521 O  OE2   . GLU A 1 444 ? -66.78600 -55.13800 0.61500   1.000 48.64000  ? 432  GLU A OE2   1 
ATOM   3522 N  N     . PRO A 1 445 ? -68.17600 -55.50700 -5.36500  1.000 30.14000  ? 433  PRO A N     1 
ATOM   3523 C  CA    . PRO A 1 445 ? -68.54200 -55.56900 -6.79000  1.000 26.17000  ? 433  PRO A CA    1 
ATOM   3524 C  C     . PRO A 1 445 ? -69.57600 -54.51800 -7.13300  1.000 28.66000  ? 433  PRO A C     1 
ATOM   3525 O  O     . PRO A 1 445 ? -70.33100 -54.11600 -6.24800  1.000 31.48000  ? 433  PRO A O     1 
ATOM   3526 C  CB    . PRO A 1 445 ? -69.14200 -56.96700 -6.94700  1.000 27.62000  ? 433  PRO A CB    1 
ATOM   3527 C  CG    . PRO A 1 445 ? -69.61800 -57.33900 -5.59200  1.000 21.42000  ? 433  PRO A CG    1 
ATOM   3528 C  CD    . PRO A 1 445 ? -68.68200 -56.66900 -4.61600  1.000 28.19000  ? 433  PRO A CD    1 
ATOM   3529 N  N     . ILE A 1 446 ? -69.61900 -54.09800 -8.38700  1.000 28.02000  ? 434  ILE A N     1 
ATOM   3530 C  CA    . ILE A 1 446 ? -70.38400 -52.91900 -8.76900  1.000 26.65000  ? 434  ILE A CA    1 
ATOM   3531 C  C     . ILE A 1 446 ? -71.73300 -53.28700 -9.33300  1.000 26.85000  ? 434  ILE A C     1 
ATOM   3532 O  O     . ILE A 1 446 ? -71.80400 -54.05400 -10.28700 1.000 28.43000  ? 434  ILE A O     1 
ATOM   3533 C  CB    . ILE A 1 446 ? -69.64700 -52.09600 -9.83500  1.000 29.40000  ? 434  ILE A CB    1 
ATOM   3534 C  CG1   . ILE A 1 446 ? -68.29800 -51.61500 -9.30600  1.000 26.63000  ? 434  ILE A CG1   1 
ATOM   3535 C  CG2   . ILE A 1 446 ? -70.51300 -50.95300 -10.34900 1.000 21.89000  ? 434  ILE A CG2   1 
ATOM   3536 C  CD1   . ILE A 1 446 ? -67.24800 -51.58700 -10.39500 1.000 24.41000  ? 434  ILE A CD1   1 
ATOM   3537 N  N     . VAL A 1 447 ? -72.79000 -52.71700 -8.75800  1.000 26.87000  ? 435  VAL A N     1 
ATOM   3538 C  CA    . VAL A 1 447 ? -74.15000 -52.92900 -9.25200  1.000 24.25000  ? 435  VAL A CA    1 
ATOM   3539 C  C     . VAL A 1 447 ? -74.37600 -52.27700 -10.61600 1.000 30.37000  ? 435  VAL A C     1 
ATOM   3540 O  O     . VAL A 1 447 ? -74.01200 -51.10200 -10.84000 1.000 30.25000  ? 435  VAL A O     1 
ATOM   3541 C  CB    . VAL A 1 447 ? -75.19800 -52.36200 -8.28500  1.000 24.81000  ? 435  VAL A CB    1 
ATOM   3542 C  CG1   . VAL A 1 447 ? -76.59700 -52.41400 -8.93300  1.000 23.45000  ? 435  VAL A CG1   1 
ATOM   3543 C  CG2   . VAL A 1 447 ? -75.16100 -53.11700 -6.95700  1.000 19.69000  ? 435  VAL A CG2   1 
ATOM   3544 N  N     . GLY A 1 448 ? -74.98800 -53.03600 -11.51800 1.000 24.35000  ? 436  GLY A N     1 
ATOM   3545 C  CA    . GLY A 1 448 ? -75.20700 -52.53000 -12.85500 1.000 28.89000  ? 436  GLY A CA    1 
ATOM   3546 C  C     . GLY A 1 448 ? -73.92700 -52.17800 -13.59400 1.000 34.50000  ? 436  GLY A C     1 
ATOM   3547 O  O     . GLY A 1 448 ? -73.80400 -51.10300 -14.21100 1.000 39.77000  ? 436  GLY A O     1 
ATOM   3548 N  N     . ALA A 1 449 ? -72.95100 -53.07500 -13.52400 1.000 31.78000  ? 437  ALA A N     1 
ATOM   3549 C  CA    . ALA A 1 449 ? -71.76600 -52.93200 -14.35600 1.000 27.44000  ? 437  ALA A CA    1 
ATOM   3550 C  C     . ALA A 1 449 ? -71.54000 -54.26800 -15.02900 1.000 28.88000  ? 437  ALA A C     1 
ATOM   3551 O  O     . ALA A 1 449 ? -71.67400 -55.30600 -14.39700 1.000 32.18000  ? 437  ALA A O     1 
ATOM   3552 C  CB    . ALA A 1 449 ? -70.58000 -52.52000 -13.54000 1.000 24.94000  ? 437  ALA A CB    1 
ATOM   3553 N  N     . GLU A 1 450 ? -71.24900 -54.25400 -16.31500 1.000 21.48000  ? 438  GLU A N     1 
ATOM   3554 C  CA    . GLU A 1 450 ? -71.11100 -55.50300 -17.01300 1.000 24.04000  ? 438  GLU A CA    1 
ATOM   3555 C  C     . GLU A 1 450 ? -69.99500 -56.31900 -16.36800 1.000 27.21000  ? 438  GLU A C     1 
ATOM   3556 O  O     . GLU A 1 450 ? -68.91300 -55.80100 -16.07700 1.000 24.99000  ? 438  GLU A O     1 
ATOM   3557 C  CB    . GLU A 1 450 ? -70.82700 -55.25800 -18.49000 1.000 25.45000  ? 438  GLU A CB    1 
ATOM   3558 C  CG    . GLU A 1 450 ? -71.01800 -56.47300 -19.35500 1.000 24.72000  ? 438  GLU A CG    1 
ATOM   3559 C  CD    . GLU A 1 450 ? -70.82800 -56.15500 -20.83200 1.000 34.70000  ? 438  GLU A CD    1 
ATOM   3560 O  OE1   . GLU A 1 450 ? -70.38100 -55.03000 -21.17400 1.000 27.46000  ? 438  GLU A OE1   1 
ATOM   3561 O  OE2   . GLU A 1 450 ? -71.13300 -57.03900 -21.65900 1.000 39.90000  ? 438  GLU A OE2   1 
ATOM   3562 N  N     . THR A 1 451 ? -70.27600 -57.59600 -16.14400 1.000 26.78000  ? 439  THR A N     1 
ATOM   3563 C  CA    . THR A 1 451 ? -69.31700 -58.53800 -15.58200 1.000 23.03000  ? 439  THR A CA    1 
ATOM   3564 C  C     . THR A 1 451 ? -68.55400 -59.32200 -16.62700 1.000 21.91000  ? 439  THR A C     1 
ATOM   3565 O  O     . THR A 1 451 ? -69.15300 -60.14400 -17.33700 1.000 23.95000  ? 439  THR A O     1 
ATOM   3566 C  CB    . THR A 1 451 ? -70.03200 -59.55700 -14.69300 1.000 25.25000  ? 439  THR A CB    1 
ATOM   3567 O  OG1   . THR A 1 451 ? -70.78300 -58.85300 -13.68200 1.000 26.57000  ? 439  THR A OG1   1 
ATOM   3568 C  CG2   . THR A 1 451 ? -69.01600 -60.53500 -14.05300 1.000 19.78000  ? 439  THR A CG2   1 
ATOM   3569 N  N     . PHE A 1 452 ? -67.24300 -59.09300 -16.69800 1.000 20.32000  ? 440  PHE A N     1 
ATOM   3570 C  CA    . PHE A 1 452 ? -66.35800 -59.78900 -17.65100 1.000 22.55000  ? 440  PHE A CA    1 
ATOM   3571 C  C     . PHE A 1 452 ? -65.61500 -60.95000 -17.00200 1.000 26.40000  ? 440  PHE A C     1 
ATOM   3572 O  O     . PHE A 1 452 ? -64.96100 -60.77000 -15.97500 1.000 26.59000  ? 440  PHE A O     1 
ATOM   3573 C  CB    . PHE A 1 452 ? -65.30900 -58.83000 -18.23100 1.000 20.16000  ? 440  PHE A CB    1 
ATOM   3574 C  CG    . PHE A 1 452 ? -65.86200 -57.82800 -19.20000 1.000 20.48000  ? 440  PHE A CG    1 
ATOM   3575 C  CD1   . PHE A 1 452 ? -66.70700 -56.82300 -18.77300 1.000 20.55000  ? 440  PHE A CD1   1 
ATOM   3576 C  CD2   . PHE A 1 452 ? -65.49900 -57.88100 -20.54200 1.000 23.94000  ? 440  PHE A CD2   1 
ATOM   3577 C  CE1   . PHE A 1 452 ? -67.20400 -55.91900 -19.66400 1.000 24.61000  ? 440  PHE A CE1   1 
ATOM   3578 C  CE2   . PHE A 1 452 ? -66.00000 -56.98300 -21.44400 1.000 22.98000  ? 440  PHE A CE2   1 
ATOM   3579 C  CZ    . PHE A 1 452 ? -66.84700 -55.99000 -21.00900 1.000 26.68000  ? 440  PHE A CZ    1 
ATOM   3580 N  N     . TYR A 1 453 ? -65.68700 -62.12700 -17.61000 1.000 27.14000  ? 441  TYR A N     1 
ATOM   3581 C  CA    . TYR A 1 453 ? -64.83900 -63.24700 -17.20300 1.000 22.78000  ? 441  TYR A CA    1 
ATOM   3582 C  C     . TYR A 1 453 ? -63.71700 -63.42200 -18.21600 1.000 27.63000  ? 441  TYR A C     1 
ATOM   3583 O  O     . TYR A 1 453 ? -63.96200 -63.83800 -19.34600 1.000 28.52000  ? 441  TYR A O     1 
ATOM   3584 C  CB    . TYR A 1 453 ? -65.65500 -64.52600 -17.09200 1.000 25.79000  ? 441  TYR A CB    1 
ATOM   3585 C  CG    . TYR A 1 453 ? -66.73300 -64.44100 -16.04800 1.000 26.84000  ? 441  TYR A CG    1 
ATOM   3586 C  CD1   . TYR A 1 453 ? -67.98600 -63.94800 -16.36500 1.000 25.34000  ? 441  TYR A CD1   1 
ATOM   3587 C  CD2   . TYR A 1 453 ? -66.49500 -64.83700 -14.73900 1.000 26.22000  ? 441  TYR A CD2   1 
ATOM   3588 C  CE1   . TYR A 1 453 ? -68.97300 -63.85500 -15.41900 1.000 25.96000  ? 441  TYR A CE1   1 
ATOM   3589 C  CE2   . TYR A 1 453 ? -67.47200 -64.74300 -13.79000 1.000 26.82000  ? 441  TYR A CE2   1 
ATOM   3590 C  CZ    . TYR A 1 453 ? -68.71100 -64.25000 -14.13300 1.000 28.30000  ? 441  TYR A CZ    1 
ATOM   3591 O  OH    . TYR A 1 453 ? -69.69400 -64.15300 -13.18800 1.000 29.18000  ? 441  TYR A OH    1 
ATOM   3592 N  N     . VAL A 1 454 ? -62.49000 -63.10400 -17.81900 1.000 28.85000  ? 442  VAL A N     1 
ATOM   3593 C  CA    . VAL A 1 454 ? -61.37900 -63.06300 -18.76200 1.000 25.20000  ? 442  VAL A CA    1 
ATOM   3594 C  C     . VAL A 1 454 ? -60.45900 -64.24700 -18.60400 1.000 28.29000  ? 442  VAL A C     1 
ATOM   3595 O  O     . VAL A 1 454 ? -60.45400 -64.90400 -17.56100 1.000 34.82000  ? 442  VAL A O     1 
ATOM   3596 C  CB    . VAL A 1 454 ? -60.55600 -61.79200 -18.58800 1.000 25.77000  ? 442  VAL A CB    1 
ATOM   3597 C  CG1   . VAL A 1 454 ? -61.45600 -60.57500 -18.72600 1.000 24.80000  ? 442  VAL A CG1   1 
ATOM   3598 C  CG2   . VAL A 1 454 ? -59.89500 -61.79500 -17.24500 1.000 28.31000  ? 442  VAL A CG2   1 
ATOM   3599 N  N     . ASP A 1 455 ? -59.68700 -64.53400 -19.64600 1.000 27.08000  ? 443  ASP A N     1 
ATOM   3600 C  CA    . ASP A 1 455 ? -58.70400 -65.60200 -19.56100 1.000 30.98000  ? 443  ASP A CA    1 
ATOM   3601 C  C     . ASP A 1 455 ? -57.73500 -65.61600 -20.73000 1.000 30.18000  ? 443  ASP A C     1 
ATOM   3602 O  O     . ASP A 1 455 ? -57.96000 -64.98500 -21.76200 1.000 33.11000  ? 443  ASP A O     1 
ATOM   3603 C  CB    . ASP A 1 455 ? -59.38900 -66.96900 -19.44900 1.000 37.11000  ? 443  ASP A CB    1 
ATOM   3604 C  CG    . ASP A 1 455 ? -58.54200 -67.97200 -18.67500 1.000 42.64000  ? 443  ASP A CG    1 
ATOM   3605 O  OD1   . ASP A 1 455 ? -57.76200 -67.52800 -17.78600 1.000 47.50000  ? 443  ASP A OD1   1 
ATOM   3606 O  OD2   . ASP A 1 455 ? -58.64700 -69.18600 -18.95000 1.000 37.19000  ? 443  ASP A OD2   1 
ATOM   3607 N  N     . GLY A 1 456 ? -56.63900 -66.33500 -20.55300 1.000 32.20000  ? 444  GLY A N     1 
ATOM   3608 C  CA    . GLY A 1 456 ? -55.64500 -66.43700 -21.60100 1.000 33.48000  ? 444  GLY A CA    1 
ATOM   3609 C  C     . GLY A 1 456 ? -54.91300 -67.74600 -21.45300 1.000 35.74000  ? 444  GLY A C     1 
ATOM   3610 O  O     . GLY A 1 456 ? -54.80600 -68.27600 -20.33900 1.000 41.00000  ? 444  GLY A O     1 
ATOM   3611 N  N     . ALA A 1 457 ? -54.42600 -68.27000 -22.57600 1.000 35.07000  ? 445  ALA A N     1 
ATOM   3612 C  CA    . ALA A 1 457 ? -53.67000 -69.51400 -22.60100 1.000 29.97000  ? 445  ALA A CA    1 
ATOM   3613 C  C     . ALA A 1 457 ? -52.58100 -69.39400 -23.64500 1.000 32.64000  ? 445  ALA A C     1 
ATOM   3614 O  O     . ALA A 1 457 ? -52.72300 -68.62800 -24.59100 1.000 33.03000  ? 445  ALA A O     1 
ATOM   3615 C  CB    . ALA A 1 457 ? -54.56400 -70.67100 -22.89800 1.000 26.38000  ? 445  ALA A CB    1 
ATOM   3616 N  N     . ALA A 1 458 ? -51.49500 -70.14600 -23.47000 1.000 38.29000  ? 446  ALA A N     1 
ATOM   3617 C  CA    . ALA A 1 458 ? -50.39100 -70.10800 -24.42200 1.000 35.21000  ? 446  ALA A CA    1 
ATOM   3618 C  C     . ALA A 1 458 ? -49.69900 -71.46000 -24.53000 1.000 43.79000  ? 446  ALA A C     1 
ATOM   3619 O  O     . ALA A 1 458 ? -49.57900 -72.18100 -23.54300 1.000 51.32000  ? 446  ALA A O     1 
ATOM   3620 C  CB    . ALA A 1 458 ? -49.40200 -69.04500 -24.02400 1.000 31.48000  ? 446  ALA A CB    1 
ATOM   3621 N  N     . ASN A 1 459 ? -49.23600 -71.76800 -25.74100 1.000 43.32000  ? 447  ASN A N     1 
ATOM   3622 C  CA    . ASN A 1 459 ? -48.52100 -72.99700 -26.09000 1.000 43.20000  ? 447  ASN A CA    1 
ATOM   3623 C  C     . ASN A 1 459 ? -46.99600 -72.84300 -25.94400 1.000 44.50000  ? 447  ASN A C     1 
ATOM   3624 O  O     . ASN A 1 459 ? -46.37300 -72.11200 -26.70700 1.000 45.03000  ? 447  ASN A O     1 
ATOM   3625 C  CB    . ASN A 1 459 ? -48.90000 -73.37300 -27.53300 1.000 50.05000  ? 447  ASN A CB    1 
ATOM   3626 C  CG    . ASN A 1 459 ? -48.27100 -74.67900 -28.00600 1.000 54.43000  ? 447  ASN A CG    1 
ATOM   3627 O  OD1   . ASN A 1 459 ? -47.05300 -74.76800 -28.21900 1.000 55.40000  ? 447  ASN A OD1   1 
ATOM   3628 N  ND2   . ASN A 1 459 ? -49.11200 -75.68400 -28.22700 1.000 45.22000  ? 447  ASN A ND2   1 
ATOM   3629 N  N     . ARG A 1 460 ? -46.39100 -73.52600 -24.97300 1.000 46.18000  ? 448  ARG A N     1 
ATOM   3630 C  CA    . ARG A 1 460 ? -44.97100 -73.30200 -24.67000 1.000 49.19000  ? 448  ARG A CA    1 
ATOM   3631 C  C     . ARG A 1 460 ? -44.05200 -73.50900 -25.86500 1.000 52.80000  ? 448  ARG A C     1 
ATOM   3632 O  O     . ARG A 1 460 ? -43.01300 -72.84700 -25.98500 1.000 49.35000  ? 448  ARG A O     1 
ATOM   3633 C  CB    . ARG A 1 460 ? -44.51200 -74.20400 -23.52400 1.000 52.44000  ? 448  ARG A CB    1 
ATOM   3634 C  CG    . ARG A 1 460 ? -44.60000 -73.53800 -22.15800 1.000 61.97000  ? 448  ARG A CG    1 
ATOM   3635 C  CD    . ARG A 1 460 ? -44.65000 -74.55000 -21.02700 1.000 68.27000  ? 448  ARG A CD    1 
ATOM   3636 N  NE    . ARG A 1 460 ? -43.32000 -74.96900 -20.59900 1.000 66.53000  ? 448  ARG A NE    1 
ATOM   3637 C  CZ    . ARG A 1 460 ? -43.09900 -76.02400 -19.82500 1.000 69.86000  ? 448  ARG A CZ    1 
ATOM   3638 N  NH1   . ARG A 1 460 ? -44.12900 -76.75900 -19.41400 1.000 85.63000  ? 448  ARG A NH1   1 
ATOM   3639 N  NH2   . ARG A 1 460 ? -41.86000 -76.35200 -19.46600 1.000 69.96000  ? 448  ARG A NH2   1 
ATOM   3640 N  N     . GLU A 1 461 ? -44.43400 -74.41800 -26.75400 1.000 52.49000  ? 449  GLU A N     1 
ATOM   3641 C  CA    . GLU A 1 461 ? -43.56300 -74.77000 -27.86200 1.000 55.91000  ? 449  GLU A CA    1 
ATOM   3642 C  C     . GLU A 1 461 ? -43.64300 -73.74200 -28.99300 1.000 55.31000  ? 449  GLU A C     1 
ATOM   3643 O  O     . GLU A 1 461 ? -42.60700 -73.19100 -29.40800 1.000 48.35000  ? 449  GLU A O     1 
ATOM   3644 C  CB    . GLU A 1 461 ? -43.90700 -76.16700 -28.38300 1.000 64.68000  ? 449  GLU A CB    1 
ATOM   3645 C  CG    . GLU A 1 461 ? -43.85700 -77.25300 -27.31200 1.000 71.36000  ? 449  GLU A CG    1 
ATOM   3646 C  CD    . GLU A 1 461 ? -43.41900 -78.60300 -27.87300 1.000 89.22000  ? 449  GLU A CD    1 
ATOM   3647 O  OE1   . GLU A 1 461 ? -43.72000 -79.64600 -27.23700 1.000 84.53000  ? 449  GLU A OE1   1 
ATOM   3648 O  OE2   . GLU A 1 461 ? -42.76700 -78.61600 -28.94700 1.000 85.74000  ? 449  GLU A OE2   1 
ATOM   3649 N  N     . THR A 1 462 ? -44.86600 -73.48000 -29.46900 1.000 47.89000  ? 450  THR A N     1 
ATOM   3650 C  CA    . THR A 1 462 ? -45.09600 -72.56400 -30.59200 1.000 45.97000  ? 450  THR A CA    1 
ATOM   3651 C  C     . THR A 1 462 ? -45.05300 -71.08400 -30.21600 1.000 43.31000  ? 450  THR A C     1 
ATOM   3652 O  O     . THR A 1 462 ? -44.88900 -70.22600 -31.07800 1.000 46.00000  ? 450  THR A O     1 
ATOM   3653 C  CB    . THR A 1 462 ? -46.45900 -72.81900 -31.25500 1.000 49.17000  ? 450  THR A CB    1 
ATOM   3654 O  OG1   . THR A 1 462 ? -47.49200 -72.16500 -30.50400 1.000 49.13000  ? 450  THR A OG1   1 
ATOM   3655 C  CG2   . THR A 1 462 ? -46.75500 -74.30400 -31.33100 1.000 52.61000  ? 450  THR A CG2   1 
ATOM   3656 N  N     . LYS A 1 463 ? -45.22800 -70.79400 -28.93300 1.000 45.20000  ? 451  LYS A N     1 
ATOM   3657 C  CA    . LYS A 1 463 ? -45.32300 -69.42700 -28.45100 1.000 42.13000  ? 451  LYS A CA    1 
ATOM   3658 C  C     . LYS A 1 463 ? -46.60900 -68.72900 -28.91900 1.000 45.33000  ? 451  LYS A C     1 
ATOM   3659 O  O     . LYS A 1 463 ? -46.71000 -67.50800 -28.87800 1.000 47.54000  ? 451  LYS A O     1 
ATOM   3660 C  CB    . LYS A 1 463 ? -44.09200 -68.63900 -28.88400 1.000 40.24000  ? 451  LYS A CB    1 
ATOM   3661 C  CG    . LYS A 1 463 ? -43.01900 -68.57500 -27.81300 1.000 51.98000  ? 451  LYS A CG    1 
ATOM   3662 C  CD    . LYS A 1 463 ? -42.53600 -69.97000 -27.40000 1.000 55.00000  ? 451  LYS A CD    1 
ATOM   3663 C  CE    . LYS A 1 463 ? -41.37700 -69.87700 -26.40400 1.000 57.07000  ? 451  LYS A CE    1 
ATOM   3664 N  NZ    . LYS A 1 463 ? -40.66000 -71.17600 -26.18900 1.000 60.77000  ? 451  LYS A NZ    1 
ATOM   3665 N  N     . LEU A 1 464 ? -47.59600 -69.50700 -29.34500 1.000 43.75000  ? 452  LEU A N     1 
ATOM   3666 C  CA    . LEU A 1 464 ? -48.85400 -68.95700 -29.83800 1.000 43.00000  ? 452  LEU A CA    1 
ATOM   3667 C  C     . LEU A 1 464 ? -49.90200 -69.01900 -28.74600 1.000 45.18000  ? 452  LEU A C     1 
ATOM   3668 O  O     . LEU A 1 464 ? -49.82800 -69.87700 -27.86900 1.000 46.91000  ? 452  LEU A O     1 
ATOM   3669 C  CB    . LEU A 1 464 ? -49.34200 -69.71600 -31.07000 1.000 44.07000  ? 452  LEU A CB    1 
ATOM   3670 C  CG    . LEU A 1 464 ? -48.92200 -69.20300 -32.44700 1.000 43.97000  ? 452  LEU A CG    1 
ATOM   3671 C  CD1   . LEU A 1 464 ? -47.43700 -68.82400 -32.49700 1.000 51.11000  ? 452  LEU A CD1   1 
ATOM   3672 C  CD2   . LEU A 1 464 ? -49.23200 -70.26600 -33.48200 1.000 45.25000  ? 452  LEU A CD2   1 
ATOM   3673 N  N     . GLY A 1 465 ? -50.88000 -68.11900 -28.79400 1.000 42.94000  ? 453  GLY A N     1 
ATOM   3674 C  CA    . GLY A 1 465 ? -51.81400 -68.00500 -27.69000 1.000 39.50000  ? 453  GLY A CA    1 
ATOM   3675 C  C     . GLY A 1 465 ? -53.12800 -67.30600 -27.97100 1.000 35.68000  ? 453  GLY A C     1 
ATOM   3676 O  O     . GLY A 1 465 ? -53.35900 -66.78200 -29.05200 1.000 36.27000  ? 453  GLY A O     1 
ATOM   3677 N  N     . LYS A 1 466 ? -54.00000 -67.30000 -26.97200 1.000 32.38000  ? 454  LYS A N     1 
ATOM   3678 C  CA    . LYS A 1 466 ? -55.26700 -66.62200 -27.11400 1.000 35.29000  ? 454  LYS A CA    1 
ATOM   3679 C  C     . LYS A 1 466 ? -55.63500 -65.90800 -25.82400 1.000 35.74000  ? 454  LYS A C     1 
ATOM   3680 O  O     . LYS A 1 466 ? -55.31800 -66.38100 -24.73900 1.000 39.86000  ? 454  LYS A O     1 
ATOM   3681 C  CB    . LYS A 1 466 ? -56.34900 -67.61700 -27.50800 1.000 37.34000  ? 454  LYS A CB    1 
ATOM   3682 C  CG    . LYS A 1 466 ? -56.21400 -68.09900 -28.92900 1.000 33.73000  ? 454  LYS A CG    1 
ATOM   3683 C  CD    . LYS A 1 466 ? -57.41200 -68.94100 -29.29000 1.000 37.70000  ? 454  LYS A CD    1 
ATOM   3684 C  CE    . LYS A 1 466 ? -57.32100 -69.42700 -30.72700 1.000 46.29000  ? 454  LYS A CE    1 
ATOM   3685 N  NZ    . LYS A 1 466 ? -58.32700 -70.49500 -31.02400 1.000 48.26000  ? 454  LYS A NZ    1 
ATOM   3686 N  N     . ALA A 1 467 ? -56.28500 -64.75500 -25.95400 1.000 32.37000  ? 455  ALA A N     1 
ATOM   3687 C  CA    . ALA A 1 467 ? -56.79800 -64.00100 -24.81800 1.000 26.10000  ? 455  ALA A CA    1 
ATOM   3688 C  C     . ALA A 1 467 ? -58.20200 -63.55000 -25.15100 1.000 29.50000  ? 455  ALA A C     1 
ATOM   3689 O  O     . ALA A 1 467 ? -58.46200 -63.18000 -26.29400 1.000 31.38000  ? 455  ALA A O     1 
ATOM   3690 C  CB    . ALA A 1 467 ? -55.92100 -62.81900 -24.52800 1.000 27.97000  ? 455  ALA A CB    1 
ATOM   3691 N  N     . GLY A 1 468 ? -59.10900 -63.56700 -24.17300 1.000 27.81000  ? 456  GLY A N     1 
ATOM   3692 C  CA    . GLY A 1 468 ? -60.47400 -63.14400 -24.43200 1.000 28.33000  ? 456  GLY A CA    1 
ATOM   3693 C  C     . GLY A 1 468 ? -61.39100 -63.08800 -23.22000 1.000 31.27000  ? 456  GLY A C     1 
ATOM   3694 O  O     . GLY A 1 468 ? -60.95600 -63.30100 -22.08500 1.000 29.08000  ? 456  GLY A O     1 
ATOM   3695 N  N     . TYR A 1 469 ? -62.67100 -62.79200 -23.45800 1.000 27.63000  ? 457  TYR A N     1 
ATOM   3696 C  CA    . TYR A 1 469 ? -63.62600 -62.71900 -22.36500 1.000 27.26000  ? 457  TYR A CA    1 
ATOM   3697 C  C     . TYR A 1 469 ? -64.97700 -63.27500 -22.73600 1.000 28.93000  ? 457  TYR A C     1 
ATOM   3698 O  O     . TYR A 1 469 ? -65.24000 -63.61700 -23.87800 1.000 30.50000  ? 457  TYR A O     1 
ATOM   3699 C  CB    . TYR A 1 469 ? -63.80400 -61.28000 -21.86000 1.000 22.49000  ? 457  TYR A CB    1 
ATOM   3700 C  CG    . TYR A 1 469 ? -64.21600 -60.30500 -22.93200 1.000 28.27000  ? 457  TYR A CG    1 
ATOM   3701 C  CD1   . TYR A 1 469 ? -65.51500 -60.28300 -23.41900 1.000 27.65000  ? 457  TYR A CD1   1 
ATOM   3702 C  CD2   . TYR A 1 469 ? -63.29100 -59.39300 -23.46600 1.000 28.84000  ? 457  TYR A CD2   1 
ATOM   3703 C  CE1   . TYR A 1 469 ? -65.88100 -59.38800 -24.40800 1.000 28.20000  ? 457  TYR A CE1   1 
ATOM   3704 C  CE2   . TYR A 1 469 ? -63.65300 -58.50000 -24.44200 1.000 25.96000  ? 457  TYR A CE2   1 
ATOM   3705 C  CZ    . TYR A 1 469 ? -64.95300 -58.49800 -24.91700 1.000 28.68000  ? 457  TYR A CZ    1 
ATOM   3706 O  OH    . TYR A 1 469 ? -65.32400 -57.59900 -25.89500 1.000 28.44000  ? 457  TYR A OH    1 
ATOM   3707 N  N     . VAL A 1 470 ? -65.81700 -63.35400 -21.71400 1.000 31.25000  ? 458  VAL A N     1 
ATOM   3708 C  CA    . VAL A 1 470 ? -67.22000 -63.71200 -21.81000 1.000 27.59000  ? 458  VAL A CA    1 
ATOM   3709 C  C     . VAL A 1 470 ? -67.89700 -62.79200 -20.78600 1.000 29.46000  ? 458  VAL A C     1 
ATOM   3710 O  O     . VAL A 1 470 ? -67.35400 -62.60100 -19.69100 1.000 30.18000  ? 458  VAL A O     1 
ATOM   3711 C  CB    . VAL A 1 470 ? -67.44300 -65.19500 -21.47300 1.000 31.84000  ? 458  VAL A CB    1 
ATOM   3712 C  CG1   . VAL A 1 470 ? -68.50400 -65.34800 -20.41100 1.000 32.94000  ? 458  VAL A CG1   1 
ATOM   3713 C  CG2   . VAL A 1 470 ? -67.78900 -65.99100 -22.70700 1.000 33.62000  ? 458  VAL A CG2   1 
ATOM   3714 N  N     . THR A 1 471 ? -69.02900 -62.18600 -21.12900 1.000 28.08000  ? 459  THR A N     1 
ATOM   3715 C  CA    . THR A 1 471 ? -69.72400 -61.29900 -20.18000 1.000 26.08000  ? 459  THR A CA    1 
ATOM   3716 C  C     . THR A 1 471 ? -71.13600 -61.78500 -19.85800 1.000 27.25000  ? 459  THR A C     1 
ATOM   3717 O  O     . THR A 1 471 ? -71.74200 -62.53300 -20.61800 1.000 26.07000  ? 459  THR A O     1 
ATOM   3718 C  CB    . THR A 1 471 ? -69.84800 -59.86900 -20.71700 1.000 26.51000  ? 459  THR A CB    1 
ATOM   3719 O  OG1   . THR A 1 471 ? -70.94300 -59.80900 -21.65000 1.000 28.95000  ? 459  THR A OG1   1 
ATOM   3720 C  CG2   . THR A 1 471 ? -68.57000 -59.43200 -21.38400 1.000 23.43000  ? 459  THR A CG2   1 
ATOM   3721 N  N     . ASN A 1 472 ? -71.67300 -61.32900 -18.74400 1.000 25.51000  ? 460  ASN A N     1 
ATOM   3722 C  CA    . ASN A 1 472 ? -72.99500 -61.78700 -18.33400 1.000 25.87000  ? 460  ASN A CA    1 
ATOM   3723 C  C     . ASN A 1 472 ? -74.12700 -61.27700 -19.22400 1.000 28.06000  ? 460  ASN A C     1 
ATOM   3724 O  O     . ASN A 1 472 ? -75.27400 -61.67700 -19.04800 1.000 29.26000  ? 460  ASN A O     1 
ATOM   3725 C  CB    . ASN A 1 472 ? -73.27200 -61.35200 -16.90800 1.000 23.25000  ? 460  ASN A CB    1 
ATOM   3726 C  CG    . ASN A 1 472 ? -73.45200 -59.88000 -16.80600 1.000 25.47000  ? 460  ASN A CG    1 
ATOM   3727 O  OD1   . ASN A 1 472 ? -72.52700 -59.12200 -17.06800 1.000 29.13000  ? 460  ASN A OD1   1 
ATOM   3728 N  ND2   . ASN A 1 472 ? -74.64700 -59.45100 -16.44300 1.000 28.88000  ? 460  ASN A ND2   1 
ATOM   3729 N  N     . ARG A 1 473 ? -73.81400 -60.37000 -20.14700 1.000 28.85000  ? 461  ARG A N     1 
ATOM   3730 C  CA    . ARG A 1 473 ? -74.83400 -59.84000 -21.04600 1.000 27.31000  ? 461  ARG A CA    1 
ATOM   3731 C  C     . ARG A 1 473 ? -74.74200 -60.50900 -22.39600 1.000 28.83000  ? 461  ARG A C     1 
ATOM   3732 O  O     . ARG A 1 473 ? -75.42500 -60.11100 -23.33100 1.000 35.67000  ? 461  ARG A O     1 
ATOM   3733 C  CB    . ARG A 1 473 ? -74.70800 -58.33200 -21.22400 1.000 20.83000  ? 461  ARG A CB    1 
ATOM   3734 C  CG    . ARG A 1 473 ? -74.94900 -57.55000 -19.95900 1.000 28.60000  ? 461  ARG A CG    1 
ATOM   3735 C  CD    . ARG A 1 473 ? -74.59800 -56.09300 -20.15200 1.000 28.80000  ? 461  ARG A CD    1 
ATOM   3736 N  NE    . ARG A 1 473 ? -74.73600 -55.34500 -18.91400 1.000 29.25000  ? 461  ARG A NE    1 
ATOM   3737 C  CZ    . ARG A 1 473 ? -74.38500 -54.06700 -18.78800 1.000 32.30000  ? 461  ARG A CZ    1 
ATOM   3738 N  NH1   . ARG A 1 473 ? -73.89500 -53.41200 -19.84100 1.000 29.88000  ? 461  ARG A NH1   1 
ATOM   3739 N  NH2   . ARG A 1 473 ? -74.52700 -53.44600 -17.61800 1.000 32.32000  ? 461  ARG A NH2   1 
ATOM   3740 N  N     . GLY A 1 474 ? -73.88900 -61.51400 -22.49500 1.000 25.92000  ? 462  GLY A N     1 
ATOM   3741 C  CA    . GLY A 1 474 ? -73.84100 -62.32800 -23.68600 1.000 23.33000  ? 462  GLY A CA    1 
ATOM   3742 C  C     . GLY A 1 474 ? -72.71600 -62.02500 -24.64500 1.000 28.05000  ? 462  GLY A C     1 
ATOM   3743 O  O     . GLY A 1 474 ? -72.59900 -62.67800 -25.67700 1.000 37.02000  ? 462  GLY A O     1 
ATOM   3744 N  N     . ARG A 1 475 ? -71.87700 -61.05200 -24.32100 1.000 27.88000  ? 463  ARG A N     1 
ATOM   3745 C  CA    . ARG A 1 475 ? -70.75900 -60.74700 -25.19100 1.000 26.07000  ? 463  ARG A CA    1 
ATOM   3746 C  C     . ARG A 1 475 ? -69.64500 -61.76100 -25.02800 1.000 29.18000  ? 463  ARG A C     1 
ATOM   3747 O  O     . ARG A 1 475 ? -69.38500 -62.25100 -23.93400 1.000 31.91000  ? 463  ARG A O     1 
ATOM   3748 C  CB    . ARG A 1 475 ? -70.21300 -59.35800 -24.89900 1.000 26.35000  ? 463  ARG A CB    1 
ATOM   3749 C  CG    . ARG A 1 475 ? -71.24600 -58.25600 -25.01600 1.000 29.50000  ? 463  ARG A CG    1 
ATOM   3750 C  CD    . ARG A 1 475 ? -70.58200 -56.99200 -25.44800 1.000 27.94000  ? 463  ARG A CD    1 
ATOM   3751 N  NE    . ARG A 1 475 ? -70.20900 -56.15000 -24.32500 1.000 36.14000  ? 463  ARG A NE    1 
ATOM   3752 C  CZ    . ARG A 1 475 ? -69.20900 -55.27600 -24.36800 1.000 30.59000  ? 463  ARG A CZ    1 
ATOM   3753 N  NH1   . ARG A 1 475 ? -68.48100 -55.16300 -25.47000 1.000 28.96000  ? 463  ARG A NH1   1 
ATOM   3754 N  NH2   . ARG A 1 475 ? -68.93400 -54.53300 -23.30900 1.000 27.89000  ? 463  ARG A NH2   1 
ATOM   3755 N  N     . GLN A 1 476 ? -68.96800 -62.06500 -26.12300 1.000 31.50000  ? 464  GLN A N     1 
ATOM   3756 C  CA    . GLN A 1 476 ? -67.76600 -62.86500 -26.05100 1.000 28.94000  ? 464  GLN A CA    1 
ATOM   3757 C  C     . GLN A 1 476 ? -66.84400 -62.42200 -27.15300 1.000 29.50000  ? 464  GLN A C     1 
ATOM   3758 O  O     . GLN A 1 476 ? -67.29100 -62.19000 -28.27000 1.000 33.76000  ? 464  GLN A O     1 
ATOM   3759 C  CB    . GLN A 1 476 ? -68.08300 -64.34600 -26.17600 1.000 36.01000  ? 464  GLN A CB    1 
ATOM   3760 C  CG    . GLN A 1 476 ? -68.23600 -64.84500 -27.59000 1.000 37.73000  ? 464  GLN A CG    1 
ATOM   3761 C  CD    . GLN A 1 476 ? -68.22700 -66.35900 -27.63700 1.000 45.92000  ? 464  GLN A CD    1 
ATOM   3762 O  OE1   . GLN A 1 476 ? -68.91700 -67.01800 -26.85600 1.000 53.00000  ? 464  GLN A OE1   1 
ATOM   3763 N  NE2   . GLN A 1 476 ? -67.42800 -66.91900 -28.53600 1.000 46.61000  ? 464  GLN A NE2   1 
ATOM   3764 N  N     . LYS A 1 477 ? -65.55800 -62.26900 -26.82600 1.000 35.48000  ? 465  LYS A N     1 
ATOM   3765 C  CA    . LYS A 1 477 ? -64.53400 -61.93700 -27.81700 1.000 30.75000  ? 465  LYS A CA    1 
ATOM   3766 C  C     . LYS A 1 477 ? -63.28100 -62.73400 -27.54000 1.000 28.91000  ? 465  LYS A C     1 
ATOM   3767 O  O     . LYS A 1 477 ? -62.94700 -62.96300 -26.39000 1.000 31.38000  ? 465  LYS A O     1 
ATOM   3768 C  CB    . LYS A 1 477 ? -64.20400 -60.44700 -27.80500 1.000 32.37000  ? 465  LYS A CB    1 
ATOM   3769 C  CG    . LYS A 1 477 ? -63.37600 -60.01600 -29.00500 1.000 28.38000  ? 465  LYS A CG    1 
ATOM   3770 C  CD    . LYS A 1 477 ? -62.71400 -58.67300 -28.78000 1.000 33.38000  ? 465  LYS A CD    1 
ATOM   3771 C  CE    . LYS A 1 477 ? -63.58800 -57.52600 -29.25100 1.000 42.31000  ? 465  LYS A CE    1 
ATOM   3772 N  NZ    . LYS A 1 477 ? -62.77300 -56.29900 -29.53200 1.000 45.38000  ? 465  LYS A NZ    1 
ATOM   3773 N  N     . VAL A 1 478 ? -62.58900 -63.15200 -28.59000 1.000 27.03000  ? 466  VAL A N     1 
ATOM   3774 C  CA    . VAL A 1 478 ? -61.36400 -63.90300 -28.42600 1.000 27.96000  ? 466  VAL A CA    1 
ATOM   3775 C  C     . VAL A 1 478 ? -60.32500 -63.30900 -29.34600 1.000 29.86000  ? 466  VAL A C     1 
ATOM   3776 O  O     . VAL A 1 478 ? -60.58000 -63.13900 -30.52600 1.000 37.72000  ? 466  VAL A O     1 
ATOM   3777 C  CB    . VAL A 1 478 ? -61.56100 -65.42200 -28.72800 1.000 26.67000  ? 466  VAL A CB    1 
ATOM   3778 C  CG1   . VAL A 1 478 ? -60.23900 -66.14600 -28.77700 1.000 28.05000  ? 466  VAL A CG1   1 
ATOM   3779 C  CG2   . VAL A 1 478 ? -62.41000 -66.06100 -27.65400 1.000 36.91000  ? 466  VAL A CG2   1 
ATOM   3780 N  N     . VAL A 1 479 ? -59.16100 -62.98100 -28.80200 1.000 27.48000  ? 467  VAL A N     1 
ATOM   3781 C  CA    . VAL A 1 479 ? -58.06300 -62.44200 -29.58800 1.000 28.65000  ? 467  VAL A CA    1 
ATOM   3782 C  C     . VAL A 1 479 ? -56.84100 -63.38200 -29.64300 1.000 34.16000  ? 467  VAL A C     1 
ATOM   3783 O  O     . VAL A 1 479 ? -56.42800 -63.93100 -28.63000 1.000 37.56000  ? 467  VAL A O     1 
ATOM   3784 C  CB    . VAL A 1 479 ? -57.64800 -61.08600 -29.01800 1.000 33.20000  ? 467  VAL A CB    1 
ATOM   3785 C  CG1   . VAL A 1 479 ? -56.25000 -60.71100 -29.46800 1.000 33.64000  ? 467  VAL A CG1   1 
ATOM   3786 C  CG2   . VAL A 1 479 ? -58.67300 -60.02400 -29.41900 1.000 28.23000  ? 467  VAL A CG2   1 
ATOM   3787 N  N     . THR A 1 480 ? -56.25400 -63.56000 -30.82500 1.000 36.95000  ? 468  THR A N     1 
ATOM   3788 C  CA    . THR A 1 480 ? -55.11200 -64.47200 -30.97800 1.000 33.96000  ? 468  THR A CA    1 
ATOM   3789 C  C     . THR A 1 480 ? -53.78900 -63.72400 -30.98400 1.000 35.48000  ? 468  THR A C     1 
ATOM   3790 O  O     . THR A 1 480 ? -53.70900 -62.59200 -31.47000 1.000 38.59000  ? 468  THR A O     1 
ATOM   3791 C  CB    . THR A 1 480 ? -55.21300 -65.32000 -32.27400 1.000 35.12000  ? 468  THR A CB    1 
ATOM   3792 O  OG1   . THR A 1 480 ? -55.11700 -64.46900 -33.42200 1.000 39.15000  ? 468  THR A OG1   1 
ATOM   3793 C  CG2   . THR A 1 480 ? -56.53600 -66.08800 -32.31800 1.000 32.95000  ? 468  THR A CG2   1 
ATOM   3794 N  N     . LEU A 1 481 ? -52.75000 -64.35400 -30.43600 1.000 33.38000  ? 469  LEU A N     1 
ATOM   3795 C  CA    . LEU A 1 481 ? -51.46100 -63.67700 -30.28800 1.000 39.67000  ? 469  LEU A CA    1 
ATOM   3796 C  C     . LEU A 1 481 ? -50.29900 -64.53700 -30.77100 1.000 42.46000  ? 469  LEU A C     1 
ATOM   3797 O  O     . LEU A 1 481 ? -50.45500 -65.74200 -30.98600 1.000 42.32000  ? 469  LEU A O     1 
ATOM   3798 C  CB    . LEU A 1 481 ? -51.23000 -63.29000 -28.83000 1.000 39.82000  ? 469  LEU A CB    1 
ATOM   3799 C  CG    . LEU A 1 481 ? -52.25500 -62.37700 -28.16900 1.000 41.46000  ? 469  LEU A CG    1 
ATOM   3800 C  CD1   . LEU A 1 481 ? -52.08700 -62.41900 -26.67300 1.000 33.57000  ? 469  LEU A CD1   1 
ATOM   3801 C  CD2   . LEU A 1 481 ? -52.06300 -60.97400 -28.67300 1.000 42.66000  ? 469  LEU A CD2   1 
ATOM   3802 N  N     . THR A 1 482 ? -49.13500 -63.91200 -30.93000 1.000 40.35000  ? 470  THR A N     1 
ATOM   3803 C  CA    . THR A 1 482 ? -47.91700 -64.64300 -31.28100 1.000 42.28000  ? 470  THR A CA    1 
ATOM   3804 C  C     . THR A 1 482 ? -46.71300 -64.20500 -30.45700 1.000 46.69000  ? 470  THR A C     1 
ATOM   3805 O  O     . THR A 1 482 ? -46.60700 -63.04100 -30.04300 1.000 45.86000  ? 470  THR A O     1 
ATOM   3806 C  CB    . THR A 1 482 ? -47.54900 -64.45700 -32.74500 1.000 43.34000  ? 470  THR A CB    1 
ATOM   3807 O  OG1   . THR A 1 482 ? -47.18000 -63.08500 -32.95900 1.000 47.22000  ? 470  THR A OG1   1 
ATOM   3808 C  CG2   . THR A 1 482 ? -48.71300 -64.84900 -33.64800 1.000 40.95000  ? 470  THR A CG2   1 
ATOM   3809 N  N     . ASP A 1 483 ? -45.79200 -65.14500 -30.25700 1.000 47.20000  ? 471  ASP A N     1 
ATOM   3810 C  CA    . ASP A 1 483 ? -44.61400 -64.91100 -29.43300 1.000 46.37000  ? 471  ASP A CA    1 
ATOM   3811 C  C     . ASP A 1 483 ? -45.00700 -64.41600 -28.03800 1.000 44.31000  ? 471  ASP A C     1 
ATOM   3812 O  O     . ASP A 1 483 ? -44.53000 -63.38400 -27.56900 1.000 41.24000  ? 471  ASP A O     1 
ATOM   3813 C  CB    . ASP A 1 483 ? -43.68100 -63.90400 -30.10300 1.000 52.00000  ? 471  ASP A CB    1 
ATOM   3814 C  CG    . ASP A 1 483 ? -42.23600 -64.06400 -29.65300 1.000 65.32000  ? 471  ASP A CG    1 
ATOM   3815 O  OD1   . ASP A 1 483 ? -41.97400 -64.81700 -28.68000 1.000 63.05000  ? 471  ASP A OD1   1 
ATOM   3816 O  OD2   . ASP A 1 483 ? -41.35800 -63.43300 -30.27900 1.000 74.76000  ? 471  ASP A OD2   1 
ATOM   3817 N  N     . THR A 1 484 ? -45.87200 -65.16400 -27.37400 1.000 42.66000  ? 472  THR A N     1 
ATOM   3818 C  CA    . THR A 1 484 ? -46.42700 -64.69700 -26.12700 1.000 37.07000  ? 472  THR A CA    1 
ATOM   3819 C  C     . THR A 1 484 ? -46.22700 -65.70900 -24.99900 1.000 38.29000  ? 472  THR A C     1 
ATOM   3820 O  O     . THR A 1 484 ? -45.51700 -66.69200 -25.14400 1.000 41.47000  ? 472  THR A O     1 
ATOM   3821 C  CB    . THR A 1 484 ? -47.91700 -64.38500 -26.29200 1.000 34.78000  ? 472  THR A CB    1 
ATOM   3822 O  OG1   . THR A 1 484 ? -48.36200 -63.62000 -25.17500 1.000 39.19000  ? 472  THR A OG1   1 
ATOM   3823 C  CG2   . THR A 1 484 ? -48.72900 -65.65200 -26.37100 1.000 36.26000  ? 472  THR A CG2   1 
ATOM   3824 N  N     . THR A 1 485 ? -46.85100 -65.45000 -23.86500 1.000 37.32000  ? 473  THR A N     1 
ATOM   3825 C  CA    . THR A 1 485 ? -46.69700 -66.30400 -22.70100 1.000 31.79000  ? 473  THR A CA    1 
ATOM   3826 C  C     . THR A 1 485 ? -47.97700 -66.36200 -21.90700 1.000 33.62000  ? 473  THR A C     1 
ATOM   3827 O  O     . THR A 1 485 ? -48.87000 -65.54000 -22.10200 1.000 39.76000  ? 473  THR A O     1 
ATOM   3828 C  CB    . THR A 1 485 ? -45.63500 -65.78000 -21.77000 1.000 37.52000  ? 473  THR A CB    1 
ATOM   3829 O  OG1   . THR A 1 485 ? -46.23700 -64.80900 -20.89600 1.000 36.92000  ? 473  THR A OG1   1 
ATOM   3830 C  CG2   . THR A 1 485 ? -44.52200 -65.14600 -22.55900 1.000 38.02000  ? 473  THR A CG2   1 
ATOM   3831 N  N     . ASN A 1 486 ? -48.05100 -67.30000 -20.97400 1.000 34.87000  ? 474  ASN A N     1 
ATOM   3832 C  CA    . ASN A 1 486 ? -49.23500 -67.41200 -20.14100 1.000 36.32000  ? 474  ASN A CA    1 
ATOM   3833 C  C     . ASN A 1 486 ? -49.53400 -66.12700 -19.40500 1.000 37.37000  ? 474  ASN A C     1 
ATOM   3834 O  O     . ASN A 1 486 ? -50.64600 -65.59000 -19.51600 1.000 35.58000  ? 474  ASN A O     1 
ATOM   3835 C  CB    . ASN A 1 486 ? -49.09000 -68.55800 -19.15000 1.000 41.04000  ? 474  ASN A CB    1 
ATOM   3836 C  CG    . ASN A 1 486 ? -49.45500 -69.87400 -19.76300 1.000 49.47000  ? 474  ASN A CG    1 
ATOM   3837 O  OD1   . ASN A 1 486 ? -50.61900 -70.30000 -19.71300 1.000 48.77000  ? 474  ASN A OD1   1 
ATOM   3838 N  ND2   . ASN A 1 486 ? -48.47000 -70.52000 -20.39400 1.000 52.56000  ? 474  ASN A ND2   1 
ATOM   3839 N  N     . GLN A 1 487 ? -48.54400 -65.64100 -18.66100 1.000 32.22000  ? 475  GLN A N     1 
ATOM   3840 C  CA    . GLN A 1 487 ? -48.69500 -64.39900 -17.93300 1.000 30.05000  ? 475  GLN A CA    1 
ATOM   3841 C  C     . GLN A 1 487 ? -49.18600 -63.34700 -18.89800 1.000 32.14000  ? 475  GLN A C     1 
ATOM   3842 O  O     . GLN A 1 487 ? -50.20600 -62.71300 -18.66700 1.000 32.47000  ? 475  GLN A O     1 
ATOM   3843 C  CB    . GLN A 1 487 ? -47.38100 -63.96400 -17.28800 1.000 35.92000  ? 475  GLN A CB    1 
ATOM   3844 C  CG    . GLN A 1 487 ? -46.79100 -64.96800 -16.29900 1.000 36.09000  ? 475  GLN A CG    1 
ATOM   3845 C  CD    . GLN A 1 487 ? -46.14500 -66.16200 -16.98600 1.000 41.43000  ? 475  GLN A CD    1 
ATOM   3846 O  OE1   . GLN A 1 487 ? -46.38900 -66.42300 -18.16900 1.000 44.08000  ? 475  GLN A OE1   1 
ATOM   3847 N  NE2   . GLN A 1 487 ? -45.31900 -66.89300 -16.25000 1.000 42.34000  ? 475  GLN A NE2   1 
ATOM   3848 N  N     . LYS A 1 488 ? -48.48500 -63.20200 -20.01600 1.000 33.49000  ? 476  LYS A N     1 
ATOM   3849 C  CA    . LYS A 1 488 ? -48.83500 -62.17000 -20.97600 1.000 32.44000  ? 476  LYS A CA    1 
ATOM   3850 C  C     . LYS A 1 488 ? -50.27600 -62.30400 -21.45800 1.000 32.00000  ? 476  LYS A C     1 
ATOM   3851 O  O     . LYS A 1 488 ? -50.99300 -61.31300 -21.53100 1.000 34.44000  ? 476  LYS A O     1 
ATOM   3852 C  CB    . LYS A 1 488 ? -47.87800 -62.19700 -22.16200 1.000 32.86000  ? 476  LYS A CB    1 
ATOM   3853 C  CG    . LYS A 1 488 ? -46.68300 -61.31000 -21.95800 1.000 30.24000  ? 476  LYS A CG    1 
ATOM   3854 C  CD    . LYS A 1 488 ? -45.47400 -61.81900 -22.71500 1.000 35.10000  ? 476  LYS A CD    1 
ATOM   3855 C  CE    . LYS A 1 488 ? -44.27900 -60.90100 -22.50800 1.000 34.97000  ? 476  LYS A CE    1 
ATOM   3856 N  NZ    . LYS A 1 488 ? -43.43400 -60.79500 -23.72600 1.000 33.57000  ? 476  LYS A NZ    1 
ATOM   3857 N  N     . THR A 1 489 ? -50.71700 -63.51400 -21.76700 1.000 29.49000  ? 477  THR A N     1 
ATOM   3858 C  CA    . THR A 1 489 ? -52.07700 -63.62900 -22.26200 1.000 30.93000  ? 477  THR A CA    1 
ATOM   3859 C  C     . THR A 1 489 ? -53.08400 -63.36300 -21.14500 1.000 32.50000  ? 477  THR A C     1 
ATOM   3860 O  O     . THR A 1 489 ? -54.20700 -62.94600 -21.42300 1.000 34.52000  ? 477  THR A O     1 
ATOM   3861 C  CB    . THR A 1 489 ? -52.36000 -64.99400 -22.89200 1.000 29.54000  ? 477  THR A CB    1 
ATOM   3862 O  OG1   . THR A 1 489 ? -52.49200 -65.99600 -21.86800 1.000 32.65000  ? 477  THR A OG1   1 
ATOM   3863 C  CG2   . THR A 1 489 ? -51.22700 -65.36500 -23.79400 1.000 32.93000  ? 477  THR A CG2   1 
ATOM   3864 N  N     . GLU A 1 490 ? -52.70400 -63.58400 -19.89000 1.000 30.81000  ? 478  GLU A N     1 
ATOM   3865 C  CA    . GLU A 1 490 ? -53.64300 -63.26800 -18.82200 1.000 32.57000  ? 478  GLU A CA    1 
ATOM   3866 C  C     . GLU A 1 490 ? -53.78200 -61.73400 -18.71400 1.000 35.18000  ? 478  GLU A C     1 
ATOM   3867 O  O     . GLU A 1 490 ? -54.87800 -61.20900 -18.51700 1.000 30.20000  ? 478  GLU A O     1 
ATOM   3868 C  CB    . GLU A 1 490 ? -53.20400 -63.88200 -17.49000 1.000 29.13000  ? 478  GLU A CB    1 
ATOM   3869 C  CG    . GLU A 1 490 ? -53.11200 -65.40400 -17.50800 1.000 34.47000  ? 478  GLU A CG    1 
ATOM   3870 C  CD    . GLU A 1 490 ? -54.44400 -66.12500 -17.30000 1.000 34.53000  ? 478  GLU A CD    1 
ATOM   3871 O  OE1   . GLU A 1 490 ? -55.49700 -65.48300 -17.11900 1.000 39.36000  ? 478  GLU A OE1   1 
ATOM   3872 O  OE2   . GLU A 1 490 ? -54.43700 -67.36300 -17.32000 1.000 42.48000  ? 478  GLU A OE2   1 
ATOM   3873 N  N     . LEU A 1 491 ? -52.66100 -61.02800 -18.85700 1.000 32.36000  ? 479  LEU A N     1 
ATOM   3874 C  CA    . LEU A 1 491 ? -52.67200 -59.58000 -18.81100 1.000 27.16000  ? 479  LEU A CA    1 
ATOM   3875 C  C     . LEU A 1 491 ? -53.34400 -59.02600 -20.05600 1.000 34.30000  ? 479  LEU A C     1 
ATOM   3876 O  O     . LEU A 1 491 ? -53.98000 -57.96800 -20.00900 1.000 38.71000  ? 479  LEU A O     1 
ATOM   3877 C  CB    . LEU A 1 491 ? -51.26300 -59.01900 -18.71000 1.000 29.39000  ? 479  LEU A CB    1 
ATOM   3878 C  CG    . LEU A 1 491 ? -50.60300 -58.86500 -17.35500 1.000 26.09000  ? 479  LEU A CG    1 
ATOM   3879 C  CD1   . LEU A 1 491 ? -49.18600 -58.40100 -17.58300 1.000 21.97000  ? 479  LEU A CD1   1 
ATOM   3880 C  CD2   . LEU A 1 491 ? -51.37100 -57.85600 -16.56000 1.000 22.37000  ? 479  LEU A CD2   1 
ATOM   3881 N  N     . GLN A 1 492 ? -53.18600 -59.72400 -21.18100 1.000 30.58000  ? 480  GLN A N     1 
ATOM   3882 C  CA    . GLN A 1 492 ? -53.83700 -59.28900 -22.40500 1.000 29.81000  ? 480  GLN A CA    1 
ATOM   3883 C  C     . GLN A 1 492 ? -55.37600 -59.37200 -22.28300 1.000 33.28000  ? 480  GLN A C     1 
ATOM   3884 O  O     . GLN A 1 492 ? -56.08900 -58.44900 -22.69400 1.000 32.83000  ? 480  GLN A O     1 
ATOM   3885 C  CB    . GLN A 1 492 ? -53.33900 -60.10800 -23.58800 1.000 27.07000  ? 480  GLN A CB    1 
ATOM   3886 C  CG    . GLN A 1 492 ? -51.92900 -59.74800 -24.02800 1.000 26.83000  ? 480  GLN A CG    1 
ATOM   3887 C  CD    . GLN A 1 492 ? -51.87200 -58.53100 -24.97200 1.000 32.40000  ? 480  GLN A CD    1 
ATOM   3888 O  OE1   . GLN A 1 492 ? -52.88600 -57.87000 -25.24000 1.000 33.85000  ? 480  GLN A OE1   1 
ATOM   3889 N  NE2   . GLN A 1 492 ? -50.67700 -58.24100 -25.48100 1.000 35.06000  ? 480  GLN A NE2   1 
ATOM   3890 N  N     . ALA A 1 493 ? -55.87500 -60.45900 -21.70000 1.000 33.35000  ? 481  ALA A N     1 
ATOM   3891 C  CA    . ALA A 1 493 ? -57.31500 -60.63600 -21.50700 1.000 31.77000  ? 481  ALA A CA    1 
ATOM   3892 C  C     . ALA A 1 493 ? -57.90500 -59.49200 -20.70100 1.000 31.49000  ? 481  ALA A C     1 
ATOM   3893 O  O     . ALA A 1 493 ? -59.03400 -59.04500 -20.94000 1.000 33.07000  ? 481  ALA A O     1 
ATOM   3894 C  CB    . ALA A 1 493 ? -57.61100 -61.96900 -20.80300 1.000 26.08000  ? 481  ALA A CB    1 
ATOM   3895 N  N     . ILE A 1 494 ? -57.14300 -59.02700 -19.72900 1.000 29.77000  ? 482  ILE A N     1 
ATOM   3896 C  CA    . ILE A 1 494 ? -57.65900 -58.02800 -18.82400 1.000 26.41000  ? 482  ILE A CA    1 
ATOM   3897 C  C     . ILE A 1 494 ? -57.75100 -56.70900 -19.56500 1.000 25.88000  ? 482  ILE A C     1 
ATOM   3898 O  O     . ILE A 1 494 ? -58.73300 -56.00600 -19.43800 1.000 27.23000  ? 482  ILE A O     1 
ATOM   3899 C  CB    . ILE A 1 494 ? -56.77200 -57.90700 -17.57000 1.000 26.32000  ? 482  ILE A CB    1 
ATOM   3900 C  CG1   . ILE A 1 494 ? -57.13800 -59.01500 -16.58000 1.000 21.67000  ? 482  ILE A CG1   1 
ATOM   3901 C  CG2   . ILE A 1 494 ? -56.90000 -56.53300 -16.93400 1.000 21.75000  ? 482  ILE A CG2   1 
ATOM   3902 C  CD1   . ILE A 1 494 ? -56.31000 -58.97600 -15.31700 1.000 24.28000  ? 482  ILE A CD1   1 
ATOM   3903 N  N     . TYR A 1 495 ? -56.72200 -56.41300 -20.35800 1.000 29.95000  ? 483  TYR A N     1 
ATOM   3904 C  CA    . TYR A 1 495 ? -56.62100 -55.16600 -21.10500 1.000 26.60000  ? 483  TYR A CA    1 
ATOM   3905 C  C     . TYR A 1 495 ? -57.79500 -55.12100 -22.04800 1.000 26.99000  ? 483  TYR A C     1 
ATOM   3906 O  O     . TYR A 1 495 ? -58.45700 -54.10700 -22.22200 1.000 27.67000  ? 483  TYR A O     1 
ATOM   3907 C  CB    . TYR A 1 495 ? -55.28900 -55.10800 -21.86900 1.000 22.46000  ? 483  TYR A CB    1 
ATOM   3908 C  CG    . TYR A 1 495 ? -55.08000 -53.89000 -22.73600 1.000 24.86000  ? 483  TYR A CG    1 
ATOM   3909 C  CD1   . TYR A 1 495 ? -55.16500 -52.60400 -22.20900 1.000 29.36000  ? 483  TYR A CD1   1 
ATOM   3910 C  CD2   . TYR A 1 495 ? -54.74700 -54.01600 -24.07200 1.000 29.90000  ? 483  TYR A CD2   1 
ATOM   3911 C  CE1   . TYR A 1 495 ? -54.94800 -51.48600 -23.00500 1.000 31.60000  ? 483  TYR A CE1   1 
ATOM   3912 C  CE2   . TYR A 1 495 ? -54.52600 -52.91000 -24.87900 1.000 27.41000  ? 483  TYR A CE2   1 
ATOM   3913 C  CZ    . TYR A 1 495 ? -54.63400 -51.65400 -24.34400 1.000 34.23000  ? 483  TYR A CZ    1 
ATOM   3914 O  OH    . TYR A 1 495 ? -54.41700 -50.55700 -25.15400 1.000 41.32000  ? 483  TYR A OH    1 
ATOM   3915 N  N     . LEU A 1 496 ? -58.05200 -56.27700 -22.63400 1.000 28.86000  ? 484  LEU A N     1 
ATOM   3916 C  CA    . LEU A 1 496 ? -59.13300 -56.43100 -23.57700 1.000 29.00000  ? 484  LEU A CA    1 
ATOM   3917 C  C     . LEU A 1 496 ? -60.47900 -56.10200 -22.92300 1.000 30.93000  ? 484  LEU A C     1 
ATOM   3918 O  O     . LEU A 1 496 ? -61.34600 -55.49200 -23.54800 1.000 30.85000  ? 484  LEU A O     1 
ATOM   3919 C  CB    . LEU A 1 496 ? -59.11000 -57.85200 -24.12700 1.000 26.90000  ? 484  LEU A CB    1 
ATOM   3920 C  CG    . LEU A 1 496 ? -59.97600 -58.16200 -25.32900 1.000 35.55000  ? 484  LEU A CG    1 
ATOM   3921 C  CD1   . LEU A 1 496 ? -59.76200 -57.12600 -26.41300 1.000 36.26000  ? 484  LEU A CD1   1 
ATOM   3922 C  CD2   . LEU A 1 496 ? -59.63500 -59.54600 -25.83200 1.000 30.81000  ? 484  LEU A CD2   1 
ATOM   3923 N  N     . ALA A 1 497 ? -60.65400 -56.47700 -21.65600 1.000 27.10000  ? 485  ALA A N     1 
ATOM   3924 C  CA    . ALA A 1 497 ? -61.95500 -56.26000 -21.02800 1.000 24.99000  ? 485  ALA A CA    1 
ATOM   3925 C  C     . ALA A 1 497 ? -62.10300 -54.79500 -20.63400 1.000 25.18000  ? 485  ALA A C     1 
ATOM   3926 O  O     . ALA A 1 497 ? -63.20400 -54.25700 -20.59100 1.000 24.37000  ? 485  ALA A O     1 
ATOM   3927 C  CB    . ALA A 1 497 ? -62.13100 -57.16000 -19.85000 1.000 19.23000  ? 485  ALA A CB    1 
ATOM   3928 N  N     . LEU A 1 498 ? -60.98500 -54.14700 -20.36300 1.000 22.31000  ? 486  LEU A N     1 
ATOM   3929 C  CA    . LEU A 1 498 ? -61.02200 -52.73600 -20.04200 1.000 25.30000  ? 486  LEU A CA    1 
ATOM   3930 C  C     . LEU A 1 498 ? -61.35600 -51.91800 -21.27800 1.000 26.15000  ? 486  LEU A C     1 
ATOM   3931 O  O     . LEU A 1 498 ? -62.07400 -50.93000 -21.19200 1.000 21.12000  ? 486  LEU A O     1 
ATOM   3932 C  CB    . LEU A 1 498 ? -59.69100 -52.28400 -19.46200 1.000 24.04000  ? 486  LEU A CB    1 
ATOM   3933 C  CG    . LEU A 1 498 ? -59.39600 -52.80500 -18.06700 1.000 22.15000  ? 486  LEU A CG    1 
ATOM   3934 C  CD1   . LEU A 1 498 ? -57.96600 -52.49900 -17.73700 1.000 22.57000  ? 486  LEU A CD1   1 
ATOM   3935 C  CD2   . LEU A 1 498 ? -60.34300 -52.12900 -17.07400 1.000 21.33000  ? 486  LEU A CD2   1 
ATOM   3936 N  N     . GLN A 1 499 ? -60.81700 -52.35600 -22.41300 1.000 24.94000  ? 487  GLN A N     1 
ATOM   3937 C  CA    . GLN A 1 499 ? -61.02300 -51.71300 -23.69800 1.000 23.45000  ? 487  GLN A CA    1 
ATOM   3938 C  C     . GLN A 1 499 ? -62.47600 -51.75100 -24.15600 1.000 29.52000  ? 487  GLN A C     1 
ATOM   3939 O  O     . GLN A 1 499 ? -63.00100 -50.75600 -24.65500 1.000 30.56000  ? 487  GLN A O     1 
ATOM   3940 C  CB    . GLN A 1 499 ? -60.16000 -52.36900 -24.75500 1.000 20.89000  ? 487  GLN A CB    1 
ATOM   3941 C  CG    . GLN A 1 499 ? -58.98800 -51.53300 -25.17300 1.000 31.98000  ? 487  GLN A CG    1 
ATOM   3942 C  CD    . GLN A 1 499 ? -57.97000 -52.34700 -25.93500 1.000 35.82000  ? 487  GLN A CD    1 
ATOM   3943 O  OE1   . GLN A 1 499 ? -57.87800 -53.55700 -25.73900 1.000 35.54000  ? 487  GLN A OE1   1 
ATOM   3944 N  NE2   . GLN A 1 499 ? -57.20000 -51.69700 -26.80300 1.000 32.05000  ? 487  GLN A NE2   1 
ATOM   3945 N  N     . ASP A 1 500 ? -63.12000 -52.90200 -23.99400 1.000 27.46000  ? 488  ASP A N     1 
ATOM   3946 C  CA    . ASP A 1 500 ? -64.48600 -53.06900 -24.45100 1.000 24.15000  ? 488  ASP A CA    1 
ATOM   3947 C  C     . ASP A 1 500 ? -65.54500 -52.82400 -23.37500 1.000 28.29000  ? 488  ASP A C     1 
ATOM   3948 O  O     . ASP A 1 500 ? -66.72300 -52.99300 -23.63000 1.000 36.91000  ? 488  ASP A O     1 
ATOM   3949 C  CB    . ASP A 1 500 ? -64.66600 -54.46500 -25.01600 1.000 25.54000  ? 488  ASP A CB    1 
ATOM   3950 C  CG    . ASP A 1 500 ? -63.69300 -54.76400 -26.12300 1.000 32.60000  ? 488  ASP A CG    1 
ATOM   3951 O  OD1   . ASP A 1 500 ? -62.96300 -53.84600 -26.52500 1.000 31.45000  ? 488  ASP A OD1   1 
ATOM   3952 O  OD2   . ASP A 1 500 ? -63.66900 -55.91300 -26.60500 1.000 35.79000  ? 488  ASP A OD2   1 
ATOM   3953 N  N     . SER A 1 501 ? -65.15200 -52.43800 -22.17900 1.000 25.31000  ? 489  SER A N     1 
ATOM   3954 C  CA    . SER A 1 501 ? -66.13800 -52.24400 -21.12600 1.000 26.89000  ? 489  SER A CA    1 
ATOM   3955 C  C     . SER A 1 501 ? -66.56400 -50.80000 -21.09800 1.000 30.48000  ? 489  SER A C     1 
ATOM   3956 O  O     . SER A 1 501 ? -66.01200 -49.98800 -21.83600 1.000 30.50000  ? 489  SER A O     1 
ATOM   3957 C  CB    . SER A 1 501 ? -65.58000 -52.64300 -19.75900 1.000 29.03000  ? 489  SER A CB    1 
ATOM   3958 O  OG    . SER A 1 501 ? -64.40400 -51.90500 -19.45400 1.000 30.83000  ? 489  SER A OG    1 
ATOM   3959 N  N     . GLY A 1 502 ? -67.53800 -50.48300 -20.23600 1.000 32.14000  ? 490  GLY A N     1 
ATOM   3960 C  CA    . GLY A 1 502 ? -68.01700 -49.11900 -20.06600 1.000 20.09000  ? 490  GLY A CA    1 
ATOM   3961 C  C     . GLY A 1 502 ? -67.15200 -48.41700 -19.05400 1.000 25.97000  ? 490  GLY A C     1 
ATOM   3962 O  O     . GLY A 1 502 ? -66.01200 -48.81300 -18.83300 1.000 30.16000  ? 490  GLY A O     1 
ATOM   3963 N  N     . LEU A 1 503 ? -67.68500 -47.38000 -18.42600 1.000 25.31000  ? 491  LEU A N     1 
ATOM   3964 C  CA    . LEU A 1 503 ? -66.92300 -46.63300 -17.44000 1.000 21.59000  ? 491  LEU A CA    1 
ATOM   3965 C  C     . LEU A 1 503 ? -66.93300 -47.35700 -16.10900 1.000 26.26000  ? 491  LEU A C     1 
ATOM   3966 O  O     . LEU A 1 503 ? -66.22900 -46.97500 -15.16300 1.000 31.29000  ? 491  LEU A O     1 
ATOM   3967 C  CB    . LEU A 1 503 ? -67.48500 -45.22700 -17.26300 1.000 21.16000  ? 491  LEU A CB    1 
ATOM   3968 C  CG    . LEU A 1 503 ? -67.22400 -44.19200 -18.36200 1.000 23.77000  ? 491  LEU A CG    1 
ATOM   3969 C  CD1   . LEU A 1 503 ? -67.95300 -42.90300 -18.02300 1.000 20.52000  ? 491  LEU A CD1   1 
ATOM   3970 C  CD2   . LEU A 1 503 ? -65.70500 -43.92900 -18.56900 1.000 22.16000  ? 491  LEU A CD2   1 
ATOM   3971 N  N     . GLU A 1 504 ? -67.74600 -48.39600 -16.03400 1.000 24.57000  ? 492  GLU A N     1 
ATOM   3972 C  CA    . GLU A 1 504 ? -67.80800 -49.20500 -14.83500 1.000 22.90000  ? 492  GLU A CA    1 
ATOM   3973 C  C     . GLU A 1 504 ? -67.80800 -50.66800 -15.22300 1.000 24.14000  ? 492  GLU A C     1 
ATOM   3974 O  O     . GLU A 1 504 ? -68.66800 -51.09700 -15.99400 1.000 26.72000  ? 492  GLU A O     1 
ATOM   3975 C  CB    . GLU A 1 504 ? -69.04200 -48.84400 -14.03000 1.000 17.41000  ? 492  GLU A CB    1 
ATOM   3976 C  CG    . GLU A 1 504 ? -69.02300 -47.37000 -13.65100 1.000 24.41000  ? 492  GLU A CG    1 
ATOM   3977 C  CD    . GLU A 1 504 ? -70.22400 -46.91800 -12.81400 1.000 39.44000  ? 492  GLU A CD    1 
ATOM   3978 O  OE1   . GLU A 1 504 ? -70.31500 -45.69200 -12.52100 1.000 42.47000  ? 492  GLU A OE1   1 
ATOM   3979 O  OE2   . GLU A 1 504 ? -71.07500 -47.77200 -12.45600 1.000 42.41000  ? 492  GLU A OE2   1 
ATOM   3980 N  N     . VAL A 1 505 ? -66.83400 -51.43000 -14.70900 1.000 21.97000  ? 493  VAL A N     1 
ATOM   3981 C  CA    . VAL A 1 505 ? -66.70500 -52.83200 -15.07400 1.000 18.95000  ? 493  VAL A CA    1 
ATOM   3982 C  C     . VAL A 1 505 ? -66.33500 -53.74900 -13.89000 1.000 21.59000  ? 493  VAL A C     1 
ATOM   3983 O  O     . VAL A 1 505 ? -65.56400 -53.37100 -13.00100 1.000 23.73000  ? 493  VAL A O     1 
ATOM   3984 C  CB    . VAL A 1 505 ? -65.65600 -52.98600 -16.18700 1.000 21.36000  ? 493  VAL A CB    1 
ATOM   3985 C  CG1   . VAL A 1 505 ? -64.29000 -52.56400 -15.69200 1.000 17.79000  ? 493  VAL A CG1   1 
ATOM   3986 C  CG2   . VAL A 1 505 ? -65.65000 -54.40400 -16.74900 1.000 22.03000  ? 493  VAL A CG2   1 
ATOM   3987 N  N     . ASN A 1 506 ? -66.91800 -54.94100 -13.86600 1.000 21.22000  ? 494  ASN A N     1 
ATOM   3988 C  CA    . ASN A 1 506 ? -66.50800 -55.99400 -12.95700 1.000 18.42000  ? 494  ASN A CA    1 
ATOM   3989 C  C     . ASN A 1 506 ? -65.64300 -56.96600 -13.75600 1.000 20.55000  ? 494  ASN A C     1 
ATOM   3990 O  O     . ASN A 1 506 ? -66.04600 -57.44500 -14.81400 1.000 20.63000  ? 494  ASN A O     1 
ATOM   3991 C  CB    . ASN A 1 506 ? -67.72900 -56.74400 -12.36000 1.000 18.38000  ? 494  ASN A CB    1 
ATOM   3992 C  CG    . ASN A 1 506 ? -68.56000 -55.88600 -11.39700 1.000 23.74000  ? 494  ASN A CG    1 
ATOM   3993 O  OD1   . ASN A 1 506 ? -68.05500 -55.34900 -10.40200 1.000 24.72000  ? 494  ASN A OD1   1 
ATOM   3994 N  ND2   . ASN A 1 506 ? -69.86200 -55.78600 -11.68300 1.000 22.12000  ? 494  ASN A ND2   1 
ATOM   3995 N  N     . ILE A 1 507 ? -64.45900 -57.27900 -13.27000 1.000 21.45000  ? 495  ILE A N     1 
ATOM   3996 C  CA    . ILE A 1 507 ? -63.62400 -58.22700 -13.99200 1.000 21.63000  ? 495  ILE A CA    1 
ATOM   3997 C  C     . ILE A 1 507 ? -63.22900 -59.40800 -13.11400 1.000 28.47000  ? 495  ILE A C     1 
ATOM   3998 O  O     . ILE A 1 507 ? -62.75200 -59.22900 -11.97700 1.000 27.77000  ? 495  ILE A O     1 
ATOM   3999 C  CB    . ILE A 1 507 ? -62.36800 -57.55600 -14.50500 1.000 21.86000  ? 495  ILE A CB    1 
ATOM   4000 C  CG1   . ILE A 1 507 ? -62.76100 -56.28000 -15.25900 1.000 20.06000  ? 495  ILE A CG1   1 
ATOM   4001 C  CG2   . ILE A 1 507 ? -61.55500 -58.54500 -15.33700 1.000 22.13000  ? 495  ILE A CG2   1 
ATOM   4002 C  CD1   . ILE A 1 507 ? -61.65700 -55.64100 -16.01300 1.000 18.73000  ? 495  ILE A CD1   1 
ATOM   4003 N  N     . VAL A 1 508 ? -63.43100 -60.61200 -13.63800 1.000 27.27000  ? 496  VAL A N     1 
ATOM   4004 C  CA    . VAL A 1 508 ? -63.12200 -61.82100 -12.88500 1.000 26.02000  ? 496  VAL A CA    1 
ATOM   4005 C  C     . VAL A 1 508 ? -62.05500 -62.62300 -13.59200 1.000 28.12000  ? 496  VAL A C     1 
ATOM   4006 O  O     . VAL A 1 508 ? -62.22200 -63.04300 -14.74900 1.000 26.36000  ? 496  VAL A O     1 
ATOM   4007 C  CB    . VAL A 1 508 ? -64.35100 -62.69600 -12.68800 1.000 24.13000  ? 496  VAL A CB    1 
ATOM   4008 C  CG1   . VAL A 1 508 ? -63.93300 -63.96400 -12.01300 1.000 24.88000  ? 496  VAL A CG1   1 
ATOM   4009 C  CG2   . VAL A 1 508 ? -65.38100 -61.95800 -11.84300 1.000 22.62000  ? 496  VAL A CG2   1 
ATOM   4010 N  N     . THR A 1 509 ? -60.95000 -62.82800 -12.88900 1.000 26.51000  ? 497  THR A N     1 
ATOM   4011 C  CA    . THR A 1 509 ? -59.80600 -63.53300 -13.45600 1.000 29.25000  ? 497  THR A CA    1 
ATOM   4012 C  C     . THR A 1 509 ? -59.38600 -64.69300 -12.54000 1.000 29.45000  ? 497  THR A C     1 
ATOM   4013 O  O     . THR A 1 509 ? -59.71500 -64.70500 -11.34200 1.000 30.27000  ? 497  THR A O     1 
ATOM   4014 C  CB    . THR A 1 509 ? -58.62100 -62.56000 -13.67800 1.000 24.78000  ? 497  THR A CB    1 
ATOM   4015 O  OG1   . THR A 1 509 ? -57.43900 -63.29400 -13.99100 1.000 30.31000  ? 497  THR A OG1   1 
ATOM   4016 C  CG2   . THR A 1 509 ? -58.35100 -61.78500 -12.43500 1.000 25.77000  ? 497  THR A CG2   1 
ATOM   4017 N  N     . ASP A 1 510 ? -58.67800 -65.67600 -13.09400 1.000 27.30000  ? 498  ASP A N     1 
ATOM   4018 C  CA    . ASP A 1 510 ? -58.10400 -66.72400 -12.25600 1.000 28.57000  ? 498  ASP A CA    1 
ATOM   4019 C  C     . ASP A 1 510 ? -56.58300 -66.62700 -12.13000 1.000 30.84000  ? 498  ASP A C     1 
ATOM   4020 O  O     . ASP A 1 510 ? -55.94800 -67.56100 -11.65200 1.000 36.79000  ? 498  ASP A O     1 
ATOM   4021 C  CB    . ASP A 1 510 ? -58.49000 -68.10100 -12.78100 1.000 30.17000  ? 498  ASP A CB    1 
ATOM   4022 C  CG    . ASP A 1 510 ? -57.91900 -68.40800 -14.15600 1.000 34.80000  ? 498  ASP A CG    1 
ATOM   4023 O  OD1   . ASP A 1 510 ? -56.82500 -67.91500 -14.50700 1.000 35.12000  ? 498  ASP A OD1   1 
ATOM   4024 O  OD2   . ASP A 1 510 ? -58.57800 -69.18100 -14.89200 1.000 41.00000  ? 498  ASP A OD2   1 
ATOM   4025 N  N     . SER A 1 511 ? -56.01400 -65.50200 -12.55500 1.000 28.85000  ? 499  SER A N     1 
ATOM   4026 C  CA    . SER A 1 511 ? -54.56600 -65.32800 -12.64800 1.000 30.77000  ? 499  SER A CA    1 
ATOM   4027 C  C     . SER A 1 511 ? -53.96600 -64.63700 -11.41400 1.000 29.11000  ? 499  SER A C     1 
ATOM   4028 O  O     . SER A 1 511 ? -54.11100 -63.43700 -11.23800 1.000 25.91000  ? 499  SER A O     1 
ATOM   4029 C  CB    . SER A 1 511 ? -54.23300 -64.52400 -13.92200 1.000 30.16000  ? 499  SER A CB    1 
ATOM   4030 O  OG    . SER A 1 511 ? -52.84900 -64.21300 -14.02100 1.000 34.16000  ? 499  SER A OG    1 
ATOM   4031 N  N     . GLN A 1 512 ? -53.28700 -65.39600 -10.56100 1.000 34.21000  ? 500  GLN A N     1 
ATOM   4032 C  CA    . GLN A 1 512 ? -52.67600 -64.80100 -9.36200  1.000 35.68000  ? 500  GLN A CA    1 
ATOM   4033 C  C     . GLN A 1 512 ? -51.65000 -63.74700 -9.73200  1.000 33.02000  ? 500  GLN A C     1 
ATOM   4034 O  O     . GLN A 1 512 ? -51.59600 -62.67700 -9.11500  1.000 31.43000  ? 500  GLN A O     1 
ATOM   4035 C  CB    . GLN A 1 512 ? -52.01700 -65.86600 -8.49900  1.000 40.13000  ? 500  GLN A CB    1 
ATOM   4036 C  CG    . GLN A 1 512 ? -52.95600 -66.52000 -7.52100  1.000 45.69000  ? 500  GLN A CG    1 
ATOM   4037 C  CD    . GLN A 1 512 ? -52.29200 -67.64200 -6.75500  1.000 49.89000  ? 500  GLN A CD    1 
ATOM   4038 O  OE1   . GLN A 1 512 ? -52.53100 -68.82200 -7.03500  1.000 49.33000  ? 500  GLN A OE1   1 
ATOM   4039 N  NE2   . GLN A 1 512 ? -51.45000 -67.28200 -5.77800  1.000 48.11000  ? 500  GLN A NE2   1 
ATOM   4040 N  N     . TYR A 1 513 ? -50.84100 -64.07500 -10.74000 1.000 28.13000  ? 501  TYR A N     1 
ATOM   4041 C  CA    . TYR A 1 513 ? -49.90200 -63.14200 -11.33300 1.000 29.75000  ? 501  TYR A CA    1 
ATOM   4042 C  C     . TYR A 1 513 ? -50.53500 -61.79000 -11.62900 1.000 32.96000  ? 501  TYR A C     1 
ATOM   4043 O  O     . TYR A 1 513 ? -50.10500 -60.76700 -11.08500 1.000 36.71000  ? 501  TYR A O     1 
ATOM   4044 C  CB    . TYR A 1 513 ? -49.33000 -63.72300 -12.62600 1.000 33.73000  ? 501  TYR A CB    1 
ATOM   4045 C  CG    . TYR A 1 513 ? -48.50600 -62.74300 -13.42500 1.000 30.73000  ? 501  TYR A CG    1 
ATOM   4046 C  CD1   . TYR A 1 513 ? -47.22500 -62.38000 -13.01300 1.000 31.04000  ? 501  TYR A CD1   1 
ATOM   4047 C  CD2   . TYR A 1 513 ? -49.00300 -62.18400 -14.59500 1.000 30.86000  ? 501  TYR A CD2   1 
ATOM   4048 C  CE1   . TYR A 1 513 ? -46.45100 -61.47700 -13.74800 1.000 31.73000  ? 501  TYR A CE1   1 
ATOM   4049 C  CE2   . TYR A 1 513 ? -48.24000 -61.28100 -15.33800 1.000 34.45000  ? 501  TYR A CE2   1 
ATOM   4050 C  CZ    . TYR A 1 513 ? -46.96000 -60.93100 -14.90600 1.000 33.98000  ? 501  TYR A CZ    1 
ATOM   4051 O  OH    . TYR A 1 513 ? -46.20400 -60.03400 -15.63300 1.000 32.94000  ? 501  TYR A OH    1 
ATOM   4052 N  N     . ALA A 1 514 ? -51.56000 -61.79200 -12.48400 1.000 32.59000  ? 502  ALA A N     1 
ATOM   4053 C  CA    . ALA A 1 514 ? -52.19000 -60.54600 -12.93600 1.000 29.18000  ? 502  ALA A CA    1 
ATOM   4054 C  C     . ALA A 1 514 ? -52.83300 -59.75200 -11.80100 1.000 29.47000  ? 502  ALA A C     1 
ATOM   4055 O  O     . ALA A 1 514 ? -52.78200 -58.52600 -11.78700 1.000 32.47000  ? 502  ALA A O     1 
ATOM   4056 C  CB    . ALA A 1 514 ? -53.20600 -60.84100 -13.97400 1.000 25.98000  ? 502  ALA A CB    1 
ATOM   4057 N  N     . LEU A 1 515 ? -53.44300 -60.46900 -10.86600 1.000 29.72000  ? 503  LEU A N     1 
ATOM   4058 C  CA    . LEU A 1 515 ? -54.16900 -59.85500 -9.77400  1.000 32.12000  ? 503  LEU A CA    1 
ATOM   4059 C  C     . LEU A 1 515 ? -53.22300 -59.19600 -8.78400  1.000 35.70000  ? 503  LEU A C     1 
ATOM   4060 O  O     . LEU A 1 515 ? -53.57400 -58.18500 -8.16500  1.000 35.29000  ? 503  LEU A O     1 
ATOM   4061 C  CB    . LEU A 1 515 ? -55.02300 -60.89800 -9.05600  1.000 33.70000  ? 503  LEU A CB    1 
ATOM   4062 C  CG    . LEU A 1 515 ? -55.61700 -60.41500 -7.74200  1.000 35.75000  ? 503  LEU A CG    1 
ATOM   4063 C  CD1   . LEU A 1 515 ? -57.11300 -60.36800 -7.89700  1.000 34.98000  ? 503  LEU A CD1   1 
ATOM   4064 C  CD2   . LEU A 1 515 ? -55.20000 -61.34700 -6.60000  1.000 32.93000  ? 503  LEU A CD2   1 
ATOM   4065 N  N     . GLY A 1 516 ? -52.03100 -59.78200 -8.63600  1.000 32.92000  ? 504  GLY A N     1 
ATOM   4066 C  CA    . GLY A 1 516 ? -51.01700 -59.25200 -7.74400  1.000 28.85000  ? 504  GLY A CA    1 
ATOM   4067 C  C     . GLY A 1 516 ? -50.37100 -57.96600 -8.23500  1.000 28.69000  ? 504  GLY A C     1 
ATOM   4068 O  O     . GLY A 1 516 ? -50.05500 -57.06900 -7.45000  1.000 31.74000  ? 504  GLY A O     1 
ATOM   4069 N  N     . ILE A 1 517 ? -50.17300 -57.86100 -9.54300  1.000 29.68000  ? 505  ILE A N     1 
ATOM   4070 C  CA    . ILE A 1 517 ? -49.69900 -56.60500 -10.12100 1.000 32.79000  ? 505  ILE A CA    1 
ATOM   4071 C  C     . ILE A 1 517 ? -50.71600 -55.47000 -9.97700  1.000 32.59000  ? 505  ILE A C     1 
ATOM   4072 O  O     . ILE A 1 517 ? -50.44600 -54.46600 -9.32100  1.000 33.00000  ? 505  ILE A O     1 
ATOM   4073 C  CB    . ILE A 1 517 ? -49.36500 -56.76900 -11.60100 1.000 27.33000  ? 505  ILE A CB    1 
ATOM   4074 C  CG1   . ILE A 1 517 ? -48.03300 -57.49900 -11.73800 1.000 27.05000  ? 505  ILE A CG1   1 
ATOM   4075 C  CG2   . ILE A 1 517 ? -49.30300 -55.41300 -12.27800 1.000 26.63000  ? 505  ILE A CG2   1 
ATOM   4076 C  CD1   . ILE A 1 517 ? -47.82300 -58.09900 -13.09900 1.000 31.70000  ? 505  ILE A CD1   1 
ATOM   4077 N  N     . ILE A 1 518 ? -51.88200 -55.65500 -10.58700 1.000 27.19000  ? 506  ILE A N     1 
ATOM   4078 C  CA    . ILE A 1 518 ? -52.92700 -54.65100 -10.60300 1.000 26.06000  ? 506  ILE A CA    1 
ATOM   4079 C  C     . ILE A 1 518 ? -53.40200 -54.22600 -9.22100  1.000 30.25000  ? 506  ILE A C     1 
ATOM   4080 O  O     . ILE A 1 518 ? -53.71500 -53.06400 -9.00200  1.000 29.50000  ? 506  ILE A O     1 
ATOM   4081 C  CB    . ILE A 1 518 ? -54.14300 -55.15300 -11.38700 1.000 27.82000  ? 506  ILE A CB    1 
ATOM   4082 C  CG1   . ILE A 1 518 ? -53.73400 -55.50000 -12.81200 1.000 25.25000  ? 506  ILE A CG1   1 
ATOM   4083 C  CG2   . ILE A 1 518 ? -55.21200 -54.10000 -11.41500 1.000 26.74000  ? 506  ILE A CG2   1 
ATOM   4084 C  CD1   . ILE A 1 518 ? -54.83300 -56.05700 -13.61500 1.000 25.38000  ? 506  ILE A CD1   1 
ATOM   4085 N  N     . GLN A 1 519 ? -53.46900 -55.15800 -8.27900  1.000 33.39000  ? 507  GLN A N     1 
ATOM   4086 C  CA    . GLN A 1 519 ? -53.94700 -54.78800 -6.94800  1.000 35.80000  ? 507  GLN A CA    1 
ATOM   4087 C  C     . GLN A 1 519 ? -52.99700 -53.85200 -6.20900  1.000 35.85000  ? 507  GLN A C     1 
ATOM   4088 O  O     . GLN A 1 519 ? -53.38200 -53.25500 -5.20600  1.000 34.22000  ? 507  GLN A O     1 
ATOM   4089 C  CB    . GLN A 1 519 ? -54.17700 -56.01500 -6.08300  1.000 34.26000  ? 507  GLN A CB    1 
ATOM   4090 C  CG    . GLN A 1 519 ? -55.48800 -56.68800 -6.31000  1.000 39.76000  ? 507  GLN A CG    1 
ATOM   4091 C  CD    . GLN A 1 519 ? -55.86300 -57.56500 -5.13700  1.000 51.30000  ? 507  GLN A CD    1 
ATOM   4092 O  OE1   . GLN A 1 519 ? -55.31200 -57.41600 -4.04500  1.000 60.66000  ? 507  GLN A OE1   1 
ATOM   4093 N  NE2   . GLN A 1 519 ? -56.80300 -58.48400 -5.35100  1.000 51.93000  ? 507  GLN A NE2   1 
ATOM   4094 N  N     . ALA A 1 520 ? -51.75700 -53.73500 -6.68200  1.000 35.94000  ? 508  ALA A N     1 
ATOM   4095 C  CA    . ALA A 1 520 ? -50.80000 -52.85700 -6.00500  1.000 35.26000  ? 508  ALA A CA    1 
ATOM   4096 C  C     . ALA A 1 520 ? -50.81000 -51.46400 -6.61000  1.000 34.29000  ? 508  ALA A C     1 
ATOM   4097 O  O     . ALA A 1 520 ? -49.91300 -50.66000 -6.34400  1.000 35.81000  ? 508  ALA A O     1 
ATOM   4098 C  CB    . ALA A 1 520 ? -49.40500 -53.43800 -6.04800  1.000 30.87000  ? 508  ALA A CB    1 
ATOM   4099 N  N     . GLN A 1 521 ? -51.82200 -51.19800 -7.43500  1.000 31.61000  ? 509  GLN A N     1 
ATOM   4100 C  CA    . GLN A 1 521 ? -52.11500 -49.85300 -7.91700  1.000 28.76000  ? 509  GLN A CA    1 
ATOM   4101 C  C     . GLN A 1 521 ? -50.93400 -49.13200 -8.54600  1.000 27.31000  ? 509  GLN A C     1 
ATOM   4102 O  O     . GLN A 1 521 ? -50.69500 -47.96600 -8.26400  1.000 29.75000  ? 509  GLN A O     1 
ATOM   4103 C  CB    . GLN A 1 521 ? -52.67600 -49.01600 -6.77100  1.000 30.59000  ? 509  GLN A CB    1 
ATOM   4104 C  CG    . GLN A 1 521 ? -53.95300 -49.63000 -6.19200  1.000 39.83000  ? 509  GLN A CG    1 
ATOM   4105 C  CD    . GLN A 1 521 ? -54.59100 -48.77900 -5.11900  1.000 44.21000  ? 509  GLN A CD    1 
ATOM   4106 O  OE1   . GLN A 1 521 ? -55.70500 -48.28700 -5.28300  1.000 47.83000  ? 509  GLN A OE1   1 
ATOM   4107 N  NE2   . GLN A 1 521 ? -53.89300 -48.61800 -4.00400  1.000 41.26000  ? 509  GLN A NE2   1 
ATOM   4108 N  N     . PRO A 1 522 ? -50.21000 -49.81800 -9.42900  1.000 23.22000  ? 510  PRO A N     1 
ATOM   4109 C  CA    . PRO A 1 522 ? -49.07500 -49.18400 -10.10000 1.000 25.08000  ? 510  PRO A CA    1 
ATOM   4110 C  C     . PRO A 1 522 ? -49.48600 -48.05500 -11.03400 1.000 27.94000  ? 510  PRO A C     1 
ATOM   4111 O  O     . PRO A 1 522 ? -50.58100 -48.12400 -11.62400 1.000 24.20000  ? 510  PRO A O     1 
ATOM   4112 C  CB    . PRO A 1 522 ? -48.47700 -50.33000 -10.90800 1.000 23.44000  ? 510  PRO A CB    1 
ATOM   4113 C  CG    . PRO A 1 522 ? -49.65100 -51.18700 -11.21200 1.000 24.61000  ? 510  PRO A CG    1 
ATOM   4114 C  CD    . PRO A 1 522 ? -50.46800 -51.16500 -9.95200  1.000 24.86000  ? 510  PRO A CD    1 
ATOM   4115 N  N     . ASP A 1 523 ? -48.61400 -47.05500 -11.18600 1.000 29.18000  ? 511  ASP A N     1 
ATOM   4116 C  CA    . ASP A 1 523 ? -48.80200 -46.04400 -12.21900 1.000 27.37000  ? 511  ASP A CA    1 
ATOM   4117 C  C     . ASP A 1 523 ? -47.63200 -45.99300 -13.19900 1.000 29.37000  ? 511  ASP A C     1 
ATOM   4118 O  O     . ASP A 1 523 ? -47.64400 -45.19900 -14.14200 1.000 31.53000  ? 511  ASP A O     1 
ATOM   4119 C  CB    . ASP A 1 523 ? -49.04200 -44.65800 -11.60000 1.000 27.93000  ? 511  ASP A CB    1 
ATOM   4120 C  CG    . ASP A 1 523 ? -47.93500 -44.21900 -10.67300 1.000 33.26000  ? 511  ASP A CG    1 
ATOM   4121 O  OD1   . ASP A 1 523 ? -46.77900 -44.61300 -10.91600 1.000 36.38000  ? 511  ASP A OD1   1 
ATOM   4122 O  OD2   . ASP A 1 523 ? -48.21900 -43.46800 -9.70200  1.000 33.07000  ? 511  ASP A OD2   1 
ATOM   4123 N  N     . GLN A 1 524 ? -46.62500 -46.83500 -12.99000 1.000 28.04000  ? 512  GLN A N     1 
ATOM   4124 C  CA    . GLN A 1 524 ? -45.53400 -46.95100 -13.95900 1.000 25.34000  ? 512  GLN A CA    1 
ATOM   4125 C  C     . GLN A 1 524 ? -45.07900 -48.37800 -14.09400 1.000 25.64000  ? 512  GLN A C     1 
ATOM   4126 O  O     . GLN A 1 524 ? -45.05300 -49.10600 -13.11000 1.000 28.83000  ? 512  GLN A O     1 
ATOM   4127 C  CB    . GLN A 1 524 ? -44.32100 -46.12600 -13.55400 1.000 24.98000  ? 512  GLN A CB    1 
ATOM   4128 C  CG    . GLN A 1 524 ? -44.60400 -44.81800 -12.94400 1.000 30.68000  ? 512  GLN A CG    1 
ATOM   4129 C  CD    . GLN A 1 524 ? -43.53600 -44.45100 -11.93700 1.000 35.14000  ? 512  GLN A CD    1 
ATOM   4130 O  OE1   . GLN A 1 524 ? -43.85200 -43.94000 -10.85200 1.000 34.07000  ? 512  GLN A OE1   1 
ATOM   4131 N  NE2   . GLN A 1 524 ? -42.26100 -44.72400 -12.27400 1.000 29.76000  ? 512  GLN A NE2   1 
ATOM   4132 N  N     . SER A 1 525 ? -44.65500 -48.76700 -15.28700 1.000 24.33000  ? 513  SER A N     1 
ATOM   4133 C  CA    . SER A 1 525 ? -44.15400 -50.11600 -15.45600 1.000 27.19000  ? 513  SER A CA    1 
ATOM   4134 C  C     . SER A 1 525 ? -43.10600 -50.20700 -16.54600 1.000 31.49000  ? 513  SER A C     1 
ATOM   4135 O  O     . SER A 1 525 ? -43.07300 -49.38100 -17.45700 1.000 33.06000  ? 513  SER A O     1 
ATOM   4136 C  CB    . SER A 1 525 ? -45.30100 -51.07000 -15.77900 1.000 29.03000  ? 513  SER A CB    1 
ATOM   4137 O  OG    . SER A 1 525 ? -44.81800 -52.18000 -16.52200 1.000 33.16000  ? 513  SER A OG    1 
ATOM   4138 N  N     . GLU A 1 526 ? -42.25200 -51.22100 -16.44000 1.000 31.73000  ? 514  GLU A N     1 
ATOM   4139 C  CA    . GLU A 1 526 ? -41.29000 -51.53300 -17.48500 1.000 30.87000  ? 514  GLU A CA    1 
ATOM   4140 C  C     . GLU A 1 526 ? -42.04000 -52.04000 -18.68600 1.000 36.64000  ? 514  GLU A C     1 
ATOM   4141 O  O     . GLU A 1 526 ? -41.55700 -51.94900 -19.82300 1.000 38.21000  ? 514  GLU A O     1 
ATOM   4142 C  CB    . GLU A 1 526 ? -40.30600 -52.59700 -17.04000 1.000 27.15000  ? 514  GLU A CB    1 
ATOM   4143 C  CG    . GLU A 1 526 ? -39.29600 -52.14000 -16.04000 1.000 37.74000  ? 514  GLU A CG    1 
ATOM   4144 C  CD    . GLU A 1 526 ? -38.67100 -53.31500 -15.28600 1.000 51.44000  ? 514  GLU A CD    1 
ATOM   4145 O  OE1   . GLU A 1 526 ? -38.91600 -54.48700 -15.67600 1.000 51.14000  ? 514  GLU A OE1   1 
ATOM   4146 O  OE2   . GLU A 1 526 ? -37.94300 -53.06600 -14.29700 1.000 58.19000  ? 514  GLU A OE2   1 
ATOM   4147 N  N     . SER A 1 527 ? -43.22200 -52.59100 -18.41000 1.000 32.31000  ? 515  SER A N     1 
ATOM   4148 C  CA    . SER A 1 527 ? -43.97200 -53.33300 -19.40500 1.000 30.84000  ? 515  SER A CA    1 
ATOM   4149 C  C     . SER A 1 527 ? -44.89500 -52.44400 -20.21600 1.000 34.29000  ? 515  SER A C     1 
ATOM   4150 O  O     . SER A 1 527 ? -45.73600 -51.72300 -19.66600 1.000 33.27000  ? 515  SER A O     1 
ATOM   4151 C  CB    . SER A 1 527 ? -44.78100 -54.42700 -18.73300 1.000 30.89000  ? 515  SER A CB    1 
ATOM   4152 O  OG    . SER A 1 527 ? -45.83700 -54.82200 -19.58400 1.000 32.66000  ? 515  SER A OG    1 
ATOM   4153 N  N     . GLU A 1 528 ? -44.74100 -52.49800 -21.53000 1.000 38.32000  ? 516  GLU A N     1 
ATOM   4154 C  CA    . GLU A 1 528 ? -45.59400 -51.69800 -22.39700 1.000 40.52000  ? 516  GLU A CA    1 
ATOM   4155 C  C     . GLU A 1 528 ? -47.04600 -52.04700 -22.11800 1.000 34.94000  ? 516  GLU A C     1 
ATOM   4156 O  O     . GLU A 1 528 ? -47.91600 -51.18100 -22.10500 1.000 41.43000  ? 516  GLU A O     1 
ATOM   4157 C  CB    . GLU A 1 528 ? -45.24200 -51.92700 -23.86900 1.000 44.53000  ? 516  GLU A CB    1 
ATOM   4158 C  CG    . GLU A 1 528 ? -45.90300 -50.96600 -24.85400 1.000 55.64000  ? 516  GLU A CG    1 
ATOM   4159 C  CD    . GLU A 1 528 ? -45.41600 -51.18100 -26.29400 1.000 77.75000  ? 516  GLU A CD    1 
ATOM   4160 O  OE1   . GLU A 1 528 ? -44.28500 -51.69700 -26.47900 1.000 78.26000  ? 516  GLU A OE1   1 
ATOM   4161 O  OE2   . GLU A 1 528 ? -46.16700 -50.83800 -27.23900 1.000 85.91000  ? 516  GLU A OE2   1 
ATOM   4162 N  N     . LEU A 1 529 ? -47.30000 -53.31400 -21.84500 1.000 30.64000  ? 517  LEU A N     1 
ATOM   4163 C  CA    . LEU A 1 529 ? -48.66400 -53.79600 -21.73400 1.000 29.83000  ? 517  LEU A CA    1 
ATOM   4164 C  C     . LEU A 1 529 ? -49.30100 -53.32500 -20.43900 1.000 29.19000  ? 517  LEU A C     1 
ATOM   4165 O  O     . LEU A 1 529 ? -50.45900 -52.94200 -20.39900 1.000 25.39000  ? 517  LEU A O     1 
ATOM   4166 C  CB    . LEU A 1 529 ? -48.67200 -55.31200 -21.82100 1.000 26.31000  ? 517  LEU A CB    1 
ATOM   4167 C  CG    . LEU A 1 529 ? -49.99800 -56.03900 -21.82400 1.000 30.40000  ? 517  LEU A CG    1 
ATOM   4168 C  CD1   . LEU A 1 529 ? -50.89200 -55.49000 -22.91400 1.000 28.54000  ? 517  LEU A CD1   1 
ATOM   4169 C  CD2   . LEU A 1 529 ? -49.73000 -57.51700 -22.02800 1.000 28.05000  ? 517  LEU A CD2   1 
ATOM   4170 N  N     . VAL A 1 530 ? -48.52700 -53.34100 -19.37000 1.000 30.52000  ? 518  VAL A N     1 
ATOM   4171 C  CA    . VAL A 1 530 ? -49.07200 -52.92900 -18.09300 1.000 29.35000  ? 518  VAL A CA    1 
ATOM   4172 C  C     . VAL A 1 530 ? -49.32900 -51.43200 -18.12100 1.000 30.23000  ? 518  VAL A C     1 
ATOM   4173 O  O     . VAL A 1 530 ? -50.21300 -50.92400 -17.43400 1.000 34.98000  ? 518  VAL A O     1 
ATOM   4174 C  CB    . VAL A 1 530 ? -48.13300 -53.28000 -16.94100 1.000 27.17000  ? 518  VAL A CB    1 
ATOM   4175 C  CG1   . VAL A 1 530 ? -48.64300 -52.67400 -15.64600 1.000 25.73000  ? 518  VAL A CG1   1 
ATOM   4176 C  CG2   . VAL A 1 530 ? -48.01500 -54.78600 -16.84100 1.000 27.26000  ? 518  VAL A CG2   1 
ATOM   4177 N  N     . ASN A 1 531 ? -48.55000 -50.73100 -18.92700 1.000 30.85000  ? 519  ASN A N     1 
ATOM   4178 C  CA    . ASN A 1 531 ? -48.73800 -49.30400 -19.05300 1.000 30.31000  ? 519  ASN A CA    1 
ATOM   4179 C  C     . ASN A 1 531 ? -50.05900 -49.04800 -19.76000 1.000 31.84000  ? 519  ASN A C     1 
ATOM   4180 O  O     . ASN A 1 531 ? -50.81900 -48.19400 -19.33700 1.000 35.65000  ? 519  ASN A O     1 
ATOM   4181 C  CB    . ASN A 1 531 ? -47.56700 -48.65500 -19.80500 1.000 31.05000  ? 519  ASN A CB    1 
ATOM   4182 C  CG    . ASN A 1 531 ? -46.42400 -48.23400 -18.87900 1.000 29.60000  ? 519  ASN A CG    1 
ATOM   4183 O  OD1   . ASN A 1 531 ? -46.64000 -47.62000 -17.83300 1.000 30.09000  ? 519  ASN A OD1   1 
ATOM   4184 N  ND2   . ASN A 1 531 ? -45.20100 -48.56100 -19.27200 1.000 34.49000  ? 519  ASN A ND2   1 
ATOM   4185 N  N     . GLN A 1 532 ? -50.34700 -49.80500 -20.82100 1.000 30.36000  ? 520  GLN A N     1 
ATOM   4186 C  CA    . GLN A 1 532 ? -51.61500 -49.62400 -21.51500 1.000 28.74000  ? 520  GLN A CA    1 
ATOM   4187 C  C     . GLN A 1 532 ? -52.76000 -49.92000 -20.55200 1.000 30.29000  ? 520  GLN A C     1 
ATOM   4188 O  O     . GLN A 1 532 ? -53.74400 -49.18100 -20.52400 1.000 34.01000  ? 520  GLN A O     1 
ATOM   4189 C  CB    . GLN A 1 532 ? -51.71100 -50.51000 -22.76500 1.000 29.14000  ? 520  GLN A CB    1 
ATOM   4190 C  CG    . GLN A 1 532 ? -50.94800 -49.95700 -23.96700 1.000 36.32000  ? 520  GLN A CG    1 
ATOM   4191 C  CD    . GLN A 1 532 ? -50.77500 -50.98100 -25.08600 1.000 46.24000  ? 520  GLN A CD    1 
ATOM   4192 O  OE1   . GLN A 1 532 ? -50.35800 -52.12100 -24.84900 1.000 42.82000  ? 520  GLN A OE1   1 
ATOM   4193 N  NE2   . GLN A 1 532 ? -51.10200 -50.57800 -26.31300 1.000 52.56000  ? 520  GLN A NE2   1 
ATOM   4194 N  N     . ILE A 1 533 ? -52.61400 -50.97300 -19.74900 1.000 26.35000  ? 521  ILE A N     1 
ATOM   4195 C  CA    . ILE A 1 533 ? -53.61800 -51.30900 -18.74400 1.000 24.91000  ? 521  ILE A CA    1 
ATOM   4196 C  C     . ILE A 1 533 ? -53.81600 -50.17400 -17.74200 1.000 25.39000  ? 521  ILE A C     1 
ATOM   4197 O  O     . ILE A 1 533 ? -54.93800 -49.79100 -17.44400 1.000 27.32000  ? 521  ILE A O     1 
ATOM   4198 C  CB    . ILE A 1 533 ? -53.25000 -52.58600 -17.99000 1.000 23.04000  ? 521  ILE A CB    1 
ATOM   4199 C  CG1   . ILE A 1 533 ? -53.33100 -53.77900 -18.93000 1.000 22.21000  ? 521  ILE A CG1   1 
ATOM   4200 C  CG2   . ILE A 1 533 ? -54.18300 -52.79800 -16.82600 1.000 17.94000  ? 521  ILE A CG2   1 
ATOM   4201 C  CD1   . ILE A 1 533 ? -53.13900 -55.08700 -18.24800 1.000 22.22000  ? 521  ILE A CD1   1 
ATOM   4202 N  N     . ILE A 1 534 ? -52.72500 -49.62800 -17.23300 1.000 25.45000  ? 522  ILE A N     1 
ATOM   4203 C  CA    . ILE A 1 534 ? -52.79800 -48.49100 -16.33000 1.000 26.57000  ? 522  ILE A CA    1 
ATOM   4204 C  C     . ILE A 1 534 ? -53.59200 -47.30900 -16.92000 1.000 27.11000  ? 522  ILE A C     1 
ATOM   4205 O  O     . ILE A 1 534 ? -54.40400 -46.68900 -16.23600 1.000 26.20000  ? 522  ILE A O     1 
ATOM   4206 C  CB    . ILE A 1 534 ? -51.38400 -48.01200 -15.95400 1.000 23.32000  ? 522  ILE A CB    1 
ATOM   4207 C  CG1   . ILE A 1 534 ? -50.74400 -49.00600 -14.99600 1.000 22.43000  ? 522  ILE A CG1   1 
ATOM   4208 C  CG2   . ILE A 1 534 ? -51.42400 -46.63000 -15.35500 1.000 21.26000  ? 522  ILE A CG2   1 
ATOM   4209 C  CD1   . ILE A 1 534 ? -49.25700 -48.84100 -14.88100 1.000 25.17000  ? 522  ILE A CD1   1 
ATOM   4210 N  N     . GLU A 1 535 ? -53.34800 -47.01100 -18.19000 1.000 28.45000  ? 523  GLU A N     1 
ATOM   4211 C  CA    . GLU A 1 535 ? -54.07400 -45.94600 -18.86400 1.000 30.89000  ? 523  GLU A CA    1 
ATOM   4212 C  C     . GLU A 1 535 ? -55.57400 -46.17200 -18.72900 1.000 29.62000  ? 523  GLU A C     1 
ATOM   4213 O  O     . GLU A 1 535 ? -56.30900 -45.29700 -18.29300 1.000 28.94000  ? 523  GLU A O     1 
ATOM   4214 C  CB    . GLU A 1 535 ? -53.67000 -45.87300 -20.33500 1.000 37.07000  ? 523  GLU A CB    1 
ATOM   4215 C  CG    . GLU A 1 535 ? -53.13600 -44.51500 -20.75000 1.000 53.73000  ? 523  GLU A CG    1 
ATOM   4216 C  CD    . GLU A 1 535 ? -53.32800 -44.23400 -22.23900 1.000 64.86000  ? 523  GLU A CD    1 
ATOM   4217 O  OE1   . GLU A 1 535 ? -54.02900 -43.24600 -22.56500 1.000 66.55000  ? 523  GLU A OE1   1 
ATOM   4218 O  OE2   . GLU A 1 535 ? -52.77700 -44.99200 -23.07700 1.000 64.67000  ? 523  GLU A OE2   1 
ATOM   4219 N  N     . GLN A 1 536 ? -56.01500 -47.37800 -19.06800 1.000 27.46000  ? 524  GLN A N     1 
ATOM   4220 C  CA    . GLN A 1 536 ? -57.42100 -47.72400 -18.96700 1.000 23.48000  ? 524  GLN A CA    1 
ATOM   4221 C  C     . GLN A 1 536 ? -57.95600 -47.60900 -17.55000 1.000 26.83000  ? 524  GLN A C     1 
ATOM   4222 O  O     . GLN A 1 536 ? -59.09500 -47.19200 -17.35500 1.000 29.70000  ? 524  GLN A O     1 
ATOM   4223 C  CB    . GLN A 1 536 ? -57.64500 -49.14000 -19.48300 1.000 28.28000  ? 524  GLN A CB    1 
ATOM   4224 C  CG    . GLN A 1 536 ? -57.26300 -49.34300 -20.95400 1.000 28.22000  ? 524  GLN A CG    1 
ATOM   4225 C  CD    . GLN A 1 536 ? -58.20400 -48.63000 -21.90500 1.000 30.67000  ? 524  GLN A CD    1 
ATOM   4226 O  OE1   . GLN A 1 536 ? -59.38700 -48.42200 -21.59800 1.000 29.51000  ? 524  GLN A OE1   1 
ATOM   4227 N  NE2   . GLN A 1 536 ? -57.68600 -48.24500 -23.06700 1.000 33.62000  ? 524  GLN A NE2   1 
ATOM   4228 N  N     . LEU A 1 537 ? -57.15300 -47.99000 -16.54800 1.000 26.58000  ? 525  LEU A N     1 
ATOM   4229 C  CA    . LEU A 1 537 ? -57.65100 -47.94900 -15.17500 1.000 21.82000  ? 525  LEU A CA    1 
ATOM   4230 C  C     . LEU A 1 537 ? -57.85100 -46.51000 -14.72000 1.000 25.97000  ? 525  LEU A C     1 
ATOM   4231 O  O     . LEU A 1 537 ? -58.70500 -46.21000 -13.88400 1.000 28.62000  ? 525  LEU A O     1 
ATOM   4232 C  CB    . LEU A 1 537 ? -56.71100 -48.67100 -14.23000 1.000 23.84000  ? 525  LEU A CB    1 
ATOM   4233 C  CG    . LEU A 1 537 ? -56.64800 -50.19100 -14.28100 1.000 24.80000  ? 525  LEU A CG    1 
ATOM   4234 C  CD1   . LEU A 1 537 ? -55.55000 -50.63100 -13.36400 1.000 26.93000  ? 525  LEU A CD1   1 
ATOM   4235 C  CD2   . LEU A 1 537 ? -57.95400 -50.82900 -13.86500 1.000 21.98000  ? 525  LEU A CD2   1 
ATOM   4236 N  N     . ILE A 1 538 ? -57.05800 -45.61100 -15.28800 1.000 28.03000  ? 526  ILE A N     1 
ATOM   4237 C  CA    . ILE A 1 538 ? -57.16500 -44.21300 -14.93000 1.000 25.87000  ? 526  ILE A CA    1 
ATOM   4238 C  C     . ILE A 1 538 ? -58.41900 -43.59600 -15.53400 1.000 25.68000  ? 526  ILE A C     1 
ATOM   4239 O  O     . ILE A 1 538 ? -59.11000 -42.84800 -14.87100 1.000 24.25000  ? 526  ILE A O     1 
ATOM   4240 C  CB    . ILE A 1 538 ? -55.92400 -43.46100 -15.35900 1.000 24.22000  ? 526  ILE A CB    1 
ATOM   4241 C  CG1   . ILE A 1 538 ? -54.79100 -43.78600 -14.37700 1.000 24.99000  ? 526  ILE A CG1   1 
ATOM   4242 C  CG2   . ILE A 1 538 ? -56.19400 -41.98500 -15.39800 1.000 21.76000  ? 526  ILE A CG2   1 
ATOM   4243 C  CD1   . ILE A 1 538 ? -53.45600 -43.34500 -14.81700 1.000 25.11000  ? 526  ILE A CD1   1 
ATOM   4244 N  N     . LYS A 1 539 ? -58.73700 -43.96400 -16.76600 1.000 27.83000  ? 527  LYS A N     1 
ATOM   4245 C  CA    . LYS A 1 539 ? -59.95600 -43.49200 -17.42700 1.000 24.12000  ? 527  LYS A CA    1 
ATOM   4246 C  C     . LYS A 1 539 ? -61.28600 -43.95800 -16.78600 1.000 28.51000  ? 527  LYS A C     1 
ATOM   4247 O  O     . LYS A 1 539 ? -62.29400 -43.25100 -16.87500 1.000 31.13000  ? 527  LYS A O     1 
ATOM   4248 C  CB    . LYS A 1 539 ? -59.96200 -43.93500 -18.89500 1.000 24.82000  ? 527  LYS A CB    1 
ATOM   4249 C  CG    . LYS A 1 539 ? -58.89300 -43.33200 -19.76200 1.000 28.46000  ? 527  LYS A CG    1 
ATOM   4250 C  CD    . LYS A 1 539 ? -59.19200 -43.64900 -21.21500 1.000 39.10000  ? 527  LYS A CD    1 
ATOM   4251 C  CE    . LYS A 1 539 ? -58.10300 -43.13300 -22.15700 1.000 46.57000  ? 527  LYS A CE    1 
ATOM   4252 N  NZ    . LYS A 1 539 ? -58.37700 -41.76300 -22.68800 1.000 55.56000  ? 527  LYS A NZ    1 
ATOM   4253 N  N     . LYS A 1 540 ? -61.29700 -45.14300 -16.17500 1.000 24.45000  ? 528  LYS A N     1 
ATOM   4254 C  CA    . LYS A 1 540 ? -62.53800 -45.74500 -15.71200 1.000 23.16000  ? 528  LYS A CA    1 
ATOM   4255 C  C     . LYS A 1 540 ? -63.03800 -45.04900 -14.45500 1.000 26.30000  ? 528  LYS A C     1 
ATOM   4256 O  O     . LYS A 1 540 ? -62.24700 -44.50300 -13.70600 1.000 25.18000  ? 528  LYS A O     1 
ATOM   4257 C  CB    . LYS A 1 540 ? -62.34400 -47.23700 -15.42700 1.000 22.95000  ? 528  LYS A CB    1 
ATOM   4258 C  CG    . LYS A 1 540 ? -62.00300 -48.09000 -16.61000 1.000 20.71000  ? 528  LYS A CG    1 
ATOM   4259 C  CD    . LYS A 1 540 ? -63.25300 -48.34700 -17.41500 1.000 25.39000  ? 528  LYS A CD    1 
ATOM   4260 C  CE    . LYS A 1 540 ? -62.99500 -49.35500 -18.53200 1.000 26.12000  ? 528  LYS A CE    1 
ATOM   4261 N  NZ    . LYS A 1 540 ? -63.81300 -49.06400 -19.74200 1.000 26.49000  ? 528  LYS A NZ    1 
ATOM   4262 N  N     . GLU A 1 541 ? -64.35300 -45.07800 -14.22500 1.000 28.59000  ? 529  GLU A N     1 
ATOM   4263 C  CA    . GLU A 1 541 ? -64.90300 -44.52500 -13.00500 1.000 27.03000  ? 529  GLU A CA    1 
ATOM   4264 C  C     . GLU A 1 541 ? -64.84600 -45.53900 -11.87900 1.000 26.13000  ? 529  GLU A C     1 
ATOM   4265 O  O     . GLU A 1 541 ? -64.53900 -45.19500 -10.75500 1.000 29.34000  ? 529  GLU A O     1 
ATOM   4266 C  CB    . GLU A 1 541 ? -66.35000 -44.06000 -13.20700 1.000 31.96000  ? 529  GLU A CB    1 
ATOM   4267 C  CG    . GLU A 1 541 ? -66.49900 -42.61900 -13.73800 1.000 41.43000  ? 529  GLU A CG    1 
ATOM   4268 C  CD    . GLU A 1 541 ? -65.76900 -41.55400 -12.88200 1.000 59.48000  ? 529  GLU A CD    1 
ATOM   4269 O  OE1   . GLU A 1 541 ? -66.22400 -41.25800 -11.74200 1.000 60.56000  ? 529  GLU A OE1   1 
ATOM   4270 O  OE2   . GLU A 1 541 ? -64.73600 -41.00200 -13.35800 1.000 61.09000  ? 529  GLU A OE2   1 
ATOM   4271 N  N     . LYS A 1 542 ? -65.18000 -46.78900 -12.17500 1.000 27.45000  ? 530  LYS A N     1 
ATOM   4272 C  CA    . LYS A 1 542 ? -65.09400 -47.83700 -11.16700 1.000 26.42000  ? 530  LYS A CA    1 
ATOM   4273 C  C     . LYS A 1 542 ? -64.62600 -49.13900 -11.78000 1.000 26.24000  ? 530  LYS A C     1 
ATOM   4274 O  O     . LYS A 1 542 ? -65.14900 -49.55300 -12.81300 1.000 26.09000  ? 530  LYS A O     1 
ATOM   4275 C  CB    . LYS A 1 542 ? -66.44000 -48.07200 -10.48700 1.000 26.81000  ? 530  LYS A CB    1 
ATOM   4276 C  CG    . LYS A 1 542 ? -66.93000 -46.93400 -9.63200  1.000 26.77000  ? 530  LYS A CG    1 
ATOM   4277 C  CD    . LYS A 1 542 ? -68.05800 -47.42500 -8.75800  1.000 27.61000  ? 530  LYS A CD    1 
ATOM   4278 C  CE    . LYS A 1 542 ? -68.75300 -46.29300 -8.03300  1.000 31.01000  ? 530  LYS A CE    1 
ATOM   4279 N  NZ    . LYS A 1 542 ? -69.97500 -46.79900 -7.36700  1.000 41.99000  ? 530  LYS A NZ    1 
ATOM   4280 N  N     . VAL A 1 543 ? -63.64700 -49.77900 -11.14800 1.000 24.14000  ? 531  VAL A N     1 
ATOM   4281 C  CA    . VAL A 1 543 ? -63.22000 -51.09900 -11.57200 1.000 20.83000  ? 531  VAL A CA    1 
ATOM   4282 C  C     . VAL A 1 543 ? -63.27500 -51.99100 -10.37100 1.000 21.17000  ? 531  VAL A C     1 
ATOM   4283 O  O     . VAL A 1 543 ? -63.07200 -51.52900 -9.26100  1.000 26.86000  ? 531  VAL A O     1 
ATOM   4284 C  CB    . VAL A 1 543 ? -61.79200 -51.10900 -12.14400 1.000 22.89000  ? 531  VAL A CB    1 
ATOM   4285 C  CG1   . VAL A 1 543 ? -61.21500 -52.50200 -12.11200 1.000 18.00000  ? 531  VAL A CG1   1 
ATOM   4286 C  CG2   . VAL A 1 543 ? -61.78800 -50.60000 -13.55000 1.000 22.75000  ? 531  VAL A CG2   1 
ATOM   4287 N  N     . TYR A 1 544 ? -63.57000 -53.26600 -10.58100 1.000 23.54000  ? 532  TYR A N     1 
ATOM   4288 C  CA    . TYR A 1 544 ? -63.52400 -54.22300 -9.49200  1.000 23.83000  ? 532  TYR A CA    1 
ATOM   4289 C  C     . TYR A 1 544 ? -62.95800 -55.52400 -9.99400  1.000 25.63000  ? 532  TYR A C     1 
ATOM   4290 O  O     . TYR A 1 544 ? -63.51600 -56.14000 -10.90800 1.000 27.33000  ? 532  TYR A O     1 
ATOM   4291 C  CB    . TYR A 1 544 ? -64.91000 -54.44700 -8.88500  1.000 26.46000  ? 532  TYR A CB    1 
ATOM   4292 C  CG    . TYR A 1 544 ? -64.94800 -55.58100 -7.89500  1.000 30.02000  ? 532  TYR A CG    1 
ATOM   4293 C  CD1   . TYR A 1 544 ? -64.47600 -55.41500 -6.59500  1.000 30.66000  ? 532  TYR A CD1   1 
ATOM   4294 C  CD2   . TYR A 1 544 ? -65.44000 -56.82600 -8.25900  1.000 28.80000  ? 532  TYR A CD2   1 
ATOM   4295 C  CE1   . TYR A 1 544 ? -64.51500 -56.44600 -5.68800  1.000 30.68000  ? 532  TYR A CE1   1 
ATOM   4296 C  CE2   . TYR A 1 544 ? -65.47900 -57.86900 -7.36200  1.000 31.31000  ? 532  TYR A CE2   1 
ATOM   4297 C  CZ    . TYR A 1 544 ? -65.02000 -57.68000 -6.07300  1.000 34.69000  ? 532  TYR A CZ    1 
ATOM   4298 O  OH    . TYR A 1 544 ? -65.05900 -58.73000 -5.17000  1.000 37.80000  ? 532  TYR A OH    1 
ATOM   4299 N  N     . LEU A 1 545 ? -61.85700 -55.94400 -9.37800  1.000 27.53000  ? 533  LEU A N     1 
ATOM   4300 C  CA    . LEU A 1 545 ? -61.14600 -57.14800 -9.78400  1.000 24.88000  ? 533  LEU A CA    1 
ATOM   4301 C  C     . LEU A 1 545 ? -61.28900 -58.28100 -8.75600  1.000 25.91000  ? 533  LEU A C     1 
ATOM   4302 O  O     . LEU A 1 545 ? -60.88400 -58.15300 -7.60100  1.000 30.24000  ? 533  LEU A O     1 
ATOM   4303 C  CB    . LEU A 1 545 ? -59.67700 -56.82000 -9.99200  1.000 29.88000  ? 533  LEU A CB    1 
ATOM   4304 C  CG    . LEU A 1 545 ? -58.94000 -57.71700 -10.96900 1.000 26.63000  ? 533  LEU A CG    1 
ATOM   4305 C  CD1   . LEU A 1 545 ? -59.65900 -57.65200 -12.28600 1.000 30.52000  ? 533  LEU A CD1   1 
ATOM   4306 C  CD2   . LEU A 1 545 ? -57.54100 -57.19800 -11.09100 1.000 28.41000  ? 533  LEU A CD2   1 
ATOM   4307 N  N     . ALA A 1 546 ? -61.86400 -59.39200 -9.18700  1.000 26.34000  ? 534  ALA A N     1 
ATOM   4308 C  CA    . ALA A 1 546 ? -62.03500 -60.53200 -8.31400  1.000 23.37000  ? 534  ALA A CA    1 
ATOM   4309 C  C     . ALA A 1 546 ? -61.23600 -61.72600 -8.83400  1.000 28.58000  ? 534  ALA A C     1 
ATOM   4310 O  O     . ALA A 1 546 ? -60.89800 -61.79600 -10.02700 1.000 29.85000  ? 534  ALA A O     1 
ATOM   4311 C  CB    . ALA A 1 546 ? -63.49100 -60.87600 -8.20300  1.000 25.33000  ? 534  ALA A CB    1 
ATOM   4312 N  N     . TRP A 1 547 ? -60.93500 -62.67100 -7.95000  1.000 27.57000  ? 535  TRP A N     1 
ATOM   4313 C  CA    . TRP A 1 547 ? -60.18800 -63.84500 -8.37300  1.000 27.59000  ? 535  TRP A CA    1 
ATOM   4314 C  C     . TRP A 1 547 ? -61.00000 -65.13900 -8.17500  1.000 28.00000  ? 535  TRP A C     1 
ATOM   4315 O  O     . TRP A 1 547 ? -61.83400 -65.22700 -7.28500  1.000 28.74000  ? 535  TRP A O     1 
ATOM   4316 C  CB    . TRP A 1 547 ? -58.86300 -63.89400 -7.60700  1.000 31.72000  ? 535  TRP A CB    1 
ATOM   4317 C  CG    . TRP A 1 547 ? -58.03300 -65.09800 -7.92000  1.000 32.96000  ? 535  TRP A CG    1 
ATOM   4318 C  CD1   . TRP A 1 547 ? -57.12100 -65.22800 -8.93700  1.000 29.77000  ? 535  TRP A CD1   1 
ATOM   4319 C  CD2   . TRP A 1 547 ? -58.03500 -66.34000 -7.21600  1.000 31.54000  ? 535  TRP A CD2   1 
ATOM   4320 N  NE1   . TRP A 1 547 ? -56.55900 -66.47600 -8.90300  1.000 32.35000  ? 535  TRP A NE1   1 
ATOM   4321 C  CE2   . TRP A 1 547 ? -57.10800 -67.18200 -7.85900  1.000 33.55000  ? 535  TRP A CE2   1 
ATOM   4322 C  CE3   . TRP A 1 547 ? -58.73300 -66.82200 -6.10500  1.000 33.50000  ? 535  TRP A CE3   1 
ATOM   4323 C  CZ2   . TRP A 1 547 ? -56.85800 -68.48700 -7.42400  1.000 26.32000  ? 535  TRP A CZ2   1 
ATOM   4324 C  CZ3   . TRP A 1 547 ? -58.48900 -68.11500 -5.68100  1.000 33.93000  ? 535  TRP A CZ3   1 
ATOM   4325 C  CH2   . TRP A 1 547 ? -57.55700 -68.93100 -6.34100  1.000 29.49000  ? 535  TRP A CH2   1 
ATOM   4326 N  N     . VAL A 1 548 ? -60.77700 -66.12700 -9.02300  1.000 26.75000  ? 536  VAL A N     1 
ATOM   4327 C  CA    . VAL A 1 548 ? -61.36400 -67.44300 -8.80800  1.000 29.95000  ? 536  VAL A CA    1 
ATOM   4328 C  C     . VAL A 1 548 ? -60.33400 -68.47400 -9.21800  1.000 33.31000  ? 536  VAL A C     1 
ATOM   4329 O  O     . VAL A 1 548 ? -59.52900 -68.21600 -10.10600 1.000 31.13000  ? 536  VAL A O     1 
ATOM   4330 C  CB    . VAL A 1 548 ? -62.65300 -67.68100 -9.63300  1.000 26.02000  ? 536  VAL A CB    1 
ATOM   4331 C  CG1   . VAL A 1 548 ? -63.72000 -66.70000 -9.26900  1.000 26.41000  ? 536  VAL A CG1   1 
ATOM   4332 C  CG2   . VAL A 1 548 ? -62.33700 -67.60200 -11.09700 1.000 29.99000  ? 536  VAL A CG2   1 
ATOM   4333 N  N     . PRO A 1 549 ? -60.35700 -69.64900 -8.57800  1.000 37.29000  ? 537  PRO A N     1 
ATOM   4334 C  CA    . PRO A 1 549 ? -59.39700 -70.70900 -8.91800  1.000 36.73000  ? 537  PRO A CA    1 
ATOM   4335 C  C     . PRO A 1 549 ? -59.70100 -71.28900 -10.29200 1.000 36.41000  ? 537  PRO A C     1 
ATOM   4336 O  O     . PRO A 1 549 ? -60.87400 -71.53500 -10.58800 1.000 42.68000  ? 537  PRO A O     1 
ATOM   4337 C  CB    . PRO A 1 549 ? -59.60700 -71.75500 -7.81800  1.000 37.17000  ? 537  PRO A CB    1 
ATOM   4338 C  CG    . PRO A 1 549 ? -60.38900 -71.05600 -6.75200  1.000 37.16000  ? 537  PRO A CG    1 
ATOM   4339 C  CD    . PRO A 1 549 ? -61.21000 -70.01300 -7.44000  1.000 34.56000  ? 537  PRO A CD    1 
ATOM   4340 N  N     . ALA A 1 550 ? -58.67500 -71.50600 -11.10900 1.000 37.47000  ? 538  ALA A N     1 
ATOM   4341 C  CA    . ALA A 1 550 ? -58.87800 -71.97300 -12.48200 1.000 42.31000  ? 538  ALA A CA    1 
ATOM   4342 C  C     . ALA A 1 550 ? -59.12500 -73.48300 -12.56400 1.000 51.90000  ? 538  ALA A C     1 
ATOM   4343 O  O     . ALA A 1 550 ? -58.78300 -74.23200 -11.65000 1.000 53.39000  ? 538  ALA A O     1 
ATOM   4344 C  CB    . ALA A 1 550 ? -57.69400 -71.60700 -13.33400 1.000 41.20000  ? 538  ALA A CB    1 
ATOM   4345 N  N     . HIS A 1 551 ? -59.72500 -73.91300 -13.66900 1.000 52.06000  ? 539  HIS A N     1 
ATOM   4346 C  CA    . HIS A 1 551 ? -59.99600 -75.32600 -13.89500 1.000 53.53000  ? 539  HIS A CA    1 
ATOM   4347 C  C     . HIS A 1 551 ? -60.86000 -75.96800 -12.82500 1.000 50.44000  ? 539  HIS A C     1 
ATOM   4348 O  O     . HIS A 1 551 ? -60.68900 -77.15100 -12.54200 1.000 55.44000  ? 539  HIS A O     1 
ATOM   4349 C  CB    . HIS A 1 551 ? -58.69200 -76.11000 -13.98300 1.000 48.22000  ? 539  HIS A CB    1 
ATOM   4350 C  CG    . HIS A 1 551 ? -57.68400 -75.49200 -14.88900 1.000 47.11000  ? 539  HIS A CG    1 
ATOM   4351 N  ND1   . HIS A 1 551 ? -57.95200 -75.21400 -16.21100 1.000 57.56000  ? 539  HIS A ND1   1 
ATOM   4352 C  CD2   . HIS A 1 551 ? -56.40800 -75.09700 -14.66600 1.000 54.41000  ? 539  HIS A CD2   1 
ATOM   4353 C  CE1   . HIS A 1 551 ? -56.87900 -74.67200 -16.76900 1.000 65.27000  ? 539  HIS A CE1   1 
ATOM   4354 N  NE2   . HIS A 1 551 ? -55.93000 -74.58800 -15.85200 1.000 65.47000  ? 539  HIS A NE2   1 
ATOM   4355 N  N     . LYS A 1 552 ? -61.78100 -75.22300 -12.22600 1.000 47.65000  ? 540  LYS A N     1 
ATOM   4356 C  CA    . LYS A 1 552 ? -62.65000 -75.83900 -11.23200 1.000 46.07000  ? 540  LYS A CA    1 
ATOM   4357 C  C     . LYS A 1 552 ? -64.12800 -75.68600 -11.58200 1.000 46.39000  ? 540  LYS A C     1 
ATOM   4358 O  O     . LYS A 1 552 ? -64.98300 -75.69900 -10.69400 1.000 47.59000  ? 540  LYS A O     1 
ATOM   4359 C  CB    . LYS A 1 552 ? -62.36200 -75.25800 -9.85000  1.000 47.49000  ? 540  LYS A CB    1 
ATOM   4360 C  CG    . LYS A 1 552 ? -61.09000 -75.80500 -9.20100  1.000 52.31000  ? 540  LYS A CG    1 
ATOM   4361 C  CD    . LYS A 1 552 ? -61.38900 -76.82800 -8.08400  1.000 61.73000  ? 540  LYS A CD    1 
ATOM   4362 C  CE    . LYS A 1 552 ? -60.76700 -78.21700 -8.35400  1.000 70.10000  ? 540  LYS A CE    1 
ATOM   4363 N  NZ    . LYS A 1 552 ? -59.27100 -78.26700 -8.22200  1.000 59.91000  ? 540  LYS A NZ    1 
ATOM   4364 N  N     . GLY A 1 553 ? -64.42100 -75.54900 -12.87700 1.000 46.32000  ? 541  GLY A N     1 
ATOM   4365 C  CA    . GLY A 1 553 ? -65.80100 -75.54300 -13.36700 1.000 51.47000  ? 541  GLY A CA    1 
ATOM   4366 C  C     . GLY A 1 553 ? -66.67000 -74.33500 -13.02400 1.000 52.61000  ? 541  GLY A C     1 
ATOM   4367 O  O     . GLY A 1 553 ? -67.87900 -74.32400 -13.27400 1.000 56.86000  ? 541  GLY A O     1 
ATOM   4368 N  N     . ILE A 1 554 ? -66.04700 -73.31400 -12.44900 1.000 45.58000  ? 542  ILE A N     1 
ATOM   4369 C  CA    . ILE A 1 554 ? -66.72000 -72.09400 -12.06300 1.000 46.43000  ? 542  ILE A CA    1 
ATOM   4370 C  C     . ILE A 1 554 ? -67.11400 -71.23100 -13.27500 1.000 49.35000  ? 542  ILE A C     1 
ATOM   4371 O  O     . ILE A 1 554 ? -66.28300 -70.50300 -13.82000 1.000 51.93000  ? 542  ILE A O     1 
ATOM   4372 C  CB    . ILE A 1 554 ? -65.81300 -71.29100 -11.11300 1.000 46.88000  ? 542  ILE A CB    1 
ATOM   4373 C  CG1   . ILE A 1 554 ? -65.63400 -72.06200 -9.81000  1.000 42.42000  ? 542  ILE A CG1   1 
ATOM   4374 C  CG2   . ILE A 1 554 ? -66.37800 -69.90400 -10.84700 1.000 47.78000  ? 542  ILE A CG2   1 
ATOM   4375 C  CD1   . ILE A 1 554 ? -64.41400 -71.64100 -9.02300  1.000 44.02000  ? 542  ILE A CD1   1 
ATOM   4376 N  N     . GLY A 1 555 ? -68.37400 -71.31900 -13.69700 1.000 47.91000  ? 543  GLY A N     1 
ATOM   4377 C  CA    . GLY A 1 555 ? -68.85600 -70.49600 -14.79600 1.000 44.03000  ? 543  GLY A CA    1 
ATOM   4378 C  C     . GLY A 1 555 ? -68.78700 -69.05000 -14.34800 1.000 47.04000  ? 543  GLY A C     1 
ATOM   4379 O  O     . GLY A 1 555 ? -69.00900 -68.76600 -13.16600 1.000 61.80000  ? 543  GLY A O     1 
ATOM   4380 N  N     . GLY A 1 556 ? -68.47000 -68.12500 -15.25000 1.000 37.63000  ? 544  GLY A N     1 
ATOM   4381 C  CA    . GLY A 1 556 ? -68.21700 -68.43300 -16.63400 1.000 38.17000  ? 544  GLY A CA    1 
ATOM   4382 C  C     . GLY A 1 556 ? -66.73300 -68.38200 -16.85700 1.000 42.58000  ? 544  GLY A C     1 
ATOM   4383 O  O     . GLY A 1 556 ? -66.26900 -68.13700 -17.97300 1.000 47.56000  ? 544  GLY A O     1 
ATOM   4384 N  N     . ASN A 1 557 ? -65.97100 -68.59400 -15.79200 1.000 39.47000  ? 545  ASN A N     1 
ATOM   4385 C  CA    . ASN A 1 557 ? -64.55600 -68.83900 -15.96600 1.000 36.87000  ? 545  ASN A CA    1 
ATOM   4386 C  C     . ASN A 1 557 ? -64.43800 -70.11000 -16.79500 1.000 45.02000  ? 545  ASN A C     1 
ATOM   4387 O  O     . ASN A 1 557 ? -63.51200 -70.26900 -17.60000 1.000 44.41000  ? 545  ASN A O     1 
ATOM   4388 C  CB    . ASN A 1 557 ? -63.84400 -68.96900 -14.61800 1.000 34.44000  ? 545  ASN A CB    1 
ATOM   4389 C  CG    . ASN A 1 557 ? -62.43600 -69.51100 -14.74800 1.000 34.28000  ? 545  ASN A CG    1 
ATOM   4390 O  OD1   . ASN A 1 557 ? -62.15900 -70.65000 -14.37300 1.000 43.21000  ? 545  ASN A OD1   1 
ATOM   4391 N  ND2   . ASN A 1 557 ? -61.53700 -68.69900 -15.27600 1.000 33.57000  ? 545  ASN A ND2   1 
ATOM   4392 N  N     . GLU A 1 558 ? -65.40700 -71.00600 -16.61100 1.000 43.98000  ? 546  GLU A N     1 
ATOM   4393 C  CA    . GLU A 1 558 ? -65.39300 -72.25700 -17.34500 1.000 48.26000  ? 546  GLU A CA    1 
ATOM   4394 C  C     . GLU A 1 558 ? -65.61100 -71.97700 -18.82200 1.000 50.79000  ? 546  GLU A C     1 
ATOM   4395 O  O     . GLU A 1 558 ? -64.93800 -72.55800 -19.68200 1.000 51.25000  ? 546  GLU A O     1 
ATOM   4396 C  CB    . GLU A 1 558 ? -66.45700 -73.23100 -16.82400 1.000 54.75000  ? 546  GLU A CB    1 
ATOM   4397 C  CG    . GLU A 1 558 ? -66.27000 -74.66100 -17.34700 1.000 59.51000  ? 546  GLU A CG    1 
ATOM   4398 C  CD    . GLU A 1 558 ? -67.44200 -75.56900 -17.02900 1.000 67.64000  ? 546  GLU A CD    1 
ATOM   4399 O  OE1   . GLU A 1 558 ? -67.38300 -76.75800 -17.41500 1.000 72.96000  ? 546  GLU A OE1   1 
ATOM   4400 O  OE2   . GLU A 1 558 ? -68.42000 -75.09800 -16.40200 1.000 67.71000  ? 546  GLU A OE2   1 
ATOM   4401 N  N     . GLN A 1 559 ? -66.54700 -71.07400 -19.11000 1.000 49.25000  ? 547  GLN A N     1 
ATOM   4402 C  CA    . GLN A 1 559 ? -66.90800 -70.78200 -20.49500 1.000 45.81000  ? 547  GLN A CA    1 
ATOM   4403 C  C     . GLN A 1 559 ? -65.75900 -70.12400 -21.24600 1.000 45.62000  ? 547  GLN A C     1 
ATOM   4404 O  O     . GLN A 1 559 ? -65.47900 -70.48200 -22.39800 1.000 47.47000  ? 547  GLN A O     1 
ATOM   4405 C  CB    . GLN A 1 559 ? -68.15400 -69.89400 -20.56100 1.000 44.45000  ? 547  GLN A CB    1 
ATOM   4406 C  CG    . GLN A 1 559 ? -69.46900 -70.66500 -20.61300 1.000 41.85000  ? 547  GLN A CG    1 
ATOM   4407 C  CD    . GLN A 1 559 ? -69.84500 -71.26100 -19.28200 1.000 47.13000  ? 547  GLN A CD    1 
ATOM   4408 O  OE1   . GLN A 1 559 ? -68.97900 -71.58000 -18.46100 1.000 53.00000  ? 547  GLN A OE1   1 
ATOM   4409 N  NE2   . GLN A 1 559 ? -71.14500 -71.39800 -19.04500 1.000 48.61000  ? 547  GLN A NE2   1 
ATOM   4410 N  N     . VAL A 1 560 ? -65.08500 -69.17400 -20.59300 1.000 43.48000  ? 548  VAL A N     1 
ATOM   4411 C  CA    . VAL A 1 560 ? -64.01800 -68.44200 -21.25400 1.000 41.16000  ? 548  VAL A CA    1 
ATOM   4412 C  C     . VAL A 1 560 ? -62.79000 -69.32400 -21.39700 1.000 42.85000  ? 548  VAL A C     1 
ATOM   4413 O  O     . VAL A 1 560 ? -61.99400 -69.14100 -22.32300 1.000 42.24000  ? 548  VAL A O     1 
ATOM   4414 C  CB    . VAL A 1 560 ? -63.65100 -67.15700 -20.49500 1.000 35.07000  ? 548  VAL A CB    1 
ATOM   4415 C  CG1   . VAL A 1 560 ? -62.99700 -67.49400 -19.19700 1.000 39.59000  ? 548  VAL A CG1   1 
ATOM   4416 C  CG2   . VAL A 1 560 ? -62.71800 -66.30300 -21.32300 1.000 33.35000  ? 548  VAL A CG2   1 
ATOM   4417 N  N     . ASP A 1 561 ? -62.64300 -70.28500 -20.48400 1.000 44.06000  ? 549  ASP A N     1 
ATOM   4418 C  CA    . ASP A 1 561 ? -61.52400 -71.22200 -20.53800 1.000 41.85000  ? 549  ASP A CA    1 
ATOM   4419 C  C     . ASP A 1 561 ? -61.58800 -72.01800 -21.82400 1.000 47.18000  ? 549  ASP A C     1 
ATOM   4420 O  O     . ASP A 1 561 ? -60.58900 -72.13700 -22.53400 1.000 51.34000  ? 549  ASP A O     1 
ATOM   4421 C  CB    . ASP A 1 561 ? -61.53200 -72.15800 -19.33000 1.000 48.76000  ? 549  ASP A CB    1 
ATOM   4422 C  CG    . ASP A 1 561 ? -60.12200 -72.50600 -18.84700 1.000 57.89000  ? 549  ASP A CG    1 
ATOM   4423 O  OD1   . ASP A 1 561 ? -59.30600 -73.00300 -19.65400 1.000 60.04000  ? 549  ASP A OD1   1 
ATOM   4424 O  OD2   . ASP A 1 561 ? -59.81800 -72.27300 -17.65000 1.000 60.00000  ? 549  ASP A OD2   1 
ATOM   4425 N  N     . LYS A 1 562 ? -62.77300 -72.55100 -22.13200 1.000 45.37000  ? 550  LYS A N     1 
ATOM   4426 C  CA    . LYS A 1 562 ? -62.97600 -73.31000 -23.36700 1.000 44.38000  ? 550  LYS A CA    1 
ATOM   4427 C  C     . LYS A 1 562 ? -62.59300 -72.50700 -24.60900 1.000 48.51000  ? 550  LYS A C     1 
ATOM   4428 O  O     . LYS A 1 562 ? -61.89700 -73.02400 -25.48400 1.000 54.15000  ? 550  LYS A O     1 
ATOM   4429 C  CB    . LYS A 1 562 ? -64.43100 -73.78400 -23.47000 1.000 47.32000  ? 550  LYS A CB    1 
ATOM   4430 C  CG    . LYS A 1 562 ? -64.72800 -74.97500 -22.57300 1.000 56.46000  ? 550  LYS A CG    1 
ATOM   4431 C  CD    . LYS A 1 562 ? -66.21400 -75.24700 -22.40700 1.000 60.50000  ? 550  LYS A CD    1 
ATOM   4432 C  CE    . LYS A 1 562 ? -66.43600 -76.47500 -21.51100 1.000 67.90000  ? 550  LYS A CE    1 
ATOM   4433 N  NZ    . LYS A 1 562 ? -65.58200 -76.44600 -20.27600 1.000 63.41000  ? 550  LYS A NZ    1 
ATOM   4434 N  N     . LEU A 1 563 ? -63.03600 -71.24700 -24.66900 1.000 46.89000  ? 551  LEU A N     1 
ATOM   4435 C  CA    . LEU A 1 563 ? -62.74800 -70.33400 -25.78900 1.000 42.36000  ? 551  LEU A CA    1 
ATOM   4436 C  C     . LEU A 1 563 ? -61.26300 -70.12900 -26.07400 1.000 42.65000  ? 551  LEU A C     1 
ATOM   4437 O  O     . LEU A 1 563 ? -60.80200 -70.33100 -27.19400 1.000 44.58000  ? 551  LEU A O     1 
ATOM   4438 C  CB    . LEU A 1 563 ? -63.37400 -68.96500 -25.52000 1.000 43.94000  ? 551  LEU A CB    1 
ATOM   4439 C  CG    . LEU A 1 563 ? -64.89000 -68.90300 -25.62000 1.000 48.64000  ? 551  LEU A CG    1 
ATOM   4440 C  CD1   . LEU A 1 563 ? -65.37700 -67.48300 -25.42500 1.000 47.18000  ? 551  LEU A CD1   1 
ATOM   4441 C  CD2   . LEU A 1 563 ? -65.30800 -69.41300 -26.96800 1.000 42.04000  ? 551  LEU A CD2   1 
ATOM   4442 N  N     . VAL A 1 564 ? -60.52600 -69.70000 -25.05600 1.000 41.97000  ? 552  VAL A N     1 
ATOM   4443 C  CA    . VAL A 1 564 ? -59.12000 -69.37300 -25.22900 1.000 46.05000  ? 552  VAL A CA    1 
ATOM   4444 C  C     . VAL A 1 564 ? -58.26100 -70.63100 -25.20300 1.000 50.73000  ? 552  VAL A C     1 
ATOM   4445 O  O     . VAL A 1 564 ? -57.05200 -70.56100 -25.40600 1.000 51.91000  ? 552  VAL A O     1 
ATOM   4446 C  CB    . VAL A 1 564 ? -58.63600 -68.39600 -24.14800 1.000 39.01000  ? 552  VAL A CB    1 
ATOM   4447 C  CG1   . VAL A 1 564 ? -59.71100 -67.37400 -23.88100 1.000 34.26000  ? 552  VAL A CG1   1 
ATOM   4448 C  CG2   . VAL A 1 564 ? -58.31500 -69.14300 -22.87400 1.000 38.51000  ? 552  VAL A CG2   1 
ATOM   4449 N  N     . SER A 1 565 ? -58.88500 -71.78100 -24.95700 1.000 52.09000  ? 553  SER A N     1 
ATOM   4450 C  CA    . SER A 1 565 ? -58.18300 -73.06000 -25.04100 1.000 52.09000  ? 553  SER A CA    1 
ATOM   4451 C  C     . SER A 1 565 ? -58.44800 -73.77600 -26.37600 1.000 59.37000  ? 553  SER A C     1 
ATOM   4452 O  O     . SER A 1 565 ? -59.18500 -74.76100 -26.43200 1.000 64.87000  ? 553  SER A O     1 
ATOM   4453 C  CB    . SER A 1 565 ? -58.58700 -73.95800 -23.87300 1.000 52.05000  ? 553  SER A CB    1 
ATOM   4454 O  OG    . SER A 1 565 ? -57.82000 -73.66700 -22.71700 1.000 53.62000  ? 553  SER A OG    1 
ATOM   4455 N  N     . ALA A 1 566 ? -57.87500 -73.24200 -27.45100 1.000 60.11000  ? 554  ALA A N     1 
ATOM   4456 C  CA    . ALA A 1 566 ? -57.79300 -73.94500 -28.73100 1.000 55.43000  ? 554  ALA A CA    1 
ATOM   4457 C  C     . ALA A 1 566 ? -56.31400 -74.22200 -28.98300 1.000 67.10000  ? 554  ALA A C     1 
ATOM   4458 O  O     . ALA A 1 566 ? -55.85500 -74.31000 -30.13200 1.000 58.36000  ? 554  ALA A O     1 
ATOM   4459 C  CB    . ALA A 1 566 ? -58.38000 -73.13300 -29.83800 1.000 47.41000  ? 554  ALA A CB    1 
ATOM   4460 N  N     . GLY A 1 567 ? -55.57100 -74.31900 -27.87700 1.000 66.95000  ? 555  GLY A N     1 
ATOM   4461 C  CA    . GLY A 1 567 ? -54.14600 -74.57800 -27.90500 1.000 57.72000  ? 555  GLY A CA    1 
ATOM   4462 C  C     . GLY A 1 567 ? -53.79000 -75.46400 -26.73200 1.000 55.83000  ? 555  GLY A C     1 
ATOM   4463 O  O     . GLY A 1 567 ? -52.83700 -75.19300 -26.01700 1.000 52.42000  ? 555  GLY A O     1 
ATOM   4464 N  N     . ILE B 2 5   ? -9.35600  -70.45000 34.87000  1.000 93.40000  ? 5    ILE B N     1 
ATOM   4465 C  CA    . ILE B 2 5   ? -10.16300 -71.56800 34.37700  1.000 90.14000  ? 5    ILE B CA    1 
ATOM   4466 C  C     . ILE B 2 5   ? -9.77100  -71.93100 32.93600  1.000 84.94000  ? 5    ILE B C     1 
ATOM   4467 O  O     . ILE B 2 5   ? -9.71600  -71.06000 32.06500  1.000 82.85000  ? 5    ILE B O     1 
ATOM   4468 C  CB    . ILE B 2 5   ? -11.67500 -71.23800 34.43800  1.000 80.56000  ? 5    ILE B CB    1 
ATOM   4469 C  CG1   . ILE B 2 5   ? -11.97000 -70.32800 35.64200  1.000 81.25000  ? 5    ILE B CG1   1 
ATOM   4470 C  CG2   . ILE B 2 5   ? -12.50200 -72.52400 34.46300  1.000 76.00000  ? 5    ILE B CG2   1 
ATOM   4471 C  CD1   . ILE B 2 5   ? -13.41000 -69.82900 35.73700  1.000 65.09000  ? 5    ILE B CD1   1 
ATOM   4472 N  N     . GLU B 2 6   ? -9.48900  -73.20500 32.68300  1.000 78.78000  ? 6    GLU B N     1 
ATOM   4473 C  CA    . GLU B 2 6   ? -9.08100  -73.62000 31.34100  1.000 79.64000  ? 6    GLU B CA    1 
ATOM   4474 C  C     . GLU B 2 6   ? -10.27000 -73.66700 30.38600  1.000 75.05000  ? 6    GLU B C     1 
ATOM   4475 O  O     . GLU B 2 6   ? -11.37600 -74.07300 30.75700  1.000 69.97000  ? 6    GLU B O     1 
ATOM   4476 C  CB    . GLU B 2 6   ? -8.37100  -74.97600 31.37800  1.000 81.79000  ? 6    GLU B CB    1 
ATOM   4477 C  CG    . GLU B 2 6   ? -6.91600  -74.87100 31.80400  1.000 95.91000  ? 6    GLU B CG    1 
ATOM   4478 C  CD    . GLU B 2 6   ? -6.16700  -76.17500 31.66400  1.000 101.33000 ? 6    GLU B CD    1 
ATOM   4479 O  OE1   . GLU B 2 6   ? -6.78900  -77.17300 31.24200  1.000 103.57000 ? 6    GLU B OE1   1 
ATOM   4480 O  OE2   . GLU B 2 6   ? -4.95600  -76.19900 31.97700  1.000 101.82000 ? 6    GLU B OE2   1 
ATOM   4481 N  N     . THR B 2 7   ? -10.02500 -73.25000 29.14800  1.000 69.18000  ? 7    THR B N     1 
ATOM   4482 C  CA    . THR B 2 7   ? -11.09800 -73.04900 28.18400  1.000 62.57000  ? 7    THR B CA    1 
ATOM   4483 C  C     . THR B 2 7   ? -11.52700 -74.34100 27.50600  1.000 60.44000  ? 7    THR B C     1 
ATOM   4484 O  O     . THR B 2 7   ? -10.80000 -75.33700 27.50500  1.000 59.08000  ? 7    THR B O     1 
ATOM   4485 C  CB    . THR B 2 7   ? -10.69500 -72.02100 27.08600  1.000 55.05000  ? 7    THR B CB    1 
ATOM   4486 O  OG1   . THR B 2 7   ? -9.73700  -72.59900 26.18200  1.000 50.78000  ? 7    THR B OG1   1 
ATOM   4487 C  CG2   . THR B 2 7   ? -10.11400 -70.77500 27.72200  1.000 47.93000  ? 7    THR B CG2   1 
ATOM   4488 N  N     . VAL B 2 8   ? -12.72300 -74.29500 26.92900  1.000 57.41000  ? 8    VAL B N     1 
ATOM   4489 C  CA    . VAL B 2 8   ? -13.29100 -75.40500 26.17600  1.000 54.68000  ? 8    VAL B CA    1 
ATOM   4490 C  C     . VAL B 2 8   ? -13.05900 -75.17300 24.69000  1.000 54.55000  ? 8    VAL B C     1 
ATOM   4491 O  O     . VAL B 2 8   ? -13.64800 -74.25500 24.11900  1.000 62.64000  ? 8    VAL B O     1 
ATOM   4492 C  CB    . VAL B 2 8   ? -14.82300 -75.54700 26.43300  1.000 49.86000  ? 8    VAL B CB    1 
ATOM   4493 C  CG1   . VAL B 2 8   ? -15.43400 -76.54200 25.47700  1.000 52.66000  ? 8    VAL B CG1   1 
ATOM   4494 C  CG2   . VAL B 2 8   ? -15.11200 -75.94400 27.87600  1.000 49.70000  ? 8    VAL B CG2   1 
ATOM   4495 N  N     . PRO B 2 9   ? -12.20200 -75.98600 24.05500  1.000 54.12000  ? 9    PRO B N     1 
ATOM   4496 C  CA    . PRO B 2 9   ? -11.97300 -75.77800 22.61500  1.000 54.24000  ? 9    PRO B CA    1 
ATOM   4497 C  C     . PRO B 2 9   ? -13.28100 -75.77400 21.82200  1.000 52.35000  ? 9    PRO B C     1 
ATOM   4498 O  O     . PRO B 2 9   ? -14.17300 -76.57300 22.10700  1.000 53.29000  ? 9    PRO B O     1 
ATOM   4499 C  CB    . PRO B 2 9   ? -11.08900 -76.97400 22.21900  1.000 49.14000  ? 9    PRO B CB    1 
ATOM   4500 C  CG    . PRO B 2 9   ? -11.26800 -77.97900 23.32400  1.000 44.30000  ? 9    PRO B CG    1 
ATOM   4501 C  CD    . PRO B 2 9   ? -11.45800 -77.14700 24.56400  1.000 53.27000  ? 9    PRO B CD    1 
ATOM   4502 N  N     . VAL B 2 10  ? -13.40400 -74.86500 20.86400  1.000 51.31000  ? 10   VAL B N     1 
ATOM   4503 C  CA    . VAL B 2 10  ? -14.58700 -74.82100 20.02000  1.000 49.30000  ? 10   VAL B CA    1 
ATOM   4504 C  C     . VAL B 2 10  ? -14.17400 -74.67700 18.57700  1.000 46.57000  ? 10   VAL B C     1 
ATOM   4505 O  O     . VAL B 2 10  ? -13.11100 -74.12400 18.29500  1.000 46.68000  ? 10   VAL B O     1 
ATOM   4506 C  CB    . VAL B 2 10  ? -15.51300 -73.66700 20.38100  1.000 45.86000  ? 10   VAL B CB    1 
ATOM   4507 C  CG1   . VAL B 2 10  ? -16.86900 -73.91500 19.76800  1.000 48.09000  ? 10   VAL B CG1   1 
ATOM   4508 C  CG2   . VAL B 2 10  ? -15.63100 -73.53000 21.89000  1.000 45.72000  ? 10   VAL B CG2   1 
ATOM   4509 N  N     . LYS B 2 11  ? -15.01400 -75.18100 17.67800  1.000 45.55000  ? 11   LYS B N     1 
ATOM   4510 C  CA    . LYS B 2 11  ? -14.70300 -75.21500 16.24700  1.000 54.88000  ? 11   LYS B CA    1 
ATOM   4511 C  C     . LYS B 2 11  ? -15.85100 -74.66500 15.42600  1.000 54.02000  ? 11   LYS B C     1 
ATOM   4512 O  O     . LYS B 2 11  ? -16.98500 -74.60400 15.89900  1.000 55.45000  ? 11   LYS B O     1 
ATOM   4513 C  CB    . LYS B 2 11  ? -14.40500 -76.64600 15.78200  1.000 64.19000  ? 11   LYS B CB    1 
ATOM   4514 C  CG    . LYS B 2 11  ? -12.99100 -77.15500 16.04400  1.000 66.07000  ? 11   LYS B CG    1 
ATOM   4515 C  CD    . LYS B 2 11  ? -12.83200 -78.56000 15.45800  1.000 71.38000  ? 11   LYS B CD    1 
ATOM   4516 C  CE    . LYS B 2 11  ? -13.70700 -79.58400 16.17700  1.000 68.88000  ? 11   LYS B CE    1 
ATOM   4517 N  NZ    . LYS B 2 11  ? -12.99400 -80.19600 17.34200  1.000 70.28000  ? 11   LYS B NZ    1 
ATOM   4518 N  N     . LEU B 2 12  ? -15.56500 -74.27400 14.18900  1.000 51.68000  ? 12   LEU B N     1 
ATOM   4519 C  CA    . LEU B 2 12  ? -16.63700 -73.91900 13.26900  1.000 53.73000  ? 12   LEU B CA    1 
ATOM   4520 C  C     . LEU B 2 12  ? -17.19300 -75.19800 12.67700  1.000 57.80000  ? 12   LEU B C     1 
ATOM   4521 O  O     . LEU B 2 12  ? -16.59300 -76.26100 12.82800  1.000 64.73000  ? 12   LEU B O     1 
ATOM   4522 C  CB    . LEU B 2 12  ? -16.14900 -72.99300 12.15300  1.000 47.05000  ? 12   LEU B CB    1 
ATOM   4523 C  CG    . LEU B 2 12  ? -15.84000 -71.52900 12.46800  1.000 43.53000  ? 12   LEU B CG    1 
ATOM   4524 C  CD1   . LEU B 2 12  ? -15.82700 -70.70300 11.19900  1.000 44.09000  ? 12   LEU B CD1   1 
ATOM   4525 C  CD2   . LEU B 2 12  ? -16.81800 -70.94500 13.45000  1.000 45.78000  ? 12   LEU B CD2   1 
ATOM   4526 N  N     . LYS B 2 13  ? -18.34200 -75.10400 12.01500  1.000 58.03000  ? 13   LYS B N     1 
ATOM   4527 C  CA    . LYS B 2 13  ? -18.78500 -76.18900 11.15200  1.000 60.95000  ? 13   LYS B CA    1 
ATOM   4528 C  C     . LYS B 2 13  ? -17.67500 -76.43500 10.13600  1.000 62.58000  ? 13   LYS B C     1 
ATOM   4529 O  O     . LYS B 2 13  ? -16.82200 -75.57000 9.90300   1.000 57.51000  ? 13   LYS B O     1 
ATOM   4530 C  CB    . LYS B 2 13  ? -20.10200 -75.86000 10.43500  1.000 60.24000  ? 13   LYS B CB    1 
ATOM   4531 C  CG    . LYS B 2 13  ? -21.37600 -76.35600 11.11600  1.000 55.33000  ? 13   LYS B CG    1 
ATOM   4532 C  CD    . LYS B 2 13  ? -21.85000 -75.42100 12.21800  1.000 56.91000  ? 13   LYS B CD    1 
ATOM   4533 C  CE    . LYS B 2 13  ? -23.33700 -75.66200 12.53500  1.000 60.56000  ? 13   LYS B CE    1 
ATOM   4534 N  NZ    . LYS B 2 13  ? -23.87900 -74.72300 13.58000  1.000 65.17000  ? 13   LYS B NZ    1 
ATOM   4535 N  N     . PRO B 2 14  ? -17.68200 -77.61800 9.52200   1.000 71.54000  ? 14   PRO B N     1 
ATOM   4536 C  CA    . PRO B 2 14  ? -16.60100 -77.97100 8.60100   1.000 70.46000  ? 14   PRO B CA    1 
ATOM   4537 C  C     . PRO B 2 14  ? -16.78700 -77.35700 7.21200   1.000 62.41000  ? 14   PRO B C     1 
ATOM   4538 O  O     . PRO B 2 14  ? -17.84600 -77.47900 6.59700   1.000 61.08000  ? 14   PRO B O     1 
ATOM   4539 C  CB    . PRO B 2 14  ? -16.68500 -79.49700 8.54900   1.000 71.72000  ? 14   PRO B CB    1 
ATOM   4540 C  CG    . PRO B 2 14  ? -18.14000 -79.78100 8.73700   1.000 72.64000  ? 14   PRO B CG    1 
ATOM   4541 C  CD    . PRO B 2 14  ? -18.67700 -78.69700 9.65400   1.000 70.78000  ? 14   PRO B CD    1 
ATOM   4542 N  N     . GLY B 2 15  ? -15.74400 -76.69900 6.72100   1.000 65.88000  ? 15   GLY B N     1 
ATOM   4543 C  CA    . GLY B 2 15  ? -15.79900 -76.09700 5.40700   1.000 60.48000  ? 15   GLY B CA    1 
ATOM   4544 C  C     . GLY B 2 15  ? -16.45800 -74.73900 5.47500   1.000 66.32000  ? 15   GLY B C     1 
ATOM   4545 O  O     . GLY B 2 15  ? -16.96600 -74.23500 4.47600   1.000 68.26000  ? 15   GLY B O     1 
ATOM   4546 N  N     . MET B 2 16  ? -16.44500 -74.13500 6.66000   1.000 62.64000  ? 16   MET B N     1 
ATOM   4547 C  CA    . MET B 2 16  ? -17.06300 -72.82800 6.83900   1.000 54.54000  ? 16   MET B CA    1 
ATOM   4548 C  C     . MET B 2 16  ? -16.09700 -71.78600 7.41600   1.000 52.91000  ? 16   MET B C     1 
ATOM   4549 O  O     . MET B 2 16  ? -15.30000 -72.08900 8.30600   1.000 53.10000  ? 16   MET B O     1 
ATOM   4550 C  CB    . MET B 2 16  ? -18.29400 -72.96300 7.73300   1.000 51.50000  ? 16   MET B CB    1 
ATOM   4551 C  CG    . MET B 2 16  ? -19.59600 -72.97300 6.95400   1.000 50.74000  ? 16   MET B CG    1 
ATOM   4552 S  SD    . MET B 2 16  ? -20.97100 -73.57300 7.94300   1.000 64.09000  ? 16   MET B SD    1 
ATOM   4553 C  CE    . MET B 2 16  ? -22.35800 -72.98900 6.95400   1.000 51.81000  ? 16   MET B CE    1 
ATOM   4554 N  N     . ASP B 2 17  ? -16.16800 -70.56300 6.89500   1.000 46.97000  ? 17   ASP B N     1 
ATOM   4555 C  CA    . ASP B 2 17  ? -15.37200 -69.46600 7.43000   1.000 40.71000  ? 17   ASP B CA    1 
ATOM   4556 C  C     . ASP B 2 17  ? -16.20500 -68.59600 8.36900   1.000 43.79000  ? 17   ASP B C     1 
ATOM   4557 O  O     . ASP B 2 17  ? -17.44800 -68.65600 8.36800   1.000 37.11000  ? 17   ASP B O     1 
ATOM   4558 C  CB    . ASP B 2 17  ? -14.80100 -68.60800 6.30400   1.000 41.44000  ? 17   ASP B CB    1 
ATOM   4559 C  CG    . ASP B 2 17  ? -13.49200 -67.91300 6.69700   1.000 50.21000  ? 17   ASP B CG    1 
ATOM   4560 O  OD1   . ASP B 2 17  ? -13.08700 -68.01000 7.88100   1.000 45.31000  ? 17   ASP B OD1   1 
ATOM   4561 O  OD2   . ASP B 2 17  ? -12.86300 -67.26900 5.82100   1.000 55.90000  ? 17   ASP B OD2   1 
ATOM   4562 N  N     . GLY B 2 18  ? -15.50200 -67.78300 9.16200   1.000 41.97000  ? 18   GLY B N     1 
ATOM   4563 C  CA    . GLY B 2 18  ? -16.11100 -66.88100 10.12700  1.000 34.66000  ? 18   GLY B CA    1 
ATOM   4564 C  C     . GLY B 2 18  ? -16.94400 -65.79600 9.46800   1.000 35.54000  ? 18   GLY B C     1 
ATOM   4565 O  O     . GLY B 2 18  ? -16.80700 -65.53900 8.26900   1.000 35.99000  ? 18   GLY B O     1 
ATOM   4566 N  N     . PRO B 2 19  ? -17.82100 -65.14900 10.24600  1.000 33.33000  ? 19   PRO B N     1 
ATOM   4567 C  CA    . PRO B 2 19  ? -18.74000 -64.15500 9.67800   1.000 29.34000  ? 19   PRO B CA    1 
ATOM   4568 C  C     . PRO B 2 19  ? -18.03700 -62.89800 9.16600   1.000 27.17000  ? 19   PRO B C     1 
ATOM   4569 O  O     . PRO B 2 19  ? -17.01900 -62.46000 9.69600   1.000 27.89000  ? 19   PRO B O     1 
ATOM   4570 C  CB    . PRO B 2 19  ? -19.65900 -63.82100 10.85700  1.000 29.98000  ? 19   PRO B CB    1 
ATOM   4571 C  CG    . PRO B 2 19  ? -18.83700 -64.10500 12.07400  1.000 32.24000  ? 19   PRO B CG    1 
ATOM   4572 C  CD    . PRO B 2 19  ? -17.97100 -65.27700 11.71000  1.000 32.86000  ? 19   PRO B CD    1 
ATOM   4573 N  N     . LYS B 2 20  ? -18.60500 -62.31400 8.12700   1.000 24.87000  ? 20   LYS B N     1 
ATOM   4574 C  CA    . LYS B 2 20  ? -18.08400 -61.06700 7.60900   1.000 22.41000  ? 20   LYS B CA    1 
ATOM   4575 C  C     . LYS B 2 20  ? -19.21800 -60.10400 7.20000   1.000 25.53000  ? 20   LYS B C     1 
ATOM   4576 O  O     . LYS B 2 20  ? -19.32600 -59.71900 6.04100   1.000 25.20000  ? 20   LYS B O     1 
ATOM   4577 C  CB    . LYS B 2 20  ? -17.16000 -61.35700 6.43600   1.000 24.06000  ? 20   LYS B CB    1 
ATOM   4578 C  CG    . LYS B 2 20  ? -15.91300 -62.17700 6.79000   1.000 22.66000  ? 20   LYS B CG    1 
ATOM   4579 C  CD    . LYS B 2 20  ? -15.03800 -62.36200 5.54400   1.000 19.04000  ? 20   LYS B CD    1 
ATOM   4580 C  CE    . LYS B 2 20  ? -13.74900 -63.11700 5.84000   1.000 31.04000  ? 20   LYS B CE    1 
ATOM   4581 N  NZ    . LYS B 2 20  ? -13.03300 -63.52800 4.57800   1.000 35.06000  ? 20   LYS B NZ    1 
ATOM   4582 N  N     . VAL B 2 21  ? -20.04900 -59.72000 8.17200   1.000 27.38000  ? 21   VAL B N     1 
ATOM   4583 C  CA    . VAL B 2 21  ? -21.20400 -58.83200 7.96200   1.000 24.96000  ? 21   VAL B CA    1 
ATOM   4584 C  C     . VAL B 2 21  ? -20.87000 -57.37600 8.29100   1.000 28.50000  ? 21   VAL B C     1 
ATOM   4585 O  O     . VAL B 2 21  ? -20.39400 -57.09200 9.37900   1.000 24.77000  ? 21   VAL B O     1 
ATOM   4586 C  CB    . VAL B 2 21  ? -22.39100 -59.25200 8.84900   1.000 23.60000  ? 21   VAL B CB    1 
ATOM   4587 C  CG1   . VAL B 2 21  ? -23.66000 -58.54400 8.43000   1.000 24.78000  ? 21   VAL B CG1   1 
ATOM   4588 C  CG2   . VAL B 2 21  ? -22.57200 -60.74400 8.79300   1.000 27.83000  ? 21   VAL B CG2   1 
ATOM   4589 N  N     . LYS B 2 22  ? -21.13400 -56.46200 7.36000   1.000 28.99000  ? 22   LYS B N     1 
ATOM   4590 C  CA    . LYS B 2 22  ? -20.83200 -55.04300 7.58500   1.000 27.67000  ? 22   LYS B CA    1 
ATOM   4591 C  C     . LYS B 2 22  ? -21.68100 -54.43600 8.69000   1.000 23.25000  ? 22   LYS B C     1 
ATOM   4592 O  O     . LYS B 2 22  ? -22.86500 -54.72100 8.82700   1.000 28.82000  ? 22   LYS B O     1 
ATOM   4593 C  CB    . LYS B 2 22  ? -21.01400 -54.24000 6.28500   1.000 25.84000  ? 22   LYS B CB    1 
ATOM   4594 C  CG    . LYS B 2 22  ? -19.84600 -54.39000 5.33400   1.000 32.21000  ? 22   LYS B CG    1 
ATOM   4595 C  CD    . LYS B 2 22  ? -20.19300 -53.93600 3.93600   1.000 46.03000  ? 22   LYS B CD    1 
ATOM   4596 C  CE    . LYS B 2 22  ? -19.92900 -52.44300 3.73300   1.000 48.13000  ? 22   LYS B CE    1 
ATOM   4597 N  NZ    . LYS B 2 22  ? -19.71800 -52.12900 2.28100   1.000 46.63000  ? 22   LYS B NZ    1 
ATOM   4598 N  N     . GLN B 2 23  ? -21.06300 -53.59200 9.49700   1.000 26.26000  ? 23   GLN B N     1 
ATOM   4599 C  CA    . GLN B 2 23  ? -21.81200 -52.87000 10.51400  1.000 24.85000  ? 23   GLN B CA    1 
ATOM   4600 C  C     . GLN B 2 23  ? -22.78700 -51.92200 9.84100   1.000 25.31000  ? 23   GLN B C     1 
ATOM   4601 O  O     . GLN B 2 23  ? -22.49200 -51.37000 8.77800   1.000 29.73000  ? 23   GLN B O     1 
ATOM   4602 C  CB    . GLN B 2 23  ? -20.86200 -52.09400 11.41600  1.000 21.37000  ? 23   GLN B CB    1 
ATOM   4603 C  CG    . GLN B 2 23  ? -21.57100 -51.15000 12.35800  1.000 23.76000  ? 23   GLN B CG    1 
ATOM   4604 C  CD    . GLN B 2 23  ? -22.25700 -51.85400 13.51800  1.000 25.17000  ? 23   GLN B CD    1 
ATOM   4605 O  OE1   . GLN B 2 23  ? -21.75100 -52.85000 14.07600  1.000 21.47000  ? 23   GLN B OE1   1 
ATOM   4606 N  NE2   . GLN B 2 23  ? -23.40700 -51.32800 13.90300  1.000 29.55000  ? 23   GLN B NE2   1 
ATOM   4607 N  N     . TRP B 2 24  ? -23.94500 -51.71900 10.44400  1.000 29.26000  ? 24   TRP B N     1 
ATOM   4608 C  CA    . TRP B 2 24  ? -24.86600 -50.73400 9.88400   1.000 27.93000  ? 24   TRP B CA    1 
ATOM   4609 C  C     . TRP B 2 24  ? -24.84200 -49.43300 10.68400  1.000 27.79000  ? 24   TRP B C     1 
ATOM   4610 O  O     . TRP B 2 24  ? -24.28400 -49.36100 11.77000  1.000 32.71000  ? 24   TRP B O     1 
ATOM   4611 C  CB    . TRP B 2 24  ? -26.26800 -51.31000 9.81100   1.000 29.41000  ? 24   TRP B CB    1 
ATOM   4612 C  CG    . TRP B 2 24  ? -26.83300 -51.80500 11.09300  1.000 27.34000  ? 24   TRP B CG    1 
ATOM   4613 C  CD1   . TRP B 2 24  ? -27.23700 -51.04200 12.15800  1.000 31.10000  ? 24   TRP B CD1   1 
ATOM   4614 C  CD2   . TRP B 2 24  ? -27.14700 -53.16400 11.42700  1.000 25.53000  ? 24   TRP B CD2   1 
ATOM   4615 N  NE1   . TRP B 2 24  ? -27.76400 -51.84700 13.14800  1.000 32.11000  ? 24   TRP B NE1   1 
ATOM   4616 C  CE2   . TRP B 2 24  ? -27.72100 -53.15500 12.72500  1.000 34.50000  ? 24   TRP B CE2   1 
ATOM   4617 C  CE3   . TRP B 2 24  ? -26.99600 -54.37700 10.77200  1.000 21.35000  ? 24   TRP B CE3   1 
ATOM   4618 C  CZ2   . TRP B 2 24  ? -28.13100 -54.33000 13.38100  1.000 24.67000  ? 24   TRP B CZ2   1 
ATOM   4619 C  CZ3   . TRP B 2 24  ? -27.40200 -55.53000 11.41500  1.000 28.59000  ? 24   TRP B CZ3   1 
ATOM   4620 C  CH2   . TRP B 2 24  ? -27.96000 -55.50200 12.71400  1.000 23.32000  ? 24   TRP B CH2   1 
ATOM   4621 N  N     . PRO B 2 25  ? -25.43300 -48.37900 10.14100  1.000 31.70000  ? 25   PRO B N     1 
ATOM   4622 C  CA    . PRO B 2 25  ? -25.21900 -47.10000 10.83500  1.000 28.09000  ? 25   PRO B CA    1 
ATOM   4623 C  C     . PRO B 2 25  ? -26.07500 -47.00100 12.08600  1.000 28.17000  ? 25   PRO B C     1 
ATOM   4624 O  O     . PRO B 2 25  ? -27.21000 -47.50100 12.07800  1.000 33.08000  ? 25   PRO B O     1 
ATOM   4625 C  CB    . PRO B 2 25  ? -25.63000 -46.06600 9.78100   1.000 28.29000  ? 25   PRO B CB    1 
ATOM   4626 C  CG    . PRO B 2 25  ? -26.61700 -46.78800 8.92500   1.000 25.56000  ? 25   PRO B CG    1 
ATOM   4627 C  CD    . PRO B 2 25  ? -26.24200 -48.24200 8.91900   1.000 28.90000  ? 25   PRO B CD    1 
ATOM   4628 N  N     . LEU B 2 26  ? -25.53700 -46.38300 13.13100  1.000 26.19000  ? 26   LEU B N     1 
ATOM   4629 C  CA    . LEU B 2 26  ? -26.21100 -46.29100 14.42800  1.000 25.00000  ? 26   LEU B CA    1 
ATOM   4630 C  C     . LEU B 2 26  ? -26.58300 -44.85800 14.76200  1.000 24.56000  ? 26   LEU B C     1 
ATOM   4631 O  O     . LEU B 2 26  ? -25.92900 -43.93300 14.26500  1.000 27.26000  ? 26   LEU B O     1 
ATOM   4632 C  CB    . LEU B 2 26  ? -25.30900 -46.85100 15.53900  1.000 23.15000  ? 26   LEU B CB    1 
ATOM   4633 C  CG    . LEU B 2 26  ? -24.90500 -48.31900 15.39000  1.000 24.07000  ? 26   LEU B CG    1 
ATOM   4634 C  CD1   . LEU B 2 26  ? -24.03000 -48.78800 16.54600  1.000 21.53000  ? 26   LEU B CD1   1 
ATOM   4635 C  CD2   . LEU B 2 26  ? -26.12900 -49.18500 15.23600  1.000 20.94000  ? 26   LEU B CD2   1 
ATOM   4636 N  N     . THR B 2 27  ? -27.59600 -44.65400 15.61000  1.000 19.44000  ? 27   THR B N     1 
ATOM   4637 C  CA    . THR B 2 27  ? -27.86200 -43.29000 16.08100  1.000 20.11000  ? 27   THR B CA    1 
ATOM   4638 C  C     . THR B 2 27  ? -26.83500 -42.84900 17.11800  1.000 25.09000  ? 27   THR B C     1 
ATOM   4639 O  O     . THR B 2 27  ? -26.09800 -43.65000 17.69600  1.000 31.41000  ? 27   THR B O     1 
ATOM   4640 C  CB    . THR B 2 27  ? -29.28100 -43.12100 16.69600  1.000 25.41000  ? 27   THR B CB    1 
ATOM   4641 O  OG1   . THR B 2 27  ? -29.44100 -43.99400 17.82600  1.000 37.23000  ? 27   THR B OG1   1 
ATOM   4642 C  CG2   . THR B 2 27  ? -30.37700 -43.41600 15.68100  1.000 17.70000  ? 27   THR B CG2   1 
ATOM   4643 N  N     . GLU B 2 28  ? -26.78800 -41.55600 17.34700  1.000 28.08000  ? 28   GLU B N     1 
ATOM   4644 C  CA    . GLU B 2 28  ? -25.88000 -41.00000 18.32700  1.000 25.44000  ? 28   GLU B CA    1 
ATOM   4645 C  C     . GLU B 2 28  ? -26.08200 -41.61500 19.68600  1.000 23.11000  ? 28   GLU B C     1 
ATOM   4646 O  O     . GLU B 2 28  ? -25.12800 -42.05000 20.29800  1.000 28.12000  ? 28   GLU B O     1 
ATOM   4647 C  CB    . GLU B 2 28  ? -26.07900 -39.49900 18.41100  1.000 28.31000  ? 28   GLU B CB    1 
ATOM   4648 C  CG    . GLU B 2 28  ? -24.99700 -38.80100 19.16600  1.000 32.82000  ? 28   GLU B CG    1 
ATOM   4649 C  CD    . GLU B 2 28  ? -24.98400 -37.35000 18.83300  1.000 33.83000  ? 28   GLU B CD    1 
ATOM   4650 O  OE1   . GLU B 2 28  ? -23.99100 -36.68300 19.18400  1.000 41.49000  ? 28   GLU B OE1   1 
ATOM   4651 O  OE2   . GLU B 2 28  ? -25.97900 -36.88800 18.21800  1.000 32.80000  ? 28   GLU B OE2   1 
ATOM   4652 N  N     . GLU B 2 29  ? -27.32500 -41.61200 20.15700  1.000 24.22000  ? 29   GLU B N     1 
ATOM   4653 C  CA    . GLU B 2 29  ? -27.71800 -42.34200 21.35900  1.000 29.30000  ? 29   GLU B CA    1 
ATOM   4654 C  C     . GLU B 2 29  ? -26.98800 -43.67900 21.51100  1.000 32.60000  ? 29   GLU B C     1 
ATOM   4655 O  O     . GLU B 2 29  ? -26.29000 -43.91400 22.50200  1.000 31.57000  ? 29   GLU B O     1 
ATOM   4656 C  CB    . GLU B 2 29  ? -29.21700 -42.62400 21.33200  1.000 33.88000  ? 29   GLU B CB    1 
ATOM   4657 C  CG    . GLU B 2 29  ? -30.08700 -41.78800 22.24300  1.000 39.34000  ? 29   GLU B CG    1 
ATOM   4658 C  CD    . GLU B 2 29  ? -31.55600 -42.24800 22.17300  1.000 55.93000  ? 29   GLU B CD    1 
ATOM   4659 O  OE1   . GLU B 2 29  ? -31.86600 -43.13500 21.33400  1.000 50.92000  ? 29   GLU B OE1   1 
ATOM   4660 O  OE2   . GLU B 2 29  ? -32.39800 -41.73200 22.94700  1.000 53.67000  ? 29   GLU B OE2   1 
ATOM   4661 N  N     . LYS B 2 30  ? -27.17300 -44.54800 20.51500  1.000 30.52000  ? 30   LYS B N     1 
ATOM   4662 C  CA    . LYS B 2 30  ? -26.63800 -45.90100 20.55900  1.000 25.72000  ? 30   LYS B CA    1 
ATOM   4663 C  C     . LYS B 2 30  ? -25.12200 -45.94800 20.50600  1.000 24.38000  ? 30   LYS B C     1 
ATOM   4664 O  O     . LYS B 2 30  ? -24.51000 -46.76100 21.17500  1.000 28.66000  ? 30   LYS B O     1 
ATOM   4665 C  CB    . LYS B 2 30  ? -27.21700 -46.73500 19.41100  1.000 26.30000  ? 30   LYS B CB    1 
ATOM   4666 C  CG    . LYS B 2 30  ? -28.69500 -47.06900 19.57700  1.000 24.92000  ? 30   LYS B CG    1 
ATOM   4667 C  CD    . LYS B 2 30  ? -29.19200 -47.81800 18.36400  1.000 25.04000  ? 30   LYS B CD    1 
ATOM   4668 C  CE    . LYS B 2 30  ? -30.69300 -47.70600 18.22500  1.000 31.96000  ? 30   LYS B CE    1 
ATOM   4669 N  NZ    . LYS B 2 30  ? -31.36500 -48.82600 18.94300  1.000 41.03000  ? 30   LYS B NZ    1 
ATOM   4670 N  N     . ILE B 2 31  ? -24.50200 -45.10000 19.69700  1.000 24.76000  ? 31   ILE B N     1 
ATOM   4671 C  CA    . ILE B 2 31  ? -23.04500 -45.12300 19.65200  1.000 27.18000  ? 31   ILE B CA    1 
ATOM   4672 C  C     . ILE B 2 31  ? -22.42600 -44.71200 20.98900  1.000 27.56000  ? 31   ILE B C     1 
ATOM   4673 O  O     . ILE B 2 31  ? -21.44100 -45.30700 21.43100  1.000 28.61000  ? 31   ILE B O     1 
ATOM   4674 C  CB    . ILE B 2 31  ? -22.49000 -44.21800 18.57100  1.000 20.85000  ? 31   ILE B CB    1 
ATOM   4675 C  CG1   . ILE B 2 31  ? -22.74700 -44.84100 17.20800  1.000 18.49000  ? 31   ILE B CG1   1 
ATOM   4676 C  CG2   . ILE B 2 31  ? -20.98200 -43.98900 18.77600  1.000 17.95000  ? 31   ILE B CG2   1 
ATOM   4677 C  CD1   . ILE B 2 31  ? -22.49700 -43.87500 16.10100  1.000 20.57000  ? 31   ILE B CD1   1 
ATOM   4678 N  N     . LYS B 2 32  ? -22.99600 -43.69100 21.62100  1.000 21.90000  ? 32   LYS B N     1 
ATOM   4679 C  CA    . LYS B 2 32  ? -22.50700 -43.23900 22.91700  1.000 23.51000  ? 32   LYS B CA    1 
ATOM   4680 C  C     . LYS B 2 32  ? -22.66800 -44.32300 23.98100  1.000 26.50000  ? 32   LYS B C     1 
ATOM   4681 O  O     . LYS B 2 32  ? -21.77800 -44.53200 24.80900  1.000 28.35000  ? 32   LYS B O     1 
ATOM   4682 C  CB    . LYS B 2 32  ? -23.23700 -41.96000 23.35900  1.000 27.83000  ? 32   LYS B CB    1 
ATOM   4683 C  CG    . LYS B 2 32  ? -22.60200 -40.65400 22.86900  1.000 27.54000  ? 32   LYS B CG    1 
ATOM   4684 C  CD    . LYS B 2 32  ? -23.47800 -39.48300 23.23300  1.000 30.30000  ? 32   LYS B CD    1 
ATOM   4685 C  CE    . LYS B 2 32  ? -22.96700 -38.18100 22.66300  1.000 31.18000  ? 32   LYS B CE    1 
ATOM   4686 N  NZ    . LYS B 2 32  ? -22.26200 -37.36500 23.70000  1.000 42.43000  ? 32   LYS B NZ    1 
ATOM   4687 N  N     . ALA B 2 33  ? -23.79800 -45.01200 23.96900  1.000 26.39000  ? 33   ALA B N     1 
ATOM   4688 C  CA    . ALA B 2 33  ? -23.97400 -46.11500 24.89400  1.000 26.64000  ? 33   ALA B CA    1 
ATOM   4689 C  C     . ALA B 2 33  ? -22.91400 -47.20700 24.67400  1.000 29.41000  ? 33   ALA B C     1 
ATOM   4690 O  O     . ALA B 2 33  ? -22.29800 -47.67800 25.62600  1.000 27.41000  ? 33   ALA B O     1 
ATOM   4691 C  CB    . ALA B 2 33  ? -25.34900 -46.68500 24.76400  1.000 25.21000  ? 33   ALA B CB    1 
ATOM   4692 N  N     . LEU B 2 34  ? -22.69600 -47.58500 23.41300  1.000 28.46000  ? 34   LEU B N     1 
ATOM   4693 C  CA    . LEU B 2 34  ? -21.76300 -48.65400 23.10200  1.000 24.21000  ? 34   LEU B CA    1 
ATOM   4694 C  C     . LEU B 2 34  ? -20.31900 -48.27500 23.39100  1.000 26.26000  ? 34   LEU B C     1 
ATOM   4695 O  O     . LEU B 2 34  ? -19.52800 -49.11900 23.75700  1.000 31.88000  ? 34   LEU B O     1 
ATOM   4696 C  CB    . LEU B 2 34  ? -21.89600 -49.06500 21.64100  1.000 24.48000  ? 34   LEU B CB    1 
ATOM   4697 C  CG    . LEU B 2 34  ? -23.18900 -49.79000 21.28600  1.000 25.12000  ? 34   LEU B CG    1 
ATOM   4698 C  CD1   . LEU B 2 34  ? -23.27100 -49.96600 19.77800  1.000 24.93000  ? 34   LEU B CD1   1 
ATOM   4699 C  CD2   . LEU B 2 34  ? -23.24400 -51.13000 21.96700  1.000 21.75000  ? 34   LEU B CD2   1 
ATOM   4700 N  N     . VAL B 2 35  ? -19.97000 -47.00800 23.19700  1.000 23.42000  ? 35   VAL B N     1 
ATOM   4701 C  CA    . VAL B 2 35  ? -18.61500 -46.57500 23.44700  1.000 23.38000  ? 35   VAL B CA    1 
ATOM   4702 C  C     . VAL B 2 35  ? -18.37100 -46.60300 24.94100  1.000 31.15000  ? 35   VAL B C     1 
ATOM   4703 O  O     . VAL B 2 35  ? -17.26800 -46.88000 25.43800  1.000 32.66000  ? 35   VAL B O     1 
ATOM   4704 C  CB    . VAL B 2 35  ? -18.35800 -45.16200 22.92900  1.000 23.03000  ? 35   VAL B CB    1 
ATOM   4705 C  CG1   . VAL B 2 35  ? -17.10000 -44.57900 23.58400  1.000 18.44000  ? 35   VAL B CG1   1 
ATOM   4706 C  CG2   . VAL B 2 35  ? -18.24500 -45.16600 21.42100  1.000 22.07000  ? 35   VAL B CG2   1 
ATOM   4707 N  N     . GLU B 2 36  ? -19.43300 -46.30800 25.66000  1.000 29.95000  ? 36   GLU B N     1 
ATOM   4708 C  CA    . GLU B 2 36  ? -19.37300 -46.21800 27.09300  1.000 31.11000  ? 36   GLU B CA    1 
ATOM   4709 C  C     . GLU B 2 36  ? -19.26500 -47.63000 27.68800  1.000 35.70000  ? 36   GLU B C     1 
ATOM   4710 O  O     . GLU B 2 36  ? -18.42200 -47.89400 28.54500  1.000 38.69000  ? 36   GLU B O     1 
ATOM   4711 C  CB    . GLU B 2 36  ? -20.61000 -45.48800 27.58100  1.000 35.32000  ? 36   GLU B CB    1 
ATOM   4712 C  CG    . GLU B 2 36  ? -20.45300 -44.73300 28.85800  1.000 44.25000  ? 36   GLU B CG    1 
ATOM   4713 C  CD    . GLU B 2 36  ? -21.77900 -44.60700 29.54500  1.000 48.61000  ? 36   GLU B CD    1 
ATOM   4714 O  OE1   . GLU B 2 36  ? -21.99100 -45.38200 30.50700  1.000 52.01000  ? 36   GLU B OE1   1 
ATOM   4715 O  OE2   . GLU B 2 36  ? -22.61400 -43.77800 29.10200  1.000 49.65000  ? 36   GLU B OE2   1 
ATOM   4716 N  N     . ILE B 2 37  ? -20.10100 -48.53700 27.19200  1.000 29.02000  ? 37   ILE B N     1 
ATOM   4717 C  CA    . ILE B 2 37  ? -20.12600 -49.90200 27.66200  1.000 24.65000  ? 37   ILE B CA    1 
ATOM   4718 C  C     . ILE B 2 37  ? -18.83900 -50.60300 27.29800  1.000 28.52000  ? 37   ILE B C     1 
ATOM   4719 O  O     . ILE B 2 37  ? -18.21500 -51.25500 28.13800  1.000 33.82000  ? 37   ILE B O     1 
ATOM   4720 C  CB    . ILE B 2 37  ? -21.31600 -50.67900 27.07600  1.000 22.07000  ? 37   ILE B CB    1 
ATOM   4721 C  CG1   . ILE B 2 37  ? -22.62300 -50.24500 27.73600  1.000 21.46000  ? 37   ILE B CG1   1 
ATOM   4722 C  CG2   . ILE B 2 37  ? -21.17000 -52.12800 27.33400  1.000 20.20000  ? 37   ILE B CG2   1 
ATOM   4723 C  CD1   . ILE B 2 37  ? -23.84700 -50.57200 26.90400  1.000 28.22000  ? 37   ILE B CD1   1 
ATOM   4724 N  N     . CYS B 2 38  ? -18.43500 -50.46700 26.04700  1.000 26.05000  ? 38   CYS B N     1 
ATOM   4725 C  CA    . CYS B 2 38  ? -17.21200 -51.10100 25.60600  1.000 27.22000  ? 38   CYS B CA    1 
ATOM   4726 C  C     . CYS B 2 38  ? -15.95700 -50.66100 26.37900  1.000 34.08000  ? 38   CYS B C     1 
ATOM   4727 O  O     . CYS B 2 38  ? -15.11500 -51.50400 26.69500  1.000 35.30000  ? 38   CYS B O     1 
ATOM   4728 C  CB    . CYS B 2 38  ? -17.00900 -50.85900 24.11800  1.000 31.63000  ? 38   CYS B CB    1 
ATOM   4729 S  SG    . CYS B 2 38  ? -18.05800 -51.91300 23.07500  1.000 33.40000  ? 38   CYS B SG    1 
ATOM   4730 N  N     . THR B 2 39  ? -15.80600 -49.37500 26.70500  1.000 30.06000  ? 39   THR B N     1 
ATOM   4731 C  CA    . THR B 2 39  ? -14.56900 -49.02100 27.38200  1.000 32.03000  ? 39   THR B CA    1 
ATOM   4732 C  C     . THR B 2 39  ? -14.50800 -49.71500 28.75600  1.000 40.91000  ? 39   THR B C     1 
ATOM   4733 O  O     . THR B 2 39  ? -13.44100 -50.17800 29.18200  1.000 44.32000  ? 39   THR B O     1 
ATOM   4734 C  CB    . THR B 2 39  ? -14.39800 -47.50400 27.54800  1.000 36.16000  ? 39   THR B CB    1 
ATOM   4735 O  OG1   . THR B 2 39  ? -15.28400 -47.02900 28.56000  1.000 50.88000  ? 39   THR B OG1   1 
ATOM   4736 C  CG2   . THR B 2 39  ? -14.64700 -46.76100 26.22800  1.000 31.53000  ? 39   THR B CG2   1 
ATOM   4737 N  N     . GLU B 2 40  ? -15.65300 -49.82100 29.43100  1.000 39.29000  ? 40   GLU B N     1 
ATOM   4738 C  CA    . GLU B 2 40  ? -15.74100 -50.58500 30.67300  1.000 37.86000  ? 40   GLU B CA    1 
ATOM   4739 C  C     . GLU B 2 40  ? -15.36700 -52.04400 30.45700  1.000 41.71000  ? 40   GLU B C     1 
ATOM   4740 O  O     . GLU B 2 40  ? -14.46700 -52.56900 31.10600  1.000 44.19000  ? 40   GLU B O     1 
ATOM   4741 C  CB    . GLU B 2 40  ? -17.14900 -50.51500 31.25600  1.000 39.99000  ? 40   GLU B CB    1 
ATOM   4742 C  CG    . GLU B 2 40  ? -17.27000 -50.99500 32.68900  1.000 40.28000  ? 40   GLU B CG    1 
ATOM   4743 C  CD    . GLU B 2 40  ? -16.61400 -50.02800 33.67600  1.000 62.43000  ? 40   GLU B CD    1 
ATOM   4744 O  OE1   . GLU B 2 40  ? -16.74200 -50.25800 34.90000  1.000 68.73000  ? 40   GLU B OE1   1 
ATOM   4745 O  OE2   . GLU B 2 40  ? -15.96500 -49.04200 33.23600  1.000 61.78000  ? 40   GLU B OE2   1 
ATOM   4746 N  N     . MET B 2 41  ? -16.05800 -52.70500 29.54100  1.000 36.75000  ? 41   MET B N     1 
ATOM   4747 C  CA    . MET B 2 41  ? -15.70300 -54.07600 29.23200  1.000 34.85000  ? 41   MET B CA    1 
ATOM   4748 C  C     . MET B 2 41  ? -14.23500 -54.21000 28.89200  1.000 31.26000  ? 41   MET B C     1 
ATOM   4749 O  O     . MET B 2 41  ? -13.62900 -55.23000 29.15800  1.000 34.36000  ? 41   MET B O     1 
ATOM   4750 C  CB    . MET B 2 41  ? -16.54600 -54.60400 28.07900  1.000 33.78000  ? 41   MET B CB    1 
ATOM   4751 C  CG    . MET B 2 41  ? -17.99500 -54.80500 28.45200  1.000 32.34000  ? 41   MET B CG    1 
ATOM   4752 S  SD    . MET B 2 41  ? -18.96800 -55.30300 27.03500  1.000 38.15000  ? 41   MET B SD    1 
ATOM   4753 C  CE    . MET B 2 41  ? -18.77800 -57.09100 27.04000  1.000 36.13000  ? 41   MET B CE    1 
ATOM   4754 N  N     . GLU B 2 42  ? -13.64700 -53.19300 28.29200  1.000 34.59000  ? 42   GLU B N     1 
ATOM   4755 C  CA    . GLU B 2 42  ? -12.22800 -53.28700 28.02500  1.000 35.75000  ? 42   GLU B CA    1 
ATOM   4756 C  C     . GLU B 2 42  ? -11.44100 -53.11700 29.34300  1.000 39.28000  ? 42   GLU B C     1 
ATOM   4757 O  O     . GLU B 2 42  ? -10.41300 -53.76000 29.54900  1.000 36.57000  ? 42   GLU B O     1 
ATOM   4758 C  CB    . GLU B 2 42  ? -11.79800 -52.25700 26.98800  1.000 36.52000  ? 42   GLU B CB    1 
ATOM   4759 C  CG    . GLU B 2 42  ? -10.31900 -52.33100 26.65600  1.000 38.18000  ? 42   GLU B CG    1 
ATOM   4760 C  CD    . GLU B 2 42  ? -9.83300  -51.17100 25.79700  1.000 45.74000  ? 42   GLU B CD    1 
ATOM   4761 O  OE1   . GLU B 2 42  ? -8.63200  -51.17200 25.44300  1.000 51.63000  ? 42   GLU B OE1   1 
ATOM   4762 O  OE2   . GLU B 2 42  ? -10.63700 -50.26400 25.46400  1.000 47.91000  ? 42   GLU B OE2   1 
ATOM   4763 N  N     . LYS B 2 43  ? -11.93700 -52.26800 30.23500  1.000 39.53000  ? 43   LYS B N     1 
ATOM   4764 C  CA    . LYS B 2 43  ? -11.30800 -52.08700 31.54600  1.000 38.50000  ? 43   LYS B CA    1 
ATOM   4765 C  C     . LYS B 2 43  ? -11.35800 -53.32100 32.44300  1.000 39.42000  ? 43   LYS B C     1 
ATOM   4766 O  O     . LYS B 2 43  ? -10.80900 -53.28900 33.53400  1.000 49.81000  ? 43   LYS B O     1 
ATOM   4767 C  CB    . LYS B 2 43  ? -11.96700 -50.93700 32.31400  1.000 43.33000  ? 43   LYS B CB    1 
ATOM   4768 C  CG    . LYS B 2 43  ? -11.39600 -49.55500 32.03100  1.000 51.57000  ? 43   LYS B CG    1 
ATOM   4769 C  CD    . LYS B 2 43  ? -12.15000 -48.50500 32.83500  1.000 48.76000  ? 43   LYS B CD    1 
ATOM   4770 C  CE    . LYS B 2 43  ? -11.74500 -47.09800 32.44300  1.000 46.93000  ? 43   LYS B CE    1 
ATOM   4771 N  NZ    . LYS B 2 43  ? -12.27600 -46.10800 33.43700  1.000 48.83000  ? 43   LYS B NZ    1 
ATOM   4772 N  N     . GLU B 2 44  ? -12.03900 -54.37600 32.01000  1.000 35.46000  ? 44   GLU B N     1 
ATOM   4773 C  CA    . GLU B 2 44  ? -12.25800 -55.55800 32.83900  1.000 32.64000  ? 44   GLU B CA    1 
ATOM   4774 C  C     . GLU B 2 44  ? -11.74800 -56.82000 32.14300  1.000 34.45000  ? 44   GLU B C     1 
ATOM   4775 O  O     . GLU B 2 44  ? -12.05200 -57.93200 32.57100  1.000 40.96000  ? 44   GLU B O     1 
ATOM   4776 C  CB    . GLU B 2 44  ? -13.75200 -55.71700 33.18500  1.000 29.57000  ? 44   GLU B CB    1 
ATOM   4777 C  CG    . GLU B 2 44  ? -14.30900 -54.58500 34.03500  1.000 35.27000  ? 44   GLU B CG    1 
ATOM   4778 C  CD    . GLU B 2 44  ? -15.83600 -54.46700 33.99500  1.000 49.91000  ? 44   GLU B CD    1 
ATOM   4779 O  OE1   . GLU B 2 44  ? -16.39200 -53.54700 34.65000  1.000 50.38000  ? 44   GLU B OE1   1 
ATOM   4780 O  OE2   . GLU B 2 44  ? -16.48900 -55.28200 33.30400  1.000 53.09000  ? 44   GLU B OE2   1 
ATOM   4781 N  N     . GLY B 2 45  ? -10.98600 -56.64800 31.06400  1.000 29.88000  ? 45   GLY B N     1 
ATOM   4782 C  CA    . GLY B 2 45  ? -10.44100 -57.77900 30.33300  1.000 27.15000  ? 45   GLY B CA    1 
ATOM   4783 C  C     . GLY B 2 45  ? -11.41900 -58.52900 29.44000  1.000 36.39000  ? 45   GLY B C     1 
ATOM   4784 O  O     . GLY B 2 45  ? -11.03000 -59.46000 28.69900  1.000 30.39000  ? 45   GLY B O     1 
ATOM   4785 N  N     . LYS B 2 46  ? -12.68900 -58.12900 29.49000  1.000 30.68000  ? 46   LYS B N     1 
ATOM   4786 C  CA    . LYS B 2 46  ? -13.72800 -58.86000 28.78200  1.000 33.11000  ? 46   LYS B CA    1 
ATOM   4787 C  C     . LYS B 2 46  ? -13.62300 -58.73400 27.24600  1.000 34.29000  ? 46   LYS B C     1 
ATOM   4788 O  O     . LYS B 2 46  ? -13.89200 -59.71200 26.53700  1.000 31.96000  ? 46   LYS B O     1 
ATOM   4789 C  CB    . LYS B 2 46  ? -15.09200 -58.41700 29.29200  1.000 32.57000  ? 46   LYS B CB    1 
ATOM   4790 C  CG    . LYS B 2 46  ? -15.39800 -59.04600 30.65900  1.000 37.97000  ? 46   LYS B CG    1 
ATOM   4791 C  CD    . LYS B 2 46  ? -16.03900 -58.09200 31.64800  1.000 31.35000  ? 46   LYS B CD    1 
ATOM   4792 C  CE    . LYS B 2 46  ? -17.45600 -57.68800 31.21000  1.000 52.03000  ? 46   LYS B CE    1 
ATOM   4793 N  NZ    . LYS B 2 46  ? -18.22300 -56.86000 32.23300  1.000 54.44000  ? 46   LYS B NZ    1 
ATOM   4794 N  N     . ILE B 2 47  ? -13.18700 -57.57400 26.74100  1.000 28.57000  ? 47   ILE B N     1 
ATOM   4795 C  CA    . ILE B 2 47  ? -12.92000 -57.41700 25.30800  1.000 28.26000  ? 47   ILE B CA    1 
ATOM   4796 C  C     . ILE B 2 47  ? -11.57700 -56.72000 24.99100  1.000 31.80000  ? 47   ILE B C     1 
ATOM   4797 O  O     . ILE B 2 47  ? -11.13400 -55.85500 25.74600  1.000 37.08000  ? 47   ILE B O     1 
ATOM   4798 C  CB    . ILE B 2 47  ? -14.05300 -56.60000 24.59800  1.000 31.19000  ? 47   ILE B CB    1 
ATOM   4799 C  CG1   . ILE B 2 47  ? -14.07800 -55.15600 25.08500  1.000 34.46000  ? 47   ILE B CG1   1 
ATOM   4800 C  CG2   . ILE B 2 47  ? -15.43300 -57.26000 24.75800  1.000 29.07000  ? 47   ILE B CG2   1 
ATOM   4801 C  CD1   . ILE B 2 47  ? -14.91300 -54.26300 24.19800  1.000 33.73000  ? 47   ILE B CD1   1 
ATOM   4802 N  N     . SER B 2 48  ? -10.95100 -57.06600 23.86600  1.000 31.81000  ? 48   SER B N     1 
ATOM   4803 C  CA    . SER B 2 48  ? -9.70800  -56.38300 23.44100  1.000 31.66000  ? 48   SER B CA    1 
ATOM   4804 C  C     . SER B 2 48  ? -9.79500  -55.69100 22.07700  1.000 33.65000  ? 48   SER B C     1 
ATOM   4805 O  O     . SER B 2 48  ? -10.38700 -56.23800 21.13700  1.000 33.87000  ? 48   SER B O     1 
ATOM   4806 C  CB    . SER B 2 48  ? -8.53800  -57.37300 23.38200  1.000 31.26000  ? 48   SER B CB    1 
ATOM   4807 O  OG    . SER B 2 48  ? -8.25000  -57.92400 24.64900  1.000 33.43000  ? 48   SER B OG    1 
ATOM   4808 N  N     . LYS B 2 49  ? -9.17500  -54.50800 21.97600  1.000 32.94000  ? 49   LYS B N     1 
ATOM   4809 C  CA    . LYS B 2 49  ? -8.96000  -53.81200 20.69100  1.000 29.60000  ? 49   LYS B CA    1 
ATOM   4810 C  C     . LYS B 2 49  ? -8.19500  -54.69700 19.71200  1.000 25.02000  ? 49   LYS B C     1 
ATOM   4811 O  O     . LYS B 2 49  ? -7.24500  -55.35600 20.09800  1.000 26.25000  ? 49   LYS B O     1 
ATOM   4812 C  CB    . LYS B 2 49  ? -8.19400  -52.49400 20.88500  1.000 24.18000  ? 49   LYS B CB    1 
ATOM   4813 C  CG    . LYS B 2 49  ? -8.89500  -51.50700 21.78400  1.000 35.02000  ? 49   LYS B CG    1 
ATOM   4814 C  CD    . LYS B 2 49  ? -8.62900  -50.05100 21.43100  1.000 30.38000  ? 49   LYS B CD    1 
ATOM   4815 C  CE    . LYS B 2 49  ? -9.75600  -49.17300 21.99600  1.000 35.64000  ? 49   LYS B CE    1 
ATOM   4816 N  NZ    . LYS B 2 49  ? -9.48800  -47.69300 22.06900  1.000 45.73000  ? 49   LYS B NZ    1 
ATOM   4817 N  N     . ILE B 2 50  ? -8.61700  -54.71100 18.45500  1.000 26.36000  ? 50   ILE B N     1 
ATOM   4818 C  CA    . ILE B 2 50  ? -7.93100  -55.48200 17.43200  1.000 29.45000  ? 50   ILE B CA    1 
ATOM   4819 C  C     . ILE B 2 50  ? -7.73300  -54.70200 16.13800  1.000 30.30000  ? 50   ILE B C     1 
ATOM   4820 O  O     . ILE B 2 50  ? -8.34600  -53.64800 15.90500  1.000 31.69000  ? 50   ILE B O     1 
ATOM   4821 C  CB    . ILE B 2 50  ? -8.68000  -56.76800 17.10600  1.000 29.42000  ? 50   ILE B CB    1 
ATOM   4822 C  CG1   . ILE B 2 50  ? -10.10000 -56.45100 16.63100  1.000 29.97000  ? 50   ILE B CG1   1 
ATOM   4823 C  CG2   . ILE B 2 50  ? -8.72500  -57.68300 18.33300  1.000 29.65000  ? 50   ILE B CG2   1 
ATOM   4824 C  CD1   . ILE B 2 50  ? -10.94600 -57.70800 16.42600  1.000 29.39000  ? 50   ILE B CD1   1 
ATOM   4825 N  N     . GLY B 2 51  ? -6.86800  -55.22000 15.28500  1.000 24.47000  ? 51   GLY B N     1 
ATOM   4826 C  CA    . GLY B 2 51  ? -6.56700  -54.49800 14.07700  1.000 26.68000  ? 51   GLY B CA    1 
ATOM   4827 C  C     . GLY B 2 51  ? -7.46300  -54.96500 12.96300  1.000 28.97000  ? 51   GLY B C     1 
ATOM   4828 O  O     . GLY B 2 51  ? -8.45300  -55.65800 13.19500  1.000 30.84000  ? 51   GLY B O     1 
ATOM   4829 N  N     . PRO B 2 52  ? -7.13100  -54.57000 11.73900  1.000 28.79000  ? 52   PRO B N     1 
ATOM   4830 C  CA    . PRO B 2 52  ? -7.87800  -55.07000 10.59100  1.000 26.94000  ? 52   PRO B CA    1 
ATOM   4831 C  C     . PRO B 2 52  ? -7.23200  -56.28300 9.95500   1.000 30.39000  ? 52   PRO B C     1 
ATOM   4832 O  O     . PRO B 2 52  ? -7.64100  -56.64900 8.86200   1.000 34.78000  ? 52   PRO B O     1 
ATOM   4833 C  CB    . PRO B 2 52  ? -7.83600  -53.88700 9.63200   1.000 24.45000  ? 52   PRO B CB    1 
ATOM   4834 C  CG    . PRO B 2 52  ? -6.53400  -53.27500 9.89300   1.000 22.13000  ? 52   PRO B CG    1 
ATOM   4835 C  CD    . PRO B 2 52  ? -6.28500  -53.41800 11.37400  1.000 27.22000  ? 52   PRO B CD    1 
ATOM   4836 N  N     . GLU B 2 53  ? -6.23000  -56.88300 10.58200  1.000 31.01000  ? 53   GLU B N     1 
ATOM   4837 C  CA    . GLU B 2 53  ? -5.68800  -58.11000 10.01000  1.000 31.27000  ? 53   GLU B CA    1 
ATOM   4838 C  C     . GLU B 2 53  ? -6.62200  -59.25200 10.38500  1.000 31.74000  ? 53   GLU B C     1 
ATOM   4839 O  O     . GLU B 2 53  ? -6.62900  -60.29000 9.72500   1.000 34.31000  ? 53   GLU B O     1 
ATOM   4840 C  CB    . GLU B 2 53  ? -4.26700  -58.38500 10.49000  1.000 28.59000  ? 53   GLU B CB    1 
ATOM   4841 C  CG    . GLU B 2 53  ? -4.16400  -58.69300 11.95800  1.000 30.61000  ? 53   GLU B CG    1 
ATOM   4842 C  CD    . GLU B 2 53  ? -4.29900  -57.45900 12.80400  1.000 35.14000  ? 53   GLU B CD    1 
ATOM   4843 O  OE1   . GLU B 2 53  ? -4.74800  -56.42300 12.25300  1.000 31.77000  ? 53   GLU B OE1   1 
ATOM   4844 O  OE2   . GLU B 2 53  ? -3.94100  -57.51700 14.00700  1.000 37.96000  ? 53   GLU B OE2   1 
ATOM   4845 N  N     . ASN B 2 54  ? -7.40700  -59.05500 11.44700  1.000 28.06000  ? 54   ASN B N     1 
ATOM   4846 C  CA    . ASN B 2 54  ? -8.55500  -59.90400 11.70000  1.000 24.63000  ? 54   ASN B CA    1 
ATOM   4847 C  C     . ASN B 2 54  ? -9.56500  -59.57500 10.63100  1.000 28.26000  ? 54   ASN B C     1 
ATOM   4848 O  O     . ASN B 2 54  ? -10.09600 -58.46900 10.61800  1.000 29.25000  ? 54   ASN B O     1 
ATOM   4849 C  CB    . ASN B 2 54  ? -9.13700  -59.65700 13.08600  1.000 27.90000  ? 54   ASN B CB    1 
ATOM   4850 C  CG    . ASN B 2 54  ? -10.35400 -60.52600 13.38800  1.000 30.16000  ? 54   ASN B CG    1 
ATOM   4851 O  OD1   . ASN B 2 54  ? -11.09100 -60.94100 12.49000  1.000 29.10000  ? 54   ASN B OD1   1 
ATOM   4852 N  ND2   . ASN B 2 54  ? -10.57000 -60.80300 14.67200  1.000 30.11000  ? 54   ASN B ND2   1 
ATOM   4853 N  N     . PRO B 2 55  ? -9.84000  -60.52900 9.72900   1.000 28.79000  ? 55   PRO B N     1 
ATOM   4854 C  CA    . PRO B 2 55  ? -10.75500 -60.29900 8.61200   1.000 26.85000  ? 55   PRO B CA    1 
ATOM   4855 C  C     . PRO B 2 55  ? -12.20100 -60.54700 8.95900   1.000 23.12000  ? 55   PRO B C     1 
ATOM   4856 O  O     . PRO B 2 55  ? -13.00800 -60.53100 8.05800   1.000 26.87000  ? 55   PRO B O     1 
ATOM   4857 C  CB    . PRO B 2 55  ? -10.30300 -61.32400 7.59400   1.000 24.90000  ? 55   PRO B CB    1 
ATOM   4858 C  CG    . PRO B 2 55  ? -9.92100  -62.47100 8.46200   1.000 30.04000  ? 55   PRO B CG    1 
ATOM   4859 C  CD    . PRO B 2 55  ? -9.28500  -61.88700 9.69500   1.000 28.83000  ? 55   PRO B CD    1 
ATOM   4860 N  N     . TYR B 2 56  ? -12.54300 -60.78000 10.21300  1.000 23.68000  ? 56   TYR B N     1 
ATOM   4861 C  CA    . TYR B 2 56  ? -13.93500 -61.08500 10.51400  1.000 26.46000  ? 56   TYR B CA    1 
ATOM   4862 C  C     . TYR B 2 56  ? -14.70600 -59.89400 11.09500  1.000 26.92000  ? 56   TYR B C     1 
ATOM   4863 O  O     . TYR B 2 56  ? -14.10100 -58.93800 11.59700  1.000 26.05000  ? 56   TYR B O     1 
ATOM   4864 C  CB    . TYR B 2 56  ? -13.99100 -62.27500 11.46500  1.000 26.22000  ? 56   TYR B CB    1 
ATOM   4865 C  CG    . TYR B 2 56  ? -13.24800 -63.47400 10.94300  1.000 28.55000  ? 56   TYR B CG    1 
ATOM   4866 C  CD1   . TYR B 2 56  ? -13.77600 -64.24800 9.91200   1.000 28.90000  ? 56   TYR B CD1   1 
ATOM   4867 C  CD2   . TYR B 2 56  ? -12.00900 -63.83500 11.46900  1.000 31.00000  ? 56   TYR B CD2   1 
ATOM   4868 C  CE1   . TYR B 2 56  ? -13.09200 -65.35100 9.42000   1.000 33.34000  ? 56   TYR B CE1   1 
ATOM   4869 C  CE2   . TYR B 2 56  ? -11.32900 -64.93500 10.99200  1.000 33.44000  ? 56   TYR B CE2   1 
ATOM   4870 C  CZ    . TYR B 2 56  ? -11.87300 -65.69600 9.97000   1.000 35.53000  ? 56   TYR B CZ    1 
ATOM   4871 O  OH    . TYR B 2 56  ? -11.18800 -66.79500 9.50100   1.000 37.68000  ? 56   TYR B OH    1 
ATOM   4872 N  N     . ASN B 2 57  ? -16.03800 -59.94700 11.01600  1.000 23.71000  ? 57   ASN B N     1 
ATOM   4873 C  CA    . ASN B 2 57  ? -16.86600 -58.89200 11.60200  1.000 25.16000  ? 57   ASN B CA    1 
ATOM   4874 C  C     . ASN B 2 57  ? -18.34500 -59.25500 11.74000  1.000 28.81000  ? 57   ASN B C     1 
ATOM   4875 O  O     . ASN B 2 57  ? -18.89700 -59.99500 10.93000  1.000 26.84000  ? 57   ASN B O     1 
ATOM   4876 C  CB    . ASN B 2 57  ? -16.75200 -57.60400 10.79000  1.000 24.26000  ? 57   ASN B CB    1 
ATOM   4877 C  CG    . ASN B 2 57  ? -17.32500 -56.42100 11.51500  1.000 26.81000  ? 57   ASN B CG    1 
ATOM   4878 O  OD1   . ASN B 2 57  ? -16.77700 -55.98800 12.52700  1.000 36.44000  ? 57   ASN B OD1   1 
ATOM   4879 N  ND2   . ASN B 2 57  ? -18.43100 -55.89300 11.02400  1.000 27.07000  ? 57   ASN B ND2   1 
ATOM   4880 N  N     . THR B 2 58  ? -18.97600 -58.68500 12.76600  1.000 22.52000  ? 58   THR B N     1 
ATOM   4881 C  CA    . THR B 2 58  ? -20.34400 -59.00500 13.11000  1.000 23.27000  ? 58   THR B CA    1 
ATOM   4882 C  C     . THR B 2 58  ? -20.99300 -57.74000 13.62700  1.000 22.14000  ? 58   THR B C     1 
ATOM   4883 O  O     . THR B 2 58  ? -20.37500 -57.01800 14.38400  1.000 25.04000  ? 58   THR B O     1 
ATOM   4884 C  CB    . THR B 2 58  ? -20.38400 -60.10900 14.18200  1.000 32.93000  ? 58   THR B CB    1 
ATOM   4885 O  OG1   . THR B 2 58  ? -19.97300 -61.35800 13.60200  1.000 32.99000  ? 58   THR B OG1   1 
ATOM   4886 C  CG2   . THR B 2 58  ? -21.76700 -60.23800 14.77700  1.000 27.00000  ? 58   THR B CG2   1 
ATOM   4887 N  N     . PRO B 2 59  ? -22.23500 -57.45800 13.22400  1.000 19.60000  ? 59   PRO B N     1 
ATOM   4888 C  CA    . PRO B 2 59  ? -22.79200 -56.13400 13.50400  1.000 22.30000  ? 59   PRO B CA    1 
ATOM   4889 C  C     . PRO B 2 59  ? -23.06500 -55.97100 14.97500  1.000 23.61000  ? 59   PRO B C     1 
ATOM   4890 O  O     . PRO B 2 59  ? -23.15800 -56.97700 15.65300  1.000 28.55000  ? 59   PRO B O     1 
ATOM   4891 C  CB    . PRO B 2 59  ? -24.11200 -56.11700 12.72000  1.000 25.79000  ? 59   PRO B CB    1 
ATOM   4892 C  CG    . PRO B 2 59  ? -24.17500 -57.40300 11.96200  1.000 24.53000  ? 59   PRO B CG    1 
ATOM   4893 C  CD    . PRO B 2 59  ? -23.25700 -58.35900 12.67700  1.000 29.54000  ? 59   PRO B CD    1 
ATOM   4894 N  N     . VAL B 2 60  ? -23.20400 -54.74100 15.46100  1.000 23.37000  ? 60   VAL B N     1 
ATOM   4895 C  CA    . VAL B 2 60  ? -23.51000 -54.51900 16.86300  1.000 22.22000  ? 60   VAL B CA    1 
ATOM   4896 C  C     . VAL B 2 60  ? -24.45700 -53.34600 16.98200  1.000 24.83000  ? 60   VAL B C     1 
ATOM   4897 O  O     . VAL B 2 60  ? -24.43800 -52.44900 16.12900  1.000 21.39000  ? 60   VAL B O     1 
ATOM   4898 C  CB    . VAL B 2 60  ? -22.23400 -54.26300 17.66900  1.000 22.47000  ? 60   VAL B CB    1 
ATOM   4899 C  CG1   . VAL B 2 60  ? -21.64600 -52.93600 17.29200  1.000 23.23000  ? 60   VAL B CG1   1 
ATOM   4900 C  CG2   . VAL B 2 60  ? -22.53300 -54.27900 19.12200  1.000 25.92000  ? 60   VAL B CG2   1 
ATOM   4901 N  N     . PHE B 2 61  ? -25.30100 -53.34400 18.01800  1.000 24.40000  ? 61   PHE B N     1 
ATOM   4902 C  CA    . PHE B 2 61  ? -26.08500 -52.13800 18.32000  1.000 25.17000  ? 61   PHE B CA    1 
ATOM   4903 C  C     . PHE B 2 61  ? -26.49700 -52.12100 19.78100  1.000 30.06000  ? 61   PHE B C     1 
ATOM   4904 O  O     . PHE B 2 61  ? -25.76800 -52.60900 20.63600  1.000 30.74000  ? 61   PHE B O     1 
ATOM   4905 C  CB    . PHE B 2 61  ? -27.29800 -51.99200 17.38900  1.000 24.55000  ? 61   PHE B CB    1 
ATOM   4906 C  CG    . PHE B 2 61  ? -28.33300 -53.06600 17.53100  1.000 28.22000  ? 61   PHE B CG    1 
ATOM   4907 C  CD1   . PHE B 2 61  ? -28.06400 -54.37100 17.15800  1.000 29.66000  ? 61   PHE B CD1   1 
ATOM   4908 C  CD2   . PHE B 2 61  ? -29.61000 -52.75000 17.97500  1.000 29.69000  ? 61   PHE B CD2   1 
ATOM   4909 C  CE1   . PHE B 2 61  ? -29.03900 -55.35300 17.27200  1.000 27.86000  ? 61   PHE B CE1   1 
ATOM   4910 C  CE2   . PHE B 2 61  ? -30.58700 -53.72800 18.08300  1.000 26.64000  ? 61   PHE B CE2   1 
ATOM   4911 C  CZ    . PHE B 2 61  ? -30.29700 -55.02600 17.73300  1.000 28.55000  ? 61   PHE B CZ    1 
ATOM   4912 N  N     . ALA B 2 62  ? -27.64600 -51.53700 20.09800  1.000 28.79000  ? 62   ALA B N     1 
ATOM   4913 C  CA    . ALA B 2 62  ? -27.96200 -51.35900 21.50300  1.000 27.16000  ? 62   ALA B CA    1 
ATOM   4914 C  C     . ALA B 2 62  ? -29.43000 -51.02500 21.72700  1.000 35.61000  ? 62   ALA B C     1 
ATOM   4915 O  O     . ALA B 2 62  ? -30.06400 -50.38600 20.88400  1.000 39.52000  ? 62   ALA B O     1 
ATOM   4916 C  CB    . ALA B 2 62  ? -27.08400 -50.28100 22.07700  1.000 26.19000  ? 62   ALA B CB    1 
ATOM   4917 N  N     . ILE B 2 63  ? -29.97400 -51.45700 22.86500  1.000 34.78000  ? 63   ILE B N     1 
ATOM   4918 C  CA    . ILE B 2 63  ? -31.36400 -51.16000 23.18700  1.000 37.79000  ? 63   ILE B CA    1 
ATOM   4919 C  C     . ILE B 2 63  ? -31.51700 -50.56300 24.57800  1.000 45.67000  ? 63   ILE B C     1 
ATOM   4920 O  O     . ILE B 2 63  ? -30.82800 -50.96400 25.52500  1.000 45.77000  ? 63   ILE B O     1 
ATOM   4921 C  CB    . ILE B 2 63  ? -32.23300 -52.40400 23.09100  1.000 33.38000  ? 63   ILE B CB    1 
ATOM   4922 C  CG1   . ILE B 2 63  ? -31.76500 -53.43700 24.11600  1.000 36.03000  ? 63   ILE B CG1   1 
ATOM   4923 C  CG2   . ILE B 2 63  ? -32.19200 -52.94800 21.69000  1.000 31.66000  ? 63   ILE B CG2   1 
ATOM   4924 C  CD1   . ILE B 2 63  ? -32.47600 -54.76100 24.02100  1.000 34.53000  ? 63   ILE B CD1   1 
ATOM   4925 N  N     . LYS B 2 64  ? -32.42100 -49.59100 24.67700  1.000 52.08000  ? 64   LYS B N     1 
ATOM   4926 C  CA    . LYS B 2 64  ? -32.74800 -48.92900 25.94100  1.000 54.28000  ? 64   LYS B CA    1 
ATOM   4927 C  C     . LYS B 2 64  ? -34.01200 -49.55300 26.50500  1.000 55.94000  ? 64   LYS B C     1 
ATOM   4928 O  O     . LYS B 2 64  ? -35.07400 -49.52000 25.88400  1.000 56.11000  ? 64   LYS B O     1 
ATOM   4929 C  CB    . LYS B 2 64  ? -32.93100 -47.42200 25.74200  1.000 51.55000  ? 64   LYS B CB    1 
ATOM   4930 C  CG    . LYS B 2 64  ? -32.94900 -46.61500 27.01700  1.000 51.07000  ? 64   LYS B CG    1 
ATOM   4931 C  CD    . LYS B 2 64  ? -33.11700 -45.13300 26.70600  1.000 50.92000  ? 64   LYS B CD    1 
ATOM   4932 C  CE    . LYS B 2 64  ? -33.11300 -44.31100 27.98500  1.000 65.60000  ? 64   LYS B CE    1 
ATOM   4933 N  NZ    . LYS B 2 64  ? -33.21300 -42.84400 27.72600  1.000 69.20000  ? 64   LYS B NZ    1 
ATOM   4934 N  N     . LYS B 2 65  ? -33.88900 -50.12600 27.68800  1.000 62.36000  ? 65   LYS B N     1 
ATOM   4935 C  CA    . LYS B 2 65  ? -34.93200 -50.98700 28.21200  1.000 69.51000  ? 65   LYS B CA    1 
ATOM   4936 C  C     . LYS B 2 65  ? -36.05800 -50.21900 28.89800  1.000 80.76000  ? 65   LYS B C     1 
ATOM   4937 O  O     . LYS B 2 65  ? -35.83100 -49.55700 29.91200  1.000 90.25000  ? 65   LYS B O     1 
ATOM   4938 C  CB    . LYS B 2 65  ? -34.31200 -51.98700 29.18400  1.000 72.23000  ? 65   LYS B CB    1 
ATOM   4939 C  CG    . LYS B 2 65  ? -33.05700 -52.65000 28.63800  1.000 65.52000  ? 65   LYS B CG    1 
ATOM   4940 C  CD    . LYS B 2 65  ? -33.41500 -53.69800 27.61000  1.000 53.43000  ? 65   LYS B CD    1 
ATOM   4941 C  CE    . LYS B 2 65  ? -34.18500 -54.82300 28.26600  1.000 61.39000  ? 65   LYS B CE    1 
ATOM   4942 N  NZ    . LYS B 2 65  ? -34.99600 -55.55400 27.26500  1.000 53.90000  ? 65   LYS B NZ    1 
ATOM   4943 N  N     . LYS B 2 66  ? -37.26400 -50.31000 28.33100  1.000 84.45000  ? 66   LYS B N     1 
ATOM   4944 C  CA    . LYS B 2 66  ? -38.49100 -49.85700 28.99700  1.000 91.22000  ? 66   LYS B CA    1 
ATOM   4945 C  C     . LYS B 2 66  ? -38.42800 -48.39300 29.42800  1.000 93.88000  ? 66   LYS B C     1 
ATOM   4946 O  O     . LYS B 2 66  ? -38.24200 -47.48200 28.61300  1.000 89.49000  ? 66   LYS B O     1 
ATOM   4947 C  CB    . LYS B 2 66  ? -38.76800 -50.74100 30.22800  1.000 91.76000  ? 66   LYS B CB    1 
ATOM   4948 C  CG    . LYS B 2 66  ? -40.14500 -50.56000 30.88100  1.000 95.53000  ? 66   LYS B CG    1 
ATOM   4949 C  CD    . LYS B 2 66  ? -40.08300 -50.84100 32.37900  1.000 92.60000  ? 66   LYS B CD    1 
ATOM   4950 C  CE    . LYS B 2 66  ? -41.46300 -51.09800 32.95700  1.000 78.56000  ? 66   LYS B CE    1 
ATOM   4951 N  NZ    . LYS B 2 66  ? -41.38600 -52.07100 34.07700  1.000 78.18000  ? 66   LYS B NZ    1 
ATOM   4952 N  N     . ASP B 2 67  ? -38.62300 -48.20100 30.72900  1.000 93.78000  ? 67   ASP B N     1 
ATOM   4953 C  CA    . ASP B 2 67  ? -38.29600 -46.97300 31.42600  1.000 91.07000  ? 67   ASP B CA    1 
ATOM   4954 C  C     . ASP B 2 67  ? -36.96500 -47.24600 32.11600  1.000 93.07000  ? 67   ASP B C     1 
ATOM   4955 O  O     . ASP B 2 67  ? -36.88800 -48.06300 33.04600  1.000 93.01000  ? 67   ASP B O     1 
ATOM   4956 C  CB    . ASP B 2 67  ? -39.38400 -46.60200 32.44500  1.000 94.48000  ? 67   ASP B CB    1 
ATOM   4957 C  CG    . ASP B 2 67  ? -39.81500 -45.15400 32.34100  1.000 91.97000  ? 67   ASP B CG    1 
ATOM   4958 O  OD1   . ASP B 2 67  ? -38.96100 -44.26600 32.53800  1.000 87.62000  ? 67   ASP B OD1   1 
ATOM   4959 O  OD2   . ASP B 2 67  ? -41.01600 -44.90800 32.07900  1.000 86.94000  ? 67   ASP B OD2   1 
ATOM   4960 N  N     . SER B 2 68  ? -35.90900 -46.59300 31.63700  1.000 90.32000  ? 68   SER B N     1 
ATOM   4961 C  CA    . SER B 2 68  ? -34.57500 -46.82700 32.16700  1.000 77.74000  ? 68   SER B CA    1 
ATOM   4962 C  C     . SER B 2 68  ? -33.57700 -45.79800 31.67100  1.000 74.14000  ? 68   SER B C     1 
ATOM   4963 O  O     . SER B 2 68  ? -33.84700 -45.03300 30.74200  1.000 70.40000  ? 68   SER B O     1 
ATOM   4964 C  CB    . SER B 2 68  ? -34.09000 -48.22800 31.79200  1.000 74.28000  ? 68   SER B CB    1 
ATOM   4965 O  OG    . SER B 2 68  ? -32.70300 -48.35400 32.01900  1.000 73.62000  ? 68   SER B OG    1 
ATOM   4966 N  N     . THR B 2 69  ? -32.41900 -45.78600 32.31800  1.000 72.59000  ? 69   THR B N     1 
ATOM   4967 C  CA    . THR B 2 69  ? -31.28300 -44.99300 31.87300  1.000 69.61000  ? 69   THR B CA    1 
ATOM   4968 C  C     . THR B 2 69  ? -30.14000 -45.95700 31.55700  1.000 71.07000  ? 69   THR B C     1 
ATOM   4969 O  O     . THR B 2 69  ? -28.97000 -45.56500 31.47400  1.000 66.16000  ? 69   THR B O     1 
ATOM   4970 C  CB    . THR B 2 69  ? -30.84800 -43.95400 32.94000  1.000 72.49000  ? 69   THR B CB    1 
ATOM   4971 O  OG1   . THR B 2 69  ? -31.37700 -44.32200 34.22900  1.000 69.59000  ? 69   THR B OG1   1 
ATOM   4972 C  CG2   . THR B 2 69  ? -31.33500 -42.54600 32.55800  1.000 58.90000  ? 69   THR B CG2   1 
ATOM   4973 N  N     . LYS B 2 70  ? -30.49500 -47.23000 31.39100  1.000 72.40000  ? 70   LYS B N     1 
ATOM   4974 C  CA    . LYS B 2 70  ? -29.51800 -48.25700 31.04300  1.000 66.58000  ? 70   LYS B CA    1 
ATOM   4975 C  C     . LYS B 2 70  ? -29.77100 -48.83400 29.65700  1.000 58.69000  ? 70   LYS B C     1 
ATOM   4976 O  O     . LYS B 2 70  ? -30.89100 -49.21500 29.32000  1.000 59.81000  ? 70   LYS B O     1 
ATOM   4977 C  CB    . LYS B 2 70  ? -29.51000 -49.38200 32.07800  1.000 61.59000  ? 70   LYS B CB    1 
ATOM   4978 C  CG    . LYS B 2 70  ? -28.75800 -49.02500 33.35400  1.000 77.12000  ? 70   LYS B CG    1 
ATOM   4979 C  CD    . LYS B 2 70  ? -27.42800 -48.31700 33.06000  1.000 76.36000  ? 70   LYS B CD    1 
ATOM   4980 C  CE    . LYS B 2 70  ? -26.38600 -48.60300 34.15000  1.000 71.16000  ? 70   LYS B CE    1 
ATOM   4981 N  NZ    . LYS B 2 70  ? -26.99000 -48.63700 35.52200  1.000 65.64000  ? 70   LYS B NZ    1 
ATOM   4982 N  N     . TRP B 2 71  ? -28.69700 -48.87600 28.87000  1.000 57.02000  ? 71   TRP B N     1 
ATOM   4983 C  CA    . TRP B 2 71  ? -28.67900 -49.50000 27.55600  1.000 44.60000  ? 71   TRP B CA    1 
ATOM   4984 C  C     . TRP B 2 71  ? -28.13800 -50.91300 27.62400  1.000 38.74000  ? 71   TRP B C     1 
ATOM   4985 O  O     . TRP B 2 71  ? -27.33300 -51.24500 28.50500  1.000 38.32000  ? 71   TRP B O     1 
ATOM   4986 C  CB    . TRP B 2 71  ? -27.82900 -48.68000 26.60600  1.000 41.34000  ? 71   TRP B CB    1 
ATOM   4987 C  CG    . TRP B 2 71  ? -28.44000 -47.39900 26.29800  1.000 39.36000  ? 71   TRP B CG    1 
ATOM   4988 C  CD1   . TRP B 2 71  ? -28.42400 -46.28600 27.06300  1.000 38.42000  ? 71   TRP B CD1   1 
ATOM   4989 C  CD2   . TRP B 2 71  ? -29.19500 -47.08100 25.12700  1.000 37.93000  ? 71   TRP B CD2   1 
ATOM   4990 N  NE1   . TRP B 2 71  ? -29.11800 -45.27800 26.44100  1.000 41.99000  ? 71   TRP B NE1   1 
ATOM   4991 C  CE2   . TRP B 2 71  ? -29.60000 -45.74600 25.24500  1.000 39.03000  ? 71   TRP B CE2   1 
ATOM   4992 C  CE3   . TRP B 2 71  ? -29.56600 -47.80000 23.98800  1.000 39.93000  ? 71   TRP B CE3   1 
ATOM   4993 C  CZ2   . TRP B 2 71  ? -30.35900 -45.10800 24.26800  1.000 39.47000  ? 71   TRP B CZ2   1 
ATOM   4994 C  CZ3   . TRP B 2 71  ? -30.32000 -47.16800 23.02400  1.000 37.79000  ? 71   TRP B CZ3   1 
ATOM   4995 C  CH2   . TRP B 2 71  ? -30.71000 -45.83500 23.17200  1.000 34.77000  ? 71   TRP B CH2   1 
ATOM   4996 N  N     . ARG B 2 72  ? -28.57500 -51.74800 26.69500  1.000 35.74000  ? 72   ARG B N     1 
ATOM   4997 C  CA    . ARG B 2 72  ? -28.03200 -53.09400 26.60500  1.000 34.48000  ? 72   ARG B CA    1 
ATOM   4998 C  C     . ARG B 2 72  ? -27.28400 -53.23400 25.29600  1.000 34.56000  ? 72   ARG B C     1 
ATOM   4999 O  O     . ARG B 2 72  ? -27.84100 -52.97700 24.23300  1.000 42.12000  ? 72   ARG B O     1 
ATOM   5000 C  CB    . ARG B 2 72  ? -29.14000 -54.14000 26.70800  1.000 36.42000  ? 72   ARG B CB    1 
ATOM   5001 C  CG    . ARG B 2 72  ? -28.80200 -55.34100 27.57600  1.000 37.44000  ? 72   ARG B CG    1 
ATOM   5002 C  CD    . ARG B 2 72  ? -28.19400 -56.46300 26.75700  1.000 45.64000  ? 72   ARG B CD    1 
ATOM   5003 N  NE    . ARG B 2 72  ? -28.47700 -57.77600 27.33100  1.000 48.93000  ? 72   ARG B NE    1 
ATOM   5004 C  CZ    . ARG B 2 72  ? -28.19600 -58.92600 26.72200  1.000 46.72000  ? 72   ARG B CZ    1 
ATOM   5005 N  NH1   . ARG B 2 72  ? -27.62900 -58.92500 25.51300  1.000 40.90000  ? 72   ARG B NH1   1 
ATOM   5006 N  NH2   . ARG B 2 72  ? -28.48700 -60.07800 27.32700  1.000 38.48000  ? 72   ARG B NH2   1 
ATOM   5007 N  N     . LYS B 2 73  ? -26.01600 -53.61300 25.34900  1.000 29.57000  ? 73   LYS B N     1 
ATOM   5008 C  CA    . LYS B 2 73  ? -25.35600 -53.92700 24.10900  1.000 26.84000  ? 73   LYS B CA    1 
ATOM   5009 C  C     . LYS B 2 73  ? -25.96500 -55.20100 23.60900  1.000 29.46000  ? 73   LYS B C     1 
ATOM   5010 O  O     . LYS B 2 73  ? -26.35900 -56.05600 24.39800  1.000 36.71000  ? 73   LYS B O     1 
ATOM   5011 C  CB    . LYS B 2 73  ? -23.85400 -54.08000 24.26300  1.000 29.28000  ? 73   LYS B CB    1 
ATOM   5012 C  CG    . LYS B 2 73  ? -23.23100 -54.59600 22.98800  1.000 27.32000  ? 73   LYS B CG    1 
ATOM   5013 C  CD    . LYS B 2 73  ? -21.73800 -54.54000 23.04500  1.000 30.46000  ? 73   LYS B CD    1 
ATOM   5014 C  CE    . LYS B 2 73  ? -21.19200 -55.70300 23.82700  1.000 38.38000  ? 73   LYS B CE    1 
ATOM   5015 N  NZ    . LYS B 2 73  ? -19.83900 -56.04400 23.31800  1.000 43.51000  ? 73   LYS B NZ    1 
ATOM   5016 N  N     . LEU B 2 74  ? -26.06000 -55.30700 22.29300  1.000 32.70000  ? 74   LEU B N     1 
ATOM   5017 C  CA    . LEU B 2 74  ? -26.63600 -56.46700 21.64100  1.000 29.75000  ? 74   LEU B CA    1 
ATOM   5018 C  C     . LEU B 2 74  ? -25.83600 -56.72000 20.39300  1.000 27.18000  ? 74   LEU B C     1 
ATOM   5019 O  O     . LEU B 2 74  ? -25.89900 -55.93800 19.45900  1.000 30.54000  ? 74   LEU B O     1 
ATOM   5020 C  CB    . LEU B 2 74  ? -28.10200 -56.21200 21.30000  1.000 31.45000  ? 74   LEU B CB    1 
ATOM   5021 C  CG    . LEU B 2 74  ? -29.12600 -57.34700 21.35100  1.000 35.12000  ? 74   LEU B CG    1 
ATOM   5022 C  CD1   . LEU B 2 74  ? -29.15700 -57.92500 22.74500  1.000 45.23000  ? 74   LEU B CD1   1 
ATOM   5023 C  CD2   . LEU B 2 74  ? -30.49300 -56.80200 21.00900  1.000 39.23000  ? 74   LEU B CD2   1 
ATOM   5024 N  N     . VAL B 2 75  ? -25.05100 -57.78500 20.38400  1.000 25.77000  ? 75   VAL B N     1 
ATOM   5025 C  CA    . VAL B 2 75  ? -24.34600 -58.16800 19.16400  1.000 27.10000  ? 75   VAL B CA    1 
ATOM   5026 C  C     . VAL B 2 75  ? -25.21800 -59.11100 18.31500  1.000 29.29000  ? 75   VAL B C     1 
ATOM   5027 O  O     . VAL B 2 75  ? -25.86900 -60.00800 18.84400  1.000 35.48000  ? 75   VAL B O     1 
ATOM   5028 C  CB    . VAL B 2 75  ? -23.01600 -58.84400 19.50400  1.000 27.56000  ? 75   VAL B CB    1 
ATOM   5029 C  CG1   . VAL B 2 75  ? -22.31600 -59.22500 18.26200  1.000 25.30000  ? 75   VAL B CG1   1 
ATOM   5030 C  CG2   . VAL B 2 75  ? -22.15200 -57.91200 20.32100  1.000 29.32000  ? 75   VAL B CG2   1 
ATOM   5031 N  N     . ASP B 2 76  ? -25.25000 -58.90000 17.01000  1.000 26.81000  ? 76   ASP B N     1 
ATOM   5032 C  CA    . ASP B 2 76  ? -26.02200 -59.78500 16.12900  1.000 28.63000  ? 76   ASP B CA    1 
ATOM   5033 C  C     . ASP B 2 76  ? -25.18400 -60.97600 15.67700  1.000 25.42000  ? 76   ASP B C     1 
ATOM   5034 O  O     . ASP B 2 76  ? -24.55400 -60.94200 14.62000  1.000 22.70000  ? 76   ASP B O     1 
ATOM   5035 C  CB    . ASP B 2 76  ? -26.54500 -59.02600 14.89300  1.000 30.31000  ? 76   ASP B CB    1 
ATOM   5036 C  CG    . ASP B 2 76  ? -27.38400 -59.90800 13.96300  1.000 33.60000  ? 76   ASP B CG    1 
ATOM   5037 O  OD1   . ASP B 2 76  ? -27.46400 -61.14600 14.16600  1.000 32.48000  ? 76   ASP B OD1   1 
ATOM   5038 O  OD2   . ASP B 2 76  ? -27.96900 -59.35900 13.01500  1.000 31.08000  ? 76   ASP B OD2   1 
ATOM   5039 N  N     . PHE B 2 77  ? -25.24400 -62.04100 16.46000  1.000 25.97000  ? 77   PHE B N     1 
ATOM   5040 C  CA    . PHE B 2 77  ? -24.45300 -63.23000 16.18500  1.000 31.77000  ? 77   PHE B CA    1 
ATOM   5041 C  C     . PHE B 2 77  ? -25.17700 -64.28900 15.32900  1.000 33.67000  ? 77   PHE B C     1 
ATOM   5042 O  O     . PHE B 2 77  ? -24.74500 -65.43900 15.27900  1.000 35.11000  ? 77   PHE B O     1 
ATOM   5043 C  CB    . PHE B 2 77  ? -23.99900 -63.85000 17.51400  1.000 27.02000  ? 77   PHE B CB    1 
ATOM   5044 C  CG    . PHE B 2 77  ? -22.74400 -63.23800 18.06600  1.000 27.27000  ? 77   PHE B CG    1 
ATOM   5045 C  CD1   . PHE B 2 77  ? -21.62700 -63.06400 17.25800  1.000 28.61000  ? 77   PHE B CD1   1 
ATOM   5046 C  CD2   . PHE B 2 77  ? -22.67600 -62.83400 19.38800  1.000 27.93000  ? 77   PHE B CD2   1 
ATOM   5047 C  CE1   . PHE B 2 77  ? -20.48100 -62.50200 17.76600  1.000 24.43000  ? 77   PHE B CE1   1 
ATOM   5048 C  CE2   . PHE B 2 77  ? -21.51800 -62.27700 19.89600  1.000 21.73000  ? 77   PHE B CE2   1 
ATOM   5049 C  CZ    . PHE B 2 77  ? -20.44000 -62.10800 19.08700  1.000 24.94000  ? 77   PHE B CZ    1 
ATOM   5050 N  N     . ARG B 2 78  ? -26.25300 -63.90600 14.63800  1.000 31.29000  ? 78   ARG B N     1 
ATOM   5051 C  CA    . ARG B 2 78  ? -27.00300 -64.88600 13.84900  1.000 31.37000  ? 78   ARG B CA    1 
ATOM   5052 C  C     . ARG B 2 78  ? -26.11400 -65.62000 12.87600  1.000 33.52000  ? 78   ARG B C     1 
ATOM   5053 O  O     . ARG B 2 78  ? -26.17200 -66.84600 12.78900  1.000 39.09000  ? 78   ARG B O     1 
ATOM   5054 C  CB    . ARG B 2 78  ? -28.15400 -64.23600 13.09400  1.000 25.80000  ? 78   ARG B CB    1 
ATOM   5055 C  CG    . ARG B 2 78  ? -29.37200 -64.07100 13.96700  1.000 27.98000  ? 78   ARG B CG    1 
ATOM   5056 C  CD    . ARG B 2 78  ? -30.44900 -63.28100 13.29300  1.000 33.43000  ? 78   ARG B CD    1 
ATOM   5057 N  NE    . ARG B 2 78  ? -30.06100 -61.88300 13.11100  1.000 38.03000  ? 78   ARG B NE    1 
ATOM   5058 C  CZ    . ARG B 2 78  ? -30.62900 -61.07400 12.22700  1.000 31.30000  ? 78   ARG B CZ    1 
ATOM   5059 N  NH1   . ARG B 2 78  ? -31.60000 -61.53500 11.45900  1.000 29.78000  ? 78   ARG B NH1   1 
ATOM   5060 N  NH2   . ARG B 2 78  ? -30.23700 -59.81500 12.12100  1.000 26.37000  ? 78   ARG B NH2   1 
ATOM   5061 N  N     . GLU B 2 79  ? -25.28000 -64.88400 12.15400  1.000 34.29000  ? 79   GLU B N     1 
ATOM   5062 C  CA    . GLU B 2 79  ? -24.36500 -65.53700 11.23000  1.000 38.37000  ? 79   GLU B CA    1 
ATOM   5063 C  C     . GLU B 2 79  ? -23.38800 -66.45600 11.99000  1.000 38.15000  ? 79   GLU B C     1 
ATOM   5064 O  O     . GLU B 2 79  ? -23.33600 -67.65300 11.72200  1.000 39.07000  ? 79   GLU B O     1 
ATOM   5065 C  CB    . GLU B 2 79  ? -23.62100 -64.50100 10.39400  1.000 30.51000  ? 79   GLU B CB    1 
ATOM   5066 C  CG    . GLU B 2 79  ? -23.44100 -64.91500 8.95500   1.000 37.68000  ? 79   GLU B CG    1 
ATOM   5067 C  CD    . GLU B 2 79  ? -24.76200 -65.28300 8.26100   1.000 47.22000  ? 79   GLU B CD    1 
ATOM   5068 O  OE1   . GLU B 2 79  ? -24.83000 -66.34600 7.59300   1.000 48.05000  ? 79   GLU B OE1   1 
ATOM   5069 O  OE2   . GLU B 2 79  ? -25.73500 -64.49800 8.36600   1.000 49.72000  ? 79   GLU B OE2   1 
ATOM   5070 N  N     . LEU B 2 80  ? -22.65800 -65.92100 12.96200  1.000 28.54000  ? 80   LEU B N     1 
ATOM   5071 C  CA    . LEU B 2 80  ? -21.71600 -66.73600 13.70500  1.000 30.13000  ? 80   LEU B CA    1 
ATOM   5072 C  C     . LEU B 2 80  ? -22.33100 -68.03400 14.18700  1.000 35.58000  ? 80   LEU B C     1 
ATOM   5073 O  O     . LEU B 2 80  ? -21.76800 -69.10500 13.97800  1.000 36.24000  ? 80   LEU B O     1 
ATOM   5074 C  CB    . LEU B 2 80  ? -21.16300 -65.97700 14.91300  1.000 33.60000  ? 80   LEU B CB    1 
ATOM   5075 C  CG    . LEU B 2 80  ? -20.17600 -66.78600 15.75700  1.000 29.59000  ? 80   LEU B CG    1 
ATOM   5076 C  CD1   . LEU B 2 80  ? -19.06800 -67.36600 14.89100  1.000 27.61000  ? 80   LEU B CD1   1 
ATOM   5077 C  CD2   . LEU B 2 80  ? -19.60800 -65.90700 16.82300  1.000 28.40000  ? 80   LEU B CD2   1 
ATOM   5078 N  N     . ASN B 2 81  ? -23.48800 -67.91500 14.83000  1.000 37.30000  ? 81   ASN B N     1 
ATOM   5079 C  CA    . ASN B 2 81  ? -24.23500 -69.06000 15.33900  1.000 34.04000  ? 81   ASN B CA    1 
ATOM   5080 C  C     . ASN B 2 81  ? -24.55900 -70.10200 14.27200  1.000 42.26000  ? 81   ASN B C     1 
ATOM   5081 O  O     . ASN B 2 81  ? -24.46500 -71.30200 14.53000  1.000 48.56000  ? 81   ASN B O     1 
ATOM   5082 C  CB    . ASN B 2 81  ? -25.52700 -68.58400 15.99100  1.000 32.65000  ? 81   ASN B CB    1 
ATOM   5083 C  CG    . ASN B 2 81  ? -25.27500 -67.81000 17.26400  1.000 36.18000  ? 81   ASN B CG    1 
ATOM   5084 O  OD1   . ASN B 2 81  ? -24.17700 -67.86400 17.83300  1.000 40.80000  ? 81   ASN B OD1   1 
ATOM   5085 N  ND2   . ASN B 2 81  ? -26.28600 -67.10600 17.73500  1.000 32.28000  ? 81   ASN B ND2   1 
ATOM   5086 N  N     . LYS B 2 82  ? -24.93600 -69.64200 13.07900  1.000 41.91000  ? 82   LYS B N     1 
ATOM   5087 C  CA    . LYS B 2 82  ? -25.13700 -70.53700 11.95100  1.000 37.49000  ? 82   LYS B CA    1 
ATOM   5088 C  C     . LYS B 2 82  ? -23.88000 -71.32800 11.60600  1.000 38.11000  ? 82   LYS B C     1 
ATOM   5089 O  O     . LYS B 2 82  ? -23.97200 -72.40300 11.02900  1.000 48.38000  ? 82   LYS B O     1 
ATOM   5090 C  CB    . LYS B 2 82  ? -25.59000 -69.76100 10.70500  1.000 37.91000  ? 82   LYS B CB    1 
ATOM   5091 C  CG    . LYS B 2 82  ? -27.08900 -69.57700 10.57100  1.000 41.94000  ? 82   LYS B CG    1 
ATOM   5092 C  CD    . LYS B 2 82  ? -27.45800 -68.94100 9.22900   1.000 45.42000  ? 82   LYS B CD    1 
ATOM   5093 C  CE    . LYS B 2 82  ? -27.77000 -67.45100 9.35100   1.000 44.23000  ? 82   LYS B CE    1 
ATOM   5094 N  NZ    . LYS B 2 82  ? -28.13900 -66.83500 8.03500   1.000 46.24000  ? 82   LYS B NZ    1 
ATOM   5095 N  N     . ARG B 2 83  ? -22.70600 -70.80400 11.94600  1.000 38.33000  ? 83   ARG B N     1 
ATOM   5096 C  CA    . ARG B 2 83  ? -21.44900 -71.41500 11.50900  1.000 41.56000  ? 83   ARG B CA    1 
ATOM   5097 C  C     . ARG B 2 83  ? -20.65700 -72.07500 12.63900  1.000 44.13000  ? 83   ARG B C     1 
ATOM   5098 O  O     . ARG B 2 83  ? -19.49800 -72.42600 12.46600  1.000 45.68000  ? 83   ARG B O     1 
ATOM   5099 C  CB    . ARG B 2 83  ? -20.56500 -70.36600 10.83000  1.000 39.05000  ? 83   ARG B CB    1 
ATOM   5100 C  CG    . ARG B 2 83  ? -21.12400 -69.75600 9.54800   1.000 35.63000  ? 83   ARG B CG    1 
ATOM   5101 C  CD    . ARG B 2 83  ? -20.55000 -68.36700 9.37600   1.000 38.21000  ? 83   ARG B CD    1 
ATOM   5102 N  NE    . ARG B 2 83  ? -20.19100 -68.02300 7.99800   1.000 40.60000  ? 83   ARG B NE    1 
ATOM   5103 C  CZ    . ARG B 2 83  ? -20.97700 -67.32800 7.17800   1.000 37.64000  ? 83   ARG B CZ    1 
ATOM   5104 N  NH1   . ARG B 2 83  ? -22.16600 -66.92100 7.58500   1.000 34.55000  ? 83   ARG B NH1   1 
ATOM   5105 N  NH2   . ARG B 2 83  ? -20.58100 -67.04300 5.94800   1.000 45.87000  ? 83   ARG B NH2   1 
ATOM   5106 N  N     . THR B 2 84  ? -21.28500 -72.24100 13.79300  1.000 48.18000  ? 84   THR B N     1 
ATOM   5107 C  CA    . THR B 2 84  ? -20.60000 -72.75800 14.97200  1.000 48.13000  ? 84   THR B CA    1 
ATOM   5108 C  C     . THR B 2 84  ? -20.90800 -74.23000 15.17200  1.000 55.33000  ? 84   THR B C     1 
ATOM   5109 O  O     . THR B 2 84  ? -22.08100 -74.60400 15.21500  1.000 53.47000  ? 84   THR B O     1 
ATOM   5110 C  CB    . THR B 2 84  ? -21.02300 -72.00200 16.24000  1.000 44.39000  ? 84   THR B CB    1 
ATOM   5111 O  OG1   . THR B 2 84  ? -21.16200 -70.61200 15.94600  1.000 47.77000  ? 84   THR B OG1   1 
ATOM   5112 C  CG2   . THR B 2 84  ? -19.99300 -72.16500 17.31100  1.000 50.31000  ? 84   THR B CG2   1 
ATOM   5113 N  N     . GLN B 2 85  ? -19.86200 -75.04800 15.31600  1.000 63.10000  ? 85   GLN B N     1 
ATOM   5114 C  CA    . GLN B 2 85  ? -20.01000 -76.48800 15.54100  1.000 63.41000  ? 85   GLN B CA    1 
ATOM   5115 C  C     . GLN B 2 85  ? -21.08400 -76.73800 16.59000  1.000 64.05000  ? 85   GLN B C     1 
ATOM   5116 O  O     . GLN B 2 85  ? -21.00900 -76.22300 17.71100  1.000 63.28000  ? 85   GLN B O     1 
ATOM   5117 C  CB    . GLN B 2 85  ? -18.67800 -77.12400 15.96700  1.000 65.77000  ? 85   GLN B CB    1 
ATOM   5118 C  CG    . GLN B 2 85  ? -18.61800 -78.67400 15.84100  1.000 77.10000  ? 85   GLN B CG    1 
ATOM   5119 C  CD    . GLN B 2 85  ? -18.48900 -79.18800 14.38900  1.000 77.44000  ? 85   GLN B CD    1 
ATOM   5120 O  OE1   . GLN B 2 85  ? -17.40100 -79.17500 13.80400  1.000 74.44000  ? 85   GLN B OE1   1 
ATOM   5121 N  NE2   . GLN B 2 85  ? -19.60300 -79.65700 13.82200  1.000 71.87000  ? 85   GLN B NE2   1 
ATOM   5122 N  N     . ASP B 2 86  ? -22.08800 -77.51500 16.20100  1.000 63.34000  ? 86   ASP B N     1 
ATOM   5123 C  CA    . ASP B 2 86  ? -23.31900 -77.66700 16.97400  1.000 63.63000  ? 86   ASP B CA    1 
ATOM   5124 C  C     . ASP B 2 86  ? -23.12200 -78.32400 18.34100  1.000 62.11000  ? 86   ASP B C     1 
ATOM   5125 O  O     . ASP B 2 86  ? -22.01200 -78.69500 18.72300  1.000 55.81000  ? 86   ASP B O     1 
ATOM   5126 C  CB    . ASP B 2 86  ? -24.33000 -78.46900 16.15900  1.000 67.36000  ? 86   ASP B CB    1 
ATOM   5127 C  CG    . ASP B 2 86  ? -23.74100 -79.00200 14.85600  1.000 76.62000  ? 86   ASP B CG    1 
ATOM   5128 O  OD1   . ASP B 2 86  ? -22.49600 -79.18000 14.77200  1.000 73.33000  ? 86   ASP B OD1   1 
ATOM   5129 O  OD2   . ASP B 2 86  ? -24.53200 -79.24600 13.91500  1.000 73.44000  ? 86   ASP B OD2   1 
ATOM   5130 N  N     . PRO B 2 95  ? -32.24000 -80.14400 26.70400  1.000 88.27000  ? 95   PRO B N     1 
ATOM   5131 C  CA    . PRO B 2 95  ? -33.49300 -80.90800 26.83900  1.000 91.60000  ? 95   PRO B CA    1 
ATOM   5132 C  C     . PRO B 2 95  ? -34.68500 -80.04200 27.28200  1.000 85.26000  ? 95   PRO B C     1 
ATOM   5133 O  O     . PRO B 2 95  ? -34.85800 -79.78400 28.47600  1.000 83.17000  ? 95   PRO B O     1 
ATOM   5134 C  CB    . PRO B 2 95  ? -33.13500 -81.95400 27.89500  1.000 82.92000  ? 95   PRO B CB    1 
ATOM   5135 C  CG    . PRO B 2 95  ? -31.68000 -82.24500 27.60400  1.000 84.72000  ? 95   PRO B CG    1 
ATOM   5136 C  CD    . PRO B 2 95  ? -31.07100 -80.92500 27.15100  1.000 85.21000  ? 95   PRO B CD    1 
ATOM   5137 N  N     . HIS B 2 96  ? -35.49400 -79.61700 26.31000  1.000 72.57000  ? 96   HIS B N     1 
ATOM   5138 C  CA    . HIS B 2 96  ? -36.58500 -78.66500 26.52500  1.000 64.94000  ? 96   HIS B CA    1 
ATOM   5139 C  C     . HIS B 2 96  ? -37.80900 -79.31900 27.20300  1.000 62.53000  ? 96   HIS B C     1 
ATOM   5140 O  O     . HIS B 2 96  ? -38.25600 -80.39100 26.78800  1.000 65.49000  ? 96   HIS B O     1 
ATOM   5141 C  CB    . HIS B 2 96  ? -36.97300 -78.02400 25.17200  1.000 59.64000  ? 96   HIS B CB    1 
ATOM   5142 C  CG    . HIS B 2 96  ? -38.31300 -77.35700 25.17400  1.000 50.40000  ? 96   HIS B CG    1 
ATOM   5143 N  ND1   . HIS B 2 96  ? -38.50200 -76.06500 25.61700  1.000 48.92000  ? 96   HIS B ND1   1 
ATOM   5144 C  CD2   . HIS B 2 96  ? -39.53600 -77.81200 24.80900  1.000 54.36000  ? 96   HIS B CD2   1 
ATOM   5145 C  CE1   . HIS B 2 96  ? -39.78200 -75.74900 25.52400  1.000 47.02000  ? 96   HIS B CE1   1 
ATOM   5146 N  NE2   . HIS B 2 96  ? -40.43400 -76.79300 25.03900  1.000 52.61000  ? 96   HIS B NE2   1 
ATOM   5147 N  N     . PRO B 2 97  ? -38.34900 -78.66300 28.25000  1.000 59.64000  ? 97   PRO B N     1 
ATOM   5148 C  CA    . PRO B 2 97  ? -39.45300 -79.16500 29.08300  1.000 59.01000  ? 97   PRO B CA    1 
ATOM   5149 C  C     . PRO B 2 97  ? -40.85400 -78.85300 28.58300  1.000 57.55000  ? 97   PRO B C     1 
ATOM   5150 O  O     . PRO B 2 97  ? -41.25700 -77.68400 28.58200  1.000 54.71000  ? 97   PRO B O     1 
ATOM   5151 C  CB    . PRO B 2 97  ? -39.22300 -78.44700 30.41200  1.000 58.93000  ? 97   PRO B CB    1 
ATOM   5152 C  CG    . PRO B 2 97  ? -38.66200 -77.14500 30.00700  1.000 54.35000  ? 97   PRO B CG    1 
ATOM   5153 C  CD    . PRO B 2 97  ? -37.76300 -77.44100 28.82800  1.000 58.81000  ? 97   PRO B CD    1 
ATOM   5154 N  N     . ALA B 2 98  ? -41.60000 -79.89700 28.22500  1.000 61.62000  ? 98   ALA B N     1 
ATOM   5155 C  CA    . ALA B 2 98  ? -42.98200 -79.74500 27.76700  1.000 59.51000  ? 98   ALA B CA    1 
ATOM   5156 C  C     . ALA B 2 98  ? -43.86000 -79.07900 28.81500  1.000 57.11000  ? 98   ALA B C     1 
ATOM   5157 O  O     . ALA B 2 98  ? -44.95800 -78.61900 28.50800  1.000 66.03000  ? 98   ALA B O     1 
ATOM   5158 C  CB    . ALA B 2 98  ? -43.56900 -81.09700 27.38500  1.000 57.50000  ? 98   ALA B CB    1 
ATOM   5159 N  N     . GLY B 2 99  ? -43.37600 -79.02500 30.05100  1.000 58.07000  ? 99   GLY B N     1 
ATOM   5160 C  CA    . GLY B 2 99  ? -44.19200 -78.55600 31.15400  1.000 57.73000  ? 99   GLY B CA    1 
ATOM   5161 C  C     . GLY B 2 99  ? -44.32300 -77.05200 31.17300  1.000 62.41000  ? 99   GLY B C     1 
ATOM   5162 O  O     . GLY B 2 99  ? -45.31200 -76.51100 31.66500  1.000 68.10000  ? 99   GLY B O     1 
ATOM   5163 N  N     . LEU B 2 100 ? -43.32100 -76.37600 30.62300  1.000 62.66000  ? 100  LEU B N     1 
ATOM   5164 C  CA    . LEU B 2 100 ? -43.26400 -74.92000 30.66000  1.000 60.22000  ? 100  LEU B CA    1 
ATOM   5165 C  C     . LEU B 2 100 ? -44.41000 -74.23200 29.90500  1.000 61.16000  ? 100  LEU B C     1 
ATOM   5166 O  O     . LEU B 2 100 ? -44.82100 -73.12500 30.28000  1.000 54.81000  ? 100  LEU B O     1 
ATOM   5167 C  CB    . LEU B 2 100 ? -41.92300 -74.44300 30.10300  1.000 57.59000  ? 100  LEU B CB    1 
ATOM   5168 C  CG    . LEU B 2 100 ? -41.82400 -72.92900 29.95300  1.000 51.96000  ? 100  LEU B CG    1 
ATOM   5169 C  CD1   . LEU B 2 100 ? -41.99400 -72.26200 31.30400  1.000 49.75000  ? 100  LEU B CD1   1 
ATOM   5170 C  CD2   . LEU B 2 100 ? -40.50900 -72.53500 29.29300  1.000 48.85000  ? 100  LEU B CD2   1 
ATOM   5171 N  N     . LYS B 2 101 ? -44.91900 -74.87100 28.84700  1.000 63.08000  ? 101  LYS B N     1 
ATOM   5172 C  CA    . LYS B 2 101 ? -46.01900 -74.28000 28.07000  1.000 65.24000  ? 101  LYS B CA    1 
ATOM   5173 C  C     . LYS B 2 101 ? -47.34800 -74.28700 28.83700  1.000 70.04000  ? 101  LYS B C     1 
ATOM   5174 O  O     . LYS B 2 101 ? -48.34700 -73.75400 28.35200  1.000 72.86000  ? 101  LYS B O     1 
ATOM   5175 C  CB    . LYS B 2 101 ? -46.19700 -74.99600 26.72000  1.000 57.09000  ? 101  LYS B CB    1 
ATOM   5176 C  CG    . LYS B 2 101 ? -46.14100 -76.51000 26.76300  1.000 58.65000  ? 101  LYS B CG    1 
ATOM   5177 C  CD    . LYS B 2 101 ? -46.68900 -77.10000 25.47400  1.000 48.91000  ? 101  LYS B CD    1 
ATOM   5178 C  CE    . LYS B 2 101 ? -46.24000 -78.53600 25.28500  1.000 48.24000  ? 101  LYS B CE    1 
ATOM   5179 N  NZ    . LYS B 2 101 ? -44.81000 -78.62300 24.86200  1.000 52.04000  ? 101  LYS B NZ    1 
ATOM   5180 N  N     . LYS B 2 102 ? -47.34900 -74.88400 30.02700  1.000 70.61000  ? 102  LYS B N     1 
ATOM   5181 C  CA    . LYS B 2 102 ? -48.53200 -74.93800 30.88300  1.000 67.59000  ? 102  LYS B CA    1 
ATOM   5182 C  C     . LYS B 2 102 ? -48.23700 -74.36200 32.25800  1.000 71.40000  ? 102  LYS B C     1 
ATOM   5183 O  O     . LYS B 2 102 ? -47.86100 -75.10100 33.16700  1.000 77.42000  ? 102  LYS B O     1 
ATOM   5184 C  CB    . LYS B 2 102 ? -49.02000 -76.37600 31.03100  1.000 63.62000  ? 102  LYS B CB    1 
ATOM   5185 C  CG    . LYS B 2 102 ? -49.47700 -76.99000 29.73300  1.000 69.79000  ? 102  LYS B CG    1 
ATOM   5186 C  CD    . LYS B 2 102 ? -49.27400 -78.49500 29.73500  1.000 72.06000  ? 102  LYS B CD    1 
ATOM   5187 C  CE    . LYS B 2 102 ? -47.79600 -78.84200 29.77600  1.000 68.69000  ? 102  LYS B CE    1 
ATOM   5188 N  NZ    . LYS B 2 102 ? -47.55200 -80.19100 29.18300  1.000 67.98000  ? 102  LYS B NZ    1 
ATOM   5189 N  N     . LYS B 2 103 ? -48.39700 -73.05000 32.40600  1.000 63.50000  ? 103  LYS B N     1 
ATOM   5190 C  CA    . LYS B 2 103 ? -48.16100 -72.38300 33.68500  1.000 61.64000  ? 103  LYS B CA    1 
ATOM   5191 C  C     . LYS B 2 103 ? -48.90700 -71.06400 33.68300  1.000 63.16000  ? 103  LYS B C     1 
ATOM   5192 O  O     . LYS B 2 103 ? -48.89400 -70.35700 32.68500  1.000 66.22000  ? 103  LYS B O     1 
ATOM   5193 C  CB    . LYS B 2 103 ? -46.66500 -72.15800 33.92600  1.000 60.05000  ? 103  LYS B CB    1 
ATOM   5194 C  CG    . LYS B 2 103 ? -45.90200 -73.35700 34.50000  1.000 63.43000  ? 103  LYS B CG    1 
ATOM   5195 C  CD    . LYS B 2 103 ? -46.09900 -73.49700 36.02000  1.000 68.03000  ? 103  LYS B CD    1 
ATOM   5196 C  CE    . LYS B 2 103 ? -45.21200 -74.59400 36.61900  1.000 63.57000  ? 103  LYS B CE    1 
ATOM   5197 N  NZ    . LYS B 2 103 ? -45.45500 -75.92200 35.97200  1.000 62.89000  ? 103  LYS B NZ    1 
ATOM   5198 N  N     . LYS B 2 104 ? -49.57200 -70.73500 34.78600  1.000 67.54000  ? 104  LYS B N     1 
ATOM   5199 C  CA    . LYS B 2 104 ? -50.38400 -69.51500 34.82500  1.000 75.44000  ? 104  LYS B CA    1 
ATOM   5200 C  C     . LYS B 2 104 ? -49.51400 -68.29000 34.54800  1.000 72.94000  ? 104  LYS B C     1 
ATOM   5201 O  O     . LYS B 2 104 ? -49.93900 -67.34300 33.87000  1.000 69.46000  ? 104  LYS B O     1 
ATOM   5202 C  CB    . LYS B 2 104 ? -51.09700 -69.36100 36.17700  1.000 71.88000  ? 104  LYS B CB    1 
ATOM   5203 C  CG    . LYS B 2 104 ? -52.23200 -70.35800 36.41900  1.000 81.05000  ? 104  LYS B CG    1 
ATOM   5204 C  CD    . LYS B 2 104 ? -52.70300 -70.32700 37.88200  1.000 85.27000  ? 104  LYS B CD    1 
ATOM   5205 C  CE    . LYS B 2 104 ? -53.52300 -71.56300 38.25300  1.000 74.91000  ? 104  LYS B CE    1 
ATOM   5206 N  NZ    . LYS B 2 104 ? -53.70300 -71.68500 39.73100  1.000 73.45000  ? 104  LYS B NZ    1 
ATOM   5207 N  N     . SER B 2 105 ? -48.29300 -68.32700 35.07300  1.000 66.26000  ? 105  SER B N     1 
ATOM   5208 C  CA    . SER B 2 105 ? -47.35200 -67.23400 34.90200  1.000 64.44000  ? 105  SER B CA    1 
ATOM   5209 C  C     . SER B 2 105 ? -45.99800 -67.78100 34.49700  1.000 60.95000  ? 105  SER B C     1 
ATOM   5210 O  O     . SER B 2 105 ? -45.61200 -68.87300 34.91800  1.000 61.31000  ? 105  SER B O     1 
ATOM   5211 C  CB    . SER B 2 105 ? -47.22200 -66.40700 36.19000  1.000 64.81000  ? 105  SER B CB    1 
ATOM   5212 O  OG    . SER B 2 105 ? -48.45800 -65.83000 36.57000  1.000 68.72000  ? 105  SER B OG    1 
ATOM   5213 N  N     . VAL B 2 106 ? -45.29600 -67.01700 33.66400  1.000 56.68000  ? 106  VAL B N     1 
ATOM   5214 C  CA    . VAL B 2 106 ? -43.92600 -67.33100 33.29200  1.000 54.93000  ? 106  VAL B CA    1 
ATOM   5215 C  C     . VAL B 2 106 ? -43.16000 -66.04800 33.18600  1.000 58.00000  ? 106  VAL B C     1 
ATOM   5216 O  O     . VAL B 2 106 ? -43.55600 -65.11600 32.48700  1.000 57.25000  ? 106  VAL B O     1 
ATOM   5217 C  CB    . VAL B 2 106 ? -43.80400 -68.08200 31.96100  1.000 51.13000  ? 106  VAL B CB    1 
ATOM   5218 C  CG1   . VAL B 2 106 ? -42.35100 -68.40200 31.67300  1.000 47.31000  ? 106  VAL B CG1   1 
ATOM   5219 C  CG2   . VAL B 2 106 ? -44.60400 -69.34800 32.00100  1.000 59.12000  ? 106  VAL B CG2   1 
ATOM   5220 N  N     . THR B 2 107 ? -42.03000 -66.02600 33.86200  1.000 52.97000  ? 107  THR B N     1 
ATOM   5221 C  CA    . THR B 2 107 ? -41.28300 -64.81400 34.03000  1.000 58.46000  ? 107  THR B CA    1 
ATOM   5222 C  C     . THR B 2 107 ? -39.94000 -64.95000 33.28700  1.000 51.99000  ? 107  THR B C     1 
ATOM   5223 O  O     . THR B 2 107 ? -39.36200 -66.02600 33.28700  1.000 50.77000  ? 107  THR B O     1 
ATOM   5224 C  CB    . THR B 2 107 ? -41.13700 -64.58000 35.52900  1.000 62.80000  ? 107  THR B CB    1 
ATOM   5225 O  OG1   . THR B 2 107 ? -42.10200 -63.61600 35.98400  1.000 60.58000  ? 107  THR B OG1   1 
ATOM   5226 C  CG2   . THR B 2 107 ? -39.76300 -64.18500 35.86800  1.000 62.61000  ? 107  THR B CG2   1 
ATOM   5227 N  N     . VAL B 2 108 ? -39.46800 -63.90000 32.62000  1.000 60.69000  ? 108  VAL B N     1 
ATOM   5228 C  CA    . VAL B 2 108 ? -38.23000 -63.99800 31.82800  1.000 57.48000  ? 108  VAL B CA    1 
ATOM   5229 C  C     . VAL B 2 108 ? -37.10800 -63.12400 32.37000  1.000 55.40000  ? 108  VAL B C     1 
ATOM   5230 O  O     . VAL B 2 108 ? -37.22100 -61.90200 32.31600  1.000 54.10000  ? 108  VAL B O     1 
ATOM   5231 C  CB    . VAL B 2 108 ? -38.44900 -63.59100 30.35400  1.000 54.73000  ? 108  VAL B CB    1 
ATOM   5232 C  CG1   . VAL B 2 108 ? -37.21400 -63.95000 29.51500  1.000 48.57000  ? 108  VAL B CG1   1 
ATOM   5233 C  CG2   . VAL B 2 108 ? -39.69100 -64.25400 29.79600  1.000 50.66000  ? 108  VAL B CG2   1 
ATOM   5234 N  N     . LEU B 2 109 ? -36.03100 -63.75500 32.85300  1.000 54.85000  ? 109  LEU B N     1 
ATOM   5235 C  CA    . LEU B 2 109 ? -34.87900 -63.06200 33.45800  1.000 49.36000  ? 109  LEU B CA    1 
ATOM   5236 C  C     . LEU B 2 109 ? -33.67100 -63.06400 32.53300  1.000 47.03000  ? 109  LEU B C     1 
ATOM   5237 O  O     . LEU B 2 109 ? -33.46600 -64.02100 31.78800  1.000 48.76000  ? 109  LEU B O     1 
ATOM   5238 C  CB    . LEU B 2 109 ? -34.48100 -63.71700 34.78500  1.000 49.49000  ? 109  LEU B CB    1 
ATOM   5239 C  CG    . LEU B 2 109 ? -35.42500 -63.71900 35.98600  1.000 48.51000  ? 109  LEU B CG    1 
ATOM   5240 C  CD1   . LEU B 2 109 ? -35.02700 -64.79200 36.93800  1.000 53.10000  ? 109  LEU B CD1   1 
ATOM   5241 C  CD2   . LEU B 2 109 ? -35.28100 -62.45900 36.71200  1.000 55.24000  ? 109  LEU B CD2   1 
ATOM   5242 N  N     . ASP B 2 110 ? -32.85800 -62.01200 32.60500  1.000 48.16000  ? 110  ASP B N     1 
ATOM   5243 C  CA    . ASP B 2 110 ? -31.72400 -61.85300 31.69200  1.000 43.40000  ? 110  ASP B CA    1 
ATOM   5244 C  C     . ASP B 2 110 ? -30.40300 -62.25700 32.34600  1.000 49.63000  ? 110  ASP B C     1 
ATOM   5245 O  O     . ASP B 2 110 ? -29.75500 -61.43400 33.01200  1.000 51.13000  ? 110  ASP B O     1 
ATOM   5246 C  CB    . ASP B 2 110 ? -31.64100 -60.40100 31.20600  1.000 38.03000  ? 110  ASP B CB    1 
ATOM   5247 C  CG    . ASP B 2 110 ? -30.45700 -60.16000 30.28300  1.000 43.33000  ? 110  ASP B CG    1 
ATOM   5248 O  OD1   . ASP B 2 110 ? -29.83400 -61.14900 29.84600  1.000 47.14000  ? 110  ASP B OD1   1 
ATOM   5249 O  OD2   . ASP B 2 110 ? -30.15200 -58.98000 29.97900  1.000 48.95000  ? 110  ASP B OD2   1 
ATOM   5250 N  N     . VAL B 2 111 ? -29.98400 -63.50000 32.13300  1.000 41.78000  ? 111  VAL B N     1 
ATOM   5251 C  CA    . VAL B 2 111 ? -28.80400 -63.99000 32.82500  1.000 36.38000  ? 111  VAL B CA    1 
ATOM   5252 C  C     . VAL B 2 111 ? -27.54900 -63.89400 31.97100  1.000 39.37000  ? 111  VAL B C     1 
ATOM   5253 O  O     . VAL B 2 111 ? -26.57300 -64.58500 32.22100  1.000 43.11000  ? 111  VAL B O     1 
ATOM   5254 C  CB    . VAL B 2 111 ? -28.99200 -65.43600 33.27100  1.000 38.75000  ? 111  VAL B CB    1 
ATOM   5255 C  CG1   . VAL B 2 111 ? -30.33100 -65.58400 33.93600  1.000 41.29000  ? 111  VAL B CG1   1 
ATOM   5256 C  CG2   . VAL B 2 111 ? -28.89800 -66.35600 32.08300  1.000 42.28000  ? 111  VAL B CG2   1 
ATOM   5257 N  N     . GLY B 2 112 ? -27.57400 -63.02300 30.97600  1.000 42.89000  ? 112  GLY B N     1 
ATOM   5258 C  CA    . GLY B 2 112 ? -26.42100 -62.83600 30.11000  1.000 45.61000  ? 112  GLY B CA    1 
ATOM   5259 C  C     . GLY B 2 112 ? -25.14100 -62.42800 30.83100  1.000 52.67000  ? 112  GLY B C     1 
ATOM   5260 O  O     . GLY B 2 112 ? -24.03200 -62.74800 30.38600  1.000 52.15000  ? 112  GLY B O     1 
ATOM   5261 N  N     . ASP B 2 113 ? -25.29500 -61.71900 31.94900  1.000 55.95000  ? 113  ASP B N     1 
ATOM   5262 C  CA    . ASP B 2 113 ? -24.15200 -61.24600 32.72800  1.000 58.64000  ? 113  ASP B CA    1 
ATOM   5263 C  C     . ASP B 2 113 ? -23.22600 -62.39800 33.08500  1.000 56.26000  ? 113  ASP B C     1 
ATOM   5264 O  O     . ASP B 2 113 ? -21.99700 -62.27200 33.03100  1.000 53.63000  ? 113  ASP B O     1 
ATOM   5265 C  CB    . ASP B 2 113 ? -24.63000 -60.54400 34.00000  1.000 55.61000  ? 113  ASP B CB    1 
ATOM   5266 C  CG    . ASP B 2 113 ? -24.52400 -59.04300 33.90700  1.000 66.47000  ? 113  ASP B CG    1 
ATOM   5267 O  OD1   . ASP B 2 113 ? -24.17900 -58.53700 32.81300  1.000 70.03000  ? 113  ASP B OD1   1 
ATOM   5268 O  OD2   . ASP B 2 113 ? -24.78500 -58.36700 34.92200  1.000 74.23000  ? 113  ASP B OD2   1 
ATOM   5269 N  N     . ALA B 2 114 ? -23.84600 -63.52900 33.41600  1.000 52.24000  ? 114  ALA B N     1 
ATOM   5270 C  CA    . ALA B 2 114 ? -23.15600 -64.70000 33.93400  1.000 50.09000  ? 114  ALA B CA    1 
ATOM   5271 C  C     . ALA B 2 114 ? -21.99700 -65.16800 33.05500  1.000 49.05000  ? 114  ALA B C     1 
ATOM   5272 O  O     . ALA B 2 114 ? -21.00100 -65.67600 33.56000  1.000 52.31000  ? 114  ALA B O     1 
ATOM   5273 C  CB    . ALA B 2 114 ? -24.15800 -65.83300 34.13100  1.000 44.84000  ? 114  ALA B CB    1 
ATOM   5274 N  N     . TYR B 2 115 ? -22.12400 -64.99500 31.74300  1.000 46.23000  ? 115  TYR B N     1 
ATOM   5275 C  CA    . TYR B 2 115 ? -21.15400 -65.55900 30.80400  1.000 47.91000  ? 115  TYR B CA    1 
ATOM   5276 C  C     . TYR B 2 115 ? -19.74900 -64.92600 30.85900  1.000 45.52000  ? 115  TYR B C     1 
ATOM   5277 O  O     . TYR B 2 115 ? -18.75300 -65.55800 30.50200  1.000 45.27000  ? 115  TYR B O     1 
ATOM   5278 C  CB    . TYR B 2 115 ? -21.70600 -65.44100 29.39000  1.000 43.15000  ? 115  TYR B CB    1 
ATOM   5279 C  CG    . TYR B 2 115 ? -22.97600 -66.21600 29.17100  1.000 44.98000  ? 115  TYR B CG    1 
ATOM   5280 C  CD1   . TYR B 2 115 ? -23.36900 -67.20700 30.05300  1.000 47.92000  ? 115  TYR B CD1   1 
ATOM   5281 C  CD2   . TYR B 2 115 ? -23.77600 -65.97200 28.06300  1.000 47.28000  ? 115  TYR B CD2   1 
ATOM   5282 C  CE1   . TYR B 2 115 ? -24.52800 -67.93100 29.84200  1.000 46.22000  ? 115  TYR B CE1   1 
ATOM   5283 C  CE2   . TYR B 2 115 ? -24.93900 -66.68800 27.84400  1.000 46.96000  ? 115  TYR B CE2   1 
ATOM   5284 C  CZ    . TYR B 2 115 ? -25.31000 -67.66800 28.73400  1.000 48.64000  ? 115  TYR B CZ    1 
ATOM   5285 O  OH    . TYR B 2 115 ? -26.46200 -68.39300 28.51400  1.000 50.15000  ? 115  TYR B OH    1 
ATOM   5286 N  N     . PHE B 2 116 ? -19.67500 -63.67800 31.31200  1.000 45.67000  ? 116  PHE B N     1 
ATOM   5287 C  CA    . PHE B 2 116 ? -18.42000 -62.93200 31.30800  1.000 50.54000  ? 116  PHE B CA    1 
ATOM   5288 C  C     . PHE B 2 116 ? -17.41900 -63.49100 32.31500  1.000 51.00000  ? 116  PHE B C     1 
ATOM   5289 O  O     . PHE B 2 116 ? -16.30600 -62.97700 32.47800  1.000 47.96000  ? 116  PHE B O     1 
ATOM   5290 C  CB    . PHE B 2 116 ? -18.68800 -61.45100 31.59800  1.000 52.62000  ? 116  PHE B CB    1 
ATOM   5291 C  CG    . PHE B 2 116 ? -19.55500 -60.78400 30.57100  1.000 49.84000  ? 116  PHE B CG    1 
ATOM   5292 C  CD1   . PHE B 2 116 ? -19.70200 -61.33600 29.30100  1.000 53.02000  ? 116  PHE B CD1   1 
ATOM   5293 C  CD2   . PHE B 2 116 ? -20.22000 -59.60600 30.87100  1.000 47.35000  ? 116  PHE B CD2   1 
ATOM   5294 C  CE1   . PHE B 2 116 ? -20.51000 -60.72500 28.34100  1.000 56.92000  ? 116  PHE B CE1   1 
ATOM   5295 C  CE2   . PHE B 2 116 ? -21.02500 -58.98900 29.92900  1.000 56.50000  ? 116  PHE B CE2   1 
ATOM   5296 C  CZ    . PHE B 2 116 ? -21.17700 -59.54800 28.65700  1.000 59.51000  ? 116  PHE B CZ    1 
ATOM   5297 N  N     . SER B 2 117 ? -17.82000 -64.55800 32.98400  1.000 51.33000  ? 117  SER B N     1 
ATOM   5298 C  CA    . SER B 2 117 ? -16.97800 -65.14500 34.00700  1.000 51.60000  ? 117  SER B CA    1 
ATOM   5299 C  C     . SER B 2 117 ? -16.23000 -66.34100 33.44600  1.000 46.68000  ? 117  SER B C     1 
ATOM   5300 O  O     . SER B 2 117 ? -15.42600 -66.94500 34.14800  1.000 54.25000  ? 117  SER B O     1 
ATOM   5301 C  CB    . SER B 2 117 ? -17.81800 -65.55000 35.22300  1.000 48.64000  ? 117  SER B CB    1 
ATOM   5302 O  OG    . SER B 2 117 ? -18.82800 -66.48000 34.86000  1.000 50.87000  ? 117  SER B OG    1 
ATOM   5303 N  N     . VAL B 2 118 ? -16.48800 -66.67700 32.18500  1.000 39.25000  ? 118  VAL B N     1 
ATOM   5304 C  CA    . VAL B 2 118 ? -15.87400 -67.85800 31.59300  1.000 40.36000  ? 118  VAL B CA    1 
ATOM   5305 C  C     . VAL B 2 118 ? -15.01200 -67.46700 30.41600  1.000 42.68000  ? 118  VAL B C     1 
ATOM   5306 O  O     . VAL B 2 118 ? -15.50400 -66.89200 29.46700  1.000 46.21000  ? 118  VAL B O     1 
ATOM   5307 C  CB    . VAL B 2 118 ? -16.92300 -68.87700 31.11100  1.000 39.83000  ? 118  VAL B CB    1 
ATOM   5308 C  CG1   . VAL B 2 118 ? -16.24200 -70.06100 30.46300  1.000 37.15000  ? 118  VAL B CG1   1 
ATOM   5309 C  CG2   . VAL B 2 118 ? -17.80800 -69.32500 32.25900  1.000 37.02000  ? 118  VAL B CG2   1 
ATOM   5310 N  N     . PRO B 2 119 ? -13.71700 -67.78300 30.46800  1.000 43.45000  ? 119  PRO B N     1 
ATOM   5311 C  CA    . PRO B 2 119 ? -12.82500 -67.39700 29.37900  1.000 38.66000  ? 119  PRO B CA    1 
ATOM   5312 C  C     . PRO B 2 119 ? -13.28500 -68.00600 28.07600  1.000 39.45000  ? 119  PRO B C     1 
ATOM   5313 O  O     . PRO B 2 119 ? -14.02200 -68.97900 28.11600  1.000 40.92000  ? 119  PRO B O     1 
ATOM   5314 C  CB    . PRO B 2 119 ? -11.47300 -67.97700 29.80000  1.000 39.11000  ? 119  PRO B CB    1 
ATOM   5315 C  CG    . PRO B 2 119 ? -11.58500 -68.18200 31.24400  1.000 51.61000  ? 119  PRO B CG    1 
ATOM   5316 C  CD    . PRO B 2 119 ? -13.00700 -68.52300 31.51700  1.000 49.35000  ? 119  PRO B CD    1 
ATOM   5317 N  N     . LEU B 2 120 ? -12.82600 -67.45200 26.95900  1.000 45.19000  ? 120  LEU B N     1 
ATOM   5318 C  CA    . LEU B 2 120 ? -13.23100 -67.88300 25.62800  1.000 42.22000  ? 120  LEU B CA    1 
ATOM   5319 C  C     . LEU B 2 120 ? -12.03500 -68.46400 24.89800  1.000 43.00000  ? 120  LEU B C     1 
ATOM   5320 O  O     . LEU B 2 120 ? -10.98500 -67.83100 24.84300  1.000 48.01000  ? 120  LEU B O     1 
ATOM   5321 C  CB    . LEU B 2 120 ? -13.82300 -66.69800 24.84500  1.000 43.03000  ? 120  LEU B CB    1 
ATOM   5322 C  CG    . LEU B 2 120 ? -14.49800 -66.94600 23.49000  1.000 44.46000  ? 120  LEU B CG    1 
ATOM   5323 C  CD1   . LEU B 2 120 ? -13.46600 -67.01900 22.37900  1.000 46.34000  ? 120  LEU B CD1   1 
ATOM   5324 C  CD2   . LEU B 2 120 ? -15.33700 -68.21900 23.51900  1.000 42.44000  ? 120  LEU B CD2   1 
ATOM   5325 N  N     . ASP B 2 121 ? -12.19500 -69.66700 24.35000  1.000 45.21000  ? 121  ASP B N     1 
ATOM   5326 C  CA    . ASP B 2 121 ? -11.10300 -70.35300 23.66800  1.000 38.93000  ? 121  ASP B CA    1 
ATOM   5327 C  C     . ASP B 2 121 ? -10.35000 -69.40800 22.76400  1.000 41.38000  ? 121  ASP B C     1 
ATOM   5328 O  O     . ASP B 2 121 ? -10.92700 -68.85400 21.83500  1.000 45.59000  ? 121  ASP B O     1 
ATOM   5329 C  CB    . ASP B 2 121 ? -11.63300 -71.52400 22.85400  1.000 44.75000  ? 121  ASP B CB    1 
ATOM   5330 C  CG    . ASP B 2 121 ? -10.54500 -72.20100 22.02800  1.000 52.36000  ? 121  ASP B CG    1 
ATOM   5331 O  OD1   . ASP B 2 121 ? -9.34500  -71.96500 22.29700  1.000 54.26000  ? 121  ASP B OD1   1 
ATOM   5332 O  OD2   . ASP B 2 121 ? -10.88800 -72.98100 21.10900  1.000 57.61000  ? 121  ASP B OD2   1 
ATOM   5333 N  N     . GLU B 2 122 ? -9.06400  -69.23600 23.04800  1.000 44.81000  ? 122  GLU B N     1 
ATOM   5334 C  CA    . GLU B 2 122 ? -8.22700  -68.25700 22.35200  1.000 47.04000  ? 122  GLU B CA    1 
ATOM   5335 C  C     . GLU B 2 122 ? -8.33000  -68.31900 20.82600  1.000 46.24000  ? 122  GLU B C     1 
ATOM   5336 O  O     . GLU B 2 122 ? -8.29500  -67.28300 20.16600  1.000 46.71000  ? 122  GLU B O     1 
ATOM   5337 C  CB    . GLU B 2 122 ? -6.75900  -68.42200 22.77300  1.000 49.00000  ? 122  GLU B CB    1 
ATOM   5338 C  CG    . GLU B 2 122 ? -5.73000  -67.95500 21.72800  1.000 60.68000  ? 122  GLU B CG    1 
ATOM   5339 C  CD    . GLU B 2 122 ? -5.69100  -66.43200 21.50400  1.000 67.45000  ? 122  GLU B CD    1 
ATOM   5340 O  OE1   . GLU B 2 122 ? -6.30200  -65.67200 22.30600  1.000 60.16000  ? 122  GLU B OE1   1 
ATOM   5341 O  OE2   . GLU B 2 122 ? -5.03400  -66.00800 20.51400  1.000 53.58000  ? 122  GLU B OE2   1 
ATOM   5342 N  N     . ASP B 2 123 ? -8.46000  -69.51400 20.26500  1.000 46.45000  ? 123  ASP B N     1 
ATOM   5343 C  CA    . ASP B 2 123 ? -8.45800  -69.62900 18.81100  1.000 46.73000  ? 123  ASP B CA    1 
ATOM   5344 C  C     . ASP B 2 123 ? -9.78100  -69.19900 18.23900  1.000 47.44000  ? 123  ASP B C     1 
ATOM   5345 O  O     . ASP B 2 123 ? -9.89700  -68.94500 17.04400  1.000 47.80000  ? 123  ASP B O     1 
ATOM   5346 C  CB    . ASP B 2 123 ? -8.15100  -71.05400 18.36300  1.000 48.34000  ? 123  ASP B CB    1 
ATOM   5347 C  CG    . ASP B 2 123 ? -6.70000  -71.24100 18.00900  1.000 60.67000  ? 123  ASP B CG    1 
ATOM   5348 O  OD1   . ASP B 2 123 ? -5.86500  -70.45300 18.50500  1.000 57.42000  ? 123  ASP B OD1   1 
ATOM   5349 O  OD2   . ASP B 2 123 ? -6.38800  -72.17500 17.23800  1.000 72.47000  ? 123  ASP B OD2   1 
ATOM   5350 N  N     . PHE B 2 124 ? -10.79000 -69.12300 19.09300  1.000 42.18000  ? 124  PHE B N     1 
ATOM   5351 C  CA    . PHE B 2 124 ? -12.11100 -68.81100 18.60800  1.000 37.67000  ? 124  PHE B CA    1 
ATOM   5352 C  C     . PHE B 2 124 ? -12.34500 -67.30900 18.59800  1.000 40.93000  ? 124  PHE B C     1 
ATOM   5353 O  O     . PHE B 2 124 ? -13.10300 -66.80100 17.76700  1.000 41.07000  ? 124  PHE B O     1 
ATOM   5354 C  CB    . PHE B 2 124 ? -13.16000 -69.49900 19.46100  1.000 33.81000  ? 124  PHE B CB    1 
ATOM   5355 C  CG    . PHE B 2 124 ? -14.47100 -69.61400 18.78700  1.000 33.00000  ? 124  PHE B CG    1 
ATOM   5356 C  CD1   . PHE B 2 124 ? -14.62100 -70.45700 17.69900  1.000 34.22000  ? 124  PHE B CD1   1 
ATOM   5357 C  CD2   . PHE B 2 124 ? -15.54900 -68.87100 19.21700  1.000 30.73000  ? 124  PHE B CD2   1 
ATOM   5358 C  CE1   . PHE B 2 124 ? -15.82600 -70.56500 17.05500  1.000 35.15000  ? 124  PHE B CE1   1 
ATOM   5359 C  CE2   . PHE B 2 124 ? -16.75100 -68.97500 18.58400  1.000 31.74000  ? 124  PHE B CE2   1 
ATOM   5360 C  CZ    . PHE B 2 124 ? -16.89700 -69.83000 17.50300  1.000 33.84000  ? 124  PHE B CZ    1 
ATOM   5361 N  N     . ARG B 2 125 ? -11.67300 -66.61800 19.51400  1.000 39.76000  ? 125  ARG B N     1 
ATOM   5362 C  CA    . ARG B 2 125 ? -11.86000 -65.19100 19.76900  1.000 38.42000  ? 125  ARG B CA    1 
ATOM   5363 C  C     . ARG B 2 125 ? -11.98700 -64.34700 18.52200  1.000 37.63000  ? 125  ARG B C     1 
ATOM   5364 O  O     . ARG B 2 125 ? -12.87500 -63.49600 18.43200  1.000 36.32000  ? 125  ARG B O     1 
ATOM   5365 C  CB    . ARG B 2 125 ? -10.70700 -64.67600 20.61500  1.000 33.98000  ? 125  ARG B CB    1 
ATOM   5366 C  CG    . ARG B 2 125 ? -10.57400 -65.49200 21.86600  1.000 41.68000  ? 125  ARG B CG    1 
ATOM   5367 C  CD    . ARG B 2 125 ? -9.66300  -64.88200 22.87400  1.000 42.88000  ? 125  ARG B CD    1 
ATOM   5368 N  NE    . ARG B 2 125 ? -9.94500  -65.43700 24.19000  1.000 44.73000  ? 125  ARG B NE    1 
ATOM   5369 C  CZ    . ARG B 2 125 ? -9.28900  -65.09000 25.28900  1.000 46.53000  ? 125  ARG B CZ    1 
ATOM   5370 N  NH1   . ARG B 2 125 ? -8.31000  -64.19600 25.20600  1.000 44.83000  ? 125  ARG B NH1   1 
ATOM   5371 N  NH2   . ARG B 2 125 ? -9.61000  -65.64100 26.46200  1.000 46.80000  ? 125  ARG B NH2   1 
ATOM   5372 N  N     . LYS B 2 126 ? -11.11500 -64.61500 17.55700  1.000 34.63000  ? 126  LYS B N     1 
ATOM   5373 C  CA    . LYS B 2 126 ? -11.05900 -63.84100 16.33500  1.000 30.64000  ? 126  LYS B CA    1 
ATOM   5374 C  C     . LYS B 2 126 ? -12.40600 -63.81800 15.57500  1.000 35.03000  ? 126  LYS B C     1 
ATOM   5375 O  O     . LYS B 2 126 ? -12.75900 -62.81300 14.92600  1.000 34.40000  ? 126  LYS B O     1 
ATOM   5376 C  CB    . LYS B 2 126 ? -9.95000  -64.39600 15.44700  1.000 27.51000  ? 126  LYS B CB    1 
ATOM   5377 C  CG    . LYS B 2 126 ? -10.13300 -65.83100 15.09200  1.000 32.85000  ? 126  LYS B CG    1 
ATOM   5378 C  CD    . LYS B 2 126 ? -9.24900  -66.21200 13.90200  1.000 36.63000  ? 126  LYS B CD    1 
ATOM   5379 C  CE    . LYS B 2 126 ? -7.82400  -66.54900 14.32100  1.000 47.43000  ? 126  LYS B CE    1 
ATOM   5380 N  NZ    . LYS B 2 126 ? -7.67600  -67.89100 14.98800  1.000 45.28000  ? 126  LYS B NZ    1 
ATOM   5381 N  N     . TYR B 2 127 ? -13.16500 -64.90900 15.65500  1.000 33.35000  ? 127  TYR B N     1 
ATOM   5382 C  CA    . TYR B 2 127 ? -14.44300 -64.95900 14.95300  1.000 31.58000  ? 127  TYR B CA    1 
ATOM   5383 C  C     . TYR B 2 127 ? -15.52200 -64.11100 15.59900  1.000 28.82000  ? 127  TYR B C     1 
ATOM   5384 O  O     . TYR B 2 127 ? -16.62200 -64.04900 15.07000  1.000 30.14000  ? 127  TYR B O     1 
ATOM   5385 C  CB    . TYR B 2 127 ? -14.95100 -66.39600 14.85000  1.000 32.72000  ? 127  TYR B CB    1 
ATOM   5386 C  CG    . TYR B 2 127 ? -13.98200 -67.33400 14.17000  1.000 40.07000  ? 127  TYR B CG    1 
ATOM   5387 C  CD1   . TYR B 2 127 ? -13.44100 -67.03400 12.90800  1.000 37.99000  ? 127  TYR B CD1   1 
ATOM   5388 C  CD2   . TYR B 2 127 ? -13.58500 -68.51100 14.79700  1.000 39.13000  ? 127  TYR B CD2   1 
ATOM   5389 C  CE1   . TYR B 2 127 ? -12.53700 -67.89900 12.30200  1.000 39.39000  ? 127  TYR B CE1   1 
ATOM   5390 C  CE2   . TYR B 2 127 ? -12.69600 -69.37100 14.19600  1.000 35.85000  ? 127  TYR B CE2   1 
ATOM   5391 C  CZ    . TYR B 2 127 ? -12.17400 -69.06800 12.96400  1.000 38.57000  ? 127  TYR B CZ    1 
ATOM   5392 O  OH    . TYR B 2 127 ? -11.28900 -69.95200 12.41200  1.000 40.64000  ? 127  TYR B OH    1 
ATOM   5393 N  N     . THR B 2 128 ? -15.23200 -63.46800 16.73200  1.000 28.95000  ? 128  THR B N     1 
ATOM   5394 C  CA    . THR B 2 128 ? -16.25200 -62.66300 17.39800  1.000 29.39000  ? 128  THR B CA    1 
ATOM   5395 C  C     . THR B 2 128 ? -16.02000 -61.15500 17.29800  1.000 30.91000  ? 128  THR B C     1 
ATOM   5396 O  O     . THR B 2 128 ? -16.66700 -60.37600 18.01500  1.000 27.79000  ? 128  THR B O     1 
ATOM   5397 C  CB    . THR B 2 128 ? -16.36400 -63.00200 18.89000  1.000 31.66000  ? 128  THR B CB    1 
ATOM   5398 O  OG1   . THR B 2 128 ? -15.25300 -62.42200 19.59600  1.000 32.83000  ? 128  THR B OG1   1 
ATOM   5399 C  CG2   . THR B 2 128 ? -16.38800 -64.49800 19.09000  1.000 23.98000  ? 128  THR B CG2   1 
ATOM   5400 N  N     . ALA B 2 129 ? -15.11200 -60.74000 16.42000  1.000 27.45000  ? 129  ALA B N     1 
ATOM   5401 C  CA    . ALA B 2 129 ? -14.83400 -59.31900 16.21500  1.000 26.39000  ? 129  ALA B CA    1 
ATOM   5402 C  C     . ALA B 2 129 ? -16.08200 -58.51700 15.86000  1.000 26.86000  ? 129  ALA B C     1 
ATOM   5403 O  O     . ALA B 2 129 ? -16.96300 -59.01900 15.16200  1.000 28.14000  ? 129  ALA B O     1 
ATOM   5404 C  CB    . ALA B 2 129 ? -13.79500 -59.14600 15.12200  1.000 21.32000  ? 129  ALA B CB    1 
ATOM   5405 N  N     . PHE B 2 130 ? -16.13100 -57.27400 16.34200  1.000 28.26000  ? 130  PHE B N     1 
ATOM   5406 C  CA    . PHE B 2 130 ? -17.14500 -56.30000 15.93800  1.000 25.56000  ? 130  PHE B CA    1 
ATOM   5407 C  C     . PHE B 2 130 ? -16.55300 -54.89500 15.81900  1.000 27.28000  ? 130  PHE B C     1 
ATOM   5408 O  O     . PHE B 2 130 ? -15.43400 -54.65800 16.26600  1.000 28.58000  ? 130  PHE B O     1 
ATOM   5409 C  CB    . PHE B 2 130 ? -18.33000 -56.29500 16.92600  1.000 22.14000  ? 130  PHE B CB    1 
ATOM   5410 C  CG    . PHE B 2 130 ? -17.96800 -55.90300 18.32000  1.000 20.19000  ? 130  PHE B CG    1 
ATOM   5411 C  CD1   . PHE B 2 130 ? -17.99400 -54.58200 18.71000  1.000 22.46000  ? 130  PHE B CD1   1 
ATOM   5412 C  CD2   . PHE B 2 130 ? -17.63200 -56.86600 19.25500  1.000 27.93000  ? 130  PHE B CD2   1 
ATOM   5413 C  CE1   . PHE B 2 130 ? -17.66300 -54.20700 20.01600  1.000 23.76000  ? 130  PHE B CE1   1 
ATOM   5414 C  CE2   . PHE B 2 130 ? -17.29100 -56.50200 20.56800  1.000 28.33000  ? 130  PHE B CE2   1 
ATOM   5415 C  CZ    . PHE B 2 130 ? -17.31100 -55.16100 20.94700  1.000 25.71000  ? 130  PHE B CZ    1 
ATOM   5416 N  N     . THR B 2 131 ? -17.31700 -53.96500 15.24500  1.000 26.20000  ? 131  THR B N     1 
ATOM   5417 C  CA    . THR B 2 131 ? -16.82600 -52.60800 14.98600  1.000 22.58000  ? 131  THR B CA    1 
ATOM   5418 C  C     . THR B 2 131 ? -17.80700 -51.50200 15.38600  1.000 28.94000  ? 131  THR B C     1 
ATOM   5419 O  O     . THR B 2 131 ? -18.99200 -51.52600 15.01100  1.000 26.71000  ? 131  THR B O     1 
ATOM   5420 C  CB    . THR B 2 131 ? -16.50000 -52.42800 13.47500  1.000 23.40000  ? 131  THR B CB    1 
ATOM   5421 O  OG1   . THR B 2 131 ? -15.64800 -53.49200 13.04400  1.000 33.63000  ? 131  THR B OG1   1 
ATOM   5422 C  CG2   . THR B 2 131 ? -15.80800 -51.08500 13.20300  1.000 23.58000  ? 131  THR B CG2   1 
ATOM   5423 N  N     . ILE B 2 132 ? -17.30000 -50.50800 16.11400  1.000 26.00000  ? 132  ILE B N     1 
ATOM   5424 C  CA    . ILE B 2 132 ? -18.12900 -49.37100 16.49200  1.000 24.68000  ? 132  ILE B CA    1 
ATOM   5425 C  C     . ILE B 2 132 ? -17.92000 -48.19300 15.53700  1.000 24.95000  ? 132  ILE B C     1 
ATOM   5426 O  O     . ILE B 2 132 ? -16.81800 -47.70200 15.37500  1.000 27.67000  ? 132  ILE B O     1 
ATOM   5427 C  CB    . ILE B 2 132 ? -17.83100 -48.93200 17.93700  1.000 26.80000  ? 132  ILE B CB    1 
ATOM   5428 C  CG1   . ILE B 2 132 ? -17.79000 -50.15500 18.85200  1.000 20.80000  ? 132  ILE B CG1   1 
ATOM   5429 C  CG2   . ILE B 2 132 ? -18.88100 -47.93000 18.44800  1.000 24.68000  ? 132  ILE B CG2   1 
ATOM   5430 C  CD1   . ILE B 2 132 ? -17.86400 -49.81300 20.32200  1.000 25.73000  ? 132  ILE B CD1   1 
ATOM   5431 N  N     . PRO B 2 133 ? -18.99400 -47.72300 14.90900  1.000 21.73000  ? 133  PRO B N     1 
ATOM   5432 C  CA    . PRO B 2 133 ? -18.89400 -46.60800 13.96700  1.000 21.31000  ? 133  PRO B CA    1 
ATOM   5433 C  C     . PRO B 2 133 ? -18.80400 -45.25600 14.65300  1.000 23.09000  ? 133  PRO B C     1 
ATOM   5434 O  O     . PRO B 2 133 ? -18.98500 -45.18400 15.87500  1.000 25.30000  ? 133  PRO B O     1 
ATOM   5435 C  CB    . PRO B 2 133 ? -20.19600 -46.71600 13.17200  1.000 22.71000  ? 133  PRO B CB    1 
ATOM   5436 C  CG    . PRO B 2 133 ? -21.16600 -47.35700 14.10700  1.000 20.37000  ? 133  PRO B CG    1 
ATOM   5437 C  CD    . PRO B 2 133 ? -20.35800 -48.27800 14.99000  1.000 26.10000  ? 133  PRO B CD    1 
ATOM   5438 N  N     . SER B 2 134 ? -18.54300 -44.19700 13.89000  1.000 20.78000  ? 134  SER B N     1 
ATOM   5439 C  CA    . SER B 2 134 ? -18.59200 -42.85400 14.46800  1.000 21.58000  ? 134  SER B CA    1 
ATOM   5440 C  C     . SER B 2 134 ? -19.59200 -41.98900 13.73400  1.000 23.46000  ? 134  SER B C     1 
ATOM   5441 O  O     . SER B 2 134 ? -19.93200 -42.23700 12.57900  1.000 23.97000  ? 134  SER B O     1 
ATOM   5442 C  CB    . SER B 2 134 ? -17.21600 -42.18600 14.46400  1.000 23.92000  ? 134  SER B CB    1 
ATOM   5443 O  OG    . SER B 2 134 ? -16.62700 -42.22200 13.19100  1.000 24.07000  ? 134  SER B OG    1 
ATOM   5444 N  N     . ILE B 2 135 ? -20.09200 -40.98100 14.42000  1.000 22.62000  ? 135  ILE B N     1 
ATOM   5445 C  CA    . ILE B 2 135 ? -20.99400 -40.06000 13.77600  1.000 21.36000  ? 135  ILE B CA    1 
ATOM   5446 C  C     . ILE B 2 135 ? -20.28800 -39.35700 12.61200  1.000 22.30000  ? 135  ILE B C     1 
ATOM   5447 O  O     . ILE B 2 135 ? -19.16900 -38.85100 12.75700  1.000 22.49000  ? 135  ILE B O     1 
ATOM   5448 C  CB    . ILE B 2 135 ? -21.53300 -39.03300 14.78900  1.000 18.06000  ? 135  ILE B CB    1 
ATOM   5449 C  CG1   . ILE B 2 135 ? -22.45000 -39.73900 15.78400  1.000 24.22000  ? 135  ILE B CG1   1 
ATOM   5450 C  CG2   . ILE B 2 135 ? -22.32000 -37.95900 14.09300  1.000 19.96000  ? 135  ILE B CG2   1 
ATOM   5451 C  CD1   . ILE B 2 135 ? -22.81200 -38.87400 16.99900  1.000 31.58000  ? 135  ILE B CD1   1 
ATOM   5452 N  N     . ASN B 2 136 ? -20.93600 -39.34000 11.45300  1.000 19.39000  ? 136  ASN B N     1 
ATOM   5453 C  CA    . ASN B 2 136 ? -20.40200 -38.60300 10.31200  1.000 22.19000  ? 136  ASN B CA    1 
ATOM   5454 C  C     . ASN B 2 136 ? -18.95300 -38.98100 10.01800  1.000 20.49000  ? 136  ASN B C     1 
ATOM   5455 O  O     . ASN B 2 136 ? -18.15600 -38.15300 9.57300   1.000 22.58000  ? 136  ASN B O     1 
ATOM   5456 C  CB    . ASN B 2 136 ? -20.52100 -37.08600 10.53500  1.000 17.66000  ? 136  ASN B CB    1 
ATOM   5457 C  CG    . ASN B 2 136 ? -20.22800 -36.28400 9.26000   1.000 19.59000  ? 136  ASN B CG    1 
ATOM   5458 O  OD1   . ASN B 2 136 ? -20.52400 -36.73400 8.15200   1.000 22.94000  ? 136  ASN B OD1   1 
ATOM   5459 N  ND2   . ASN B 2 136 ? -19.60400 -35.12700 9.41100   1.000 17.53000  ? 136  ASN B ND2   1 
ATOM   5460 N  N     . ASN B 2 137 ? -18.62500 -40.24100 10.29700  1.000 20.83000  ? 137  ASN B N     1 
ATOM   5461 C  CA    . ASN B 2 137 ? -17.33100 -40.81000 9.96300   1.000 17.33000  ? 137  ASN B CA    1 
ATOM   5462 C  C     . ASN B 2 137 ? -16.18400 -39.92800 10.35600  1.000 18.53000  ? 137  ASN B C     1 
ATOM   5463 O  O     . ASN B 2 137 ? -15.25600 -39.72500 9.61800   1.000 21.84000  ? 137  ASN B O     1 
ATOM   5464 C  CB    . ASN B 2 137 ? -17.27500 -41.12200 8.47500   1.000 16.37000  ? 137  ASN B CB    1 
ATOM   5465 C  CG    . ASN B 2 137 ? -18.23800 -42.22000 8.10100   1.000 22.40000  ? 137  ASN B CG    1 
ATOM   5466 O  OD1   . ASN B 2 137 ? -17.96000 -43.38800 8.36000   1.000 26.31000  ? 137  ASN B OD1   1 
ATOM   5467 N  ND2   . ASN B 2 137 ? -19.39900 -41.85900 7.53700   1.000 19.66000  ? 137  ASN B ND2   1 
ATOM   5468 N  N     . GLU B 2 138 ? -16.25900 -39.39800 11.55300  1.000 19.73000  ? 138  GLU B N     1 
ATOM   5469 C  CA    . GLU B 2 138 ? -15.17200 -38.62200 12.06700  1.000 17.84000  ? 138  GLU B CA    1 
ATOM   5470 C  C     . GLU B 2 138 ? -13.95500 -39.53500 12.22300  1.000 19.35000  ? 138  GLU B C     1 
ATOM   5471 O  O     . GLU B 2 138 ? -12.82900 -39.08500 12.08800  1.000 23.03000  ? 138  GLU B O     1 
ATOM   5472 C  CB    . GLU B 2 138 ? -15.59500 -37.97400 13.39100  1.000 18.97000  ? 138  GLU B CB    1 
ATOM   5473 C  CG    . GLU B 2 138 ? -14.47700 -37.43600 14.25600  1.000 22.18000  ? 138  GLU B CG    1 
ATOM   5474 C  CD    . GLU B 2 138 ? -14.95100 -37.08800 15.67300  1.000 25.70000  ? 138  GLU B CD    1 
ATOM   5475 O  OE1   . GLU B 2 138 ? -14.09000 -36.94300 16.58200  1.000 28.49000  ? 138  GLU B OE1   1 
ATOM   5476 O  OE2   . GLU B 2 138 ? -16.18400 -36.94000 15.86100  1.000 27.26000  ? 138  GLU B OE2   1 
ATOM   5477 N  N     . THR B 2 139 ? -14.16000 -40.81600 12.52300  1.000 17.83000  ? 139  THR B N     1 
ATOM   5478 C  CA    . THR B 2 139 ? -13.01000 -41.71800 12.59600  1.000 22.73000  ? 139  THR B CA    1 
ATOM   5479 C  C     . THR B 2 139 ? -13.24800 -43.03400 11.85800  1.000 26.66000  ? 139  THR B C     1 
ATOM   5480 O  O     . THR B 2 139 ? -14.37200 -43.36600 11.47100  1.000 21.91000  ? 139  THR B O     1 
ATOM   5481 C  CB    . THR B 2 139 ? -12.60000 -42.07100 14.06400  1.000 21.65000  ? 139  THR B CB    1 
ATOM   5482 O  OG1   . THR B 2 139 ? -13.49900 -43.04000 14.60100  1.000 19.51000  ? 139  THR B OG1   1 
ATOM   5483 C  CG2   . THR B 2 139 ? -12.61600 -40.85600 14.95900  1.000 20.56000  ? 139  THR B CG2   1 
ATOM   5484 N  N     . PRO B 2 140 ? -12.16700 -43.78600 11.63800  1.000 23.15000  ? 140  PRO B N     1 
ATOM   5485 C  CA    . PRO B 2 140 ? -12.30800 -45.17100 11.19700  1.000 20.11000  ? 140  PRO B CA    1 
ATOM   5486 C  C     . PRO B 2 140 ? -13.02800 -45.93500 12.29400  1.000 22.76000  ? 140  PRO B C     1 
ATOM   5487 O  O     . PRO B 2 140 ? -13.07900 -45.42900 13.41800  1.000 22.50000  ? 140  PRO B O     1 
ATOM   5488 C  CB    . PRO B 2 140 ? -10.86000 -45.64000 11.05200  1.000 19.87000  ? 140  PRO B CB    1 
ATOM   5489 C  CG    . PRO B 2 140 ? -10.08100 -44.40000 10.85800  1.000 18.89000  ? 140  PRO B CG    1 
ATOM   5490 C  CD    . PRO B 2 140 ? -10.76300 -43.34200 11.67400  1.000 21.01000  ? 140  PRO B CD    1 
ATOM   5491 N  N     . GLY B 2 141 ? -13.57100 -47.11200 12.00300  1.000 21.44000  ? 141  GLY B N     1 
ATOM   5492 C  CA    . GLY B 2 141 ? -14.17800 -47.92700 13.04600  1.000 21.75000  ? 141  GLY B CA    1 
ATOM   5493 C  C     . GLY B 2 141 ? -13.22100 -48.45000 14.11700  1.000 26.10000  ? 141  GLY B C     1 
ATOM   5494 O  O     . GLY B 2 141 ? -12.05300 -48.78100 13.84900  1.000 27.48000  ? 141  GLY B O     1 
ATOM   5495 N  N     . ILE B 2 142 ? -13.71600 -48.53200 15.34100  1.000 22.33000  ? 142  ILE B N     1 
ATOM   5496 C  CA    . ILE B 2 142 ? -12.94500 -49.11600 16.42900  1.000 24.38000  ? 142  ILE B CA    1 
ATOM   5497 C  C     . ILE B 2 142 ? -13.33200 -50.58900 16.62900  1.000 26.77000  ? 142  ILE B C     1 
ATOM   5498 O  O     . ILE B 2 142 ? -14.45100 -50.90800 17.02900  1.000 26.23000  ? 142  ILE B O     1 
ATOM   5499 C  CB    . ILE B 2 142 ? -13.15300 -48.34200 17.74300  1.000 24.99000  ? 142  ILE B CB    1 
ATOM   5500 C  CG1   . ILE B 2 142 ? -13.08000 -46.82400 17.48800  1.000 19.94000  ? 142  ILE B CG1   1 
ATOM   5501 C  CG2   . ILE B 2 142 ? -12.14700 -48.79700 18.77600  1.000 27.81000  ? 142  ILE B CG2   1 
ATOM   5502 C  CD1   . ILE B 2 142 ? -11.73900 -46.33700 16.97900  1.000 13.66000  ? 142  ILE B CD1   1 
ATOM   5503 N  N     . ARG B 2 143 ? -12.39600 -51.48200 16.32600  1.000 32.48000  ? 143  ARG B N     1 
ATOM   5504 C  CA    . ARG B 2 143 ? -12.64900 -52.91900 16.35300  1.000 29.67000  ? 143  ARG B CA    1 
ATOM   5505 C  C     . ARG B 2 143 ? -12.30000 -53.56000 17.67900  1.000 30.33000  ? 143  ARG B C     1 
ATOM   5506 O  O     . ARG B 2 143 ? -11.25000 -53.29000 18.24000  1.000 35.08000  ? 143  ARG B O     1 
ATOM   5507 C  CB    . ARG B 2 143 ? -11.84600 -53.61500 15.26600  1.000 33.83000  ? 143  ARG B CB    1 
ATOM   5508 C  CG    . ARG B 2 143 ? -11.96600 -52.97000 13.92800  1.000 30.24000  ? 143  ARG B CG    1 
ATOM   5509 C  CD    . ARG B 2 143 ? -12.53000 -53.94200 12.95700  1.000 30.73000  ? 143  ARG B CD    1 
ATOM   5510 N  NE    . ARG B 2 143 ? -11.73700 -55.15900 12.84100  1.000 26.75000  ? 143  ARG B NE    1 
ATOM   5511 C  CZ    . ARG B 2 143 ? -12.29400 -56.32900 12.55900  1.000 28.20000  ? 143  ARG B CZ    1 
ATOM   5512 N  NH1   . ARG B 2 143 ? -13.60300 -56.36800 12.39900  1.000 28.10000  ? 143  ARG B NH1   1 
ATOM   5513 N  NH2   . ARG B 2 143 ? -11.57600 -57.44300 12.43800  1.000 25.62000  ? 143  ARG B NH2   1 
ATOM   5514 N  N     . TYR B 2 144 ? -13.16800 -54.44000 18.15900  1.000 31.75000  ? 144  TYR B N     1 
ATOM   5515 C  CA    . TYR B 2 144 ? -12.93300 -55.15300 19.39700  1.000 28.21000  ? 144  TYR B CA    1 
ATOM   5516 C  C     . TYR B 2 144 ? -13.04700 -56.64200 19.14300  1.000 33.74000  ? 144  TYR B C     1 
ATOM   5517 O  O     . TYR B 2 144 ? -13.48800 -57.06300 18.07400  1.000 33.98000  ? 144  TYR B O     1 
ATOM   5518 C  CB    . TYR B 2 144 ? -13.92800 -54.73200 20.47000  1.000 27.75000  ? 144  TYR B CB    1 
ATOM   5519 C  CG    . TYR B 2 144 ? -13.68600 -53.35900 21.04300  1.000 29.60000  ? 144  TYR B CG    1 
ATOM   5520 C  CD1   . TYR B 2 144 ? -12.74800 -53.16300 22.05000  1.000 31.64000  ? 144  TYR B CD1   1 
ATOM   5521 C  CD2   . TYR B 2 144 ? -14.41600 -52.26000 20.59600  1.000 27.71000  ? 144  TYR B CD2   1 
ATOM   5522 C  CE1   . TYR B 2 144 ? -12.52900 -51.91600 22.59000  1.000 31.59000  ? 144  TYR B CE1   1 
ATOM   5523 C  CE2   . TYR B 2 144 ? -14.20800 -51.00200 21.12500  1.000 29.52000  ? 144  TYR B CE2   1 
ATOM   5524 C  CZ    . TYR B 2 144 ? -13.26300 -50.82700 22.12500  1.000 35.18000  ? 144  TYR B CZ    1 
ATOM   5525 O  OH    . TYR B 2 144 ? -13.05100 -49.56500 22.66400  1.000 41.20000  ? 144  TYR B OH    1 
ATOM   5526 N  N     . GLN B 2 145 ? -12.66700 -57.43200 20.14900  1.000 33.44000  ? 145  GLN B N     1 
ATOM   5527 C  CA    . GLN B 2 145 ? -12.70400 -58.88600 20.08200  1.000 27.79000  ? 145  GLN B CA    1 
ATOM   5528 C  C     . GLN B 2 145 ? -13.09700 -59.38200 21.46300  1.000 31.29000  ? 145  GLN B C     1 
ATOM   5529 O  O     . GLN B 2 145 ? -12.87600 -58.68600 22.45500  1.000 31.56000  ? 145  GLN B O     1 
ATOM   5530 C  CB    . GLN B 2 145 ? -11.34800 -59.42000 19.66700  1.000 29.87000  ? 145  GLN B CB    1 
ATOM   5531 C  CG    . GLN B 2 145 ? -11.34600 -60.82000 19.20300  1.000 33.83000  ? 145  GLN B CG    1 
ATOM   5532 C  CD    . GLN B 2 145 ? -9.95100  -61.28100 18.87500  1.000 35.06000  ? 145  GLN B CD    1 
ATOM   5533 O  OE1   . GLN B 2 145 ? -9.60800  -61.51000 17.70100  1.000 34.52000  ? 145  GLN B OE1   1 
ATOM   5534 N  NE2   . GLN B 2 145 ? -9.12600  -61.42000 19.91200  1.000 30.14000  ? 145  GLN B NE2   1 
ATOM   5535 N  N     . TYR B 2 146 ? -13.68400 -60.57600 21.55300  1.000 31.11000  ? 146  TYR B N     1 
ATOM   5536 C  CA    . TYR B 2 146 ? -14.14200 -61.04600 22.86300  1.000 35.60000  ? 146  TYR B CA    1 
ATOM   5537 C  C     . TYR B 2 146 ? -13.11900 -61.93800 23.58700  1.000 35.90000  ? 146  TYR B C     1 
ATOM   5538 O  O     . TYR B 2 146 ? -12.37500 -62.69500 22.96700  1.000 35.62000  ? 146  TYR B O     1 
ATOM   5539 C  CB    . TYR B 2 146 ? -15.45200 -61.79600 22.71100  1.000 33.14000  ? 146  TYR B CB    1 
ATOM   5540 C  CG    . TYR B 2 146 ? -16.67500 -60.98300 23.03700  1.000 32.30000  ? 146  TYR B CG    1 
ATOM   5541 C  CD1   . TYR B 2 146 ? -17.07400 -60.81200 24.34100  1.000 32.76000  ? 146  TYR B CD1   1 
ATOM   5542 C  CD2   . TYR B 2 146 ? -17.44700 -60.41900 22.03700  1.000 27.69000  ? 146  TYR B CD2   1 
ATOM   5543 C  CE1   . TYR B 2 146 ? -18.19300 -60.08900 24.64900  1.000 34.57000  ? 146  TYR B CE1   1 
ATOM   5544 C  CE2   . TYR B 2 146 ? -18.56400 -59.70000 22.32900  1.000 25.47000  ? 146  TYR B CE2   1 
ATOM   5545 C  CZ    . TYR B 2 146 ? -18.94300 -59.53800 23.64300  1.000 34.82000  ? 146  TYR B CZ    1 
ATOM   5546 O  OH    . TYR B 2 146 ? -20.07500 -58.81000 23.97600  1.000 36.00000  ? 146  TYR B OH    1 
ATOM   5547 N  N     . ASN B 2 147 ? -13.09100 -61.85400 24.90800  1.000 33.85000  ? 147  ASN B N     1 
ATOM   5548 C  CA    . ASN B 2 147 ? -12.13900 -62.64900 25.67400  1.000 39.24000  ? 147  ASN B CA    1 
ATOM   5549 C  C     . ASN B 2 147 ? -12.86100 -63.61900 26.59900  1.000 43.28000  ? 147  ASN B C     1 
ATOM   5550 O  O     . ASN B 2 147 ? -12.24200 -64.47100 27.25300  1.000 37.57000  ? 147  ASN B O     1 
ATOM   5551 C  CB    . ASN B 2 147 ? -11.21300 -61.73700 26.48100  1.000 35.80000  ? 147  ASN B CB    1 
ATOM   5552 C  CG    . ASN B 2 147 ? -10.21200 -61.00500 25.60100  1.000 36.07000  ? 147  ASN B CG    1 
ATOM   5553 O  OD1   . ASN B 2 147 ? -9.74400  -61.54000 24.58000  1.000 34.98000  ? 147  ASN B OD1   1 
ATOM   5554 N  ND2   . ASN B 2 147 ? -9.87500  -59.77400 25.99300  1.000 30.99000  ? 147  ASN B ND2   1 
ATOM   5555 N  N     . VAL B 2 148 ? -14.18000 -63.47000 26.63700  1.000 39.79000  ? 148  VAL B N     1 
ATOM   5556 C  CA    . VAL B 2 148 ? -15.01500 -64.31300 27.46100  1.000 37.47000  ? 148  VAL B CA    1 
ATOM   5557 C  C     . VAL B 2 148 ? -16.17400 -64.83500 26.62600  1.000 42.19000  ? 148  VAL B C     1 
ATOM   5558 O  O     . VAL B 2 148 ? -16.18000 -64.67700 25.40700  1.000 47.91000  ? 148  VAL B O     1 
ATOM   5559 C  CB    . VAL B 2 148 ? -15.52800 -63.55100 28.66300  1.000 40.13000  ? 148  VAL B CB    1 
ATOM   5560 C  CG1   . VAL B 2 148 ? -14.34200 -63.00400 29.44700  1.000 34.36000  ? 148  VAL B CG1   1 
ATOM   5561 C  CG2   . VAL B 2 148 ? -16.45400 -62.43700 28.21100  1.000 38.78000  ? 148  VAL B CG2   1 
ATOM   5562 N  N     . LEU B 2 149 ? -17.13900 -65.48100 27.27200  1.000 41.49000  ? 149  LEU B N     1 
ATOM   5563 C  CA    . LEU B 2 149 ? -18.29400 -65.97900 26.54700  1.000 38.85000  ? 149  LEU B CA    1 
ATOM   5564 C  C     . LEU B 2 149 ? -19.15800 -64.79300 26.23600  1.000 38.32000  ? 149  LEU B C     1 
ATOM   5565 O  O     . LEU B 2 149 ? -19.65400 -64.12400 27.14200  1.000 40.37000  ? 149  LEU B O     1 
ATOM   5566 C  CB    . LEU B 2 149 ? -19.07700 -67.00600 27.36000  1.000 42.39000  ? 149  LEU B CB    1 
ATOM   5567 C  CG    . LEU B 2 149 ? -18.41800 -68.33900 27.70800  1.000 41.26000  ? 149  LEU B CG    1 
ATOM   5568 C  CD1   . LEU B 2 149 ? -19.34900 -69.11100 28.62500  1.000 42.47000  ? 149  LEU B CD1   1 
ATOM   5569 C  CD2   . LEU B 2 149 ? -18.07900 -69.14800 26.46400  1.000 37.45000  ? 149  LEU B CD2   1 
ATOM   5570 N  N     . PRO B 2 150 ? -19.32200 -64.50100 24.95100  1.000 36.10000  ? 150  PRO B N     1 
ATOM   5571 C  CA    . PRO B 2 150 ? -20.15100 -63.35900 24.53600  1.000 34.11000  ? 150  PRO B CA    1 
ATOM   5572 C  C     . PRO B 2 150 ? -21.63700 -63.65600 24.71700  1.000 30.64000  ? 150  PRO B C     1 
ATOM   5573 O  O     . PRO B 2 150 ? -22.04700 -64.79300 24.57700  1.000 36.77000  ? 150  PRO B O     1 
ATOM   5574 C  CB    . PRO B 2 150 ? -19.79200 -63.19200 23.06600  1.000 35.19000  ? 150  PRO B CB    1 
ATOM   5575 C  CG    . PRO B 2 150 ? -19.30200 -64.56900 22.64200  1.000 32.26000  ? 150  PRO B CG    1 
ATOM   5576 C  CD    . PRO B 2 150 ? -18.64900 -65.17000 23.82700  1.000 30.10000  ? 150  PRO B CD    1 
ATOM   5577 N  N     . GLN B 2 151 ? -22.43100 -62.65500 25.06700  1.000 33.27000  ? 151  GLN B N     1 
ATOM   5578 C  CA    . GLN B 2 151 ? -23.88400 -62.82000 25.05200  1.000 37.61000  ? 151  GLN B CA    1 
ATOM   5579 C  C     . GLN B 2 151 ? -24.38700 -62.91400 23.59600  1.000 38.11000  ? 151  GLN B C     1 
ATOM   5580 O  O     . GLN B 2 151 ? -23.83300 -62.27900 22.68400  1.000 33.77000  ? 151  GLN B O     1 
ATOM   5581 C  CB    . GLN B 2 151 ? -24.56300 -61.66300 25.78100  1.000 40.24000  ? 151  GLN B CB    1 
ATOM   5582 C  CG    . GLN B 2 151 ? -23.75300 -61.10600 26.95500  1.000 42.32000  ? 151  GLN B CG    1 
ATOM   5583 C  CD    . GLN B 2 151 ? -24.57600 -60.18000 27.84500  1.000 51.91000  ? 151  GLN B CD    1 
ATOM   5584 O  OE1   . GLN B 2 151 ? -25.58900 -60.59200 28.41600  1.000 51.16000  ? 151  GLN B OE1   1 
ATOM   5585 N  NE2   . GLN B 2 151 ? -24.15000 -58.92400 27.96300  1.000 54.87000  ? 151  GLN B NE2   1 
ATOM   5586 N  N     . GLY B 2 152 ? -25.42000 -63.71700 23.36400  1.000 35.51000  ? 152  GLY B N     1 
ATOM   5587 C  CA    . GLY B 2 152 ? -25.93900 -63.86800 22.01700  1.000 31.70000  ? 152  GLY B CA    1 
ATOM   5588 C  C     . GLY B 2 152 ? -25.27900 -64.92900 21.14700  1.000 32.49000  ? 152  GLY B C     1 
ATOM   5589 O  O     . GLY B 2 152 ? -25.78500 -65.23800 20.07200  1.000 40.00000  ? 152  GLY B O     1 
ATOM   5590 N  N     . TRP B 2 153 ? -24.15800 -65.49000 21.58600  1.000 30.12000  ? 153  TRP B N     1 
ATOM   5591 C  CA    . TRP B 2 153 ? -23.56800 -66.62400 20.87700  1.000 33.50000  ? 153  TRP B CA    1 
ATOM   5592 C  C     . TRP B 2 153 ? -24.14100 -67.91400 21.43100  1.000 39.70000  ? 153  TRP B C     1 
ATOM   5593 O  O     . TRP B 2 153 ? -24.20500 -68.08700 22.65100  1.000 35.30000  ? 153  TRP B O     1 
ATOM   5594 C  CB    . TRP B 2 153 ? -22.05300 -66.62300 21.01600  1.000 32.87000  ? 153  TRP B CB    1 
ATOM   5595 C  CG    . TRP B 2 153 ? -21.34500 -67.74700 20.32300  1.000 36.41000  ? 153  TRP B CG    1 
ATOM   5596 C  CD1   . TRP B 2 153 ? -21.44700 -68.10400 19.01000  1.000 39.08000  ? 153  TRP B CD1   1 
ATOM   5597 C  CD2   . TRP B 2 153 ? -20.37200 -68.62900 20.90200  1.000 36.84000  ? 153  TRP B CD2   1 
ATOM   5598 N  NE1   . TRP B 2 153 ? -20.60800 -69.16200 18.73400  1.000 38.10000  ? 153  TRP B NE1   1 
ATOM   5599 C  CE2   . TRP B 2 153 ? -19.94000 -69.50500 19.88000  1.000 36.82000  ? 153  TRP B CE2   1 
ATOM   5600 C  CE3   . TRP B 2 153 ? -19.83700 -68.77300 22.18500  1.000 38.13000  ? 153  TRP B CE3   1 
ATOM   5601 C  CZ2   . TRP B 2 153 ? -18.99900 -70.50900 20.10500  1.000 36.77000  ? 153  TRP B CZ2   1 
ATOM   5602 C  CZ3   . TRP B 2 153 ? -18.90900 -69.76300 22.40100  1.000 41.21000  ? 153  TRP B CZ3   1 
ATOM   5603 C  CH2   . TRP B 2 153 ? -18.49300 -70.61800 21.36400  1.000 39.71000  ? 153  TRP B CH2   1 
ATOM   5604 N  N     . LYS B 2 154 ? -24.54600 -68.82300 20.54800  1.000 38.71000  ? 154  LYS B N     1 
ATOM   5605 C  CA    . LYS B 2 154 ? -25.24200 -70.01300 21.00000  1.000 39.06000  ? 154  LYS B CA    1 
ATOM   5606 C  C     . LYS B 2 154 ? -24.27000 -70.93700 21.74000  1.000 45.45000  ? 154  LYS B C     1 
ATOM   5607 O  O     . LYS B 2 154 ? -24.68800 -71.87000 22.44200  1.000 44.28000  ? 154  LYS B O     1 
ATOM   5608 C  CB    . LYS B 2 154 ? -25.89300 -70.73000 19.82300  1.000 42.54000  ? 154  LYS B CB    1 
ATOM   5609 C  CG    . LYS B 2 154 ? -25.28200 -72.08700 19.49800  1.000 43.29000  ? 154  LYS B CG    1 
ATOM   5610 C  CD    . LYS B 2 154 ? -24.66700 -72.09900 18.12100  1.000 41.60000  ? 154  LYS B CD    1 
ATOM   5611 C  CE    . LYS B 2 154 ? -24.69400 -73.49500 17.55100  1.000 46.16000  ? 154  LYS B CE    1 
ATOM   5612 N  NZ    . LYS B 2 154 ? -26.05500 -74.06700 17.75000  1.000 55.80000  ? 154  LYS B NZ    1 
ATOM   5613 N  N     . GLY B 2 155 ? -22.97300 -70.67000 21.58500  1.000 42.13000  ? 155  GLY B N     1 
ATOM   5614 C  CA    . GLY B 2 155 ? -21.96100 -71.40200 22.32000  1.000 39.00000  ? 155  GLY B CA    1 
ATOM   5615 C  C     . GLY B 2 155 ? -21.99300 -71.12600 23.81300  1.000 41.68000  ? 155  GLY B C     1 
ATOM   5616 O  O     . GLY B 2 155 ? -21.74500 -72.02100 24.61500  1.000 40.11000  ? 155  GLY B O     1 
ATOM   5617 N  N     . SER B 2 156 ? -22.31400 -69.88500 24.17900  1.000 40.63000  ? 156  SER B N     1 
ATOM   5618 C  CA    . SER B 2 156 ? -22.28600 -69.43000 25.57300  1.000 39.12000  ? 156  SER B CA    1 
ATOM   5619 C  C     . SER B 2 156 ? -23.14300 -70.23600 26.54800  1.000 44.50000  ? 156  SER B C     1 
ATOM   5620 O  O     . SER B 2 156 ? -22.66100 -70.62100 27.60700  1.000 46.66000  ? 156  SER B O     1 
ATOM   5621 C  CB    . SER B 2 156 ? -22.71500 -67.96800 25.65400  1.000 43.14000  ? 156  SER B CB    1 
ATOM   5622 O  OG    . SER B 2 156 ? -21.72300 -67.12300 25.10100  1.000 45.64000  ? 156  SER B OG    1 
ATOM   5623 N  N     . PRO B 2 157 ? -24.41800 -70.49000 26.20500  1.000 43.85000  ? 157  PRO B N     1 
ATOM   5624 C  CA    . PRO B 2 157 ? -25.18800 -71.27000 27.17300  1.000 40.83000  ? 157  PRO B CA    1 
ATOM   5625 C  C     . PRO B 2 157 ? -24.66600 -72.70300 27.23800  1.000 43.48000  ? 157  PRO B C     1 
ATOM   5626 O  O     . PRO B 2 157 ? -24.61800 -73.25600 28.33700  1.000 51.11000  ? 157  PRO B O     1 
ATOM   5627 C  CB    . PRO B 2 157 ? -26.61600 -71.23300 26.61500  1.000 41.52000  ? 157  PRO B CB    1 
ATOM   5628 C  CG    . PRO B 2 157 ? -26.51300 -70.66300 25.24300  1.000 40.10000  ? 157  PRO B CG    1 
ATOM   5629 C  CD    . PRO B 2 157 ? -25.07100 -70.49000 24.88900  1.000 40.58000  ? 157  PRO B CD    1 
ATOM   5630 N  N     . ALA B 2 158 ? -24.28000 -73.28100 26.09700  1.000 39.53000  ? 158  ALA B N     1 
ATOM   5631 C  CA    . ALA B 2 158 ? -23.75200 -74.64200 26.06300  1.000 37.29000  ? 158  ALA B CA    1 
ATOM   5632 C  C     . ALA B 2 158 ? -22.60500 -74.79000 27.05100  1.000 41.30000  ? 158  ALA B C     1 
ATOM   5633 O  O     . ALA B 2 158 ? -22.72000 -75.49700 28.04600  1.000 46.39000  ? 158  ALA B O     1 
ATOM   5634 C  CB    . ALA B 2 158 ? -23.29400 -75.01100 24.66700  1.000 28.95000  ? 158  ALA B CB    1 
ATOM   5635 N  N     . ILE B 2 159 ? -21.50800 -74.09400 26.78100  1.000 42.52000  ? 159  ILE B N     1 
ATOM   5636 C  CA    . ILE B 2 159 ? -20.31400 -74.16100 27.61000  1.000 40.72000  ? 159  ILE B CA    1 
ATOM   5637 C  C     . ILE B 2 159 ? -20.57800 -73.81400 29.07400  1.000 41.57000  ? 159  ILE B C     1 
ATOM   5638 O  O     . ILE B 2 159 ? -19.86900 -74.26400 29.96900  1.000 48.02000  ? 159  ILE B O     1 
ATOM   5639 C  CB    . ILE B 2 159 ? -19.22400 -73.22200 27.06000  1.000 39.27000  ? 159  ILE B CB    1 
ATOM   5640 C  CG1   . ILE B 2 159 ? -18.71700 -73.74500 25.71600  1.000 36.88000  ? 159  ILE B CG1   1 
ATOM   5641 C  CG2   . ILE B 2 159 ? -18.07900 -73.06200 28.05700  1.000 35.74000  ? 159  ILE B CG2   1 
ATOM   5642 C  CD1   . ILE B 2 159 ? -17.68900 -72.85900 25.09100  1.000 39.11000  ? 159  ILE B CD1   1 
ATOM   5643 N  N     . PHE B 2 160 ? -21.60500 -73.02500 29.33000  1.000 40.89000  ? 160  PHE B N     1 
ATOM   5644 C  CA    . PHE B 2 160 ? -21.87700 -72.60900 30.70100  1.000 44.84000  ? 160  PHE B CA    1 
ATOM   5645 C  C     . PHE B 2 160 ? -22.96400 -73.45400 31.36600  1.000 48.95000  ? 160  PHE B C     1 
ATOM   5646 O  O     . PHE B 2 160 ? -23.27500 -73.26300 32.53900  1.000 52.63000  ? 160  PHE B O     1 
ATOM   5647 C  CB    . PHE B 2 160 ? -22.27000 -71.14500 30.70300  1.000 42.95000  ? 160  PHE B CB    1 
ATOM   5648 C  CG    . PHE B 2 160 ? -22.46500 -70.55000 32.05600  1.000 34.88000  ? 160  PHE B CG    1 
ATOM   5649 C  CD1   . PHE B 2 160 ? -21.41000 -69.98000 32.72300  1.000 40.67000  ? 160  PHE B CD1   1 
ATOM   5650 C  CD2   . PHE B 2 160 ? -23.72400 -70.48200 32.61500  1.000 42.55000  ? 160  PHE B CD2   1 
ATOM   5651 C  CE1   . PHE B 2 160 ? -21.59900 -69.38700 33.94400  1.000 46.53000  ? 160  PHE B CE1   1 
ATOM   5652 C  CE2   . PHE B 2 160 ? -23.92100 -69.90900 33.83500  1.000 43.91000  ? 160  PHE B CE2   1 
ATOM   5653 C  CZ    . PHE B 2 160 ? -22.86000 -69.35500 34.50700  1.000 48.04000  ? 160  PHE B CZ    1 
ATOM   5654 N  N     . GLN B 2 161 ? -23.52000 -74.40100 30.62000  1.000 49.33000  ? 161  GLN B N     1 
ATOM   5655 C  CA    . GLN B 2 161 ? -24.59100 -75.24000 31.13800  1.000 50.98000  ? 161  GLN B CA    1 
ATOM   5656 C  C     . GLN B 2 161 ? -24.23000 -75.85300 32.48600  1.000 53.29000  ? 161  GLN B C     1 
ATOM   5657 O  O     . GLN B 2 161 ? -25.00600 -75.76100 33.43700  1.000 55.52000  ? 161  GLN B O     1 
ATOM   5658 C  CB    . GLN B 2 161 ? -24.93400 -76.34700 30.14000  1.000 46.40000  ? 161  GLN B CB    1 
ATOM   5659 C  CG    . GLN B 2 161 ? -26.02100 -77.28400 30.61800  1.000 52.01000  ? 161  GLN B CG    1 
ATOM   5660 C  CD    . GLN B 2 161 ? -27.38200 -76.61200 30.69900  1.000 60.89000  ? 161  GLN B CD    1 
ATOM   5661 O  OE1   . GLN B 2 161 ? -27.82000 -75.94500 29.75700  1.000 69.17000  ? 161  GLN B OE1   1 
ATOM   5662 N  NE2   . GLN B 2 161 ? -28.06100 -76.78800 31.82300  1.000 58.51000  ? 161  GLN B NE2   1 
ATOM   5663 N  N     . SER B 2 162 ? -23.04600 -76.45600 32.57100  1.000 53.01000  ? 162  SER B N     1 
ATOM   5664 C  CA    . SER B 2 162 ? -22.67700 -77.20900 33.76500  1.000 54.93000  ? 162  SER B CA    1 
ATOM   5665 C  C     . SER B 2 162 ? -22.69600 -76.29800 34.99400  1.000 56.02000  ? 162  SER B C     1 
ATOM   5666 O  O     . SER B 2 162 ? -23.30500 -76.63200 36.01200  1.000 59.70000  ? 162  SER B O     1 
ATOM   5667 C  CB    . SER B 2 162 ? -21.30600 -77.87100 33.59700  1.000 52.10000  ? 162  SER B CB    1 
ATOM   5668 O  OG    . SER B 2 162 ? -20.26900 -76.90600 33.52000  1.000 59.94000  ? 162  SER B OG    1 
ATOM   5669 N  N     . SER B 2 163 ? -22.05600 -75.13900 34.89200  1.000 52.73000  ? 163  SER B N     1 
ATOM   5670 C  CA    . SER B 2 163 ? -22.05900 -74.18300 35.99300  1.000 51.43000  ? 163  SER B CA    1 
ATOM   5671 C  C     . SER B 2 163 ? -23.48600 -73.71400 36.27800  1.000 56.42000  ? 163  SER B C     1 
ATOM   5672 O  O     . SER B 2 163 ? -23.87100 -73.49600 37.42800  1.000 57.28000  ? 163  SER B O     1 
ATOM   5673 C  CB    . SER B 2 163 ? -21.16600 -72.97800 35.68100  1.000 49.78000  ? 163  SER B CB    1 
ATOM   5674 O  OG    . SER B 2 163 ? -20.05000 -73.34200 34.88700  1.000 55.09000  ? 163  SER B OG    1 
ATOM   5675 N  N     . MET B 2 164 ? -24.27300 -73.55600 35.21900  1.000 57.51000  ? 164  MET B N     1 
ATOM   5676 C  CA    . MET B 2 164 ? -25.67000 -73.17000 35.37900  1.000 60.45000  ? 164  MET B CA    1 
ATOM   5677 C  C     . MET B 2 164 ? -26.41900 -74.18900 36.24800  1.000 64.77000  ? 164  MET B C     1 
ATOM   5678 O  O     . MET B 2 164 ? -27.11600 -73.80800 37.19900  1.000 61.92000  ? 164  MET B O     1 
ATOM   5679 C  CB    . MET B 2 164 ? -26.35700 -73.01900 34.01100  1.000 55.62000  ? 164  MET B CB    1 
ATOM   5680 C  CG    . MET B 2 164 ? -27.79500 -72.52700 34.08600  1.000 53.74000  ? 164  MET B CG    1 
ATOM   5681 S  SD    . MET B 2 164 ? -27.98100 -70.94200 34.94200  1.000 50.12000  ? 164  MET B SD    1 
ATOM   5682 C  CE    . MET B 2 164 ? -27.23600 -69.83300 33.75800  1.000 51.30000  ? 164  MET B CE    1 
ATOM   5683 N  N     . THR B 2 165 ? -26.25500 -75.47700 35.93200  1.000 58.36000  ? 165  THR B N     1 
ATOM   5684 C  CA    . THR B 2 165 ? -26.98500 -76.52300 36.63900  1.000 61.74000  ? 165  THR B CA    1 
ATOM   5685 C  C     . THR B 2 165 ? -26.67300 -76.54100 38.13900  1.000 68.87000  ? 165  THR B C     1 
ATOM   5686 O  O     . THR B 2 165 ? -27.54100 -76.88600 38.95500  1.000 67.60000  ? 165  THR B O     1 
ATOM   5687 C  CB    . THR B 2 165 ? -26.68500 -77.91100 36.07700  1.000 56.57000  ? 165  THR B CB    1 
ATOM   5688 O  OG1   . THR B 2 165 ? -26.76200 -77.88000 34.65000  1.000 61.90000  ? 165  THR B OG1   1 
ATOM   5689 C  CG2   . THR B 2 165 ? -27.70300 -78.88900 36.59900  1.000 58.44000  ? 165  THR B CG2   1 
ATOM   5690 N  N     . LYS B 2 166 ? -25.44200 -76.17300 38.49800  1.000 64.83000  ? 166  LYS B N     1 
ATOM   5691 C  CA    . LYS B 2 166 ? -25.04900 -76.14800 39.90600  1.000 66.33000  ? 166  LYS B CA    1 
ATOM   5692 C  C     . LYS B 2 166 ? -25.74900 -75.00400 40.62400  1.000 69.36000  ? 166  LYS B C     1 
ATOM   5693 O  O     . LYS B 2 166 ? -26.25100 -75.17300 41.73600  1.000 70.52000  ? 166  LYS B O     1 
ATOM   5694 C  CB    . LYS B 2 166 ? -23.53300 -76.00900 40.06400  1.000 62.52000  ? 166  LYS B CB    1 
ATOM   5695 C  CG    . LYS B 2 166 ? -22.69900 -77.11500 39.41600  1.000 67.14000  ? 166  LYS B CG    1 
ATOM   5696 C  CD    . LYS B 2 166 ? -21.20300 -76.82100 39.59700  1.000 74.26000  ? 166  LYS B CD    1 
ATOM   5697 C  CE    . LYS B 2 166 ? -20.32000 -77.66200 38.67300  1.000 73.18000  ? 166  LYS B CE    1 
ATOM   5698 N  NZ    . LYS B 2 166 ? -18.93000 -77.10500 38.60900  1.000 67.78000  ? 166  LYS B NZ    1 
ATOM   5699 N  N     . ILE B 2 167 ? -25.78100 -73.84000 39.98100  1.000 67.39000  ? 167  ILE B N     1 
ATOM   5700 C  CA    . ILE B 2 167 ? -26.41400 -72.66100 40.56300  1.000 69.34000  ? 167  ILE B CA    1 
ATOM   5701 C  C     . ILE B 2 167 ? -27.88400 -72.91900 40.90500  1.000 69.77000  ? 167  ILE B C     1 
ATOM   5702 O  O     . ILE B 2 167 ? -28.30300 -72.80200 42.06000  1.000 72.87000  ? 167  ILE B O     1 
ATOM   5703 C  CB    . ILE B 2 167 ? -26.32200 -71.45500 39.60800  1.000 68.37000  ? 167  ILE B CB    1 
ATOM   5704 C  CG1   . ILE B 2 167 ? -24.87900 -71.24000 39.14600  1.000 64.51000  ? 167  ILE B CG1   1 
ATOM   5705 C  CG2   . ILE B 2 167 ? -26.87100 -70.19500 40.27600  1.000 69.92000  ? 167  ILE B CG2   1 
ATOM   5706 C  CD1   . ILE B 2 167 ? -24.09200 -70.31400 40.02400  1.000 66.17000  ? 167  ILE B CD1   1 
ATOM   5707 N  N     . LEU B 2 168 ? -28.66400 -73.28000 39.89400  1.000 68.92000  ? 168  LEU B N     1 
ATOM   5708 C  CA    . LEU B 2 168 ? -30.09900 -73.46100 40.07400  1.000 71.46000  ? 168  LEU B CA    1 
ATOM   5709 C  C     . LEU B 2 168 ? -30.41300 -74.72100 40.87700  1.000 71.90000  ? 168  LEU B C     1 
ATOM   5710 O  O     . LEU B 2 168 ? -31.55300 -74.93300 41.29200  1.000 72.33000  ? 168  LEU B O     1 
ATOM   5711 C  CB    . LEU B 2 168 ? -30.80800 -73.51500 38.71000  1.000 67.46000  ? 168  LEU B CB    1 
ATOM   5712 C  CG    . LEU B 2 168 ? -31.05700 -72.17400 38.02300  1.000 59.11000  ? 168  LEU B CG    1 
ATOM   5713 C  CD1   . LEU B 2 168 ? -31.75800 -71.21800 38.97200  1.000 58.85000  ? 168  LEU B CD1   1 
ATOM   5714 C  CD2   . LEU B 2 168 ? -29.75900 -71.57600 37.55300  1.000 63.75000  ? 168  LEU B CD2   1 
ATOM   5715 N  N     . GLU B 2 169 ? -29.39200 -75.54100 41.09600  1.000 72.52000  ? 169  GLU B N     1 
ATOM   5716 C  CA    . GLU B 2 169 ? -29.57200 -76.88100 41.65200  1.000 79.03000  ? 169  GLU B CA    1 
ATOM   5717 C  C     . GLU B 2 169 ? -30.49400 -76.95700 42.89000  1.000 77.64000  ? 169  GLU B C     1 
ATOM   5718 O  O     . GLU B 2 169 ? -31.49300 -77.68500 42.88400  1.000 72.79000  ? 169  GLU B O     1 
ATOM   5719 C  CB    . GLU B 2 169 ? -28.19400 -77.46700 41.98000  1.000 78.70000  ? 169  GLU B CB    1 
ATOM   5720 C  CG    . GLU B 2 169 ? -28.21400 -78.89100 42.49500  1.000 80.23000  ? 169  GLU B CG    1 
ATOM   5721 C  CD    . GLU B 2 169 ? -28.34900 -78.95400 44.00300  1.000 85.17000  ? 169  GLU B CD    1 
ATOM   5722 O  OE1   . GLU B 2 169 ? -29.44600 -79.31000 44.48200  1.000 91.86000  ? 169  GLU B OE1   1 
ATOM   5723 O  OE2   . GLU B 2 169 ? -27.36000 -78.64900 44.70800  1.000 81.63000  ? 169  GLU B OE2   1 
ATOM   5724 N  N     . PRO B 2 170 ? -30.16900 -76.20700 43.95400  1.000 75.71000  ? 170  PRO B N     1 
ATOM   5725 C  CA    . PRO B 2 170 ? -30.96800 -76.32600 45.17300  1.000 75.91000  ? 170  PRO B CA    1 
ATOM   5726 C  C     . PRO B 2 170 ? -32.18100 -75.40300 45.19300  1.000 76.05000  ? 170  PRO B C     1 
ATOM   5727 O  O     . PRO B 2 170 ? -33.06700 -75.60700 46.02600  1.000 75.64000  ? 170  PRO B O     1 
ATOM   5728 C  CB    . PRO B 2 170 ? -29.97800 -75.93800 46.26700  1.000 79.59000  ? 170  PRO B CB    1 
ATOM   5729 C  CG    . PRO B 2 170 ? -29.12400 -74.90800 45.61100  1.000 78.34000  ? 170  PRO B CG    1 
ATOM   5730 C  CD    . PRO B 2 170 ? -29.01700 -75.30300 44.14700  1.000 81.31000  ? 170  PRO B CD    1 
ATOM   5731 N  N     . PHE B 2 171 ? -32.21500 -74.39500 44.32300  1.000 77.02000  ? 171  PHE B N     1 
ATOM   5732 C  CA    . PHE B 2 171 ? -33.40900 -73.56700 44.21100  1.000 70.97000  ? 171  PHE B CA    1 
ATOM   5733 C  C     . PHE B 2 171 ? -34.52200 -74.45100 43.67500  1.000 67.34000  ? 171  PHE B C     1 
ATOM   5734 O  O     . PHE B 2 171 ? -35.68800 -74.33500 44.06800  1.000 65.80000  ? 171  PHE B O     1 
ATOM   5735 C  CB    . PHE B 2 171 ? -33.19000 -72.34900 43.30000  1.000 67.15000  ? 171  PHE B CB    1 
ATOM   5736 C  CG    . PHE B 2 171 ? -34.40100 -71.46000 43.19200  1.000 60.43000  ? 171  PHE B CG    1 
ATOM   5737 C  CD1   . PHE B 2 171 ? -34.59700 -70.42100 44.09000  1.000 59.90000  ? 171  PHE B CD1   1 
ATOM   5738 C  CD2   . PHE B 2 171 ? -35.35800 -71.68600 42.21700  1.000 57.16000  ? 171  PHE B CD2   1 
ATOM   5739 C  CE1   . PHE B 2 171 ? -35.71900 -69.62500 44.01200  1.000 56.79000  ? 171  PHE B CE1   1 
ATOM   5740 C  CE2   . PHE B 2 171 ? -36.47800 -70.89200 42.13600  1.000 56.92000  ? 171  PHE B CE2   1 
ATOM   5741 C  CZ    . PHE B 2 171 ? -36.66100 -69.86000 43.03500  1.000 57.52000  ? 171  PHE B CZ    1 
ATOM   5742 N  N     . ARG B 2 172 ? -34.12500 -75.35300 42.78200  1.000 65.82000  ? 172  ARG B N     1 
ATOM   5743 C  CA    . ARG B 2 172 ? -35.03200 -76.31300 42.18200  1.000 65.64000  ? 172  ARG B CA    1 
ATOM   5744 C  C     . ARG B 2 172 ? -35.51300 -77.37300 43.17300  1.000 65.72000  ? 172  ARG B C     1 
ATOM   5745 O  O     . ARG B 2 172 ? -36.70800 -77.64500 43.26100  1.000 64.43000  ? 172  ARG B O     1 
ATOM   5746 C  CB    . ARG B 2 172 ? -34.35400 -77.00000 40.99800  1.000 65.79000  ? 172  ARG B CB    1 
ATOM   5747 C  CG    . ARG B 2 172 ? -34.10400 -76.11900 39.79500  1.000 61.46000  ? 172  ARG B CG    1 
ATOM   5748 C  CD    . ARG B 2 172 ? -33.79400 -77.00700 38.61300  1.000 64.01000  ? 172  ARG B CD    1 
ATOM   5749 N  NE    . ARG B 2 172 ? -33.77700 -76.27500 37.35600  1.000 63.86000  ? 172  ARG B NE    1 
ATOM   5750 C  CZ    . ARG B 2 172 ? -32.67200 -75.99700 36.67400  1.000 61.27000  ? 172  ARG B CZ    1 
ATOM   5751 N  NH1   . ARG B 2 172 ? -31.49100 -76.39400 37.12900  1.000 57.77000  ? 172  ARG B NH1   1 
ATOM   5752 N  NH2   . ARG B 2 172 ? -32.75600 -75.32800 35.53400  1.000 61.32000  ? 172  ARG B NH2   1 
ATOM   5753 N  N     . LYS B 2 173 ? -34.57600 -77.98800 43.89100  1.000 68.10000  ? 173  LYS B N     1 
ATOM   5754 C  CA    . LYS B 2 173 ? -34.92200 -79.02100 44.86700  1.000 74.26000  ? 173  LYS B CA    1 
ATOM   5755 C  C     . LYS B 2 173 ? -35.88000 -78.44900 45.90800  1.000 71.15000  ? 173  LYS B C     1 
ATOM   5756 O  O     . LYS B 2 173 ? -36.85200 -79.09500 46.31000  1.000 67.35000  ? 173  LYS B O     1 
ATOM   5757 C  CB    . LYS B 2 173 ? -33.65700 -79.58500 45.53100  1.000 76.56000  ? 173  LYS B CB    1 
ATOM   5758 C  CG    . LYS B 2 173 ? -33.85200 -80.15900 46.93500  1.000 75.91000  ? 173  LYS B CG    1 
ATOM   5759 C  CD    . LYS B 2 173 ? -33.67900 -79.08300 48.01800  1.000 79.89000  ? 173  LYS B CD    1 
ATOM   5760 C  CE    . LYS B 2 173 ? -33.81900 -79.66100 49.43000  1.000 82.85000  ? 173  LYS B CE    1 
ATOM   5761 N  NZ    . LYS B 2 173 ? -33.60700 -78.62300 50.48500  1.000 78.80000  ? 173  LYS B NZ    1 
ATOM   5762 N  N     . GLN B 2 174 ? -35.59700 -77.21700 46.31200  1.000 69.31000  ? 174  GLN B N     1 
ATOM   5763 C  CA    . GLN B 2 174 ? -36.39800 -76.49800 47.28500  1.000 68.78000  ? 174  GLN B CA    1 
ATOM   5764 C  C     . GLN B 2 174 ? -37.74700 -76.06500 46.70500  1.000 67.77000  ? 174  GLN B C     1 
ATOM   5765 O  O     . GLN B 2 174 ? -38.72800 -75.90700 47.43600  1.000 66.13000  ? 174  GLN B O     1 
ATOM   5766 C  CB    . GLN B 2 174 ? -35.61500 -75.28200 47.78700  1.000 73.36000  ? 174  GLN B CB    1 
ATOM   5767 C  CG    . GLN B 2 174 ? -36.41400 -74.31000 48.63600  1.000 82.07000  ? 174  GLN B CG    1 
ATOM   5768 C  CD    . GLN B 2 174 ? -36.10000 -74.43400 50.11100  1.000 90.58000  ? 174  GLN B CD    1 
ATOM   5769 O  OE1   . GLN B 2 174 ? -35.88200 -75.53700 50.62200  1.000 90.16000  ? 174  GLN B OE1   1 
ATOM   5770 N  NE2   . GLN B 2 174 ? -36.06700 -73.29600 50.80500  1.000 89.22000  ? 174  GLN B NE2   1 
ATOM   5771 N  N     . ASN B 2 175 ? -37.78800 -75.87100 45.38900  1.000 66.68000  ? 175  ASN B N     1 
ATOM   5772 C  CA    . ASN B 2 175 ? -39.01100 -75.45300 44.71200  1.000 66.63000  ? 175  ASN B CA    1 
ATOM   5773 C  C     . ASN B 2 175 ? -39.30400 -76.31300 43.48800  1.000 68.62000  ? 175  ASN B C     1 
ATOM   5774 O  O     . ASN B 2 175 ? -39.34100 -75.80800 42.36500  1.000 66.50000  ? 175  ASN B O     1 
ATOM   5775 C  CB    . ASN B 2 175 ? -38.91200 -73.98400 44.29900  1.000 63.32000  ? 175  ASN B CB    1 
ATOM   5776 C  CG    . ASN B 2 175 ? -39.22000 -73.03200 45.43900  1.000 62.36000  ? 175  ASN B CG    1 
ATOM   5777 O  OD1   . ASN B 2 175 ? -40.38300 -72.80500 45.77400  1.000 66.89000  ? 175  ASN B OD1   1 
ATOM   5778 N  ND2   . ASN B 2 175 ? -38.18200 -72.45400 46.02600  1.000 60.61000  ? 175  ASN B ND2   1 
ATOM   5779 N  N     . PRO B 2 176 ? -39.52700 -77.61900 43.70800  1.000 73.03000  ? 176  PRO B N     1 
ATOM   5780 C  CA    . PRO B 2 176 ? -39.56900 -78.65800 42.66300  1.000 68.42000  ? 176  PRO B CA    1 
ATOM   5781 C  C     . PRO B 2 176 ? -40.73300 -78.55600 41.67600  1.000 70.98000  ? 176  PRO B C     1 
ATOM   5782 O  O     . PRO B 2 176 ? -40.70500 -79.29000 40.68600  1.000 72.39000  ? 176  PRO B O     1 
ATOM   5783 C  CB    . PRO B 2 176 ? -39.67800 -79.95300 43.46600  1.000 66.07000  ? 176  PRO B CB    1 
ATOM   5784 C  CG    . PRO B 2 176 ? -40.34600 -79.54100 44.72500  1.000 67.17000  ? 176  PRO B CG    1 
ATOM   5785 C  CD    . PRO B 2 176 ? -39.80100 -78.17800 45.04200  1.000 68.62000  ? 176  PRO B CD    1 
ATOM   5786 N  N     . ASP B 2 177 ? -41.72400 -77.69800 41.92800  1.000 74.00000  ? 177  ASP B N     1 
ATOM   5787 C  CA    . ASP B 2 177 ? -42.76800 -77.45200 40.92100  1.000 76.35000  ? 177  ASP B CA    1 
ATOM   5788 C  C     . ASP B 2 177 ? -42.76700 -76.00100 40.45000  1.000 72.30000  ? 177  ASP B C     1 
ATOM   5789 O  O     . ASP B 2 177 ? -43.80500 -75.44800 40.09000  1.000 73.91000  ? 177  ASP B O     1 
ATOM   5790 C  CB    . ASP B 2 177 ? -44.15700 -77.83400 41.44100  1.000 79.95000  ? 177  ASP B CB    1 
ATOM   5791 C  CG    . ASP B 2 177 ? -44.43200 -77.29200 42.81900  1.000 84.10000  ? 177  ASP B CG    1 
ATOM   5792 O  OD1   . ASP B 2 177 ? -43.70700 -76.36600 43.25600  1.000 81.75000  ? 177  ASP B OD1   1 
ATOM   5793 O  OD2   . ASP B 2 177 ? -45.37800 -77.79800 43.46200  1.000 83.90000  ? 177  ASP B OD2   1 
ATOM   5794 N  N     . ILE B 2 178 ? -41.58700 -75.39000 40.48700  1.000 70.05000  ? 178  ILE B N     1 
ATOM   5795 C  CA    . ILE B 2 178 ? -41.28100 -74.21200 39.68900  1.000 64.15000  ? 178  ILE B CA    1 
ATOM   5796 C  C     . ILE B 2 178 ? -40.31300 -74.66300 38.60800  1.000 61.14000  ? 178  ILE B C     1 
ATOM   5797 O  O     . ILE B 2 178 ? -39.24400 -75.20100 38.91800  1.000 68.65000  ? 178  ILE B O     1 
ATOM   5798 C  CB    . ILE B 2 178 ? -40.64500 -73.08900 40.51500  1.000 63.10000  ? 178  ILE B CB    1 
ATOM   5799 C  CG1   . ILE B 2 178 ? -41.69800 -72.38300 41.37100  1.000 65.66000  ? 178  ILE B CG1   1 
ATOM   5800 C  CG2   . ILE B 2 178 ? -39.97000 -72.09500 39.60600  1.000 58.78000  ? 178  ILE B CG2   1 
ATOM   5801 C  CD1   . ILE B 2 178 ? -41.11100 -71.31300 42.27700  1.000 63.34000  ? 178  ILE B CD1   1 
ATOM   5802 N  N     . VAL B 2 179 ? -40.67800 -74.48100 37.34600  1.000 58.71000  ? 179  VAL B N     1 
ATOM   5803 C  CA    . VAL B 2 179 ? -39.82800 -74.97600 36.26400  1.000 60.26000  ? 179  VAL B CA    1 
ATOM   5804 C  C     . VAL B 2 179 ? -38.97900 -73.86400 35.63600  1.000 56.96000  ? 179  VAL B C     1 
ATOM   5805 O  O     . VAL B 2 179 ? -39.47800 -72.81200 35.22200  1.000 55.65000  ? 179  VAL B O     1 
ATOM   5806 C  CB    . VAL B 2 179 ? -40.65100 -75.67100 35.17300  1.000 50.07000  ? 179  VAL B CB    1 
ATOM   5807 C  CG1   . VAL B 2 179 ? -42.00800 -75.00700 35.03000  1.000 55.61000  ? 179  VAL B CG1   1 
ATOM   5808 C  CG2   . VAL B 2 179 ? -39.88100 -75.66500 33.86700  1.000 48.83000  ? 179  VAL B CG2   1 
ATOM   5809 N  N     . ILE B 2 180 ? -37.68000 -74.11700 35.58700  1.000 50.85000  ? 180  ILE B N     1 
ATOM   5810 C  CA    . ILE B 2 180 ? -36.72600 -73.13000 35.13200  1.000 52.84000  ? 180  ILE B CA    1 
ATOM   5811 C  C     . ILE B 2 180 ? -36.07600 -73.59600 33.84600  1.000 55.37000  ? 180  ILE B C     1 
ATOM   5812 O  O     . ILE B 2 180 ? -35.45600 -74.66800 33.81700  1.000 53.16000  ? 180  ILE B O     1 
ATOM   5813 C  CB    . ILE B 2 180 ? -35.63900 -72.87000 36.18900  1.000 60.78000  ? 180  ILE B CB    1 
ATOM   5814 C  CG1   . ILE B 2 180 ? -36.24900 -72.24800 37.44600  1.000 56.04000  ? 180  ILE B CG1   1 
ATOM   5815 C  CG2   . ILE B 2 180 ? -34.54100 -71.96500 35.63100  1.000 60.30000  ? 180  ILE B CG2   1 
ATOM   5816 C  CD1   . ILE B 2 180 ? -35.21300 -71.79800 38.44000  1.000 53.89000  ? 180  ILE B CD1   1 
ATOM   5817 N  N     . TYR B 2 181 ? -36.21900 -72.78900 32.79400  1.000 51.84000  ? 181  TYR B N     1 
ATOM   5818 C  CA    . TYR B 2 181 ? -35.64700 -73.10200 31.48400  1.000 49.89000  ? 181  TYR B CA    1 
ATOM   5819 C  C     . TYR B 2 181 ? -34.76000 -71.99900 30.92400  1.000 50.44000  ? 181  TYR B C     1 
ATOM   5820 O  O     . TYR B 2 181 ? -35.05900 -70.80600 31.05200  1.000 49.22000  ? 181  TYR B O     1 
ATOM   5821 C  CB    . TYR B 2 181 ? -36.75000 -73.39500 30.48000  1.000 53.59000  ? 181  TYR B CB    1 
ATOM   5822 C  CG    . TYR B 2 181 ? -36.24400 -73.64900 29.08500  1.000 46.00000  ? 181  TYR B CG    1 
ATOM   5823 C  CD1   . TYR B 2 181 ? -35.39800 -74.70900 28.81600  1.000 47.56000  ? 181  TYR B CD1   1 
ATOM   5824 C  CD2   . TYR B 2 181 ? -36.62700 -72.84000 28.03800  1.000 45.53000  ? 181  TYR B CD2   1 
ATOM   5825 C  CE1   . TYR B 2 181 ? -34.94900 -74.95500 27.53900  1.000 47.18000  ? 181  TYR B CE1   1 
ATOM   5826 C  CE2   . TYR B 2 181 ? -36.18600 -73.07400 26.76200  1.000 45.73000  ? 181  TYR B CE2   1 
ATOM   5827 C  CZ    . TYR B 2 181 ? -35.34700 -74.13000 26.51400  1.000 46.82000  ? 181  TYR B CZ    1 
ATOM   5828 O  OH    . TYR B 2 181 ? -34.91300 -74.35400 25.22400  1.000 51.82000  ? 181  TYR B OH    1 
ATOM   5829 N  N     . GLN B 2 182 ? -33.67900 -72.40500 30.27400  1.000 51.01000  ? 182  GLN B N     1 
ATOM   5830 C  CA    . GLN B 2 182 ? -32.71500 -71.45300 29.76800  1.000 44.59000  ? 182  GLN B CA    1 
ATOM   5831 C  C     . GLN B 2 182 ? -32.65500 -71.49600 28.24600  1.000 49.84000  ? 182  GLN B C     1 
ATOM   5832 O  O     . GLN B 2 182 ? -32.59400 -72.57500 27.64200  1.000 51.23000  ? 182  GLN B O     1 
ATOM   5833 C  CB    . GLN B 2 182 ? -31.35100 -71.73600 30.37500  1.000 45.17000  ? 182  GLN B CB    1 
ATOM   5834 C  CG    . GLN B 2 182 ? -30.18600 -71.22400 29.56700  1.000 47.59000  ? 182  GLN B CG    1 
ATOM   5835 C  CD    . GLN B 2 182 ? -28.93300 -71.08300 30.40900  1.000 53.78000  ? 182  GLN B CD    1 
ATOM   5836 O  OE1   . GLN B 2 182 ? -28.67800 -71.89500 31.30300  1.000 57.30000  ? 182  GLN B OE1   1 
ATOM   5837 N  NE2   . GLN B 2 182 ? -28.15000 -70.03700 30.13700  1.000 48.15000  ? 182  GLN B NE2   1 
ATOM   5838 N  N     . TYR B 2 183 ? -32.70700 -70.32100 27.62300  1.000 44.37000  ? 183  TYR B N     1 
ATOM   5839 C  CA    . TYR B 2 183 ? -32.45900 -70.21400 26.18800  1.000 40.98000  ? 183  TYR B CA    1 
ATOM   5840 C  C     . TYR B 2 183 ? -31.56100 -69.02100 25.96800  1.000 37.60000  ? 183  TYR B C     1 
ATOM   5841 O  O     . TYR B 2 183 ? -31.93200 -67.90200 26.31400  1.000 42.36000  ? 183  TYR B O     1 
ATOM   5842 C  CB    . TYR B 2 183 ? -33.76000 -70.06200 25.39000  1.000 42.91000  ? 183  TYR B CB    1 
ATOM   5843 C  CG    . TYR B 2 183 ? -33.52600 -70.00800 23.90400  1.000 40.41000  ? 183  TYR B CG    1 
ATOM   5844 C  CD1   . TYR B 2 183 ? -33.28000 -68.80000 23.25900  1.000 39.58000  ? 183  TYR B CD1   1 
ATOM   5845 C  CD2   . TYR B 2 183 ? -33.52200 -71.16600 23.15100  1.000 36.81000  ? 183  TYR B CD2   1 
ATOM   5846 C  CE1   . TYR B 2 183 ? -33.04300 -68.75500 21.89700  1.000 37.46000  ? 183  TYR B CE1   1 
ATOM   5847 C  CE2   . TYR B 2 183 ? -33.28900 -71.13200 21.79400  1.000 39.11000  ? 183  TYR B CE2   1 
ATOM   5848 C  CZ    . TYR B 2 183 ? -33.05000 -69.92600 21.16500  1.000 39.10000  ? 183  TYR B CZ    1 
ATOM   5849 O  OH    . TYR B 2 183 ? -32.81100 -69.89900 19.80100  1.000 43.28000  ? 183  TYR B OH    1 
ATOM   5850 N  N     . MET B 2 184 ? -30.38400 -69.26300 25.41000  1.000 32.91000  ? 184  MET B N     1 
ATOM   5851 C  CA    . MET B 2 184 ? -29.39500 -68.20900 25.21600  1.000 37.45000  ? 184  MET B CA    1 
ATOM   5852 C  C     . MET B 2 184 ? -29.21800 -67.37600 26.49600  1.000 38.03000  ? 184  MET B C     1 
ATOM   5853 O  O     . MET B 2 184 ? -28.96200 -67.91600 27.56400  1.000 37.91000  ? 184  MET B O     1 
ATOM   5854 C  CB    . MET B 2 184 ? -29.79100 -67.31500 24.02800  1.000 35.90000  ? 184  MET B CB    1 
ATOM   5855 C  CG    . MET B 2 184 ? -30.08900 -68.08000 22.72100  1.000 38.35000  ? 184  MET B CG    1 
ATOM   5856 S  SD    . MET B 2 184 ? -28.62600 -68.74700 21.87100  1.000 53.55000  ? 184  MET B SD    1 
ATOM   5857 C  CE    . MET B 2 184 ? -29.32400 -69.38900 20.33900  1.000 53.46000  ? 184  MET B CE    1 
ATOM   5858 N  N     . ASP B 2 185 ? -29.36700 -66.06200 26.38800  1.000 36.91000  ? 185  ASP B N     1 
ATOM   5859 C  CA    . ASP B 2 185 ? -29.13800 -65.19900 27.52700  1.000 30.94000  ? 185  ASP B CA    1 
ATOM   5860 C  C     . ASP B 2 185 ? -30.33200 -65.21800 28.47800  1.000 37.58000  ? 185  ASP B C     1 
ATOM   5861 O  O     . ASP B 2 185 ? -30.39400 -64.43700 29.43400  1.000 40.41000  ? 185  ASP B O     1 
ATOM   5862 C  CB    . ASP B 2 185 ? -28.88100 -63.75400 27.08000  1.000 36.48000  ? 185  ASP B CB    1 
ATOM   5863 C  CG    . ASP B 2 185 ? -27.84500 -63.63500 25.97000  1.000 36.96000  ? 185  ASP B CG    1 
ATOM   5864 O  OD1   . ASP B 2 185 ? -26.93700 -64.48300 25.86200  1.000 38.63000  ? 185  ASP B OD1   1 
ATOM   5865 O  OD2   . ASP B 2 185 ? -27.93000 -62.65200 25.20000  1.000 43.77000  ? 185  ASP B OD2   1 
ATOM   5866 N  N     . ASP B 2 186 ? -31.29300 -66.08900 28.21500  1.000 36.58000  ? 186  ASP B N     1 
ATOM   5867 C  CA    . ASP B 2 186 ? -32.57300 -65.98000 28.90200  1.000 35.64000  ? 186  ASP B CA    1 
ATOM   5868 C  C     . ASP B 2 186 ? -32.85600 -67.12600 29.86400  1.000 40.20000  ? 186  ASP B C     1 
ATOM   5869 O  O     . ASP B 2 186 ? -32.48500 -68.27500 29.61900  1.000 44.07000  ? 186  ASP B O     1 
ATOM   5870 C  CB    . ASP B 2 186 ? -33.71800 -65.90500 27.88200  1.000 42.43000  ? 186  ASP B CB    1 
ATOM   5871 C  CG    . ASP B 2 186 ? -33.81000 -64.55100 27.19100  1.000 42.47000  ? 186  ASP B CG    1 
ATOM   5872 O  OD1   . ASP B 2 186 ? -33.13600 -63.58700 27.63600  1.000 38.91000  ? 186  ASP B OD1   1 
ATOM   5873 O  OD2   . ASP B 2 186 ? -34.58500 -64.45200 26.20900  1.000 44.05000  ? 186  ASP B OD2   1 
ATOM   5874 N  N     . LEU B 2 187 ? -33.54200 -66.79300 30.95300  1.000 42.10000  ? 187  LEU B N     1 
ATOM   5875 C  CA    . LEU B 2 187 ? -34.04900 -67.78700 31.89100  1.000 42.45000  ? 187  LEU B CA    1 
ATOM   5876 C  C     . LEU B 2 187 ? -35.55300 -67.66200 31.95400  1.000 44.86000  ? 187  LEU B C     1 
ATOM   5877 O  O     . LEU B 2 187 ? -36.08600 -66.60600 32.29300  1.000 47.87000  ? 187  LEU B O     1 
ATOM   5878 C  CB    . LEU B 2 187 ? -33.45400 -67.59900 33.29200  1.000 46.86000  ? 187  LEU B CB    1 
ATOM   5879 C  CG    . LEU B 2 187 ? -32.82000 -68.80700 33.98900  1.000 44.88000  ? 187  LEU B CG    1 
ATOM   5880 C  CD1   . LEU B 2 187 ? -31.66600 -69.38100 33.18000  1.000 44.59000  ? 187  LEU B CD1   1 
ATOM   5881 C  CD2   . LEU B 2 187 ? -32.32700 -68.39700 35.35100  1.000 48.91000  ? 187  LEU B CD2   1 
ATOM   5882 N  N     . TYR B 2 188 ? -36.23300 -68.74300 31.60800  1.000 43.85000  ? 188  TYR B N     1 
ATOM   5883 C  CA    . TYR B 2 188 ? -37.67500 -68.79100 31.71600  1.000 46.92000  ? 188  TYR B CA    1 
ATOM   5884 C  C     . TYR B 2 188 ? -38.06000 -69.48800 33.02400  1.000 48.89000  ? 188  TYR B C     1 
ATOM   5885 O  O     . TYR B 2 188 ? -37.49000 -70.52600 33.38100  1.000 51.50000  ? 188  TYR B O     1 
ATOM   5886 C  CB    . TYR B 2 188 ? -38.27600 -69.50800 30.49800  1.000 47.48000  ? 188  TYR B CB    1 
ATOM   5887 C  CG    . TYR B 2 188 ? -38.17900 -68.69100 29.23200  1.000 46.96000  ? 188  TYR B CG    1 
ATOM   5888 C  CD1   . TYR B 2 188 ? -39.17900 -67.78100 28.90000  1.000 46.24000  ? 188  TYR B CD1   1 
ATOM   5889 C  CD2   . TYR B 2 188 ? -37.08100 -68.81500 28.37300  1.000 43.70000  ? 188  TYR B CD2   1 
ATOM   5890 C  CE1   . TYR B 2 188 ? -39.10400 -67.02400 27.75200  1.000 44.45000  ? 188  TYR B CE1   1 
ATOM   5891 C  CE2   . TYR B 2 188 ? -36.99200 -68.06000 27.21700  1.000 42.88000  ? 188  TYR B CE2   1 
ATOM   5892 C  CZ    . TYR B 2 188 ? -38.01100 -67.16300 26.91300  1.000 47.47000  ? 188  TYR B CZ    1 
ATOM   5893 O  OH    . TYR B 2 188 ? -37.94800 -66.39100 25.77700  1.000 46.32000  ? 188  TYR B OH    1 
ATOM   5894 N  N     . VAL B 2 189 ? -39.01800 -68.90600 33.73600  1.000 46.15000  ? 189  VAL B N     1 
ATOM   5895 C  CA    . VAL B 2 189 ? -39.43300 -69.43300 35.03200  1.000 52.21000  ? 189  VAL B CA    1 
ATOM   5896 C  C     . VAL B 2 189 ? -40.95300 -69.47200 35.14700  1.000 56.35000  ? 189  VAL B C     1 
ATOM   5897 O  O     . VAL B 2 189 ? -41.59200 -68.42000 35.24700  1.000 58.19000  ? 189  VAL B O     1 
ATOM   5898 C  CB    . VAL B 2 189 ? -38.87200 -68.57700 36.19900  1.000 51.41000  ? 189  VAL B CB    1 
ATOM   5899 C  CG1   . VAL B 2 189 ? -39.13800 -69.25500 37.52800  1.000 51.71000  ? 189  VAL B CG1   1 
ATOM   5900 C  CG2   . VAL B 2 189 ? -37.38800 -68.31900 36.02000  1.000 48.70000  ? 189  VAL B CG2   1 
ATOM   5901 N  N     . GLY B 2 190 ? -41.52900 -70.67000 35.14800  1.000 54.50000  ? 190  GLY B N     1 
ATOM   5902 C  CA    . GLY B 2 190 ? -42.97300 -70.80200 35.28700  1.000 56.17000  ? 190  GLY B CA    1 
ATOM   5903 C  C     . GLY B 2 190 ? -43.45800 -71.31500 36.63600  1.000 62.86000  ? 190  GLY B C     1 
ATOM   5904 O  O     . GLY B 2 190 ? -42.81000 -72.16200 37.26400  1.000 59.62000  ? 190  GLY B O     1 
ATOM   5905 N  N     . SER B 2 191 ? -44.61200 -70.80800 37.07400  1.000 65.76000  ? 191  SER B N     1 
ATOM   5906 C  CA    . SER B 2 191 ? -45.25700 -71.27300 38.30300  1.000 62.26000  ? 191  SER B CA    1 
ATOM   5907 C  C     . SER B 2 191 ? -46.77500 -71.08800 38.26200  1.000 67.74000  ? 191  SER B C     1 
ATOM   5908 O  O     . SER B 2 191 ? -47.29100 -70.26800 37.50000  1.000 70.46000  ? 191  SER B O     1 
ATOM   5909 C  CB    . SER B 2 191 ? -44.70300 -70.52300 39.50900  1.000 61.59000  ? 191  SER B CB    1 
ATOM   5910 O  OG    . SER B 2 191 ? -45.33800 -69.26200 39.62400  1.000 62.47000  ? 191  SER B OG    1 
ATOM   5911 N  N     . ASP B 2 192 ? -47.48700 -71.83500 39.10500  1.000 67.09000  ? 192  ASP B N     1 
ATOM   5912 C  CA    . ASP B 2 192 ? -48.93600 -71.68700 39.22000  1.000 63.29000  ? 192  ASP B CA    1 
ATOM   5913 C  C     . ASP B 2 192 ? -49.28400 -70.83600 40.43900  1.000 66.95000  ? 192  ASP B C     1 
ATOM   5914 O  O     . ASP B 2 192 ? -50.45700 -70.65900 40.78300  1.000 67.77000  ? 192  ASP B O     1 
ATOM   5915 C  CB    . ASP B 2 192 ? -49.60100 -73.06000 39.30400  1.000 62.46000  ? 192  ASP B CB    1 
ATOM   5916 C  CG    . ASP B 2 192 ? -49.34600 -73.90300 38.06400  1.000 65.49000  ? 192  ASP B CG    1 
ATOM   5917 O  OD1   . ASP B 2 192 ? -49.60400 -73.39100 36.95100  1.000 70.87000  ? 192  ASP B OD1   1 
ATOM   5918 O  OD2   . ASP B 2 192 ? -48.88500 -75.06400 38.19300  1.000 55.57000  ? 192  ASP B OD2   1 
ATOM   5919 N  N     . LEU B 2 193 ? -48.24800 -70.31100 41.08600  1.000 68.58000  ? 193  LEU B N     1 
ATOM   5920 C  CA    . LEU B 2 193 ? -48.41500 -69.38700 42.20500  1.000 66.91000  ? 193  LEU B CA    1 
ATOM   5921 C  C     . LEU B 2 193 ? -49.24900 -68.18900 41.78700  1.000 68.99000  ? 193  LEU B C     1 
ATOM   5922 O  O     . LEU B 2 193 ? -49.12300 -67.68300 40.66600  1.000 68.71000  ? 193  LEU B O     1 
ATOM   5923 C  CB    . LEU B 2 193 ? -47.06200 -68.90400 42.73300  1.000 59.75000  ? 193  LEU B CB    1 
ATOM   5924 C  CG    . LEU B 2 193 ? -46.06200 -69.95800 43.19400  1.000 56.12000  ? 193  LEU B CG    1 
ATOM   5925 C  CD1   . LEU B 2 193 ? -44.83400 -69.27200 43.73200  1.000 60.20000  ? 193  LEU B CD1   1 
ATOM   5926 C  CD2   . LEU B 2 193 ? -46.67900 -70.84800 44.24800  1.000 57.14000  ? 193  LEU B CD2   1 
ATOM   5927 N  N     . GLU B 2 194 ? -50.10800 -67.72900 42.68200  1.000 66.96000  ? 194  GLU B N     1 
ATOM   5928 C  CA    . GLU B 2 194 ? -50.85400 -66.53900 42.37000  1.000 73.14000  ? 194  GLU B CA    1 
ATOM   5929 C  C     . GLU B 2 194 ? -49.84800 -65.40000 42.32500  1.000 69.80000  ? 194  GLU B C     1 
ATOM   5930 O  O     . GLU B 2 194 ? -48.88700 -65.39000 43.09300  1.000 69.38000  ? 194  GLU B O     1 
ATOM   5931 C  CB    . GLU B 2 194 ? -51.95200 -66.28800 43.39300  1.000 72.12000  ? 194  GLU B CB    1 
ATOM   5932 C  CG    . GLU B 2 194 ? -51.44600 -65.76800 44.71100  1.000 77.41000  ? 194  GLU B CG    1 
ATOM   5933 C  CD    . GLU B 2 194 ? -52.21800 -64.54800 45.15800  1.000 83.63000  ? 194  GLU B CD    1 
ATOM   5934 O  OE1   . GLU B 2 194 ? -52.48800 -63.67500 44.29700  1.000 80.30000  ? 194  GLU B OE1   1 
ATOM   5935 O  OE2   . GLU B 2 194 ? -52.56600 -64.47300 46.36100  1.000 80.06000  ? 194  GLU B OE2   1 
ATOM   5936 N  N     . ILE B 2 195 ? -50.05300 -64.47600 41.39600  1.000 71.65000  ? 195  ILE B N     1 
ATOM   5937 C  CA    . ILE B 2 195 ? -49.16900 -63.33100 41.24400  1.000 74.86000  ? 195  ILE B CA    1 
ATOM   5938 C  C     . ILE B 2 195 ? -48.96400 -62.68400 42.61800  1.000 77.77000  ? 195  ILE B C     1 
ATOM   5939 O  O     . ILE B 2 195 ? -49.90500 -62.56000 43.40400  1.000 81.26000  ? 195  ILE B O     1 
ATOM   5940 C  CB    . ILE B 2 195 ? -49.74000 -62.30900 40.22600  1.000 77.10000  ? 195  ILE B CB    1 
ATOM   5941 C  CG1   . ILE B 2 195 ? -50.86200 -62.94800 39.39300  1.000 85.57000  ? 195  ILE B CG1   1 
ATOM   5942 C  CG2   . ILE B 2 195 ? -48.63900 -61.80200 39.31300  1.000 68.06000  ? 195  ILE B CG2   1 
ATOM   5943 C  CD1   . ILE B 2 195 ? -52.28400 -62.46700 39.72500  1.000 79.50000  ? 195  ILE B CD1   1 
ATOM   5944 N  N     . GLY B 2 196 ? -47.72700 -62.30000 42.91900  1.000 74.44000  ? 196  GLY B N     1 
ATOM   5945 C  CA    . GLY B 2 196 ? -47.38400 -61.86100 44.25800  1.000 68.09000  ? 196  GLY B CA    1 
ATOM   5946 C  C     . GLY B 2 196 ? -46.49800 -62.90800 44.90200  1.000 72.79000  ? 196  GLY B C     1 
ATOM   5947 O  O     . GLY B 2 196 ? -45.35400 -62.62600 45.26500  1.000 72.66000  ? 196  GLY B O     1 
ATOM   5948 N  N     . GLN B 2 197 ? -47.02100 -64.12700 45.03400  1.000 70.35000  ? 197  GLN B N     1 
ATOM   5949 C  CA    . GLN B 2 197 ? -46.21000 -65.25900 45.47400  1.000 70.26000  ? 197  GLN B CA    1 
ATOM   5950 C  C     . GLN B 2 197 ? -45.30400 -65.75500 44.34000  1.000 67.06000  ? 197  GLN B C     1 
ATOM   5951 O  O     . GLN B 2 197 ? -44.20000 -66.24800 44.58700  1.000 66.35000  ? 197  GLN B O     1 
ATOM   5952 C  CB    . GLN B 2 197 ? -47.09900 -66.38700 45.99800  1.000 69.95000  ? 197  GLN B CB    1 
ATOM   5953 C  CG    . GLN B 2 197 ? -47.54300 -66.15500 47.43900  1.000 75.35000  ? 197  GLN B CG    1 
ATOM   5954 C  CD    . GLN B 2 197 ? -48.36900 -67.30100 48.01600  1.000 85.68000  ? 197  GLN B CD    1 
ATOM   5955 O  OE1   . GLN B 2 197 ? -48.20500 -68.46700 47.63400  1.000 78.64000  ? 197  GLN B OE1   1 
ATOM   5956 N  NE2   . GLN B 2 197 ? -49.26300 -66.96900 48.94700  1.000 79.76000  ? 197  GLN B NE2   1 
ATOM   5957 N  N     . HIS B 2 198 ? -45.77000 -65.60700 43.10100  1.000 65.38000  ? 198  HIS B N     1 
ATOM   5958 C  CA    . HIS B 2 198 ? -44.91200 -65.79900 41.93200  1.000 63.10000  ? 198  HIS B CA    1 
ATOM   5959 C  C     . HIS B 2 198 ? -43.85200 -64.71100 41.86100  1.000 63.41000  ? 198  HIS B C     1 
ATOM   5960 O  O     . HIS B 2 198 ? -42.68600 -64.98000 41.59200  1.000 61.60000  ? 198  HIS B O     1 
ATOM   5961 C  CB    . HIS B 2 198 ? -45.72800 -65.78900 40.64200  1.000 65.90000  ? 198  HIS B CB    1 
ATOM   5962 C  CG    . HIS B 2 198 ? -44.90100 -65.98100 39.40800  1.000 62.89000  ? 198  HIS B CG    1 
ATOM   5963 N  ND1   . HIS B 2 198 ? -44.73600 -67.21100 38.80200  1.000 59.43000  ? 198  HIS B ND1   1 
ATOM   5964 C  CD2   . HIS B 2 198 ? -44.18200 -65.10000 38.67000  1.000 59.78000  ? 198  HIS B CD2   1 
ATOM   5965 C  CE1   . HIS B 2 198 ? -43.95400 -67.08100 37.74800  1.000 57.24000  ? 198  HIS B CE1   1 
ATOM   5966 N  NE2   . HIS B 2 198 ? -43.60300 -65.81100 37.64400  1.000 59.31000  ? 198  HIS B NE2   1 
ATOM   5967 N  N     . ARG B 2 199 ? -44.27700 -63.47600 42.09500  1.000 63.58000  ? 199  ARG B N     1 
ATOM   5968 C  CA    . ARG B 2 199 ? -43.36200 -62.34100 42.15700  1.000 65.64000  ? 199  ARG B CA    1 
ATOM   5969 C  C     . ARG B 2 199 ? -42.33800 -62.47200 43.30200  1.000 70.13000  ? 199  ARG B C     1 
ATOM   5970 O  O     . ARG B 2 199 ? -41.14500 -62.19800 43.12200  1.000 65.32000  ? 199  ARG B O     1 
ATOM   5971 C  CB    . ARG B 2 199 ? -44.15600 -61.04600 42.30800  1.000 65.75000  ? 199  ARG B CB    1 
ATOM   5972 C  CG    . ARG B 2 199 ? -45.23200 -60.86200 41.24400  1.000 73.46000  ? 199  ARG B CG    1 
ATOM   5973 C  CD    . ARG B 2 199 ? -44.84200 -59.79100 40.22700  1.000 70.50000  ? 199  ARG B CD    1 
ATOM   5974 N  NE    . ARG B 2 199 ? -45.88300 -59.58400 39.22400  1.000 74.82000  ? 199  ARG B NE    1 
ATOM   5975 C  CZ    . ARG B 2 199 ? -47.10500 -59.13400 39.49600  1.000 80.92000  ? 199  ARG B CZ    1 
ATOM   5976 N  NH1   . ARG B 2 199 ? -47.45400 -58.84700 40.74600  1.000 78.78000  ? 199  ARG B NH1   1 
ATOM   5977 N  NH2   . ARG B 2 199 ? -47.98900 -58.98100 38.51900  1.000 79.51000  ? 199  ARG B NH2   1 
ATOM   5978 N  N     . THR B 2 200 ? -42.80200 -62.89100 44.47900  1.000 69.78000  ? 200  THR B N     1 
ATOM   5979 C  CA    . THR B 2 200 ? -41.90100 -63.07500 45.60800  1.000 64.46000  ? 200  THR B CA    1 
ATOM   5980 C  C     . THR B 2 200 ? -40.97800 -64.27900 45.36600  1.000 65.66000  ? 200  THR B C     1 
ATOM   5981 O  O     . THR B 2 200 ? -39.84000 -64.31900 45.84900  1.000 63.80000  ? 200  THR B O     1 
ATOM   5982 C  CB    . THR B 2 200 ? -42.67700 -63.25400 46.92100  1.000 66.54000  ? 200  THR B CB    1 
ATOM   5983 O  OG1   . THR B 2 200 ? -43.56500 -62.14400 47.10600  1.000 68.81000  ? 200  THR B OG1   1 
ATOM   5984 C  CG2   . THR B 2 200 ? -41.72200 -63.31100 48.09600  1.000 72.77000  ? 200  THR B CG2   1 
ATOM   5985 N  N     . LYS B 2 201 ? -41.46300 -65.25000 44.60000  1.000 61.30000  ? 201  LYS B N     1 
ATOM   5986 C  CA    . LYS B 2 201 ? -40.61900 -66.36400 44.20400  1.000 58.75000  ? 201  LYS B CA    1 
ATOM   5987 C  C     . LYS B 2 201 ? -39.51700 -65.92800 43.25200  1.000 61.66000  ? 201  LYS B C     1 
ATOM   5988 O  O     . LYS B 2 201 ? -38.35400 -66.29700 43.41500  1.000 61.72000  ? 201  LYS B O     1 
ATOM   5989 C  CB    . LYS B 2 201 ? -41.45400 -67.45900 43.56500  1.000 56.42000  ? 201  LYS B CB    1 
ATOM   5990 C  CG    . LYS B 2 201 ? -41.91300 -68.48900 44.56400  1.000 62.51000  ? 201  LYS B CG    1 
ATOM   5991 C  CD    . LYS B 2 201 ? -40.73200 -69.03700 45.35800  1.000 61.89000  ? 201  LYS B CD    1 
ATOM   5992 C  CE    . LYS B 2 201 ? -41.20800 -69.87700 46.52900  1.000 61.89000  ? 201  LYS B CE    1 
ATOM   5993 N  NZ    . LYS B 2 201 ? -40.12700 -70.05700 47.53400  1.000 67.03000  ? 201  LYS B NZ    1 
ATOM   5994 N  N     . ILE B 2 202 ? -39.88600 -65.13400 42.25800  1.000 60.82000  ? 202  ILE B N     1 
ATOM   5995 C  CA    . ILE B 2 202 ? -38.92800 -64.68600 41.25700  1.000 61.91000  ? 202  ILE B CA    1 
ATOM   5996 C  C     . ILE B 2 202 ? -37.77900 -63.91700 41.89100  1.000 59.98000  ? 202  ILE B C     1 
ATOM   5997 O  O     . ILE B 2 202 ? -36.61000 -64.13100 41.55000  1.000 56.09000  ? 202  ILE B O     1 
ATOM   5998 C  CB    . ILE B 2 202 ? -39.61200 -63.80600 40.18700  1.000 64.53000  ? 202  ILE B CB    1 
ATOM   5999 C  CG1   . ILE B 2 202 ? -40.48100 -64.67600 39.27000  1.000 59.39000  ? 202  ILE B CG1   1 
ATOM   6000 C  CG2   . ILE B 2 202 ? -38.58400 -62.99700 39.39400  1.000 59.58000  ? 202  ILE B CG2   1 
ATOM   6001 C  CD1   . ILE B 2 202 ? -39.86800 -66.01600 38.93200  1.000 51.36000  ? 202  ILE B CD1   1 
ATOM   6002 N  N     . GLU B 2 203 ? -38.11400 -63.03400 42.82700  1.000 63.12000  ? 203  GLU B N     1 
ATOM   6003 C  CA    . GLU B 2 203 ? -37.09800 -62.22400 43.48000  1.000 63.32000  ? 203  GLU B CA    1 
ATOM   6004 C  C     . GLU B 2 203 ? -36.22400 -63.11400 44.35100  1.000 64.69000  ? 203  GLU B C     1 
ATOM   6005 O  O     . GLU B 2 203 ? -35.05300 -62.80900 44.58300  1.000 62.47000  ? 203  GLU B O     1 
ATOM   6006 C  CB    . GLU B 2 203 ? -37.73300 -61.09900 44.30700  1.000 58.54000  ? 203  GLU B CB    1 
ATOM   6007 C  CG    . GLU B 2 203 ? -36.72900 -60.13600 44.95100  1.000 58.74000  ? 203  GLU B CG    1 
ATOM   6008 C  CD    . GLU B 2 203 ? -35.85800 -59.39400 43.93200  1.000 64.36000  ? 203  GLU B CD    1 
ATOM   6009 O  OE1   . GLU B 2 203 ? -34.82300 -58.81300 44.33700  1.000 60.53000  ? 203  GLU B OE1   1 
ATOM   6010 O  OE2   . GLU B 2 203 ? -36.20400 -59.38700 42.72700  1.000 65.61000  ? 203  GLU B OE2   1 
ATOM   6011 N  N     . GLU B 2 204 ? -36.79000 -64.22200 44.82300  1.000 65.18000  ? 204  GLU B N     1 
ATOM   6012 C  CA    . GLU B 2 204 ? -36.00500 -65.17800 45.59500  1.000 63.89000  ? 204  GLU B CA    1 
ATOM   6013 C  C     . GLU B 2 204 ? -34.86900 -65.72100 44.73100  1.000 66.85000  ? 204  GLU B C     1 
ATOM   6014 O  O     . GLU B 2 204 ? -33.71300 -65.76600 45.15900  1.000 65.58000  ? 204  GLU B O     1 
ATOM   6015 C  CB    . GLU B 2 204 ? -36.87900 -66.31700 46.11100  1.000 64.52000  ? 204  GLU B CB    1 
ATOM   6016 C  CG    . GLU B 2 204 ? -36.09300 -67.40900 46.82100  1.000 66.63000  ? 204  GLU B CG    1 
ATOM   6017 C  CD    . GLU B 2 204 ? -36.98800 -68.41900 47.52100  1.000 72.27000  ? 204  GLU B CD    1 
ATOM   6018 O  OE1   . GLU B 2 204 ? -38.20800 -68.14300 47.65300  1.000 69.27000  ? 204  GLU B OE1   1 
ATOM   6019 O  OE2   . GLU B 2 204 ? -36.46600 -69.48500 47.93500  1.000 72.68000  ? 204  GLU B OE2   1 
ATOM   6020 N  N     . LEU B 2 205 ? -35.21200 -66.10400 43.50000  1.000 67.10000  ? 205  LEU B N     1 
ATOM   6021 C  CA    . LEU B 2 205 ? -34.23500 -66.62500 42.55300  1.000 61.86000  ? 205  LEU B CA    1 
ATOM   6022 C  C     . LEU B 2 205 ? -33.17500 -65.59400 42.19300  1.000 62.51000  ? 205  LEU B C     1 
ATOM   6023 O  O     . LEU B 2 205 ? -32.00600 -65.93000 42.03600  1.000 61.54000  ? 205  LEU B O     1 
ATOM   6024 C  CB    . LEU B 2 205 ? -34.92500 -67.10300 41.28400  1.000 56.92000  ? 205  LEU B CB    1 
ATOM   6025 C  CG    . LEU B 2 205 ? -33.96100 -67.61300 40.21400  1.000 58.74000  ? 205  LEU B CG    1 
ATOM   6026 C  CD1   . LEU B 2 205 ? -33.08600 -68.70800 40.77000  1.000 60.54000  ? 205  LEU B CD1   1 
ATOM   6027 C  CD2   . LEU B 2 205 ? -34.71600 -68.11200 38.99200  1.000 58.66000  ? 205  LEU B CD2   1 
ATOM   6028 N  N     . ARG B 2 206 ? -33.59600 -64.34200 42.05300  1.000 64.27000  ? 206  ARG B N     1 
ATOM   6029 C  CA    . ARG B 2 206 ? -32.69100 -63.27000 41.65800  1.000 63.77000  ? 206  ARG B CA    1 
ATOM   6030 C  C     . ARG B 2 206 ? -31.69000 -63.01200 42.77600  1.000 65.76000  ? 206  ARG B C     1 
ATOM   6031 O  O     . ARG B 2 206 ? -30.51000 -62.76700 42.52500  1.000 68.77000  ? 206  ARG B O     1 
ATOM   6032 C  CB    . ARG B 2 206 ? -33.48800 -62.00100 41.31200  1.000 69.75000  ? 206  ARG B CB    1 
ATOM   6033 C  CG    . ARG B 2 206 ? -32.69700 -60.89300 40.62700  1.000 68.25000  ? 206  ARG B CG    1 
ATOM   6034 C  CD    . ARG B 2 206 ? -33.48500 -59.59000 40.63500  1.000 73.26000  ? 206  ARG B CD    1 
ATOM   6035 N  NE    . ARG B 2 206 ? -32.62400 -58.42500 40.42000  1.000 88.96000  ? 206  ARG B NE    1 
ATOM   6036 C  CZ    . ARG B 2 206 ? -32.02000 -57.73100 41.38800  1.000 89.00000  ? 206  ARG B CZ    1 
ATOM   6037 N  NH1   . ARG B 2 206 ? -32.17300 -58.07500 42.66300  1.000 73.98000  ? 206  ARG B NH1   1 
ATOM   6038 N  NH2   . ARG B 2 206 ? -31.25700 -56.68500 41.07500  1.000 87.61000  ? 206  ARG B NH2   1 
ATOM   6039 N  N     . GLN B 2 207 ? -32.16700 -63.07800 44.01500  1.000 69.08000  ? 207  GLN B N     1 
ATOM   6040 C  CA    . GLN B 2 207 ? -31.28400 -62.96800 45.16900  1.000 71.15000  ? 207  GLN B CA    1 
ATOM   6041 C  C     . GLN B 2 207 ? -30.30800 -64.13200 45.12600  1.000 73.29000  ? 207  GLN B C     1 
ATOM   6042 O  O     . GLN B 2 207 ? -29.10600 -63.98300 45.34500  1.000 74.78000  ? 207  GLN B O     1 
ATOM   6043 C  CB    . GLN B 2 207 ? -32.07500 -62.98000 46.48200  1.000 73.07000  ? 207  GLN B CB    1 
ATOM   6044 C  CG    . GLN B 2 207 ? -33.00700 -61.78300 46.70300  1.000 69.69000  ? 207  GLN B CG    1 
ATOM   6045 C  CD    . GLN B 2 207 ? -34.08900 -62.07100 47.75600  1.000 79.09000  ? 207  GLN B CD    1 
ATOM   6046 O  OE1   . GLN B 2 207 ? -34.07600 -63.11600 48.41900  1.000 80.54000  ? 207  GLN B OE1   1 
ATOM   6047 N  NE2   . GLN B 2 207 ? -35.03300 -61.14200 47.90300  1.000 72.93000  ? 207  GLN B NE2   1 
ATOM   6048 N  N     . HIS B 2 208 ? -30.84300 -65.30300 44.81300  1.000 74.57000  ? 208  HIS B N     1 
ATOM   6049 C  CA    . HIS B 2 208 ? -30.04400 -66.51700 44.75200  1.000 74.67000  ? 208  HIS B CA    1 
ATOM   6050 C  C     . HIS B 2 208 ? -28.95900 -66.45500 43.67500  1.000 69.57000  ? 208  HIS B C     1 
ATOM   6051 O  O     . HIS B 2 208 ? -27.98600 -67.20400 43.73100  1.000 72.27000  ? 208  HIS B O     1 
ATOM   6052 C  CB    . HIS B 2 208 ? -30.95600 -67.72000 44.50600  1.000 73.20000  ? 208  HIS B CB    1 
ATOM   6053 C  CG    . HIS B 2 208 ? -30.32800 -69.03000 44.85100  1.000 76.02000  ? 208  HIS B CG    1 
ATOM   6054 N  ND1   . HIS B 2 208 ? -29.46000 -69.68300 44.00100  1.000 76.34000  ? 208  HIS B ND1   1 
ATOM   6055 C  CD2   . HIS B 2 208 ? -30.43600 -69.80600 45.95500  1.000 80.99000  ? 208  HIS B CD2   1 
ATOM   6056 C  CE1   . HIS B 2 208 ? -29.06200 -70.80900 44.56700  1.000 86.21000  ? 208  HIS B CE1   1 
ATOM   6057 N  NE2   . HIS B 2 208 ? -29.63900 -70.90600 45.75400  1.000 88.65000  ? 208  HIS B NE2   1 
ATOM   6058 N  N     . LEU B 2 209 ? -29.13400 -65.55800 42.70400  1.000 66.30000  ? 209  LEU B N     1 
ATOM   6059 C  CA    . LEU B 2 209 ? -28.23300 -65.46300 41.55900  1.000 67.52000  ? 209  LEU B CA    1 
ATOM   6060 C  C     . LEU B 2 209 ? -27.17100 -64.38500 41.73900  1.000 74.72000  ? 209  LEU B C     1 
ATOM   6061 O  O     . LEU B 2 209 ? -26.12600 -64.42400 41.08200  1.000 76.14000  ? 209  LEU B O     1 
ATOM   6062 C  CB    . LEU B 2 209 ? -29.01600 -65.18700 40.27300  1.000 64.67000  ? 209  LEU B CB    1 
ATOM   6063 C  CG    . LEU B 2 209 ? -29.84900 -66.31200 39.66100  1.000 62.98000  ? 209  LEU B CG    1 
ATOM   6064 C  CD1   . LEU B 2 209 ? -30.61900 -65.79300 38.46600  1.000 52.73000  ? 209  LEU B CD1   1 
ATOM   6065 C  CD2   . LEU B 2 209 ? -28.96100 -67.46500 39.25000  1.000 67.39000  ? 209  LEU B CD2   1 
ATOM   6066 N  N     . LEU B 2 210 ? -27.44300 -63.41300 42.60700  1.000 73.32000  ? 210  LEU B N     1 
ATOM   6067 C  CA    . LEU B 2 210 ? -26.45400 -62.38600 42.92300  1.000 71.84000  ? 210  LEU B CA    1 
ATOM   6068 C  C     . LEU B 2 210 ? -25.44600 -62.92300 43.93100  1.000 73.69000  ? 210  LEU B C     1 
ATOM   6069 O  O     . LEU B 2 210 ? -24.39000 -62.32700 44.16300  1.000 72.32000  ? 210  LEU B O     1 
ATOM   6070 C  CB    . LEU B 2 210 ? -27.13100 -61.13300 43.46600  1.000 70.97000  ? 210  LEU B CB    1 
ATOM   6071 C  CG    . LEU B 2 210 ? -27.92100 -60.31900 42.44600  1.000 82.31000  ? 210  LEU B CG    1 
ATOM   6072 C  CD1   . LEU B 2 210 ? -28.67900 -59.18800 43.13100  1.000 85.23000  ? 210  LEU B CD1   1 
ATOM   6073 C  CD2   . LEU B 2 210 ? -26.99400 -59.78100 41.34900  1.000 87.35000  ? 210  LEU B CD2   1 
ATOM   6074 N  N     . ARG B 2 211 ? -25.78300 -64.06000 44.53000  1.000 75.31000  ? 211  ARG B N     1 
ATOM   6075 C  CA    . ARG B 2 211 ? -24.93800 -64.66900 45.54000  1.000 75.73000  ? 211  ARG B CA    1 
ATOM   6076 C  C     . ARG B 2 211 ? -23.85100 -65.52300 44.89500  1.000 82.48000  ? 211  ARG B C     1 
ATOM   6077 O  O     . ARG B 2 211 ? -22.78400 -65.72100 45.48000  1.000 82.44000  ? 211  ARG B O     1 
ATOM   6078 C  CB    . ARG B 2 211 ? -25.77800 -65.50700 46.50300  1.000 77.78000  ? 211  ARG B CB    1 
ATOM   6079 C  CG    . ARG B 2 211 ? -25.54200 -65.16900 47.96600  1.000 74.42000  ? 211  ARG B CG    1 
ATOM   6080 C  CD    . ARG B 2 211 ? -26.42700 -65.99500 48.87200  1.000 78.69000  ? 211  ARG B CD    1 
ATOM   6081 N  NE    . ARG B 2 211 ? -27.83600 -65.86800 48.50700  1.000 84.18000  ? 211  ARG B NE    1 
ATOM   6082 C  CZ    . ARG B 2 211 ? -28.82500 -66.50100 49.13000  1.000 89.88000  ? 211  ARG B CZ    1 
ATOM   6083 N  NH1   . ARG B 2 211 ? -28.55500 -67.30700 50.15500  1.000 98.95000  ? 211  ARG B NH1   1 
ATOM   6084 N  NH2   . ARG B 2 211 ? -30.08200 -66.33100 48.73200  1.000 75.51000  ? 211  ARG B NH2   1 
ATOM   6085 N  N     . TRP B 2 212 ? -24.12100 -66.01700 43.68900  1.000 81.72000  ? 212  TRP B N     1 
ATOM   6086 C  CA    . TRP B 2 212 ? -23.13200 -66.79500 42.94400  1.000 78.69000  ? 212  TRP B CA    1 
ATOM   6087 C  C     . TRP B 2 212 ? -22.27800 -65.91500 42.03200  1.000 79.13000  ? 212  TRP B C     1 
ATOM   6088 O  O     . TRP B 2 212 ? -21.09700 -66.20000 41.82300  1.000 80.23000  ? 212  TRP B O     1 
ATOM   6089 C  CB    . TRP B 2 212 ? -23.81900 -67.88900 42.13400  1.000 79.45000  ? 212  TRP B CB    1 
ATOM   6090 C  CG    . TRP B 2 212 ? -24.29000 -69.03200 42.98400  1.000 88.60000  ? 212  TRP B CG    1 
ATOM   6091 C  CD1   . TRP B 2 212 ? -25.54200 -69.20900 43.51400  1.000 91.54000  ? 212  TRP B CD1   1 
ATOM   6092 C  CD2   . TRP B 2 212 ? -23.51000 -70.15700 43.41100  1.000 93.45000  ? 212  TRP B CD2   1 
ATOM   6093 N  NE1   . TRP B 2 212 ? -25.58900 -70.38000 44.24000  1.000 91.87000  ? 212  TRP B NE1   1 
ATOM   6094 C  CE2   . TRP B 2 212 ? -24.35600 -70.97900 44.19400  1.000 98.22000  ? 212  TRP B CE2   1 
ATOM   6095 C  CE3   . TRP B 2 212 ? -22.18200 -70.55300 43.20700  1.000 92.63000  ? 212  TRP B CE3   1 
ATOM   6096 C  CZ2   . TRP B 2 212 ? -23.91300 -72.17100 44.77000  1.000 104.80000 ? 212  TRP B CZ2   1 
ATOM   6097 C  CZ3   . TRP B 2 212 ? -21.74400 -71.73600 43.78000  1.000 96.22000  ? 212  TRP B CZ3   1 
ATOM   6098 C  CH2   . TRP B 2 212 ? -22.60700 -72.53000 44.55200  1.000 107.14000 ? 212  TRP B CH2   1 
ATOM   6099 N  N     . GLY B 2 213 ? -22.87400 -64.84900 41.49400  1.000 77.56000  ? 213  GLY B N     1 
ATOM   6100 C  CA    . GLY B 2 213 ? -22.12400 -63.85500 40.74000  1.000 79.62000  ? 213  GLY B CA    1 
ATOM   6101 C  C     . GLY B 2 213 ? -22.59900 -63.62700 39.31600  1.000 71.44000  ? 213  GLY B C     1 
ATOM   6102 O  O     . GLY B 2 213 ? -22.35400 -64.44900 38.43200  1.000 64.01000  ? 213  GLY B O     1 
ATOM   6103 N  N     . GLU B 2 233 ? -44.28000 -60.00200 31.88200  1.000 82.15000  ? 233  GLU B N     1 
ATOM   6104 C  CA    . GLU B 2 233 ? -44.42800 -61.41600 32.32100  1.000 72.53000  ? 233  GLU B CA    1 
ATOM   6105 C  C     . GLU B 2 233 ? -45.36300 -62.15200 31.35400  1.000 74.95000  ? 233  GLU B C     1 
ATOM   6106 O  O     . GLU B 2 233 ? -46.23000 -61.48900 30.75100  1.000 78.53000  ? 233  GLU B O     1 
ATOM   6107 C  CB    . GLU B 2 233 ? -44.96000 -61.47600 33.75400  1.000 79.79000  ? 233  GLU B CB    1 
ATOM   6108 C  CG    . GLU B 2 233 ? -46.37600 -60.94800 33.89600  1.000 84.32000  ? 233  GLU B CG    1 
ATOM   6109 C  CD    . GLU B 2 233 ? -46.82100 -60.70600 35.32800  1.000 93.78000  ? 233  GLU B CD    1 
ATOM   6110 O  OE1   . GLU B 2 233 ? -46.25200 -59.80600 35.97900  1.000 89.92000  ? 233  GLU B OE1   1 
ATOM   6111 O  OE2   . GLU B 2 233 ? -47.73500 -61.41800 35.78900  1.000 100.30000 ? 233  GLU B OE2   1 
ATOM   6112 N  N     . LEU B 2 234 ? -45.18400 -63.47000 31.22000  1.000 68.39000  ? 234  LEU B N     1 
ATOM   6113 C  CA    . LEU B 2 234 ? -46.01800 -64.28300 30.32600  1.000 59.26000  ? 234  LEU B CA    1 
ATOM   6114 C  C     . LEU B 2 234 ? -47.12000 -65.07900 31.01400  1.000 63.20000  ? 234  LEU B C     1 
ATOM   6115 O  O     . LEU B 2 234 ? -47.15100 -65.19300 32.23600  1.000 68.22000  ? 234  LEU B O     1 
ATOM   6116 C  CB    . LEU B 2 234 ? -45.15000 -65.27100 29.54900  1.000 55.29000  ? 234  LEU B CB    1 
ATOM   6117 C  CG    . LEU B 2 234 ? -44.49200 -64.79600 28.26300  1.000 51.11000  ? 234  LEU B CG    1 
ATOM   6118 C  CD1   . LEU B 2 234 ? -43.91600 -63.40800 28.44800  1.000 52.71000  ? 234  LEU B CD1   1 
ATOM   6119 C  CD2   . LEU B 2 234 ? -43.41300 -65.78400 27.88700  1.000 45.38000  ? 234  LEU B CD2   1 
ATOM   6120 N  N     . HIS B 2 235 ? -47.99900 -65.65300 30.19600  1.000 64.55000  ? 235  HIS B N     1 
ATOM   6121 C  CA    . HIS B 2 235 ? -49.10500 -66.48300 30.65400  1.000 62.81000  ? 235  HIS B CA    1 
ATOM   6122 C  C     . HIS B 2 235 ? -49.44900 -67.54200 29.60500  1.000 64.43000  ? 235  HIS B C     1 
ATOM   6123 O  O     . HIS B 2 235 ? -50.53300 -67.51100 29.02700  1.000 69.87000  ? 235  HIS B O     1 
ATOM   6124 C  CB    . HIS B 2 235 ? -50.35300 -65.63800 30.93600  1.000 67.76000  ? 235  HIS B CB    1 
ATOM   6125 C  CG    . HIS B 2 235 ? -50.14100 -64.55300 31.94400  1.000 71.93000  ? 235  HIS B CG    1 
ATOM   6126 N  ND1   . HIS B 2 235 ? -50.08300 -64.79700 33.30100  1.000 73.76000  ? 235  HIS B ND1   1 
ATOM   6127 C  CD2   . HIS B 2 235 ? -49.98200 -63.21400 31.79400  1.000 71.97000  ? 235  HIS B CD2   1 
ATOM   6128 C  CE1   . HIS B 2 235 ? -49.88900 -63.65700 33.94200  1.000 78.75000  ? 235  HIS B CE1   1 
ATOM   6129 N  NE2   . HIS B 2 235 ? -49.82400 -62.67900 33.05100  1.000 73.34000  ? 235  HIS B NE2   1 
ATOM   6130 N  N     . PRO B 2 236 ? -48.53300 -68.48800 29.36700  1.000 64.85000  ? 236  PRO B N     1 
ATOM   6131 C  CA    . PRO B 2 236 ? -48.62800 -69.50400 28.30400  1.000 66.21000  ? 236  PRO B CA    1 
ATOM   6132 C  C     . PRO B 2 236 ? -49.98900 -70.16800 28.16700  1.000 69.52000  ? 236  PRO B C     1 
ATOM   6133 O  O     . PRO B 2 236 ? -50.41500 -70.44400 27.05000  1.000 74.16000  ? 236  PRO B O     1 
ATOM   6134 C  CB    . PRO B 2 236 ? -47.59100 -70.55000 28.72400  1.000 62.37000  ? 236  PRO B CB    1 
ATOM   6135 C  CG    . PRO B 2 236 ? -46.59600 -69.78700 29.50500  1.000 67.23000  ? 236  PRO B CG    1 
ATOM   6136 C  CD    . PRO B 2 236 ? -47.32300 -68.65600 30.19100  1.000 65.21000  ? 236  PRO B CD    1 
ATOM   6137 N  N     . ASP B 2 237 ? -50.65400 -70.42900 29.28700  1.000 76.42000  ? 237  ASP B N     1 
ATOM   6138 C  CA    . ASP B 2 237 ? -51.89000 -71.21900 29.27400  1.000 84.38000  ? 237  ASP B CA    1 
ATOM   6139 C  C     . ASP B 2 237 ? -53.02900 -70.53700 28.53300  1.000 82.03000  ? 237  ASP B C     1 
ATOM   6140 O  O     . ASP B 2 237 ? -53.99000 -71.19400 28.13200  1.000 82.80000  ? 237  ASP B O     1 
ATOM   6141 C  CB    . ASP B 2 237 ? -52.34000 -71.53900 30.70500  1.000 81.13000  ? 237  ASP B CB    1 
ATOM   6142 C  CG    . ASP B 2 237 ? -51.72500 -72.82400 31.23400  1.000 83.59000  ? 237  ASP B CG    1 
ATOM   6143 O  OD1   . ASP B 2 237 ? -51.53100 -73.77400 30.43600  1.000 80.51000  ? 237  ASP B OD1   1 
ATOM   6144 O  OD2   . ASP B 2 237 ? -51.43500 -72.88100 32.45000  1.000 89.09000  ? 237  ASP B OD2   1 
ATOM   6145 N  N     . LYS B 2 238 ? -52.91100 -69.22600 28.35000  1.000 80.44000  ? 238  LYS B N     1 
ATOM   6146 C  CA    . LYS B 2 238 ? -53.99900 -68.43000 27.80000  1.000 80.10000  ? 238  LYS B CA    1 
ATOM   6147 C  C     . LYS B 2 238 ? -53.63300 -67.83000 26.44800  1.000 80.39000  ? 238  LYS B C     1 
ATOM   6148 O  O     . LYS B 2 238 ? -53.86700 -66.64600 26.19700  1.000 79.12000  ? 238  LYS B O     1 
ATOM   6149 C  CB    . LYS B 2 238 ? -54.38900 -67.33400 28.79400  1.000 81.29000  ? 238  LYS B CB    1 
ATOM   6150 C  CG    . LYS B 2 238 ? -54.98400 -67.88700 30.09500  1.000 83.13000  ? 238  LYS B CG    1 
ATOM   6151 C  CD    . LYS B 2 238 ? -54.79200 -66.93800 31.27800  1.000 76.91000  ? 238  LYS B CD    1 
ATOM   6152 C  CE    . LYS B 2 238 ? -53.65900 -67.41600 32.18300  1.000 71.59000  ? 238  LYS B CE    1 
ATOM   6153 N  NZ    . LYS B 2 238 ? -53.38300 -66.45900 33.29500  1.000 69.23000  ? 238  LYS B NZ    1 
ATOM   6154 N  N     . TRP B 2 239 ? -53.05300 -68.66600 25.58500  1.000 81.77000  ? 239  TRP B N     1 
ATOM   6155 C  CA    . TRP B 2 239 ? -52.68700 -68.26600 24.22700  1.000 79.52000  ? 239  TRP B CA    1 
ATOM   6156 C  C     . TRP B 2 239 ? -53.73400 -68.79500 23.25400  1.000 85.92000  ? 239  TRP B C     1 
ATOM   6157 O  O     . TRP B 2 239 ? -54.03000 -69.99600 23.23200  1.000 86.75000  ? 239  TRP B O     1 
ATOM   6158 C  CB    . TRP B 2 239 ? -51.28700 -68.78400 23.84400  1.000 75.45000  ? 239  TRP B CB    1 
ATOM   6159 C  CG    . TRP B 2 239 ? -50.14600 -68.04400 24.50600  1.000 69.20000  ? 239  TRP B CG    1 
ATOM   6160 C  CD1   . TRP B 2 239 ? -50.20400 -66.82200 25.10400  1.000 68.74000  ? 239  TRP B CD1   1 
ATOM   6161 C  CD2   . TRP B 2 239 ? -48.78500 -68.49000 24.63900  1.000 62.21000  ? 239  TRP B CD2   1 
ATOM   6162 N  NE1   . TRP B 2 239 ? -48.96900 -66.47500 25.59900  1.000 65.64000  ? 239  TRP B NE1   1 
ATOM   6163 C  CE2   . TRP B 2 239 ? -48.08100 -67.48100 25.32600  1.000 60.71000  ? 239  TRP B CE2   1 
ATOM   6164 C  CE3   . TRP B 2 239 ? -48.09500 -69.64000 24.24400  1.000 61.88000  ? 239  TRP B CE3   1 
ATOM   6165 C  CZ2   . TRP B 2 239 ? -46.72300 -67.58800 25.62700  1.000 57.55000  ? 239  TRP B CZ2   1 
ATOM   6166 C  CZ3   . TRP B 2 239 ? -46.74400 -69.74400 24.54300  1.000 58.13000  ? 239  TRP B CZ3   1 
ATOM   6167 C  CH2   . TRP B 2 239 ? -46.07400 -68.72200 25.22800  1.000 54.53000  ? 239  TRP B CH2   1 
ATOM   6168 N  N     . THR B 2 240 ? -54.29600 -67.89000 22.45800  1.000 89.10000  ? 240  THR B N     1 
ATOM   6169 C  CA    . THR B 2 240 ? -55.36100 -68.23400 21.52000  1.000 80.95000  ? 240  THR B CA    1 
ATOM   6170 C  C     . THR B 2 240 ? -54.83300 -69.04900 20.34500  1.000 78.54000  ? 240  THR B C     1 
ATOM   6171 O  O     . THR B 2 240 ? -53.69500 -68.86300 19.90400  1.000 72.70000  ? 240  THR B O     1 
ATOM   6172 C  CB    . THR B 2 240 ? -56.05900 -66.96800 20.96400  1.000 77.05000  ? 240  THR B CB    1 
ATOM   6173 O  OG1   . THR B 2 240 ? -55.14600 -66.24500 20.12400  1.000 74.91000  ? 240  THR B OG1   1 
ATOM   6174 C  CG2   . THR B 2 240 ? -56.52100 -66.06100 22.09200  1.000 75.01000  ? 240  THR B CG2   1 
ATOM   6175 N  N     . VAL B 2 241 ? -55.66500 -69.96700 19.85900  1.000 82.57000  ? 241  VAL B N     1 
ATOM   6176 C  CA    . VAL B 2 241 ? -55.47300 -70.56900 18.54300  1.000 70.79000  ? 241  VAL B CA    1 
ATOM   6177 C  C     . VAL B 2 241 ? -56.47500 -69.90600 17.60900  1.000 67.35000  ? 241  VAL B C     1 
ATOM   6178 O  O     . VAL B 2 241 ? -57.62600 -69.67100 17.99900  1.000 65.77000  ? 241  VAL B O     1 
ATOM   6179 C  CB    . VAL B 2 241 ? -55.69300 -72.09200 18.54400  1.000 69.88000  ? 241  VAL B CB    1 
ATOM   6180 C  CG1   . VAL B 2 241 ? -55.04900 -72.70700 17.30900  1.000 61.64000  ? 241  VAL B CG1   1 
ATOM   6181 C  CG2   . VAL B 2 241 ? -55.14000 -72.71600 19.82300  1.000 73.31000  ? 241  VAL B CG2   1 
ATOM   6182 N  N     . GLN B 2 242 ? -56.04200 -69.60000 16.39000  1.000 66.77000  ? 242  GLN B N     1 
ATOM   6183 C  CA    . GLN B 2 242 ? -56.87200 -68.84900 15.44100  1.000 62.12000  ? 242  GLN B CA    1 
ATOM   6184 C  C     . GLN B 2 242 ? -57.45700 -69.73700 14.33500  1.000 60.44000  ? 242  GLN B C     1 
ATOM   6185 O  O     . GLN B 2 242 ? -56.79800 -69.97500 13.32200  1.000 60.64000  ? 242  GLN B O     1 
ATOM   6186 C  CB    . GLN B 2 242 ? -56.05000 -67.71400 14.81800  1.000 53.03000  ? 242  GLN B CB    1 
ATOM   6187 C  CG    . GLN B 2 242 ? -56.77000 -66.92900 13.73500  1.000 58.22000  ? 242  GLN B CG    1 
ATOM   6188 C  CD    . GLN B 2 242 ? -57.86700 -66.02300 14.29000  1.000 68.91000  ? 242  GLN B CD    1 
ATOM   6189 O  OE1   . GLN B 2 242 ? -57.70400 -64.80200 14.34000  1.000 69.20000  ? 242  GLN B OE1   1 
ATOM   6190 N  NE2   . GLN B 2 242 ? -58.99200 -66.61700 14.69600  1.000 63.18000  ? 242  GLN B NE2   1 
ATOM   6191 N  N     . PRO B 2 243 ? -58.69800 -70.22600 14.52300  1.000 58.00000  ? 243  PRO B N     1 
ATOM   6192 C  CA    . PRO B 2 243 ? -59.34400 -71.03100 13.48000  1.000 59.97000  ? 243  PRO B CA    1 
ATOM   6193 C  C     . PRO B 2 243 ? -59.66100 -70.21900 12.23000  1.000 59.39000  ? 243  PRO B C     1 
ATOM   6194 O  O     . PRO B 2 243 ? -59.85200 -69.00000 12.32500  1.000 58.69000  ? 243  PRO B O     1 
ATOM   6195 C  CB    . PRO B 2 243 ? -60.64200 -71.49300 14.15200  1.000 55.60000  ? 243  PRO B CB    1 
ATOM   6196 C  CG    . PRO B 2 243 ? -60.94000 -70.42400 15.13500  1.000 54.39000  ? 243  PRO B CG    1 
ATOM   6197 C  CD    . PRO B 2 243 ? -59.59100 -70.02200 15.67400  1.000 58.75000  ? 243  PRO B CD    1 
ATOM   6198 N  N     . ILE B 2 244 ? -59.69900 -70.88600 11.07900  1.000 58.33000  ? 244  ILE B N     1 
ATOM   6199 C  CA    . ILE B 2 244 ? -60.31200 -70.31800 9.88100   1.000 55.97000  ? 244  ILE B CA    1 
ATOM   6200 C  C     . ILE B 2 244 ? -61.82500 -70.35900 10.05600  1.000 55.77000  ? 244  ILE B C     1 
ATOM   6201 O  O     . ILE B 2 244 ? -62.35500 -71.24400 10.72200  1.000 53.21000  ? 244  ILE B O     1 
ATOM   6202 C  CB    . ILE B 2 244 ? -59.93000 -71.07800 8.61400   1.000 52.95000  ? 244  ILE B CB    1 
ATOM   6203 C  CG1   . ILE B 2 244 ? -58.41100 -71.05500 8.42100   1.000 53.25000  ? 244  ILE B CG1   1 
ATOM   6204 C  CG2   . ILE B 2 244 ? -60.63900 -70.48700 7.41600   1.000 53.52000  ? 244  ILE B CG2   1 
ATOM   6205 C  CD1   . ILE B 2 244 ? -57.95000 -71.75500 7.15700   1.000 50.73000  ? 244  ILE B CD1   1 
ATOM   6206 N  N     . VAL B 2 245 ? -62.52700 -69.39800 9.47400   1.000 55.61000  ? 245  VAL B N     1 
ATOM   6207 C  CA    . VAL B 2 245 ? -63.95700 -69.30200 9.72600   1.000 60.11000  ? 245  VAL B CA    1 
ATOM   6208 C  C     . VAL B 2 245 ? -64.68200 -68.83500 8.46400   1.000 53.44000  ? 245  VAL B C     1 
ATOM   6209 O  O     . VAL B 2 245 ? -64.07500 -68.20200 7.60100   1.000 52.92000  ? 245  VAL B O     1 
ATOM   6210 C  CB    . VAL B 2 245 ? -64.23200 -68.35500 10.92400  1.000 65.02000  ? 245  VAL B CB    1 
ATOM   6211 C  CG1   . VAL B 2 245 ? -63.57400 -66.98300 10.68600  1.000 61.93000  ? 245  VAL B CG1   1 
ATOM   6212 C  CG2   . VAL B 2 245 ? -65.73900 -68.25200 11.21200  1.000 60.77000  ? 245  VAL B CG2   1 
ATOM   6213 N  N     . LEU B 2 246 ? -65.96700 -69.17200 8.34700   1.000 52.06000  ? 246  LEU B N     1 
ATOM   6214 C  CA    . LEU B 2 246 ? -66.72700 -68.88100 7.13100   1.000 47.46000  ? 246  LEU B CA    1 
ATOM   6215 C  C     . LEU B 2 246 ? -67.92000 -67.96300 7.39000   1.000 51.22000  ? 246  LEU B C     1 
ATOM   6216 O  O     . LEU B 2 246 ? -68.62600 -68.10700 8.38900   1.000 52.68000  ? 246  LEU B O     1 
ATOM   6217 C  CB    . LEU B 2 246 ? -67.21900 -70.17400 6.47800   1.000 40.03000  ? 246  LEU B CB    1 
ATOM   6218 C  CG    . LEU B 2 246 ? -66.21300 -71.23800 6.03700   1.000 42.24000  ? 246  LEU B CG    1 
ATOM   6219 C  CD1   . LEU B 2 246 ? -66.94800 -72.43700 5.46800   1.000 38.96000  ? 246  LEU B CD1   1 
ATOM   6220 C  CD2   . LEU B 2 246 ? -65.20500 -70.69800 5.02600   1.000 39.40000  ? 246  LEU B CD2   1 
ATOM   6221 N  N     . PRO B 2 247 ? -68.16600 -67.03200 6.45900   1.000 53.95000  ? 247  PRO B N     1 
ATOM   6222 C  CA    . PRO B 2 247 ? -69.23100 -66.03300 6.57100   1.000 52.81000  ? 247  PRO B CA    1 
ATOM   6223 C  C     . PRO B 2 247 ? -70.59500 -66.67600 6.80700   1.000 55.84000  ? 247  PRO B C     1 
ATOM   6224 O  O     . PRO B 2 247 ? -70.83700 -67.74100 6.24100   1.000 53.27000  ? 247  PRO B O     1 
ATOM   6225 C  CB    . PRO B 2 247 ? -69.20200 -65.33300 5.20200   1.000 51.73000  ? 247  PRO B CB    1 
ATOM   6226 C  CG    . PRO B 2 247 ? -67.89000 -65.65000 4.61500   1.000 47.98000  ? 247  PRO B CG    1 
ATOM   6227 C  CD    . PRO B 2 247 ? -67.50900 -66.99500 5.13700   1.000 51.70000  ? 247  PRO B CD    1 
ATOM   6228 N  N     . GLU B 2 248 ? -71.44700 -66.06300 7.63100   1.000 56.33000  ? 248  GLU B N     1 
ATOM   6229 C  CA    . GLU B 2 248 ? -72.85600 -66.45200 7.70800   1.000 60.31000  ? 248  GLU B CA    1 
ATOM   6230 C  C     . GLU B 2 248 ? -73.67400 -65.37000 7.04000   1.000 63.90000  ? 248  GLU B C     1 
ATOM   6231 O  O     . GLU B 2 248 ? -73.48800 -64.18400 7.33300   1.000 61.78000  ? 248  GLU B O     1 
ATOM   6232 C  CB    . GLU B 2 248 ? -73.33000 -66.62500 9.14600   1.000 69.56000  ? 248  GLU B CB    1 
ATOM   6233 C  CG    . GLU B 2 248 ? -72.38700 -67.37200 10.06300  1.000 75.62000  ? 248  GLU B CG    1 
ATOM   6234 C  CD    . GLU B 2 248 ? -72.82200 -67.27400 11.51600  1.000 88.75000  ? 248  GLU B CD    1 
ATOM   6235 O  OE1   . GLU B 2 248 ? -71.97100 -67.48800 12.41300  1.000 93.07000  ? 248  GLU B OE1   1 
ATOM   6236 O  OE2   . GLU B 2 248 ? -74.01800 -66.97600 11.75800  1.000 83.00000  ? 248  GLU B OE2   1 
ATOM   6237 N  N     . LYS B 2 249 ? -74.58300 -65.75800 6.15000   1.000 62.32000  ? 249  LYS B N     1 
ATOM   6238 C  CA    . LYS B 2 249 ? -75.33300 -64.75800 5.38900   1.000 61.25000  ? 249  LYS B CA    1 
ATOM   6239 C  C     . LYS B 2 249 ? -76.77400 -65.19000 5.11800   1.000 58.43000  ? 249  LYS B C     1 
ATOM   6240 O  O     . LYS B 2 249 ? -77.07300 -66.38500 5.00900   1.000 53.07000  ? 249  LYS B O     1 
ATOM   6241 C  CB    . LYS B 2 249 ? -74.61800 -64.44200 4.05900   1.000 51.73000  ? 249  LYS B CB    1 
ATOM   6242 C  CG    . LYS B 2 249 ? -73.44400 -63.47500 4.18100   1.000 45.12000  ? 249  LYS B CG    1 
ATOM   6243 C  CD    . LYS B 2 249 ? -72.86800 -63.11500 2.81700   1.000 40.74000  ? 249  LYS B CD    1 
ATOM   6244 C  CE    . LYS B 2 249 ? -71.90600 -61.92500 2.91400   1.000 48.47000  ? 249  LYS B CE    1 
ATOM   6245 N  NZ    . LYS B 2 249 ? -70.50300 -62.25200 3.36500   1.000 39.35000  ? 249  LYS B NZ    1 
ATOM   6246 N  N     . ASP B 2 250 ? -77.65800 -64.19700 5.02700   1.000 53.81000  ? 250  ASP B N     1 
ATOM   6247 C  CA    . ASP B 2 250 ? -79.03900 -64.43300 4.65900   1.000 55.37000  ? 250  ASP B CA    1 
ATOM   6248 C  C     . ASP B 2 250 ? -79.22300 -64.30700 3.15700   1.000 60.20000  ? 250  ASP B C     1 
ATOM   6249 O  O     . ASP B 2 250 ? -80.00200 -65.04700 2.54600   1.000 54.92000  ? 250  ASP B O     1 
ATOM   6250 C  CB    . ASP B 2 250 ? -79.95400 -63.46100 5.38600   1.000 62.90000  ? 250  ASP B CB    1 
ATOM   6251 C  CG    . ASP B 2 250 ? -80.42600 -64.01100 6.70600   1.000 72.71000  ? 250  ASP B CG    1 
ATOM   6252 O  OD1   . ASP B 2 250 ? -79.68400 -64.83200 7.29900   1.000 61.99000  ? 250  ASP B OD1   1 
ATOM   6253 O  OD2   . ASP B 2 250 ? -81.53900 -63.63300 7.13900   1.000 85.51000  ? 250  ASP B OD2   1 
ATOM   6254 N  N     . SER B 2 251 ? -78.50100 -63.35700 2.57100   1.000 56.35000  ? 251  SER B N     1 
ATOM   6255 C  CA    . SER B 2 251 ? -78.44000 -63.23200 1.12700   1.000 43.45000  ? 251  SER B CA    1 
ATOM   6256 C  C     . SER B 2 251 ? -77.01900 -63.48300 0.63600   1.000 46.72000  ? 251  SER B C     1 
ATOM   6257 O  O     . SER B 2 251 ? -76.08100 -62.79000 1.04400   1.000 45.74000  ? 251  SER B O     1 
ATOM   6258 C  CB    . SER B 2 251 ? -78.90800 -61.84900 0.68800   1.000 45.03000  ? 251  SER B CB    1 
ATOM   6259 O  OG    . SER B 2 251 ? -80.31700 -61.80400 0.58300   1.000 62.92000  ? 251  SER B OG    1 
ATOM   6260 N  N     . TRP B 2 252 ? -76.85500 -64.47600 -0.23000  1.000 42.89000  ? 252  TRP B N     1 
ATOM   6261 C  CA    . TRP B 2 252 ? -75.57300 -64.68800 -0.88200  1.000 39.44000  ? 252  TRP B CA    1 
ATOM   6262 C  C     . TRP B 2 252 ? -75.67100 -64.22100 -2.31500  1.000 36.93000  ? 252  TRP B C     1 
ATOM   6263 O  O     . TRP B 2 252 ? -76.62700 -64.57900 -3.00100  1.000 35.28000  ? 252  TRP B O     1 
ATOM   6264 C  CB    . TRP B 2 252 ? -75.15600 -66.16700 -0.84900  1.000 39.39000  ? 252  TRP B CB    1 
ATOM   6265 C  CG    . TRP B 2 252 ? -74.84800 -66.70700 0.53000   1.000 45.05000  ? 252  TRP B CG    1 
ATOM   6266 C  CD1   . TRP B 2 252 ? -75.75100 -67.11300 1.47600   1.000 48.31000  ? 252  TRP B CD1   1 
ATOM   6267 C  CD2   . TRP B 2 252 ? -73.55200 -66.92800 1.09600   1.000 38.25000  ? 252  TRP B CD2   1 
ATOM   6268 N  NE1   . TRP B 2 252 ? -75.09400 -67.55500 2.59500   1.000 46.77000  ? 252  TRP B NE1   1 
ATOM   6269 C  CE2   . TRP B 2 252 ? -73.74300 -67.45200 2.38800   1.000 43.00000  ? 252  TRP B CE2   1 
ATOM   6270 C  CE3   . TRP B 2 252 ? -72.24900 -66.72500 0.64100   1.000 42.08000  ? 252  TRP B CE3   1 
ATOM   6271 C  CZ2   . TRP B 2 252 ? -72.68300 -67.76700 3.22700   1.000 46.75000  ? 252  TRP B CZ2   1 
ATOM   6272 C  CZ3   . TRP B 2 252 ? -71.19100 -67.05200 1.48100   1.000 35.53000  ? 252  TRP B CZ3   1 
ATOM   6273 C  CH2   . TRP B 2 252 ? -71.41700 -67.56000 2.75300   1.000 43.27000  ? 252  TRP B CH2   1 
ATOM   6274 N  N     . THR B 2 253 ? -74.69300 -63.43400 -2.77000  1.000 33.09000  ? 253  THR B N     1 
ATOM   6275 C  CA    . THR B 2 253 ? -74.59300 -63.08200 -4.18900  1.000 30.53000  ? 253  THR B CA    1 
ATOM   6276 C  C     . THR B 2 253 ? -73.61000 -63.97200 -4.90800  1.000 28.69000  ? 253  THR B C     1 
ATOM   6277 O  O     . THR B 2 253 ? -72.87200 -64.71800 -4.28100  1.000 29.38000  ? 253  THR B O     1 
ATOM   6278 C  CB    . THR B 2 253 ? -74.11400 -61.66500 -4.39700  1.000 30.19000  ? 253  THR B CB    1 
ATOM   6279 O  OG1   . THR B 2 253 ? -72.71200 -61.59600 -4.07100  1.000 30.11000  ? 253  THR B OG1   1 
ATOM   6280 C  CG2   . THR B 2 253 ? -74.89200 -60.74100 -3.52300  1.000 28.10000  ? 253  THR B CG2   1 
ATOM   6281 N  N     . VAL B 2 254 ? -73.56600 -63.86600 -6.22900  1.000 29.04000  ? 254  VAL B N     1 
ATOM   6282 C  CA    . VAL B 2 254 ? -72.57200 -64.62200 -6.97100  1.000 23.34000  ? 254  VAL B CA    1 
ATOM   6283 C  C     . VAL B 2 254 ? -71.18400 -64.28400 -6.46400  1.000 26.27000  ? 254  VAL B C     1 
ATOM   6284 O  O     . VAL B 2 254 ? -70.34000 -65.15900 -6.32500  1.000 30.58000  ? 254  VAL B O     1 
ATOM   6285 C  CB    . VAL B 2 254 ? -72.65800 -64.34500 -8.44200  1.000 21.23000  ? 254  VAL B CB    1 
ATOM   6286 C  CG1   . VAL B 2 254 ? -71.45400 -64.94000 -9.16800  1.000 18.86000  ? 254  VAL B CG1   1 
ATOM   6287 C  CG2   . VAL B 2 254 ? -73.96900 -64.90400 -8.96800  1.000 25.08000  ? 254  VAL B CG2   1 
ATOM   6288 N  N     . ASN B 2 255 ? -70.95100 -63.01900 -6.14100  1.000 26.33000  ? 255  ASN B N     1 
ATOM   6289 C  CA    . ASN B 2 255 ? -69.61500 -62.65800 -5.72500  1.000 26.66000  ? 255  ASN B CA    1 
ATOM   6290 C  C     . ASN B 2 255 ? -69.25600 -63.31200 -4.38700  1.000 30.13000  ? 255  ASN B C     1 
ATOM   6291 O  O     . ASN B 2 255 ? -68.16400 -63.84400 -4.23800  1.000 29.30000  ? 255  ASN B O     1 
ATOM   6292 C  CB    . ASN B 2 255 ? -69.45700 -61.15000 -5.62900  1.000 24.45000  ? 255  ASN B CB    1 
ATOM   6293 C  CG    . ASN B 2 255 ? -68.04700 -60.75400 -5.27400  1.000 30.21000  ? 255  ASN B CG    1 
ATOM   6294 O  OD1   . ASN B 2 255 ? -67.12000 -61.01300 -6.04600  1.000 30.38000  ? 255  ASN B OD1   1 
ATOM   6295 N  ND2   . ASN B 2 255 ? -67.86700 -60.14100 -4.10200  1.000 30.02000  ? 255  ASN B ND2   1 
ATOM   6296 N  N     . ASP B 2 256 ? -70.18500 -63.25500 -3.42900  1.000 32.09000  ? 256  ASP B N     1 
ATOM   6297 C  CA    . ASP B 2 256 ? -69.99700 -63.89100 -2.13700  1.000 29.36000  ? 256  ASP B CA    1 
ATOM   6298 C  C     . ASP B 2 256 ? -69.56700 -65.33700 -2.34300  1.000 30.62000  ? 256  ASP B C     1 
ATOM   6299 O  O     . ASP B 2 256 ? -68.49700 -65.74600 -1.89000  1.000 32.50000  ? 256  ASP B O     1 
ATOM   6300 C  CB    . ASP B 2 256 ? -71.27400 -63.83100 -1.30200  1.000 29.22000  ? 256  ASP B CB    1 
ATOM   6301 C  CG    . ASP B 2 256 ? -71.54900 -62.43800 -0.73200  1.000 37.15000  ? 256  ASP B CG    1 
ATOM   6302 O  OD1   . ASP B 2 256 ? -70.58100 -61.71800 -0.37900  1.000 36.01000  ? 256  ASP B OD1   1 
ATOM   6303 O  OD2   . ASP B 2 256 ? -72.74100 -62.06000 -0.62000  1.000 42.50000  ? 256  ASP B OD2   1 
ATOM   6304 N  N     . ILE B 2 257 ? -70.38200 -66.08700 -3.07300  1.000 29.97000  ? 257  ILE B N     1 
ATOM   6305 C  CA    . ILE B 2 257 ? -70.12100 -67.49500 -3.31100  1.000 30.47000  ? 257  ILE B CA    1 
ATOM   6306 C  C     . ILE B 2 257 ? -68.78700 -67.75400 -3.99300  1.000 31.82000  ? 257  ILE B C     1 
ATOM   6307 O  O     . ILE B 2 257 ? -68.10900 -68.72400 -3.64700  1.000 33.83000  ? 257  ILE B O     1 
ATOM   6308 C  CB    . ILE B 2 257 ? -71.23100 -68.12400 -4.15400  1.000 30.02000  ? 257  ILE B CB    1 
ATOM   6309 C  CG1   . ILE B 2 257 ? -72.50900 -68.21600 -3.33700  1.000 28.29000  ? 257  ILE B CG1   1 
ATOM   6310 C  CG2   . ILE B 2 257 ? -70.83400 -69.51300 -4.62900  1.000 31.32000  ? 257  ILE B CG2   1 
ATOM   6311 C  CD1   . ILE B 2 257 ? -73.64000 -68.69600 -4.16600  1.000 37.10000  ? 257  ILE B CD1   1 
ATOM   6312 N  N     . GLN B 2 258 ? -68.39800 -66.90700 -4.94600  1.000 29.98000  ? 258  GLN B N     1 
ATOM   6313 C  CA    . GLN B 2 258 ? -67.11200 -67.11400 -5.61800  1.000 29.17000  ? 258  GLN B CA    1 
ATOM   6314 C  C     . GLN B 2 258 ? -65.95600 -66.94200 -4.64800  1.000 29.51000  ? 258  GLN B C     1 
ATOM   6315 O  O     . GLN B 2 258 ? -64.99600 -67.71200 -4.68300  1.000 29.95000  ? 258  GLN B O     1 
ATOM   6316 C  CB    . GLN B 2 258 ? -66.95100 -66.17400 -6.80400  1.000 31.68000  ? 258  GLN B CB    1 
ATOM   6317 C  CG    . GLN B 2 258 ? -67.76100 -66.62200 -8.01800  1.000 34.89000  ? 258  GLN B CG    1 
ATOM   6318 C  CD    . GLN B 2 258 ? -67.65000 -65.66000 -9.18300  1.000 32.21000  ? 258  GLN B CD    1 
ATOM   6319 O  OE1   . GLN B 2 258 ? -67.00800 -64.61100 -9.07300  1.000 29.11000  ? 258  GLN B OE1   1 
ATOM   6320 N  NE2   . GLN B 2 258 ? -68.28700 -66.00800 -10.30600 1.000 29.89000  ? 258  GLN B NE2   1 
ATOM   6321 N  N     . LYS B 2 259 ? -66.06400 -65.94900 -3.77200  1.000 29.07000  ? 259  LYS B N     1 
ATOM   6322 C  CA    . LYS B 2 259 ? -65.03700 -65.69700 -2.78100  1.000 28.15000  ? 259  LYS B CA    1 
ATOM   6323 C  C     . LYS B 2 259 ? -64.94100 -66.90500 -1.85900  1.000 34.99000  ? 259  LYS B C     1 
ATOM   6324 O  O     . LYS B 2 259 ? -63.85600 -67.46400 -1.63700  1.000 35.08000  ? 259  LYS B O     1 
ATOM   6325 C  CB    . LYS B 2 259 ? -65.35500 -64.43600 -1.98200  1.000 25.45000  ? 259  LYS B CB    1 
ATOM   6326 C  CG    . LYS B 2 259 ? -64.64000 -63.17800 -2.46100  1.000 33.09000  ? 259  LYS B CG    1 
ATOM   6327 C  CD    . LYS B 2 259 ? -65.18100 -61.92300 -1.75200  1.000 38.93000  ? 259  LYS B CD    1 
ATOM   6328 C  CE    . LYS B 2 259 ? -64.65000 -61.78900 -0.31900  1.000 54.99000  ? 259  LYS B CE    1 
ATOM   6329 N  NZ    . LYS B 2 259 ? -65.47600 -60.87000 0.53900   1.000 53.28000  ? 259  LYS B NZ    1 
ATOM   6330 N  N     . LEU B 2 260 ? -66.10000 -67.28700 -1.33200  1.000 33.67000  ? 260  LEU B N     1 
ATOM   6331 C  CA    . LEU B 2 260 ? -66.26100 -68.51000 -0.55600  1.000 29.80000  ? 260  LEU B CA    1 
ATOM   6332 C  C     . LEU B 2 260 ? -65.58400 -69.72400 -1.18300  1.000 37.09000  ? 260  LEU B C     1 
ATOM   6333 O  O     . LEU B 2 260 ? -64.67200 -70.29800 -0.58400  1.000 38.60000  ? 260  LEU B O     1 
ATOM   6334 C  CB    . LEU B 2 260 ? -67.73100 -68.80700 -0.37900  1.000 32.39000  ? 260  LEU B CB    1 
ATOM   6335 C  CG    . LEU B 2 260 ? -68.06500 -69.98700 0.51400   1.000 37.52000  ? 260  LEU B CG    1 
ATOM   6336 C  CD1   . LEU B 2 260 ? -67.58400 -69.68800 1.92000   1.000 34.84000  ? 260  LEU B CD1   1 
ATOM   6337 C  CD2   . LEU B 2 260 ? -69.56600 -70.19300 0.47200   1.000 35.84000  ? 260  LEU B CD2   1 
ATOM   6338 N  N     . VAL B 2 261 ? -66.02100 -70.11100 -2.38300  1.000 33.27000  ? 261  VAL B N     1 
ATOM   6339 C  CA    . VAL B 2 261 ? -65.47400 -71.30200 -3.01700  1.000 29.73000  ? 261  VAL B CA    1 
ATOM   6340 C  C     . VAL B 2 261 ? -63.95600 -71.24600 -3.12900  1.000 39.28000  ? 261  VAL B C     1 
ATOM   6341 O  O     . VAL B 2 261 ? -63.28000 -72.24800 -2.92100  1.000 46.54000  ? 261  VAL B O     1 
ATOM   6342 C  CB    . VAL B 2 261 ? -66.06800 -71.52900 -4.40600  1.000 31.20000  ? 261  VAL B CB    1 
ATOM   6343 C  CG1   . VAL B 2 261 ? -65.17500 -72.44500 -5.22600  1.000 30.56000  ? 261  VAL B CG1   1 
ATOM   6344 C  CG2   . VAL B 2 261 ? -67.44500 -72.13900 -4.28100  1.000 36.33000  ? 261  VAL B CG2   1 
ATOM   6345 N  N     . GLY B 2 262 ? -63.40600 -70.07700 -3.44200  1.000 39.38000  ? 262  GLY B N     1 
ATOM   6346 C  CA    . GLY B 2 262 ? -61.96500 -69.97600 -3.59800  1.000 38.51000  ? 262  GLY B CA    1 
ATOM   6347 C  C     . GLY B 2 262 ? -61.22300 -70.12200 -2.27900  1.000 39.14000  ? 262  GLY B C     1 
ATOM   6348 O  O     . GLY B 2 262 ? -60.20900 -70.80900 -2.19800  1.000 39.54000  ? 262  GLY B O     1 
ATOM   6349 N  N     . LYS B 2 263 ? -61.73000 -69.45700 -1.24800  1.000 35.31000  ? 263  LYS B N     1 
ATOM   6350 C  CA    . LYS B 2 263 ? -61.21500 -69.64600 0.09300   1.000 38.95000  ? 263  LYS B CA    1 
ATOM   6351 C  C     . LYS B 2 263 ? -61.24400 -71.13500 0.53600   1.000 49.33000  ? 263  LYS B C     1 
ATOM   6352 O  O     . LYS B 2 263 ? -60.28700 -71.61000 1.14500   1.000 53.69000  ? 263  LYS B O     1 
ATOM   6353 C  CB    . LYS B 2 263 ? -62.00500 -68.79000 1.07100   1.000 34.17000  ? 263  LYS B CB    1 
ATOM   6354 C  CG    . LYS B 2 263 ? -61.43500 -68.77700 2.46000   1.000 41.46000  ? 263  LYS B CG    1 
ATOM   6355 C  CD    . LYS B 2 263 ? -62.33800 -67.97400 3.39600   1.000 51.78000  ? 263  LYS B CD    1 
ATOM   6356 C  CE    . LYS B 2 263 ? -61.81900 -67.95600 4.83900   1.000 44.49000  ? 263  LYS B CE    1 
ATOM   6357 N  NZ    . LYS B 2 263 ? -62.44100 -66.84600 5.61400   1.000 43.06000  ? 263  LYS B NZ    1 
ATOM   6358 N  N     . LEU B 2 264 ? -62.32800 -71.86300 0.23200   1.000 46.30000  ? 264  LEU B N     1 
ATOM   6359 C  CA    . LEU B 2 264 ? -62.44800 -73.28400 0.58700   1.000 40.30000  ? 264  LEU B CA    1 
ATOM   6360 C  C     . LEU B 2 264 ? -61.53200 -74.19100 -0.23100  1.000 41.50000  ? 264  LEU B C     1 
ATOM   6361 O  O     . LEU B 2 264 ? -61.01100 -75.18900 0.26600   1.000 42.85000  ? 264  LEU B O     1 
ATOM   6362 C  CB    . LEU B 2 264 ? -63.88100 -73.76500 0.39600   1.000 38.85000  ? 264  LEU B CB    1 
ATOM   6363 C  CG    . LEU B 2 264 ? -64.99400 -73.16200 1.23900   1.000 32.36000  ? 264  LEU B CG    1 
ATOM   6364 C  CD1   . LEU B 2 264 ? -66.28800 -73.77300 0.80600   1.000 30.83000  ? 264  LEU B CD1   1 
ATOM   6365 C  CD2   . LEU B 2 264 ? -64.74700 -73.40100 2.70700   1.000 37.05000  ? 264  LEU B CD2   1 
ATOM   6366 N  N     . ASN B 2 265 ? -61.37500 -73.86200 -1.50600  1.000 39.68000  ? 265  ASN B N     1 
ATOM   6367 C  CA    . ASN B 2 265 ? -60.49700 -74.62300 -2.37900  1.000 43.53000  ? 265  ASN B CA    1 
ATOM   6368 C  C     . ASN B 2 265 ? -59.08800 -74.64700 -1.80800  1.000 46.26000  ? 265  ASN B C     1 
ATOM   6369 O  O     . ASN B 2 265 ? -58.35500 -75.61800 -1.96600  1.000 50.02000  ? 265  ASN B O     1 
ATOM   6370 C  CB    . ASN B 2 265 ? -60.48100 -74.01800 -3.78500  1.000 44.61000  ? 265  ASN B CB    1 
ATOM   6371 C  CG    . ASN B 2 265 ? -59.73600 -74.87600 -4.78700  1.000 44.25000  ? 265  ASN B CG    1 
ATOM   6372 O  OD1   . ASN B 2 265 ? -59.97900 -76.08000 -4.89400  1.000 52.29000  ? 265  ASN B OD1   1 
ATOM   6373 N  ND2   . ASN B 2 265 ? -58.83100 -74.25700 -5.53500  1.000 40.93000  ? 265  ASN B ND2   1 
ATOM   6374 N  N     . TRP B 2 266 ? -58.71700 -73.56100 -1.14100  1.000 47.13000  ? 266  TRP B N     1 
ATOM   6375 C  CA    . TRP B 2 266 ? -57.37100 -73.42700 -0.60400  1.000 52.49000  ? 266  TRP B CA    1 
ATOM   6376 C  C     . TRP B 2 266 ? -57.31200 -74.05100 0.78500   1.000 52.47000  ? 266  TRP B C     1 
ATOM   6377 O  O     . TRP B 2 266 ? -56.38600 -74.80000 1.10800   1.000 54.42000  ? 266  TRP B O     1 
ATOM   6378 C  CB    . TRP B 2 266 ? -56.96000 -71.95100 -0.57800  1.000 51.38000  ? 266  TRP B CB    1 
ATOM   6379 C  CG    . TRP B 2 266 ? -55.86200 -71.60500 0.37200   1.000 59.17000  ? 266  TRP B CG    1 
ATOM   6380 C  CD1   . TRP B 2 266 ? -54.52900 -71.47300 0.08000   1.000 60.11000  ? 266  TRP B CD1   1 
ATOM   6381 C  CD2   . TRP B 2 266 ? -56.00200 -71.30600 1.77100   1.000 58.72000  ? 266  TRP B CD2   1 
ATOM   6382 N  NE1   . TRP B 2 266 ? -53.83200 -71.11700 1.21500   1.000 60.98000  ? 266  TRP B NE1   1 
ATOM   6383 C  CE2   . TRP B 2 266 ? -54.71000 -71.01400 2.26700   1.000 59.69000  ? 266  TRP B CE2   1 
ATOM   6384 C  CE3   . TRP B 2 266 ? -57.09300 -71.26000 2.65200   1.000 52.41000  ? 266  TRP B CE3   1 
ATOM   6385 C  CZ2   . TRP B 2 266 ? -54.48200 -70.67500 3.60500   1.000 56.32000  ? 266  TRP B CZ2   1 
ATOM   6386 C  CZ3   . TRP B 2 266 ? -56.86200 -70.92400 3.98600   1.000 56.85000  ? 266  TRP B CZ3   1 
ATOM   6387 C  CH2   . TRP B 2 266 ? -55.56800 -70.63700 4.44800   1.000 56.93000  ? 266  TRP B CH2   1 
ATOM   6388 N  N     . ALA B 2 267 ? -58.32900 -73.76800 1.58900   1.000 45.72000  ? 267  ALA B N     1 
ATOM   6389 C  CA    . ALA B 2 267 ? -58.41900 -74.33500 2.91400   1.000 44.44000  ? 267  ALA B CA    1 
ATOM   6390 C  C     . ALA B 2 267 ? -58.37000 -75.85000 2.85200   1.000 49.27000  ? 267  ALA B C     1 
ATOM   6391 O  O     . ALA B 2 267 ? -57.96900 -76.49700 3.80900   1.000 54.60000  ? 267  ALA B O     1 
ATOM   6392 C  CB    . ALA B 2 267 ? -59.68200 -73.87100 3.60500   1.000 40.29000  ? 267  ALA B CB    1 
ATOM   6393 N  N     . SER B 2 268 ? -58.75500 -76.41500 1.71500   1.000 50.27000  ? 268  SER B N     1 
ATOM   6394 C  CA    . SER B 2 268 ? -58.79600 -77.86500 1.57400   1.000 51.34000  ? 268  SER B CA    1 
ATOM   6395 C  C     . SER B 2 268 ? -57.39500 -78.47300 1.38100   1.000 52.32000  ? 268  SER B C     1 
ATOM   6396 O  O     . SER B 2 268 ? -57.24400 -79.68900 1.33500   1.000 52.65000  ? 268  SER B O     1 
ATOM   6397 C  CB    . SER B 2 268 ? -59.71400 -78.25100 0.40700   1.000 50.80000  ? 268  SER B CB    1 
ATOM   6398 O  OG    . SER B 2 268 ? -59.07600 -78.05300 -0.84400  1.000 49.73000  ? 268  SER B OG    1 
ATOM   6399 N  N     . GLN B 2 269 ? -56.37500 -77.62900 1.27100   1.000 53.89000  ? 269  GLN B N     1 
ATOM   6400 C  CA    . GLN B 2 269 ? -54.99900 -78.11700 1.25900   1.000 54.30000  ? 269  GLN B CA    1 
ATOM   6401 C  C     . GLN B 2 269 ? -54.54700 -78.40400 2.67500   1.000 54.33000  ? 269  GLN B C     1 
ATOM   6402 O  O     . GLN B 2 269 ? -53.71600 -79.26900 2.91500   1.000 58.08000  ? 269  GLN B O     1 
ATOM   6403 C  CB    . GLN B 2 269 ? -54.04800 -77.10600 0.63500   1.000 53.82000  ? 269  GLN B CB    1 
ATOM   6404 C  CG    . GLN B 2 269 ? -54.31900 -76.76300 -0.80200  1.000 51.48000  ? 269  GLN B CG    1 
ATOM   6405 C  CD    . GLN B 2 269 ? -53.55000 -75.52800 -1.21600  1.000 58.71000  ? 269  GLN B CD    1 
ATOM   6406 O  OE1   . GLN B 2 269 ? -53.80800 -74.42900 -0.71200  1.000 60.18000  ? 269  GLN B OE1   1 
ATOM   6407 N  NE2   . GLN B 2 269 ? -52.57700 -75.69800 -2.11600  1.000 58.14000  ? 269  GLN B NE2   1 
ATOM   6408 N  N     . ILE B 2 270 ? -55.08800 -77.63200 3.60700   1.000 55.15000  ? 270  ILE B N     1 
ATOM   6409 C  CA    . ILE B 2 270 ? -54.84300 -77.82700 5.02800   1.000 56.61000  ? 270  ILE B CA    1 
ATOM   6410 C  C     . ILE B 2 270 ? -55.77500 -78.90400 5.59800   1.000 61.40000  ? 270  ILE B C     1 
ATOM   6411 O  O     . ILE B 2 270 ? -55.34200 -79.79700 6.33500   1.000 63.50000  ? 270  ILE B O     1 
ATOM   6412 C  CB    . ILE B 2 270 ? -55.04500 -76.49900 5.79600   1.000 61.35000  ? 270  ILE B CB    1 
ATOM   6413 C  CG1   . ILE B 2 270 ? -53.93200 -75.50800 5.44600   1.000 57.45000  ? 270  ILE B CG1   1 
ATOM   6414 C  CG2   . ILE B 2 270 ? -55.13900 -76.73300 7.30100   1.000 59.76000  ? 270  ILE B CG2   1 
ATOM   6415 C  CD1   . ILE B 2 270 ? -54.17000 -74.12300 5.99400   1.000 55.31000  ? 270  ILE B CD1   1 
ATOM   6416 N  N     . TYR B 2 271 ? -57.05800 -78.80900 5.23900   1.000 59.36000  ? 271  TYR B N     1 
ATOM   6417 C  CA    . TYR B 2 271 ? -58.08800 -79.73300 5.70400   1.000 56.56000  ? 271  TYR B CA    1 
ATOM   6418 C  C     . TYR B 2 271 ? -58.70600 -80.52600 4.56600   1.000 56.31000  ? 271  TYR B C     1 
ATOM   6419 O  O     . TYR B 2 271 ? -59.72100 -80.10700 4.01600   1.000 56.69000  ? 271  TYR B O     1 
ATOM   6420 C  CB    . TYR B 2 271 ? -59.21300 -78.98300 6.40900   1.000 57.21000  ? 271  TYR B CB    1 
ATOM   6421 C  CG    . TYR B 2 271 ? -58.77800 -78.08500 7.52700   1.000 64.22000  ? 271  TYR B CG    1 
ATOM   6422 C  CD1   . TYR B 2 271 ? -58.62300 -78.57800 8.81500   1.000 68.15000  ? 271  TYR B CD1   1 
ATOM   6423 C  CD2   . TYR B 2 271 ? -58.55200 -76.73300 7.30900   1.000 62.04000  ? 271  TYR B CD2   1 
ATOM   6424 C  CE1   . TYR B 2 271 ? -58.24200 -77.75900 9.84900   1.000 70.86000  ? 271  TYR B CE1   1 
ATOM   6425 C  CE2   . TYR B 2 271 ? -58.17200 -75.90500 8.33900   1.000 65.04000  ? 271  TYR B CE2   1 
ATOM   6426 C  CZ    . TYR B 2 271 ? -58.01800 -76.42500 9.60800   1.000 68.16000  ? 271  TYR B CZ    1 
ATOM   6427 O  OH    . TYR B 2 271 ? -57.64000 -75.61000 10.64500  1.000 75.95000  ? 271  TYR B OH    1 
ATOM   6428 N  N     . PRO B 2 272 ? -58.12100 -81.68500 4.23000   1.000 57.59000  ? 272  PRO B N     1 
ATOM   6429 C  CA    . PRO B 2 272 ? -58.62800 -82.48200 3.11000   1.000 56.43000  ? 272  PRO B CA    1 
ATOM   6430 C  C     . PRO B 2 272 ? -60.12300 -82.79400 3.22600   1.000 56.82000  ? 272  PRO B C     1 
ATOM   6431 O  O     . PRO B 2 272 ? -60.75800 -83.14600 2.23300   1.000 58.69000  ? 272  PRO B O     1 
ATOM   6432 C  CB    . PRO B 2 272 ? -57.78800 -83.75800 3.18900   1.000 62.12000  ? 272  PRO B CB    1 
ATOM   6433 C  CG    . PRO B 2 272 ? -56.50800 -83.31100 3.83800   1.000 56.15000  ? 272  PRO B CG    1 
ATOM   6434 C  CD    . PRO B 2 272 ? -56.94100 -82.30700 4.85900   1.000 58.40000  ? 272  PRO B CD    1 
ATOM   6435 N  N     . GLY B 2 273 ? -60.68100 -82.64500 4.42400   1.000 56.42000  ? 273  GLY B N     1 
ATOM   6436 C  CA    . GLY B 2 273 ? -62.10800 -82.83600 4.60400   1.000 57.74000  ? 273  GLY B CA    1 
ATOM   6437 C  C     . GLY B 2 273 ? -62.99100 -81.91800 3.76800   1.000 62.88000  ? 273  GLY B C     1 
ATOM   6438 O  O     . GLY B 2 273 ? -64.12200 -82.28300 3.43000   1.000 65.94000  ? 273  GLY B O     1 
ATOM   6439 N  N     . ILE B 2 274 ? -62.47700 -80.73200 3.43000   1.000 61.53000  ? 274  ILE B N     1 
ATOM   6440 C  CA    . ILE B 2 274 ? -63.27700 -79.67100 2.80400   1.000 55.90000  ? 274  ILE B CA    1 
ATOM   6441 C  C     . ILE B 2 274 ? -63.85300 -80.06800 1.45200   1.000 56.85000  ? 274  ILE B C     1 
ATOM   6442 O  O     . ILE B 2 274 ? -63.17500 -80.69200 0.64100   1.000 59.32000  ? 274  ILE B O     1 
ATOM   6443 C  CB    . ILE B 2 274 ? -62.45400 -78.38200 2.60100   1.000 55.69000  ? 274  ILE B CB    1 
ATOM   6444 C  CG1   . ILE B 2 274 ? -61.90900 -77.86800 3.92900   1.000 50.84000  ? 274  ILE B CG1   1 
ATOM   6445 C  CG2   . ILE B 2 274 ? -63.31500 -77.31000 1.95700   1.000 50.97000  ? 274  ILE B CG2   1 
ATOM   6446 C  CD1   . ILE B 2 274 ? -62.96200 -77.26700 4.81900   1.000 50.44000  ? 274  ILE B CD1   1 
ATOM   6447 N  N     . LYS B 2 275 ? -65.10100 -79.67800 1.21100   1.000 53.92000  ? 275  LYS B N     1 
ATOM   6448 C  CA    . LYS B 2 275 ? -65.80500 -80.04500 -0.01600  1.000 59.34000  ? 275  LYS B CA    1 
ATOM   6449 C  C     . LYS B 2 275 ? -66.39800 -78.80100 -0.68700  1.000 58.54000  ? 275  LYS B C     1 
ATOM   6450 O  O     . LYS B 2 275 ? -66.74200 -77.84200 -0.00400  1.000 58.22000  ? 275  LYS B O     1 
ATOM   6451 C  CB    . LYS B 2 275 ? -66.90100 -81.07300 0.29900   1.000 67.90000  ? 275  LYS B CB    1 
ATOM   6452 C  CG    . LYS B 2 275 ? -67.82800 -80.67200 1.47600   1.000 73.54000  ? 275  LYS B CG    1 
ATOM   6453 C  CD    . LYS B 2 275 ? -68.89100 -81.74800 1.79000   1.000 76.16000  ? 275  LYS B CD    1 
ATOM   6454 C  CE    . LYS B 2 275 ? -68.27400 -83.03100 2.38400   1.000 81.87000  ? 275  LYS B CE    1 
ATOM   6455 N  NZ    . LYS B 2 275 ? -69.18000 -84.23000 2.30600   1.000 65.70000  ? 275  LYS B NZ    1 
ATOM   6456 N  N     . VAL B 2 276 ? -66.53100 -78.81800 -2.01100  1.000 52.75000  ? 276  VAL B N     1 
ATOM   6457 C  CA    . VAL B 2 276 ? -66.86300 -77.59100 -2.73500  1.000 53.56000  ? 276  VAL B CA    1 
ATOM   6458 C  C     . VAL B 2 276 ? -67.88400 -77.76000 -3.87500  1.000 56.71000  ? 276  VAL B C     1 
ATOM   6459 O  O     . VAL B 2 276 ? -68.42800 -76.78000 -4.39500  1.000 53.46000  ? 276  VAL B O     1 
ATOM   6460 C  CB    . VAL B 2 276 ? -65.56600 -76.96100 -3.31100  1.000 44.60000  ? 276  VAL B CB    1 
ATOM   6461 C  CG1   . VAL B 2 276 ? -65.64500 -76.82900 -4.82800  1.000 45.88000  ? 276  VAL B CG1   1 
ATOM   6462 C  CG2   . VAL B 2 276 ? -65.28400 -75.62900 -2.65000  1.000 38.54000  ? 276  VAL B CG2   1 
ATOM   6463 N  N     . ARG B 2 277 ? -68.16100 -79.00300 -4.24600  1.000 60.75000  ? 277  ARG B N     1 
ATOM   6464 C  CA    . ARG B 2 277 ? -68.92700 -79.27500 -5.46000  1.000 58.55000  ? 277  ARG B CA    1 
ATOM   6465 C  C     . ARG B 2 277 ? -70.33400 -78.67500 -5.48300  1.000 48.86000  ? 277  ARG B C     1 
ATOM   6466 O  O     . ARG B 2 277 ? -70.72300 -78.08400 -6.47100  1.000 51.10000  ? 277  ARG B O     1 
ATOM   6467 C  CB    . ARG B 2 277 ? -69.01500 -80.78600 -5.69500  1.000 58.87000  ? 277  ARG B CB    1 
ATOM   6468 C  CG    . ARG B 2 277 ? -67.90600 -81.32800 -6.59400  1.000 62.94000  ? 277  ARG B CG    1 
ATOM   6469 C  CD    . ARG B 2 277 ? -68.10200 -82.81200 -6.91000  1.000 67.97000  ? 277  ARG B CD    1 
ATOM   6470 N  NE    . ARG B 2 277 ? -67.43200 -83.20200 -8.15200  1.000 69.76000  ? 277  ARG B NE    1 
ATOM   6471 C  CZ    . ARG B 2 277 ? -67.98300 -83.97600 -9.09000  1.000 71.21000  ? 277  ARG B CZ    1 
ATOM   6472 N  NH1   . ARG B 2 277 ? -69.21600 -84.45300 -8.92900  1.000 66.47000  ? 277  ARG B NH1   1 
ATOM   6473 N  NH2   . ARG B 2 277 ? -67.30100 -84.27500 -10.19300 1.000 70.65000  ? 277  ARG B NH2   1 
ATOM   6474 N  N     . GLN B 2 278 ? -71.10400 -78.82400 -4.41700  1.000 51.86000  ? 278  GLN B N     1 
ATOM   6475 C  CA    . GLN B 2 278 ? -72.48400 -78.34200 -4.46600  1.000 56.47000  ? 278  GLN B CA    1 
ATOM   6476 C  C     . GLN B 2 278 ? -72.58400 -76.81500 -4.52500  1.000 55.89000  ? 278  GLN B C     1 
ATOM   6477 O  O     . GLN B 2 278 ? -73.53800 -76.28000 -5.08300  1.000 55.36000  ? 278  GLN B O     1 
ATOM   6478 C  CB    . GLN B 2 278 ? -73.28600 -78.86300 -3.26000  1.000 59.88000  ? 278  GLN B CB    1 
ATOM   6479 C  CG    . GLN B 2 278 ? -73.57000 -80.36300 -3.29300  1.000 61.47000  ? 278  GLN B CG    1 
ATOM   6480 C  CD    . GLN B 2 278 ? -74.13400 -80.84700 -4.62900  1.000 65.66000  ? 278  GLN B CD    1 
ATOM   6481 O  OE1   . GLN B 2 278 ? -75.25700 -80.50100 -5.01900  1.000 61.58000  ? 278  GLN B OE1   1 
ATOM   6482 N  NE2   . GLN B 2 278 ? -73.34900 -81.65700 -5.33300  1.000 64.22000  ? 278  GLN B NE2   1 
ATOM   6483 N  N     . LEU B 2 279 ? -71.60800 -76.12000 -3.93800  1.000 58.15000  ? 279  LEU B N     1 
ATOM   6484 C  CA    . LEU B 2 279 ? -71.59100 -74.65300 -3.93900  1.000 51.34000  ? 279  LEU B CA    1 
ATOM   6485 C  C     . LEU B 2 279 ? -71.16700 -74.14700 -5.29800  1.000 48.06000  ? 279  LEU B C     1 
ATOM   6486 O  O     . LEU B 2 279 ? -71.69400 -73.15900 -5.80600  1.000 48.06000  ? 279  LEU B O     1 
ATOM   6487 C  CB    . LEU B 2 279 ? -70.64000 -74.11000 -2.87700  1.000 45.95000  ? 279  LEU B CB    1 
ATOM   6488 C  CG    . LEU B 2 279 ? -71.11900 -74.15700 -1.43400  1.000 44.44000  ? 279  LEU B CG    1 
ATOM   6489 C  CD1   . LEU B 2 279 ? -69.94400 -74.28900 -0.48500  1.000 46.43000  ? 279  LEU B CD1   1 
ATOM   6490 C  CD2   . LEU B 2 279 ? -71.91600 -72.91400 -1.13400  1.000 39.09000  ? 279  LEU B CD2   1 
ATOM   6491 N  N     . SER B 2 280 ? -70.19900 -74.83500 -5.87800  1.000 44.58000  ? 280  SER B N     1 
ATOM   6492 C  CA    . SER B 2 280 ? -69.72400 -74.46000 -7.18300  1.000 45.95000  ? 280  SER B CA    1 
ATOM   6493 C  C     . SER B 2 280 ? -70.82100 -74.64900 -8.22700  1.000 50.52000  ? 280  SER B C     1 
ATOM   6494 O  O     . SER B 2 280 ? -70.80200 -73.98700 -9.26000  1.000 59.39000  ? 280  SER B O     1 
ATOM   6495 C  CB    . SER B 2 280 ? -68.48500 -75.26900 -7.54600  1.000 49.83000  ? 280  SER B CB    1 
ATOM   6496 O  OG    . SER B 2 280 ? -68.01300 -74.91600 -8.83300  1.000 53.39000  ? 280  SER B OG    1 
ATOM   6497 N  N     . LYS B 2 281 ? -71.78500 -75.53200 -7.95700  1.000 49.87000  ? 281  LYS B N     1 
ATOM   6498 C  CA    . LYS B 2 281 ? -72.88000 -75.77300 -8.90500  1.000 56.45000  ? 281  LYS B CA    1 
ATOM   6499 C  C     . LYS B 2 281 ? -73.82000 -74.57500 -9.03000  1.000 54.12000  ? 281  LYS B C     1 
ATOM   6500 O  O     . LYS B 2 281 ? -74.49700 -74.42200 -10.04800 1.000 55.41000  ? 281  LYS B O     1 
ATOM   6501 C  CB    . LYS B 2 281 ? -73.69800 -77.00800 -8.51100  1.000 58.68000  ? 281  LYS B CB    1 
ATOM   6502 C  CG    . LYS B 2 281 ? -73.36000 -78.27400 -9.28400  1.000 62.44000  ? 281  LYS B CG    1 
ATOM   6503 C  CD    . LYS B 2 281 ? -74.31500 -79.42100 -8.94000  1.000 72.05000  ? 281  LYS B CD    1 
ATOM   6504 C  CE    . LYS B 2 281 ? -73.91100 -80.71600 -9.65900  1.000 78.37000  ? 281  LYS B CE    1 
ATOM   6505 N  NZ    . LYS B 2 281 ? -74.97000 -81.24200 -10.58000 1.000 76.03000  ? 281  LYS B NZ    1 
ATOM   6506 N  N     . LEU B 2 282 ? -73.88100 -73.74600 -7.99000  1.000 46.66000  ? 282  LEU B N     1 
ATOM   6507 C  CA    . LEU B 2 282 ? -74.69000 -72.53300 -8.03300  1.000 47.63000  ? 282  LEU B CA    1 
ATOM   6508 C  C     . LEU B 2 282 ? -74.09200 -71.50000 -9.01300  1.000 54.07000  ? 282  LEU B C     1 
ATOM   6509 O  O     . LEU B 2 282 ? -74.78300 -70.61900 -9.54300  1.000 50.32000  ? 282  LEU B O     1 
ATOM   6510 C  CB    . LEU B 2 282 ? -74.80400 -71.93300 -6.63500  1.000 48.79000  ? 282  LEU B CB    1 
ATOM   6511 C  CG    . LEU B 2 282 ? -75.14100 -72.87400 -5.47200  1.000 49.91000  ? 282  LEU B CG    1 
ATOM   6512 C  CD1   . LEU B 2 282 ? -74.74500 -72.23000 -4.14200  1.000 43.15000  ? 282  LEU B CD1   1 
ATOM   6513 C  CD2   . LEU B 2 282 ? -76.62500 -73.23600 -5.46200  1.000 49.78000  ? 282  LEU B CD2   1 
ATOM   6514 N  N     . LEU B 2 283 ? -72.78900 -71.61100 -9.24300  1.000 53.06000  ? 283  LEU B N     1 
ATOM   6515 C  CA    . LEU B 2 283 ? -72.11500 -70.75900 -10.20700 1.000 48.92000  ? 283  LEU B CA    1 
ATOM   6516 C  C     . LEU B 2 283 ? -72.07700 -71.48800 -11.53700 1.000 57.75000  ? 283  LEU B C     1 
ATOM   6517 O  O     . LEU B 2 283 ? -71.03000 -71.57000 -12.19300 1.000 61.48000  ? 283  LEU B O     1 
ATOM   6518 C  CB    . LEU B 2 283 ? -70.70000 -70.41700 -9.74100  1.000 47.68000  ? 283  LEU B CB    1 
ATOM   6519 C  CG    . LEU B 2 283 ? -70.65500 -69.85800 -8.32100  1.000 43.96000  ? 283  LEU B CG    1 
ATOM   6520 C  CD1   . LEU B 2 283 ? -69.22200 -69.65300 -7.88700  1.000 40.39000  ? 283  LEU B CD1   1 
ATOM   6521 C  CD2   . LEU B 2 283 ? -71.45600 -68.56800 -8.23000  1.000 30.33000  ? 283  LEU B CD2   1 
ATOM   6522 N  N     . ARG B 2 284 ? -73.21700 -72.05900 -11.91400 1.000 54.55000  ? 284  ARG B N     1 
ATOM   6523 C  CA    . ARG B 2 284 ? -73.35900 -72.59700 -13.25000 1.000 57.04000  ? 284  ARG B CA    1 
ATOM   6524 C  C     . ARG B 2 284 ? -73.87800 -71.49500 -14.14400 1.000 57.05000  ? 284  ARG B C     1 
ATOM   6525 O  O     . ARG B 2 284 ? -74.85800 -70.82000 -13.82200 1.000 56.86000  ? 284  ARG B O     1 
ATOM   6526 C  CB    . ARG B 2 284 ? -74.28900 -73.80900 -13.28000 1.000 57.28000  ? 284  ARG B CB    1 
ATOM   6527 C  CG    . ARG B 2 284 ? -73.57900 -75.12400 -13.02500 1.000 57.29000  ? 284  ARG B CG    1 
ATOM   6528 C  CD    . ARG B 2 284 ? -74.24900 -76.25700 -13.76700 1.000 63.85000  ? 284  ARG B CD    1 
ATOM   6529 N  NE    . ARG B 2 284 ? -73.44700 -77.47400 -13.70300 1.000 72.54000  ? 284  ARG B NE    1 
ATOM   6530 C  CZ    . ARG B 2 284 ? -73.72900 -78.51700 -12.92500 1.000 76.22000  ? 284  ARG B CZ    1 
ATOM   6531 N  NH1   . ARG B 2 284 ? -74.80900 -78.49500 -12.15000 1.000 71.62000  ? 284  ARG B NH1   1 
ATOM   6532 N  NH2   . ARG B 2 284 ? -72.93500 -79.58600 -12.92600 1.000 77.39000  ? 284  ARG B NH2   1 
ATOM   6533 N  N     . GLY B 2 285 ? -73.21200 -71.31200 -15.27200 1.000 50.58000  ? 285  GLY B N     1 
ATOM   6534 C  CA    . GLY B 2 285 ? -73.59400 -70.25400 -16.17900 1.000 43.08000  ? 285  GLY B CA    1 
ATOM   6535 C  C     . GLY B 2 285 ? -72.61500 -69.11300 -16.00500 1.000 47.41000  ? 285  GLY B C     1 
ATOM   6536 O  O     . GLY B 2 285 ? -71.59700 -69.24200 -15.31100 1.000 47.68000  ? 285  GLY B O     1 
ATOM   6537 N  N     . THR B 2 286 ? -72.92800 -67.99400 -16.64000 1.000 37.70000  ? 286  THR B N     1 
ATOM   6538 C  CA    . THR B 2 286 ? -72.08600 -66.82100 -16.57200 1.000 30.40000  ? 286  THR B CA    1 
ATOM   6539 C  C     . THR B 2 286 ? -72.95900 -65.63100 -16.15000 1.000 31.40000  ? 286  THR B C     1 
ATOM   6540 O  O     . THR B 2 286 ? -73.76400 -65.14500 -16.92500 1.000 33.28000  ? 286  THR B O     1 
ATOM   6541 C  CB    . THR B 2 286 ? -71.37500 -66.58000 -17.92800 1.000 27.70000  ? 286  THR B CB    1 
ATOM   6542 O  OG1   . THR B 2 286 ? -71.35700 -65.18500 -18.23100 1.000 30.59000  ? 286  THR B OG1   1 
ATOM   6543 C  CG2   . THR B 2 286 ? -72.08400 -67.30400 -19.04100 1.000 39.91000  ? 286  THR B CG2   1 
ATOM   6544 N  N     . LYS B 2 287 ? -72.78800 -65.18100 -14.91200 1.000 31.26000  ? 287  LYS B N     1 
ATOM   6545 C  CA    . LYS B 2 287 ? -73.75500 -64.29800 -14.25400 1.000 30.22000  ? 287  LYS B CA    1 
ATOM   6546 C  C     . LYS B 2 287 ? -73.16000 -63.01200 -13.65300 1.000 29.92000  ? 287  LYS B C     1 
ATOM   6547 O  O     . LYS B 2 287 ? -71.96500 -62.92500 -13.36600 1.000 29.69000  ? 287  LYS B O     1 
ATOM   6548 C  CB    . LYS B 2 287 ? -74.46800 -65.06600 -13.13200 1.000 31.40000  ? 287  LYS B CB    1 
ATOM   6549 C  CG    . LYS B 2 287 ? -75.09800 -66.36900 -13.54900 1.000 35.09000  ? 287  LYS B CG    1 
ATOM   6550 C  CD    . LYS B 2 287 ? -75.55400 -67.15600 -12.32900 1.000 38.94000  ? 287  LYS B CD    1 
ATOM   6551 C  CE    . LYS B 2 287 ? -77.06600 -67.31900 -12.30200 1.000 50.30000  ? 287  LYS B CE    1 
ATOM   6552 N  NZ    . LYS B 2 287 ? -77.56100 -68.15300 -13.43500 1.000 47.71000  ? 287  LYS B NZ    1 
ATOM   6553 N  N     . ALA B 2 288 ? -74.01900 -62.02500 -13.42900 1.000 26.97000  ? 288  ALA B N     1 
ATOM   6554 C  CA    . ALA B 2 288 ? -73.60200 -60.77900 -12.79000 1.000 25.41000  ? 288  ALA B CA    1 
ATOM   6555 C  C     . ALA B 2 288 ? -73.02300 -61.03200 -11.40500 1.000 23.25000  ? 288  ALA B C     1 
ATOM   6556 O  O     . ALA B 2 288 ? -73.56900 -61.82400 -10.65100 1.000 31.22000  ? 288  ALA B O     1 
ATOM   6557 C  CB    . ALA B 2 288 ? -74.77300 -59.83600 -12.68800 1.000 24.16000  ? 288  ALA B CB    1 
ATOM   6558 N  N     . LEU B 2 289 ? -71.94300 -60.34400 -11.04900 1.000 21.97000  ? 289  LEU B N     1 
ATOM   6559 C  CA    . LEU B 2 289 ? -71.38900 -60.51000 -9.70400  1.000 20.04000  ? 289  LEU B CA    1 
ATOM   6560 C  C     . LEU B 2 289 ? -72.39100 -60.18600 -8.60900  1.000 22.81000  ? 289  LEU B C     1 
ATOM   6561 O  O     . LEU B 2 289 ? -72.30600 -60.77400 -7.54600  1.000 29.06000  ? 289  LEU B O     1 
ATOM   6562 C  CB    . LEU B 2 289 ? -70.14000 -59.65100 -9.51000  1.000 18.57000  ? 289  LEU B CB    1 
ATOM   6563 C  CG    . LEU B 2 289 ? -68.80000 -60.38600 -9.61000  1.000 18.41000  ? 289  LEU B CG    1 
ATOM   6564 C  CD1   . LEU B 2 289 ? -68.82300 -61.36400 -10.71400 1.000 19.88000  ? 289  LEU B CD1   1 
ATOM   6565 C  CD2   . LEU B 2 289 ? -67.67500 -59.43100 -9.87900  1.000 21.32000  ? 289  LEU B CD2   1 
ATOM   6566 N  N     . THR B 2 290 ? -73.34800 -59.28700 -8.83700  1.000 23.82000  ? 290  THR B N     1 
ATOM   6567 C  CA    . THR B 2 290 ? -74.21700 -58.88600 -7.72300  1.000 24.28000  ? 290  THR B CA    1 
ATOM   6568 C  C     . THR B 2 290 ? -75.57400 -59.57500 -7.73800  1.000 25.53000  ? 290  THR B C     1 
ATOM   6569 O  O     . THR B 2 290 ? -76.47200 -59.21100 -6.97100  1.000 25.61000  ? 290  THR B O     1 
ATOM   6570 C  CB    . THR B 2 290 ? -74.47400 -57.36600 -7.68800  1.000 23.77000  ? 290  THR B CB    1 
ATOM   6571 O  OG1   . THR B 2 290 ? -75.16800 -56.97600 -8.88000  1.000 26.47000  ? 290  THR B OG1   1 
ATOM   6572 C  CG2   . THR B 2 290 ? -73.17800 -56.58300 -7.57200  1.000 23.32000  ? 290  THR B CG2   1 
ATOM   6573 N  N     . GLU B 2 291 ? -75.72700 -60.56900 -8.59800  1.000 23.84000  ? 291  GLU B N     1 
ATOM   6574 C  CA    . GLU B 2 291 ? -76.94900 -61.35900 -8.57800  1.000 30.87000  ? 291  GLU B CA    1 
ATOM   6575 C  C     . GLU B 2 291 ? -77.04500 -62.21800 -7.30800  1.000 35.22000  ? 291  GLU B C     1 
ATOM   6576 O  O     . GLU B 2 291 ? -76.12200 -62.98000 -6.98700  1.000 37.88000  ? 291  GLU B O     1 
ATOM   6577 C  CB    . GLU B 2 291 ? -77.02300 -62.24700 -9.81500  1.000 28.88000  ? 291  GLU B CB    1 
ATOM   6578 C  CG    . GLU B 2 291 ? -78.05600 -63.33600 -9.69400  1.000 37.99000  ? 291  GLU B CG    1 
ATOM   6579 C  CD    . GLU B 2 291 ? -78.44000 -63.92700 -11.03800 1.000 49.76000  ? 291  GLU B CD    1 
ATOM   6580 O  OE1   . GLU B 2 291 ? -79.09700 -64.99800 -11.04700 1.000 52.45000  ? 291  GLU B OE1   1 
ATOM   6581 O  OE2   . GLU B 2 291 ? -78.09500 -63.31900 -12.08200 1.000 51.43000  ? 291  GLU B OE2   1 
ATOM   6582 N  N     . VAL B 2 292 ? -78.14200 -62.10500 -6.57200  1.000 28.45000  ? 292  VAL B N     1 
ATOM   6583 C  CA    . VAL B 2 292 ? -78.25700 -62.93800 -5.39300  1.000 32.09000  ? 292  VAL B CA    1 
ATOM   6584 C  C     . VAL B 2 292 ? -78.69600 -64.32200 -5.80600  1.000 39.35000  ? 292  VAL B C     1 
ATOM   6585 O  O     . VAL B 2 292 ? -79.51500 -64.49200 -6.70600  1.000 43.48000  ? 292  VAL B O     1 
ATOM   6586 C  CB    . VAL B 2 292 ? -79.25100 -62.39800 -4.34500  1.000 33.62000  ? 292  VAL B CB    1 
ATOM   6587 C  CG1   . VAL B 2 292 ? -79.32300 -60.89500 -4.40900  1.000 32.61000  ? 292  VAL B CG1   1 
ATOM   6588 C  CG2   . VAL B 2 292 ? -80.59600 -63.01100 -4.55200  1.000 38.65000  ? 292  VAL B CG2   1 
ATOM   6589 N  N     . ILE B 2 293 ? -78.13300 -65.31200 -5.13300  1.000 43.32000  ? 293  ILE B N     1 
ATOM   6590 C  CA    . ILE B 2 293 ? -78.44100 -66.69100 -5.43100  1.000 44.63000  ? 293  ILE B CA    1 
ATOM   6591 C  C     . ILE B 2 293 ? -78.90700 -67.43100 -4.18100  1.000 47.05000  ? 293  ILE B C     1 
ATOM   6592 O  O     . ILE B 2 293 ? -78.20800 -67.47700 -3.16800  1.000 40.90000  ? 293  ILE B O     1 
ATOM   6593 C  CB    . ILE B 2 293 ? -77.24000 -67.38400 -6.03200  1.000 40.59000  ? 293  ILE B CB    1 
ATOM   6594 C  CG1   . ILE B 2 293 ? -76.96500 -66.77400 -7.40600  1.000 39.24000  ? 293  ILE B CG1   1 
ATOM   6595 C  CG2   . ILE B 2 293 ? -77.50500 -68.86300 -6.13300  1.000 46.51000  ? 293  ILE B CG2   1 
ATOM   6596 C  CD1   . ILE B 2 293 ? -75.98100 -67.55200 -8.23200  1.000 39.90000  ? 293  ILE B CD1   1 
ATOM   6597 N  N     . PRO B 2 294 ? -80.12200 -67.98800 -4.24600  1.000 49.82000  ? 294  PRO B N     1 
ATOM   6598 C  CA    . PRO B 2 294 ? -80.66600 -68.77500 -3.14200  1.000 46.62000  ? 294  PRO B CA    1 
ATOM   6599 C  C     . PRO B 2 294 ? -79.89600 -70.07200 -3.01800  1.000 48.62000  ? 294  PRO B C     1 
ATOM   6600 O  O     . PRO B 2 294 ? -79.73000 -70.75800 -4.02800  1.000 53.73000  ? 294  PRO B O     1 
ATOM   6601 C  CB    . PRO B 2 294 ? -82.09700 -69.03200 -3.58200  1.000 47.82000  ? 294  PRO B CB    1 
ATOM   6602 C  CG    . PRO B 2 294 ? -81.98600 -69.09800 -5.07100  1.000 47.30000  ? 294  PRO B CG    1 
ATOM   6603 C  CD    . PRO B 2 294 ? -81.01100 -68.00900 -5.41900  1.000 46.44000  ? 294  PRO B CD    1 
ATOM   6604 N  N     . LEU B 2 295 ? -79.42600 -70.39300 -1.81700  1.000 49.66000  ? 295  LEU B N     1 
ATOM   6605 C  CA    . LEU B 2 295 ? -78.66400 -71.61600 -1.60700  1.000 48.35000  ? 295  LEU B CA    1 
ATOM   6606 C  C     . LEU B 2 295 ? -79.57900 -72.83600 -1.64700  1.000 55.61000  ? 295  LEU B C     1 
ATOM   6607 O  O     . LEU B 2 295 ? -80.56300 -72.90300 -0.90000  1.000 57.39000  ? 295  LEU B O     1 
ATOM   6608 C  CB    . LEU B 2 295 ? -77.91400 -71.55700 -0.27400  1.000 51.69000  ? 295  LEU B CB    1 
ATOM   6609 C  CG    . LEU B 2 295 ? -76.68100 -70.64800 -0.18400  1.000 48.10000  ? 295  LEU B CG    1 
ATOM   6610 C  CD1   . LEU B 2 295 ? -76.01300 -70.78100 1.17200   1.000 43.76000  ? 295  LEU B CD1   1 
ATOM   6611 C  CD2   . LEU B 2 295 ? -75.69400 -70.95300 -1.30000  1.000 43.77000  ? 295  LEU B CD2   1 
ATOM   6612 N  N     . THR B 2 296 ? -79.26500 -73.78900 -2.52800  1.000 55.74000  ? 296  THR B N     1 
ATOM   6613 C  CA    . THR B 2 296 ? -79.95300 -75.08000 -2.53100  1.000 54.87000  ? 296  THR B CA    1 
ATOM   6614 C  C     . THR B 2 296 ? -79.71300 -75.75700 -1.18200  1.000 62.62000  ? 296  THR B C     1 
ATOM   6615 O  O     . THR B 2 296 ? -78.79200 -75.37300 -0.45300  1.000 65.23000  ? 296  THR B O     1 
ATOM   6616 C  CB    . THR B 2 296 ? -79.47600 -75.98800 -3.67800  1.000 45.24000  ? 296  THR B CB    1 
ATOM   6617 O  OG1   . THR B 2 296 ? -78.08900 -76.32500 -3.50400  1.000 49.36000  ? 296  THR B OG1   1 
ATOM   6618 C  CG2   . THR B 2 296 ? -79.64900 -75.28100 -4.98200  1.000 43.68000  ? 296  THR B CG2   1 
ATOM   6619 N  N     . GLU B 2 297 ? -80.52600 -76.74800 -0.83200  1.000 66.75000  ? 297  GLU B N     1 
ATOM   6620 C  CA    . GLU B 2 297 ? -80.37800 -77.35100 0.49400   1.000 71.43000  ? 297  GLU B CA    1 
ATOM   6621 C  C     . GLU B 2 297 ? -79.11000 -78.22000 0.56300   1.000 68.87000  ? 297  GLU B C     1 
ATOM   6622 O  O     . GLU B 2 297 ? -78.48800 -78.31600 1.62500   1.000 64.60000  ? 297  GLU B O     1 
ATOM   6623 C  CB    . GLU B 2 297 ? -81.63300 -78.15000 0.88600   1.000 73.59000  ? 297  GLU B CB    1 
ATOM   6624 C  CG    . GLU B 2 297 ? -81.63700 -79.62600 0.51100   1.000 78.18000  ? 297  GLU B CG    1 
ATOM   6625 C  CD    . GLU B 2 297 ? -82.88400 -80.33900 1.02500   1.000 90.38000  ? 297  GLU B CD    1 
ATOM   6626 O  OE1   . GLU B 2 297 ? -82.83800 -80.90100 2.14500   1.000 93.21000  ? 297  GLU B OE1   1 
ATOM   6627 O  OE2   . GLU B 2 297 ? -83.91500 -80.32600 0.31600   1.000 92.05000  ? 297  GLU B OE2   1 
ATOM   6628 N  N     . GLU B 2 298 ? -78.70600 -78.81600 -0.55900  1.000 60.26000  ? 298  GLU B N     1 
ATOM   6629 C  CA    . GLU B 2 298 ? -77.43200 -79.53500 -0.59300  1.000 64.48000  ? 298  GLU B CA    1 
ATOM   6630 C  C     . GLU B 2 298 ? -76.26600 -78.60100 -0.26300  1.000 69.60000  ? 298  GLU B C     1 
ATOM   6631 O  O     . GLU B 2 298 ? -75.51800 -78.82600 0.70000   1.000 66.72000  ? 298  GLU B O     1 
ATOM   6632 C  CB    . GLU B 2 298 ? -77.19400 -80.18200 -1.95800  1.000 63.95000  ? 298  GLU B CB    1 
ATOM   6633 C  CG    . GLU B 2 298 ? -78.01700 -81.41900 -2.21400  1.000 70.49000  ? 298  GLU B CG    1 
ATOM   6634 C  CD    . GLU B 2 298 ? -79.41400 -81.09000 -2.68500  1.000 77.49000  ? 298  GLU B CD    1 
ATOM   6635 O  OE1   . GLU B 2 298 ? -79.65500 -79.91500 -3.05200  1.000 71.53000  ? 298  GLU B OE1   1 
ATOM   6636 O  OE2   . GLU B 2 298 ? -80.26800 -82.00700 -2.69100  1.000 79.47000  ? 298  GLU B OE2   1 
ATOM   6637 N  N     . ALA B 2 299 ? -76.11400 -77.56000 -1.08400  1.000 67.80000  ? 299  ALA B N     1 
ATOM   6638 C  CA    . ALA B 2 299 ? -75.08000 -76.55600 -0.88100  1.000 58.16000  ? 299  ALA B CA    1 
ATOM   6639 C  C     . ALA B 2 299 ? -75.20600 -75.94600 0.50400   1.000 55.01000  ? 299  ALA B C     1 
ATOM   6640 O  O     . ALA B 2 299 ? -74.20700 -75.64100 1.15300   1.000 55.02000  ? 299  ALA B O     1 
ATOM   6641 C  CB    . ALA B 2 299 ? -75.17400 -75.48800 -1.93700  1.000 58.78000  ? 299  ALA B CB    1 
ATOM   6642 N  N     . GLU B 2 300 ? -76.43800 -75.77600 0.96000   1.000 57.54000  ? 300  GLU B N     1 
ATOM   6643 C  CA    . GLU B 2 300 ? -76.65700 -75.31700 2.32200   1.000 62.12000  ? 300  GLU B CA    1 
ATOM   6644 C  C     . GLU B 2 300 ? -76.11200 -76.35800 3.29500   1.000 62.32000  ? 300  GLU B C     1 
ATOM   6645 O  O     . GLU B 2 300 ? -75.57400 -76.02400 4.35000   1.000 57.52000  ? 300  GLU B O     1 
ATOM   6646 C  CB    . GLU B 2 300 ? -78.13800 -75.06300 2.58300   1.000 59.96000  ? 300  GLU B CB    1 
ATOM   6647 C  CG    . GLU B 2 300 ? -78.41200 -74.43200 3.92700   1.000 62.93000  ? 300  GLU B CG    1 
ATOM   6648 C  CD    . GLU B 2 300 ? -78.19200 -72.93200 3.91900   1.000 70.52000  ? 300  GLU B CD    1 
ATOM   6649 O  OE1   . GLU B 2 300 ? -79.10300 -72.20200 3.45800   1.000 75.26000  ? 300  GLU B OE1   1 
ATOM   6650 O  OE2   . GLU B 2 300 ? -77.11300 -72.48400 4.37600   1.000 67.61000  ? 300  GLU B OE2   1 
ATOM   6651 N  N     . LEU B 2 301 ? -76.24200 -77.62600 2.91600   1.000 61.26000  ? 301  LEU B N     1 
ATOM   6652 C  CA    . LEU B 2 301 ? -75.74700 -78.70900 3.74700   1.000 63.47000  ? 301  LEU B CA    1 
ATOM   6653 C  C     . LEU B 2 301 ? -74.22900 -78.68700 3.83400   1.000 62.19000  ? 301  LEU B C     1 
ATOM   6654 O  O     . LEU B 2 301 ? -73.67300 -78.62500 4.93300   1.000 64.38000  ? 301  LEU B O     1 
ATOM   6655 C  CB    . LEU B 2 301 ? -76.22000 -80.07100 3.22200   1.000 72.64000  ? 301  LEU B CB    1 
ATOM   6656 C  CG    . LEU B 2 301 ? -77.67600 -80.49100 3.48900   1.000 78.73000  ? 301  LEU B CG    1 
ATOM   6657 C  CD1   . LEU B 2 301 ? -77.98900 -81.86000 2.85500   1.000 76.56000  ? 301  LEU B CD1   1 
ATOM   6658 C  CD2   . LEU B 2 301 ? -77.99600 -80.48500 4.98900   1.000 69.86000  ? 301  LEU B CD2   1 
ATOM   6659 N  N     . GLU B 2 302 ? -73.54900 -78.73300 2.69300   1.000 57.05000  ? 302  GLU B N     1 
ATOM   6660 C  CA    . GLU B 2 302 ? -72.10100 -78.86300 2.74700   1.000 59.34000  ? 302  GLU B CA    1 
ATOM   6661 C  C     . GLU B 2 302 ? -71.45000 -77.63200 3.37100   1.000 56.78000  ? 302  GLU B C     1 
ATOM   6662 O  O     . GLU B 2 302 ? -70.33400 -77.69400 3.87500   1.000 59.38000  ? 302  GLU B O     1 
ATOM   6663 C  CB    . GLU B 2 302 ? -71.52400 -79.13000 1.37000   1.000 59.46000  ? 302  GLU B CB    1 
ATOM   6664 C  CG    . GLU B 2 302 ? -71.56800 -77.97600 0.42500   1.000 61.76000  ? 302  GLU B CG    1 
ATOM   6665 C  CD    . GLU B 2 302 ? -70.70400 -78.23500 -0.79300  1.000 66.02000  ? 302  GLU B CD    1 
ATOM   6666 O  OE1   . GLU B 2 302 ? -70.89200 -77.54500 -1.81500  1.000 67.09000  ? 302  GLU B OE1   1 
ATOM   6667 O  OE2   . GLU B 2 302 ? -69.82900 -79.13100 -0.72600  1.000 66.78000  ? 302  GLU B OE2   1 
ATOM   6668 N  N     . LEU B 2 303 ? -72.16300 -76.51800 3.35600   1.000 56.81000  ? 303  LEU B N     1 
ATOM   6669 C  CA    . LEU B 2 303 ? -71.77400 -75.37200 4.15900   1.000 55.75000  ? 303  LEU B CA    1 
ATOM   6670 C  C     . LEU B 2 303 ? -71.72500 -75.73500 5.63700   1.000 58.21000  ? 303  LEU B C     1 
ATOM   6671 O  O     . LEU B 2 303 ? -70.87400 -75.25600 6.38700   1.000 60.52000  ? 303  LEU B O     1 
ATOM   6672 C  CB    . LEU B 2 303 ? -72.75600 -74.23000 3.95600   1.000 57.51000  ? 303  LEU B CB    1 
ATOM   6673 C  CG    . LEU B 2 303 ? -72.20700 -73.01100 3.24700   1.000 53.26000  ? 303  LEU B CG    1 
ATOM   6674 C  CD1   . LEU B 2 303 ? -73.13800 -71.85400 3.52400   1.000 52.30000  ? 303  LEU B CD1   1 
ATOM   6675 C  CD2   . LEU B 2 303 ? -70.79700 -72.71600 3.73200   1.000 47.25000  ? 303  LEU B CD2   1 
ATOM   6676 N  N     . ALA B 2 304 ? -72.66900 -76.56600 6.05500   1.000 59.07000  ? 304  ALA B N     1 
ATOM   6677 C  CA    . ALA B 2 304 ? -72.73900 -76.97500 7.44800   1.000 62.33000  ? 304  ALA B CA    1 
ATOM   6678 C  C     . ALA B 2 304 ? -71.53600 -77.85600 7.79200   1.000 63.40000  ? 304  ALA B C     1 
ATOM   6679 O  O     . ALA B 2 304 ? -70.87300 -77.65700 8.82500   1.000 57.40000  ? 304  ALA B O     1 
ATOM   6680 C  CB    . ALA B 2 304 ? -74.03600 -77.70500 7.71600   1.000 61.58000  ? 304  ALA B CB    1 
ATOM   6681 N  N     . GLU B 2 305 ? -71.25800 -78.81600 6.90800   1.000 57.80000  ? 305  GLU B N     1 
ATOM   6682 C  CA    . GLU B 2 305 ? -70.11700 -79.70100 7.08900   1.000 58.79000  ? 305  GLU B CA    1 
ATOM   6683 C  C     . GLU B 2 305 ? -68.83800 -78.89300 7.21500   1.000 63.13000  ? 305  GLU B C     1 
ATOM   6684 O  O     . GLU B 2 305 ? -68.28300 -78.78900 8.31100   1.000 65.82000  ? 305  GLU B O     1 
ATOM   6685 C  CB    . GLU B 2 305 ? -70.00500 -80.70200 5.93400   1.000 66.17000  ? 305  GLU B CB    1 
ATOM   6686 C  CG    . GLU B 2 305 ? -71.23300 -81.60000 5.77400   1.000 70.29000  ? 305  GLU B CG    1 
ATOM   6687 C  CD    . GLU B 2 305 ? -70.89800 -82.95400 5.16400   1.000 78.86000  ? 305  GLU B CD    1 
ATOM   6688 O  OE1   . GLU B 2 305 ? -70.65400 -83.90800 5.94400   1.000 80.26000  ? 305  GLU B OE1   1 
ATOM   6689 O  OE2   . GLU B 2 305 ? -70.88500 -83.06500 3.91300   1.000 74.57000  ? 305  GLU B OE2   1 
ATOM   6690 N  N     . ASN B 2 306 ? -68.39000 -78.31300 6.09700   1.000 62.69000  ? 306  ASN B N     1 
ATOM   6691 C  CA    . ASN B 2 306 ? -67.18400 -77.48300 6.06500   1.000 55.12000  ? 306  ASN B CA    1 
ATOM   6692 C  C     . ASN B 2 306 ? -67.03200 -76.58300 7.30100   1.000 56.96000  ? 306  ASN B C     1 
ATOM   6693 O  O     . ASN B 2 306 ? -65.93400 -76.42000 7.82900   1.000 55.62000  ? 306  ASN B O     1 
ATOM   6694 C  CB    . ASN B 2 306 ? -67.17100 -76.61000 4.81100   1.000 49.69000  ? 306  ASN B CB    1 
ATOM   6695 C  CG    . ASN B 2 306 ? -67.22900 -77.40900 3.53500   1.000 51.45000  ? 306  ASN B CG    1 
ATOM   6696 O  OD1   . ASN B 2 306 ? -66.26100 -78.05500 3.13900   1.000 55.13000  ? 306  ASN B OD1   1 
ATOM   6697 N  ND2   . ASN B 2 306 ? -68.36200 -77.34000 2.85900   1.000 60.46000  ? 306  ASN B ND2   1 
ATOM   6698 N  N     . ARG B 2 307 ? -68.13600 -76.00800 7.77000   1.000 56.17000  ? 307  ARG B N     1 
ATOM   6699 C  CA    . ARG B 2 307 ? -68.07100 -75.14800 8.94800   1.000 60.71000  ? 307  ARG B CA    1 
ATOM   6700 C  C     . ARG B 2 307 ? -67.50400 -75.92200 10.12800  1.000 64.41000  ? 307  ARG B C     1 
ATOM   6701 O  O     . ARG B 2 307 ? -66.83600 -75.34700 10.99400  1.000 58.41000  ? 307  ARG B O     1 
ATOM   6702 C  CB    . ARG B 2 307 ? -69.44800 -74.58200 9.29600   1.000 58.05000  ? 307  ARG B CB    1 
ATOM   6703 C  CG    . ARG B 2 307 ? -69.81900 -73.35100 8.49900   1.000 60.43000  ? 307  ARG B CG    1 
ATOM   6704 C  CD    . ARG B 2 307 ? -70.86100 -72.51500 9.21500   1.000 63.42000  ? 307  ARG B CD    1 
ATOM   6705 N  NE    . ARG B 2 307 ? -70.84500 -71.11500 8.78100   1.000 65.93000  ? 307  ARG B NE    1 
ATOM   6706 C  CZ    . ARG B 2 307 ? -71.67400 -70.59800 7.87400   1.000 63.11000  ? 307  ARG B CZ    1 
ATOM   6707 N  NH1   . ARG B 2 307 ? -72.59500 -71.35400 7.28900   1.000 58.21000  ? 307  ARG B NH1   1 
ATOM   6708 N  NH2   . ARG B 2 307 ? -71.58300 -69.31500 7.56100   1.000 64.77000  ? 307  ARG B NH2   1 
ATOM   6709 N  N     . GLU B 2 308 ? -67.76500 -77.23000 10.13300  1.000 67.50000  ? 308  GLU B N     1 
ATOM   6710 C  CA    . GLU B 2 308 ? -67.33500 -78.12600 11.21000  1.000 70.97000  ? 308  GLU B CA    1 
ATOM   6711 C  C     . GLU B 2 308 ? -65.96100 -78.73600 10.92900  1.000 69.03000  ? 308  GLU B C     1 
ATOM   6712 O  O     . GLU B 2 308 ? -65.11700 -78.81500 11.81400  1.000 73.23000  ? 308  GLU B O     1 
ATOM   6713 C  CB    . GLU B 2 308 ? -68.36400 -79.25100 11.43100  1.000 66.90000  ? 308  GLU B CB    1 
ATOM   6714 C  CG    . GLU B 2 308 ? -69.79400 -78.78200 11.76700  1.000 71.85000  ? 308  GLU B CG    1 
ATOM   6715 C  CD    . GLU B 2 308 ? -69.88900 -77.94400 13.06000  1.000 76.15000  ? 308  GLU B CD    1 
ATOM   6716 O  OE1   . GLU B 2 308 ? -70.02000 -76.70200 12.95800  1.000 72.58000  ? 308  GLU B OE1   1 
ATOM   6717 O  OE2   . GLU B 2 308 ? -69.85000 -78.51900 14.17500  1.000 71.66000  ? 308  GLU B OE2   1 
ATOM   6718 N  N     . ILE B 2 309 ? -65.73100 -79.15600 9.69200   1.000 62.19000  ? 309  ILE B N     1 
ATOM   6719 C  CA    . ILE B 2 309 ? -64.44200 -79.71900 9.32200   1.000 62.60000  ? 309  ILE B CA    1 
ATOM   6720 C  C     . ILE B 2 309 ? -63.32500 -78.70900 9.56300   1.000 66.43000  ? 309  ILE B C     1 
ATOM   6721 O  O     . ILE B 2 309 ? -62.14900 -79.01900 9.40100   1.000 73.37000  ? 309  ILE B O     1 
ATOM   6722 C  CB    . ILE B 2 309 ? -64.42800 -80.16100 7.84800   1.000 64.48000  ? 309  ILE B CB    1 
ATOM   6723 C  CG1   . ILE B 2 309 ? -65.62600 -81.07000 7.54900   1.000 64.87000  ? 309  ILE B CG1   1 
ATOM   6724 C  CG2   . ILE B 2 309 ? -63.11600 -80.85900 7.49000   1.000 62.34000  ? 309  ILE B CG2   1 
ATOM   6725 C  CD1   . ILE B 2 309 ? -65.60700 -81.67600 6.13700   1.000 70.41000  ? 309  ILE B CD1   1 
ATOM   6726 N  N     . LEU B 2 310 ? -63.69600 -77.49500 9.95300   1.000 67.31000  ? 310  LEU B N     1 
ATOM   6727 C  CA    . LEU B 2 310 ? -62.70900 -76.47600 10.27800  1.000 70.36000  ? 310  LEU B CA    1 
ATOM   6728 C  C     . LEU B 2 310 ? -62.45400 -76.44900 11.77700  1.000 71.77000  ? 310  LEU B C     1 
ATOM   6729 O  O     . LEU B 2 310 ? -61.38100 -76.03900 12.21700  1.000 72.21000  ? 310  LEU B O     1 
ATOM   6730 C  CB    . LEU B 2 310 ? -63.16800 -75.10100 9.78500   1.000 63.86000  ? 310  LEU B CB    1 
ATOM   6731 C  CG    . LEU B 2 310 ? -63.16900 -74.94100 8.26300   1.000 64.15000  ? 310  LEU B CG    1 
ATOM   6732 C  CD1   . LEU B 2 310 ? -63.78800 -73.61700 7.83500   1.000 57.07000  ? 310  LEU B CD1   1 
ATOM   6733 C  CD2   . LEU B 2 310 ? -61.75000 -75.08400 7.71300   1.000 62.45000  ? 310  LEU B CD2   1 
ATOM   6734 N  N     . LYS B 2 311 ? -63.44400 -76.90200 12.54800  1.000 72.81000  ? 311  LYS B N     1 
ATOM   6735 C  CA    . LYS B 2 311 ? -63.35400 -76.93900 14.01200  1.000 78.41000  ? 311  LYS B CA    1 
ATOM   6736 C  C     . LYS B 2 311 ? -62.39500 -78.03200 14.51500  1.000 85.99000  ? 311  LYS B C     1 
ATOM   6737 O  O     . LYS B 2 311 ? -61.55500 -77.78200 15.38700  1.000 89.20000  ? 311  LYS B O     1 
ATOM   6738 C  CB    . LYS B 2 311 ? -64.74500 -77.14500 14.62600  1.000 74.16000  ? 311  LYS B CB    1 
ATOM   6739 C  CG    . LYS B 2 311 ? -65.78400 -76.10500 14.19900  1.000 74.59000  ? 311  LYS B CG    1 
ATOM   6740 C  CD    . LYS B 2 311 ? -66.57500 -75.56100 15.39600  1.000 71.62000  ? 311  LYS B CD    1 
ATOM   6741 C  CE    . LYS B 2 311 ? -68.09000 -75.58600 15.15900  1.000 68.36000  ? 311  LYS B CE    1 
ATOM   6742 N  NZ    . LYS B 2 311 ? -68.58600 -74.64600 14.10000  1.000 61.60000  ? 311  LYS B NZ    1 
ATOM   6743 N  N     . GLU B 2 312 ? -62.54000 -79.23600 13.96900  1.000 82.55000  ? 312  GLU B N     1 
ATOM   6744 C  CA    . GLU B 2 312 ? -61.60800 -80.33800 14.21700  1.000 83.25000  ? 312  GLU B CA    1 
ATOM   6745 C  C     . GLU B 2 312 ? -60.16600 -79.89900 13.94300  1.000 82.93000  ? 312  GLU B C     1 
ATOM   6746 O  O     . GLU B 2 312 ? -59.90700 -79.18500 12.97700  1.000 83.86000  ? 312  GLU B O     1 
ATOM   6747 C  CB    . GLU B 2 312 ? -61.98600 -81.54500 13.34500  1.000 81.85000  ? 312  GLU B CB    1 
ATOM   6748 C  CG    . GLU B 2 312 ? -63.47900 -81.90700 13.42000  1.000 80.90000  ? 312  GLU B CG    1 
ATOM   6749 C  CD    . GLU B 2 312 ? -63.92600 -82.86300 12.31600  1.000 89.80000  ? 312  GLU B CD    1 
ATOM   6750 O  OE1   . GLU B 2 312 ? -63.06700 -83.28100 11.50400  1.000 90.29000  ? 312  GLU B OE1   1 
ATOM   6751 O  OE2   . GLU B 2 312 ? -65.13900 -83.19100 12.25900  1.000 80.89000  ? 312  GLU B OE2   1 
ATOM   6752 N  N     . PRO B 2 313 ? -59.22200 -80.31400 14.80000  1.000 87.87000  ? 313  PRO B N     1 
ATOM   6753 C  CA    . PRO B 2 313 ? -57.81700 -79.88300 14.69800  1.000 85.69000  ? 313  PRO B CA    1 
ATOM   6754 C  C     . PRO B 2 313 ? -57.05500 -80.48100 13.51000  1.000 83.11000  ? 313  PRO B C     1 
ATOM   6755 O  O     . PRO B 2 313 ? -57.42100 -81.54400 12.99700  1.000 83.76000  ? 313  PRO B O     1 
ATOM   6756 C  CB    . PRO B 2 313 ? -57.21000 -80.36700 16.01700  1.000 87.09000  ? 313  PRO B CB    1 
ATOM   6757 C  CG    . PRO B 2 313 ? -58.06000 -81.53600 16.40700  1.000 86.77000  ? 313  PRO B CG    1 
ATOM   6758 C  CD    . PRO B 2 313 ? -59.45100 -81.18800 15.96500  1.000 87.30000  ? 313  PRO B CD    1 
ATOM   6759 N  N     . VAL B 2 314 ? -55.99400 -79.79600 13.09500  1.000 79.33000  ? 314  VAL B N     1 
ATOM   6760 C  CA    . VAL B 2 314 ? -55.18100 -80.24300 11.96400  1.000 82.80000  ? 314  VAL B CA    1 
ATOM   6761 C  C     . VAL B 2 314 ? -54.48600 -81.57200 12.26400  1.000 85.59000  ? 314  VAL B C     1 
ATOM   6762 O  O     . VAL B 2 314 ? -53.53700 -81.64300 13.05300  1.000 84.18000  ? 314  VAL B O     1 
ATOM   6763 C  CB    . VAL B 2 314 ? -54.11300 -79.19300 11.57200  1.000 80.75000  ? 314  VAL B CB    1 
ATOM   6764 C  CG1   . VAL B 2 314 ? -53.55200 -79.49500 10.18700  1.000 71.63000  ? 314  VAL B CG1   1 
ATOM   6765 C  CG2   . VAL B 2 314 ? -54.70300 -77.79100 11.61200  1.000 80.83000  ? 314  VAL B CG2   1 
ATOM   6766 N  N     . HIS B 2 315 ? -54.96400 -82.62500 11.61700  1.000 85.13000  ? 315  HIS B N     1 
ATOM   6767 C  CA    . HIS B 2 315 ? -54.44600 -83.96200 11.84900  1.000 86.04000  ? 315  HIS B CA    1 
ATOM   6768 C  C     . HIS B 2 315 ? -52.99900 -84.13400 11.37500  1.000 82.58000  ? 315  HIS B C     1 
ATOM   6769 O  O     . HIS B 2 315 ? -52.64800 -83.73500 10.26200  1.000 77.02000  ? 315  HIS B O     1 
ATOM   6770 C  CB    . HIS B 2 315 ? -55.34900 -84.99200 11.15500  1.000 85.01000  ? 315  HIS B CB    1 
ATOM   6771 C  CG    . HIS B 2 315 ? -54.85900 -86.40000 11.27400  1.000 87.54000  ? 315  HIS B CG    1 
ATOM   6772 N  ND1   . HIS B 2 315 ? -55.05800 -87.16500 12.40400  1.000 94.66000  ? 315  HIS B ND1   1 
ATOM   6773 C  CD2   . HIS B 2 315 ? -54.16900 -87.17800 10.40500  1.000 85.46000  ? 315  HIS B CD2   1 
ATOM   6774 C  CE1   . HIS B 2 315 ? -54.51500 -88.35500 12.22700  1.000 101.06000 ? 315  HIS B CE1   1 
ATOM   6775 N  NE2   . HIS B 2 315 ? -53.96800 -88.39000 11.02300  1.000 96.83000  ? 315  HIS B NE2   1 
ATOM   6776 N  N     . GLY B 2 316 ? -52.16400 -84.71300 12.23800  1.000 77.76000  ? 316  GLY B N     1 
ATOM   6777 C  CA    . GLY B 2 316 ? -50.89800 -85.29400 11.81900  1.000 70.79000  ? 316  GLY B CA    1 
ATOM   6778 C  C     . GLY B 2 316 ? -49.74700 -84.36200 11.49300  1.000 62.21000  ? 316  GLY B C     1 
ATOM   6779 O  O     . GLY B 2 316 ? -49.28000 -84.30600 10.35200  1.000 58.57000  ? 316  GLY B O     1 
ATOM   6780 N  N     . VAL B 2 317 ? -49.26700 -83.65000 12.50400  1.000 61.71000  ? 317  VAL B N     1 
ATOM   6781 C  CA    . VAL B 2 317 ? -48.17100 -82.71100 12.31300  1.000 55.27000  ? 317  VAL B CA    1 
ATOM   6782 C  C     . VAL B 2 317 ? -47.17600 -82.81300 13.45900  1.000 47.21000  ? 317  VAL B C     1 
ATOM   6783 O  O     . VAL B 2 317 ? -47.43700 -82.39800 14.59300  1.000 45.19000  ? 317  VAL B O     1 
ATOM   6784 C  CB    . VAL B 2 317 ? -48.68200 -81.26900 12.19600  1.000 58.05000  ? 317  VAL B CB    1 
ATOM   6785 C  CG1   . VAL B 2 317 ? -47.58100 -80.37200 11.69100  1.000 56.52000  ? 317  VAL B CG1   1 
ATOM   6786 C  CG2   . VAL B 2 317 ? -49.86100 -81.21600 11.25000  1.000 60.11000  ? 317  VAL B CG2   1 
ATOM   6787 N  N     . TYR B 2 318 ? -46.01800 -83.36900 13.13800  1.000 44.84000  ? 318  TYR B N     1 
ATOM   6788 C  CA    . TYR B 2 318 ? -45.04500 -83.71500 14.15500  1.000 45.54000  ? 318  TYR B CA    1 
ATOM   6789 C  C     . TYR B 2 318 ? -43.85800 -82.78400 14.13500  1.000 41.32000  ? 318  TYR B C     1 
ATOM   6790 O  O     . TYR B 2 318 ? -43.17400 -82.66300 13.12000  1.000 46.14000  ? 318  TYR B O     1 
ATOM   6791 C  CB    . TYR B 2 318 ? -44.60700 -85.17600 13.96900  1.000 51.81000  ? 318  TYR B CB    1 
ATOM   6792 C  CG    . TYR B 2 318 ? -45.76000 -86.12500 14.23300  1.000 58.10000  ? 318  TYR B CG    1 
ATOM   6793 C  CD1   . TYR B 2 318 ? -46.09500 -86.50100 15.53500  1.000 57.12000  ? 318  TYR B CD1   1 
ATOM   6794 C  CD2   . TYR B 2 318 ? -46.54600 -86.59700 13.18700  1.000 53.25000  ? 318  TYR B CD2   1 
ATOM   6795 C  CE1   . TYR B 2 318 ? -47.15900 -87.33600 15.78000  1.000 58.70000  ? 318  TYR B CE1   1 
ATOM   6796 C  CE2   . TYR B 2 318 ? -47.61300 -87.43000 13.42600  1.000 52.69000  ? 318  TYR B CE2   1 
ATOM   6797 C  CZ    . TYR B 2 318 ? -47.91600 -87.79500 14.72000  1.000 61.07000  ? 318  TYR B CZ    1 
ATOM   6798 O  OH    . TYR B 2 318 ? -48.98700 -88.62700 14.94800  1.000 67.51000  ? 318  TYR B OH    1 
ATOM   6799 N  N     . TYR B 2 319 ? -43.62900 -82.11500 15.26100  1.000 37.05000  ? 319  TYR B N     1 
ATOM   6800 C  CA    . TYR B 2 319 ? -42.50000 -81.21600 15.38600  1.000 38.32000  ? 319  TYR B CA    1 
ATOM   6801 C  C     . TYR B 2 319 ? -41.20100 -81.95900 15.12900  1.000 38.94000  ? 319  TYR B C     1 
ATOM   6802 O  O     . TYR B 2 319 ? -40.93400 -82.97300 15.74200  1.000 42.38000  ? 319  TYR B O     1 
ATOM   6803 C  CB    . TYR B 2 319 ? -42.47900 -80.56000 16.77000  1.000 44.23000  ? 319  TYR B CB    1 
ATOM   6804 C  CG    . TYR B 2 319 ? -41.21300 -79.77600 17.02500  1.000 47.06000  ? 319  TYR B CG    1 
ATOM   6805 C  CD1   . TYR B 2 319 ? -40.74200 -78.85800 16.08400  1.000 49.34000  ? 319  TYR B CD1   1 
ATOM   6806 C  CD2   . TYR B 2 319 ? -40.47600 -79.96900 18.18800  1.000 48.78000  ? 319  TYR B CD2   1 
ATOM   6807 C  CE1   . TYR B 2 319 ? -39.57000 -78.15500 16.29000  1.000 49.77000  ? 319  TYR B CE1   1 
ATOM   6808 C  CE2   . TYR B 2 319 ? -39.29900 -79.26300 18.41700  1.000 51.05000  ? 319  TYR B CE2   1 
ATOM   6809 C  CZ    . TYR B 2 319 ? -38.85100 -78.35400 17.45900  1.000 55.44000  ? 319  TYR B CZ    1 
ATOM   6810 O  OH    . TYR B 2 319 ? -37.68500 -77.64600 17.66600  1.000 52.60000  ? 319  TYR B OH    1 
ATOM   6811 N  N     . ASP B 2 320 ? -40.39600 -81.45200 14.21200  1.000 40.73000  ? 320  ASP B N     1 
ATOM   6812 C  CA    . ASP B 2 320 ? -39.12400 -82.08800 13.89600  1.000 48.84000  ? 320  ASP B CA    1 
ATOM   6813 C  C     . ASP B 2 320 ? -37.95400 -81.10800 14.05700  1.000 52.40000  ? 320  ASP B C     1 
ATOM   6814 O  O     . ASP B 2 320 ? -37.78000 -80.20300 13.24600  1.000 54.15000  ? 320  ASP B O     1 
ATOM   6815 C  CB    . ASP B 2 320 ? -39.17400 -82.65900 12.47900  1.000 49.06000  ? 320  ASP B CB    1 
ATOM   6816 C  CG    . ASP B 2 320 ? -37.80400 -82.98800 11.92200  1.000 55.59000  ? 320  ASP B CG    1 
ATOM   6817 O  OD1   . ASP B 2 320 ? -36.83000 -83.10500 12.69100  1.000 54.81000  ? 320  ASP B OD1   1 
ATOM   6818 O  OD2   . ASP B 2 320 ? -37.70400 -83.14600 10.69000  1.000 64.33000  ? 320  ASP B OD2   1 
ATOM   6819 N  N     . PRO B 2 321 ? -37.12600 -81.31500 15.09200  1.000 53.51000  ? 321  PRO B N     1 
ATOM   6820 C  CA    . PRO B 2 321 ? -36.04700 -80.37200 15.40400  1.000 48.85000  ? 321  PRO B CA    1 
ATOM   6821 C  C     . PRO B 2 321 ? -34.88400 -80.41000 14.41700  1.000 53.23000  ? 321  PRO B C     1 
ATOM   6822 O  O     . PRO B 2 321 ? -33.96600 -79.61700 14.57000  1.000 57.03000  ? 321  PRO B O     1 
ATOM   6823 C  CB    . PRO B 2 321 ? -35.57900 -80.81800 16.79000  1.000 45.62000  ? 321  PRO B CB    1 
ATOM   6824 C  CG    . PRO B 2 321 ? -36.65900 -81.72800 17.30500  1.000 49.80000  ? 321  PRO B CG    1 
ATOM   6825 C  CD    . PRO B 2 321 ? -37.22000 -82.38900 16.09600  1.000 51.27000  ? 321  PRO B CD    1 
ATOM   6826 N  N     . SER B 2 322 ? -34.90200 -81.29900 13.43400  1.000 55.15000  ? 322  SER B N     1 
ATOM   6827 C  CA    . SER B 2 322 ? -33.83900 -81.29900 12.42700  1.000 58.79000  ? 322  SER B CA    1 
ATOM   6828 C  C     . SER B 2 322 ? -34.11100 -80.22700 11.36100  1.000 58.63000  ? 322  SER B C     1 
ATOM   6829 O  O     . SER B 2 322 ? -33.28700 -79.98800 10.47200  1.000 55.76000  ? 322  SER B O     1 
ATOM   6830 C  CB    . SER B 2 322 ? -33.69900 -82.68500 11.77300  1.000 61.87000  ? 322  SER B CB    1 
ATOM   6831 O  OG    . SER B 2 322 ? -34.83100 -83.02100 10.97400  1.000 61.29000  ? 322  SER B OG    1 
ATOM   6832 N  N     . LYS B 2 323 ? -35.28200 -79.59600 11.46400  1.000 53.89000  ? 323  LYS B N     1 
ATOM   6833 C  CA    . LYS B 2 323 ? -35.73000 -78.59000 10.50400  1.000 53.64000  ? 323  LYS B CA    1 
ATOM   6834 C  C     . LYS B 2 323 ? -36.12600 -77.29800 11.21800  1.000 56.45000  ? 323  LYS B C     1 
ATOM   6835 O  O     . LYS B 2 323 ? -36.41700 -77.29900 12.42200  1.000 57.11000  ? 323  LYS B O     1 
ATOM   6836 C  CB    . LYS B 2 323 ? -36.91700 -79.10300 9.68300   1.000 55.27000  ? 323  LYS B CB    1 
ATOM   6837 C  CG    . LYS B 2 323 ? -36.85000 -80.57800 9.28500   1.000 60.63000  ? 323  LYS B CG    1 
ATOM   6838 C  CD    . LYS B 2 323 ? -37.38100 -80.80600 7.86100   1.000 69.07000  ? 323  LYS B CD    1 
ATOM   6839 C  CE    . LYS B 2 323 ? -38.27400 -82.04400 7.76300   1.000 67.09000  ? 323  LYS B CE    1 
ATOM   6840 N  NZ    . LYS B 2 323 ? -39.72600 -81.68000 7.78100   1.000 70.10000  ? 323  LYS B NZ    1 
ATOM   6841 N  N     . ASP B 2 324 ? -36.14400 -76.19700 10.47600  1.000 52.05000  ? 324  ASP B N     1 
ATOM   6842 C  CA    . ASP B 2 324 ? -36.43800 -74.89600 11.07200  1.000 49.65000  ? 324  ASP B CA    1 
ATOM   6843 C  C     . ASP B 2 324 ? -37.92100 -74.69000 11.21300  1.000 46.15000  ? 324  ASP B C     1 
ATOM   6844 O  O     . ASP B 2 324 ? -38.69900 -75.17400 10.39100  1.000 44.40000  ? 324  ASP B O     1 
ATOM   6845 C  CB    . ASP B 2 324 ? -35.86800 -73.76700 10.21900  1.000 52.59000  ? 324  ASP B CB    1 
ATOM   6846 C  CG    . ASP B 2 324 ? -34.46000 -74.04600 9.74300   1.000 60.35000  ? 324  ASP B CG    1 
ATOM   6847 O  OD1   . ASP B 2 324 ? -33.66100 -74.60800 10.53500  1.000 66.57000  ? 324  ASP B OD1   1 
ATOM   6848 O  OD2   . ASP B 2 324 ? -34.15600 -73.69800 8.57900   1.000 55.74000  ? 324  ASP B OD2   1 
ATOM   6849 N  N     . LEU B 2 325 ? -38.31300 -73.95900 12.24700  1.000 40.72000  ? 325  LEU B N     1 
ATOM   6850 C  CA    . LEU B 2 325 ? -39.66400 -73.42200 12.29900  1.000 42.02000  ? 325  LEU B CA    1 
ATOM   6851 C  C     . LEU B 2 325 ? -39.79800 -72.24100 11.32800  1.000 39.95000  ? 325  LEU B C     1 
ATOM   6852 O  O     . LEU B 2 325 ? -39.05500 -71.26800 11.44400  1.000 40.17000  ? 325  LEU B O     1 
ATOM   6853 C  CB    . LEU B 2 325 ? -40.01200 -72.96000 13.71300  1.000 43.70000  ? 325  LEU B CB    1 
ATOM   6854 C  CG    . LEU B 2 325 ? -40.18900 -73.99000 14.82500  1.000 45.65000  ? 325  LEU B CG    1 
ATOM   6855 C  CD1   . LEU B 2 325 ? -40.10100 -73.31900 16.19800  1.000 45.20000  ? 325  LEU B CD1   1 
ATOM   6856 C  CD2   . LEU B 2 325 ? -41.52400 -74.66900 14.65200  1.000 44.48000  ? 325  LEU B CD2   1 
ATOM   6857 N  N     . ILE B 2 326 ? -40.72700 -72.32700 10.38100  1.000 37.60000  ? 326  ILE B N     1 
ATOM   6858 C  CA    . ILE B 2 326 ? -41.03300 -71.20000 9.48800   1.000 35.67000  ? 326  ILE B CA    1 
ATOM   6859 C  C     . ILE B 2 326 ? -42.20000 -70.39600 10.05600  1.000 36.08000  ? 326  ILE B C     1 
ATOM   6860 O  O     . ILE B 2 326 ? -43.23700 -70.97300 10.37300  1.000 40.19000  ? 326  ILE B O     1 
ATOM   6861 C  CB    . ILE B 2 326 ? -41.42300 -71.67300 8.06800   1.000 36.27000  ? 326  ILE B CB    1 
ATOM   6862 C  CG1   . ILE B 2 326 ? -40.46200 -72.74700 7.55100   1.000 30.77000  ? 326  ILE B CG1   1 
ATOM   6863 C  CG2   . ILE B 2 326 ? -41.49900 -70.49600 7.11600   1.000 34.80000  ? 326  ILE B CG2   1 
ATOM   6864 C  CD1   . ILE B 2 326 ? -39.16800 -72.21100 7.03900   1.000 25.77000  ? 326  ILE B CD1   1 
ATOM   6865 N  N     . ALA B 2 327 ? -42.06500 -69.08200 10.20000  1.000 33.46000  ? 327  ALA B N     1 
ATOM   6866 C  CA    . ALA B 2 327 ? -43.23800 -68.28600 10.59500  1.000 30.23000  ? 327  ALA B CA    1 
ATOM   6867 C  C     . ALA B 2 327 ? -43.67700 -67.36500 9.47300   1.000 32.36000  ? 327  ALA B C     1 
ATOM   6868 O  O     . ALA B 2 327 ? -42.85800 -66.70300 8.82300   1.000 34.28000  ? 327  ALA B O     1 
ATOM   6869 C  CB    . ALA B 2 327 ? -42.96100 -67.48300 11.85100  1.000 31.26000  ? 327  ALA B CB    1 
ATOM   6870 N  N     . GLU B 2 328 ? -44.97600 -67.32500 9.23700   1.000 32.57000  ? 328  GLU B N     1 
ATOM   6871 C  CA    . GLU B 2 328 ? -45.50100 -66.44900 8.20900   1.000 33.11000  ? 328  GLU B CA    1 
ATOM   6872 C  C     . GLU B 2 328 ? -46.41400 -65.42600 8.88000   1.000 33.99000  ? 328  GLU B C     1 
ATOM   6873 O  O     . GLU B 2 328 ? -47.16700 -65.78500 9.78900   1.000 34.21000  ? 328  GLU B O     1 
ATOM   6874 C  CB    . GLU B 2 328 ? -46.24000 -67.27100 7.16700   1.000 33.66000  ? 328  GLU B CB    1 
ATOM   6875 C  CG    . GLU B 2 328 ? -46.15000 -66.74600 5.76700   1.000 39.18000  ? 328  GLU B CG    1 
ATOM   6876 C  CD    . GLU B 2 328 ? -46.28700 -67.85800 4.75000   1.000 44.99000  ? 328  GLU B CD    1 
ATOM   6877 O  OE1   . GLU B 2 328 ? -45.47800 -68.80700 4.80400   1.000 48.71000  ? 328  GLU B OE1   1 
ATOM   6878 O  OE2   . GLU B 2 328 ? -47.20300 -67.79100 3.90300   1.000 52.79000  ? 328  GLU B OE2   1 
ATOM   6879 N  N     . ILE B 2 329 ? -46.31800 -64.16000 8.47200   1.000 29.50000  ? 329  ILE B N     1 
ATOM   6880 C  CA    . ILE B 2 329 ? -47.16400 -63.11100 9.05100   1.000 28.36000  ? 329  ILE B CA    1 
ATOM   6881 C  C     . ILE B 2 329 ? -47.91200 -62.33800 7.97900   1.000 32.18000  ? 329  ILE B C     1 
ATOM   6882 O  O     . ILE B 2 329 ? -47.33400 -61.96400 6.96000   1.000 37.06000  ? 329  ILE B O     1 
ATOM   6883 C  CB    . ILE B 2 329 ? -46.35100 -62.10200 9.86300   1.000 31.93000  ? 329  ILE B CB    1 
ATOM   6884 C  CG1   . ILE B 2 329 ? -45.42900 -62.80700 10.85400  1.000 30.73000  ? 329  ILE B CG1   1 
ATOM   6885 C  CG2   . ILE B 2 329 ? -47.26500 -61.13900 10.59100  1.000 24.68000  ? 329  ILE B CG2   1 
ATOM   6886 C  CD1   . ILE B 2 329 ? -44.73200 -61.83500 11.72800  1.000 25.46000  ? 329  ILE B CD1   1 
ATOM   6887 N  N     . GLN B 2 330 ? -49.19600 -62.08600 8.20800   1.000 33.65000  ? 330  GLN B N     1 
ATOM   6888 C  CA    . GLN B 2 330 ? -50.00600 -61.32200 7.26000   1.000 30.87000  ? 330  GLN B CA    1 
ATOM   6889 C  C     . GLN B 2 330 ? -50.62000 -60.11200 7.92400   1.000 35.03000  ? 330  GLN B C     1 
ATOM   6890 O  O     . GLN B 2 330 ? -51.15200 -60.22000 9.03200   1.000 35.04000  ? 330  GLN B O     1 
ATOM   6891 C  CB    . GLN B 2 330 ? -51.11800 -62.18700 6.66800   1.000 31.77000  ? 330  GLN B CB    1 
ATOM   6892 C  CG    . GLN B 2 330 ? -50.62400 -63.43100 5.98000   1.000 33.04000  ? 330  GLN B CG    1 
ATOM   6893 C  CD    . GLN B 2 330 ? -50.57600 -64.62700 6.89800   1.000 34.82000  ? 330  GLN B CD    1 
ATOM   6894 O  OE1   . GLN B 2 330 ? -49.73500 -65.50900 6.73200   1.000 38.17000  ? 330  GLN B OE1   1 
ATOM   6895 N  NE2   . GLN B 2 330 ? -51.48300 -64.67300 7.86500   1.000 33.50000  ? 330  GLN B NE2   1 
ATOM   6896 N  N     . LYS B 2 331 ? -50.55900 -58.96200 7.25400   1.000 40.69000  ? 331  LYS B N     1 
ATOM   6897 C  CA    . LYS B 2 331 ? -51.21900 -57.75900 7.76200   1.000 37.57000  ? 331  LYS B CA    1 
ATOM   6898 C  C     . LYS B 2 331 ? -52.68800 -57.77100 7.39800   1.000 38.09000  ? 331  LYS B C     1 
ATOM   6899 O  O     . LYS B 2 331 ? -53.04200 -57.78900 6.21500   1.000 44.94000  ? 331  LYS B O     1 
ATOM   6900 C  CB    . LYS B 2 331 ? -50.55300 -56.50500 7.21300   1.000 36.95000  ? 331  LYS B CB    1 
ATOM   6901 C  CG    . LYS B 2 331 ? -51.38200 -55.25400 7.35900   1.000 35.39000  ? 331  LYS B CG    1 
ATOM   6902 C  CD    . LYS B 2 331 ? -50.53200 -54.05400 7.01700   1.000 36.39000  ? 331  LYS B CD    1 
ATOM   6903 C  CE    . LYS B 2 331 ? -51.35100 -52.83200 6.68200   1.000 36.79000  ? 331  LYS B CE    1 
ATOM   6904 N  NZ    . LYS B 2 331 ? -50.45200 -51.79000 6.12600   1.000 39.80000  ? 331  LYS B NZ    1 
ATOM   6905 N  N     . GLN B 2 332 ? -53.54500 -57.77700 8.41300   1.000 39.46000  ? 332  GLN B N     1 
ATOM   6906 C  CA    . GLN B 2 332 ? -54.98500 -57.87600 8.17900   1.000 42.00000  ? 332  GLN B CA    1 
ATOM   6907 C  C     . GLN B 2 332 ? -55.67800 -56.52200 8.23600   1.000 48.72000  ? 332  GLN B C     1 
ATOM   6908 O  O     . GLN B 2 332 ? -56.88500 -56.42500 7.97600   1.000 51.79000  ? 332  GLN B O     1 
ATOM   6909 C  CB    . GLN B 2 332 ? -55.63700 -58.81700 9.19800   1.000 42.31000  ? 332  GLN B CB    1 
ATOM   6910 C  CG    . GLN B 2 332 ? -55.33500 -60.29700 9.00200   1.000 42.01000  ? 332  GLN B CG    1 
ATOM   6911 C  CD    . GLN B 2 332 ? -55.62000 -60.77900 7.59400   1.000 50.27000  ? 332  GLN B CD    1 
ATOM   6912 O  OE1   . GLN B 2 332 ? -56.18300 -60.05000 6.77200   1.000 53.90000  ? 332  GLN B OE1   1 
ATOM   6913 N  NE2   . GLN B 2 332 ? -55.22400 -62.01500 7.30200   1.000 53.51000  ? 332  GLN B NE2   1 
ATOM   6914 N  N     . GLY B 2 333 ? -54.91300 -55.48800 8.58900   1.000 47.08000  ? 333  GLY B N     1 
ATOM   6915 C  CA    . GLY B 2 333 ? -55.43200 -54.14100 8.72500   1.000 43.19000  ? 333  GLY B CA    1 
ATOM   6916 C  C     . GLY B 2 333 ? -55.99400 -53.86200 10.11100  1.000 52.24000  ? 333  GLY B C     1 
ATOM   6917 O  O     . GLY B 2 333 ? -56.17800 -54.77900 10.92000  1.000 47.55000  ? 333  GLY B O     1 
ATOM   6918 N  N     . GLN B 2 334 ? -56.26400 -52.58700 10.38300  1.000 52.89000  ? 334  GLN B N     1 
ATOM   6919 C  CA    . GLN B 2 334 ? -56.91200 -52.18200 11.62300  1.000 54.72000  ? 334  GLN B CA    1 
ATOM   6920 C  C     . GLN B 2 334 ? -56.07500 -52.58400 12.82000  1.000 57.15000  ? 334  GLN B C     1 
ATOM   6921 O  O     . GLN B 2 334 ? -56.59200 -52.72400 13.93000  1.000 63.82000  ? 334  GLN B O     1 
ATOM   6922 C  CB    . GLN B 2 334 ? -58.30800 -52.80800 11.73500  1.000 64.58000  ? 334  GLN B CB    1 
ATOM   6923 C  CG    . GLN B 2 334 ? -59.17600 -52.62200 10.49500  1.000 72.69000  ? 334  GLN B CG    1 
ATOM   6924 C  CD    . GLN B 2 334 ? -59.68500 -51.20000 10.33500  1.000 81.24000  ? 334  GLN B CD    1 
ATOM   6925 O  OE1   . GLN B 2 334 ? -60.72600 -50.83900 10.89200  1.000 86.47000  ? 334  GLN B OE1   1 
ATOM   6926 N  NE2   . GLN B 2 334 ? -58.95600 -50.38400 9.56800   1.000 78.07000  ? 334  GLN B NE2   1 
ATOM   6927 N  N     . GLY B 2 335 ? -54.78400 -52.78700 12.58400  1.000 52.42000  ? 335  GLY B N     1 
ATOM   6928 C  CA    . GLY B 2 335 ? -53.87900 -53.21100 13.63200  1.000 50.51000  ? 335  GLY B CA    1 
ATOM   6929 C  C     . GLY B 2 335 ? -53.93400 -54.69800 13.93400  1.000 47.39000  ? 335  GLY B C     1 
ATOM   6930 O  O     . GLY B 2 335 ? -53.36400 -55.13500 14.91600  1.000 56.68000  ? 335  GLY B O     1 
ATOM   6931 N  N     . GLN B 2 336 ? -54.61100 -55.47700 13.09300  1.000 46.85000  ? 336  GLN B N     1 
ATOM   6932 C  CA    . GLN B 2 336 ? -54.71200 -56.92700 13.27500  1.000 46.45000  ? 336  GLN B CA    1 
ATOM   6933 C  C     . GLN B 2 336 ? -53.65800 -57.67400 12.45300  1.000 41.44000  ? 336  GLN B C     1 
ATOM   6934 O  O     . GLN B 2 336 ? -53.41100 -57.35100 11.29400  1.000 45.30000  ? 336  GLN B O     1 
ATOM   6935 C  CB    . GLN B 2 336 ? -56.10500 -57.44300 12.87000  1.000 53.11000  ? 336  GLN B CB    1 
ATOM   6936 C  CG    . GLN B 2 336 ? -57.28800 -56.67500 13.42500  1.000 48.15000  ? 336  GLN B CG    1 
ATOM   6937 C  CD    . GLN B 2 336 ? -57.40400 -56.81800 14.92500  1.000 58.90000  ? 336  GLN B CD    1 
ATOM   6938 O  OE1   . GLN B 2 336 ? -57.39900 -55.82100 15.66300  1.000 63.14000  ? 336  GLN B OE1   1 
ATOM   6939 N  NE2   . GLN B 2 336 ? -57.50200 -58.06400 15.39100  1.000 54.32000  ? 336  GLN B NE2   1 
ATOM   6940 N  N     . TRP B 2 337 ? -53.06200 -58.69900 13.03900  1.000 38.82000  ? 337  TRP B N     1 
ATOM   6941 C  CA    . TRP B 2 337 ? -52.00900 -59.43200 12.36600  1.000 40.84000  ? 337  TRP B CA    1 
ATOM   6942 C  C     . TRP B 2 337 ? -52.23600 -60.90300 12.57500  1.000 37.40000  ? 337  TRP B C     1 
ATOM   6943 O  O     . TRP B 2 337 ? -52.66000 -61.32400 13.64200  1.000 42.45000  ? 337  TRP B O     1 
ATOM   6944 C  CB    . TRP B 2 337 ? -50.62800 -59.02800 12.90200  1.000 41.05000  ? 337  TRP B CB    1 
ATOM   6945 C  CG    . TRP B 2 337 ? -50.33400 -57.57500 12.75200  1.000 38.46000  ? 337  TRP B CG    1 
ATOM   6946 C  CD1   . TRP B 2 337 ? -50.78900 -56.55800 13.53500  1.000 38.15000  ? 337  TRP B CD1   1 
ATOM   6947 C  CD2   . TRP B 2 337 ? -49.51700 -56.97200 11.74700  1.000 34.62000  ? 337  TRP B CD2   1 
ATOM   6948 N  NE1   . TRP B 2 337 ? -50.30400 -55.35500 13.08300  1.000 35.57000  ? 337  TRP B NE1   1 
ATOM   6949 C  CE2   . TRP B 2 337 ? -49.51800 -55.58300 11.98600  1.000 34.41000  ? 337  TRP B CE2   1 
ATOM   6950 C  CE3   . TRP B 2 337 ? -48.78100 -57.47200 10.67100  1.000 36.44000  ? 337  TRP B CE3   1 
ATOM   6951 C  CZ2   . TRP B 2 337 ? -48.81700 -54.69100 11.18800  1.000 34.26000  ? 337  TRP B CZ2   1 
ATOM   6952 C  CZ3   . TRP B 2 337 ? -48.08400 -56.58400 9.88300   1.000 35.57000  ? 337  TRP B CZ3   1 
ATOM   6953 C  CH2   . TRP B 2 337 ? -48.10900 -55.21000 10.14100  1.000 34.71000  ? 337  TRP B CH2   1 
ATOM   6954 N  N     . THR B 2 338 ? -51.94500 -61.69300 11.56000  1.000 33.25000  ? 338  THR B N     1 
ATOM   6955 C  CA    . THR B 2 338 ? -52.18800 -63.11700 11.64200  1.000 34.28000  ? 338  THR B CA    1 
ATOM   6956 C  C     . THR B 2 338 ? -50.90300 -63.83100 11.32200  1.000 35.50000  ? 338  THR B C     1 
ATOM   6957 O  O     . THR B 2 338 ? -50.02400 -63.27300 10.66400  1.000 36.68000  ? 338  THR B O     1 
ATOM   6958 C  CB    . THR B 2 338 ? -53.29700 -63.57100 10.67300  1.000 35.68000  ? 338  THR B CB    1 
ATOM   6959 O  OG1   . THR B 2 338 ? -52.88900 -63.32000 9.32300   1.000 35.69000  ? 338  THR B OG1   1 
ATOM   6960 C  CG2   . THR B 2 338 ? -54.57300 -62.81000 10.95400  1.000 36.47000  ? 338  THR B CG2   1 
ATOM   6961 N  N     . TYR B 2 339 ? -50.77700 -65.06500 11.78100  1.000 34.90000  ? 339  TYR B N     1 
ATOM   6962 C  CA    . TYR B 2 339 ? -49.53400 -65.76900 11.55500  1.000 33.85000  ? 339  TYR B CA    1 
ATOM   6963 C  C     . TYR B 2 339 ? -49.73200 -67.25900 11.68100  1.000 38.66000  ? 339  TYR B C     1 
ATOM   6964 O  O     . TYR B 2 339 ? -50.70400 -67.73100 12.27900  1.000 40.73000  ? 339  TYR B O     1 
ATOM   6965 C  CB    . TYR B 2 339 ? -48.46400 -65.28200 12.53900  1.000 36.45000  ? 339  TYR B CB    1 
ATOM   6966 C  CG    . TYR B 2 339 ? -48.71400 -65.70300 13.96900  1.000 35.05000  ? 339  TYR B CG    1 
ATOM   6967 C  CD1   . TYR B 2 339 ? -48.26600 -66.93400 14.42500  1.000 39.43000  ? 339  TYR B CD1   1 
ATOM   6968 C  CD2   . TYR B 2 339 ? -49.39300 -64.87800 14.86200  1.000 37.53000  ? 339  TYR B CD2   1 
ATOM   6969 C  CE1   . TYR B 2 339 ? -48.48900 -67.34800 15.71900  1.000 39.65000  ? 339  TYR B CE1   1 
ATOM   6970 C  CE2   . TYR B 2 339 ? -49.61900 -65.28000 16.17200  1.000 38.70000  ? 339  TYR B CE2   1 
ATOM   6971 C  CZ    . TYR B 2 339 ? -49.15700 -66.52300 16.58700  1.000 40.43000  ? 339  TYR B CZ    1 
ATOM   6972 O  OH    . TYR B 2 339 ? -49.35100 -66.98300 17.86900  1.000 46.96000  ? 339  TYR B OH    1 
ATOM   6973 N  N     . GLN B 2 340 ? -48.79300 -68.00200 11.11600  1.000 36.68000  ? 340  GLN B N     1 
ATOM   6974 C  CA    . GLN B 2 340 ? -48.83300 -69.44200 11.18300  1.000 36.78000  ? 340  GLN B CA    1 
ATOM   6975 C  C     . GLN B 2 340 ? -47.42200 -69.97300 11.31200  1.000 40.71000  ? 340  GLN B C     1 
ATOM   6976 O  O     . GLN B 2 340 ? -46.55400 -69.62400 10.51900  1.000 44.67000  ? 340  GLN B O     1 
ATOM   6977 C  CB    . GLN B 2 340 ? -49.50500 -70.02500 9.94400   1.000 39.71000  ? 340  GLN B CB    1 
ATOM   6978 C  CG    . GLN B 2 340 ? -50.79400 -69.32700 9.57600   1.000 36.98000  ? 340  GLN B CG    1 
ATOM   6979 C  CD    . GLN B 2 340 ? -50.53700 -68.14700 8.70300   1.000 36.08000  ? 340  GLN B CD    1 
ATOM   6980 O  OE1   . GLN B 2 340 ? -51.02000 -67.05400 8.96900   1.000 38.07000  ? 340  GLN B OE1   1 
ATOM   6981 N  NE2   . GLN B 2 340 ? -49.75300 -68.35400 7.65200   1.000 37.77000  ? 340  GLN B NE2   1 
ATOM   6982 N  N     . ILE B 2 341 ? -47.20200 -70.81000 12.31600  1.000 39.00000  ? 341  ILE B N     1 
ATOM   6983 C  CA    . ILE B 2 341 ? -45.92900 -71.48600 12.49700  1.000 36.48000  ? 341  ILE B CA    1 
ATOM   6984 C  C     . ILE B 2 341 ? -46.03700 -72.88800 11.91900  1.000 39.53000  ? 341  ILE B C     1 
ATOM   6985 O  O     . ILE B 2 341 ? -46.92500 -73.64800 12.29800  1.000 42.77000  ? 341  ILE B O     1 
ATOM   6986 C  CB    . ILE B 2 341 ? -45.54100 -71.55600 13.99200  1.000 34.62000  ? 341  ILE B CB    1 
ATOM   6987 C  CG1   . ILE B 2 341 ? -45.64500 -70.16500 14.62100  1.000 37.07000  ? 341  ILE B CG1   1 
ATOM   6988 C  CG2   . ILE B 2 341 ? -44.15100 -72.14600 14.16200  1.000 35.41000  ? 341  ILE B CG2   1 
ATOM   6989 C  CD1   . ILE B 2 341 ? -45.37600 -70.12500 16.10400  1.000 41.17000  ? 341  ILE B CD1   1 
ATOM   6990 N  N     . TYR B 2 342 ? -45.14400 -73.21800 10.99400  1.000 35.09000  ? 342  TYR B N     1 
ATOM   6991 C  CA    . TYR B 2 342 ? -45.14900 -74.51500 10.33700  1.000 36.94000  ? 342  TYR B CA    1 
ATOM   6992 C  C     . TYR B 2 342 ? -43.72600 -74.87800 9.91100   1.000 41.94000  ? 342  TYR B C     1 
ATOM   6993 O  O     . TYR B 2 342 ? -42.86200 -74.00400 9.84900   1.000 43.97000  ? 342  TYR B O     1 
ATOM   6994 C  CB    . TYR B 2 342 ? -46.06300 -74.50000 9.11900   1.000 41.13000  ? 342  TYR B CB    1 
ATOM   6995 C  CG    . TYR B 2 342 ? -45.55100 -73.61600 7.99300   1.000 42.23000  ? 342  TYR B CG    1 
ATOM   6996 C  CD1   . TYR B 2 342 ? -44.50000 -74.02500 7.18100   1.000 39.70000  ? 342  TYR B CD1   1 
ATOM   6997 C  CD2   . TYR B 2 342 ? -46.12500 -72.38100 7.73600   1.000 41.20000  ? 342  TYR B CD2   1 
ATOM   6998 C  CE1   . TYR B 2 342 ? -44.03300 -73.23100 6.17100   1.000 37.79000  ? 342  TYR B CE1   1 
ATOM   6999 C  CE2   . TYR B 2 342 ? -45.65800 -71.58300 6.71400   1.000 37.15000  ? 342  TYR B CE2   1 
ATOM   7000 C  CZ    . TYR B 2 342 ? -44.61700 -72.01600 5.93600   1.000 34.57000  ? 342  TYR B CZ    1 
ATOM   7001 O  OH    . TYR B 2 342 ? -44.14500 -71.22900 4.91500   1.000 43.30000  ? 342  TYR B OH    1 
ATOM   7002 N  N     . GLN B 2 343 ? -43.49400 -76.15100 9.58800   1.000 42.05000  ? 343  GLN B N     1 
ATOM   7003 C  CA    . GLN B 2 343 ? -42.18300 -76.61500 9.13100   1.000 38.12000  ? 343  GLN B CA    1 
ATOM   7004 C  C     . GLN B 2 343 ? -42.23900 -77.11900 7.69100   1.000 41.40000  ? 343  GLN B C     1 
ATOM   7005 O  O     . GLN B 2 343 ? -41.27600 -77.02600 6.93900   1.000 46.57000  ? 343  GLN B O     1 
ATOM   7006 C  CB    . GLN B 2 343 ? -41.67600 -77.73300 10.03600  1.000 42.63000  ? 343  GLN B CB    1 
ATOM   7007 C  CG    . GLN B 2 343 ? -40.85800 -77.29500 11.22000  1.000 45.51000  ? 343  GLN B CG    1 
ATOM   7008 C  CD    . GLN B 2 343 ? -40.72300 -78.40500 12.23500  1.000 46.62000  ? 343  GLN B CD    1 
ATOM   7009 O  OE1   . GLN B 2 343 ? -41.58600 -79.28000 12.32300  1.000 51.11000  ? 343  GLN B OE1   1 
ATOM   7010 N  NE2   . GLN B 2 343 ? -39.64500 -78.38200 13.00900  1.000 45.99000  ? 343  GLN B NE2   1 
ATOM   7011 N  N     . GLU B 2 344 ? -43.37500 -77.69600 7.33800   1.000 46.06000  ? 344  GLU B N     1 
ATOM   7012 C  CA    . GLU B 2 344 ? -43.66200 -78.13000 5.98100   1.000 47.87000  ? 344  GLU B CA    1 
ATOM   7013 C  C     . GLU B 2 344 ? -44.99800 -77.51000 5.61200   1.000 48.24000  ? 344  GLU B C     1 
ATOM   7014 O  O     . GLU B 2 344 ? -45.96600 -77.62800 6.36700   1.000 52.71000  ? 344  GLU B O     1 
ATOM   7015 C  CB    . GLU B 2 344 ? -43.73200 -79.65600 5.88300   1.000 58.16000  ? 344  GLU B CB    1 
ATOM   7016 C  CG    . GLU B 2 344 ? -42.65600 -80.32600 5.03100   1.000 61.38000  ? 344  GLU B CG    1 
ATOM   7017 C  CD    . GLU B 2 344 ? -43.05900 -81.74200 4.61000   1.000 83.38000  ? 344  GLU B CD    1 
ATOM   7018 O  OE1   . GLU B 2 344 ? -43.19500 -82.61800 5.49900   1.000 84.49000  ? 344  GLU B OE1   1 
ATOM   7019 O  OE2   . GLU B 2 344 ? -43.25500 -81.97700 3.39200   1.000 81.78000  ? 344  GLU B OE2   1 
ATOM   7020 N  N     . PRO B 2 345 ? -45.05800 -76.83800 4.46000   1.000 47.67000  ? 345  PRO B N     1 
ATOM   7021 C  CA    . PRO B 2 345 ? -46.25500 -76.14700 3.97200   1.000 46.01000  ? 345  PRO B CA    1 
ATOM   7022 C  C     . PRO B 2 345 ? -47.57900 -76.88800 4.22000   1.000 50.18000  ? 345  PRO B C     1 
ATOM   7023 O  O     . PRO B 2 345 ? -47.73000 -78.07500 3.90000   1.000 48.36000  ? 345  PRO B O     1 
ATOM   7024 C  CB    . PRO B 2 345 ? -45.98700 -76.02200 2.46800   1.000 54.22000  ? 345  PRO B CB    1 
ATOM   7025 C  CG    . PRO B 2 345 ? -44.73800 -76.85200 2.19800   1.000 52.77000  ? 345  PRO B CG    1 
ATOM   7026 C  CD    . PRO B 2 345 ? -43.97600 -76.80100 3.46800   1.000 49.70000  ? 345  PRO B CD    1 
ATOM   7027 N  N     . PHE B 2 346 ? -48.52000 -76.15000 4.81000   1.000 50.46000  ? 346  PHE B N     1 
ATOM   7028 C  CA    . PHE B 2 346 ? -49.88700 -76.59500 5.05500   1.000 46.16000  ? 346  PHE B CA    1 
ATOM   7029 C  C     . PHE B 2 346 ? -49.95900 -77.47600 6.28900   1.000 49.01000  ? 346  PHE B C     1 
ATOM   7030 O  O     . PHE B 2 346 ? -51.04500 -77.79300 6.78300   1.000 49.08000  ? 346  PHE B O     1 
ATOM   7031 C  CB    . PHE B 2 346 ? -50.44300 -77.30800 3.82700   1.000 55.52000  ? 346  PHE B CB    1 
ATOM   7032 C  CG    . PHE B 2 346 ? -50.39800 -76.46300 2.57400   1.000 56.81000  ? 346  PHE B CG    1 
ATOM   7033 C  CD1   . PHE B 2 346 ? -51.09700 -75.25900 2.50600   1.000 55.57000  ? 346  PHE B CD1   1 
ATOM   7034 C  CD2   . PHE B 2 346 ? -49.65600 -76.86800 1.47100   1.000 55.81000  ? 346  PHE B CD2   1 
ATOM   7035 C  CE1   . PHE B 2 346 ? -51.05300 -74.47200 1.36300   1.000 50.90000  ? 346  PHE B CE1   1 
ATOM   7036 C  CE2   . PHE B 2 346 ? -49.61100 -76.08800 0.31800   1.000 56.64000  ? 346  PHE B CE2   1 
ATOM   7037 C  CZ    . PHE B 2 346 ? -50.30600 -74.88900 0.27000   1.000 56.47000  ? 346  PHE B CZ    1 
ATOM   7038 N  N     . LYS B 2 347 ? -48.78400 -77.83100 6.80200   1.000 51.53000  ? 347  LYS B N     1 
ATOM   7039 C  CA    . LYS B 2 347 ? -48.66300 -78.56700 8.05600   1.000 47.24000  ? 347  LYS B CA    1 
ATOM   7040 C  C     . LYS B 2 347 ? -48.41000 -77.64200 9.24900   1.000 47.34000  ? 347  LYS B C     1 
ATOM   7041 O  O     . LYS B 2 347 ? -47.33200 -77.65400 9.84900   1.000 50.37000  ? 347  LYS B O     1 
ATOM   7042 C  CB    . LYS B 2 347 ? -47.53800 -79.59300 7.94100   1.000 52.89000  ? 347  LYS B CB    1 
ATOM   7043 C  CG    . LYS B 2 347 ? -47.95800 -80.93300 7.34200   1.000 54.43000  ? 347  LYS B CG    1 
ATOM   7044 C  CD    . LYS B 2 347 ? -48.05000 -80.90400 5.82900   1.000 56.35000  ? 347  LYS B CD    1 
ATOM   7045 C  CE    . LYS B 2 347 ? -48.43100 -82.29000 5.29200   1.000 61.28000  ? 347  LYS B CE    1 
ATOM   7046 N  NZ    . LYS B 2 347 ? -49.69800 -82.81300 5.89900   1.000 47.22000  ? 347  LYS B NZ    1 
ATOM   7047 N  N     . ASN B 2 348 ? -49.41200 -76.85000 9.59800   1.000 45.68000  ? 348  ASN B N     1 
ATOM   7048 C  CA    . ASN B 2 348 ? -49.26100 -75.82500 10.62700  1.000 47.65000  ? 348  ASN B CA    1 
ATOM   7049 C  C     . ASN B 2 348 ? -49.09800 -76.38400 12.02900  1.000 48.21000  ? 348  ASN B C     1 
ATOM   7050 O  O     . ASN B 2 348 ? -49.99100 -77.05700 12.52600  1.000 55.40000  ? 348  ASN B O     1 
ATOM   7051 C  CB    . ASN B 2 348 ? -50.46600 -74.87200 10.61100  1.000 43.56000  ? 348  ASN B CB    1 
ATOM   7052 C  CG    . ASN B 2 348 ? -50.51500 -74.01700 9.35000   1.000 45.72000  ? 348  ASN B CG    1 
ATOM   7053 O  OD1   . ASN B 2 348 ? -49.50300 -73.84200 8.65600   1.000 41.48000  ? 348  ASN B OD1   1 
ATOM   7054 N  ND2   . ASN B 2 348 ? -51.69600 -73.47700 9.05200   1.000 41.87000  ? 348  ASN B ND2   1 
ATOM   7055 N  N     . LEU B 2 349 ? -47.97000 -76.09700 12.66800  1.000 48.54000  ? 349  LEU B N     1 
ATOM   7056 C  CA    . LEU B 2 349 ? -47.80200 -76.44400 14.08200  1.000 47.26000  ? 349  LEU B CA    1 
ATOM   7057 C  C     . LEU B 2 349 ? -48.68700 -75.53200 14.92300  1.000 42.88000  ? 349  LEU B C     1 
ATOM   7058 O  O     . LEU B 2 349 ? -49.26400 -75.96200 15.92000  1.000 45.42000  ? 349  LEU B O     1 
ATOM   7059 C  CB    . LEU B 2 349 ? -46.33500 -76.33500 14.53600  1.000 46.30000  ? 349  LEU B CB    1 
ATOM   7060 C  CG    . LEU B 2 349 ? -45.28600 -77.38700 14.13000  1.000 45.98000  ? 349  LEU B CG    1 
ATOM   7061 C  CD1   . LEU B 2 349 ? -44.85200 -77.25300 12.67100  1.000 49.41000  ? 349  LEU B CD1   1 
ATOM   7062 C  CD2   . LEU B 2 349 ? -44.06700 -77.29000 15.03000  1.000 45.71000  ? 349  LEU B CD2   1 
ATOM   7063 N  N     . LYS B 2 350 ? -48.79200 -74.27100 14.52400  1.000 44.50000  ? 350  LYS B N     1 
ATOM   7064 C  CA    . LYS B 2 350 ? -49.72500 -73.34900 15.18400  1.000 44.96000  ? 350  LYS B CA    1 
ATOM   7065 C  C     . LYS B 2 350 ? -50.08100 -72.17700 14.28900  1.000 39.58000  ? 350  LYS B C     1 
ATOM   7066 O  O     . LYS B 2 350 ? -49.34100 -71.83400 13.37100  1.000 43.35000  ? 350  LYS B O     1 
ATOM   7067 C  CB    . LYS B 2 350 ? -49.16600 -72.81200 16.50500  1.000 41.53000  ? 350  LYS B CB    1 
ATOM   7068 C  CG    . LYS B 2 350 ? -50.10400 -71.81700 17.17500  1.000 42.23000  ? 350  LYS B CG    1 
ATOM   7069 C  CD    . LYS B 2 350 ? -49.59100 -71.33100 18.52200  1.000 44.55000  ? 350  LYS B CD    1 
ATOM   7070 C  CE    . LYS B 2 350 ? -50.52500 -70.26000 19.08200  1.000 49.19000  ? 350  LYS B CE    1 
ATOM   7071 N  NZ    . LYS B 2 350 ? -49.95900 -69.58500 20.28300  1.000 61.05000  ? 350  LYS B NZ    1 
ATOM   7072 N  N     . THR B 2 351 ? -51.22800 -71.58300 14.57300  1.000 36.38000  ? 351  THR B N     1 
ATOM   7073 C  CA    . THR B 2 351 ? -51.74700 -70.46800 13.81000  1.000 38.37000  ? 351  THR B CA    1 
ATOM   7074 C  C     . THR B 2 351 ? -52.44600 -69.53600 14.77500  1.000 40.93000  ? 351  THR B C     1 
ATOM   7075 O  O     . THR B 2 351 ? -53.28600 -69.97700 15.55500  1.000 49.69000  ? 351  THR B O     1 
ATOM   7076 C  CB    . THR B 2 351 ? -52.73100 -70.92700 12.74500  1.000 36.11000  ? 351  THR B CB    1 
ATOM   7077 O  OG1   . THR B 2 351 ? -53.89500 -71.45100 13.38800  1.000 37.55000  ? 351  THR B OG1   1 
ATOM   7078 C  CG2   . THR B 2 351 ? -52.12200 -72.00100 11.90100  1.000 38.44000  ? 351  THR B CG2   1 
ATOM   7079 N  N     . GLY B 2 352 ? -52.11300 -68.25700 14.73800  1.000 38.20000  ? 352  GLY B N     1 
ATOM   7080 C  CA    . GLY B 2 352 ? -52.63700 -67.36100 15.74600  1.000 37.78000  ? 352  GLY B CA    1 
ATOM   7081 C  C     . GLY B 2 352 ? -52.90700 -65.98500 15.21600  1.000 40.35000  ? 352  GLY B C     1 
ATOM   7082 O  O     . GLY B 2 352 ? -52.98200 -65.77000 14.00900  1.000 41.25000  ? 352  GLY B O     1 
ATOM   7083 N  N     . LYS B 2 353 ? -53.02200 -65.04200 16.13600  1.000 42.62000  ? 353  LYS B N     1 
ATOM   7084 C  CA    . LYS B 2 353 ? -53.40800 -63.69300 15.79300  1.000 41.88000  ? 353  LYS B CA    1 
ATOM   7085 C  C     . LYS B 2 353 ? -52.79800 -62.70200 16.76700  1.000 50.54000  ? 353  LYS B C     1 
ATOM   7086 O  O     . LYS B 2 353 ? -52.67900 -62.98800 17.96500  1.000 53.77000  ? 353  LYS B O     1 
ATOM   7087 C  CB    . LYS B 2 353 ? -54.92800 -63.56100 15.80600  1.000 40.97000  ? 353  LYS B CB    1 
ATOM   7088 C  CG    . LYS B 2 353 ? -55.42100 -62.23300 15.29700  1.000 46.20000  ? 353  LYS B CG    1 
ATOM   7089 C  CD    . LYS B 2 353 ? -56.90000 -62.07800 15.57900  1.000 59.77000  ? 353  LYS B CD    1 
ATOM   7090 C  CE    . LYS B 2 353 ? -57.16800 -62.12100 17.07400  1.000 57.06000  ? 353  LYS B CE    1 
ATOM   7091 N  NZ    . LYS B 2 353 ? -58.38100 -62.92000 17.39900  1.000 67.23000  ? 353  LYS B NZ    1 
ATOM   7092 N  N     . TYR B 2 354 ? -52.44000 -61.52800 16.25000  1.000 47.50000  ? 354  TYR B N     1 
ATOM   7093 C  CA    . TYR B 2 354 ? -51.91700 -60.44100 17.06600  1.000 46.37000  ? 354  TYR B CA    1 
ATOM   7094 C  C     . TYR B 2 354 ? -52.72900 -59.16700 16.80300  1.000 47.00000  ? 354  TYR B C     1 
ATOM   7095 O  O     . TYR B 2 354 ? -52.72100 -58.64700 15.69200  1.000 50.14000  ? 354  TYR B O     1 
ATOM   7096 C  CB    . TYR B 2 354 ? -50.42900 -60.23200 16.75900  1.000 47.43000  ? 354  TYR B CB    1 
ATOM   7097 C  CG    . TYR B 2 354 ? -49.73200 -59.26800 17.68300  1.000 52.87000  ? 354  TYR B CG    1 
ATOM   7098 C  CD1   . TYR B 2 354 ? -49.58500 -59.56100 19.03400  1.000 53.94000  ? 354  TYR B CD1   1 
ATOM   7099 C  CD2   . TYR B 2 354 ? -49.20800 -58.06200 17.20700  1.000 51.00000  ? 354  TYR B CD2   1 
ATOM   7100 C  CE1   . TYR B 2 354 ? -48.94900 -58.68200 19.89300  1.000 52.42000  ? 354  TYR B CE1   1 
ATOM   7101 C  CE2   . TYR B 2 354 ? -48.57200 -57.17200 18.05900  1.000 50.05000  ? 354  TYR B CE2   1 
ATOM   7102 C  CZ    . TYR B 2 354 ? -48.44400 -57.49100 19.40400  1.000 54.36000  ? 354  TYR B CZ    1 
ATOM   7103 O  OH    . TYR B 2 354 ? -47.81300 -56.62600 20.27200  1.000 57.13000  ? 354  TYR B OH    1 
ATOM   7104 N  N     . ALA B 2 355 ? -53.44600 -58.68300 17.82200  1.000 51.05000  ? 355  ALA B N     1 
ATOM   7105 C  CA    . ALA B 2 355 ? -54.25300 -57.45900 17.72600  1.000 49.48000  ? 355  ALA B CA    1 
ATOM   7106 C  C     . ALA B 2 355 ? -53.57100 -56.30600 18.44300  1.000 58.36000  ? 355  ALA B C     1 
ATOM   7107 O  O     . ALA B 2 355 ? -52.77400 -56.52200 19.35800  1.000 55.59000  ? 355  ALA B O     1 
ATOM   7108 C  CB    . ALA B 2 355 ? -55.63800 -57.67900 18.31000  1.000 43.53000  ? 355  ALA B CB    1 
ATOM   7109 N  N     . ARG B 2 356 ? -53.90100 -55.07900 18.04000  1.000 64.70000  ? 356  ARG B N     1 
ATOM   7110 C  CA    . ARG B 2 356 ? -53.31000 -53.88200 18.64700  1.000 69.22000  ? 356  ARG B CA    1 
ATOM   7111 C  C     . ARG B 2 356 ? -54.17400 -52.61700 18.48600  1.000 75.43000  ? 356  ARG B C     1 
ATOM   7112 O  O     . ARG B 2 356 ? -55.36600 -52.68500 18.12700  1.000 64.76000  ? 356  ARG B O     1 
ATOM   7113 C  CB    . ARG B 2 356 ? -51.91000 -53.63400 18.06700  1.000 60.30000  ? 356  ARG B CB    1 
ATOM   7114 C  CG    . ARG B 2 356 ? -50.78800 -54.36600 18.80400  1.000 65.35000  ? 356  ARG B CG    1 
ATOM   7115 C  CD    . ARG B 2 356 ? -50.51000 -53.74300 20.18500  1.000 73.64000  ? 356  ARG B CD    1 
ATOM   7116 N  NE    . ARG B 2 356 ? -49.83500 -54.66500 21.10300  1.000 69.67000  ? 356  ARG B NE    1 
ATOM   7117 C  CZ    . ARG B 2 356 ? -49.19100 -54.28900 22.20800  1.000 76.02000  ? 356  ARG B CZ    1 
ATOM   7118 N  NH1   . ARG B 2 356 ? -49.11300 -53.00500 22.52800  1.000 77.05000  ? 356  ARG B NH1   1 
ATOM   7119 N  NH2   . ARG B 2 356 ? -48.60900 -55.19700 22.99100  1.000 73.24000  ? 356  ARG B NH2   1 
ATOM   7120 N  N     . MET B 2 357 ? -53.54800 -51.46700 18.75800  1.000 83.22000  ? 357  MET B N     1 
ATOM   7121 C  CA    . MET B 2 357 ? -54.22800 -50.16600 18.81800  1.000 87.19000  ? 357  MET B CA    1 
ATOM   7122 C  C     . MET B 2 357 ? -54.85500 -49.73700 17.49100  1.000 85.95000  ? 357  MET B C     1 
ATOM   7123 O  O     . MET B 2 357 ? -54.27500 -49.93400 16.41500  1.000 81.86000  ? 357  MET B O     1 
ATOM   7124 C  CB    . MET B 2 357 ? -53.24900 -49.07900 19.28800  1.000 87.93000  ? 357  MET B CB    1 
ATOM   7125 C  CG    . MET B 2 357 ? -53.11100 -47.89900 18.31400  1.000 90.20000  ? 357  MET B CG    1 
ATOM   7126 S  SD    . MET B 2 357 ? -51.73500 -46.77200 18.68400  1.000 111.05000 ? 357  MET B SD    1 
ATOM   7127 C  CE    . MET B 2 357 ? -52.46600 -45.67400 19.90500  1.000 87.23000  ? 357  MET B CE    1 
ATOM   7128 N  N     . ARG B 2 358 ? -56.04300 -49.14100 17.58600  1.000 86.96000  ? 358  ARG B N     1 
ATOM   7129 C  CA    . ARG B 2 358 ? -56.75800 -48.62000 16.42000  1.000 88.58000  ? 358  ARG B CA    1 
ATOM   7130 C  C     . ARG B 2 358 ? -56.87300 -47.08900 16.45600  1.000 90.17000  ? 358  ARG B C     1 
ATOM   7131 O  O     . ARG B 2 358 ? -57.72100 -46.54200 17.16900  1.000 90.20000  ? 358  ARG B O     1 
ATOM   7132 C  CB    . ARG B 2 358 ? -58.16200 -49.22800 16.33300  1.000 87.14000  ? 358  ARG B CB    1 
ATOM   7133 C  CG    . ARG B 2 358 ? -58.30400 -50.45900 15.45900  1.000 77.87000  ? 358  ARG B CG    1 
ATOM   7134 C  CD    . ARG B 2 358 ? -59.77200 -50.66300 15.08800  1.000 82.49000  ? 358  ARG B CD    1 
ATOM   7135 N  NE    . ARG B 2 358 ? -60.28100 -49.55300 14.28100  1.000 85.89000  ? 358  ARG B NE    1 
ATOM   7136 C  CZ    . ARG B 2 358 ? -61.51800 -49.06400 14.35700  1.000 94.26000  ? 358  ARG B CZ    1 
ATOM   7137 N  NH1   . ARG B 2 358 ? -62.39700 -49.58400 15.21100  1.000 92.15000  ? 358  ARG B NH1   1 
ATOM   7138 N  NH2   . ARG B 2 358 ? -61.87500 -48.04800 13.57500  1.000 92.31000  ? 358  ARG B NH2   1 
ATOM   7139 N  N     . GLY B 2 359 ? -56.03800 -46.39500 15.68600  1.000 90.52000  ? 359  GLY B N     1 
ATOM   7140 C  CA    . GLY B 2 359 ? -56.09100 -44.94600 15.67800  1.000 88.32000  ? 359  GLY B CA    1 
ATOM   7141 C  C     . GLY B 2 359 ? -55.10500 -44.23300 14.77500  1.000 86.70000  ? 359  GLY B C     1 
ATOM   7142 O  O     . GLY B 2 359 ? -54.97900 -44.54800 13.58400  1.000 82.82000  ? 359  GLY B O     1 
ATOM   7143 N  N     . ALA B 2 360 ? -54.41700 -43.25500 15.36400  1.000 81.39000  ? 360  ALA B N     1 
ATOM   7144 C  CA    . ALA B 2 360 ? -53.53200 -42.34600 14.63600  1.000 86.87000  ? 360  ALA B CA    1 
ATOM   7145 C  C     . ALA B 2 360 ? -52.08600 -42.82400 14.62500  1.000 89.64000  ? 360  ALA B C     1 
ATOM   7146 O  O     . ALA B 2 360 ? -51.52000 -43.11900 13.56800  1.000 86.06000  ? 360  ALA B O     1 
ATOM   7147 C  CB    . ALA B 2 360 ? -53.60300 -40.94200 15.24200  1.000 89.87000  ? 360  ALA B CB    1 
ATOM   7148 N  N     . HIS B 2 361 ? -51.49300 -42.89900 15.81000  1.000 95.08000  ? 361  HIS B N     1 
ATOM   7149 C  CA    . HIS B 2 361 ? -50.06900 -43.18800 15.93900  1.000 93.41000  ? 361  HIS B CA    1 
ATOM   7150 C  C     . HIS B 2 361 ? -49.67100 -44.60900 15.52900  1.000 88.13000  ? 361  HIS B C     1 
ATOM   7151 O  O     . HIS B 2 361 ? -48.51800 -45.01100 15.74200  1.000 88.93000  ? 361  HIS B O     1 
ATOM   7152 C  CB    . HIS B 2 361 ? -49.62800 -42.91800 17.37700  1.000 93.45000  ? 361  HIS B CB    1 
ATOM   7153 C  CG    . HIS B 2 361 ? -49.68300 -41.47700 17.75700  1.000 104.73000 ? 361  HIS B CG    1 
ATOM   7154 N  ND1   . HIS B 2 361 ? -50.26200 -40.51400 16.94100  1.000 104.92000 ? 361  HIS B ND1   1 
ATOM   7155 C  CD2   . HIS B 2 361 ? -49.23200 -40.81100 18.84500  1.000 107.29000 ? 361  HIS B CD2   1 
ATOM   7156 C  CE1   . HIS B 2 361 ? -50.16300 -39.33500 17.51800  1.000 106.75000 ? 361  HIS B CE1   1 
ATOM   7157 N  NE2   . HIS B 2 361 ? -49.54000 -39.48500 18.67800  1.000 111.26000 ? 361  HIS B NE2   1 
ATOM   7158 N  N     . THR B 2 362 ? -50.60200 -45.36500 14.94100  1.000 76.45000  ? 362  THR B N     1 
ATOM   7159 C  CA    . THR B 2 362 ? -50.32300 -46.75600 14.62000  1.000 68.21000  ? 362  THR B CA    1 
ATOM   7160 C  C     . THR B 2 362 ? -49.16400 -46.82100 13.62900  1.000 60.15000  ? 362  THR B C     1 
ATOM   7161 O  O     . THR B 2 362 ? -49.15300 -46.14700 12.59200  1.000 61.82000  ? 362  THR B O     1 
ATOM   7162 C  CB    . THR B 2 362 ? -51.56900 -47.50400 14.05800  1.000 68.96000  ? 362  THR B CB    1 
ATOM   7163 O  OG1   . THR B 2 362 ? -51.24600 -48.13200 12.80800  1.000 56.68000  ? 362  THR B OG1   1 
ATOM   7164 C  CG2   . THR B 2 362 ? -52.73100 -46.55500 13.86600  1.000 74.98000  ? 362  THR B CG2   1 
ATOM   7165 N  N     . ASN B 2 363 ? -48.17400 -47.62500 13.98900  1.000 49.65000  ? 363  ASN B N     1 
ATOM   7166 C  CA    . ASN B 2 363 ? -46.96500 -47.76600 13.21100  1.000 43.99000  ? 363  ASN B CA    1 
ATOM   7167 C  C     . ASN B 2 363 ? -46.77200 -49.22500 12.81100  1.000 38.92000  ? 363  ASN B C     1 
ATOM   7168 O  O     . ASN B 2 363 ? -46.34400 -50.03100 13.62300  1.000 39.29000  ? 363  ASN B O     1 
ATOM   7169 C  CB    . ASN B 2 363 ? -45.77900 -47.25100 14.02700  1.000 38.49000  ? 363  ASN B CB    1 
ATOM   7170 C  CG    . ASN B 2 363 ? -44.44100 -47.58300 13.40300  1.000 39.05000  ? 363  ASN B CG    1 
ATOM   7171 O  OD1   . ASN B 2 363 ? -44.34300 -48.34300 12.43700  1.000 38.28000  ? 363  ASN B OD1   1 
ATOM   7172 N  ND2   . ASN B 2 363 ? -43.38600 -47.02400 13.97700  1.000 39.95000  ? 363  ASN B ND2   1 
ATOM   7173 N  N     . ASP B 2 364 ? -47.04800 -49.54900 11.55400  1.000 35.65000  ? 364  ASP B N     1 
ATOM   7174 C  CA    . ASP B 2 364 ? -46.93400 -50.91800 11.08800  1.000 34.40000  ? 364  ASP B CA    1 
ATOM   7175 C  C     . ASP B 2 364 ? -45.59300 -51.54600 11.42900  1.000 36.65000  ? 364  ASP B C     1 
ATOM   7176 O  O     . ASP B 2 364 ? -45.54000 -52.70200 11.85200  1.000 40.17000  ? 364  ASP B O     1 
ATOM   7177 C  CB    . ASP B 2 364 ? -47.14700 -50.99500 9.58400   1.000 35.36000  ? 364  ASP B CB    1 
ATOM   7178 C  CG    . ASP B 2 364 ? -48.59400 -50.88400 9.21000   1.000 37.76000  ? 364  ASP B CG    1 
ATOM   7179 O  OD1   . ASP B 2 364 ? -49.43400 -51.02400 10.12400  1.000 39.64000  ? 364  ASP B OD1   1 
ATOM   7180 O  OD2   . ASP B 2 364 ? -48.89100 -50.67600 8.01100   1.000 38.78000  ? 364  ASP B OD2   1 
ATOM   7181 N  N     . VAL B 2 365 ? -44.50800 -50.80400 11.26300  1.000 30.69000  ? 365  VAL B N     1 
ATOM   7182 C  CA    . VAL B 2 365 ? -43.20000 -51.41200 11.49600  1.000 34.36000  ? 365  VAL B CA    1 
ATOM   7183 C  C     . VAL B 2 365 ? -43.00900 -51.78400 12.96300  1.000 35.55000  ? 365  VAL B C     1 
ATOM   7184 O  O     . VAL B 2 365 ? -42.44500 -52.82700 13.26900  1.000 32.61000  ? 365  VAL B O     1 
ATOM   7185 C  CB    . VAL B 2 365 ? -42.06300 -50.49700 11.07100  1.000 31.11000  ? 365  VAL B CB    1 
ATOM   7186 C  CG1   . VAL B 2 365 ? -40.77100 -51.26300 11.10400  1.000 30.69000  ? 365  VAL B CG1   1 
ATOM   7187 C  CG2   . VAL B 2 365 ? -42.33400 -49.96600 9.67100   1.000 34.16000  ? 365  VAL B CG2   1 
ATOM   7188 N  N     . LYS B 2 366 ? -43.49400 -50.92800 13.86300  1.000 37.05000  ? 366  LYS B N     1 
ATOM   7189 C  CA    . LYS B 2 366 ? -43.43800 -51.20400 15.29300  1.000 33.84000  ? 366  LYS B CA    1 
ATOM   7190 C  C     . LYS B 2 366 ? -44.34900 -52.35500 15.69200  1.000 34.21000  ? 366  LYS B C     1 
ATOM   7191 O  O     . LYS B 2 366 ? -43.99000 -53.17000 16.52200  1.000 40.01000  ? 366  LYS B O     1 
ATOM   7192 C  CB    . LYS B 2 366 ? -43.82300 -49.96500 16.09000  1.000 38.30000  ? 366  LYS B CB    1 
ATOM   7193 C  CG    . LYS B 2 366 ? -43.99000 -50.21200 17.58000  1.000 34.46000  ? 366  LYS B CG    1 
ATOM   7194 C  CD    . LYS B 2 366 ? -43.83600 -48.89200 18.32400  1.000 36.71000  ? 366  LYS B CD    1 
ATOM   7195 C  CE    . LYS B 2 366 ? -44.38900 -48.97400 19.72100  1.000 44.83000  ? 366  LYS B CE    1 
ATOM   7196 N  NZ    . LYS B 2 366 ? -45.77600 -49.52000 19.65700  1.000 56.93000  ? 366  LYS B NZ    1 
ATOM   7197 N  N     . GLN B 2 367 ? -45.53500 -52.40900 15.10900  1.000 35.26000  ? 367  GLN B N     1 
ATOM   7198 C  CA    . GLN B 2 367 ? -46.44700 -53.48400 15.41300  1.000 33.50000  ? 367  GLN B CA    1 
ATOM   7199 C  C     . GLN B 2 367 ? -45.85400 -54.77100 14.93000  1.000 32.53000  ? 367  GLN B C     1 
ATOM   7200 O  O     . GLN B 2 367 ? -45.95000 -55.80500 15.60500  1.000 33.43000  ? 367  GLN B O     1 
ATOM   7201 C  CB    . GLN B 2 367 ? -47.80600 -53.27500 14.75600  1.000 35.54000  ? 367  GLN B CB    1 
ATOM   7202 C  CG    . GLN B 2 367 ? -48.60800 -52.16400 15.35100  1.000 36.70000  ? 367  GLN B CG    1 
ATOM   7203 C  CD    . GLN B 2 367 ? -50.00900 -52.13900 14.80700  1.000 45.16000  ? 367  GLN B CD    1 
ATOM   7204 O  OE1   . GLN B 2 367 ? -50.34500 -52.87700 13.86500  1.000 41.43000  ? 367  GLN B OE1   1 
ATOM   7205 N  NE2   . GLN B 2 367 ? -50.85300 -51.29600 15.40100  1.000 45.85000  ? 367  GLN B NE2   1 
ATOM   7206 N  N     . LEU B 2 368 ? -45.25400 -54.71000 13.74300  1.000 31.20000  ? 368  LEU B N     1 
ATOM   7207 C  CA    . LEU B 2 368 ? -44.72400 -55.91300 13.12300  1.000 30.32000  ? 368  LEU B CA    1 
ATOM   7208 C  C     . LEU B 2 368 ? -43.53700 -56.49100 13.88300  1.000 31.35000  ? 368  LEU B C     1 
ATOM   7209 O  O     . LEU B 2 368 ? -43.34900 -57.69900 13.88300  1.000 29.45000  ? 368  LEU B O     1 
ATOM   7210 C  CB    . LEU B 2 368 ? -44.30800 -55.65300 11.68200  1.000 28.89000  ? 368  LEU B CB    1 
ATOM   7211 C  CG    . LEU B 2 368 ? -43.69100 -56.91100 11.07000  1.000 26.90000  ? 368  LEU B CG    1 
ATOM   7212 C  CD1   . LEU B 2 368 ? -44.63300 -58.07900 11.24700  1.000 28.06000  ? 368  LEU B CD1   1 
ATOM   7213 C  CD2   . LEU B 2 368 ? -43.41900 -56.70300 9.62800   1.000 24.75000  ? 368  LEU B CD2   1 
ATOM   7214 N  N     . THR B 2 369 ? -42.73100 -55.64700 14.52900  1.000 33.84000  ? 369  THR B N     1 
ATOM   7215 C  CA    . THR B 2 369 ? -41.56100 -56.18500 15.20500  1.000 32.77000  ? 369  THR B CA    1 
ATOM   7216 C  C     . THR B 2 369 ? -41.99500 -56.68300 16.56900  1.000 32.06000  ? 369  THR B C     1 
ATOM   7217 O  O     . THR B 2 369 ? -41.44200 -57.65200 17.07400  1.000 35.39000  ? 369  THR B O     1 
ATOM   7218 C  CB    . THR B 2 369 ? -40.38900 -55.17200 15.33500  1.000 29.96000  ? 369  THR B CB    1 
ATOM   7219 O  OG1   . THR B 2 369 ? -40.56000 -54.35300 16.49300  1.000 35.28000  ? 369  THR B OG1   1 
ATOM   7220 C  CG2   . THR B 2 369 ? -40.25500 -54.31200 14.09900  1.000 23.70000  ? 369  THR B CG2   1 
ATOM   7221 N  N     . GLU B 2 370 ? -43.00700 -56.03600 17.13700  1.000 31.79000  ? 370  GLU B N     1 
ATOM   7222 C  CA    . GLU B 2 370 ? -43.69600 -56.57600 18.30900  1.000 35.88000  ? 370  GLU B CA    1 
ATOM   7223 C  C     . GLU B 2 370 ? -44.34000 -57.94200 18.02100  1.000 35.52000  ? 370  GLU B C     1 
ATOM   7224 O  O     . GLU B 2 370 ? -44.25900 -58.85900 18.83200  1.000 36.69000  ? 370  GLU B O     1 
ATOM   7225 C  CB    . GLU B 2 370 ? -44.76100 -55.60100 18.79900  1.000 36.51000  ? 370  GLU B CB    1 
ATOM   7226 C  CG    . GLU B 2 370 ? -44.21900 -54.47700 19.65500  1.000 38.44000  ? 370  GLU B CG    1 
ATOM   7227 C  CD    . GLU B 2 370 ? -45.27500 -53.41900 19.93400  1.000 51.51000  ? 370  GLU B CD    1 
ATOM   7228 O  OE1   . GLU B 2 370 ? -46.43000 -53.59300 19.47000  1.000 49.08000  ? 370  GLU B OE1   1 
ATOM   7229 O  OE2   . GLU B 2 370 ? -44.94700 -52.41400 20.60900  1.000 53.08000  ? 370  GLU B OE2   1 
ATOM   7230 N  N     . ALA B 2 371 ? -44.97800 -58.07900 16.86700  1.000 33.96000  ? 371  ALA B N     1 
ATOM   7231 C  CA    . ALA B 2 371 ? -45.49500 -59.38000 16.47700  1.000 34.98000  ? 371  ALA B CA    1 
ATOM   7232 C  C     . ALA B 2 371 ? -44.39400 -60.46800 16.43500  1.000 35.21000  ? 371  ALA B C     1 
ATOM   7233 O  O     . ALA B 2 371 ? -44.56300 -61.52500 17.05400  1.000 34.43000  ? 371  ALA B O     1 
ATOM   7234 C  CB    . ALA B 2 371 ? -46.19500 -59.29400 15.13400  1.000 29.24000  ? 371  ALA B CB    1 
ATOM   7235 N  N     . VAL B 2 372 ? -43.28500 -60.22900 15.71900  1.000 28.62000  ? 372  VAL B N     1 
ATOM   7236 C  CA    . VAL B 2 372 ? -42.25100 -61.26700 15.63100  1.000 32.03000  ? 372  VAL B CA    1 
ATOM   7237 C  C     . VAL B 2 372 ? -41.60200 -61.52700 16.98600  1.000 35.79000  ? 372  VAL B C     1 
ATOM   7238 O  O     . VAL B 2 372 ? -41.01100 -62.59200 17.19100  1.000 38.62000  ? 372  VAL B O     1 
ATOM   7239 C  CB    . VAL B 2 372 ? -41.09000 -60.94100 14.62800  1.000 31.52000  ? 372  VAL B CB    1 
ATOM   7240 C  CG1   . VAL B 2 372 ? -41.62300 -60.45500 13.28000  1.000 27.21000  ? 372  VAL B CG1   1 
ATOM   7241 C  CG2   . VAL B 2 372 ? -40.13400 -59.96300 15.23400  1.000 30.56000  ? 372  VAL B CG2   1 
ATOM   7242 N  N     . GLN B 2 373 ? -41.69200 -60.57000 17.90500  1.000 29.46000  ? 373  GLN B N     1 
ATOM   7243 C  CA    . GLN B 2 373 ? -41.13400 -60.79700 19.22200  1.000 33.34000  ? 373  GLN B CA    1 
ATOM   7244 C  C     . GLN B 2 373 ? -42.06600 -61.62300 20.10800  1.000 36.73000  ? 373  GLN B C     1 
ATOM   7245 O  O     . GLN B 2 373 ? -41.59900 -62.43200 20.91500  1.000 40.86000  ? 373  GLN B O     1 
ATOM   7246 C  CB    . GLN B 2 373 ? -40.79400 -59.47500 19.90500  1.000 35.75000  ? 373  GLN B CB    1 
ATOM   7247 C  CG    . GLN B 2 373 ? -39.55200 -58.80200 19.32400  1.000 38.37000  ? 373  GLN B CG    1 
ATOM   7248 C  CD    . GLN B 2 373 ? -39.22000 -57.50400 20.03300  1.000 35.18000  ? 373  GLN B CD    1 
ATOM   7249 O  OE1   . GLN B 2 373 ? -38.67500 -57.51700 21.14000  1.000 37.13000  ? 373  GLN B OE1   1 
ATOM   7250 N  NE2   . GLN B 2 373 ? -39.56000 -56.37500 19.40800  1.000 31.73000  ? 373  GLN B NE2   1 
ATOM   7251 N  N     . LYS B 2 374 ? -43.37300 -61.42500 19.96700  1.000 32.16000  ? 374  LYS B N     1 
ATOM   7252 C  CA    . LYS B 2 374 ? -44.31500 -62.25600 20.69300  1.000 32.99000  ? 374  LYS B CA    1 
ATOM   7253 C  C     . LYS B 2 374 ? -44.28700 -63.68100 20.13800  1.000 36.14000  ? 374  LYS B C     1 
ATOM   7254 O  O     . LYS B 2 374 ? -44.42000 -64.63800 20.88500  1.000 42.69000  ? 374  LYS B O     1 
ATOM   7255 C  CB    . LYS B 2 374 ? -45.72400 -61.67700 20.60600  1.000 40.09000  ? 374  LYS B CB    1 
ATOM   7256 C  CG    . LYS B 2 374 ? -46.80700 -62.57600 21.17500  1.000 48.41000  ? 374  LYS B CG    1 
ATOM   7257 C  CD    . LYS B 2 374 ? -48.14800 -62.25200 20.51000  1.000 60.95000  ? 374  LYS B CD    1 
ATOM   7258 C  CE    . LYS B 2 374 ? -49.29400 -63.15300 20.97700  1.000 60.72000  ? 374  LYS B CE    1 
ATOM   7259 N  NZ    . LYS B 2 374 ? -50.60600 -62.63000 20.47500  1.000 54.35000  ? 374  LYS B NZ    1 
ATOM   7260 N  N     . ILE B 2 375 ? -44.09800 -63.80900 18.82800  1.000 32.75000  ? 375  ILE B N     1 
ATOM   7261 C  CA    . ILE B 2 375 ? -44.09300 -65.10800 18.17900  1.000 31.96000  ? 375  ILE B CA    1 
ATOM   7262 C  C     . ILE B 2 375 ? -42.80200 -65.87700 18.41900  1.000 35.15000  ? 375  ILE B C     1 
ATOM   7263 O  O     . ILE B 2 375 ? -42.81600 -67.09700 18.54600  1.000 37.78000  ? 375  ILE B O     1 
ATOM   7264 C  CB    . ILE B 2 375 ? -44.29700 -64.97600 16.66700  1.000 30.71000  ? 375  ILE B CB    1 
ATOM   7265 C  CG1   . ILE B 2 375 ? -45.64600 -64.32400 16.35600  1.000 32.91000  ? 375  ILE B CG1   1 
ATOM   7266 C  CG2   . ILE B 2 375 ? -44.20300 -66.33800 16.00600  1.000 30.62000  ? 375  ILE B CG2   1 
ATOM   7267 C  CD1   . ILE B 2 375 ? -45.80500 -63.94500 14.90400  1.000 31.29000  ? 375  ILE B CD1   1 
ATOM   7268 N  N     . THR B 2 376 ? -41.67900 -65.17300 18.45100  1.000 35.31000  ? 376  THR B N     1 
ATOM   7269 C  CA    . THR B 2 376 ? -40.42600 -65.83100 18.76000  1.000 36.25000  ? 376  THR B CA    1 
ATOM   7270 C  C     . THR B 2 376 ? -40.55800 -66.37100 20.17000  1.000 38.97000  ? 376  THR B C     1 
ATOM   7271 O  O     . THR B 2 376 ? -40.24900 -67.53100 20.43700  1.000 41.44000  ? 376  THR B O     1 
ATOM   7272 C  CB    . THR B 2 376 ? -39.21300 -64.88200 18.66600  1.000 36.11000  ? 376  THR B CB    1 
ATOM   7273 O  OG1   . THR B 2 376 ? -39.04700 -64.44900 17.31100  1.000 34.09000  ? 376  THR B OG1   1 
ATOM   7274 C  CG2   . THR B 2 376 ? -37.94800 -65.59600 19.12600  1.000 28.96000  ? 376  THR B CG2   1 
ATOM   7275 N  N     . THR B 2 377 ? -41.05900 -65.51500 21.05600  1.000 38.07000  ? 377  THR B N     1 
ATOM   7276 C  CA    . THR B 2 377 ? -41.22100 -65.87100 22.45600  1.000 38.77000  ? 377  THR B CA    1 
ATOM   7277 C  C     . THR B 2 377 ? -42.04000 -67.13200 22.64000  1.000 41.00000  ? 377  THR B C     1 
ATOM   7278 O  O     . THR B 2 377 ? -41.66900 -67.99800 23.42200  1.000 43.74000  ? 377  THR B O     1 
ATOM   7279 C  CB    . THR B 2 377 ? -41.89200 -64.75600 23.24700  1.000 39.39000  ? 377  THR B CB    1 
ATOM   7280 O  OG1   . THR B 2 377 ? -40.96600 -63.67600 23.42000  1.000 44.02000  ? 377  THR B OG1   1 
ATOM   7281 C  CG2   . THR B 2 377 ? -42.29900 -65.27900 24.60800  1.000 40.25000  ? 377  THR B CG2   1 
ATOM   7282 N  N     . GLU B 2 378 ? -43.14800 -67.23900 21.92200  1.000 43.60000  ? 378  GLU B N     1 
ATOM   7283 C  CA    . GLU B 2 378 ? -43.98300 -68.42600 22.02500  1.000 39.27000  ? 378  GLU B CA    1 
ATOM   7284 C  C     . GLU B 2 378 ? -43.24500 -69.64300 21.51700  1.000 43.43000  ? 378  GLU B C     1 
ATOM   7285 O  O     . GLU B 2 378 ? -43.41600 -70.72000 22.07100  1.000 49.88000  ? 378  GLU B O     1 
ATOM   7286 C  CB    . GLU B 2 378 ? -45.28200 -68.26100 21.25300  1.000 38.98000  ? 378  GLU B CB    1 
ATOM   7287 C  CG    . GLU B 2 378 ? -46.21700 -67.23200 21.83100  1.000 43.21000  ? 378  GLU B CG    1 
ATOM   7288 C  CD    . GLU B 2 378 ? -47.57300 -67.24700 21.14000  1.000 56.88000  ? 378  GLU B CD    1 
ATOM   7289 O  OE1   . GLU B 2 378 ? -47.78500 -68.12300 20.26600  1.000 54.24000  ? 378  GLU B OE1   1 
ATOM   7290 O  OE2   . GLU B 2 378 ? -48.42800 -66.38700 21.47000  1.000 60.77000  ? 378  GLU B OE2   1 
ATOM   7291 N  N     . SER B 2 379 ? -42.42600 -69.49600 20.47800  1.000 33.07000  ? 379  SER B N     1 
ATOM   7292 C  CA    . SER B 2 379 ? -41.76300 -70.67200 19.93000  1.000 33.48000  ? 379  SER B CA    1 
ATOM   7293 C  C     . SER B 2 379 ? -40.74100 -71.22700 20.90000  1.000 42.06000  ? 379  SER B C     1 
ATOM   7294 O  O     . SER B 2 379 ? -40.65400 -72.43400 21.07900  1.000 45.99000  ? 379  SER B O     1 
ATOM   7295 C  CB    . SER B 2 379 ? -41.07000 -70.35400 18.61500  1.000 39.47000  ? 379  SER B CB    1 
ATOM   7296 O  OG    . SER B 2 379 ? -41.90700 -69.56200 17.79900  1.000 54.05000  ? 379  SER B OG    1 
ATOM   7297 N  N     . ILE B 2 380 ? -39.94400 -70.33800 21.49400  1.000 38.19000  ? 380  ILE B N     1 
ATOM   7298 C  CA    . ILE B 2 380 ? -38.93100 -70.74300 22.44800  1.000 38.58000  ? 380  ILE B CA    1 
ATOM   7299 C  C     . ILE B 2 380 ? -39.60000 -71.52100 23.57500  1.000 42.63000  ? 380  ILE B C     1 
ATOM   7300 O  O     . ILE B 2 380 ? -39.12500 -72.57200 24.00000  1.000 40.32000  ? 380  ILE B O     1 
ATOM   7301 C  CB    . ILE B 2 380 ? -38.17100 -69.52400 23.01700  1.000 39.97000  ? 380  ILE B CB    1 
ATOM   7302 C  CG1   . ILE B 2 380 ? -37.12400 -69.03100 22.02000  1.000 39.80000  ? 380  ILE B CG1   1 
ATOM   7303 C  CG2   . ILE B 2 380 ? -37.47800 -69.87600 24.32400  1.000 41.08000  ? 380  ILE B CG2   1 
ATOM   7304 C  CD1   . ILE B 2 380 ? -36.84000 -67.54500 22.12600  1.000 37.37000  ? 380  ILE B CD1   1 
ATOM   7305 N  N     . VAL B 2 381 ? -40.73000 -70.99900 24.03000  1.000 42.55000  ? 381  VAL B N     1 
ATOM   7306 C  CA    . VAL B 2 381 ? -41.47500 -71.60400 25.12300  1.000 38.51000  ? 381  VAL B CA    1 
ATOM   7307 C  C     . VAL B 2 381 ? -42.06600 -72.97000 24.77600  1.000 45.06000  ? 381  VAL B C     1 
ATOM   7308 O  O     . VAL B 2 381 ? -42.07200 -73.86600 25.60300  1.000 56.49000  ? 381  VAL B O     1 
ATOM   7309 C  CB    . VAL B 2 381 ? -42.60200 -70.68500 25.56700  1.000 38.84000  ? 381  VAL B CB    1 
ATOM   7310 C  CG1   . VAL B 2 381 ? -43.55300 -71.42800 26.45800  1.000 41.52000  ? 381  VAL B CG1   1 
ATOM   7311 C  CG2   . VAL B 2 381 ? -42.02500 -69.46800 26.27000  1.000 40.48000  ? 381  VAL B CG2   1 
ATOM   7312 N  N     . ILE B 2 382 ? -42.56000 -73.13700 23.55800  1.000 45.34000  ? 382  ILE B N     1 
ATOM   7313 C  CA    . ILE B 2 382 ? -43.24100 -74.36600 23.19900  1.000 40.66000  ? 382  ILE B CA    1 
ATOM   7314 C  C     . ILE B 2 382 ? -42.26900 -75.40900 22.66100  1.000 44.86000  ? 382  ILE B C     1 
ATOM   7315 O  O     . ILE B 2 382 ? -42.35300 -76.57000 23.04600  1.000 52.94000  ? 382  ILE B O     1 
ATOM   7316 C  CB    . ILE B 2 382 ? -44.36000 -74.08600 22.17100  1.000 44.01000  ? 382  ILE B CB    1 
ATOM   7317 C  CG1   . ILE B 2 382 ? -45.53900 -73.41900 22.88100  1.000 43.49000  ? 382  ILE B CG1   1 
ATOM   7318 C  CG2   . ILE B 2 382 ? -44.82400 -75.36000 21.48600  1.000 44.10000  ? 382  ILE B CG2   1 
ATOM   7319 C  CD1   . ILE B 2 382 ? -46.42700 -72.64200 21.97000  1.000 43.45000  ? 382  ILE B CD1   1 
ATOM   7320 N  N     . TRP B 2 383 ? -41.34100 -75.00800 21.79500  1.000 44.50000  ? 383  TRP B N     1 
ATOM   7321 C  CA    . TRP B 2 383 ? -40.40600 -75.95700 21.18300  1.000 42.48000  ? 383  TRP B CA    1 
ATOM   7322 C  C     . TRP B 2 383 ? -38.92900 -75.63100 21.45200  1.000 46.00000  ? 383  TRP B C     1 
ATOM   7323 O  O     . TRP B 2 383 ? -38.02700 -76.30400 20.92400  1.000 46.64000  ? 383  TRP B O     1 
ATOM   7324 C  CB    . TRP B 2 383 ? -40.63600 -76.02300 19.67400  1.000 42.86000  ? 383  TRP B CB    1 
ATOM   7325 C  CG    . TRP B 2 383 ? -42.04900 -76.28800 19.27800  1.000 48.29000  ? 383  TRP B CG    1 
ATOM   7326 C  CD1   . TRP B 2 383 ? -42.71000 -77.47900 19.35300  1.000 50.45000  ? 383  TRP B CD1   1 
ATOM   7327 C  CD2   . TRP B 2 383 ? -42.97700 -75.34900 18.72100  1.000 48.09000  ? 383  TRP B CD2   1 
ATOM   7328 N  NE1   . TRP B 2 383 ? -44.00100 -77.33700 18.88800  1.000 51.84000  ? 383  TRP B NE1   1 
ATOM   7329 C  CE2   . TRP B 2 383 ? -44.18700 -76.03900 18.49200  1.000 46.67000  ? 383  TRP B CE2   1 
ATOM   7330 C  CE3   . TRP B 2 383 ? -42.90700 -73.99100 18.39700  1.000 45.19000  ? 383  TRP B CE3   1 
ATOM   7331 C  CZ2   . TRP B 2 383 ? -45.30800 -75.41700 17.95900  1.000 44.32000  ? 383  TRP B CZ2   1 
ATOM   7332 C  CZ3   . TRP B 2 383 ? -44.02400 -73.37900 17.87000  1.000 40.78000  ? 383  TRP B CZ3   1 
ATOM   7333 C  CH2   . TRP B 2 383 ? -45.21000 -74.09000 17.65900  1.000 43.51000  ? 383  TRP B CH2   1 
ATOM   7334 N  N     . GLY B 2 384 ? -38.67700 -74.60200 22.26000  1.000 43.43000  ? 384  GLY B N     1 
ATOM   7335 C  CA    . GLY B 2 384 ? -37.31900 -74.21700 22.61800  1.000 41.55000  ? 384  GLY B CA    1 
ATOM   7336 C  C     . GLY B 2 384 ? -36.42300 -73.98300 21.42500  1.000 39.88000  ? 384  GLY B C     1 
ATOM   7337 O  O     . GLY B 2 384 ? -35.31300 -74.50400 21.36500  1.000 44.52000  ? 384  GLY B O     1 
ATOM   7338 N  N     . LYS B 2 385 ? -36.91000 -73.19700 20.47300  1.000 47.33000  ? 385  LYS B N     1 
ATOM   7339 C  CA    . LYS B 2 385 ? -36.19900 -72.93700 19.22000  1.000 44.09000  ? 385  LYS B CA    1 
ATOM   7340 C  C     . LYS B 2 385 ? -36.72200 -71.62800 18.60100  1.000 41.88000  ? 385  LYS B C     1 
ATOM   7341 O  O     . LYS B 2 385 ? -37.76800 -71.10200 18.98800  1.000 42.04000  ? 385  LYS B O     1 
ATOM   7342 C  CB    . LYS B 2 385 ? -36.37600 -74.11500 18.25000  1.000 39.58000  ? 385  LYS B CB    1 
ATOM   7343 C  CG    . LYS B 2 385 ? -35.42000 -74.19300 17.07000  1.000 36.62000  ? 385  LYS B CG    1 
ATOM   7344 C  CD    . LYS B 2 385 ? -35.62000 -75.54300 16.35300  1.000 47.19000  ? 385  LYS B CD    1 
ATOM   7345 C  CE    . LYS B 2 385 ? -35.37200 -75.49900 14.84200  1.000 53.26000  ? 385  LYS B CE    1 
ATOM   7346 N  NZ    . LYS B 2 385 ? -33.93700 -75.68800 14.45600  1.000 55.31000  ? 385  LYS B NZ    1 
ATOM   7347 N  N     . THR B 2 386 ? -35.98700 -71.11100 17.63500  1.000 42.71000  ? 386  THR B N     1 
ATOM   7348 C  CA    . THR B 2 386 ? -36.32400 -69.84200 17.03400  1.000 33.30000  ? 386  THR B CA    1 
ATOM   7349 C  C     . THR B 2 386 ? -36.83600 -70.05500 15.60500  1.000 37.62000  ? 386  THR B C     1 
ATOM   7350 O  O     . THR B 2 386 ? -36.24900 -70.82600 14.82600  1.000 36.73000  ? 386  THR B O     1 
ATOM   7351 C  CB    . THR B 2 386 ? -35.09900 -68.92400 17.04200  1.000 35.46000  ? 386  THR B CB    1 
ATOM   7352 O  OG1   . THR B 2 386 ? -35.39600 -67.75800 17.81200  1.000 34.56000  ? 386  THR B OG1   1 
ATOM   7353 C  CG2   . THR B 2 386 ? -34.68100 -68.53800 15.60700  1.000 41.88000  ? 386  THR B CG2   1 
ATOM   7354 N  N     . PRO B 2 387 ? -37.94700 -69.39500 15.26200  1.000 36.67000  ? 387  PRO B N     1 
ATOM   7355 C  CA    . PRO B 2 387 ? -38.49500 -69.49500 13.90200  1.000 31.52000  ? 387  PRO B CA    1 
ATOM   7356 C  C     . PRO B 2 387 ? -37.73700 -68.61800 12.89700  1.000 32.88000  ? 387  PRO B C     1 
ATOM   7357 O  O     . PRO B 2 387 ? -37.22700 -67.56400 13.26600  1.000 37.88000  ? 387  PRO B O     1 
ATOM   7358 C  CB    . PRO B 2 387 ? -39.93800 -68.99000 14.05900  1.000 32.98000  ? 387  PRO B CB    1 
ATOM   7359 C  CG    . PRO B 2 387 ? -40.18000 -68.84100 15.51200  1.000 31.81000  ? 387  PRO B CG    1 
ATOM   7360 C  CD    . PRO B 2 387 ? -38.83200 -68.61700 16.14000  1.000 38.83000  ? 387  PRO B CD    1 
ATOM   7361 N  N     . LYS B 2 388 ? -37.66300 -69.07500 11.65200  1.000 33.32000  ? 388  LYS B N     1 
ATOM   7362 C  CA    . LYS B 2 388 ? -37.32500 -68.22800 10.51600  1.000 32.15000  ? 388  LYS B CA    1 
ATOM   7363 C  C     . LYS B 2 388 ? -38.57700 -67.46600 10.06600  1.000 34.38000  ? 388  LYS B C     1 
ATOM   7364 O  O     . LYS B 2 388 ? -39.57600 -68.07500 9.67800   1.000 35.38000  ? 388  LYS B O     1 
ATOM   7365 C  CB    . LYS B 2 388 ? -36.78800 -69.07900 9.36400   1.000 32.41000  ? 388  LYS B CB    1 
ATOM   7366 C  CG    . LYS B 2 388 ? -35.34100 -68.84100 8.98800   1.000 37.81000  ? 388  LYS B CG    1 
ATOM   7367 C  CD    . LYS B 2 388 ? -35.25000 -68.00900 7.70800   1.000 44.30000  ? 388  LYS B CD    1 
ATOM   7368 C  CE    . LYS B 2 388 ? -34.28600 -68.62200 6.67900   1.000 46.53000  ? 388  LYS B CE    1 
ATOM   7369 N  NZ    . LYS B 2 388 ? -34.11500 -67.72900 5.48700   1.000 49.46000  ? 388  LYS B NZ    1 
ATOM   7370 N  N     . PHE B 2 389 ? -38.55100 -66.14000 10.13300  1.000 34.37000  ? 389  PHE B N     1 
ATOM   7371 C  CA    . PHE B 2 389 ? -39.71600 -65.36400 9.71100   1.000 31.87000  ? 389  PHE B CA    1 
ATOM   7372 C  C     . PHE B 2 389 ? -39.72200 -65.00500 8.22700   1.000 29.29000  ? 389  PHE B C     1 
ATOM   7373 O  O     . PHE B 2 389 ? -38.69800 -64.61000 7.66100   1.000 30.40000  ? 389  PHE B O     1 
ATOM   7374 C  CB    . PHE B 2 389 ? -39.81600 -64.08100 10.51500  1.000 25.81000  ? 389  PHE B CB    1 
ATOM   7375 C  CG    . PHE B 2 389 ? -40.27600 -64.29300 11.89600  1.000 29.54000  ? 389  PHE B CG    1 
ATOM   7376 C  CD1   . PHE B 2 389 ? -39.37800 -64.66000 12.89100  1.000 33.23000  ? 389  PHE B CD1   1 
ATOM   7377 C  CD2   . PHE B 2 389 ? -41.61700 -64.13400 12.22700  1.000 28.88000  ? 389  PHE B CD2   1 
ATOM   7378 C  CE1   . PHE B 2 389 ? -39.81300 -64.86500 14.20700  1.000 36.91000  ? 389  PHE B CE1   1 
ATOM   7379 C  CE2   . PHE B 2 389 ? -42.05700 -64.34100 13.53300  1.000 31.27000  ? 389  PHE B CE2   1 
ATOM   7380 C  CZ    . PHE B 2 389 ? -41.15400 -64.69800 14.52600  1.000 30.46000  ? 389  PHE B CZ    1 
ATOM   7381 N  N     . LYS B 2 390 ? -40.89000 -65.13800 7.61600   1.000 30.87000  ? 390  LYS B N     1 
ATOM   7382 C  CA    . LYS B 2 390 ? -41.16000 -64.56800 6.29800   1.000 28.79000  ? 390  LYS B CA    1 
ATOM   7383 C  C     . LYS B 2 390 ? -41.95800 -63.29900 6.50500   1.000 28.88000  ? 390  LYS B C     1 
ATOM   7384 O  O     . LYS B 2 390 ? -43.12400 -63.36300 6.89500   1.000 32.54000  ? 390  LYS B O     1 
ATOM   7385 C  CB    . LYS B 2 390 ? -41.94100 -65.54800 5.41800   1.000 35.05000  ? 390  LYS B CB    1 
ATOM   7386 C  CG    . LYS B 2 390 ? -41.11300 -66.69900 4.85200   1.000 39.02000  ? 390  LYS B CG    1 
ATOM   7387 C  CD    . LYS B 2 390 ? -42.00300 -67.63300 4.07000   1.000 40.78000  ? 390  LYS B CD    1 
ATOM   7388 C  CE    . LYS B 2 390 ? -41.21000 -68.54300 3.17500   1.000 45.86000  ? 390  LYS B CE    1 
ATOM   7389 N  NZ    . LYS B 2 390 ? -42.17600 -69.21500 2.27000   1.000 56.91000  ? 390  LYS B NZ    1 
ATOM   7390 N  N     . LEU B 2 391 ? -41.34600 -62.15300 6.24800   1.000 28.05000  ? 391  LEU B N     1 
ATOM   7391 C  CA    . LEU B 2 391 ? -41.92800 -60.88000 6.65200   1.000 25.44000  ? 391  LEU B CA    1 
ATOM   7392 C  C     . LEU B 2 391 ? -42.52000 -60.09900 5.49800   1.000 25.85000  ? 391  LEU B C     1 
ATOM   7393 O  O     . LEU B 2 391 ? -41.85600 -59.87900 4.48900   1.000 32.31000  ? 391  LEU B O     1 
ATOM   7394 C  CB    . LEU B 2 391 ? -40.86800 -60.02200 7.34100   1.000 25.32000  ? 391  LEU B CB    1 
ATOM   7395 C  CG    . LEU B 2 391 ? -40.22600 -60.62000 8.58000   1.000 23.55000  ? 391  LEU B CG    1 
ATOM   7396 C  CD1   . LEU B 2 391 ? -39.06100 -59.77000 9.04700   1.000 25.96000  ? 391  LEU B CD1   1 
ATOM   7397 C  CD2   . LEU B 2 391 ? -41.27600 -60.68800 9.64900   1.000 26.99000  ? 391  LEU B CD2   1 
ATOM   7398 N  N     . PRO B 2 392 ? -43.76800 -59.65400 5.65900   1.000 25.03000  ? 392  PRO B N     1 
ATOM   7399 C  CA    . PRO B 2 392 ? -44.53100 -58.86700 4.68900   1.000 30.23000  ? 392  PRO B CA    1 
ATOM   7400 C  C     . PRO B 2 392 ? -44.19200 -57.38700 4.77700   1.000 32.67000  ? 392  PRO B C     1 
ATOM   7401 O  O     . PRO B 2 392 ? -45.06300 -56.54800 5.10400   1.000 28.64000  ? 392  PRO B O     1 
ATOM   7402 C  CB    . PRO B 2 392 ? -45.97100 -59.11600 5.11900   1.000 28.48000  ? 392  PRO B CB    1 
ATOM   7403 C  CG    . PRO B 2 392 ? -45.87000 -59.23700 6.58700   1.000 20.82000  ? 392  PRO B CG    1 
ATOM   7404 C  CD    . PRO B 2 392 ? -44.58000 -59.96100 6.84900   1.000 27.35000  ? 392  PRO B CD    1 
ATOM   7405 N  N     . ILE B 2 393 ? -42.92900 -57.08500 4.50500   1.000 24.49000  ? 393  ILE B N     1 
ATOM   7406 C  CA    . ILE B 2 393 ? -42.45000 -55.72000 4.53400   1.000 28.67000  ? 393  ILE B CA    1 
ATOM   7407 C  C     . ILE B 2 393 ? -41.30400 -55.59700 3.55600   1.000 30.80000  ? 393  ILE B C     1 
ATOM   7408 O  O     . ILE B 2 393 ? -40.65900 -56.59500 3.23200   1.000 32.61000  ? 393  ILE B O     1 
ATOM   7409 C  CB    . ILE B 2 393 ? -41.98200 -55.30700 5.93200   1.000 29.49000  ? 393  ILE B CB    1 
ATOM   7410 C  CG1   . ILE B 2 393 ? -41.74600 -53.79700 5.97800   1.000 36.46000  ? 393  ILE B CG1   1 
ATOM   7411 C  CG2   . ILE B 2 393 ? -40.70000 -56.00500 6.27600   1.000 27.71000  ? 393  ILE B CG2   1 
ATOM   7412 C  CD1   . ILE B 2 393 ? -41.35100 -53.28800 7.35000   1.000 32.35000  ? 393  ILE B CD1   1 
ATOM   7413 N  N     . GLN B 2 394 ? -41.05500 -54.38900 3.06000   1.000 35.34000  ? 394  GLN B N     1 
ATOM   7414 C  CA    . GLN B 2 394 ? -39.91500 -54.18800 2.17600   1.000 31.82000  ? 394  GLN B CA    1 
ATOM   7415 C  C     . GLN B 2 394 ? -38.66500 -54.34700 3.00300   1.000 30.23000  ? 394  GLN B C     1 
ATOM   7416 O  O     . GLN B 2 394 ? -38.63100 -53.94100 4.15100   1.000 35.27000  ? 394  GLN B O     1 
ATOM   7417 C  CB    . GLN B 2 394 ? -39.94700 -52.81600 1.51800   1.000 32.53000  ? 394  GLN B CB    1 
ATOM   7418 C  CG    . GLN B 2 394 ? -38.64900 -52.45900 0.79600   1.000 47.12000  ? 394  GLN B CG    1 
ATOM   7419 C  CD    . GLN B 2 394 ? -38.64500 -51.04400 0.18300   1.000 57.88000  ? 394  GLN B CD    1 
ATOM   7420 O  OE1   . GLN B 2 394 ? -38.59900 -50.03000 0.90000   1.000 53.16000  ? 394  GLN B OE1   1 
ATOM   7421 N  NE2   . GLN B 2 394 ? -38.68000 -50.97900 -1.15400  1.000 56.31000  ? 394  GLN B NE2   1 
ATOM   7422 N  N     . LYS B 2 395 ? -37.63700 -54.95300 2.43000   1.000 31.05000  ? 395  LYS B N     1 
ATOM   7423 C  CA    . LYS B 2 395 ? -36.37900 -55.14000 3.15300   1.000 33.13000  ? 395  LYS B CA    1 
ATOM   7424 C  C     . LYS B 2 395 ? -35.77500 -53.85300 3.73400   1.000 35.46000  ? 395  LYS B C     1 
ATOM   7425 O  O     . LYS B 2 395 ? -35.34500 -53.81900 4.88900   1.000 34.58000  ? 395  LYS B O     1 
ATOM   7426 C  CB    . LYS B 2 395 ? -35.36400 -55.79400 2.23400   1.000 36.62000  ? 395  LYS B CB    1 
ATOM   7427 C  CG    . LYS B 2 395 ? -33.98500 -55.86800 2.79900   1.000 38.09000  ? 395  LYS B CG    1 
ATOM   7428 C  CD    . LYS B 2 395 ? -33.06100 -56.53000 1.79100   1.000 45.97000  ? 395  LYS B CD    1 
ATOM   7429 C  CE    . LYS B 2 395 ? -31.68000 -55.89300 1.81000   1.000 51.30000  ? 395  LYS B CE    1 
ATOM   7430 N  NZ    . LYS B 2 395 ? -31.66500 -54.56600 1.10200   1.000 51.36000  ? 395  LYS B NZ    1 
ATOM   7431 N  N     . GLU B 2 396 ? -35.74800 -52.79500 2.93900   1.000 39.89000  ? 396  GLU B N     1 
ATOM   7432 C  CA    . GLU B 2 396 ? -35.13300 -51.55400 3.38400   1.000 39.35000  ? 396  GLU B CA    1 
ATOM   7433 C  C     . GLU B 2 396 ? -36.00500 -50.85500 4.42200   1.000 41.94000  ? 396  GLU B C     1 
ATOM   7434 O  O     . GLU B 2 396 ? -35.48600 -50.24600 5.36400   1.000 40.10000  ? 396  GLU B O     1 
ATOM   7435 C  CB    . GLU B 2 396 ? -34.87900 -50.64100 2.19800   1.000 43.25000  ? 396  GLU B CB    1 
ATOM   7436 C  CG    . GLU B 2 396 ? -34.68900 -51.43600 0.90700   1.000 49.70000  ? 396  GLU B CG    1 
ATOM   7437 C  CD    . GLU B 2 396 ? -33.25400 -51.45600 0.44800   1.000 53.68000  ? 396  GLU B CD    1 
ATOM   7438 O  OE1   . GLU B 2 396 ? -32.81900 -52.50000 -0.07900  1.000 59.04000  ? 396  GLU B OE1   1 
ATOM   7439 O  OE2   . GLU B 2 396 ? -32.56500 -50.41900 0.60000   1.000 56.29000  ? 396  GLU B OE2   1 
ATOM   7440 N  N     . THR B 2 397 ? -37.32500 -50.94800 4.27100   1.000 38.14000  ? 397  THR B N     1 
ATOM   7441 C  CA    . THR B 2 397 ? -38.21400 -50.36700 5.27400   1.000 35.06000  ? 397  THR B CA    1 
ATOM   7442 C  C     . THR B 2 397 ? -37.93600 -51.01500 6.62600   1.000 34.29000  ? 397  THR B C     1 
ATOM   7443 O  O     . THR B 2 397 ? -37.85200 -50.33500 7.63500   1.000 40.44000  ? 397  THR B O     1 
ATOM   7444 C  CB    . THR B 2 397 ? -39.70900 -50.55000 4.92700   1.000 38.10000  ? 397  THR B CB    1 
ATOM   7445 O  OG1   . THR B 2 397 ? -40.01000 -49.91700 3.67700   1.000 38.30000  ? 397  THR B OG1   1 
ATOM   7446 C  CG2   . THR B 2 397 ? -40.58000 -49.95700 6.02500   1.000 34.30000  ? 397  THR B CG2   1 
ATOM   7447 N  N     . TRP B 2 398 ? -37.76700 -52.33000 6.63800   1.000 34.23000  ? 398  TRP B N     1 
ATOM   7448 C  CA    . TRP B 2 398 ? -37.54200 -53.05300 7.88000   1.000 33.38000  ? 398  TRP B CA    1 
ATOM   7449 C  C     . TRP B 2 398 ? -36.15500 -52.75700 8.45100   1.000 34.80000  ? 398  TRP B C     1 
ATOM   7450 O  O     . TRP B 2 398 ? -36.02000 -52.45200 9.63400   1.000 34.67000  ? 398  TRP B O     1 
ATOM   7451 C  CB    . TRP B 2 398 ? -37.73300 -54.56000 7.65300   1.000 29.70000  ? 398  TRP B CB    1 
ATOM   7452 C  CG    . TRP B 2 398 ? -37.33300 -55.41200 8.79700   1.000 27.48000  ? 398  TRP B CG    1 
ATOM   7453 C  CD1   . TRP B 2 398 ? -36.11600 -55.98100 9.01000   1.000 33.88000  ? 398  TRP B CD1   1 
ATOM   7454 C  CD2   . TRP B 2 398 ? -38.15800 -55.82400 9.88700   1.000 30.23000  ? 398  TRP B CD2   1 
ATOM   7455 N  NE1   . TRP B 2 398 ? -36.12300 -56.71600 10.17900  1.000 31.48000  ? 398  TRP B NE1   1 
ATOM   7456 C  CE2   . TRP B 2 398 ? -37.36800 -56.63300 10.73600  1.000 26.99000  ? 398  TRP B CE2   1 
ATOM   7457 C  CE3   . TRP B 2 398 ? -39.48900 -55.59700 10.22700  1.000 27.87000  ? 398  TRP B CE3   1 
ATOM   7458 C  CZ2   . TRP B 2 398 ? -37.85800 -57.20500 11.88300  1.000 24.94000  ? 398  TRP B CZ2   1 
ATOM   7459 C  CZ3   . TRP B 2 398 ? -39.97100 -56.15700 11.38400  1.000 32.85000  ? 398  TRP B CZ3   1 
ATOM   7460 C  CH2   . TRP B 2 398 ? -39.15700 -56.95000 12.20400  1.000 28.80000  ? 398  TRP B CH2   1 
ATOM   7461 N  N     . GLU B 2 399 ? -35.12000 -52.84000 7.62000   1.000 36.23000  ? 399  GLU B N     1 
ATOM   7462 C  CA    . GLU B 2 399 ? -33.77200 -52.67400 8.15900   1.000 38.14000  ? 399  GLU B CA    1 
ATOM   7463 C  C     . GLU B 2 399 ? -33.50400 -51.24800 8.60800   1.000 33.38000  ? 399  GLU B C     1 
ATOM   7464 O  O     . GLU B 2 399 ? -32.61400 -51.02300 9.42000   1.000 33.55000  ? 399  GLU B O     1 
ATOM   7465 C  CB    . GLU B 2 399 ? -32.72500 -53.11100 7.13600   1.000 43.88000  ? 399  GLU B CB    1 
ATOM   7466 C  CG    . GLU B 2 399 ? -32.50300 -54.61800 7.10200   1.000 46.29000  ? 399  GLU B CG    1 
ATOM   7467 C  CD    . GLU B 2 399 ? -31.61200 -55.02800 5.94700   1.000 55.79000  ? 399  GLU B CD    1 
ATOM   7468 O  OE1   . GLU B 2 399 ? -31.18500 -56.21000 5.90600   1.000 62.03000  ? 399  GLU B OE1   1 
ATOM   7469 O  OE2   . GLU B 2 399 ? -31.34200 -54.15900 5.08300   1.000 49.08000  ? 399  GLU B OE2   1 
ATOM   7470 N  N     . THR B 2 400 ? -34.28600 -50.29800 8.09300   1.000 36.90000  ? 400  THR B N     1 
ATOM   7471 C  CA    . THR B 2 400 ? -34.17500 -48.89900 8.51800   1.000 36.44000  ? 400  THR B CA    1 
ATOM   7472 C  C     . THR B 2 400 ? -34.63900 -48.68100 9.95600   1.000 38.17000  ? 400  THR B C     1 
ATOM   7473 O  O     . THR B 2 400 ? -34.11900 -47.79900 10.62400  1.000 39.09000  ? 400  THR B O     1 
ATOM   7474 C  CB    . THR B 2 400 ? -35.00600 -47.93000 7.61700   1.000 39.92000  ? 400  THR B CB    1 
ATOM   7475 O  OG1   . THR B 2 400 ? -34.41900 -47.82400 6.31300   1.000 39.91000  ? 400  THR B OG1   1 
ATOM   7476 C  CG2   . THR B 2 400 ? -35.04800 -46.53200 8.22900   1.000 38.75000  ? 400  THR B CG2   1 
ATOM   7477 N  N     . TRP B 2 401 ? -35.61300 -49.46900 10.42700  1.000 38.86000  ? 401  TRP B N     1 
ATOM   7478 C  CA    . TRP B 2 401 ? -36.29000 -49.13800 11.68300  1.000 31.73000  ? 401  TRP B CA    1 
ATOM   7479 C  C     . TRP B 2 401 ? -36.46700 -50.19800 12.76100  1.000 33.71000  ? 401  TRP B C     1 
ATOM   7480 O  O     . TRP B 2 401 ? -36.83400 -49.83900 13.87600  1.000 35.87000  ? 401  TRP B O     1 
ATOM   7481 C  CB    . TRP B 2 401 ? -37.67700 -48.59700 11.37000  1.000 31.52000  ? 401  TRP B CB    1 
ATOM   7482 C  CG    . TRP B 2 401 ? -37.64100 -47.14400 11.06400  1.000 39.93000  ? 401  TRP B CG    1 
ATOM   7483 C  CD1   . TRP B 2 401 ? -37.23000 -46.13200 11.89800  1.000 42.49000  ? 401  TRP B CD1   1 
ATOM   7484 C  CD2   . TRP B 2 401 ? -38.02500 -46.52500 9.84300   1.000 33.88000  ? 401  TRP B CD2   1 
ATOM   7485 N  NE1   . TRP B 2 401 ? -37.33000 -44.92300 11.25500  1.000 39.12000  ? 401  TRP B NE1   1 
ATOM   7486 C  CE2   . TRP B 2 401 ? -37.81300 -45.13900 9.99100   1.000 35.18000  ? 401  TRP B CE2   1 
ATOM   7487 C  CE3   . TRP B 2 401 ? -38.53600 -47.01000 8.63700   1.000 37.10000  ? 401  TRP B CE3   1 
ATOM   7488 C  CZ2   . TRP B 2 401 ? -38.08600 -44.23300 8.97600   1.000 40.67000  ? 401  TRP B CZ2   1 
ATOM   7489 C  CZ3   . TRP B 2 401 ? -38.81000 -46.11900 7.63500   1.000 40.94000  ? 401  TRP B CZ3   1 
ATOM   7490 C  CH2   . TRP B 2 401 ? -38.58900 -44.73900 7.80500   1.000 44.30000  ? 401  TRP B CH2   1 
ATOM   7491 N  N     . TRP B 2 402 ? -36.21400 -51.47900 12.48700  1.000 34.87000  ? 402  TRP B N     1 
ATOM   7492 C  CA    . TRP B 2 402 ? -36.57500 -52.49300 13.49700  1.000 35.79000  ? 402  TRP B CA    1 
ATOM   7493 C  C     . TRP B 2 402 ? -35.81900 -52.35400 14.83400  1.000 34.51000  ? 402  TRP B C     1 
ATOM   7494 O  O     . TRP B 2 402 ? -36.39600 -52.62900 15.89400  1.000 32.98000  ? 402  TRP B O     1 
ATOM   7495 C  CB    . TRP B 2 402 ? -36.40700 -53.91900 12.95200  1.000 28.81000  ? 402  TRP B CB    1 
ATOM   7496 C  CG    . TRP B 2 402 ? -35.00700 -54.40900 12.81300  1.000 31.16000  ? 402  TRP B CG    1 
ATOM   7497 C  CD1   . TRP B 2 402 ? -34.20500 -54.24200 11.74200  1.000 33.67000  ? 402  TRP B CD1   1 
ATOM   7498 C  CD2   . TRP B 2 402 ? -34.26000 -55.19300 13.75600  1.000 29.42000  ? 402  TRP B CD2   1 
ATOM   7499 N  NE1   . TRP B 2 402 ? -32.99400 -54.85000 11.94900  1.000 34.07000  ? 402  TRP B NE1   1 
ATOM   7500 C  CE2   . TRP B 2 402 ? -32.99600 -55.43800 13.18200  1.000 28.85000  ? 402  TRP B CE2   1 
ATOM   7501 C  CE3   . TRP B 2 402 ? -34.53100 -55.69900 15.03600  1.000 31.58000  ? 402  TRP B CE3   1 
ATOM   7502 C  CZ2   . TRP B 2 402 ? -31.99600 -56.17600 13.83500  1.000 27.05000  ? 402  TRP B CZ2   1 
ATOM   7503 C  CZ3   . TRP B 2 402 ? -33.52400 -56.42700 15.69600  1.000 29.93000  ? 402  TRP B CZ3   1 
ATOM   7504 C  CH2   . TRP B 2 402 ? -32.27800 -56.65800 15.08600  1.000 23.98000  ? 402  TRP B CH2   1 
ATOM   7505 N  N     . THR B 2 403 ? -34.56400 -51.91400 14.80500  1.000 33.75000  ? 403  THR B N     1 
ATOM   7506 C  CA    . THR B 2 403 ? -33.79900 -51.82900 16.04700  1.000 30.66000  ? 403  THR B CA    1 
ATOM   7507 C  C     . THR B 2 403 ? -34.29800 -50.72200 16.95800  1.000 35.47000  ? 403  THR B C     1 
ATOM   7508 O  O     . THR B 2 403 ? -33.78900 -50.56500 18.06700  1.000 41.76000  ? 403  THR B O     1 
ATOM   7509 C  CB    . THR B 2 403 ? -32.30200 -51.60900 15.79900  1.000 30.58000  ? 403  THR B CB    1 
ATOM   7510 O  OG1   . THR B 2 403 ? -32.11900 -50.51500 14.89600  1.000 31.40000  ? 403  THR B OG1   1 
ATOM   7511 C  CG2   . THR B 2 403 ? -31.70400 -52.84200 15.20600  1.000 29.60000  ? 403  THR B CG2   1 
ATOM   7512 N  N     . GLU B 2 404 ? -35.30200 -49.97300 16.50800  1.000 35.76000  ? 404  GLU B N     1 
ATOM   7513 C  CA    . GLU B 2 404 ? -35.89100 -48.95000 17.36600  1.000 33.87000  ? 404  GLU B CA    1 
ATOM   7514 C  C     . GLU B 2 404 ? -37.01600 -49.52400 18.24300  1.000 38.76000  ? 404  GLU B C     1 
ATOM   7515 O  O     . GLU B 2 404 ? -37.42700 -48.88000 19.21900  1.000 36.51000  ? 404  GLU B O     1 
ATOM   7516 C  CB    . GLU B 2 404 ? -36.41900 -47.77200 16.53100  1.000 37.64000  ? 404  GLU B CB    1 
ATOM   7517 C  CG    . GLU B 2 404 ? -35.33100 -46.85900 15.90200  1.000 46.77000  ? 404  GLU B CG    1 
ATOM   7518 C  CD    . GLU B 2 404 ? -34.58500 -45.98900 16.92900  1.000 49.32000  ? 404  GLU B CD    1 
ATOM   7519 O  OE1   . GLU B 2 404 ? -33.33400 -45.92300 16.86200  1.000 49.75000  ? 404  GLU B OE1   1 
ATOM   7520 O  OE2   . GLU B 2 404 ? -35.23900 -45.36000 17.79800  1.000 49.67000  ? 404  GLU B OE2   1 
ATOM   7521 N  N     . TYR B 2 405 ? -37.51400 -50.71900 17.89800  1.000 35.64000  ? 405  TYR B N     1 
ATOM   7522 C  CA    . TYR B 2 405 ? -38.62700 -51.31800 18.64700  1.000 30.47000  ? 405  TYR B CA    1 
ATOM   7523 C  C     . TYR B 2 405 ? -38.25200 -52.66100 19.28800  1.000 32.48000  ? 405  TYR B C     1 
ATOM   7524 O  O     . TYR B 2 405 ? -39.09500 -53.32700 19.90300  1.000 29.60000  ? 405  TYR B O     1 
ATOM   7525 C  CB    . TYR B 2 405 ? -39.85000 -51.46000 17.73000  1.000 28.86000  ? 405  TYR B CB    1 
ATOM   7526 C  CG    . TYR B 2 405 ? -40.12200 -50.17200 17.00100  1.000 32.17000  ? 405  TYR B CG    1 
ATOM   7527 C  CD1   . TYR B 2 405 ? -40.54200 -49.04700 17.69300  1.000 31.32000  ? 405  TYR B CD1   1 
ATOM   7528 C  CD2   . TYR B 2 405 ? -39.90700 -50.05600 15.62900  1.000 32.45000  ? 405  TYR B CD2   1 
ATOM   7529 C  CE1   . TYR B 2 405 ? -40.76600 -47.85100 17.03800  1.000 35.55000  ? 405  TYR B CE1   1 
ATOM   7530 C  CE2   . TYR B 2 405 ? -40.12400 -48.84500 14.96100  1.000 29.45000  ? 405  TYR B CE2   1 
ATOM   7531 C  CZ    . TYR B 2 405 ? -40.56000 -47.75600 15.67500  1.000 33.41000  ? 405  TYR B CZ    1 
ATOM   7532 O  OH    . TYR B 2 405 ? -40.79300 -46.55400 15.04200  1.000 35.86000  ? 405  TYR B OH    1 
ATOM   7533 N  N     . TRP B 2 406 ? -36.97400 -53.02500 19.18200  1.000 34.58000  ? 406  TRP B N     1 
ATOM   7534 C  CA    . TRP B 2 406 ? -36.50700 -54.31400 19.67700  1.000 33.77000  ? 406  TRP B CA    1 
ATOM   7535 C  C     . TRP B 2 406 ? -36.15900 -54.30700 21.17400  1.000 37.09000  ? 406  TRP B C     1 
ATOM   7536 O  O     . TRP B 2 406 ? -35.52900 -53.37900 21.68400  1.000 39.99000  ? 406  TRP B O     1 
ATOM   7537 C  CB    . TRP B 2 406 ? -35.29600 -54.78200 18.87200  1.000 29.83000  ? 406  TRP B CB    1 
ATOM   7538 C  CG    . TRP B 2 406 ? -35.10500 -56.26500 18.95600  1.000 31.52000  ? 406  TRP B CG    1 
ATOM   7539 C  CD1   . TRP B 2 406 ? -34.30700 -56.94000 19.82700  1.000 34.70000  ? 406  TRP B CD1   1 
ATOM   7540 C  CD2   . TRP B 2 406 ? -35.76400 -57.25900 18.16200  1.000 28.12000  ? 406  TRP B CD2   1 
ATOM   7541 N  NE1   . TRP B 2 406 ? -34.40200 -58.29600 19.60800  1.000 33.52000  ? 406  TRP B NE1   1 
ATOM   7542 C  CE2   . TRP B 2 406 ? -35.29200 -58.51500 18.59100  1.000 29.94000  ? 406  TRP B CE2   1 
ATOM   7543 C  CE3   . TRP B 2 406 ? -36.70600 -57.20900 17.12500  1.000 30.80000  ? 406  TRP B CE3   1 
ATOM   7544 C  CZ2   . TRP B 2 406 ? -35.72600 -59.70700 18.02200  1.000 27.98000  ? 406  TRP B CZ2   1 
ATOM   7545 C  CZ3   . TRP B 2 406 ? -37.13600 -58.38700 16.56300  1.000 26.41000  ? 406  TRP B CZ3   1 
ATOM   7546 C  CH2   . TRP B 2 406 ? -36.65000 -59.62300 17.01000  1.000 26.64000  ? 406  TRP B CH2   1 
ATOM   7547 N  N     . GLN B 2 407 ? -36.55400 -55.37700 21.85500  1.000 36.73000  ? 407  GLN B N     1 
ATOM   7548 C  CA    . GLN B 2 407 ? -36.47800 -55.44300 23.30300  1.000 32.09000  ? 407  GLN B CA    1 
ATOM   7549 C  C     . GLN B 2 407 ? -36.01400 -56.80800 23.77800  1.000 36.34000  ? 407  GLN B C     1 
ATOM   7550 O  O     . GLN B 2 407 ? -35.97500 -57.07000 24.97700  1.000 46.18000  ? 407  GLN B O     1 
ATOM   7551 C  CB    . GLN B 2 407 ? -37.84400 -55.11500 23.90700  1.000 31.48000  ? 407  GLN B CB    1 
ATOM   7552 C  CG    . GLN B 2 407 ? -38.17200 -53.62900 23.91900  1.000 37.35000  ? 407  GLN B CG    1 
ATOM   7553 C  CD    . GLN B 2 407 ? -37.30000 -52.85900 24.90800  1.000 54.90000  ? 407  GLN B CD    1 
ATOM   7554 O  OE1   . GLN B 2 407 ? -37.12500 -53.28500 26.05000  1.000 64.98000  ? 407  GLN B OE1   1 
ATOM   7555 N  NE2   . GLN B 2 407 ? -36.74000 -51.73200 24.46900  1.000 48.62000  ? 407  GLN B NE2   1 
ATOM   7556 N  N     . ALA B 2 408 ? -35.64800 -57.67800 22.84400  1.000 34.63000  ? 408  ALA B N     1 
ATOM   7557 C  CA    . ALA B 2 408 ? -35.25600 -59.03500 23.19700  1.000 29.29000  ? 408  ALA B CA    1 
ATOM   7558 C  C     . ALA B 2 408 ? -33.73300 -59.21200 23.11300  1.000 35.51000  ? 408  ALA B C     1 
ATOM   7559 O  O     . ALA B 2 408 ? -33.06500 -58.52000 22.34700  1.000 37.66000  ? 408  ALA B O     1 
ATOM   7560 C  CB    . ALA B 2 408 ? -35.97400 -60.02800 22.29400  1.000 25.32000  ? 408  ALA B CB    1 
ATOM   7561 N  N     . THR B 2 409 ? -33.17700 -60.13900 23.88400  1.000 31.40000  ? 409  THR B N     1 
ATOM   7562 C  CA    . THR B 2 409 ? -31.73000 -60.31100 23.86000  1.000 28.18000  ? 409  THR B CA    1 
ATOM   7563 C  C     . THR B 2 409 ? -31.27600 -61.16800 22.70100  1.000 34.30000  ? 409  THR B C     1 
ATOM   7564 O  O     . THR B 2 409 ? -30.09400 -61.16500 22.37900  1.000 38.47000  ? 409  THR B O     1 
ATOM   7565 C  CB    . THR B 2 409 ? -31.21600 -60.94700 25.13500  1.000 34.89000  ? 409  THR B CB    1 
ATOM   7566 O  OG1   . THR B 2 409 ? -31.87600 -62.20800 25.32600  1.000 40.60000  ? 409  THR B OG1   1 
ATOM   7567 C  CG2   . THR B 2 409 ? -31.47600 -60.03500 26.33500  1.000 35.33000  ? 409  THR B CG2   1 
ATOM   7568 N  N     . TRP B 2 410 ? -32.21300 -61.91200 22.10200  1.000 35.88000  ? 410  TRP B N     1 
ATOM   7569 C  CA    . TRP B 2 410 ? -31.94700 -62.72800 20.90500  1.000 33.82000  ? 410  TRP B CA    1 
ATOM   7570 C  C     . TRP B 2 410 ? -32.51300 -62.08300 19.62400  1.000 35.10000  ? 410  TRP B C     1 
ATOM   7571 O  O     . TRP B 2 410 ? -33.19100 -61.04200 19.65700  1.000 32.56000  ? 410  TRP B O     1 
ATOM   7572 C  CB    . TRP B 2 410 ? -32.52800 -64.14200 21.05900  1.000 30.94000  ? 410  TRP B CB    1 
ATOM   7573 C  CG    . TRP B 2 410 ? -33.81500 -64.17600 21.79600  1.000 29.97000  ? 410  TRP B CG    1 
ATOM   7574 C  CD1   . TRP B 2 410 ? -34.01900 -64.66900 23.04500  1.000 38.43000  ? 410  TRP B CD1   1 
ATOM   7575 C  CD2   . TRP B 2 410 ? -35.07800 -63.65400 21.36100  1.000 35.01000  ? 410  TRP B CD2   1 
ATOM   7576 N  NE1   . TRP B 2 410 ? -35.33400 -64.50300 23.42400  1.000 35.03000  ? 410  TRP B NE1   1 
ATOM   7577 C  CE2   . TRP B 2 410 ? -36.00700 -63.87700 22.40900  1.000 33.33000  ? 410  TRP B CE2   1 
ATOM   7578 C  CE3   . TRP B 2 410 ? -35.52000 -63.01800 20.19600  1.000 33.65000  ? 410  TRP B CE3   1 
ATOM   7579 C  CZ2   . TRP B 2 410 ? -37.33900 -63.48600 22.32300  1.000 28.18000  ? 410  TRP B CZ2   1 
ATOM   7580 C  CZ3   . TRP B 2 410 ? -36.85300 -62.64000 20.11600  1.000 32.78000  ? 410  TRP B CZ3   1 
ATOM   7581 C  CH2   . TRP B 2 410 ? -37.74400 -62.88100 21.17200  1.000 32.35000  ? 410  TRP B CH2   1 
ATOM   7582 N  N     . ILE B 2 411 ? -32.23500 -62.70900 18.49300  1.000 33.54000  ? 411  ILE B N     1 
ATOM   7583 C  CA    . ILE B 2 411 ? -32.68600 -62.17100 17.22700  1.000 29.85000  ? 411  ILE B CA    1 
ATOM   7584 C  C     . ILE B 2 411 ? -32.97500 -63.28100 16.25200  1.000 28.91000  ? 411  ILE B C     1 
ATOM   7585 O  O     . ILE B 2 411 ? -32.06900 -63.98900 15.83700  1.000 31.20000  ? 411  ILE B O     1 
ATOM   7586 C  CB    . ILE B 2 411 ? -31.64100 -61.24900 16.61800  1.000 32.64000  ? 411  ILE B CB    1 
ATOM   7587 C  CG1   . ILE B 2 411 ? -31.34000 -60.08400 17.55500  1.000 27.34000  ? 411  ILE B CG1   1 
ATOM   7588 C  CG2   . ILE B 2 411 ? -32.09400 -60.77000 15.25500  1.000 31.48000  ? 411  ILE B CG2   1 
ATOM   7589 C  CD1   . ILE B 2 411 ? -29.94600 -59.53000 17.34100  1.000 25.43000  ? 411  ILE B CD1   1 
ATOM   7590 N  N     . PRO B 2 412 ? -34.24300 -63.43600 15.88200  1.000 27.28000  ? 412  PRO B N     1 
ATOM   7591 C  CA    . PRO B 2 412 ? -34.63700 -64.49500 14.95500  1.000 28.47000  ? 412  PRO B CA    1 
ATOM   7592 C  C     . PRO B 2 412 ? -34.03300 -64.26700 13.58400  1.000 32.51000  ? 412  PRO B C     1 
ATOM   7593 O  O     . PRO B 2 412 ? -33.63800 -63.13900 13.25800  1.000 32.21000  ? 412  PRO B O     1 
ATOM   7594 C  CB    . PRO B 2 412 ? -36.15800 -64.35600 14.89900  1.000 29.65000  ? 412  PRO B CB    1 
ATOM   7595 C  CG    . PRO B 2 412 ? -36.38700 -62.92400 15.15000  1.000 26.47000  ? 412  PRO B CG    1 
ATOM   7596 C  CD    . PRO B 2 412 ? -35.36200 -62.52400 16.16900  1.000 27.04000  ? 412  PRO B CD    1 
ATOM   7597 N  N     . GLU B 2 413 ? -33.94400 -65.33600 12.80500  1.000 31.86000  ? 413  GLU B N     1 
ATOM   7598 C  CA    . GLU B 2 413 ? -33.58900 -65.24400 11.41000  1.000 29.77000  ? 413  GLU B CA    1 
ATOM   7599 C  C     . GLU B 2 413 ? -34.82100 -64.83900 10.61600  1.000 30.41000  ? 413  GLU B C     1 
ATOM   7600 O  O     . GLU B 2 413 ? -35.93300 -65.20900 10.99800  1.000 30.08000  ? 413  GLU B O     1 
ATOM   7601 C  CB    . GLU B 2 413 ? -33.06700 -66.57600 10.92700  1.000 29.75000  ? 413  GLU B CB    1 
ATOM   7602 C  CG    . GLU B 2 413 ? -31.97100 -67.08300 11.78700  1.000 34.00000  ? 413  GLU B CG    1 
ATOM   7603 C  CD    . GLU B 2 413 ? -30.68700 -67.22400 11.01200  1.000 51.13000  ? 413  GLU B CD    1 
ATOM   7604 O  OE1   . GLU B 2 413 ? -30.68100 -66.79700 9.82500   1.000 56.69000  ? 413  GLU B OE1   1 
ATOM   7605 O  OE2   . GLU B 2 413 ? -29.69200 -67.75200 11.58100  1.000 49.99000  ? 413  GLU B OE2   1 
ATOM   7606 N  N     . TRP B 2 414 ? -34.63600 -64.09700 9.52300   1.000 28.07000  ? 414  TRP B N     1 
ATOM   7607 C  CA    . TRP B 2 414 ? -35.77700 -63.72200 8.68500   1.000 28.11000  ? 414  TRP B CA    1 
ATOM   7608 C  C     . TRP B 2 414 ? -35.43100 -63.52600 7.22200   1.000 34.43000  ? 414  TRP B C     1 
ATOM   7609 O  O     . TRP B 2 414 ? -34.26500 -63.48900 6.82800   1.000 38.95000  ? 414  TRP B O     1 
ATOM   7610 C  CB    . TRP B 2 414 ? -36.43300 -62.44300 9.19200   1.000 26.66000  ? 414  TRP B CB    1 
ATOM   7611 C  CG    . TRP B 2 414 ? -35.49700 -61.29600 9.31800   1.000 26.95000  ? 414  TRP B CG    1 
ATOM   7612 C  CD1   . TRP B 2 414 ? -34.73100 -60.74000 8.33000   1.000 26.95000  ? 414  TRP B CD1   1 
ATOM   7613 C  CD2   . TRP B 2 414 ? -35.22500 -60.54900 10.50600  1.000 26.38000  ? 414  TRP B CD2   1 
ATOM   7614 N  NE1   . TRP B 2 414 ? -33.99400 -59.69400 8.83800   1.000 26.31000  ? 414  TRP B NE1   1 
ATOM   7615 C  CE2   . TRP B 2 414 ? -34.27900 -59.55700 10.17000  1.000 24.32000  ? 414  TRP B CE2   1 
ATOM   7616 C  CE3   . TRP B 2 414 ? -35.68900 -60.62500 11.81800  1.000 24.98000  ? 414  TRP B CE3   1 
ATOM   7617 C  CZ2   . TRP B 2 414 ? -33.79300 -58.65000 11.09600  1.000 29.68000  ? 414  TRP B CZ2   1 
ATOM   7618 C  CZ3   . TRP B 2 414 ? -35.20200 -59.72300 12.74800  1.000 25.08000  ? 414  TRP B CZ3   1 
ATOM   7619 C  CH2   . TRP B 2 414 ? -34.26300 -58.74700 12.38300  1.000 31.72000  ? 414  TRP B CH2   1 
ATOM   7620 N  N     . GLU B 2 415 ? -36.47600 -63.38900 6.42400   1.000 26.29000  ? 415  GLU B N     1 
ATOM   7621 C  CA    . GLU B 2 415 ? -36.32300 -63.11300 5.01400   1.000 29.91000  ? 415  GLU B CA    1 
ATOM   7622 C  C     . GLU B 2 415 ? -37.56600 -62.33400 4.62100   1.000 31.98000  ? 415  GLU B C     1 
ATOM   7623 O  O     . GLU B 2 415 ? -38.61100 -62.49600 5.25700   1.000 32.84000  ? 415  GLU B O     1 
ATOM   7624 C  CB    . GLU B 2 415 ? -36.17800 -64.40300 4.20800   1.000 36.61000  ? 415  GLU B CB    1 
ATOM   7625 C  CG    . GLU B 2 415 ? -37.44300 -65.26100 4.18200   1.000 39.54000  ? 415  GLU B CG    1 
ATOM   7626 C  CD    . GLU B 2 415 ? -37.32300 -66.45400 3.25800   1.000 48.78000  ? 415  GLU B CD    1 
ATOM   7627 O  OE1   . GLU B 2 415 ? -38.35000 -67.13900 3.03700   1.000 56.80000  ? 415  GLU B OE1   1 
ATOM   7628 O  OE2   . GLU B 2 415 ? -36.20600 -66.70900 2.75500   1.000 51.94000  ? 415  GLU B OE2   1 
ATOM   7629 N  N     . PHE B 2 416 ? -37.46900 -61.48500 3.60100   1.000 32.09000  ? 416  PHE B N     1 
ATOM   7630 C  CA    . PHE B 2 416 ? -38.61600 -60.63300 3.25100   1.000 32.61000  ? 416  PHE B CA    1 
ATOM   7631 C  C     . PHE B 2 416 ? -39.36500 -61.15200 2.02700   1.000 36.67000  ? 416  PHE B C     1 
ATOM   7632 O  O     . PHE B 2 416 ? -38.78400 -61.69700 1.08100   1.000 39.57000  ? 416  PHE B O     1 
ATOM   7633 C  CB    . PHE B 2 416 ? -38.15700 -59.19500 3.03900   1.000 25.17000  ? 416  PHE B CB    1 
ATOM   7634 C  CG    . PHE B 2 416 ? -37.24500 -58.71300 4.11500   1.000 30.72000  ? 416  PHE B CG    1 
ATOM   7635 C  CD1   . PHE B 2 416 ? -35.87200 -58.90400 4.01700   1.000 28.62000  ? 416  PHE B CD1   1 
ATOM   7636 C  CD2   . PHE B 2 416 ? -37.75200 -58.10400 5.24600   1.000 27.08000  ? 416  PHE B CD2   1 
ATOM   7637 C  CE1   . PHE B 2 416 ? -35.03000 -58.47800 5.00700   1.000 28.84000  ? 416  PHE B CE1   1 
ATOM   7638 C  CE2   . PHE B 2 416 ? -36.90300 -57.67400 6.25100   1.000 25.59000  ? 416  PHE B CE2   1 
ATOM   7639 C  CZ    . PHE B 2 416 ? -35.54900 -57.86500 6.13200   1.000 30.13000  ? 416  PHE B CZ    1 
ATOM   7640 N  N     . VAL B 2 417 ? -40.67000 -60.96700 2.05000   1.000 37.28000  ? 417  VAL B N     1 
ATOM   7641 C  CA    . VAL B 2 417 ? -41.53100 -61.66800 1.12800   1.000 38.72000  ? 417  VAL B CA    1 
ATOM   7642 C  C     . VAL B 2 417 ? -42.78300 -60.86800 0.85900   1.000 47.11000  ? 417  VAL B C     1 
ATOM   7643 O  O     . VAL B 2 417 ? -43.59800 -60.72000 1.76000   1.000 54.92000  ? 417  VAL B O     1 
ATOM   7644 C  CB    . VAL B 2 417 ? -41.91700 -63.02800 1.72000   1.000 38.35000  ? 417  VAL B CB    1 
ATOM   7645 C  CG1   . VAL B 2 417 ? -43.27800 -63.44100 1.24200   1.000 47.96000  ? 417  VAL B CG1   1 
ATOM   7646 C  CG2   . VAL B 2 417 ? -40.83700 -64.08400 1.39200   1.000 41.48000  ? 417  VAL B CG2   1 
ATOM   7647 N  N     . ASN B 2 418 ? -42.94500 -60.34100 -0.35000  1.000 45.06000  ? 418  ASN B N     1 
ATOM   7648 C  CA    . ASN B 2 418 ? -44.20100 -59.67700 -0.71100  1.000 48.82000  ? 418  ASN B CA    1 
ATOM   7649 C  C     . ASN B 2 418 ? -45.33200 -60.70300 -0.91300  1.000 54.04000  ? 418  ASN B C     1 
ATOM   7650 O  O     . ASN B 2 418 ? -45.39200 -61.37900 -1.95300  1.000 55.22000  ? 418  ASN B O     1 
ATOM   7651 C  CB    . ASN B 2 418 ? -44.02200 -58.82500 -1.97700  1.000 52.11000  ? 418  ASN B CB    1 
ATOM   7652 C  CG    . ASN B 2 418 ? -42.65000 -59.01700 -2.62500  1.000 59.00000  ? 418  ASN B CG    1 
ATOM   7653 O  OD1   . ASN B 2 418 ? -42.40000 -60.03400 -3.28700  1.000 58.01000  ? 418  ASN B OD1   1 
ATOM   7654 N  ND2   . ASN B 2 418 ? -41.75300 -58.03700 -2.43900  1.000 53.03000  ? 418  ASN B ND2   1 
ATOM   7655 N  N     . THR B 2 419 ? -46.22500 -60.80800 0.07500   1.000 50.73000  ? 419  THR B N     1 
ATOM   7656 C  CA    . THR B 2 419 ? -47.19400 -61.91900 0.12100   1.000 55.63000  ? 419  THR B CA    1 
ATOM   7657 C  C     . THR B 2 419 ? -48.38000 -61.76000 -0.82900  1.000 57.95000  ? 419  THR B C     1 
ATOM   7658 O  O     . THR B 2 419 ? -49.06300 -60.73000 -0.84200  1.000 59.04000  ? 419  THR B O     1 
ATOM   7659 C  CB    . THR B 2 419 ? -47.77700 -62.13900 1.56200   1.000 66.47000  ? 419  THR B CB    1 
ATOM   7660 O  OG1   . THR B 2 419 ? -48.83100 -61.20300 1.84000   1.000 62.06000  ? 419  THR B OG1   1 
ATOM   7661 C  CG2   . THR B 2 419 ? -46.69800 -62.04700 2.65000   1.000 56.86000  ? 419  THR B CG2   1 
ATOM   7662 N  N     . PRO B 2 420 ? -48.62800 -62.79300 -1.63300  1.000 62.47000  ? 420  PRO B N     1 
ATOM   7663 C  CA    . PRO B 2 420 ? -49.80000 -62.84400 -2.51600  1.000 70.41000  ? 420  PRO B CA    1 
ATOM   7664 C  C     . PRO B 2 420 ? -51.07300 -62.40600 -1.79100  1.000 68.47000  ? 420  PRO B C     1 
ATOM   7665 O  O     . PRO B 2 420 ? -51.44000 -63.01200 -0.78400  1.000 69.21000  ? 420  PRO B O     1 
ATOM   7666 C  CB    . PRO B 2 420 ? -49.87300 -64.32200 -2.90700  1.000 67.80000  ? 420  PRO B CB    1 
ATOM   7667 C  CG    . PRO B 2 420 ? -48.44300 -64.77100 -2.87000  1.000 66.16000  ? 420  PRO B CG    1 
ATOM   7668 C  CD    . PRO B 2 420 ? -47.78400 -63.99300 -1.75500  1.000 63.15000  ? 420  PRO B CD    1 
ATOM   7669 N  N     . PRO B 2 421 ? -51.74000 -61.35900 -2.30400  1.000 68.09000  ? 421  PRO B N     1 
ATOM   7670 C  CA    . PRO B 2 421 ? -52.93900 -60.77300 -1.67600  1.000 68.90000  ? 421  PRO B CA    1 
ATOM   7671 C  C     . PRO B 2 421 ? -54.10500 -61.76500 -1.55300  1.000 70.46000  ? 421  PRO B C     1 
ATOM   7672 O  O     . PRO B 2 421 ? -55.19700 -61.37300 -1.13800  1.000 73.00000  ? 421  PRO B O     1 
ATOM   7673 C  CB    . PRO B 2 421 ? -53.30300 -59.62900 -2.62600  1.000 61.35000  ? 421  PRO B CB    1 
ATOM   7674 C  CG    . PRO B 2 421 ? -52.73900 -60.06200 -3.95300  1.000 56.79000  ? 421  PRO B CG    1 
ATOM   7675 C  CD    . PRO B 2 421 ? -51.45200 -60.75800 -3.61700  1.000 60.47000  ? 421  PRO B CD    1 
ATOM   7676 N  N     . LEU B 2 422 ? -53.86500 -63.02300 -1.92200  1.000 66.31000  ? 422  LEU B N     1 
ATOM   7677 C  CA    . LEU B 2 422 ? -54.84100 -64.09200 -1.77400  1.000 63.03000  ? 422  LEU B CA    1 
ATOM   7678 C  C     . LEU B 2 422 ? -54.87800 -64.63900 -0.33600  1.000 64.16000  ? 422  LEU B C     1 
ATOM   7679 O  O     . LEU B 2 422 ? -55.94400 -64.69100 0.29300   1.000 60.49000  ? 422  LEU B O     1 
ATOM   7680 C  CB    . LEU B 2 422 ? -54.53100 -65.21000 -2.77100  1.000 59.41000  ? 422  LEU B CB    1 
ATOM   7681 C  CG    . LEU B 2 422 ? -55.56400 -65.45300 -3.88800  1.000 54.23000  ? 422  LEU B CG    1 
ATOM   7682 C  CD1   . LEU B 2 422 ? -56.51300 -64.27200 -4.06100  1.000 49.92000  ? 422  LEU B CD1   1 
ATOM   7683 C  CD2   . LEU B 2 422 ? -54.87400 -65.77800 -5.20000  1.000 42.21000  ? 422  LEU B CD2   1 
ATOM   7684 N  N     . VAL B 2 423 ? -53.70900 -65.02600 0.18200   1.000 71.01000  ? 423  VAL B N     1 
ATOM   7685 C  CA    . VAL B 2 423 ? -53.57800 -65.54200 1.55900   1.000 72.35000  ? 423  VAL B CA    1 
ATOM   7686 C  C     . VAL B 2 423 ? -54.04500 -64.53700 2.62300   1.000 66.91000  ? 423  VAL B C     1 
ATOM   7687 O  O     . VAL B 2 423 ? -54.45700 -64.91500 3.72900   1.000 60.22000  ? 423  VAL B O     1 
ATOM   7688 C  CB    . VAL B 2 423 ? -52.11400 -65.94000 1.88000   1.000 71.19000  ? 423  VAL B CB    1 
ATOM   7689 C  CG1   . VAL B 2 423 ? -52.02700 -66.60300 3.26300   1.000 57.86000  ? 423  VAL B CG1   1 
ATOM   7690 C  CG2   . VAL B 2 423 ? -51.55200 -66.85600 0.79000   1.000 69.37000  ? 423  VAL B CG2   1 
ATOM   7691 N  N     . LYS B 2 424 ? -53.95700 -63.25700 2.28100   1.000 66.31000  ? 424  LYS B N     1 
ATOM   7692 C  CA    . LYS B 2 424 ? -54.48000 -62.20200 3.12700   1.000 63.91000  ? 424  LYS B CA    1 
ATOM   7693 C  C     . LYS B 2 424 ? -55.92900 -62.51800 3.53900   1.000 67.40000  ? 424  LYS B C     1 
ATOM   7694 O  O     . LYS B 2 424 ? -56.26600 -62.40800 4.71900   1.000 67.02000  ? 424  LYS B O     1 
ATOM   7695 C  CB    . LYS B 2 424 ? -54.38800 -60.85900 2.38700   1.000 71.23000  ? 424  LYS B CB    1 
ATOM   7696 C  CG    . LYS B 2 424 ? -54.71800 -59.60800 3.20800   1.000 69.76000  ? 424  LYS B CG    1 
ATOM   7697 C  CD    . LYS B 2 424 ? -54.71700 -58.38200 2.29500   1.000 63.79000  ? 424  LYS B CD    1 
ATOM   7698 C  CE    . LYS B 2 424 ? -55.36500 -57.16400 2.94200   1.000 64.97000  ? 424  LYS B CE    1 
ATOM   7699 N  NZ    . LYS B 2 424 ? -55.37800 -55.99100 2.00000   1.000 58.73000  ? 424  LYS B NZ    1 
ATOM   7700 N  N     . LEU B 2 425 ? -56.76300 -62.94800 2.58300   1.000 64.42000  ? 425  LEU B N     1 
ATOM   7701 C  CA    . LEU B 2 425 ? -58.19800 -63.13700 2.84100   1.000 64.50000  ? 425  LEU B CA    1 
ATOM   7702 C  C     . LEU B 2 425 ? -58.50900 -64.51100 3.44000   1.000 60.31000  ? 425  LEU B C     1 
ATOM   7703 O  O     . LEU B 2 425 ? -59.57500 -64.74000 4.01900   1.000 57.68000  ? 425  LEU B O     1 
ATOM   7704 C  CB    . LEU B 2 425 ? -59.00600 -62.92800 1.55100   1.000 67.68000  ? 425  LEU B CB    1 
ATOM   7705 C  CG    . LEU B 2 425 ? -60.41100 -62.31700 1.72700   1.000 75.21000  ? 425  LEU B CG    1 
ATOM   7706 C  CD1   . LEU B 2 425 ? -60.90800 -61.61700 0.44600   1.000 67.46000  ? 425  LEU B CD1   1 
ATOM   7707 C  CD2   . LEU B 2 425 ? -61.43200 -63.36300 2.20900   1.000 68.27000  ? 425  LEU B CD2   1 
ATOM   7708 N  N     . TRP B 2 426 ? -57.56200 -65.42600 3.30800   1.000 61.86000  ? 426  TRP B N     1 
ATOM   7709 C  CA    . TRP B 2 426 ? -57.73900 -66.77100 3.82700   1.000 56.86000  ? 426  TRP B CA    1 
ATOM   7710 C  C     . TRP B 2 426 ? -57.80000 -66.78500 5.36000   1.000 56.87000  ? 426  TRP B C     1 
ATOM   7711 O  O     . TRP B 2 426 ? -58.64200 -67.45100 5.95500   1.000 56.56000  ? 426  TRP B O     1 
ATOM   7712 C  CB    . TRP B 2 426 ? -56.60400 -67.67400 3.34600   1.000 60.15000  ? 426  TRP B CB    1 
ATOM   7713 C  CG    . TRP B 2 426 ? -56.43400 -67.80700 1.82600   1.000 63.54000  ? 426  TRP B CG    1 
ATOM   7714 C  CD1   . TRP B 2 426 ? -55.28600 -68.17300 1.15900   1.000 64.99000  ? 426  TRP B CD1   1 
ATOM   7715 C  CD2   . TRP B 2 426 ? -57.43400 -67.60200 0.80500   1.000 65.46000  ? 426  TRP B CD2   1 
ATOM   7716 N  NE1   . TRP B 2 426 ? -55.51100 -68.21400 -0.20000  1.000 69.14000  ? 426  TRP B NE1   1 
ATOM   7717 C  CE2   . TRP B 2 426 ? -56.81600 -67.86700 -0.44600  1.000 67.08000  ? 426  TRP B CE2   1 
ATOM   7718 C  CE3   . TRP B 2 426 ? -58.78100 -67.21700 0.82300   1.000 59.17000  ? 426  TRP B CE3   1 
ATOM   7719 C  CZ2   . TRP B 2 426 ? -57.50200 -67.75500 -1.65700  1.000 51.31000  ? 426  TRP B CZ2   1 
ATOM   7720 C  CZ3   . TRP B 2 426 ? -59.45400 -67.10400 -0.38200  1.000 54.03000  ? 426  TRP B CZ3   1 
ATOM   7721 C  CH2   . TRP B 2 426 ? -58.81500 -67.37600 -1.60300  1.000 49.73000  ? 426  TRP B CH2   1 
ATOM   7722 N  N     . TYR B 2 427 ? -56.90800 -66.03700 5.99600   1.000 59.07000  ? 427  TYR B N     1 
ATOM   7723 C  CA    . TYR B 2 427 ? -56.81300 -66.06600 7.45300   1.000 57.65000  ? 427  TYR B CA    1 
ATOM   7724 C  C     . TYR B 2 427 ? -57.63600 -64.97300 8.15400   1.000 62.37000  ? 427  TYR B C     1 
ATOM   7725 O  O     . TYR B 2 427 ? -57.66600 -64.90100 9.39000   1.000 59.46000  ? 427  TYR B O     1 
ATOM   7726 C  CB    . TYR B 2 427 ? -55.34000 -65.98400 7.86300   1.000 49.04000  ? 427  TYR B CB    1 
ATOM   7727 C  CG    . TYR B 2 427 ? -54.62200 -67.30400 7.67500   1.000 47.30000  ? 427  TYR B CG    1 
ATOM   7728 C  CD1   . TYR B 2 427 ? -54.86300 -68.37600 8.53800   1.000 48.71000  ? 427  TYR B CD1   1 
ATOM   7729 C  CD2   . TYR B 2 427 ? -53.72400 -67.49300 6.63000   1.000 42.58000  ? 427  TYR B CD2   1 
ATOM   7730 C  CE1   . TYR B 2 427 ? -54.22800 -69.59500 8.36800   1.000 43.04000  ? 427  TYR B CE1   1 
ATOM   7731 C  CE2   . TYR B 2 427 ? -53.07900 -68.70600 6.45500   1.000 41.41000  ? 427  TYR B CE2   1 
ATOM   7732 C  CZ    . TYR B 2 427 ? -53.33700 -69.74900 7.32700   1.000 46.98000  ? 427  TYR B CZ    1 
ATOM   7733 O  OH    . TYR B 2 427 ? -52.69600 -70.95300 7.15600   1.000 57.28000  ? 427  TYR B OH    1 
ATOM   7734 N  N     . GLN B 2 428 ? -58.32500 -64.15700 7.35600   1.000 62.98000  ? 428  GLN B N     1 
ATOM   7735 C  CA    . GLN B 2 428 ? -59.11700 -63.02900 7.84700   1.000 63.32000  ? 428  GLN B CA    1 
ATOM   7736 C  C     . GLN B 2 428 ? -60.10300 -63.39400 8.94300   1.000 68.09000  ? 428  GLN B C     1 
ATOM   7737 O  O     . GLN B 2 428 ? -60.65900 -64.49200 8.95000   1.000 66.42000  ? 428  GLN B O     1 
ATOM   7738 C  CB    . GLN B 2 428 ? -59.89100 -62.38700 6.69200   1.000 66.27000  ? 428  GLN B CB    1 
ATOM   7739 C  CG    . GLN B 2 428 ? -59.00700 -61.81400 5.59400   1.000 68.01000  ? 428  GLN B CG    1 
ATOM   7740 C  CD    . GLN B 2 428 ? -59.17100 -60.30700 5.42200   1.000 70.86000  ? 428  GLN B CD    1 
ATOM   7741 O  OE1   . GLN B 2 428 ? -60.21100 -59.83400 4.94600   1.000 73.06000  ? 428  GLN B OE1   1 
ATOM   7742 N  NE2   . GLN B 2 428 ? -58.14300 -59.54500 5.80900   1.000 63.57000  ? 428  GLN B NE2   1 
ATOM   7743 N  N     . LEU B 2 429 ? -60.32300 -62.45500 9.86100   1.000 75.99000  ? 429  LEU B N     1 
ATOM   7744 C  CA    . LEU B 2 429 ? -61.32000 -62.63800 10.91100  1.000 74.42000  ? 429  LEU B CA    1 
ATOM   7745 C  C     . LEU B 2 429 ? -62.47700 -61.67600 10.69200  1.000 67.33000  ? 429  LEU B C     1 
ATOM   7746 O  O     . LEU B 2 429 ? -62.63800 -61.13900 9.59600   1.000 64.34000  ? 429  LEU B O     1 
ATOM   7747 C  CB    . LEU B 2 429 ? -60.70100 -62.43300 12.29700  1.000 72.38000  ? 429  LEU B CB    1 
ATOM   7748 C  CG    . LEU B 2 429 ? -61.00800 -63.50600 13.35900  1.000 80.35000  ? 429  LEU B CG    1 
ATOM   7749 C  CD1   . LEU B 2 429 ? -60.18600 -63.26900 14.62200  1.000 75.67000  ? 429  LEU B CD1   1 
ATOM   7750 C  CD2   . LEU B 2 429 ? -62.50600 -63.59700 13.69900  1.000 76.06000  ? 429  LEU B CD2   1 
ATOM   7751 O  "O5'" . DG  C 3 4   ? -37.00500 -80.43300 -11.30700 1.000 55.87000  ? 805  DG  P "O5'" 1 
ATOM   7752 C  "C5'" . DG  C 3 4   ? -36.13800 -80.96600 -12.32600 1.000 61.31000  ? 805  DG  P "C5'" 1 
ATOM   7753 C  "C4'" . DG  C 3 4   ? -36.93500 -81.47100 -13.53000 1.000 63.12000  ? 805  DG  P "C4'" 1 
ATOM   7754 O  "O4'" . DG  C 3 4   ? -38.21600 -81.98200 -13.08400 1.000 56.95000  ? 805  DG  P "O4'" 1 
ATOM   7755 C  "C3'" . DG  C 3 4   ? -37.23800 -80.42100 -14.59500 1.000 61.43000  ? 805  DG  P "C3'" 1 
ATOM   7756 O  "O3'" . DG  C 3 4   ? -36.24100 -80.48800 -15.62400 1.000 66.79000  ? 805  DG  P "O3'" 1 
ATOM   7757 C  "C2'" . DG  C 3 4   ? -38.62000 -80.81700 -15.13100 1.000 53.08000  ? 805  DG  P "C2'" 1 
ATOM   7758 C  "C1'" . DG  C 3 4   ? -39.24700 -81.57900 -13.96200 1.000 55.24000  ? 805  DG  P "C1'" 1 
ATOM   7759 N  N9    . DG  C 3 4   ? -40.23200 -80.82000 -13.18600 1.000 56.81000  ? 805  DG  P N9    1 
ATOM   7760 C  C8    . DG  C 3 4   ? -40.27000 -80.67200 -11.81100 1.000 54.30000  ? 805  DG  P C8    1 
ATOM   7761 N  N7    . DG  C 3 4   ? -41.28200 -79.96300 -11.38800 1.000 45.55000  ? 805  DG  P N7    1 
ATOM   7762 C  C5    . DG  C 3 4   ? -41.96300 -79.62500 -12.55500 1.000 51.67000  ? 805  DG  P C5    1 
ATOM   7763 C  C6    . DG  C 3 4   ? -43.14200 -78.86300 -12.72700 1.000 53.29000  ? 805  DG  P C6    1 
ATOM   7764 O  O6    . DG  C 3 4   ? -43.83500 -78.31700 -11.84800 1.000 56.66000  ? 805  DG  P O6    1 
ATOM   7765 N  N1    . DG  C 3 4   ? -43.50000 -78.76300 -14.07800 1.000 48.77000  ? 805  DG  P N1    1 
ATOM   7766 C  C2    . DG  C 3 4   ? -42.80400 -79.33100 -15.12400 1.000 51.64000  ? 805  DG  P C2    1 
ATOM   7767 N  N2    . DG  C 3 4   ? -43.30000 -79.12500 -16.35000 1.000 52.58000  ? 805  DG  P N2    1 
ATOM   7768 N  N3    . DG  C 3 4   ? -41.69700 -80.05300 -14.97700 1.000 52.05000  ? 805  DG  P N3    1 
ATOM   7769 C  C4    . DG  C 3 4   ? -41.33300 -80.15200 -13.67100 1.000 53.43000  ? 805  DG  P C4    1 
ATOM   7770 P  P     . DT  C 3 5   ? -35.45100 -79.15300 -16.07200 1.000 81.03000  ? 806  DT  P P     1 
ATOM   7771 O  OP1   . DT  C 3 5   ? -34.36000 -79.48500 -17.01000 1.000 72.22000  ? 806  DT  P OP1   1 
ATOM   7772 O  OP2   . DT  C 3 5   ? -35.20300 -78.38000 -14.82600 1.000 61.16000  ? 806  DT  P OP2   1 
ATOM   7773 O  "O5'" . DT  C 3 5   ? -36.51100 -78.36500 -16.95600 1.000 72.41000  ? 806  DT  P "O5'" 1 
ATOM   7774 C  "C5'" . DT  C 3 5   ? -37.30000 -79.06100 -17.89700 1.000 68.45000  ? 806  DT  P "C5'" 1 
ATOM   7775 C  "C4'" . DT  C 3 5   ? -38.22400 -78.08200 -18.56200 1.000 67.81000  ? 806  DT  P "C4'" 1 
ATOM   7776 O  "O4'" . DT  C 3 5   ? -39.40600 -77.89700 -17.72300 1.000 61.62000  ? 806  DT  P "O4'" 1 
ATOM   7777 C  "C3'" . DT  C 3 5   ? -37.59000 -76.70800 -18.73900 1.000 62.20000  ? 806  DT  P "C3'" 1 
ATOM   7778 O  "O3'" . DT  C 3 5   ? -37.89300 -76.18500 -20.00000 1.000 61.44000  ? 806  DT  P "O3'" 1 
ATOM   7779 C  "C2'" . DT  C 3 5   ? -38.19100 -75.87700 -17.60600 1.000 64.20000  ? 806  DT  P "C2'" 1 
ATOM   7780 C  "C1'" . DT  C 3 5   ? -39.54800 -76.53700 -17.38700 1.000 60.40000  ? 806  DT  P "C1'" 1 
ATOM   7781 N  N1    . DT  C 3 5   ? -40.03500 -76.42600 -15.97300 1.000 55.48000  ? 806  DT  P N1    1 
ATOM   7782 C  C2    . DT  C 3 5   ? -41.29900 -75.93300 -15.74900 1.000 55.25000  ? 806  DT  P C2    1 
ATOM   7783 O  O2    . DT  C 3 5   ? -42.05400 -75.60800 -16.65400 1.000 55.60000  ? 806  DT  P O2    1 
ATOM   7784 N  N3    . DT  C 3 5   ? -41.66000 -75.84000 -14.42400 1.000 48.39000  ? 806  DT  P N3    1 
ATOM   7785 C  C4    . DT  C 3 5   ? -40.90300 -76.18300 -13.32400 1.000 48.93000  ? 806  DT  P C4    1 
ATOM   7786 O  O4    . DT  C 3 5   ? -41.32400 -76.06600 -12.17400 1.000 48.69000  ? 806  DT  P O4    1 
ATOM   7787 C  C5    . DT  C 3 5   ? -39.57400 -76.69100 -13.62100 1.000 54.04000  ? 806  DT  P C5    1 
ATOM   7788 C  C7    . DT  C 3 5   ? -38.65700 -77.09200 -12.50100 1.000 44.69000  ? 806  DT  P C7    1 
ATOM   7789 C  C6    . DT  C 3 5   ? -39.20400 -76.78200 -14.92100 1.000 53.12000  ? 806  DT  P C6    1 
ATOM   7790 P  P     . DC  C 3 6   ? -37.07300 -74.91600 -20.55600 1.000 71.45000  ? 807  DC  P P     1 
ATOM   7791 O  OP1   . DC  C 3 6   ? -36.70500 -75.21700 -21.95400 1.000 63.30000  ? 807  DC  P OP1   1 
ATOM   7792 O  OP2   . DC  C 3 6   ? -36.02600 -74.48800 -19.59800 1.000 57.91000  ? 807  DC  P OP2   1 
ATOM   7793 O  "O5'" . DC  C 3 6   ? -38.18100 -73.77900 -20.57400 1.000 65.79000  ? 807  DC  P "O5'" 1 
ATOM   7794 C  "C5'" . DC  C 3 6   ? -39.49700 -74.09100 -20.97500 1.000 53.84000  ? 807  DC  P "C5'" 1 
ATOM   7795 C  "C4'" . DC  C 3 6   ? -40.41400 -72.98300 -20.54900 1.000 54.86000  ? 807  DC  P "C4'" 1 
ATOM   7796 O  "O4'" . DC  C 3 6   ? -40.76200 -73.17300 -19.15500 1.000 55.59000  ? 807  DC  P "O4'" 1 
ATOM   7797 C  "C3'" . DC  C 3 6   ? -39.78800 -71.58600 -20.64400 1.000 53.64000  ? 807  DC  P "C3'" 1 
ATOM   7798 O  "O3'" . DC  C 3 6   ? -40.69200 -70.68100 -21.26800 1.000 49.39000  ? 807  DC  P "O3'" 1 
ATOM   7799 C  "C2'" . DC  C 3 6   ? -39.52600 -71.21200 -19.18500 1.000 50.49000  ? 807  DC  P "C2'" 1 
ATOM   7800 C  "C1'" . DC  C 3 6   ? -40.65200 -71.94900 -18.48700 1.000 47.94000  ? 807  DC  P "C1'" 1 
ATOM   7801 N  N1    . DC  C 3 6   ? -40.37700 -72.23000 -17.08000 1.000 53.11000  ? 807  DC  P N1    1 
ATOM   7802 C  C2    . DC  C 3 6   ? -41.37200 -71.99900 -16.13000 1.000 51.32000  ? 807  DC  P C2    1 
ATOM   7803 O  O2    . DC  C 3 6   ? -42.46800 -71.56100 -16.50400 1.000 49.70000  ? 807  DC  P O2    1 
ATOM   7804 N  N3    . DC  C 3 6   ? -41.10600 -72.26300 -14.82200 1.000 48.86000  ? 807  DC  P N3    1 
ATOM   7805 C  C4    . DC  C 3 6   ? -39.90500 -72.73700 -14.46800 1.000 47.31000  ? 807  DC  P C4    1 
ATOM   7806 N  N4    . DC  C 3 6   ? -39.68700 -72.97800 -13.17500 1.000 48.35000  ? 807  DC  P N4    1 
ATOM   7807 C  C5    . DC  C 3 6   ? -38.88100 -72.98100 -15.42300 1.000 44.43000  ? 807  DC  P C5    1 
ATOM   7808 C  C6    . DC  C 3 6   ? -39.15500 -72.71400 -16.70800 1.000 52.31000  ? 807  DC  P C6    1 
ATOM   7809 P  P     . DC  C 3 7   ? -40.18300 -69.23300 -21.73700 1.000 62.23000  ? 808  DC  P P     1 
ATOM   7810 O  OP1   . DC  C 3 7   ? -40.63200 -69.06300 -23.13500 1.000 56.22000  ? 808  DC  P OP1   1 
ATOM   7811 O  OP2   . DC  C 3 7   ? -38.75500 -69.06900 -21.34300 1.000 53.00000  ? 808  DC  P OP2   1 
ATOM   7812 O  "O5'" . DC  C 3 7   ? -40.96100 -68.21100 -20.78300 1.000 52.54000  ? 808  DC  P "O5'" 1 
ATOM   7813 C  "C5'" . DC  C 3 7   ? -42.29600 -68.45000 -20.41800 1.000 41.65000  ? 808  DC  P "C5'" 1 
ATOM   7814 C  "C4'" . DC  C 3 7   ? -42.64100 -67.64200 -19.18000 1.000 44.95000  ? 808  DC  P "C4'" 1 
ATOM   7815 O  "O4'" . DC  C 3 7   ? -42.19600 -68.34600 -17.99400 1.000 44.01000  ? 808  DC  P "O4'" 1 
ATOM   7816 C  "C3'" . DC  C 3 7   ? -42.01800 -66.24200 -19.11200 1.000 43.03000  ? 808  DC  P "C3'" 1 
ATOM   7817 O  "O3'" . DC  C 3 7   ? -43.07700 -65.25000 -19.07300 1.000 44.21000  ? 808  DC  P "O3'" 1 
ATOM   7818 C  "C2'" . DC  C 3 7   ? -41.17500 -66.25700 -17.81600 1.000 39.92000  ? 808  DC  P "C2'" 1 
ATOM   7819 C  "C1'" . DC  C 3 7   ? -41.77100 -67.42200 -17.03100 1.000 37.40000  ? 808  DC  P "C1'" 1 
ATOM   7820 N  N1    . DC  C 3 7   ? -40.79100 -68.12500 -16.15200 1.000 45.76000  ? 808  DC  P N1    1 
ATOM   7821 C  C2    . DC  C 3 7   ? -41.07000 -68.28700 -14.79000 1.000 48.63000  ? 808  DC  P C2    1 
ATOM   7822 O  O2    . DC  C 3 7   ? -42.12000 -67.82500 -14.33700 1.000 52.46000  ? 808  DC  P O2    1 
ATOM   7823 N  N3    . DC  C 3 7   ? -40.16800 -68.94100 -14.00100 1.000 46.42000  ? 808  DC  P N3    1 
ATOM   7824 C  C4    . DC  C 3 7   ? -39.04000 -69.43100 -14.53800 1.000 47.87000  ? 808  DC  P C4    1 
ATOM   7825 N  N4    . DC  C 3 7   ? -38.18300 -70.07700 -13.73000 1.000 46.78000  ? 808  DC  P N4    1 
ATOM   7826 C  C5    . DC  C 3 7   ? -38.74800 -69.28300 -15.92700 1.000 41.28000  ? 808  DC  P C5    1 
ATOM   7827 C  C6    . DC  C 3 7   ? -39.64000 -68.63500 -16.68600 1.000 46.85000  ? 808  DC  P C6    1 
ATOM   7828 P  P     . DC  C 3 8   ? -42.75500 -63.68100 -19.23600 1.000 39.62000  ? 809  DC  P P     1 
ATOM   7829 O  OP1   . DC  C 3 8   ? -43.97600 -63.04800 -19.76000 1.000 43.51000  ? 809  DC  P OP1   1 
ATOM   7830 O  OP2   . DC  C 3 8   ? -41.46500 -63.53500 -19.95100 1.000 34.19000  ? 809  DC  P OP2   1 
ATOM   7831 O  "O5'" . DC  C 3 8   ? -42.59200 -63.17000 -17.74600 1.000 28.61000  ? 809  DC  P "O5'" 1 
ATOM   7832 C  "C5'" . DC  C 3 8   ? -43.63700 -63.31200 -16.87000 1.000 29.22000  ? 809  DC  P "C5'" 1 
ATOM   7833 C  "C4'" . DC  C 3 8   ? -43.19000 -62.96700 -15.46300 1.000 36.36000  ? 809  DC  P "C4'" 1 
ATOM   7834 O  "O4'" . DC  C 3 8   ? -42.31400 -64.01100 -14.95600 1.000 41.17000  ? 809  DC  P "O4'" 1 
ATOM   7835 C  "C3'" . DC  C 3 8   ? -42.41000 -61.64900 -15.30600 1.000 40.55000  ? 809  DC  P "C3'" 1 
ATOM   7836 O  "O3'" . DC  C 3 8   ? -42.98100 -60.88300 -14.23500 1.000 40.84000  ? 809  DC  P "O3'" 1 
ATOM   7837 C  "C2'" . DC  C 3 8   ? -40.98900 -62.12400 -14.95100 1.000 40.01000  ? 809  DC  P "C2'" 1 
ATOM   7838 C  "C1'" . DC  C 3 8   ? -41.30500 -63.40100 -14.19500 1.000 41.17000  ? 809  DC  P "C1'" 1 
ATOM   7839 N  N1    . DC  C 3 8   ? -40.14800 -64.35100 -14.05400 1.000 45.10000  ? 809  DC  P N1    1 
ATOM   7840 C  C2    . DC  C 3 8   ? -39.87900 -64.92100 -12.80400 1.000 41.49000  ? 809  DC  P C2    1 
ATOM   7841 O  O2    . DC  C 3 8   ? -40.60200 -64.62900 -11.85300 1.000 46.97000  ? 809  DC  P O2    1 
ATOM   7842 N  N3    . DC  C 3 8   ? -38.83800 -65.77500 -12.67500 1.000 39.98000  ? 809  DC  P N3    1 
ATOM   7843 C  C4    . DC  C 3 8   ? -38.08600 -66.07700 -13.74000 1.000 46.66000  ? 809  DC  P C4    1 
ATOM   7844 N  N4    . DC  C 3 8   ? -37.06300 -66.92600 -13.56800 1.000 42.41000  ? 809  DC  P N4    1 
ATOM   7845 C  C5    . DC  C 3 8   ? -38.34100 -65.51000 -15.02800 1.000 46.04000  ? 809  DC  P C5    1 
ATOM   7846 C  C6    . DC  C 3 8   ? -39.37200 -64.66000 -15.13900 1.000 46.96000  ? 809  DC  P C6    1 
ATOM   7847 P  P     . DT  C 3 9   ? -42.82400 -59.28600 -14.16900 1.000 38.74000  ? 810  DT  P P     1 
ATOM   7848 O  OP1   . DT  C 3 9   ? -44.17900 -58.68900 -14.18300 1.000 44.76000  ? 810  DT  P OP1   1 
ATOM   7849 O  OP2   . DT  C 3 9   ? -41.77300 -58.86400 -15.12300 1.000 37.73000  ? 810  DT  P OP2   1 
ATOM   7850 O  "O5'" . DT  C 3 9   ? -42.26900 -59.01600 -12.70500 1.000 40.40000  ? 810  DT  P "O5'" 1 
ATOM   7851 C  "C5'" . DT  C 3 9   ? -42.81600 -59.71500 -11.61500 1.000 41.54000  ? 810  DT  P "C5'" 1 
ATOM   7852 C  "C4'" . DT  C 3 9   ? -41.73800 -60.01900 -10.58800 1.000 46.45000  ? 810  DT  P "C4'" 1 
ATOM   7853 O  "O4'" . DT  C 3 9   ? -40.87100 -61.06500 -11.06700 1.000 47.94000  ? 810  DT  P "O4'" 1 
ATOM   7854 C  "C3'" . DT  C 3 9   ? -40.81000 -58.84700 -10.25600 1.000 40.79000  ? 810  DT  P "C3'" 1 
ATOM   7855 O  "O3'" . DT  C 3 9   ? -41.14600 -58.35400 -9.00800  1.000 40.96000  ? 810  DT  P "O3'" 1 
ATOM   7856 C  "C2'" . DT  C 3 9   ? -39.39700 -59.45400 -10.24200 1.000 44.36000  ? 810  DT  P "C2'" 1 
ATOM   7857 C  "C1'" . DT  C 3 9   ? -39.66200 -60.94800 -10.35800 1.000 47.25000  ? 810  DT  P "C1'" 1 
ATOM   7858 N  N1    . DT  C 3 9   ? -38.60300 -61.68900 -11.09200 1.000 46.78000  ? 810  DT  P N1    1 
ATOM   7859 C  C2    . DT  C 3 9   ? -37.83600 -62.60200 -10.40900 1.000 48.46000  ? 810  DT  P C2    1 
ATOM   7860 O  O2    . DT  C 3 9   ? -37.98000 -62.83400 -9.21700  1.000 50.32000  ? 810  DT  P O2    1 
ATOM   7861 N  N3    . DT  C 3 9   ? -36.89400 -63.24000 -11.17200 1.000 46.04000  ? 810  DT  P N3    1 
ATOM   7862 C  C4    . DT  C 3 9   ? -36.64900 -63.05500 -12.52200 1.000 45.03000  ? 810  DT  P C4    1 
ATOM   7863 O  O4    . DT  C 3 9   ? -35.77400 -63.67100 -13.12100 1.000 42.28000  ? 810  DT  P O4    1 
ATOM   7864 C  C5    . DT  C 3 9   ? -37.49000 -62.08200 -13.17400 1.000 43.21000  ? 810  DT  P C5    1 
ATOM   7865 C  C7    . DT  C 3 9   ? -37.31200 -61.79800 -14.62700 1.000 36.43000  ? 810  DT  P C7    1 
ATOM   7866 C  C6    . DT  C 3 9   ? -38.41800 -61.45400 -12.44100 1.000 45.34000  ? 810  DT  P C6    1 
ATOM   7867 P  P     . DG  C 3 10  ? -40.35000 -57.10200 -8.40700  1.000 48.08000  ? 811  DG  P P     1 
ATOM   7868 O  OP1   . DG  C 3 10  ? -41.31000 -56.40900 -7.51900  1.000 44.44000  ? 811  DG  P OP1   1 
ATOM   7869 O  OP2   . DG  C 3 10  ? -39.67400 -56.40900 -9.53600  1.000 42.48000  ? 811  DG  P OP2   1 
ATOM   7870 O  "O5'" . DG  C 3 10  ? -39.21400 -57.78300 -7.49300  1.000 51.95000  ? 811  DG  P "O5'" 1 
ATOM   7871 C  "C5'" . DG  C 3 10  ? -39.57800 -58.45900 -6.29200  1.000 46.67000  ? 811  DG  P "C5'" 1 
ATOM   7872 C  "C4'" . DG  C 3 10  ? -38.34600 -59.01600 -5.61000  1.000 45.91000  ? 811  DG  P "C4'" 1 
ATOM   7873 O  "O4'" . DG  C 3 10  ? -37.70400 -59.96200 -6.49700  1.000 46.22000  ? 811  DG  P "O4'" 1 
ATOM   7874 C  "C3'" . DG  C 3 10  ? -37.28800 -57.96600 -5.26600  1.000 47.17000  ? 811  DG  P "C3'" 1 
ATOM   7875 O  "O3'" . DG  C 3 10  ? -36.75500 -58.18800 -3.99100  1.000 50.11000  ? 811  DG  P "O3'" 1 
ATOM   7876 C  "C2'" . DG  C 3 10  ? -36.22600 -58.15700 -6.33600  1.000 52.80000  ? 811  DG  P "C2'" 1 
ATOM   7877 C  "C1'" . DG  C 3 10  ? -36.33400 -59.63600 -6.62800  1.000 50.97000  ? 811  DG  P "C1'" 1 
ATOM   7878 N  N9    . DG  C 3 10  ? -35.89300 -59.96000 -7.97700  1.000 47.89000  ? 811  DG  P N9    1 
ATOM   7879 C  C8    . DG  C 3 10  ? -36.29500 -59.35800 -9.14300  1.000 44.27000  ? 811  DG  P C8    1 
ATOM   7880 N  N7    . DG  C 3 10  ? -35.71500 -59.84600 -10.20400 1.000 44.48000  ? 811  DG  P N7    1 
ATOM   7881 C  C5    . DG  C 3 10  ? -34.86900 -60.82600 -9.71000  1.000 47.86000  ? 811  DG  P C5    1 
ATOM   7882 C  C6    . DG  C 3 10  ? -33.97900 -61.68900 -10.39300 1.000 53.05000  ? 811  DG  P C6    1 
ATOM   7883 O  O6    . DG  C 3 10  ? -33.76400 -61.76600 -11.61700 1.000 51.40000  ? 811  DG  P O6    1 
ATOM   7884 N  N1    . DG  C 3 10  ? -33.30200 -62.53000 -9.50900  1.000 53.26000  ? 811  DG  P N1    1 
ATOM   7885 C  C2    . DG  C 3 10  ? -33.47000 -62.53700 -8.14400  1.000 53.91000  ? 811  DG  P C2    1 
ATOM   7886 N  N2    . DG  C 3 10  ? -32.73100 -63.42400 -7.45400  1.000 54.62000  ? 811  DG  P N2    1 
ATOM   7887 N  N3    . DG  C 3 10  ? -34.30500 -61.73300 -7.49600  1.000 51.94000  ? 811  DG  P N3    1 
ATOM   7888 C  C4    . DG  C 3 10  ? -34.96400 -60.90700 -8.34000  1.000 47.18000  ? 811  DG  P C4    1 
ATOM   7889 P  P     . DT  C 3 11  ? -35.89000 -57.02500 -3.28900  1.000 58.05000  ? 812  DT  P P     1 
ATOM   7890 O  OP1   . DT  C 3 11  ? -36.39300 -56.88600 -1.90100  1.000 53.35000  ? 812  DT  P OP1   1 
ATOM   7891 O  OP2   . DT  C 3 11  ? -35.87300 -55.86000 -4.19900  1.000 50.98000  ? 812  DT  P OP2   1 
ATOM   7892 O  "O5'" . DT  C 3 11  ? -34.40200 -57.62700 -3.24600  1.000 52.28000  ? 812  DT  P "O5'" 1 
ATOM   7893 C  "C5'" . DT  C 3 11  ? -34.11900 -58.68500 -2.36100  1.000 55.08000  ? 812  DT  P "C5'" 1 
ATOM   7894 C  "C4'" . DT  C 3 11  ? -32.82300 -59.36400 -2.73800  1.000 57.18000  ? 812  DT  P "C4'" 1 
ATOM   7895 O  "O4'" . DT  C 3 11  ? -32.86800 -59.75400 -4.12100  1.000 52.88000  ? 812  DT  P "O4'" 1 
ATOM   7896 C  "C3'" . DT  C 3 11  ? -31.58200 -58.49400 -2.59100  1.000 56.72000  ? 812  DT  P "C3'" 1 
ATOM   7897 O  "O3'" . DT  C 3 11  ? -30.85000 -58.88200 -1.42400  1.000 57.07000  ? 812  DT  P "O3'" 1 
ATOM   7898 C  "C2'" . DT  C 3 11  ? -30.76300 -58.74800 -3.87100  1.000 58.66000  ? 812  DT  P "C2'" 1 
ATOM   7899 C  "C1'" . DT  C 3 11  ? -31.55400 -59.81600 -4.61300  1.000 52.29000  ? 812  DT  P "C1'" 1 
ATOM   7900 N  N1    . DT  C 3 11  ? -31.60500 -59.57100 -6.06300  1.000 50.17000  ? 812  DT  P N1    1 
ATOM   7901 C  C2    . DT  C 3 11  ? -30.79400 -60.29400 -6.90300  1.000 55.32000  ? 812  DT  P C2    1 
ATOM   7902 O  O2    . DT  C 3 11  ? -30.01200 -61.14800 -6.51200  1.000 60.24000  ? 812  DT  P O2    1 
ATOM   7903 N  N3    . DT  C 3 11  ? -30.92600 -59.98600 -8.22900  1.000 51.65000  ? 812  DT  P N3    1 
ATOM   7904 C  C4    . DT  C 3 11  ? -31.76600 -59.05000 -8.77800  1.000 48.09000  ? 812  DT  P C4    1 
ATOM   7905 O  O4    . DT  C 3 11  ? -31.81100 -58.84900 -9.97800  1.000 47.25000  ? 812  DT  P O4    1 
ATOM   7906 C  C5    . DT  C 3 11  ? -32.59100 -58.32800 -7.83600  1.000 48.35000  ? 812  DT  P C5    1 
ATOM   7907 C  C7    . DT  C 3 11  ? -33.55800 -57.28700 -8.30500  1.000 44.12000  ? 812  DT  P C7    1 
ATOM   7908 C  C6    . DT  C 3 11  ? -32.46700 -58.61900 -6.54300  1.000 49.86000  ? 812  DT  P C6    1 
ATOM   7909 P  P     . DT  C 3 12  ? -29.48300 -58.11600 -1.04600  1.000 63.64000  ? 813  DT  P P     1 
ATOM   7910 O  OP1   . DT  C 3 12  ? -29.14400 -58.57700 0.32600   1.000 64.14000  ? 813  DT  P OP1   1 
ATOM   7911 O  OP2   . DT  C 3 12  ? -29.61300 -56.66200 -1.37300  1.000 46.28000  ? 813  DT  P OP2   1 
ATOM   7912 O  "O5'" . DT  C 3 12  ? -28.40600 -58.75500 -2.02900  1.000 53.55000  ? 813  DT  P "O5'" 1 
ATOM   7913 C  "C5'" . DT  C 3 12  ? -28.19200 -60.13700 -1.97700  1.000 57.86000  ? 813  DT  P "C5'" 1 
ATOM   7914 C  "C4'" . DT  C 3 12  ? -26.93700 -60.51400 -2.72700  1.000 65.00000  ? 813  DT  P "C4'" 1 
ATOM   7915 O  "O4'" . DT  C 3 12  ? -27.17800 -60.42900 -4.15900  1.000 59.09000  ? 813  DT  P "O4'" 1 
ATOM   7916 C  "C3'" . DT  C 3 12  ? -25.72100 -59.64000 -2.45700  1.000 60.19000  ? 813  DT  P "C3'" 1 
ATOM   7917 O  "O3'" . DT  C 3 12  ? -24.55400 -60.46600 -2.56800  1.000 64.43000  ? 813  DT  P "O3'" 1 
ATOM   7918 C  "C2'" . DT  C 3 12  ? -25.81600 -58.61500 -3.58900  1.000 54.67000  ? 813  DT  P "C2'" 1 
ATOM   7919 C  "C1'" . DT  C 3 12  ? -26.28700 -59.50900 -4.73400  1.000 54.58000  ? 813  DT  P "C1'" 1 
ATOM   7920 N  N1    . DT  C 3 12  ? -27.02400 -58.81000 -5.81200  1.000 54.51000  ? 813  DT  P N1    1 
ATOM   7921 C  C2    . DT  C 3 12  ? -26.81300 -59.19300 -7.11400  1.000 53.54000  ? 813  DT  P C2    1 
ATOM   7922 O  O2    . DT  C 3 12  ? -26.02300 -60.06700 -7.43600  1.000 56.29000  ? 813  DT  P O2    1 
ATOM   7923 N  N3    . DT  C 3 12  ? -27.55300 -58.50900 -8.03600  1.000 51.96000  ? 813  DT  P N3    1 
ATOM   7924 C  C4    . DT  C 3 12  ? -28.47200 -57.51300 -7.79200  1.000 54.19000  ? 813  DT  P C4    1 
ATOM   7925 O  O4    . DT  C 3 12  ? -29.09000 -56.95500 -8.70000  1.000 57.18000  ? 813  DT  P O4    1 
ATOM   7926 C  C5    . DT  C 3 12  ? -28.65300 -57.16300 -6.40100  1.000 48.79000  ? 813  DT  P C5    1 
ATOM   7927 C  C7    . DT  C 3 12  ? -29.61900 -56.08700 -6.01400  1.000 51.19000  ? 813  DT  P C7    1 
ATOM   7928 C  C6    . DT  C 3 12  ? -27.93500 -57.82600 -5.48900  1.000 51.77000  ? 813  DT  P C6    1 
ATOM   7929 P  P     . DC  C 3 13  ? -23.12700 -59.99400 -1.98600  1.000 69.04000  ? 814  DC  P P     1 
ATOM   7930 O  OP1   . DC  C 3 13  ? -22.79400 -60.89300 -0.85900  1.000 70.12000  ? 814  DC  P OP1   1 
ATOM   7931 O  OP2   . DC  C 3 13  ? -23.14700 -58.51600 -1.82200  1.000 60.42000  ? 814  DC  P OP2   1 
ATOM   7932 O  "O5'" . DC  C 3 13  ? -22.11400 -60.37500 -3.15400  1.000 65.17000  ? 814  DC  P "O5'" 1 
ATOM   7933 C  "C5'" . DC  C 3 13  ? -22.59500 -61.08500 -4.28500  1.000 64.63000  ? 814  DC  P "C5'" 1 
ATOM   7934 C  "C4'" . DC  C 3 13  ? -22.07000 -60.45300 -5.54800  1.000 61.33000  ? 814  DC  P "C4'" 1 
ATOM   7935 O  "O4'" . DC  C 3 13  ? -23.13100 -59.74200 -6.24900  1.000 63.76000  ? 814  DC  P "O4'" 1 
ATOM   7936 C  "C3'" . DC  C 3 13  ? -20.96100 -59.42500 -5.31600  1.000 62.62000  ? 814  DC  P "C3'" 1 
ATOM   7937 O  "O3'" . DC  C 3 13  ? -19.91800 -59.69100 -6.18200  1.000 66.41000  ? 814  DC  P "O3'" 1 
ATOM   7938 C  "C2'" . DC  C 3 13  ? -21.61800 -58.10100 -5.67300  1.000 61.89000  ? 814  DC  P "C2'" 1 
ATOM   7939 C  "C1'" . DC  C 3 13  ? -22.56700 -58.56000 -6.75800  1.000 63.33000  ? 814  DC  P "C1'" 1 
ATOM   7940 N  N1    . DC  C 3 13  ? -23.62400 -57.56500 -7.07100  1.000 56.88000  ? 814  DC  P N1    1 
ATOM   7941 C  C2    . DC  C 3 13  ? -23.99100 -57.36300 -8.39700  1.000 57.15000  ? 814  DC  P C2    1 
ATOM   7942 O  O2    . DC  C 3 13  ? -23.46500 -58.05900 -9.28300  1.000 61.36000  ? 814  DC  P O2    1 
ATOM   7943 N  N3    . DC  C 3 13  ? -24.92300 -56.42400 -8.67700  1.000 53.28000  ? 814  DC  P N3    1 
ATOM   7944 C  C4    . DC  C 3 13  ? -25.46500 -55.70600 -7.69000  1.000 54.33000  ? 814  DC  P C4    1 
ATOM   7945 N  N4    . DC  C 3 13  ? -26.39400 -54.79000 -8.01300  1.000 54.95000  ? 814  DC  P N4    1 
ATOM   7946 C  C5    . DC  C 3 13  ? -25.08300 -55.89100 -6.33200  1.000 51.63000  ? 814  DC  P C5    1 
ATOM   7947 C  C6    . DC  C 3 13  ? -24.16400 -56.81400 -6.07400  1.000 52.53000  ? 814  DC  P C6    1 
ATOM   7948 P  P     . DG  C 3 14  ? -18.42100 -59.72200 -5.63100  1.000 70.43000  ? 815  DG  P P     1 
ATOM   7949 O  OP1   . DG  C 3 14  ? -18.12400 -61.15600 -5.40700  1.000 63.31000  ? 815  DG  P OP1   1 
ATOM   7950 O  OP2   . DG  C 3 14  ? -18.30900 -58.74100 -4.51400  1.000 63.90000  ? 815  DG  P OP2   1 
ATOM   7951 O  "O5'" . DG  C 3 14  ? -17.58300 -59.20400 -6.88600  1.000 62.35000  ? 815  DG  P "O5'" 1 
ATOM   7952 C  "C5'" . DG  C 3 14  ? -17.72300 -59.88000 -8.12400  1.000 71.32000  ? 815  DG  P "C5'" 1 
ATOM   7953 C  "C4'" . DG  C 3 14  ? -17.96700 -58.90900 -9.26500  1.000 70.70000  ? 815  DG  P "C4'" 1 
ATOM   7954 O  "O4'" . DG  C 3 14  ? -19.20500 -58.19300 -9.05900  1.000 71.44000  ? 815  DG  P "O4'" 1 
ATOM   7955 C  "C3'" . DG  C 3 14  ? -16.89000 -57.83300 -9.45200  1.000 65.85000  ? 815  DG  P "C3'" 1 
ATOM   7956 O  "O3'" . DG  C 3 14  ? -16.29100 -57.98500 -10.72300 1.000 68.34000  ? 815  DG  P "O3'" 1 
ATOM   7957 C  "C2'" . DG  C 3 14  ? -17.66000 -56.50800 -9.35500  1.000 66.35000  ? 815  DG  P "C2'" 1 
ATOM   7958 C  "C1'" . DG  C 3 14  ? -19.06900 -56.95400 -9.69100  1.000 65.43000  ? 815  DG  P "C1'" 1 
ATOM   7959 N  N9    . DG  C 3 14  ? -20.10400 -56.04800 -9.21100  1.000 60.31000  ? 815  DG  P N9    1 
ATOM   7960 C  C8    . DG  C 3 14  ? -20.37800 -55.69700 -7.90800  1.000 61.59000  ? 815  DG  P C8    1 
ATOM   7961 N  N7    . DG  C 3 14  ? -21.36800 -54.84600 -7.79600  1.000 63.30000  ? 815  DG  P N7    1 
ATOM   7962 C  C5    . DG  C 3 14  ? -21.77700 -54.63200 -9.11700  1.000 59.59000  ? 815  DG  P C5    1 
ATOM   7963 C  C6    . DG  C 3 14  ? -22.81400 -53.81700 -9.63300  1.000 55.80000  ? 815  DG  P C6    1 
ATOM   7964 O  O6    . DG  C 3 14  ? -23.60400 -53.09200 -9.01100  1.000 56.08000  ? 815  DG  P O6    1 
ATOM   7965 N  N1    . DG  C 3 14  ? -22.88100 -53.88600 -11.02200 1.000 56.98000  ? 815  DG  P N1    1 
ATOM   7966 C  C2    . DG  C 3 14  ? -22.06400 -54.65700 -11.81500 1.000 59.62000  ? 815  DG  P C2    1 
ATOM   7967 N  N2    . DG  C 3 14  ? -22.28900 -54.59700 -13.13700 1.000 59.82000  ? 815  DG  P N2    1 
ATOM   7968 N  N3    . DG  C 3 14  ? -21.09400 -55.43200 -11.34800 1.000 58.36000  ? 815  DG  P N3    1 
ATOM   7969 C  C4    . DG  C 3 14  ? -21.00600 -55.36400 -9.99400  1.000 59.19000  ? 815  DG  P C4    1 
ATOM   7970 P  P     . DG  C 3 15  ? -14.85100 -57.32900 -11.02400 1.000 72.83000  ? 816  DG  P P     1 
ATOM   7971 O  OP1   . DG  C 3 15  ? -14.08800 -58.32800 -11.80400 1.000 66.30000  ? 816  DG  P OP1   1 
ATOM   7972 O  OP2   . DG  C 3 15  ? -14.31000 -56.75100 -9.76800  1.000 66.15000  ? 816  DG  P OP2   1 
ATOM   7973 O  "O5'" . DG  C 3 15  ? -15.19300 -56.11600 -11.99900 1.000 62.62000  ? 816  DG  P "O5'" 1 
ATOM   7974 C  "C5'" . DG  C 3 15  ? -15.59300 -56.39500 -13.30400 1.000 61.93000  ? 816  DG  P "C5'" 1 
ATOM   7975 C  "C4'" . DG  C 3 15  ? -16.24900 -55.18900 -13.90900 1.000 60.73000  ? 816  DG  P "C4'" 1 
ATOM   7976 O  "O4'" . DG  C 3 15  ? -17.53700 -55.00700 -13.30300 1.000 63.06000  ? 816  DG  P "O4'" 1 
ATOM   7977 C  "C3'" . DG  C 3 15  ? -15.53000 -53.87700 -13.66500 1.000 60.58000  ? 816  DG  P "C3'" 1 
ATOM   7978 O  "O3'" . DG  C 3 15  ? -14.48200 -53.71300 -14.62700 1.000 63.07000  ? 816  DG  P "O3'" 1 
ATOM   7979 C  "C2'" . DG  C 3 15  ? -16.65900 -52.86400 -13.87400 1.000 63.77000  ? 816  DG  P "C2'" 1 
ATOM   7980 C  "C1'" . DG  C 3 15  ? -17.90400 -53.64300 -13.39800 1.000 65.30000  ? 816  DG  P "C1'" 1 
ATOM   7981 N  N9    . DG  C 3 15  ? -18.42700 -53.21300 -12.09100 1.000 60.88000  ? 816  DG  P N9    1 
ATOM   7982 C  C8    . DG  C 3 15  ? -17.99300 -53.61900 -10.84800 1.000 58.80000  ? 816  DG  P C8    1 
ATOM   7983 N  N7    . DG  C 3 15  ? -18.65700 -53.07900 -9.86800  1.000 57.90000  ? 816  DG  P N7    1 
ATOM   7984 C  C5    . DG  C 3 15  ? -19.59700 -52.26100 -10.50000 1.000 56.94000  ? 816  DG  P C5    1 
ATOM   7985 C  C6    . DG  C 3 15  ? -20.60100 -51.41800 -9.94900  1.000 53.68000  ? 816  DG  P C6    1 
ATOM   7986 O  O6    . DG  C 3 15  ? -20.87300 -51.21400 -8.74900  1.000 55.01000  ? 816  DG  P O6    1 
ATOM   7987 N  N1    . DG  C 3 15  ? -21.33300 -50.77900 -10.94000 1.000 47.55000  ? 816  DG  P N1    1 
ATOM   7988 C  C2    . DG  C 3 15  ? -21.12200 -50.92600 -12.29100 1.000 53.21000  ? 816  DG  P C2    1 
ATOM   7989 N  N2    . DG  C 3 15  ? -21.92600 -50.21900 -13.09800 1.000 50.38000  ? 816  DG  P N2    1 
ATOM   7990 N  N3    . DG  C 3 15  ? -20.19500 -51.70400 -12.81700 1.000 54.59000  ? 816  DG  P N3    1 
ATOM   7991 C  C4    . DG  C 3 15  ? -19.47000 -52.34000 -11.86500 1.000 55.59000  ? 816  DG  P C4    1 
ATOM   7992 P  P     . DG  C 3 16  ? -13.52000 -52.42300 -14.59500 1.000 68.12000  ? 817  DG  P P     1 
ATOM   7993 O  OP1   . DG  C 3 16  ? -12.18900 -52.80200 -15.12800 1.000 65.94000  ? 817  DG  P OP1   1 
ATOM   7994 O  OP2   . DG  C 3 16  ? -13.60800 -51.80100 -13.25200 1.000 64.69000  ? 817  DG  P OP2   1 
ATOM   7995 O  "O5'" . DG  C 3 16  ? -14.21000 -51.41400 -15.61000 1.000 49.10000  ? 817  DG  P "O5'" 1 
ATOM   7996 C  "C5'" . DG  C 3 16  ? -14.00900 -50.04900 -15.44800 1.000 46.47000  ? 817  DG  P "C5'" 1 
ATOM   7997 C  "C4'" . DG  C 3 16  ? -15.20400 -49.29600 -15.94700 1.000 47.13000  ? 817  DG  P "C4'" 1 
ATOM   7998 O  "O4'" . DG  C 3 16  ? -16.42600 -49.94800 -15.50200 1.000 54.65000  ? 817  DG  P "O4'" 1 
ATOM   7999 C  "C3'" . DG  C 3 16  ? -15.30600 -47.90000 -15.41400 1.000 48.67000  ? 817  DG  P "C3'" 1 
ATOM   8000 O  "O3'" . DG  C 3 16  ? -14.51000 -47.06200 -16.18600 1.000 51.12000  ? 817  DG  P "O3'" 1 
ATOM   8001 C  "C2'" . DG  C 3 16  ? -16.79800 -47.61600 -15.57600 1.000 45.62000  ? 817  DG  P "C2'" 1 
ATOM   8002 C  "C1'" . DG  C 3 16  ? -17.38500 -48.96300 -15.14300 1.000 46.39000  ? 817  DG  P "C1'" 1 
ATOM   8003 N  N9    . DG  C 3 16  ? -17.63000 -49.07000 -13.69500 1.000 46.70000  ? 817  DG  P N9    1 
ATOM   8004 C  C8    . DG  C 3 16  ? -16.94400 -49.85000 -12.79500 1.000 46.03000  ? 817  DG  P C8    1 
ATOM   8005 N  N7    . DG  C 3 16  ? -17.38700 -49.75200 -11.57800 1.000 46.03000  ? 817  DG  P N7    1 
ATOM   8006 C  C5    . DG  C 3 16  ? -18.43500 -48.85200 -11.67400 1.000 44.13000  ? 817  DG  P C5    1 
ATOM   8007 C  C6    . DG  C 3 16  ? -19.29500 -48.35300 -10.67600 1.000 43.90000  ? 817  DG  P C6    1 
ATOM   8008 O  O6    . DG  C 3 16  ? -19.29600 -48.61300 -9.47700  1.000 43.98000  ? 817  DG  P O6    1 
ATOM   8009 N  N1    . DG  C 3 16  ? -20.22300 -47.45100 -11.19200 1.000 44.67000  ? 817  DG  P N1    1 
ATOM   8010 C  C2    . DG  C 3 16  ? -20.31200 -47.08800 -12.50300 1.000 42.88000  ? 817  DG  P C2    1 
ATOM   8011 N  N2    . DG  C 3 16  ? -21.28100 -46.21400 -12.81100 1.000 38.77000  ? 817  DG  P N2    1 
ATOM   8012 N  N3    . DG  C 3 16  ? -19.50800 -47.54500 -13.44900 1.000 45.70000  ? 817  DG  P N3    1 
ATOM   8013 C  C4    . DG  C 3 16  ? -18.59800 -48.42100 -12.96500 1.000 42.11000  ? 817  DG  P C4    1 
ATOM   8014 P  P     . DC  C 3 17  ? -13.32500 -46.26400 -15.46400 1.000 49.64000  ? 818  DC  P P     1 
ATOM   8015 O  OP1   . DC  C 3 17  ? -12.35000 -45.75000 -16.46100 1.000 50.49000  ? 818  DC  P OP1   1 
ATOM   8016 O  OP2   . DC  C 3 17  ? -12.83800 -47.16800 -14.39200 1.000 39.40000  ? 818  DC  P OP2   1 
ATOM   8017 O  "O5'" . DC  C 3 17  ? -14.09200 -44.97300 -14.95500 1.000 37.36000  ? 818  DC  P "O5'" 1 
ATOM   8018 C  "C5'" . DC  C 3 17  ? -14.74100 -44.17100 -15.91700 1.000 36.70000  ? 818  DC  P "C5'" 1 
ATOM   8019 C  "C4'" . DC  C 3 17  ? -15.86500 -43.37600 -15.30300 1.000 40.65000  ? 818  DC  P "C4'" 1 
ATOM   8020 O  "O4'" . DC  C 3 17  ? -16.85200 -44.28600 -14.76200 1.000 47.03000  ? 818  DC  P "O4'" 1 
ATOM   8021 C  "C3'" . DC  C 3 17  ? -15.47400 -42.50200 -14.12000 1.000 36.71000  ? 818  DC  P "C3'" 1 
ATOM   8022 O  "O3'" . DC  C 3 17  ? -14.94100 -41.25600 -14.56200 1.000 34.15000  ? 818  DC  P "O3'" 1 
ATOM   8023 C  "C2'" . DC  C 3 17  ? -16.81600 -42.32000 -13.43000 1.000 33.63000  ? 818  DC  P "C2'" 1 
ATOM   8024 C  "C1'" . DC  C 3 17  ? -17.42700 -43.71200 -13.59400 1.000 41.65000  ? 818  DC  P "C1'" 1 
ATOM   8025 N  N1    . DC  C 3 17  ? -17.17000 -44.60400 -12.41000 1.000 39.99000  ? 818  DC  P N1    1 
ATOM   8026 C  C2    . DC  C 3 17  ? -17.96200 -44.45700 -11.26900 1.000 37.54000  ? 818  DC  P C2    1 
ATOM   8027 O  O2    . DC  C 3 17  ? -18.86000 -43.60400 -11.26700 1.000 41.09000  ? 818  DC  P O2    1 
ATOM   8028 N  N3    . DC  C 3 17  ? -17.73100 -45.24800 -10.20000 1.000 38.46000  ? 818  DC  P N3    1 
ATOM   8029 C  C4    . DC  C 3 17  ? -16.76300 -46.15300 -10.23300 1.000 38.05000  ? 818  DC  P C4    1 
ATOM   8030 N  N4    . DC  C 3 17  ? -16.58600 -46.90700 -9.14600  1.000 40.64000  ? 818  DC  P N4    1 
ATOM   8031 C  C5    . DC  C 3 17  ? -15.94300 -46.33600 -11.39000 1.000 41.58000  ? 818  DC  P C5    1 
ATOM   8032 C  C6    . DC  C 3 17  ? -16.17600 -45.54000 -12.44900 1.000 39.96000  ? 818  DC  P C6    1 
ATOM   8033 P  P     . DG  C 3 18  ? -14.07200 -40.36800 -13.53600 1.000 37.86000  ? 819  DG  P P     1 
ATOM   8034 O  OP1   . DG  C 3 18  ? -13.58900 -39.12900 -14.19800 1.000 36.31000  ? 819  DG  P OP1   1 
ATOM   8035 O  OP2   . DG  C 3 18  ? -13.12000 -41.30800 -12.88100 1.000 27.25000  ? 819  DG  P OP2   1 
ATOM   8036 O  "O5'" . DG  C 3 18  ? -15.15500 -39.89000 -12.43300 1.000 35.03000  ? 819  DG  P "O5'" 1 
ATOM   8037 C  "C5'" . DG  C 3 18  ? -16.26900 -39.10900 -12.82900 1.000 32.50000  ? 819  DG  P "C5'" 1 
ATOM   8038 C  "C4'" . DG  C 3 18  ? -16.97500 -38.53900 -11.61200 1.000 34.81000  ? 819  DG  P "C4'" 1 
ATOM   8039 O  "O4'" . DG  C 3 18  ? -17.75600 -39.58100 -10.98300 1.000 35.35000  ? 819  DG  P "O4'" 1 
ATOM   8040 C  "C3'" . DG  C 3 18  ? -16.04700 -38.02200 -10.52100 1.000 34.56000  ? 819  DG  P "C3'" 1 
ATOM   8041 O  "O3'" . DG  C 3 18  ? -15.80800 -36.66100 -10.72300 1.000 32.04000  ? 819  DG  P "O3'" 1 
ATOM   8042 C  "C2'" . DG  C 3 18  ? -16.85500 -38.25100 -9.25000  1.000 26.36000  ? 819  DG  P "C2'" 1 
ATOM   8043 C  "C1'" . DG  C 3 18  ? -17.59500 -39.53200 -9.57800  1.000 30.81000  ? 819  DG  P "C1'" 1 
ATOM   8044 N  N9    . DG  C 3 18  ? -16.90300 -40.74000 -9.16100  1.000 32.73000  ? 819  DG  P N9    1 
ATOM   8045 C  C8    . DG  C 3 18  ? -16.06200 -41.52500 -9.92500  1.000 34.82000  ? 819  DG  P C8    1 
ATOM   8046 N  N7    . DG  C 3 18  ? -15.60100 -42.55900 -9.28400  1.000 32.06000  ? 819  DG  P N7    1 
ATOM   8047 C  C5    . DG  C 3 18  ? -16.17300 -42.45700 -8.02700  1.000 31.80000  ? 819  DG  P C5    1 
ATOM   8048 C  C6    . DG  C 3 18  ? -16.04400 -43.30100 -6.89700  1.000 33.84000  ? 819  DG  P C6    1 
ATOM   8049 O  O6    . DG  C 3 18  ? -15.37600 -44.33700 -6.78700  1.000 34.51000  ? 819  DG  P O6    1 
ATOM   8050 N  N1    . DG  C 3 18  ? -16.79000 -42.83100 -5.81700  1.000 35.28000  ? 819  DG  P N1    1 
ATOM   8051 C  C2    . DG  C 3 18  ? -17.56800 -41.69300 -5.83800  1.000 33.79000  ? 819  DG  P C2    1 
ATOM   8052 N  N2    . DG  C 3 18  ? -18.23500 -41.40500 -4.71200  1.000 30.74000  ? 819  DG  P N2    1 
ATOM   8053 N  N3    . DG  C 3 18  ? -17.70000 -40.90000 -6.89300  1.000 34.08000  ? 819  DG  P N3    1 
ATOM   8054 C  C4    . DG  C 3 18  ? -16.98000 -41.34200 -7.94100  1.000 33.60000  ? 819  DG  P C4    1 
ATOM   8055 P  P     . DC  C 3 19  ? -14.44300 -36.02400 -10.18700 1.000 27.41000  ? 820  DC  P P     1 
ATOM   8056 O  OP1   . DC  C 3 19  ? -14.54900 -34.56400 -10.35300 1.000 34.86000  ? 820  DC  P OP1   1 
ATOM   8057 O  OP2   . DC  C 3 19  ? -13.33700 -36.83800 -10.71700 1.000 19.78000  ? 820  DC  P OP2   1 
ATOM   8058 O  "O5'" . DC  C 3 19  ? -14.51200 -36.24400 -8.61000  1.000 35.42000  ? 820  DC  P "O5'" 1 
ATOM   8059 C  "C5'" . DC  C 3 19  ? -15.19900 -35.29600 -7.81900  1.000 29.38000  ? 820  DC  P "C5'" 1 
ATOM   8060 C  "C4'" . DC  C 3 19  ? -15.23900 -35.72200 -6.36500  1.000 31.03000  ? 820  DC  P "C4'" 1 
ATOM   8061 O  "O4'" . DC  C 3 19  ? -15.81100 -37.04700 -6.23900  1.000 28.08000  ? 820  DC  P "O4'" 1 
ATOM   8062 C  "C3'" . DC  C 3 19  ? -13.89500 -35.83700 -5.69000  1.000 27.48000  ? 820  DC  P "C3'" 1 
ATOM   8063 O  "O3'" . DC  C 3 19  ? -13.47200 -34.57000 -5.26600  1.000 28.73000  ? 820  DC  P "O3'" 1 
ATOM   8064 C  "C2'" . DC  C 3 19  ? -14.25300 -36.70400 -4.49800  1.000 32.02000  ? 820  DC  P "C2'" 1 
ATOM   8065 C  "C1'" . DC  C 3 19  ? -15.25100 -37.67900 -5.10900  1.000 29.31000  ? 820  DC  P "C1'" 1 
ATOM   8066 N  N1    . DC  C 3 19  ? -14.62700 -38.95500 -5.53200  1.000 32.04000  ? 820  DC  P N1    1 
ATOM   8067 C  C2    . DC  C 3 19  ? -14.54300 -39.99300 -4.60800  1.000 31.91000  ? 820  DC  P C2    1 
ATOM   8068 O  O2    . DC  C 3 19  ? -14.99300 -39.81400 -3.47400  1.000 31.44000  ? 820  DC  P O2    1 
ATOM   8069 N  N3    . DC  C 3 19  ? -13.97600 -41.16600 -4.98200  1.000 34.14000  ? 820  DC  P N3    1 
ATOM   8070 C  C4    . DC  C 3 19  ? -13.50300 -41.31400 -6.22100  1.000 29.30000  ? 820  DC  P C4    1 
ATOM   8071 N  N4    . DC  C 3 19  ? -12.96200 -42.49200 -6.54100  1.000 24.49000  ? 820  DC  P N4    1 
ATOM   8072 C  C5    . DC  C 3 19  ? -13.57000 -40.26100 -7.17600  1.000 27.41000  ? 820  DC  P C5    1 
ATOM   8073 C  C6    . DC  C 3 19  ? -14.12500 -39.10200 -6.79300  1.000 30.24000  ? 820  DC  P C6    1 
ATOM   8074 P  P     . DC  C 3 20  ? -11.94700 -34.36500 -4.84300  1.000 26.50000  ? 821  DC  P P     1 
ATOM   8075 O  OP1   . DC  C 3 20  ? -11.74300 -32.94200 -4.47600  1.000 30.30000  ? 821  DC  P OP1   1 
ATOM   8076 O  OP2   . DC  C 3 20  ? -11.14200 -35.09000 -5.83300  1.000 27.71000  ? 821  DC  P OP2   1 
ATOM   8077 O  "O5'" . DC  C 3 20  ? -11.77200 -35.27800 -3.54300  1.000 30.21000  ? 821  DC  P "O5'" 1 
ATOM   8078 C  "C5'" . DC  C 3 20  ? -12.42900 -34.95500 -2.33500  1.000 29.18000  ? 821  DC  P "C5'" 1 
ATOM   8079 C  "C4'" . DC  C 3 20  ? -11.93900 -35.88600 -1.25400  1.000 26.72000  ? 821  DC  P "C4'" 1 
ATOM   8080 O  "O4'" . DC  C 3 20  ? -12.33100 -37.25100 -1.55300  1.000 23.49000  ? 821  DC  P "O4'" 1 
ATOM   8081 C  "C3'" . DC  C 3 20  ? -10.44100 -35.92900 -1.13800  1.000 23.13000  ? 821  DC  P "C3'" 1 
ATOM   8082 O  "O3'" . DC  C 3 20  ? -10.11800 -34.94000 -0.25700  1.000 21.86000  ? 821  DC  P "O3'" 1 
ATOM   8083 C  "C2'" . DC  C 3 20  ? -10.16100 -37.32000 -0.54900  1.000 23.84000  ? 821  DC  P "C2'" 1 
ATOM   8084 C  "C1'" . DC  C 3 20  ? -11.36800 -38.13700 -1.01200  1.000 26.65000  ? 821  DC  P "C1'" 1 
ATOM   8085 N  N1    . DC  C 3 20  ? -11.04600 -39.16400 -2.05000  1.000 28.10000  ? 821  DC  P N1    1 
ATOM   8086 C  C2    . DC  C 3 20  ? -10.72500 -40.46100 -1.65300  1.000 27.86000  ? 821  DC  P C2    1 
ATOM   8087 O  O2    . DC  C 3 20  ? -10.69400 -40.72400 -0.45800  1.000 28.76000  ? 821  DC  P O2    1 
ATOM   8088 N  N3    . DC  C 3 20  ? -10.45200 -41.38700 -2.59000  1.000 29.71000  ? 821  DC  P N3    1 
ATOM   8089 C  C4    . DC  C 3 20  ? -10.48600 -41.04900 -3.88900  1.000 30.41000  ? 821  DC  P C4    1 
ATOM   8090 N  N4    . DC  C 3 20  ? -10.21000 -41.99700 -4.79700  1.000 28.76000  ? 821  DC  P N4    1 
ATOM   8091 C  C5    . DC  C 3 20  ? -10.81100 -39.73300 -4.31100  1.000 26.02000  ? 821  DC  P C5    1 
ATOM   8092 C  C6    . DC  C 3 20  ? -11.08400 -38.83300 -3.36900  1.000 27.27000  ? 821  DC  P C6    1 
HETATM 8093 N  N1    . DOC C 3 21  ? -6.88100  -39.67600 -0.80200  1.000 31.12000  ? 822  DOC P N1    1 
HETATM 8094 C  C2    . DOC C 3 21  ? -6.77600  -41.01100 -1.14500  1.000 36.43000  ? 822  DOC P C2    1 
HETATM 8095 N  N3    . DOC C 3 21  ? -6.98000  -41.40500 -2.42600  1.000 35.94000  ? 822  DOC P N3    1 
HETATM 8096 C  C4    . DOC C 3 21  ? -7.30300  -40.45200 -3.43400  1.000 33.63000  ? 822  DOC P C4    1 
HETATM 8097 C  C5    . DOC C 3 21  ? -7.40600  -39.16200 -3.11100  1.000 30.03000  ? 822  DOC P C5    1 
HETATM 8098 C  C6    . DOC C 3 21  ? -7.17800  -38.76200 -1.78800  1.000 31.67000  ? 822  DOC P C6    1 
HETATM 8099 O  O2    . DOC C 3 21  ? -6.51700  -41.85900 -0.30300  1.000 39.33000  ? 822  DOC P O2    1 
HETATM 8100 N  N4    . DOC C 3 21  ? -7.49200  -40.89200 -4.77200  1.000 31.59000  ? 822  DOC P N4    1 
HETATM 8101 C  "C1'" . DOC C 3 21  ? -6.55700  -39.24000 0.52400   1.000 35.87000  ? 822  DOC P "C1'" 1 
HETATM 8102 C  "C2'" . DOC C 3 21  ? -5.30300  -38.66100 1.18400   1.000 41.14000  ? 822  DOC P "C2'" 1 
HETATM 8103 C  "C3'" . DOC C 3 21  ? -5.64000  -37.23500 1.37500   1.000 34.99000  ? 822  DOC P "C3'" 1 
HETATM 8104 C  "C4'" . DOC C 3 21  ? -7.09700  -37.25000 1.71900   1.000 27.15000  ? 822  DOC P "C4'" 1 
HETATM 8105 O  "O4'" . DOC C 3 21  ? -7.65700  -38.55000 1.26000   1.000 30.53000  ? 822  DOC P "O4'" 1 
HETATM 8106 C  "C5'" . DOC C 3 21  ? -7.82600  -36.00500 1.41300   1.000 29.25000  ? 822  DOC P "C5'" 1 
HETATM 8107 O  "O5'" . DOC C 3 21  ? -7.87300  -35.77300 0.05800   1.000 32.82000  ? 822  DOC P "O5'" 1 
HETATM 8108 P  P     . DOC C 3 21  ? -8.52000  -34.53100 -0.50200  1.000 28.79000  ? 822  DOC P P     1 
HETATM 8109 O  OP1   . DOC C 3 21  ? -8.47900  -33.34300 0.48700   1.000 32.33000  ? 822  DOC P OP1   1 
HETATM 8110 O  OP2   . DOC C 3 21  ? -8.10000  -34.21700 -1.87800  1.000 42.81000  ? 822  DOC P OP2   1 
ATOM   8111 P  P     . DG  D 4 3   ? -1.21900  -38.43200 -18.85300 1.000 118.41000 ? 703  DG  T P     1 
ATOM   8112 O  OP1   . DG  D 4 3   ? -2.47000  -37.75800 -18.42600 1.000 111.55000 ? 703  DG  T OP1   1 
ATOM   8113 O  OP2   . DG  D 4 3   ? 0.03200   -38.23000 -18.08700 1.000 114.27000 ? 703  DG  T OP2   1 
ATOM   8114 O  "O5'" . DG  D 4 3   ? -1.45900  -40.01100 -18.96800 1.000 103.54000 ? 703  DG  T "O5'" 1 
ATOM   8115 C  "C5'" . DG  D 4 3   ? -1.51900  -40.81600 -17.79700 1.000 101.64000 ? 703  DG  T "C5'" 1 
ATOM   8116 C  "C4'" . DG  D 4 3   ? -1.77800  -42.26500 -18.16200 1.000 102.90000 ? 703  DG  T "C4'" 1 
ATOM   8117 O  "O4'" . DG  D 4 3   ? -0.67800  -42.76700 -18.94300 1.000 104.72000 ? 703  DG  T "O4'" 1 
ATOM   8118 C  "C3'" . DG  D 4 3   ? -1.90300  -43.22600 -16.97800 1.000 103.15000 ? 703  DG  T "C3'" 1 
ATOM   8119 O  "O3'" . DG  D 4 3   ? -3.27400  -43.60400 -16.80100 1.000 116.02000 ? 703  DG  T "O3'" 1 
ATOM   8120 C  "C2'" . DG  D 4 3   ? -1.02200  -44.43600 -17.36000 1.000 93.54000  ? 703  DG  T "C2'" 1 
ATOM   8121 C  "C1'" . DG  D 4 3   ? -0.64800  -44.16200 -18.80500 1.000 96.49000  ? 703  DG  T "C1'" 1 
ATOM   8122 N  N9    . DG  D 4 3   ? 0.68400   -44.63400 -19.18500 1.000 91.03000  ? 703  DG  T N9    1 
ATOM   8123 C  C8    . DG  D 4 3   ? 1.84100   -43.89200 -19.21000 1.000 89.35000  ? 703  DG  T C8    1 
ATOM   8124 N  N7    . DG  D 4 3   ? 2.88200   -44.56500 -19.61800 1.000 86.90000  ? 703  DG  T N7    1 
ATOM   8125 C  C5    . DG  D 4 3   ? 2.38600   -45.83300 -19.88600 1.000 87.13000  ? 703  DG  T C5    1 
ATOM   8126 C  C6    . DG  D 4 3   ? 3.05700   -46.99100 -20.35600 1.000 93.51000  ? 703  DG  T C6    1 
ATOM   8127 O  O6    . DG  D 4 3   ? 4.26000   -47.12200 -20.63600 1.000 96.32000  ? 703  DG  T O6    1 
ATOM   8128 N  N1    . DG  D 4 3   ? 2.18500   -48.07700 -20.49500 1.000 92.44000  ? 703  DG  T N1    1 
ATOM   8129 C  C2    . DG  D 4 3   ? 0.83800   -48.04500 -20.21400 1.000 88.11000  ? 703  DG  T C2    1 
ATOM   8130 N  N2    . DG  D 4 3   ? 0.16700   -49.19300 -20.40700 1.000 82.72000  ? 703  DG  T N2    1 
ATOM   8131 N  N3    . DG  D 4 3   ? 0.19300   -46.96300 -19.77100 1.000 87.03000  ? 703  DG  T N3    1 
ATOM   8132 C  C4    . DG  D 4 3   ? 1.03100   -45.89600 -19.63100 1.000 87.46000  ? 703  DG  T C4    1 
ATOM   8133 P  P     . DG  D 4 4   ? -3.88100  -43.83400 -15.32500 1.000 131.16000 ? 704  DG  T P     1 
ATOM   8134 O  OP1   . DG  D 4 4   ? -5.33500  -43.53700 -15.40700 1.000 107.73000 ? 704  DG  T OP1   1 
ATOM   8135 O  OP2   . DG  D 4 4   ? -3.04700  -43.06100 -14.36500 1.000 116.26000 ? 704  DG  T OP2   1 
ATOM   8136 O  "O5'" . DG  D 4 4   ? -3.64200  -45.41100 -15.04900 1.000 102.44000 ? 704  DG  T "O5'" 1 
ATOM   8137 C  "C5'" . DG  D 4 4   ? -2.30500  -45.96100 -15.08800 1.000 91.92000  ? 704  DG  T "C5'" 1 
ATOM   8138 C  "C4'" . DG  D 4 4   ? -2.32100  -47.45300 -15.40500 1.000 86.36000  ? 704  DG  T "C4'" 1 
ATOM   8139 O  "O4'" . DG  D 4 4   ? -1.33400  -47.76700 -16.41800 1.000 85.05000  ? 704  DG  T "O4'" 1 
ATOM   8140 C  "C3'" . DG  D 4 4   ? -2.05400  -48.36800 -14.21100 1.000 77.24000  ? 704  DG  T "C3'" 1 
ATOM   8141 O  "O3'" . DG  D 4 4   ? -3.12600  -49.26700 -14.05800 1.000 74.60000  ? 704  DG  T "O3'" 1 
ATOM   8142 C  "C2'" . DG  D 4 4   ? -0.74300  -49.10700 -14.51600 1.000 73.95000  ? 704  DG  T "C2'" 1 
ATOM   8143 C  "C1'" . DG  D 4 4   ? -0.41500  -48.75500 -15.96600 1.000 83.71000  ? 704  DG  T "C1'" 1 
ATOM   8144 N  N9    . DG  D 4 4   ? 0.93500   -48.21900 -16.13100 1.000 79.46000  ? 704  DG  T N9    1 
ATOM   8145 C  C8    . DG  D 4 4   ? 2.05100   -48.88500 -16.58800 1.000 76.31000  ? 704  DG  T C8    1 
ATOM   8146 N  N7    . DG  D 4 4   ? 3.11900   -48.13600 -16.63300 1.000 75.67000  ? 704  DG  T N7    1 
ATOM   8147 C  C5    . DG  D 4 4   ? 2.67700   -46.89400 -16.18400 1.000 76.63000  ? 704  DG  T C5    1 
ATOM   8148 C  C6    . DG  D 4 4   ? 3.37900   -45.67500 -16.02400 1.000 77.61000  ? 704  DG  T C6    1 
ATOM   8149 O  O6    . DG  D 4 4   ? 4.57400   -45.44600 -16.25100 1.000 76.84000  ? 704  DG  T O6    1 
ATOM   8150 N  N1    . DG  D 4 4   ? 2.54800   -44.65300 -15.55100 1.000 81.06000  ? 704  DG  T N1    1 
ATOM   8151 C  C2    . DG  D 4 4   ? 1.20800   -44.79900 -15.26400 1.000 83.54000  ? 704  DG  T C2    1 
ATOM   8152 N  N2    . DG  D 4 4   ? 0.56500   -43.70700 -14.81300 1.000 85.37000  ? 704  DG  T N2    1 
ATOM   8153 N  N3    . DG  D 4 4   ? 0.54400   -45.93300 -15.40900 1.000 80.95000  ? 704  DG  T N3    1 
ATOM   8154 C  C4    . DG  D 4 4   ? 1.33700   -46.93200 -15.87500 1.000 77.02000  ? 704  DG  T C4    1 
ATOM   8155 P  P     . DG  D 4 5   ? -4.15600  -49.04100 -12.85400 1.000 53.81000  ? 705  DG  T P     1 
ATOM   8156 O  OP1   . DG  D 4 5   ? -5.16800  -50.13800 -12.89200 1.000 41.94000  ? 705  DG  T OP1   1 
ATOM   8157 O  OP2   . DG  D 4 5   ? -4.52900  -47.60400 -12.94200 1.000 55.22000  ? 705  DG  T OP2   1 
ATOM   8158 O  "O5'" . DG  D 4 5   ? -3.22800  -49.23200 -11.56300 1.000 48.32000  ? 705  DG  T "O5'" 1 
ATOM   8159 C  "C5'" . DG  D 4 5   ? -2.61300  -50.48700 -11.31200 1.000 44.74000  ? 705  DG  T "C5'" 1 
ATOM   8160 C  "C4'" . DG  D 4 5   ? -2.17600  -50.58900 -9.85900  1.000 39.93000  ? 705  DG  T "C4'" 1 
ATOM   8161 O  "O4'" . DG  D 4 5   ? -1.22200  -49.53900 -9.55100  1.000 40.70000  ? 705  DG  T "O4'" 1 
ATOM   8162 C  "C3'" . DG  D 4 5   ? -3.28500  -50.38400 -8.85100  1.000 35.78000  ? 705  DG  T "C3'" 1 
ATOM   8163 O  "O3'" . DG  D 4 5   ? -3.96000  -51.57000 -8.66100  1.000 37.18000  ? 705  DG  T "O3'" 1 
ATOM   8164 C  "C2'" . DG  D 4 5   ? -2.48700  -50.01000 -7.61800  1.000 37.69000  ? 705  DG  T "C2'" 1 
ATOM   8165 C  "C1'" . DG  D 4 5   ? -1.46500  -49.06900 -8.23800  1.000 37.42000  ? 705  DG  T "C1'" 1 
ATOM   8166 N  N9    . DG  D 4 5   ? -1.95700  -47.70700 -8.31200  1.000 37.75000  ? 705  DG  T N9    1 
ATOM   8167 C  C8    . DG  D 4 5   ? -2.28000  -46.98800 -9.43900  1.000 39.55000  ? 705  DG  T C8    1 
ATOM   8168 N  N7    . DG  D 4 5   ? -2.72000  -45.78800 -9.17100  1.000 47.42000  ? 705  DG  T N7    1 
ATOM   8169 C  C5    . DG  D 4 5   ? -2.68300  -45.71600 -7.76700  1.000 40.56000  ? 705  DG  T C5    1 
ATOM   8170 C  C6    . DG  D 4 5   ? -3.03400  -44.65700 -6.87500  1.000 35.29000  ? 705  DG  T C6    1 
ATOM   8171 O  O6    . DG  D 4 5   ? -3.46100  -43.51700 -7.13800  1.000 33.37000  ? 705  DG  T O6    1 
ATOM   8172 N  N1    . DG  D 4 5   ? -2.84800  -45.02900 -5.54600  1.000 36.99000  ? 705  DG  T N1    1 
ATOM   8173 C  C2    . DG  D 4 5   ? -2.38000  -46.24700 -5.12000  1.000 34.44000  ? 705  DG  T C2    1 
ATOM   8174 N  N2    . DG  D 4 5   ? -2.26700  -46.41900 -3.79700  1.000 30.83000  ? 705  DG  T N2    1 
ATOM   8175 N  N3    . DG  D 4 5   ? -2.04900  -47.23000 -5.93400  1.000 39.51000  ? 705  DG  T N3    1 
ATOM   8176 C  C4    . DG  D 4 5   ? -2.22200  -46.89400 -7.23800  1.000 37.14000  ? 705  DG  T C4    1 
ATOM   8177 P  P     . DG  D 4 6   ? -5.42100  -51.53300 -8.01500  1.000 39.69000  ? 706  DG  T P     1 
ATOM   8178 O  OP1   . DG  D 4 6   ? -5.89300  -52.92800 -7.83500  1.000 31.85000  ? 706  DG  T OP1   1 
ATOM   8179 O  OP2   . DG  D 4 6   ? -6.21800  -50.56000 -8.79500  1.000 40.18000  ? 706  DG  T OP2   1 
ATOM   8180 O  "O5'" . DG  D 4 6   ? -5.15200  -50.90300 -6.57500  1.000 35.77000  ? 706  DG  T "O5'" 1 
ATOM   8181 C  "C5'" . DG  D 4 6   ? -4.41400  -51.64100 -5.62700  1.000 31.94000  ? 706  DG  T "C5'" 1 
ATOM   8182 C  "C4'" . DG  D 4 6   ? -4.50500  -50.98400 -4.26000  1.000 33.36000  ? 706  DG  T "C4'" 1 
ATOM   8183 O  "O4'" . DG  D 4 6   ? -3.99600  -49.64300 -4.34400  1.000 35.32000  ? 706  DG  T "O4'" 1 
ATOM   8184 C  "C3'" . DG  D 4 6   ? -5.91900  -50.80500 -3.72400  1.000 28.15000  ? 706  DG  T "C3'" 1 
ATOM   8185 O  "O3'" . DG  D 4 6   ? -6.33700  -51.97600 -3.09500  1.000 25.99000  ? 706  DG  T "O3'" 1 
ATOM   8186 C  "C2'" . DG  D 4 6   ? -5.73700  -49.68100 -2.71800  1.000 28.11000  ? 706  DG  T "C2'" 1 
ATOM   8187 C  "C1'" . DG  D 4 6   ? -4.66500  -48.83000 -3.39400  1.000 32.32000  ? 706  DG  T "C1'" 1 
ATOM   8188 N  N9    . DG  D 4 6   ? -5.18300  -47.67600 -4.09400  1.000 30.87000  ? 706  DG  T N9    1 
ATOM   8189 C  C8    . DG  D 4 6   ? -5.38400  -47.55500 -5.44300  1.000 31.94000  ? 706  DG  T C8    1 
ATOM   8190 N  N7    . DG  D 4 6   ? -5.82300  -46.37800 -5.79400  1.000 35.09000  ? 706  DG  T N7    1 
ATOM   8191 C  C5    . DG  D 4 6   ? -5.91300  -45.67700 -4.60200  1.000 30.83000  ? 706  DG  T C5    1 
ATOM   8192 C  C6    . DG  D 4 6   ? -6.32600  -44.36500 -4.35900  1.000 31.27000  ? 706  DG  T C6    1 
ATOM   8193 O  O6    . DG  D 4 6   ? -6.72400  -43.51400 -5.17100  1.000 34.66000  ? 706  DG  T O6    1 
ATOM   8194 N  N1    . DG  D 4 6   ? -6.26600  -44.05800 -3.01100  1.000 31.48000  ? 706  DG  T N1    1 
ATOM   8195 C  C2    . DG  D 4 6   ? -5.85800  -44.89900 -2.02900  1.000 27.37000  ? 706  DG  T C2    1 
ATOM   8196 N  N2    . DG  D 4 6   ? -5.87700  -44.40000 -0.80200  1.000 28.80000  ? 706  DG  T N2    1 
ATOM   8197 N  N3    . DG  D 4 6   ? -5.46000  -46.13200 -2.23200  1.000 28.89000  ? 706  DG  T N3    1 
ATOM   8198 C  C4    . DG  D 4 6   ? -5.51800  -46.45800 -3.54500  1.000 33.98000  ? 706  DG  T C4    1 
ATOM   8199 P  P     . DG  D 4 7   ? -7.89700  -52.32700 -3.04800  1.000 24.38000  ? 707  DG  T P     1 
ATOM   8200 O  OP1   . DG  D 4 7   ? -8.03000  -53.73600 -2.61600  1.000 23.77000  ? 707  DG  T OP1   1 
ATOM   8201 O  OP2   . DG  D 4 7   ? -8.49500  -51.84900 -4.30900  1.000 26.78000  ? 707  DG  T OP2   1 
ATOM   8202 O  "O5'" . DG  D 4 7   ? -8.46700  -51.36900 -1.89200  1.000 29.97000  ? 707  DG  T "O5'" 1 
ATOM   8203 C  "C5'" . DG  D 4 7   ? -8.44000  -51.80500 -0.52200  1.000 28.19000  ? 707  DG  T "C5'" 1 
ATOM   8204 C  "C4'" . DG  D 4 7   ? -8.89400  -50.68800 0.40400   1.000 29.77000  ? 707  DG  T "C4'" 1 
ATOM   8205 O  "O4'" . DG  D 4 7   ? -8.10100  -49.49900 0.16000   1.000 28.55000  ? 707  DG  T "O4'" 1 
ATOM   8206 C  "C3'" . DG  D 4 7   ? -10.31600 -50.22400 0.19500   1.000 28.02000  ? 707  DG  T "C3'" 1 
ATOM   8207 O  "O3'" . DG  D 4 7   ? -11.18700 -51.07600 0.87800   1.000 28.36000  ? 707  DG  T "O3'" 1 
ATOM   8208 C  "C2'" . DG  D 4 7   ? -10.27100 -48.84500 0.82700   1.000 25.62000  ? 707  DG  T "C2'" 1 
ATOM   8209 C  "C1'" . DG  D 4 7   ? -8.90300  -48.35200 0.34900   1.000 24.75000  ? 707  DG  T "C1'" 1 
ATOM   8210 N  N9    . DG  D 4 7   ? -8.97900  -47.63800 -0.90900  1.000 27.75000  ? 707  DG  T N9    1 
ATOM   8211 C  C8    . DG  D 4 7   ? -8.89800  -48.16800 -2.17600  1.000 25.77000  ? 707  DG  T C8    1 
ATOM   8212 N  N7    . DG  D 4 7   ? -9.01400  -47.26700 -3.12100  1.000 27.69000  ? 707  DG  T N7    1 
ATOM   8213 C  C5    . DG  D 4 7   ? -9.19900  -46.07100 -2.43700  1.000 26.54000  ? 707  DG  T C5    1 
ATOM   8214 C  C6    . DG  D 4 7   ? -9.39300  -44.75800 -2.92400  1.000 27.93000  ? 707  DG  T C6    1 
ATOM   8215 O  O6    . DG  D 4 7   ? -9.45900  -44.37800 -4.08900  1.000 28.88000  ? 707  DG  T O6    1 
ATOM   8216 N  N1    . DG  D 4 7   ? -9.53700  -43.83900 -1.89000  1.000 29.62000  ? 707  DG  T N1    1 
ATOM   8217 C  C2    . DG  D 4 7   ? -9.50300  -44.14700 -0.55700  1.000 24.98000  ? 707  DG  T C2    1 
ATOM   8218 N  N2    . DG  D 4 7   ? -9.65900  -43.13700 0.27100   1.000 25.45000  ? 707  DG  T N2    1 
ATOM   8219 N  N3    . DG  D 4 7   ? -9.32900  -45.36500 -0.07500  1.000 23.12000  ? 707  DG  T N3    1 
ATOM   8220 C  C4    . DG  D 4 7   ? -9.18100  -46.27800 -1.07300  1.000 29.21000  ? 707  DG  T C4    1 
ATOM   8221 P  P     . DG  D 4 8   ? -12.73100 -51.16900 0.43500   1.000 24.23000  ? 708  DG  T P     1 
ATOM   8222 O  OP1   . DG  D 4 8   ? -13.36400 -52.22500 1.24600   1.000 25.21000  ? 708  DG  T OP1   1 
ATOM   8223 O  OP2   . DG  D 4 8   ? -12.78700 -51.29200 -1.04700  1.000 26.18000  ? 708  DG  T OP2   1 
ATOM   8224 O  "O5'" . DG  D 4 8   ? -13.31300 -49.73100 0.82900   1.000 23.66000  ? 708  DG  T "O5'" 1 
ATOM   8225 C  "C5'" . DG  D 4 8   ? -13.30200 -49.35200 2.17400   1.000 24.84000  ? 708  DG  T "C5'" 1 
ATOM   8226 C  "C4'" . DG  D 4 8   ? -13.80400 -47.93600 2.36800   1.000 24.18000  ? 708  DG  T "C4'" 1 
ATOM   8227 O  "O4'" . DG  D 4 8   ? -12.84600 -46.97600 1.84900   1.000 21.73000  ? 708  DG  T "O4'" 1 
ATOM   8228 C  "C3'" . DG  D 4 8   ? -15.12800 -47.61200 1.68500   1.000 23.26000  ? 708  DG  T "C3'" 1 
ATOM   8229 O  "O3'" . DG  D 4 8   ? -16.17700 -48.02500 2.52200   1.000 23.89000  ? 708  DG  T "O3'" 1 
ATOM   8230 C  "C2'" . DG  D 4 8   ? -15.04800 -46.09200 1.60800   1.000 24.71000  ? 708  DG  T "C2'" 1 
ATOM   8231 C  "C1'" . DG  D 4 8   ? -13.55000 -45.86800 1.30200   1.000 23.85000  ? 708  DG  T "C1'" 1 
ATOM   8232 N  N9    . DG  D 4 8   ? -13.30100 -45.88100 -0.10900  1.000 27.79000  ? 708  DG  T N9    1 
ATOM   8233 C  C8    . DG  D 4 8   ? -13.02900 -46.99200 -0.86900  1.000 26.03000  ? 708  DG  T C8    1 
ATOM   8234 N  N7    . DG  D 4 8   ? -12.87700 -46.73200 -2.12500  1.000 25.25000  ? 708  DG  T N7    1 
ATOM   8235 C  C5    . DG  D 4 8   ? -13.08300 -45.37200 -2.21700  1.000 25.74000  ? 708  DG  T C5    1 
ATOM   8236 C  C6    . DG  D 4 8   ? -13.03900 -44.54000 -3.34600  1.000 29.48000  ? 708  DG  T C6    1 
ATOM   8237 O  O6    . DG  D 4 8   ? -12.79000 -44.85800 -4.51800  1.000 34.12000  ? 708  DG  T O6    1 
ATOM   8238 N  N1    . DG  D 4 8   ? -13.28200 -43.20800 -3.01700  1.000 28.30000  ? 708  DG  T N1    1 
ATOM   8239 C  C2    . DG  D 4 8   ? -13.53800 -42.74500 -1.75000  1.000 28.89000  ? 708  DG  T C2    1 
ATOM   8240 N  N2    . DG  D 4 8   ? -13.75000 -41.43600 -1.64400  1.000 29.27000  ? 708  DG  T N2    1 
ATOM   8241 N  N3    . DG  D 4 8   ? -13.59000 -43.52400 -0.66200  1.000 27.67000  ? 708  DG  T N3    1 
ATOM   8242 C  C4    . DG  D 4 8   ? -13.34700 -44.82400 -0.97700  1.000 28.57000  ? 708  DG  T C4    1 
ATOM   8243 P  P     . DC  D 4 9   ? -17.46500 -48.77000 1.91600   1.000 25.37000  ? 709  DC  T P     1 
ATOM   8244 O  OP1   . DC  D 4 9   ? -18.19500 -49.49200 2.98700   1.000 21.28000  ? 709  DC  T OP1   1 
ATOM   8245 O  OP2   . DC  D 4 9   ? -17.04000 -49.50900 0.71300   1.000 26.26000  ? 709  DC  T OP2   1 
ATOM   8246 O  "O5'" . DC  D 4 9   ? -18.37800 -47.56300 1.42400   1.000 26.24000  ? 709  DC  T "O5'" 1 
ATOM   8247 C  "C5'" . DC  D 4 9   ? -18.94100 -46.71100 2.34700   1.000 20.21000  ? 709  DC  T "C5'" 1 
ATOM   8248 C  "C4'" . DC  D 4 9   ? -19.33300 -45.42100 1.66900   1.000 25.62000  ? 709  DC  T "C4'" 1 
ATOM   8249 O  "O4'" . DC  D 4 9   ? -18.15900 -44.79000 1.07600   1.000 27.64000  ? 709  DC  T "O4'" 1 
ATOM   8250 C  "C3'" . DC  D 4 9   ? -20.30200 -45.57700 0.52400   1.000 23.88000  ? 709  DC  T "C3'" 1 
ATOM   8251 O  "O3'" . DC  D 4 9   ? -21.59200 -45.63400 1.05200   1.000 24.51000  ? 709  DC  T "O3'" 1 
ATOM   8252 C  "C2'" . DC  D 4 9   ? -20.06000 -44.27200 -0.25000  1.000 23.36000  ? 709  DC  T "C2'" 1 
ATOM   8253 C  "C1'" . DC  D 4 9   ? -18.54100 -44.08800 -0.08700  1.000 22.60000  ? 709  DC  T "C1'" 1 
ATOM   8254 N  N1    . DC  D 4 9   ? -17.77400 -44.67100 -1.18900  1.000 25.80000  ? 709  DC  T N1    1 
ATOM   8255 C  C2    . DC  D 4 9   ? -17.44000 -43.88600 -2.27900  1.000 26.50000  ? 709  DC  T C2    1 
ATOM   8256 O  O2    . DC  D 4 9   ? -17.79700 -42.70500 -2.29200  1.000 30.81000  ? 709  DC  T O2    1 
ATOM   8257 N  N3    . DC  D 4 9   ? -16.73200 -44.43500 -3.29600  1.000 30.47000  ? 709  DC  T N3    1 
ATOM   8258 C  C4    . DC  D 4 9   ? -16.34900 -45.72000 -3.22800  1.000 31.43000  ? 709  DC  T C4    1 
ATOM   8259 N  N4    . DC  D 4 9   ? -15.65200 -46.22200 -4.25200  1.000 28.03000  ? 709  DC  T N4    1 
ATOM   8260 C  C5    . DC  D 4 9   ? -16.68200 -46.54500 -2.11400  1.000 27.57000  ? 709  DC  T C5    1 
ATOM   8261 C  C6    . DC  D 4 9   ? -17.37900 -45.98000 -1.11900  1.000 26.41000  ? 709  DC  T C6    1 
ATOM   8262 P  P     . DG  D 4 10  ? -22.80400 -46.09800 0.11700   1.000 24.76000  ? 710  DG  T P     1 
ATOM   8263 O  OP1   . DG  D 4 10  ? -24.07400 -45.89500 0.82700   1.000 22.33000  ? 710  DG  T OP1   1 
ATOM   8264 O  OP2   . DG  D 4 10  ? -22.45600 -47.44400 -0.37800  1.000 21.97000  ? 710  DG  T OP2   1 
ATOM   8265 O  "O5'" . DG  D 4 10  ? -22.78800 -45.02500 -1.05200  1.000 24.42000  ? 710  DG  T "O5'" 1 
ATOM   8266 C  "C5'" . DG  D 4 10  ? -23.21900 -43.71600 -0.78700  1.000 23.17000  ? 710  DG  T "C5'" 1 
ATOM   8267 C  "C4'" . DG  D 4 10  ? -23.27100 -42.90400 -2.06200  1.000 23.90000  ? 710  DG  T "C4'" 1 
ATOM   8268 O  "O4'" . DG  D 4 10  ? -21.92600 -42.71700 -2.56100  1.000 27.50000  ? 710  DG  T "O4'" 1 
ATOM   8269 C  "C3'" . DG  D 4 10  ? -24.03000 -43.54200 -3.20600  1.000 26.38000  ? 710  DG  T "C3'" 1 
ATOM   8270 O  "O3'" . DG  D 4 10  ? -25.37200 -43.18900 -3.11500  1.000 30.99000  ? 710  DG  T "O3'" 1 
ATOM   8271 C  "C2'" . DG  D 4 10  ? -23.38400 -42.89200 -4.42500  1.000 30.81000  ? 710  DG  T "C2'" 1 
ATOM   8272 C  "C1'" . DG  D 4 10  ? -21.93200 -42.73100 -3.96900  1.000 31.19000  ? 710  DG  T "C1'" 1 
ATOM   8273 N  N9    . DG  D 4 10  ? -21.06500 -43.81500 -4.40400  1.000 30.79000  ? 710  DG  T N9    1 
ATOM   8274 C  C8    . DG  D 4 10  ? -20.67100 -44.91300 -3.68000  1.000 29.25000  ? 710  DG  T C8    1 
ATOM   8275 N  N7    . DG  D 4 10  ? -19.89200 -45.72000 -4.34500  1.000 28.91000  ? 710  DG  T N7    1 
ATOM   8276 C  C5    . DG  D 4 10  ? -19.75900 -45.11000 -5.58200  1.000 30.61000  ? 710  DG  T C5    1 
ATOM   8277 C  C6    . DG  D 4 10  ? -19.03000 -45.51000 -6.72500  1.000 33.77000  ? 710  DG  T C6    1 
ATOM   8278 O  O6    . DG  D 4 10  ? -18.32300 -46.51900 -6.87900  1.000 38.40000  ? 710  DG  T O6    1 
ATOM   8279 N  N1    . DG  D 4 10  ? -19.17500 -44.60000 -7.76000  1.000 34.93000  ? 710  DG  T N1    1 
ATOM   8280 C  C2    . DG  D 4 10  ? -19.93100 -43.45100 -7.71000  1.000 33.99000  ? 710  DG  T C2    1 
ATOM   8281 N  N2    . DG  D 4 10  ? -19.94200 -42.70400 -8.81500  1.000 33.41000  ? 710  DG  T N2    1 
ATOM   8282 N  N3    . DG  D 4 10  ? -20.62100 -43.06200 -6.64900  1.000 34.79000  ? 710  DG  T N3    1 
ATOM   8283 C  C4    . DG  D 4 10  ? -20.48000 -43.93300 -5.62400  1.000 33.01000  ? 710  DG  T C4    1 
ATOM   8284 P  P     . DC  D 4 11  ? -26.48800 -44.04700 -3.88700  1.000 35.59000  ? 711  DC  T P     1 
ATOM   8285 O  OP1   . DC  D 4 11  ? -27.79600 -43.45700 -3.51300  1.000 42.90000  ? 711  DC  T OP1   1 
ATOM   8286 O  OP2   . DC  D 4 11  ? -26.23900 -45.49000 -3.70600  1.000 31.66000  ? 711  DC  T OP2   1 
ATOM   8287 O  "O5'" . DC  D 4 11  ? -26.18000 -43.76400 -5.41900  1.000 37.66000  ? 711  DC  T "O5'" 1 
ATOM   8288 C  "C5'" . DC  D 4 11  ? -26.26700 -42.45700 -5.94700  1.000 33.94000  ? 711  DC  T "C5'" 1 
ATOM   8289 C  "C4'" . DC  D 4 11  ? -25.99800 -42.52100 -7.43300  1.000 36.94000  ? 711  DC  T "C4'" 1 
ATOM   8290 O  "O4'" . DC  D 4 11  ? -24.60500 -42.83300 -7.64200  1.000 38.75000  ? 711  DC  T "O4'" 1 
ATOM   8291 C  "C3'" . DC  D 4 11  ? -26.77500 -43.61000 -8.15600  1.000 35.52000  ? 711  DC  T "C3'" 1 
ATOM   8292 O  "O3'" . DC  D 4 11  ? -27.98900 -43.04000 -8.66600  1.000 49.56000  ? 711  DC  T "O3'" 1 
ATOM   8293 C  "C2'" . DC  D 4 11  ? -25.83500 -44.05200 -9.27800  1.000 36.47000  ? 711  DC  T "C2'" 1 
ATOM   8294 C  "C1'" . DC  D 4 11  ? -24.44600 -43.69200 -8.74800  1.000 38.71000  ? 711  DC  T "C1'" 1 
ATOM   8295 N  N1    . DC  D 4 11  ? -23.63000 -44.87100 -8.31100  1.000 34.87000  ? 711  DC  T N1    1 
ATOM   8296 C  C2    . DC  D 4 11  ? -22.66200 -45.39500 -9.17100  1.000 38.37000  ? 711  DC  T C2    1 
ATOM   8297 O  O2    . DC  D 4 11  ? -22.50300 -44.88100 -10.28800 1.000 45.18000  ? 711  DC  T O2    1 
ATOM   8298 N  N3    . DC  D 4 11  ? -21.92600 -46.45200 -8.76200  1.000 36.67000  ? 711  DC  T N3    1 
ATOM   8299 C  C4    . DC  D 4 11  ? -22.12700 -46.97500 -7.56000  1.000 34.76000  ? 711  DC  T C4    1 
ATOM   8300 N  N4    . DC  D 4 11  ? -21.38800 -48.02600 -7.20300  1.000 36.47000  ? 711  DC  T N4    1 
ATOM   8301 C  C5    . DC  D 4 11  ? -23.10700 -46.45000 -6.67200  1.000 38.46000  ? 711  DC  T C5    1 
ATOM   8302 C  C6    . DC  D 4 11  ? -23.82600 -45.40600 -7.08500  1.000 35.91000  ? 711  DC  T C6    1 
ATOM   8303 P  P     . DC  D 4 12  ? -29.00900 -43.90000 -9.57000  1.000 48.41000  ? 712  DC  T P     1 
ATOM   8304 O  OP1   . DC  D 4 12  ? -30.25200 -43.11000 -9.69500  1.000 45.60000  ? 712  DC  T OP1   1 
ATOM   8305 O  OP2   . DC  D 4 12  ? -29.06700 -45.30800 -9.06700  1.000 44.99000  ? 712  DC  T OP2   1 
ATOM   8306 O  "O5'" . DC  D 4 12  ? -28.29000 -43.89700 -10.98500 1.000 47.32000  ? 712  DC  T "O5'" 1 
ATOM   8307 C  "C5'" . DC  D 4 12  ? -28.88700 -44.55200 -12.04200 1.000 53.39000  ? 712  DC  T "C5'" 1 
ATOM   8308 C  "C4'" . DC  D 4 12  ? -27.86400 -45.31000 -12.83400 1.000 45.36000  ? 712  DC  T "C4'" 1 
ATOM   8309 O  "O4'" . DC  D 4 12  ? -26.76000 -45.64500 -12.00000 1.000 45.59000  ? 712  DC  T "O4'" 1 
ATOM   8310 C  "C3'" . DC  D 4 12  ? -28.35600 -46.63900 -13.32800 1.000 54.43000  ? 712  DC  T "C3'" 1 
ATOM   8311 O  "O3'" . DC  D 4 12  ? -29.00800 -46.44100 -14.55900 1.000 48.70000  ? 712  DC  T "O3'" 1 
ATOM   8312 C  "C2'" . DC  D 4 12  ? -27.06500 -47.46700 -13.47200 1.000 47.68000  ? 712  DC  T "C2'" 1 
ATOM   8313 C  "C1'" . DC  D 4 12  ? -26.05700 -46.70000 -12.61400 1.000 44.08000  ? 712  DC  T "C1'" 1 
ATOM   8314 N  N1    . DC  D 4 12  ? -25.45600 -47.51300 -11.56000 1.000 41.82000  ? 712  DC  T N1    1 
ATOM   8315 C  C2    . DC  D 4 12  ? -24.32600 -48.27100 -11.84200 1.000 46.80000  ? 712  DC  T C2    1 
ATOM   8316 O  O2    . DC  D 4 12  ? -23.85600 -48.24300 -12.98300 1.000 51.11000  ? 712  DC  T O2    1 
ATOM   8317 N  N3    . DC  D 4 12  ? -23.78300 -49.02400 -10.85700 1.000 44.74000  ? 712  DC  T N3    1 
ATOM   8318 C  C4    . DC  D 4 12  ? -24.32100 -49.01200 -9.64500  1.000 40.97000  ? 712  DC  T C4    1 
ATOM   8319 N  N4    . DC  D 4 12  ? -23.74600 -49.75400 -8.70100  1.000 42.08000  ? 712  DC  T N4    1 
ATOM   8320 C  C5    . DC  D 4 12  ? -25.47000 -48.23600 -9.34400  1.000 41.06000  ? 712  DC  T C5    1 
ATOM   8321 C  C6    . DC  D 4 12  ? -25.99900 -47.51200 -10.32300 1.000 42.90000  ? 712  DC  T C6    1 
ATOM   8322 P  P     . DC  D 4 13  ? -30.07800 -47.51300 -15.06500 1.000 58.00000  ? 713  DC  T P     1 
ATOM   8323 O  OP1   . DC  D 4 13  ? -30.72200 -46.82800 -16.21900 1.000 58.28000  ? 713  DC  T OP1   1 
ATOM   8324 O  OP2   . DC  D 4 13  ? -30.86400 -48.03000 -13.91400 1.000 53.59000  ? 713  DC  T OP2   1 
ATOM   8325 O  "O5'" . DC  D 4 13  ? -29.17800 -48.75700 -15.54900 1.000 53.39000  ? 713  DC  T "O5'" 1 
ATOM   8326 C  "C5'" . DC  D 4 13  ? -28.30000 -48.58900 -16.65000 1.000 54.04000  ? 713  DC  T "C5'" 1 
ATOM   8327 C  "C4'" . DC  D 4 13  ? -27.29100 -49.70900 -16.69600 1.000 53.00000  ? 713  DC  T "C4'" 1 
ATOM   8328 O  "O4'" . DC  D 4 13  ? -26.55000 -49.71800 -15.46400 1.000 55.72000  ? 713  DC  T "O4'" 1 
ATOM   8329 C  "C3'" . DC  D 4 13  ? -27.89200 -51.09300 -16.80500 1.000 54.17000  ? 713  DC  T "C3'" 1 
ATOM   8330 O  "O3'" . DC  D 4 13  ? -28.02900 -51.44600 -18.18800 1.000 59.18000  ? 713  DC  T "O3'" 1 
ATOM   8331 C  "C2'" . DC  D 4 13  ? -26.85800 -51.98300 -16.09800 1.000 58.42000  ? 713  DC  T "C2'" 1 
ATOM   8332 C  "C1'" . DC  D 4 13  ? -26.05500 -51.01100 -15.22000 1.000 51.86000  ? 713  DC  T "C1'" 1 
ATOM   8333 N  N1    . DC  D 4 13  ? -26.19200 -51.26500 -13.77100 1.000 46.03000  ? 713  DC  T N1    1 
ATOM   8334 C  C2    . DC  D 4 13  ? -25.33300 -52.16600 -13.12500 1.000 54.06000  ? 713  DC  T C2    1 
ATOM   8335 O  O2    . DC  D 4 13  ? -24.46700 -52.76000 -13.78200 1.000 54.20000  ? 713  DC  T O2    1 
ATOM   8336 N  N3    . DC  D 4 13  ? -25.48100 -52.36300 -11.78700 1.000 55.60000  ? 713  DC  T N3    1 
ATOM   8337 C  C4    . DC  D 4 13  ? -26.42700 -51.70200 -11.11100 1.000 51.84000  ? 713  DC  T C4    1 
ATOM   8338 N  N4    . DC  D 4 13  ? -26.53800 -51.93000 -9.79900  1.000 49.46000  ? 713  DC  T N4    1 
ATOM   8339 C  C5    . DC  D 4 13  ? -27.30000 -50.78100 -11.75500 1.000 48.99000  ? 713  DC  T C5    1 
ATOM   8340 C  C6    . DC  D 4 13  ? -27.14700 -50.59600 -13.06800 1.000 50.63000  ? 713  DC  T C6    1 
ATOM   8341 P  P     . DG  D 4 14  ? -29.01600 -52.63400 -18.62800 1.000 63.36000  ? 714  DG  T P     1 
ATOM   8342 O  OP1   . DG  D 4 14  ? -29.37800 -52.38900 -20.04100 1.000 64.04000  ? 714  DG  T OP1   1 
ATOM   8343 O  OP2   . DG  D 4 14  ? -30.10000 -52.73300 -17.61000 1.000 57.38000  ? 714  DG  T OP2   1 
ATOM   8344 O  "O5'" . DG  D 4 14  ? -28.09300 -53.94800 -18.54200 1.000 49.36000  ? 714  DG  T "O5'" 1 
ATOM   8345 C  "C5'" . DG  D 4 14  ? -26.76600 -53.89300 -19.02900 1.000 49.42000  ? 714  DG  T "C5'" 1 
ATOM   8346 C  "C4'" . DG  D 4 14  ? -25.99300 -55.13900 -18.63800 1.000 54.70000  ? 714  DG  T "C4'" 1 
ATOM   8347 O  "O4'" . DG  D 4 14  ? -25.66200 -55.09900 -17.21900 1.000 61.64000  ? 714  DG  T "O4'" 1 
ATOM   8348 C  "C3'" . DG  D 4 14  ? -26.72500 -56.45900 -18.84700 1.000 60.62000  ? 714  DG  T "C3'" 1 
ATOM   8349 O  "O3'" . DG  D 4 14  ? -25.77500 -57.47900 -19.14400 1.000 69.82000  ? 714  DG  T "O3'" 1 
ATOM   8350 C  "C2'" . DG  D 4 14  ? -27.37800 -56.68600 -17.49000 1.000 60.21000  ? 714  DG  T "C2'" 1 
ATOM   8351 C  "C1'" . DG  D 4 14  ? -26.29300 -56.17900 -16.54700 1.000 62.82000  ? 714  DG  T "C1'" 1 
ATOM   8352 N  N9    . DG  D 4 14  ? -26.81300 -55.68900 -15.26300 1.000 60.06000  ? 714  DG  T N9    1 
ATOM   8353 C  C8    . DG  D 4 14  ? -27.89800 -54.86100 -15.06800 1.000 58.37000  ? 714  DG  T C8    1 
ATOM   8354 N  N7    . DG  D 4 14  ? -28.12800 -54.58400 -13.81500 1.000 53.75000  ? 714  DG  T N7    1 
ATOM   8355 C  C5    . DG  D 4 14  ? -27.13200 -55.27500 -13.13500 1.000 55.71000  ? 714  DG  T C5    1 
ATOM   8356 C  C6    . DG  D 4 14  ? -26.86700 -55.35600 -11.74800 1.000 53.16000  ? 714  DG  T C6    1 
ATOM   8357 O  O6    . DG  D 4 14  ? -27.48400 -54.81900 -10.81700 1.000 53.58000  ? 714  DG  T O6    1 
ATOM   8358 N  N1    . DG  D 4 14  ? -25.76400 -56.15800 -11.48100 1.000 54.94000  ? 714  DG  T N1    1 
ATOM   8359 C  C2    . DG  D 4 14  ? -25.01300 -56.80200 -12.42700 1.000 56.30000  ? 714  DG  T C2    1 
ATOM   8360 N  N2    . DG  D 4 14  ? -23.98600 -57.52700 -11.97100 1.000 54.28000  ? 714  DG  T N2    1 
ATOM   8361 N  N3    . DG  D 4 14  ? -25.24700 -56.73900 -13.73200 1.000 59.92000  ? 714  DG  T N3    1 
ATOM   8362 C  C4    . DG  D 4 14  ? -26.31600 -55.96000 -14.01100 1.000 56.91000  ? 714  DG  T C4    1 
ATOM   8363 P  P     . DA  D 4 15  ? -26.25400 -58.95100 -19.59200 1.000 75.97000  ? 715  DA  T P     1 
ATOM   8364 O  OP1   . DA  D 4 15  ? -25.53100 -59.24400 -20.84900 1.000 76.72000  ? 715  DA  T OP1   1 
ATOM   8365 O  OP2   . DA  D 4 15  ? -27.74000 -59.02800 -19.55800 1.000 59.04000  ? 715  DA  T OP2   1 
ATOM   8366 O  "O5'" . DA  D 4 15  ? -25.63900 -59.89500 -18.46000 1.000 61.51000  ? 715  DA  T "O5'" 1 
ATOM   8367 C  "C5'" . DA  D 4 15  ? -24.24600 -59.88000 -18.24700 1.000 61.13000  ? 715  DA  T "C5'" 1 
ATOM   8368 C  "C4'" . DA  D 4 15  ? -23.87800 -60.68700 -17.02200 1.000 66.09000  ? 715  DA  T "C4'" 1 
ATOM   8369 O  "O4'" . DA  D 4 15  ? -24.37500 -60.02400 -15.83400 1.000 69.75000  ? 715  DA  T "O4'" 1 
ATOM   8370 C  "C3'" . DA  D 4 15  ? -24.42600 -62.10200 -16.98900 1.000 73.78000  ? 715  DA  T "C3'" 1 
ATOM   8371 O  "O3'" . DA  D 4 15  ? -23.39600 -62.99400 -16.59300 1.000 77.48000  ? 715  DA  T "O3'" 1 
ATOM   8372 C  "C2'" . DA  D 4 15  ? -25.57000 -62.03900 -15.96100 1.000 66.33000  ? 715  DA  T "C2'" 1 
ATOM   8373 C  "C1'" . DA  D 4 15  ? -25.13200 -60.91200 -15.03900 1.000 64.49000  ? 715  DA  T "C1'" 1 
ATOM   8374 N  N9    . DA  D 4 15  ? -26.24600 -60.14100 -14.47600 1.000 64.92000  ? 715  DA  T N9    1 
ATOM   8375 C  C8    . DA  D 4 15  ? -27.27000 -59.55900 -15.17100 1.000 64.36000  ? 715  DA  T C8    1 
ATOM   8376 N  N7    . DA  D 4 15  ? -28.12000 -58.89900 -14.42100 1.000 63.47000  ? 715  DA  T N7    1 
ATOM   8377 C  C5    . DA  D 4 15  ? -27.61400 -59.04100 -13.13900 1.000 60.68000  ? 715  DA  T C5    1 
ATOM   8378 C  C6    . DA  D 4 15  ? -28.06300 -58.56900 -11.88500 1.000 57.30000  ? 715  DA  T C6    1 
ATOM   8379 N  N6    . DA  D 4 15  ? -29.16700 -57.83400 -11.73100 1.000 53.90000  ? 715  DA  T N6    1 
ATOM   8380 N  N1    . DA  D 4 15  ? -27.32600 -58.88200 -10.79300 1.000 58.51000  ? 715  DA  T N1    1 
ATOM   8381 C  C2    . DA  D 4 15  ? -26.22100 -59.62400 -10.95400 1.000 59.35000  ? 715  DA  T C2    1 
ATOM   8382 N  N3    . DA  D 4 15  ? -25.70000 -60.12800 -12.07900 1.000 63.85000  ? 715  DA  T N3    1 
ATOM   8383 C  C4    . DA  D 4 15  ? -26.45200 -59.79700 -13.14900 1.000 61.77000  ? 715  DA  T C4    1 
ATOM   8384 P  P     . DA  D 4 16  ? -23.56900 -64.57800 -16.80100 1.000 82.80000  ? 716  DA  T P     1 
ATOM   8385 O  OP1   . DA  D 4 16  ? -22.19700 -65.10900 -16.98700 1.000 79.03000  ? 716  DA  T OP1   1 
ATOM   8386 O  OP2   . DA  D 4 16  ? -24.60500 -64.81600 -17.83700 1.000 77.77000  ? 716  DA  T OP2   1 
ATOM   8387 O  "O5'" . DA  D 4 16  ? -24.16300 -65.07300 -15.39500 1.000 74.20000  ? 716  DA  T "O5'" 1 
ATOM   8388 C  "C5'" . DA  D 4 16  ? -23.30800 -65.12200 -14.26200 1.000 72.28000  ? 716  DA  T "C5'" 1 
ATOM   8389 C  "C4'" . DA  D 4 16  ? -24.10100 -65.18900 -12.96900 1.000 72.97000  ? 716  DA  T "C4'" 1 
ATOM   8390 O  "O4'" . DA  D 4 16  ? -25.05600 -64.12500 -12.92600 1.000 73.65000  ? 716  DA  T "O4'" 1 
ATOM   8391 C  "C3'" . DA  D 4 16  ? -24.91200 -66.47000 -12.74800 1.000 70.12000  ? 716  DA  T "C3'" 1 
ATOM   8392 O  "O3'" . DA  D 4 16  ? -24.22000 -67.30000 -11.82700 1.000 70.17000  ? 716  DA  T "O3'" 1 
ATOM   8393 C  "C2'" . DA  D 4 16  ? -26.26600 -65.97600 -12.17300 1.000 66.52000  ? 716  DA  T "C2'" 1 
ATOM   8394 C  "C1'" . DA  D 4 16  ? -26.03700 -64.47900 -11.98500 1.000 66.50000  ? 716  DA  T "C1'" 1 
ATOM   8395 N  N9    . DA  D 4 16  ? -27.20400 -63.64100 -12.23400 1.000 64.43000  ? 716  DA  T N9    1 
ATOM   8396 C  C8    . DA  D 4 16  ? -27.74600 -63.32800 -13.45300 1.000 63.47000  ? 716  DA  T C8    1 
ATOM   8397 N  N7    . DA  D 4 16  ? -28.77600 -62.51600 -13.38300 1.000 62.87000  ? 716  DA  T N7    1 
ATOM   8398 C  C5    . DA  D 4 16  ? -28.90600 -62.26800 -12.02300 1.000 63.18000  ? 716  DA  T C5    1 
ATOM   8399 C  C6    . DA  D 4 16  ? -29.81500 -61.48100 -11.28400 1.000 58.19000  ? 716  DA  T C6    1 
ATOM   8400 N  N6    . DA  D 4 16  ? -30.79500 -60.77900 -11.84800 1.000 53.65000  ? 716  DA  T N6    1 
ATOM   8401 N  N1    . DA  D 4 16  ? -29.67000 -61.45000 -9.94000  1.000 58.29000  ? 716  DA  T N1    1 
ATOM   8402 C  C2    . DA  D 4 16  ? -28.68100 -62.16300 -9.37900  1.000 57.38000  ? 716  DA  T C2    1 
ATOM   8403 N  N3    . DA  D 4 16  ? -27.77000 -62.93900 -9.96700  1.000 59.50000  ? 716  DA  T N3    1 
ATOM   8404 C  C4    . DA  D 4 16  ? -27.93800 -62.94700 -11.30000 1.000 60.30000  ? 716  DA  T C4    1 
ATOM   8405 P  P     . DC  D 4 17  ? -24.68600 -68.81400 -11.57700 1.000 76.74000  ? 717  DC  T P     1 
ATOM   8406 O  OP1   . DC  D 4 17  ? -23.54100 -69.56500 -10.99900 1.000 74.52000  ? 717  DC  T OP1   1 
ATOM   8407 O  OP2   . DC  D 4 17  ? -25.34700 -69.24900 -12.82700 1.000 77.78000  ? 717  DC  T OP2   1 
ATOM   8408 O  "O5'" . DC  D 4 17  ? -25.82300 -68.68800 -10.45900 1.000 74.54000  ? 717  DC  T "O5'" 1 
ATOM   8409 C  "C5'" . DC  D 4 17  ? -25.61900 -67.85000 -9.34000  1.000 69.35000  ? 717  DC  T "C5'" 1 
ATOM   8410 C  "C4'" . DC  D 4 17  ? -26.92400 -67.61300 -8.61900  1.000 68.10000  ? 717  DC  T "C4'" 1 
ATOM   8411 O  "O4'" . DC  D 4 17  ? -27.68500 -66.57800 -9.29700  1.000 67.96000  ? 717  DC  T "O4'" 1 
ATOM   8412 C  "C3'" . DC  D 4 17  ? -27.86200 -68.83400 -8.54600  1.000 66.58000  ? 717  DC  T "C3'" 1 
ATOM   8413 O  "O3'" . DC  D 4 17  ? -28.34100 -68.96500 -7.22000  1.000 71.59000  ? 717  DC  T "O3'" 1 
ATOM   8414 C  "C2'" . DC  D 4 17  ? -28.99800 -68.45600 -9.50200  1.000 63.37000  ? 717  DC  T "C2'" 1 
ATOM   8415 C  "C1'" . DC  D 4 17  ? -29.03800 -66.96800 -9.24600  1.000 67.60000  ? 717  DC  T "C1'" 1 
ATOM   8416 N  N1    . DC  D 4 17  ? -29.84700 -66.16600 -10.22300 1.000 65.61000  ? 717  DC  T N1    1 
ATOM   8417 C  C2    . DC  D 4 17  ? -30.74600 -65.20700 -9.73100  1.000 60.87000  ? 717  DC  T C2    1 
ATOM   8418 O  O2    . DC  D 4 17  ? -30.85100 -65.05300 -8.50200  1.000 60.52000  ? 717  DC  T O2    1 
ATOM   8419 N  N3    . DC  D 4 17  ? -31.47500 -64.47300 -10.61200 1.000 55.77000  ? 717  DC  T N3    1 
ATOM   8420 C  C4    . DC  D 4 17  ? -31.33400 -64.67500 -11.91900 1.000 56.04000  ? 717  DC  T C4    1 
ATOM   8421 N  N4    . DC  D 4 17  ? -32.07800 -63.93200 -12.74300 1.000 56.65000  ? 717  DC  T N4    1 
ATOM   8422 C  C5    . DC  D 4 17  ? -30.42100 -65.64300 -12.44000 1.000 56.48000  ? 717  DC  T C5    1 
ATOM   8423 C  C6    . DC  D 4 17  ? -29.70700 -66.36100 -11.56500 1.000 60.30000  ? 717  DC  T C6    1 
ATOM   8424 P  P     . DA  D 4 18  ? -29.10300 -70.30400 -6.76200  1.000 78.53000  ? 718  DA  T P     1 
ATOM   8425 O  OP1   . DA  D 4 18  ? -28.15700 -71.05900 -5.90900  1.000 75.64000  ? 718  DA  T OP1   1 
ATOM   8426 O  OP2   . DA  D 4 18  ? -29.72100 -70.93700 -7.95900  1.000 65.12000  ? 718  DA  T OP2   1 
ATOM   8427 O  "O5'" . DA  D 4 18  ? -30.29300 -69.77200 -5.83100  1.000 71.96000  ? 718  DA  T "O5'" 1 
ATOM   8428 C  "C5'" . DA  D 4 18  ? -30.13900 -68.58600 -5.06100  1.000 64.09000  ? 718  DA  T "C5'" 1 
ATOM   8429 C  "C4'" . DA  D 4 18  ? -31.49100 -68.10100 -4.58000  1.000 64.09000  ? 718  DA  T "C4'" 1 
ATOM   8430 O  "O4'" . DA  D 4 18  ? -32.08200 -67.24500 -5.59400  1.000 65.87000  ? 718  DA  T "O4'" 1 
ATOM   8431 C  "C3'" . DA  D 4 18  ? -32.51200 -69.21100 -4.33400  1.000 66.50000  ? 718  DA  T "C3'" 1 
ATOM   8432 O  "O3'" . DA  D 4 18  ? -33.40400 -68.83500 -3.29800  1.000 68.01000  ? 718  DA  T "O3'" 1 
ATOM   8433 C  "C2'" . DA  D 4 18  ? -33.23600 -69.29500 -5.67000  1.000 64.24000  ? 718  DA  T "C2'" 1 
ATOM   8434 C  "C1'" . DA  D 4 18  ? -33.29400 -67.82400 -6.05500  1.000 64.32000  ? 718  DA  T "C1'" 1 
ATOM   8435 N  N9    . DA  D 4 18  ? -33.40800 -67.59700 -7.49300  1.000 61.21000  ? 718  DA  T N9    1 
ATOM   8436 C  C8    . DA  D 4 18  ? -32.70900 -68.22300 -8.49300  1.000 62.59000  ? 718  DA  T C8    1 
ATOM   8437 N  N7    . DA  D 4 18  ? -33.02400 -67.80700 -9.69700  1.000 60.12000  ? 718  DA  T N7    1 
ATOM   8438 C  C5    . DA  D 4 18  ? -33.99600 -66.84600 -9.47000  1.000 56.55000  ? 718  DA  T C5    1 
ATOM   8439 C  C6    . DA  D 4 18  ? -34.73600 -66.02100 -10.33500 1.000 53.43000  ? 718  DA  T C6    1 
ATOM   8440 N  N6    . DA  D 4 18  ? -34.60100 -66.04400 -11.66000 1.000 50.37000  ? 718  DA  T N6    1 
ATOM   8441 N  N1    . DA  D 4 18  ? -35.62600 -65.17300 -9.77700  1.000 55.09000  ? 718  DA  T N1    1 
ATOM   8442 C  C2    . DA  D 4 18  ? -35.75300 -65.15100 -8.44900  1.000 53.53000  ? 718  DA  T C2    1 
ATOM   8443 N  N3    . DA  D 4 18  ? -35.11100 -65.87200 -7.53600  1.000 55.55000  ? 718  DA  T N3    1 
ATOM   8444 C  C4    . DA  D 4 18  ? -34.24100 -66.70700 -8.11700  1.000 57.57000  ? 718  DA  T C4    1 
ATOM   8445 P  P     . DG  D 4 19  ? -34.08100 -69.96700 -2.36900  1.000 80.39000  ? 719  DG  T P     1 
ATOM   8446 O  OP1   . DG  D 4 19  ? -33.77700 -69.60800 -0.95900  1.000 71.40000  ? 719  DG  T OP1   1 
ATOM   8447 O  OP2   . DG  D 4 19  ? -33.81100 -71.30800 -2.94900  1.000 72.66000  ? 719  DG  T OP2   1 
ATOM   8448 O  "O5'" . DG  D 4 19  ? -35.63000 -69.73200 -2.55300  1.000 71.14000  ? 719  DG  T "O5'" 1 
ATOM   8449 C  "C5'" . DG  D 4 19  ? -36.18300 -68.48900 -2.21600  1.000 67.69000  ? 719  DG  T "C5'" 1 
ATOM   8450 C  "C4'" . DG  D 4 19  ? -37.42000 -68.26600 -3.03300  1.000 61.34000  ? 719  DG  T "C4'" 1 
ATOM   8451 O  "O4'" . DG  D 4 19  ? -37.04300 -68.04600 -4.41500  1.000 62.74000  ? 719  DG  T "O4'" 1 
ATOM   8452 C  "C3'" . DG  D 4 19  ? -38.37600 -69.46500 -3.04400  1.000 60.15000  ? 719  DG  T "C3'" 1 
ATOM   8453 O  "O3'" . DG  D 4 19  ? -39.63800 -69.04700 -2.59500  1.000 59.74000  ? 719  DG  T "O3'" 1 
ATOM   8454 C  "C2'" . DG  D 4 19  ? -38.40200 -69.92000 -4.52000  1.000 61.76000  ? 719  DG  T "C2'" 1 
ATOM   8455 C  "C1'" . DG  D 4 19  ? -38.02800 -68.63100 -5.22800  1.000 62.12000  ? 719  DG  T "C1'" 1 
ATOM   8456 N  N9    . DG  D 4 19  ? -37.50400 -68.79100 -6.58800  1.000 55.94000  ? 719  DG  T N9    1 
ATOM   8457 C  C8    . DG  D 4 19  ? -36.51100 -69.63300 -7.02400  1.000 60.21000  ? 719  DG  T C8    1 
ATOM   8458 N  N7    . DG  D 4 19  ? -36.25600 -69.52200 -8.30300  1.000 56.42000  ? 719  DG  T N7    1 
ATOM   8459 C  C5    . DG  D 4 19  ? -37.13000 -68.54000 -8.73200  1.000 52.62000  ? 719  DG  T C5    1 
ATOM   8460 C  C6    . DG  D 4 19  ? -37.31900 -67.99100 -10.01300 1.000 50.13000  ? 719  DG  T C6    1 
ATOM   8461 O  O6    . DG  D 4 19  ? -36.72700 -68.27600 -11.06900 1.000 49.97000  ? 719  DG  T O6    1 
ATOM   8462 N  N1    . DG  D 4 19  ? -38.30700 -67.01100 -10.00800 1.000 49.10000  ? 719  DG  T N1    1 
ATOM   8463 C  C2    . DG  D 4 19  ? -39.02700 -66.62700 -8.89900  1.000 50.41000  ? 719  DG  T C2    1 
ATOM   8464 N  N2    . DG  D 4 19  ? -39.94100 -65.67400 -9.08200  1.000 51.28000  ? 719  DG  T N2    1 
ATOM   8465 N  N3    . DG  D 4 19  ? -38.85800 -67.12900 -7.70100  1.000 53.37000  ? 719  DG  T N3    1 
ATOM   8466 C  C4    . DG  D 4 19  ? -37.89900 -68.07800 -7.68900  1.000 55.33000  ? 719  DG  T C4    1 
ATOM   8467 P  P     . DG  D 4 20  ? -40.80100 -70.12500 -2.34000  1.000 66.84000  ? 720  DG  T P     1 
ATOM   8468 O  OP1   . DG  D 4 20  ? -41.39500 -69.89100 -1.00300  1.000 65.34000  ? 720  DG  T OP1   1 
ATOM   8469 O  OP2   . DG  D 4 20  ? -40.25300 -71.45300 -2.70600  1.000 57.14000  ? 720  DG  T OP2   1 
ATOM   8470 O  "O5'" . DG  D 4 20  ? -41.91900 -69.70400 -3.39800  1.000 66.86000  ? 720  DG  T "O5'" 1 
ATOM   8471 C  "C5'" . DG  D 4 20  ? -42.59600 -68.46500 -3.24400  1.000 58.86000  ? 720  DG  T "C5'" 1 
ATOM   8472 C  "C4'" . DG  D 4 20  ? -43.49900 -68.22300 -4.42700  1.000 57.21000  ? 720  DG  T "C4'" 1 
ATOM   8473 O  "O4'" . DG  D 4 20  ? -42.68900 -68.12300 -5.63000  1.000 61.44000  ? 720  DG  T "O4'" 1 
ATOM   8474 C  "C3'" . DG  D 4 20  ? -44.49500 -69.34000 -4.68400  1.000 56.58000  ? 720  DG  T "C3'" 1 
ATOM   8475 O  "O3'" . DG  D 4 20  ? -45.73800 -68.80300 -5.04100  1.000 59.74000  ? 720  DG  T "O3'" 1 
ATOM   8476 C  "C2'" . DG  D 4 20  ? -43.87600 -70.11900 -5.83900  1.000 56.77000  ? 720  DG  T "C2'" 1 
ATOM   8477 C  "C1'" . DG  D 4 20  ? -43.15500 -69.02200 -6.60200  1.000 54.88000  ? 720  DG  T "C1'" 1 
ATOM   8478 N  N9    . DG  D 4 20  ? -42.01200 -69.52500 -7.33800  1.000 52.92000  ? 720  DG  T N9    1 
ATOM   8479 C  C8    . DG  D 4 20  ? -41.01700 -70.33400 -6.85100  1.000 52.66000  ? 720  DG  T C8    1 
ATOM   8480 N  N7    . DG  D 4 20  ? -40.12600 -70.65600 -7.74400  1.000 54.84000  ? 720  DG  T N7    1 
ATOM   8481 C  C5    . DG  D 4 20  ? -40.55600 -70.02400 -8.90000  1.000 53.53000  ? 720  DG  T C5    1 
ATOM   8482 C  C6    . DG  D 4 20  ? -39.98400 -70.00600 -10.18700 1.000 50.50000  ? 720  DG  T C6    1 
ATOM   8483 O  O6    . DG  D 4 20  ? -38.95200 -70.56300 -10.57200 1.000 53.65000  ? 720  DG  T O6    1 
ATOM   8484 N  N1    . DG  D 4 20  ? -40.73400 -69.25400 -11.07600 1.000 47.87000  ? 720  DG  T N1    1 
ATOM   8485 C  C2    . DG  D 4 20  ? -41.88700 -68.58000 -10.75500 1.000 48.42000  ? 720  DG  T C2    1 
ATOM   8486 N  N2    . DG  D 4 20  ? -42.45800 -67.90000 -11.75000 1.000 46.69000  ? 720  DG  T N2    1 
ATOM   8487 N  N3    . DG  D 4 20  ? -42.44200 -68.57300 -9.54700  1.000 51.22000  ? 720  DG  T N3    1 
ATOM   8488 C  C4    . DG  D 4 20  ? -41.71800 -69.32000 -8.66900  1.000 54.94000  ? 720  DG  T C4    1 
ATOM   8489 P  P     . DG  D 4 21  ? -47.01800 -69.76900 -5.05200  1.000 69.26000  ? 721  DG  T P     1 
ATOM   8490 O  OP1   . DG  D 4 21  ? -48.02800 -69.14600 -4.16900  1.000 62.52000  ? 721  DG  T OP1   1 
ATOM   8491 O  OP2   . DG  D 4 21  ? -46.55300 -71.16400 -4.82400  1.000 58.85000  ? 721  DG  T OP2   1 
ATOM   8492 O  "O5'" . DG  D 4 21  ? -47.52500 -69.69900 -6.56400  1.000 67.74000  ? 721  DG  T "O5'" 1 
ATOM   8493 C  "C5'" . DG  D 4 21  ? -47.91500 -68.45200 -7.11000  1.000 62.87000  ? 721  DG  T "C5'" 1 
ATOM   8494 C  "C4'" . DG  D 4 21  ? -47.96600 -68.55000 -8.61200  1.000 54.82000  ? 721  DG  T "C4'" 1 
ATOM   8495 O  "O4'" . DG  D 4 21  ? -46.63200 -68.79700 -9.10400  1.000 53.88000  ? 721  DG  T "O4'" 1 
ATOM   8496 C  "C3'" . DG  D 4 21  ? -48.84700 -69.69000 -9.14000  1.000 57.67000  ? 721  DG  T "C3'" 1 
ATOM   8497 O  "O3'" . DG  D 4 21  ? -49.75100 -69.18600 -10.10400 1.000 67.50000  ? 721  DG  T "O3'" 1 
ATOM   8498 C  "C2'" . DG  D 4 21  ? -47.85900 -70.67400 -9.76200  1.000 57.88000  ? 721  DG  T "C2'" 1 
ATOM   8499 C  "C1'" . DG  D 4 21  ? -46.68000 -69.77600 -10.10500 1.000 57.48000  ? 721  DG  T "C1'" 1 
ATOM   8500 N  N9    . DG  D 4 21  ? -45.40800 -70.48500 -10.11300 1.000 54.19000  ? 721  DG  T N9    1 
ATOM   8501 C  C8    . DG  D 4 21  ? -44.75200 -71.02900 -9.03400  1.000 51.74000  ? 721  DG  T C8    1 
ATOM   8502 N  N7    . DG  D 4 21  ? -43.62600 -71.61700 -9.35200  1.000 49.45000  ? 721  DG  T N7    1 
ATOM   8503 C  C5    . DG  D 4 21  ? -43.53800 -71.45300 -10.72500 1.000 48.04000  ? 721  DG  T C5    1 
ATOM   8504 C  C6    . DG  D 4 21  ? -42.54300 -71.87000 -11.61500 1.000 48.23000  ? 721  DG  T C6    1 
ATOM   8505 O  O6    . DG  D 4 21  ? -41.51200 -72.49200 -11.35400 1.000 55.06000  ? 721  DG  T O6    1 
ATOM   8506 N  N1    . DG  D 4 21  ? -42.83300 -71.50300 -12.93000 1.000 47.53000  ? 721  DG  T N1    1 
ATOM   8507 C  C2    . DG  D 4 21  ? -43.95000 -70.80900 -13.32600 1.000 47.33000  ? 721  DG  T C2    1 
ATOM   8508 N  N2    . DG  D 4 21  ? -44.05700 -70.54500 -14.63800 1.000 45.92000  ? 721  DG  T N2    1 
ATOM   8509 N  N3    . DG  D 4 21  ? -44.89700 -70.40200 -12.49600 1.000 50.72000  ? 721  DG  T N3    1 
ATOM   8510 C  C4    . DG  D 4 21  ? -44.62500 -70.76100 -11.21400 1.000 53.59000  ? 721  DG  T C4    1 
ATOM   8511 P  P     . DA  D 4 22  ? -51.02800 -70.05700 -10.54900 1.000 74.07000  ? 722  DA  T P     1 
ATOM   8512 O  OP1   . DA  D 4 22  ? -52.16200 -69.10200 -10.73100 1.000 51.13000  ? 722  DA  T OP1   1 
ATOM   8513 O  OP2   . DA  D 4 22  ? -51.09100 -71.23500 -9.63800  1.000 53.00000  ? 722  DA  T OP2   1 
ATOM   8514 O  "O5'" . DA  D 4 22  ? -50.62300 -70.59600 -11.99500 1.000 60.95000  ? 722  DA  T "O5'" 1 
ATOM   8515 C  "C5'" . DA  D 4 22  ? -50.03200 -69.70500 -12.91200 1.000 55.19000  ? 722  DA  T "C5'" 1 
ATOM   8516 C  "C4'" . DA  D 4 22  ? -49.83100 -70.38600 -14.24200 1.000 58.55000  ? 722  DA  T "C4'" 1 
ATOM   8517 O  "O4'" . DA  D 4 22  ? -48.49600 -70.96100 -14.30800 1.000 61.55000  ? 722  DA  T "O4'" 1 
ATOM   8518 C  "C3'" . DA  D 4 22  ? -50.79600 -71.52600 -14.51300 1.000 56.70000  ? 722  DA  T "C3'" 1 
ATOM   8519 O  "O3'" . DA  D 4 22  ? -51.05600 -71.59100 -15.89900 1.000 62.91000  ? 722  DA  T "O3'" 1 
ATOM   8520 C  "C2'" . DA  D 4 22  ? -50.02700 -72.74700 -14.01600 1.000 59.60000  ? 722  DA  T "C2'" 1 
ATOM   8521 C  "C1'" . DA  D 4 22  ? -48.57100 -72.37300 -14.32700 1.000 60.64000  ? 722  DA  T "C1'" 1 
ATOM   8522 N  N9    . DA  D 4 22  ? -47.61100 -72.92400 -13.34900 1.000 57.23000  ? 722  DA  T N9    1 
ATOM   8523 C  C8    . DA  D 4 22  ? -47.79200 -73.05300 -11.99500 1.000 53.95000  ? 722  DA  T C8    1 
ATOM   8524 N  N7    . DA  D 4 22  ? -46.77500 -73.60000 -11.37000 1.000 50.81000  ? 722  DA  T N7    1 
ATOM   8525 C  C5    . DA  D 4 22  ? -45.85900 -73.85300 -12.37800 1.000 51.87000  ? 722  DA  T C5    1 
ATOM   8526 C  C6    . DA  D 4 22  ? -44.56000 -74.42800 -12.36800 1.000 49.49000  ? 722  DA  T C6    1 
ATOM   8527 N  N6    . DA  D 4 22  ? -43.95400 -74.87000 -11.26100 1.000 47.13000  ? 722  DA  T N6    1 
ATOM   8528 N  N1    . DA  D 4 22  ? -43.91500 -74.53300 -13.55200 1.000 52.33000  ? 722  DA  T N1    1 
ATOM   8529 C  C2    . DA  D 4 22  ? -44.53300 -74.09600 -14.67200 1.000 52.94000  ? 722  DA  T C2    1 
ATOM   8530 N  N3    . DA  D 4 22  ? -45.74300 -73.53700 -14.80600 1.000 50.63000  ? 722  DA  T N3    1 
ATOM   8531 C  C4    . DA  D 4 22  ? -46.35900 -73.44300 -13.61000 1.000 51.20000  ? 722  DA  T C4    1 
ATOM   8532 P  P     . DC  D 4 23  ? -52.07300 -72.68700 -16.48400 1.000 70.82000  ? 723  DC  T P     1 
ATOM   8533 O  OP1   . DC  D 4 23  ? -52.78600 -72.02100 -17.59800 1.000 67.91000  ? 723  DC  T OP1   1 
ATOM   8534 O  OP2   . DC  D 4 23  ? -52.80900 -73.31500 -15.35300 1.000 61.68000  ? 723  DC  T OP2   1 
ATOM   8535 O  "O5'" . DC  D 4 23  ? -51.10900 -73.77900 -17.13500 1.000 61.42000  ? 723  DC  T "O5'" 1 
ATOM   8536 C  "C5'" . DC  D 4 23  ? -50.22200 -73.37600 -18.14600 1.000 61.39000  ? 723  DC  T "C5'" 1 
ATOM   8537 C  "C4'" . DC  D 4 23  ? -49.23600 -74.47600 -18.46700 1.000 65.15000  ? 723  DC  T "C4'" 1 
ATOM   8538 O  "O4'" . DC  D 4 23  ? -48.36700 -74.69400 -17.33000 1.000 64.61000  ? 723  DC  T "O4'" 1 
ATOM   8539 C  "C3'" . DC  D 4 23  ? -49.86200 -75.83400 -18.80000 1.000 66.64000  ? 723  DC  T "C3'" 1 
ATOM   8540 O  "O3'" . DC  D 4 23  ? -49.30700 -76.32400 -20.00900 1.000 77.91000  ? 723  DC  T "O3'" 1 
ATOM   8541 C  "C2'" . DC  D 4 23  ? -49.47500 -76.70800 -17.61200 1.000 66.78000  ? 723  DC  T "C2'" 1 
ATOM   8542 C  "C1'" . DC  D 4 23  ? -48.15800 -76.07400 -17.19600 1.000 67.19000  ? 723  DC  T "C1'" 1 
ATOM   8543 N  N1    . DC  D 4 23  ? -47.75500 -76.38100 -15.77500 1.000 56.31000  ? 723  DC  T N1    1 
ATOM   8544 C  C2    . DC  D 4 23  ? -46.46000 -76.86400 -15.50800 1.000 51.62000  ? 723  DC  T C2    1 
ATOM   8545 O  O2    . DC  D 4 23  ? -45.66500 -77.01500 -16.44300 1.000 52.84000  ? 723  DC  T O2    1 
ATOM   8546 N  N3    . DC  D 4 23  ? -46.12200 -77.14900 -14.22900 1.000 49.74000  ? 723  DC  T N3    1 
ATOM   8547 C  C4    . DC  D 4 23  ? -47.01200 -76.96700 -13.24300 1.000 53.05000  ? 723  DC  T C4    1 
ATOM   8548 N  N4    . DC  D 4 23  ? -46.63800 -77.26100 -11.99400 1.000 46.78000  ? 723  DC  T N4    1 
ATOM   8549 C  C5    . DC  D 4 23  ? -48.33100 -76.47800 -13.49900 1.000 52.71000  ? 723  DC  T C5    1 
ATOM   8550 C  C6    . DC  D 4 23  ? -48.65600 -76.20300 -14.76500 1.000 53.09000  ? 723  DC  T C6    1 
ATOM   8551 P  P     . DT  D 4 24  ? -50.12100 -77.38800 -20.90300 1.000 94.20000  ? 724  DT  T P     1 
ATOM   8552 O  OP1   . DT  D 4 24  ? -50.26400 -76.80200 -22.26100 1.000 73.43000  ? 724  DT  T OP1   1 
ATOM   8553 O  OP2   . DT  D 4 24  ? -51.33000 -77.80400 -20.13900 1.000 73.10000  ? 724  DT  T OP2   1 
ATOM   8554 O  "O5'" . DT  D 4 24  ? -49.10900 -78.63400 -20.99100 1.000 99.43000  ? 724  DT  T "O5'" 1 
ATOM   8555 C  "C5'" . DT  D 4 24  ? -47.71100 -78.40700 -21.27500 1.000 98.57000  ? 724  DT  T "C5'" 1 
ATOM   8556 C  "C4'" . DT  D 4 24  ? -46.89100 -79.68400 -21.11100 1.000 106.83000 ? 724  DT  T "C4'" 1 
ATOM   8557 O  "O4'" . DT  D 4 24  ? -46.61600 -79.92000 -19.69900 1.000 100.40000 ? 724  DT  T "O4'" 1 
ATOM   8558 C  "C3'" . DT  D 4 24  ? -47.55700 -80.97200 -21.60000 1.000 111.64000 ? 724  DT  T "C3'" 1 
ATOM   8559 O  "O3'" . DT  D 4 24  ? -47.32800 -81.16500 -22.99600 1.000 121.00000 ? 724  DT  T "O3'" 1 
ATOM   8560 C  "C2'" . DT  D 4 24  ? -46.82900 -82.01900 -20.77000 1.000 110.38000 ? 724  DT  T "C2'" 1 
ATOM   8561 C  "C1'" . DT  D 4 24  ? -46.74600 -81.31100 -19.41900 1.000 100.38000 ? 724  DT  T "C1'" 1 
ATOM   8562 N  N1    . DT  D 4 24  ? -47.96400 -81.53400 -18.56700 1.000 91.40000  ? 724  DT  T N1    1 
ATOM   8563 C  C2    . DT  D 4 24  ? -48.03700 -82.66300 -17.78100 1.000 85.57000  ? 724  DT  T C2    1 
ATOM   8564 O  O2    . DT  D 4 24  ? -47.14900 -83.49700 -17.72600 1.000 79.17000  ? 724  DT  T O2    1 
ATOM   8565 N  N3    . DT  D 4 24  ? -49.18600 -82.78000 -17.04400 1.000 83.49000  ? 724  DT  T N3    1 
ATOM   8566 C  C4    . DT  D 4 24  ? -50.25400 -81.90400 -17.02300 1.000 87.52000  ? 724  DT  T C4    1 
ATOM   8567 O  O4    . DT  D 4 24  ? -51.24700 -82.09800 -16.32700 1.000 90.86000  ? 724  DT  T O4    1 
ATOM   8568 C  C5    . DT  D 4 24  ? -50.12000 -80.74400 -17.87600 1.000 90.91000  ? 724  DT  T C5    1 
ATOM   8569 C  C7    . DT  D 4 24  ? -51.21800 -79.72000 -17.93500 1.000 91.84000  ? 724  DT  T C7    1 
ATOM   8570 C  C6    . DT  D 4 24  ? -48.99700 -80.61800 -18.60200 1.000 89.23000  ? 724  DT  T C6    1 
HETATM 8571 S  S     . SO4 E 5 .   ? -76.17000 -56.20600 -14.99000 1.000 46.53000  ? 601  SO4 A S     1 
HETATM 8572 O  O1    . SO4 E 5 .   ? -77.59900 -56.55800 -15.05300 1.000 38.11000  ? 601  SO4 A O1    1 
HETATM 8573 O  O2    . SO4 E 5 .   ? -75.64000 -55.80300 -16.30300 1.000 35.55000  ? 601  SO4 A O2    1 
HETATM 8574 O  O3    . SO4 E 5 .   ? -75.39800 -57.35600 -14.50900 1.000 41.53000  ? 601  SO4 A O3    1 
HETATM 8575 O  O4    . SO4 E 5 .   ? -76.02300 -55.10600 -14.03600 1.000 49.63000  ? 601  SO4 A O4    1 
HETATM 8576 S  S     . SO4 F 5 .   ? -37.53900 -24.33900 -3.11800  1.000 81.44000  ? 602  SO4 A S     1 
HETATM 8577 O  O1    . SO4 F 5 .   ? -37.45000 -25.57100 -3.90700  1.000 55.68000  ? 602  SO4 A O1    1 
HETATM 8578 O  O2    . SO4 F 5 .   ? -36.62600 -23.33200 -3.67800  1.000 64.80000  ? 602  SO4 A O2    1 
HETATM 8579 O  O3    . SO4 F 5 .   ? -38.90000 -23.81200 -3.17800  1.000 82.36000  ? 602  SO4 A O3    1 
HETATM 8580 O  O4    . SO4 F 5 .   ? -37.22300 -24.61700 -1.71000  1.000 66.50000  ? 602  SO4 A O4    1 
HETATM 8581 MG MG    . MG  G 6 .   ? 0.56400   -36.21600 3.65500   1.000 41.03000  ? 603  MG  A MG    1 
HETATM 8582 O  OAC   A 1RY H 7 .   ? 3.00500   -33.52000 1.14300   0.450 45.34000  ? 604  1RY A OAC   1 
HETATM 8583 O  OAC   B 1RY H 7 .   ? 4.02600   -35.04000 2.36100   0.550 46.81000  1 604  1RY A OAC   1 
HETATM 8584 P  PAZ   A 1RY H 7 .   ? 3.10700   -34.99300 1.48400   0.450 48.46000  ? 604  1RY A PAZ   1 
HETATM 8585 P  PAZ   B 1RY H 7 .   ? 2.74700   -35.40600 1.64200   0.550 48.78000  ? 604  1RY A PAZ   1 
HETATM 8586 O  OAF   A 1RY H 7 .   ? 3.71600   -35.31500 2.81600   0.450 45.82000  ? 604  1RY A OAF   1 
HETATM 8587 O  OAF   B 1RY H 7 .   ? 2.39000   -34.59700 0.42200   0.550 49.66000  ? 604  1RY A OAF   1 
HETATM 8588 O  OAG   A 1RY H 7 .   ? 3.72900   -35.73600 0.32900   0.450 49.65000  ? 604  1RY A OAG   1 
HETATM 8589 O  OAG   B 1RY H 7 .   ? 1.64300   -35.46700 2.67000   0.550 45.93000  1 604  1RY A OAG   1 
HETATM 8590 O  OAQ   A 1RY H 7 .   ? 1.58800   -35.53400 1.52400   0.450 48.86000  ? 604  1RY A OAQ   1 
HETATM 8591 O  OAQ   B 1RY H 7 .   ? 3.01200   -36.89500 1.09100   0.550 44.08000  ? 604  1RY A OAQ   1 
HETATM 8592 P  PBB   A 1RY H 7 .   ? 0.89400   -36.25400 0.26900   0.450 48.57000  ? 604  1RY A PBB   1 
HETATM 8593 P  PBB   B 1RY H 7 .   ? 1.96000   -38.07200 1.29500   0.550 45.79000  ? 604  1RY A PBB   1 
HETATM 8594 O  OAI   A 1RY H 7 .   ? -0.53900  -36.38500 0.69500   0.450 47.13000  ? 604  1RY A OAI   1 
HETATM 8595 O  OAI   B 1RY H 7 .   ? 2.43700   -39.27300 0.52200   0.550 48.23000  1 604  1RY A OAI   1 
HETATM 8596 O  OAE   A 1RY H 7 .   ? 1.18200   -35.56300 -1.00100  0.450 46.97000  ? 604  1RY A OAE   1 
HETATM 8597 O  OAE   B 1RY H 7 .   ? 1.58700   -38.24400 2.71700   0.550 41.59000  ? 604  1RY A OAE   1 
HETATM 8598 O  OAR   A 1RY H 7 .   ? 1.36700   -37.81000 0.24300   0.450 44.20000  ? 604  1RY A OAR   1 
HETATM 8599 O  OAR   B 1RY H 7 .   ? 0.67800   -37.66700 0.40000   0.550 44.93000  ? 604  1RY A OAR   1 
HETATM 8600 P  PBA   A 1RY H 7 .   ? 2.13700   -38.80000 1.30800   0.450 46.39000  ? 604  1RY A PBA   1 
HETATM 8601 P  PBA   B 1RY H 7 .   ? -0.84500  -37.33300 0.88900   0.550 46.24000  ? 604  1RY A PBA   1 
HETATM 8602 O  OAH   A 1RY H 7 .   ? 3.59700   -39.13300 0.83800   0.450 48.45000  ? 604  1RY A OAH   1 
HETATM 8603 O  OAH   B 1RY H 7 .   ? -0.82300  -36.36000 2.10000   0.550 40.81000  ? 604  1RY A OAH   1 
HETATM 8604 O  OAD   A 1RY H 7 .   ? 1.85500   -38.16600 2.65600   0.450 41.75000  ? 604  1RY A OAD   1 
HETATM 8605 O  OAD   B 1RY H 7 .   ? -1.55300  -36.96700 -0.40400  0.550 40.13000  1 604  1RY A OAD   1 
HETATM 8606 O  OAO   A 1RY H 7 .   ? 1.06800   -40.02200 1.30100   0.450 37.31000  ? 604  1RY A OAO   1 
HETATM 8607 O  OAO   B 1RY H 7 .   ? -1.27500  -38.87800 1.15600   0.550 39.98000  ? 604  1RY A OAO   1 
HETATM 8608 C  CAL   A 1RY H 7 .   ? -0.31500  -39.85700 1.62200   0.450 39.13000  ? 604  1RY A CAL   1 
HETATM 8609 C  CAL   B 1RY H 7 .   ? -0.47900  -39.89600 1.77400   0.550 39.10000  ? 604  1RY A CAL   1 
HETATM 8610 C  CAW   A 1RY H 7 .   ? -1.04000  -41.21300 1.51500   0.450 34.74000  ? 604  1RY A CAW   1 
HETATM 8611 C  CAW   B 1RY H 7 .   ? -1.24400  -41.21700 1.67800   0.550 34.56000  ? 604  1RY A CAW   1 
HETATM 8612 O  OAP   A 1RY H 7 .   ? -0.97100  -41.61200 0.14700   0.450 34.83000  ? 604  1RY A OAP   1 
HETATM 8613 O  OAP   B 1RY H 7 .   ? -1.02300  -41.65100 0.34300   0.550 34.82000  ? 604  1RY A OAP   1 
HETATM 8614 S  SAS   A 1RY H 7 .   ? -2.77900  -41.10900 1.91000   0.450 34.08000  ? 604  1RY A SAS   1 
HETATM 8615 S  SAS   B 1RY H 7 .   ? -3.01100  -41.02400 1.86900   0.550 34.05000  ? 604  1RY A SAS   1 
HETATM 8616 C  CAM   A 1RY H 7 .   ? -3.03400  -42.47200 0.86700   0.450 30.95000  ? 604  1RY A CAM   1 
HETATM 8617 C  CAM   B 1RY H 7 .   ? -3.14200  -42.47100 0.92300   0.550 31.57000  ? 604  1RY A CAM   1 
HETATM 8618 C  CAX   A 1RY H 7 .   ? -1.94100  -42.52200 -0.18800  0.450 32.33000  ? 604  1RY A CAX   1 
HETATM 8619 C  CAX   B 1RY H 7 .   ? -1.97200  -42.55100 -0.04100  0.550 32.30000  ? 604  1RY A CAX   1 
HETATM 8620 N  NAY   A 1RY H 7 .   ? -2.47400  -42.16700 -1.46300  0.450 32.80000  ? 604  1RY A NAY   1 
HETATM 8621 N  NAY   B 1RY H 7 .   ? -2.44400  -42.19100 -1.32500  0.550 31.83000  ? 604  1RY A NAY   1 
HETATM 8622 C  CAK   A 1RY H 7 .   ? -2.88500  -40.93200 -1.68600  0.450 33.35000  ? 604  1RY A CAK   1 
HETATM 8623 C  CAK   B 1RY H 7 .   ? -2.80100  -40.94500 -1.56400  0.550 33.36000  ? 604  1RY A CAK   1 
HETATM 8624 C  CAU   A 1RY H 7 .   ? -3.39600  -40.61400 -2.92800  0.450 33.96000  ? 604  1RY A CAU   1 
HETATM 8625 C  CAU   B 1RY H 7 .   ? -3.27100  -40.63300 -2.81700  0.550 33.95000  ? 604  1RY A CAU   1 
HETATM 8626 F  FAJ   A 1RY H 7 .   ? -3.84200  -39.37500 -3.21000  0.450 34.68000  ? 604  1RY A FAJ   1 
HETATM 8627 F  FAJ   B 1RY H 7 .   ? -3.66400  -39.38700 -3.13900  0.550 34.76000  ? 604  1RY A FAJ   1 
HETATM 8628 C  CAV   A 1RY H 7 .   ? -2.54400  -43.07200 -2.45100  0.450 33.06000  ? 604  1RY A CAV   1 
HETATM 8629 C  CAV   B 1RY H 7 .   ? -2.52800  -43.11900 -2.28400  0.550 33.06000  ? 604  1RY A CAV   1 
HETATM 8630 O  OAB   A 1RY H 7 .   ? -2.14400  -44.30500 -2.29100  0.450 31.96000  ? 604  1RY A OAB   1 
HETATM 8631 O  OAB   B 1RY H 7 .   ? -2.17500  -44.36200 -2.07900  0.550 32.00000  ? 604  1RY A OAB   1 
HETATM 8632 N  NAN   A 1RY H 7 .   ? -3.01700  -42.82500 -3.64300  0.450 33.29000  ? 604  1RY A NAN   1 
HETATM 8633 N  NAN   B 1RY H 7 .   ? -2.96400  -42.87900 -3.48700  0.550 33.28000  ? 604  1RY A NAN   1 
HETATM 8634 C  CAT   A 1RY H 7 .   ? -3.45200  -41.58500 -3.91000  0.450 33.99000  ? 604  1RY A CAT   1 
HETATM 8635 C  CAT   B 1RY H 7 .   ? -3.34100  -41.62600 -3.77600  0.550 33.97000  ? 604  1RY A CAT   1 
HETATM 8636 N  NAA   A 1RY H 7 .   ? -3.95100  -41.25000 -5.12500  0.450 34.77000  ? 604  1RY A NAA   1 
HETATM 8637 N  NAA   B 1RY H 7 .   ? -3.80000  -41.28900 -5.00300  0.550 34.83000  ? 604  1RY A NAA   1 
HETATM 8638 S  S     . SO4 I 5 .   ? -17.48700 -50.75000 -6.73500  1.000 100.32000 ? 901  SO4 P S     1 
HETATM 8639 O  O1    . SO4 I 5 .   ? -16.10100 -50.95500 -7.19100  1.000 85.68000  ? 901  SO4 P O1    1 
HETATM 8640 O  O2    . SO4 I 5 .   ? -18.26400 -50.36400 -7.90600  1.000 73.65000  ? 901  SO4 P O2    1 
HETATM 8641 O  O3    . SO4 I 5 .   ? -18.03900 -51.99700 -6.17600  1.000 82.64000  ? 901  SO4 P O3    1 
HETATM 8642 O  O4    . SO4 I 5 .   ? -17.58100 -49.66800 -5.74200  1.000 67.68000  ? 901  SO4 P O4    1 
HETATM 8643 S  S     . SO4 J 5 .   ? -7.40600  -44.54200 -9.39200  1.000 101.31000 ? 801  SO4 T S     1 
HETATM 8644 O  O1    . SO4 J 5 .   ? -6.66400  -44.59600 -10.66100 1.000 92.19000  ? 801  SO4 T O1    1 
HETATM 8645 O  O2    . SO4 J 5 .   ? -8.84800  -44.68900 -9.64000  1.000 80.88000  ? 801  SO4 T O2    1 
HETATM 8646 O  O3    . SO4 J 5 .   ? -6.95500  -45.65200 -8.53700  1.000 71.85000  ? 801  SO4 T O3    1 
HETATM 8647 O  O4    . SO4 J 5 .   ? -7.15500  -43.25000 -8.73900  1.000 66.80000  ? 801  SO4 T O4    1 
HETATM 8648 O  O     . HOH K 8 .   ? -19.40000 -33.62500 13.49300  1.000 24.42000  ? 701  HOH A O     1 
HETATM 8649 O  O     . HOH K 8 .   ? -6.91600  -21.15400 30.32700  1.000 41.36000  ? 702  HOH A O     1 
HETATM 8650 O  O     . HOH K 8 .   ? -20.58600 -44.67100 6.78100   1.000 25.89000  ? 703  HOH A O     1 
HETATM 8651 O  O     . HOH K 8 .   ? -40.41400 -45.94200 5.16600   1.000 31.37000  ? 704  HOH A O     1 
HETATM 8652 O  O     . HOH K 8 .   ? -15.94900 -33.46500 27.90000  1.000 34.67000  ? 705  HOH A O     1 
HETATM 8653 O  O     . HOH K 8 .   ? 3.98100   -33.72800 14.32300  1.000 25.76000  ? 706  HOH A O     1 
HETATM 8654 O  O     . HOH K 8 .   ? -61.02900 -47.61700 -20.17200 1.000 34.83000  ? 707  HOH A O     1 
HETATM 8655 O  O     . HOH K 8 .   ? -23.13400 -25.84100 15.31000  1.000 30.82000  ? 708  HOH A O     1 
HETATM 8656 O  O     . HOH K 8 .   ? -42.74000 -41.29800 -9.44900  1.000 35.67000  ? 709  HOH A O     1 
HETATM 8657 O  O     . HOH K 8 .   ? -63.79900 -63.36800 -30.68900 1.000 31.53000  ? 710  HOH A O     1 
HETATM 8658 O  O     . HOH K 8 .   ? 2.53500   -51.97800 10.29100  1.000 24.45000  ? 711  HOH A O     1 
HETATM 8659 O  O     . HOH K 8 .   ? -44.99200 -47.64400 1.00200   1.000 33.18000  ? 712  HOH A O     1 
HETATM 8660 O  O     . HOH K 8 .   ? -2.97200  -46.39100 -0.82200  1.000 27.67000  ? 713  HOH A O     1 
HETATM 8661 O  O     . HOH K 8 .   ? -64.87800 -48.87700 -23.79100 1.000 40.04000  ? 714  HOH A O     1 
HETATM 8662 O  O     . HOH K 8 .   ? -1.72400  -49.17500 -1.34000  1.000 28.04000  ? 715  HOH A O     1 
HETATM 8663 O  O     . HOH K 8 .   ? -69.88400 -52.86500 -19.98600 1.000 30.23000  ? 716  HOH A O     1 
HETATM 8664 O  O     . HOH K 8 .   ? -70.31600 -52.00400 -17.69600 1.000 28.42000  ? 717  HOH A O     1 
HETATM 8665 O  O     . HOH K 8 .   ? -7.90200  -46.60700 26.66200  1.000 42.83000  ? 718  HOH A O     1 
HETATM 8666 O  O     . HOH K 8 .   ? -30.55900 -24.34500 8.21500   1.000 26.14000  ? 719  HOH A O     1 
HETATM 8667 O  O     . HOH K 8 .   ? 0.59200   -30.48900 8.28000   1.000 29.56000  ? 720  HOH A O     1 
HETATM 8668 O  O     . HOH K 8 .   ? -7.19000  -30.71600 3.30700   1.000 37.27000  ? 721  HOH A O     1 
HETATM 8669 O  O     . HOH K 8 .   ? -20.63200 -39.38900 6.44700   1.000 28.04000  ? 722  HOH A O     1 
HETATM 8670 O  O     . HOH K 8 .   ? -59.680   -40.503   -24.540   1.000 40.59000  ? 723  HOH A O     1 
HETATM 8671 O  O     . HOH K 8 .   ? -17.60300 -35.52700 1.38300   1.000 20.42000  ? 724  HOH A O     1 
HETATM 8672 O  O     . HOH K 8 .   ? -72.88300 -57.39900 -13.19200 1.000 33.78000  ? 725  HOH A O     1 
HETATM 8673 O  O     . HOH K 8 .   ? -9.29400  -42.10400 8.21800   1.000 21.60000  ? 726  HOH A O     1 
HETATM 8674 O  O     . HOH K 8 .   ? -47.51100 -50.92400 -7.35300  1.000 29.23000  ? 727  HOH A O     1 
HETATM 8675 O  O     . HOH K 8 .   ? -30.14200 -31.96600 -5.92300  1.000 30.03000  ? 728  HOH A O     1 
HETATM 8676 O  O     . HOH K 8 .   ? 1.20800   -50.51000 12.15100  1.000 30.94000  ? 729  HOH A O     1 
HETATM 8677 O  O     . HOH K 8 .   ? -3.98900  -28.97800 4.34700   1.000 33.47000  ? 730  HOH A O     1 
HETATM 8678 O  O     . HOH K 8 .   ? -57.73800 -40.83400 -0.69800  1.000 38.22000  ? 731  HOH A O     1 
HETATM 8679 O  O     . HOH K 8 .   ? -61.28300 -54.51300 -6.87200  1.000 29.83000  ? 732  HOH A O     1 
HETATM 8680 O  O     . HOH K 8 .   ? -2.56700  -61.66100 10.83500  1.000 39.86000  ? 733  HOH A O     1 
HETATM 8681 O  O     . HOH K 8 .   ? -36.32200 -25.43100 0.72100   1.000 47.40000  ? 734  HOH A O     1 
HETATM 8682 O  O     . HOH K 8 .   ? -5.08900  -55.28000 -6.36900  1.000 33.94000  ? 735  HOH A O     1 
HETATM 8683 O  O     . HOH K 8 .   ? 6.09100   -32.12800 12.53000  1.000 33.24000  ? 736  HOH A O     1 
HETATM 8684 O  O     . HOH K 8 .   ? -10.46500 -49.28000 5.81200   1.000 29.62000  ? 737  HOH A O     1 
HETATM 8685 O  O     . HOH K 8 .   ? 6.86100   -27.29900 9.58400   1.000 25.96000  ? 738  HOH A O     1 
HETATM 8686 O  O     . HOH K 8 .   ? -23.00900 -34.62900 12.87800  1.000 19.59000  ? 739  HOH A O     1 
HETATM 8687 O  O     . HOH K 8 .   ? -62.47700 -66.08800 -15.18600 1.000 32.00000  ? 740  HOH A O     1 
HETATM 8688 O  O     . HOH K 8 .   ? -16.25400 -50.02500 5.10100   1.000 21.92000  ? 741  HOH A O     1 
HETATM 8689 O  O     . HOH K 8 .   ? -20.85600 -25.01000 -3.09200  1.000 34.27000  ? 742  HOH A O     1 
HETATM 8690 O  O     . HOH K 8 .   ? -35.66600 -24.26800 2.72200   1.000 43.35000  ? 743  HOH A O     1 
HETATM 8691 O  O     . HOH K 8 .   ? -68.74200 -50.91300 -5.46400  1.000 34.62000  ? 744  HOH A O     1 
HETATM 8692 O  O     . HOH K 8 .   ? -47.95500 -53.23600 -8.77900  1.000 26.44000  ? 745  HOH A O     1 
HETATM 8693 O  O     . HOH K 8 .   ? -10.33000 -55.48700 1.43400   1.000 30.19000  ? 746  HOH A O     1 
HETATM 8694 O  O     . HOH K 8 .   ? 7.72600   -56.62600 12.44100  1.000 36.18000  ? 747  HOH A O     1 
HETATM 8695 O  O     . HOH K 8 .   ? -16.63400 -29.12700 13.61700  1.000 27.32000  ? 748  HOH A O     1 
HETATM 8696 O  O     . HOH K 8 .   ? -46.29500 -38.03800 10.92000  1.000 43.48000  ? 749  HOH A O     1 
HETATM 8697 O  O     . HOH K 8 .   ? -50.96100 -66.53100 -12.33900 1.000 44.81000  ? 750  HOH A O     1 
HETATM 8698 O  O     . HOH K 8 .   ? -1.25500  -36.45900 24.56000  1.000 35.92000  ? 751  HOH A O     1 
HETATM 8699 O  O     . HOH K 8 .   ? -20.24000 -42.16000 3.23300   1.000 22.67000  ? 752  HOH A O     1 
HETATM 8700 O  O     . HOH K 8 .   ? -15.48400 -35.94500 0.08400   1.000 21.02000  ? 753  HOH A O     1 
HETATM 8701 O  O     . HOH K 8 .   ? -59.20800 -42.90200 -11.61700 1.000 38.51000  ? 754  HOH A O     1 
HETATM 8702 O  O     . HOH K 8 .   ? -60.61300 -44.60800 -9.25600  1.000 40.46000  ? 755  HOH A O     1 
HETATM 8703 O  O     . HOH K 8 .   ? 11.12400  -40.06700 2.80100   1.000 43.33000  ? 756  HOH A O     1 
HETATM 8704 O  O     . HOH K 8 .   ? -45.44900 -33.27300 12.09300  1.000 48.05000  ? 757  HOH A O     1 
HETATM 8705 O  O     . HOH K 8 .   ? -3.41200  -23.68500 13.99400  1.000 31.23000  ? 758  HOH A O     1 
HETATM 8706 O  O     . HOH K 8 .   ? -26.56700 -21.02800 10.30100  1.000 32.69000  ? 759  HOH A O     1 
HETATM 8707 O  O     . HOH K 8 .   ? 3.33000   -63.68300 -10.97900 1.000 47.76000  ? 760  HOH A O     1 
HETATM 8708 O  O     . HOH K 8 .   ? -38.73900 -34.57700 -25.92700 1.000 53.98000  ? 761  HOH A O     1 
HETATM 8709 O  O     . HOH K 8 .   ? -18.42900 -31.10200 14.96700  1.000 29.23000  ? 762  HOH A O     1 
HETATM 8710 O  O     . HOH K 8 .   ? -4.81400  -21.11000 5.17700   1.000 30.70000  ? 763  HOH A O     1 
HETATM 8711 O  O     . HOH K 8 .   ? -34.76300 -47.11400 0.50900   1.000 39.19000  ? 764  HOH A O     1 
HETATM 8712 O  O     . HOH K 8 .   ? -25.95100 -18.13000 -2.37300  1.000 47.97000  ? 765  HOH A O     1 
HETATM 8713 O  O     . HOH K 8 .   ? -62.82400 -45.77300 -21.17700 1.000 34.83000  ? 766  HOH A O     1 
HETATM 8714 O  O     . HOH K 8 .   ? -69.937   -47.419   -22.883   1.000 32.37000  ? 767  HOH A O     1 
HETATM 8715 O  O     . HOH L 8 .   ? -51.82300 -61.52000 44.51600  1.000 59.73000  ? 501  HOH B O     1 
HETATM 8716 O  O     . HOH L 8 .   ? -65.73900 -62.71500 -7.12100  1.000 33.65000  ? 502  HOH B O     1 
HETATM 8717 O  O     . HOH L 8 .   ? -62.73000 -66.86400 -5.14300  1.000 36.32000  ? 503  HOH B O     1 
HETATM 8718 O  O     . HOH L 8 .   ? -35.66800 -76.57800 32.18900  1.000 41.10000  ? 504  HOH B O     1 
HETATM 8719 O  O     . HOH L 8 .   ? -14.77700 -42.54700 16.71800  1.000 31.29000  ? 505  HOH B O     1 
HETATM 8720 O  O     . HOH L 8 .   ? -18.82100 -44.44900 10.51300  1.000 31.74000  ? 506  HOH B O     1 
HETATM 8721 O  O     . HOH L 8 .   ? -19.24100 -74.57200 32.74200  1.000 47.77000  ? 507  HOH B O     1 
HETATM 8722 O  O     . HOH L 8 .   ? -32.11700 -58.13700 7.38800   1.000 42.09000  ? 508  HOH B O     1 
HETATM 8723 O  O     . HOH L 8 .   ? -7.86600  -53.42800 24.37700  1.000 34.39000  ? 509  HOH B O     1 
HETATM 8724 O  O     . HOH L 8 .   ? -18.62900 -37.15300 14.94000  1.000 20.22000  ? 510  HOH B O     1 
HETATM 8725 O  O     . HOH L 8 .   ? -15.54500 -44.44100 9.31600   1.000 25.30000  ? 511  HOH B O     1 
HETATM 8726 O  O     . HOH L 8 .   ? -78.90100 -66.04800 -0.99400  1.000 41.48000  ? 512  HOH B O     1 
HETATM 8727 O  O     . HOH L 8 .   ? -19.28400 -40.78200 17.00300  1.000 30.08000  ? 513  HOH B O     1 
HETATM 8728 O  O     . HOH L 8 .   ? -29.46600 -50.10800 14.38800  1.000 27.82000  ? 514  HOH B O     1 
HETATM 8729 O  O     . HOH L 8 .   ? -49.30000 -59.63000 4.12300   1.000 34.00000  ? 515  HOH B O     1 
HETATM 8730 O  O     . HOH L 8 .   ? -30.10000 -71.95300 24.61900  1.000 37.20000  ? 516  HOH B O     1 
HETATM 8731 O  O     . HOH L 8 .   ? -9.26600  -51.44200 17.42800  1.000 32.82000  ? 517  HOH B O     1 
HETATM 8732 O  O     . HOH L 8 .   ? -40.44300 -77.90700 38.21200  1.000 53.94000  ? 518  HOH B O     1 
HETATM 8733 O  O     . HOH L 8 .   ? -22.21400 -63.00800 12.99200  1.000 29.06000  ? 519  HOH B O     1 
HETATM 8734 O  O     . HOH L 8 .   ? -20.50100 -63.96800 6.60400   1.000 36.30000  ? 520  HOH B O     1 
HETATM 8735 O  O     . HOH L 8 .   ? -24.66600 -62.00900 11.84700  1.000 37.54000  ? 521  HOH B O     1 
HETATM 8736 O  O     . HOH L 8 .   ? -29.78600 -64.43700 18.11300  1.000 32.97000  ? 522  HOH B O     1 
HETATM 8737 O  O     . HOH L 8 .   ? -9.46100  -50.32200 14.34800  1.000 31.79000  ? 523  HOH B O     1 
HETATM 8738 O  O     . HOH L 8 .   ? -26.18800 -60.31300 22.49500  1.000 42.04000  ? 524  HOH B O     1 
HETATM 8739 O  O     . HOH L 8 .   ? -75.13600 -70.01400 5.92000   1.000 39.71000  ? 525  HOH B O     1 
HETATM 8740 O  O     . HOH L 8 .   ? -33.12800 -47.24200 3.42300   1.000 39.87000  ? 526  HOH B O     1 
HETATM 8741 O  O     . HOH L 8 .   ? -16.71200 -44.33700 18.02000  1.000 35.87000  ? 527  HOH B O     1 
HETATM 8742 O  O     . HOH L 8 .   ? -27.03700 -42.31800 25.24400  1.000 32.62000  ? 528  HOH B O     1 
HETATM 8743 O  O     . HOH L 8 .   ? -15.76100 -36.38500 19.34000  1.000 31.68000  ? 529  HOH B O     1 
HETATM 8744 O  O     . HOH L 8 .   ? -31.21200 -57.49800 10.00000  1.000 42.23000  ? 530  HOH B O     1 
HETATM 8745 O  O     . HOH L 8 .   ? -31.20600 -63.25500 8.64000   1.000 35.55000  ? 531  HOH B O     1 
HETATM 8746 O  O     . HOH L 8 .   ? -29.60000 -47.26000 14.40500  1.000 29.59000  ? 532  HOH B O     1 
HETATM 8747 O  O     . HOH L 8 .   ? -48.36800 -48.54700 17.21500  1.000 36.06000  ? 533  HOH B O     1 
HETATM 8748 O  O     . HOH L 8 .   ? -22.04000 -46.30000 8.98600   1.000 41.82000  ? 534  HOH B O     1 
HETATM 8749 O  O     . HOH M 8 .   ? -22.15200 -45.33800 -14.75000 1.000 41.21000  ? 1001 HOH P O     1 
HETATM 8750 O  O     . HOH M 8 .   ? -12.02400 -43.99500 -17.97300 1.000 44.77000  ? 1002 HOH P O     1 
HETATM 8751 O  O     . HOH M 8 .   ? -15.73600 -38.24000 -1.29600  1.000 29.17000  ? 1003 HOH P O     1 
HETATM 8752 O  O     . HOH M 8 .   ? -32.28600 -63.83800 -3.89500  1.000 45.79000  ? 1004 HOH P O     1 
HETATM 8753 O  O     . HOH M 8 .   ? -34.79800 -62.81500 -3.16500  1.000 48.54000  ? 1005 HOH P O     1 
HETATM 8754 O  O     . HOH N 8 .   ? -29.26700 -53.99100 -9.64500  1.000 43.93000  ? 901  HOH T O     1 
HETATM 8755 O  O     . HOH N 8 .   ? -48.12600 -75.93900 -23.40000 1.000 54.30000  ? 902  HOH T O     1 
HETATM 8756 O  O     . HOH N 8 .   ? -9.94200  -46.20600 2.38100   1.000 30.72000  ? 903  HOH T O     1 
HETATM 8757 O  O     . HOH N 8 .   ? -13.47800 -55.22600 1.05000   1.000 32.54000  ? 904  HOH T O     1 
HETATM 8758 O  O     . HOH N 8 .   ? -11.49900 -47.18400 -6.22300  1.000 41.40000  ? 905  HOH T O     1 
HETATM 8759 O  O     . HOH N 8 .   ? -22.22100 -44.28300 4.46600   1.000 25.62000  ? 906  HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -11 ?   ?   ?   A . n 
A 1 2   GLY 2   -10 ?   ?   ?   A . n 
A 1 3   SER 3   -9  ?   ?   ?   A . n 
A 1 4   SER 4   -8  ?   ?   ?   A . n 
A 1 5   HIS 5   -7  ?   ?   ?   A . n 
A 1 6   HIS 6   -6  ?   ?   ?   A . n 
A 1 7   HIS 7   -5  ?   ?   ?   A . n 
A 1 8   HIS 8   -4  ?   ?   ?   A . n 
A 1 9   HIS 9   -3  ?   ?   ?   A . n 
A 1 10  HIS 10  -2  ?   ?   ?   A . n 
A 1 11  SER 11  -1  ?   ?   ?   A . n 
A 1 12  SER 12  0   ?   ?   ?   A . n 
A 1 13  PRO 13  1   1   PRO PRO A . n 
A 1 14  ILE 14  2   2   ILE ILE A . n 
A 1 15  SER 15  3   3   SER SER A . n 
A 1 16  PRO 16  4   4   PRO PRO A . n 
A 1 17  ILE 17  5   5   ILE ILE A . n 
A 1 18  GLU 18  6   6   GLU GLU A . n 
A 1 19  THR 19  7   7   THR THR A . n 
A 1 20  VAL 20  8   8   VAL VAL A . n 
A 1 21  PRO 21  9   9   PRO PRO A . n 
A 1 22  VAL 22  10  10  VAL VAL A . n 
A 1 23  LYS 23  11  11  LYS LYS A . n 
A 1 24  LEU 24  12  12  LEU LEU A . n 
A 1 25  LYS 25  13  13  LYS LYS A . n 
A 1 26  PRO 26  14  14  PRO PRO A . n 
A 1 27  GLY 27  15  15  GLY GLY A . n 
A 1 28  MET 28  16  16  MET MET A . n 
A 1 29  ASP 29  17  17  ASP ASP A . n 
A 1 30  GLY 30  18  18  GLY GLY A . n 
A 1 31  PRO 31  19  19  PRO PRO A . n 
A 1 32  LYS 32  20  20  LYS LYS A . n 
A 1 33  VAL 33  21  21  VAL VAL A . n 
A 1 34  LYS 34  22  22  LYS LYS A . n 
A 1 35  GLN 35  23  23  GLN GLN A . n 
A 1 36  TRP 36  24  24  TRP TRP A . n 
A 1 37  PRO 37  25  25  PRO PRO A . n 
A 1 38  LEU 38  26  26  LEU LEU A . n 
A 1 39  THR 39  27  27  THR THR A . n 
A 1 40  GLU 40  28  28  GLU GLU A . n 
A 1 41  GLU 41  29  29  GLU GLU A . n 
A 1 42  LYS 42  30  30  LYS LYS A . n 
A 1 43  ILE 43  31  31  ILE ILE A . n 
A 1 44  LYS 44  32  32  LYS LYS A . n 
A 1 45  ALA 45  33  33  ALA ALA A . n 
A 1 46  LEU 46  34  34  LEU LEU A . n 
A 1 47  VAL 47  35  35  VAL VAL A . n 
A 1 48  GLU 48  36  36  GLU GLU A . n 
A 1 49  ILE 49  37  37  ILE ILE A . n 
A 1 50  CYS 50  38  38  CYS CYS A . n 
A 1 51  THR 51  39  39  THR THR A . n 
A 1 52  GLU 52  40  40  GLU GLU A . n 
A 1 53  MET 53  41  41  MET MET A . n 
A 1 54  GLU 54  42  42  GLU GLU A . n 
A 1 55  LYS 55  43  43  LYS LYS A . n 
A 1 56  GLU 56  44  44  GLU GLU A . n 
A 1 57  GLY 57  45  45  GLY GLY A . n 
A 1 58  LYS 58  46  46  LYS LYS A . n 
A 1 59  ILE 59  47  47  ILE ILE A . n 
A 1 60  SER 60  48  48  SER SER A . n 
A 1 61  LYS 61  49  49  LYS LYS A . n 
A 1 62  ILE 62  50  50  ILE ILE A . n 
A 1 63  GLY 63  51  51  GLY GLY A . n 
A 1 64  PRO 64  52  52  PRO PRO A . n 
A 1 65  GLU 65  53  53  GLU GLU A . n 
A 1 66  ASN 66  54  54  ASN ASN A . n 
A 1 67  PRO 67  55  55  PRO PRO A . n 
A 1 68  TYR 68  56  56  TYR TYR A . n 
A 1 69  ASN 69  57  57  ASN ASN A . n 
A 1 70  THR 70  58  58  THR THR A . n 
A 1 71  PRO 71  59  59  PRO PRO A . n 
A 1 72  VAL 72  60  60  VAL VAL A . n 
A 1 73  PHE 73  61  61  PHE PHE A . n 
A 1 74  ALA 74  62  62  ALA ALA A . n 
A 1 75  ILE 75  63  63  ILE ILE A . n 
A 1 76  LYS 76  64  64  LYS LYS A . n 
A 1 77  LYS 77  65  65  LYS LYS A . n 
A 1 78  LYS 78  66  66  LYS LYS A . n 
A 1 79  ASP 79  67  67  ASP ASP A . n 
A 1 80  SER 80  68  68  SER SER A . n 
A 1 81  THR 81  69  69  THR THR A . n 
A 1 82  LYS 82  70  70  LYS LYS A . n 
A 1 83  TRP 83  71  71  TRP TRP A . n 
A 1 84  ARG 84  72  72  ARG ARG A . n 
A 1 85  LYS 85  73  73  LYS LYS A . n 
A 1 86  LEU 86  74  74  LEU LEU A . n 
A 1 87  VAL 87  75  75  VAL VAL A . n 
A 1 88  ASP 88  76  76  ASP ASP A . n 
A 1 89  PHE 89  77  77  PHE PHE A . n 
A 1 90  ARG 90  78  78  ARG ARG A . n 
A 1 91  GLU 91  79  79  GLU GLU A . n 
A 1 92  LEU 92  80  80  LEU LEU A . n 
A 1 93  ASN 93  81  81  ASN ASN A . n 
A 1 94  LYS 94  82  82  LYS LYS A . n 
A 1 95  ARG 95  83  83  ARG ARG A . n 
A 1 96  THR 96  84  84  THR THR A . n 
A 1 97  GLN 97  85  85  GLN GLN A . n 
A 1 98  ASP 98  86  86  ASP ASP A . n 
A 1 99  PHE 99  87  87  PHE PHE A . n 
A 1 100 TRP 100 88  88  TRP TRP A . n 
A 1 101 GLU 101 89  89  GLU GLU A . n 
A 1 102 VAL 102 90  90  VAL VAL A . n 
A 1 103 GLN 103 91  91  GLN GLN A . n 
A 1 104 LEU 104 92  92  LEU LEU A . n 
A 1 105 GLY 105 93  93  GLY GLY A . n 
A 1 106 ILE 106 94  94  ILE ILE A . n 
A 1 107 PRO 107 95  95  PRO PRO A . n 
A 1 108 HIS 108 96  96  HIS HIS A . n 
A 1 109 PRO 109 97  97  PRO PRO A . n 
A 1 110 ALA 110 98  98  ALA ALA A . n 
A 1 111 GLY 111 99  99  GLY GLY A . n 
A 1 112 LEU 112 100 100 LEU LEU A . n 
A 1 113 LYS 113 101 101 LYS LYS A . n 
A 1 114 LYS 114 102 102 LYS LYS A . n 
A 1 115 LYS 115 103 103 LYS LYS A . n 
A 1 116 LYS 116 104 104 LYS LYS A . n 
A 1 117 SER 117 105 105 SER SER A . n 
A 1 118 VAL 118 106 106 VAL VAL A . n 
A 1 119 THR 119 107 107 THR THR A . n 
A 1 120 VAL 120 108 108 VAL VAL A . n 
A 1 121 LEU 121 109 109 LEU LEU A . n 
A 1 122 ASP 122 110 110 ASP ASP A . n 
A 1 123 VAL 123 111 111 VAL VAL A . n 
A 1 124 GLY 124 112 112 GLY GLY A . n 
A 1 125 ASP 125 113 113 ASP ASP A . n 
A 1 126 ALA 126 114 114 ALA ALA A . n 
A 1 127 TYR 127 115 115 TYR TYR A . n 
A 1 128 PHE 128 116 116 PHE PHE A . n 
A 1 129 SER 129 117 117 SER SER A . n 
A 1 130 VAL 130 118 118 VAL VAL A . n 
A 1 131 PRO 131 119 119 PRO PRO A . n 
A 1 132 LEU 132 120 120 LEU LEU A . n 
A 1 133 ASP 133 121 121 ASP ASP A . n 
A 1 134 GLU 134 122 122 GLU GLU A . n 
A 1 135 ASP 135 123 123 ASP ASP A . n 
A 1 136 PHE 136 124 124 PHE PHE A . n 
A 1 137 ARG 137 125 125 ARG ARG A . n 
A 1 138 LYS 138 126 126 LYS LYS A . n 
A 1 139 TYR 139 127 127 TYR TYR A . n 
A 1 140 THR 140 128 128 THR THR A . n 
A 1 141 ALA 141 129 129 ALA ALA A . n 
A 1 142 PHE 142 130 130 PHE PHE A . n 
A 1 143 THR 143 131 131 THR THR A . n 
A 1 144 ILE 144 132 132 ILE ILE A . n 
A 1 145 PRO 145 133 133 PRO PRO A . n 
A 1 146 SER 146 134 134 SER SER A . n 
A 1 147 ILE 147 135 ?   ?   ?   A . n 
A 1 148 ASN 148 136 ?   ?   ?   A . n 
A 1 149 ASN 149 137 ?   ?   ?   A . n 
A 1 150 GLU 150 138 ?   ?   ?   A . n 
A 1 151 THR 151 139 ?   ?   ?   A . n 
A 1 152 PRO 152 140 ?   ?   ?   A . n 
A 1 153 GLY 153 141 ?   ?   ?   A . n 
A 1 154 ILE 154 142 142 ILE ILE A . n 
A 1 155 ARG 155 143 143 ARG ARG A . n 
A 1 156 TYR 156 144 144 TYR TYR A . n 
A 1 157 GLN 157 145 145 GLN GLN A . n 
A 1 158 TYR 158 146 146 TYR TYR A . n 
A 1 159 ASN 159 147 147 ASN ASN A . n 
A 1 160 VAL 160 148 148 VAL VAL A . n 
A 1 161 LEU 161 149 149 LEU LEU A . n 
A 1 162 PRO 162 150 150 PRO PRO A . n 
A 1 163 GLN 163 151 151 GLN GLN A . n 
A 1 164 GLY 164 152 152 GLY GLY A . n 
A 1 165 TRP 165 153 153 TRP TRP A . n 
A 1 166 LYS 166 154 154 LYS LYS A . n 
A 1 167 GLY 167 155 155 GLY GLY A . n 
A 1 168 SER 168 156 156 SER SER A . n 
A 1 169 PRO 169 157 157 PRO PRO A . n 
A 1 170 ALA 170 158 158 ALA ALA A . n 
A 1 171 ILE 171 159 159 ILE ILE A . n 
A 1 172 PHE 172 160 160 PHE PHE A . n 
A 1 173 GLN 173 161 161 GLN GLN A . n 
A 1 174 SER 174 162 162 SER SER A . n 
A 1 175 SER 175 163 163 SER SER A . n 
A 1 176 MET 176 164 164 MET MET A . n 
A 1 177 THR 177 165 165 THR THR A . n 
A 1 178 LYS 178 166 166 LYS LYS A . n 
A 1 179 ILE 179 167 167 ILE ILE A . n 
A 1 180 LEU 180 168 168 LEU LEU A . n 
A 1 181 GLU 181 169 169 GLU GLU A . n 
A 1 182 PRO 182 170 170 PRO PRO A . n 
A 1 183 PHE 183 171 171 PHE PHE A . n 
A 1 184 ARG 184 172 172 ARG ARG A . n 
A 1 185 LYS 185 173 173 LYS LYS A . n 
A 1 186 GLN 186 174 174 GLN GLN A . n 
A 1 187 ASN 187 175 175 ASN ASN A . n 
A 1 188 PRO 188 176 176 PRO PRO A . n 
A 1 189 ASP 189 177 177 ASP ASP A . n 
A 1 190 ILE 190 178 178 ILE ILE A . n 
A 1 191 VAL 191 179 179 VAL VAL A . n 
A 1 192 ILE 192 180 180 ILE ILE A . n 
A 1 193 TYR 193 181 181 TYR TYR A . n 
A 1 194 GLN 194 182 182 GLN GLN A . n 
A 1 195 TYR 195 183 183 TYR TYR A . n 
A 1 196 MET 196 184 184 MET MET A . n 
A 1 197 ASP 197 185 185 ASP ASP A . n 
A 1 198 ASP 198 186 186 ASP ASP A . n 
A 1 199 LEU 199 187 187 LEU LEU A . n 
A 1 200 TYR 200 188 188 TYR TYR A . n 
A 1 201 VAL 201 189 189 VAL VAL A . n 
A 1 202 GLY 202 190 190 GLY GLY A . n 
A 1 203 SER 203 191 191 SER SER A . n 
A 1 204 ASP 204 192 192 ASP ASP A . n 
A 1 205 LEU 205 193 193 LEU LEU A . n 
A 1 206 GLU 206 194 194 GLU GLU A . n 
A 1 207 ILE 207 195 195 ILE ILE A . n 
A 1 208 GLY 208 196 196 GLY GLY A . n 
A 1 209 GLN 209 197 197 GLN GLN A . n 
A 1 210 HIS 210 198 198 HIS HIS A . n 
A 1 211 ARG 211 199 199 ARG ARG A . n 
A 1 212 THR 212 200 200 THR THR A . n 
A 1 213 LYS 213 201 201 LYS LYS A . n 
A 1 214 ILE 214 202 202 ILE ILE A . n 
A 1 215 GLU 215 203 203 GLU GLU A . n 
A 1 216 GLU 216 204 204 GLU GLU A . n 
A 1 217 LEU 217 205 205 LEU LEU A . n 
A 1 218 ARG 218 206 206 ARG ARG A . n 
A 1 219 GLN 219 207 207 GLN GLN A . n 
A 1 220 HIS 220 208 208 HIS HIS A . n 
A 1 221 LEU 221 209 209 LEU LEU A . n 
A 1 222 LEU 222 210 210 LEU LEU A . n 
A 1 223 ARG 223 211 211 ARG ARG A . n 
A 1 224 TRP 224 212 212 TRP TRP A . n 
A 1 225 GLY 225 213 213 GLY GLY A . n 
A 1 226 LEU 226 214 214 LEU LEU A . n 
A 1 227 THR 227 215 215 THR THR A . n 
A 1 228 THR 228 216 216 THR THR A . n 
A 1 229 PRO 229 217 217 PRO PRO A . n 
A 1 230 ASP 230 218 218 ASP ASP A . n 
A 1 231 LYS 231 219 219 LYS LYS A . n 
A 1 232 LYS 232 220 220 LYS LYS A . n 
A 1 233 HIS 233 221 221 HIS HIS A . n 
A 1 234 GLN 234 222 222 GLN GLN A . n 
A 1 235 LYS 235 223 223 LYS LYS A . n 
A 1 236 GLU 236 224 224 GLU GLU A . n 
A 1 237 PRO 237 225 225 PRO PRO A . n 
A 1 238 PRO 238 226 226 PRO PRO A . n 
A 1 239 PHE 239 227 227 PHE PHE A . n 
A 1 240 LEU 240 228 228 LEU LEU A . n 
A 1 241 TRP 241 229 229 TRP TRP A . n 
A 1 242 MET 242 230 230 MET MET A . n 
A 1 243 GLY 243 231 231 GLY GLY A . n 
A 1 244 TYR 244 232 232 TYR TYR A . n 
A 1 245 GLU 245 233 233 GLU GLU A . n 
A 1 246 LEU 246 234 234 LEU LEU A . n 
A 1 247 HIS 247 235 235 HIS HIS A . n 
A 1 248 PRO 248 236 236 PRO PRO A . n 
A 1 249 ASP 249 237 237 ASP ASP A . n 
A 1 250 LYS 250 238 238 LYS LYS A . n 
A 1 251 TRP 251 239 239 TRP TRP A . n 
A 1 252 THR 252 240 240 THR THR A . n 
A 1 253 VAL 253 241 241 VAL VAL A . n 
A 1 254 GLN 254 242 242 GLN GLN A . n 
A 1 255 PRO 255 243 243 PRO PRO A . n 
A 1 256 ILE 256 244 244 ILE ILE A . n 
A 1 257 VAL 257 245 245 VAL VAL A . n 
A 1 258 LEU 258 246 246 LEU LEU A . n 
A 1 259 PRO 259 247 247 PRO PRO A . n 
A 1 260 GLU 260 248 248 GLU GLU A . n 
A 1 261 LYS 261 249 249 LYS LYS A . n 
A 1 262 ASP 262 250 250 ASP ASP A . n 
A 1 263 SER 263 251 251 SER SER A . n 
A 1 264 TRP 264 252 252 TRP TRP A . n 
A 1 265 THR 265 253 253 THR THR A . n 
A 1 266 VAL 266 254 254 VAL VAL A . n 
A 1 267 ASN 267 255 255 ASN ASN A . n 
A 1 268 ASP 268 256 256 ASP ASP A . n 
A 1 269 ILE 269 257 257 ILE ILE A . n 
A 1 270 CYS 270 258 258 CYS CYS A . n 
A 1 271 LYS 271 259 259 LYS LYS A . n 
A 1 272 LEU 272 260 260 LEU LEU A . n 
A 1 273 VAL 273 261 261 VAL VAL A . n 
A 1 274 GLY 274 262 262 GLY GLY A . n 
A 1 275 LYS 275 263 263 LYS LYS A . n 
A 1 276 LEU 276 264 264 LEU LEU A . n 
A 1 277 ASN 277 265 265 ASN ASN A . n 
A 1 278 TRP 278 266 266 TRP TRP A . n 
A 1 279 ALA 279 267 267 ALA ALA A . n 
A 1 280 SER 280 268 268 SER SER A . n 
A 1 281 GLN 281 269 269 GLN GLN A . n 
A 1 282 ILE 282 270 270 ILE ILE A . n 
A 1 283 TYR 283 271 271 TYR TYR A . n 
A 1 284 PRO 284 272 272 PRO PRO A . n 
A 1 285 GLY 285 273 273 GLY GLY A . n 
A 1 286 ILE 286 274 274 ILE ILE A . n 
A 1 287 LYS 287 275 275 LYS LYS A . n 
A 1 288 VAL 288 276 276 VAL VAL A . n 
A 1 289 ARG 289 277 277 ARG ARG A . n 
A 1 290 GLN 290 278 278 GLN GLN A . n 
A 1 291 LEU 291 279 279 LEU LEU A . n 
A 1 292 SER 292 280 280 SER SER A . n 
A 1 293 LYS 293 281 281 LYS LYS A . n 
A 1 294 LEU 294 282 282 LEU LEU A . n 
A 1 295 LEU 295 283 283 LEU LEU A . n 
A 1 296 ARG 296 284 284 ARG ARG A . n 
A 1 297 GLY 297 285 285 GLY GLY A . n 
A 1 298 THR 298 286 286 THR THR A . n 
A 1 299 LYS 299 287 287 LYS LYS A . n 
A 1 300 ALA 300 288 288 ALA ALA A . n 
A 1 301 LEU 301 289 289 LEU LEU A . n 
A 1 302 THR 302 290 290 THR THR A . n 
A 1 303 GLU 303 291 291 GLU GLU A . n 
A 1 304 VAL 304 292 292 VAL VAL A . n 
A 1 305 ILE 305 293 293 ILE ILE A . n 
A 1 306 PRO 306 294 294 PRO PRO A . n 
A 1 307 LEU 307 295 295 LEU LEU A . n 
A 1 308 THR 308 296 296 THR THR A . n 
A 1 309 GLU 309 297 297 GLU GLU A . n 
A 1 310 GLU 310 298 298 GLU GLU A . n 
A 1 311 ALA 311 299 299 ALA ALA A . n 
A 1 312 GLU 312 300 300 GLU GLU A . n 
A 1 313 LEU 313 301 301 LEU LEU A . n 
A 1 314 GLU 314 302 302 GLU GLU A . n 
A 1 315 LEU 315 303 303 LEU LEU A . n 
A 1 316 ALA 316 304 304 ALA ALA A . n 
A 1 317 GLU 317 305 305 GLU GLU A . n 
A 1 318 ASN 318 306 306 ASN ASN A . n 
A 1 319 ARG 319 307 307 ARG ARG A . n 
A 1 320 GLU 320 308 308 GLU GLU A . n 
A 1 321 ILE 321 309 309 ILE ILE A . n 
A 1 322 LEU 322 310 310 LEU LEU A . n 
A 1 323 LYS 323 311 311 LYS LYS A . n 
A 1 324 GLU 324 312 312 GLU GLU A . n 
A 1 325 PRO 325 313 313 PRO PRO A . n 
A 1 326 VAL 326 314 314 VAL VAL A . n 
A 1 327 HIS 327 315 315 HIS HIS A . n 
A 1 328 GLY 328 316 316 GLY GLY A . n 
A 1 329 VAL 329 317 317 VAL VAL A . n 
A 1 330 TYR 330 318 318 TYR TYR A . n 
A 1 331 TYR 331 319 319 TYR TYR A . n 
A 1 332 ASP 332 320 320 ASP ASP A . n 
A 1 333 PRO 333 321 321 PRO PRO A . n 
A 1 334 SER 334 322 322 SER SER A . n 
A 1 335 LYS 335 323 323 LYS LYS A . n 
A 1 336 ASP 336 324 324 ASP ASP A . n 
A 1 337 LEU 337 325 325 LEU LEU A . n 
A 1 338 ILE 338 326 326 ILE ILE A . n 
A 1 339 ALA 339 327 327 ALA ALA A . n 
A 1 340 GLU 340 328 328 GLU GLU A . n 
A 1 341 ILE 341 329 329 ILE ILE A . n 
A 1 342 GLN 342 330 330 GLN GLN A . n 
A 1 343 LYS 343 331 331 LYS LYS A . n 
A 1 344 GLN 344 332 332 GLN GLN A . n 
A 1 345 GLY 345 333 333 GLY GLY A . n 
A 1 346 GLN 346 334 334 GLN GLN A . n 
A 1 347 GLY 347 335 335 GLY GLY A . n 
A 1 348 GLN 348 336 336 GLN GLN A . n 
A 1 349 TRP 349 337 337 TRP TRP A . n 
A 1 350 THR 350 338 338 THR THR A . n 
A 1 351 TYR 351 339 339 TYR TYR A . n 
A 1 352 GLN 352 340 340 GLN GLN A . n 
A 1 353 ILE 353 341 341 ILE ILE A . n 
A 1 354 TYR 354 342 342 TYR TYR A . n 
A 1 355 GLN 355 343 343 GLN GLN A . n 
A 1 356 GLU 356 344 344 GLU GLU A . n 
A 1 357 PRO 357 345 345 PRO PRO A . n 
A 1 358 PHE 358 346 346 PHE PHE A . n 
A 1 359 LYS 359 347 347 LYS LYS A . n 
A 1 360 ASN 360 348 348 ASN ASN A . n 
A 1 361 LEU 361 349 349 LEU LEU A . n 
A 1 362 LYS 362 350 350 LYS LYS A . n 
A 1 363 THR 363 351 351 THR THR A . n 
A 1 364 GLY 364 352 352 GLY GLY A . n 
A 1 365 LYS 365 353 353 LYS LYS A . n 
A 1 366 TYR 366 354 354 TYR TYR A . n 
A 1 367 ALA 367 355 355 ALA ALA A . n 
A 1 368 ARG 368 356 356 ARG ARG A . n 
A 1 369 MET 369 357 357 MET MET A . n 
A 1 370 ARG 370 358 358 ARG ARG A . n 
A 1 371 GLY 371 359 359 GLY GLY A . n 
A 1 372 ALA 372 360 360 ALA ALA A . n 
A 1 373 HIS 373 361 361 HIS HIS A . n 
A 1 374 THR 374 362 362 THR THR A . n 
A 1 375 ASN 375 363 363 ASN ASN A . n 
A 1 376 ASP 376 364 364 ASP ASP A . n 
A 1 377 VAL 377 365 365 VAL VAL A . n 
A 1 378 LYS 378 366 366 LYS LYS A . n 
A 1 379 GLN 379 367 367 GLN GLN A . n 
A 1 380 LEU 380 368 368 LEU LEU A . n 
A 1 381 THR 381 369 369 THR THR A . n 
A 1 382 GLU 382 370 370 GLU GLU A . n 
A 1 383 ALA 383 371 371 ALA ALA A . n 
A 1 384 VAL 384 372 372 VAL VAL A . n 
A 1 385 GLN 385 373 373 GLN GLN A . n 
A 1 386 LYS 386 374 374 LYS LYS A . n 
A 1 387 ILE 387 375 375 ILE ILE A . n 
A 1 388 THR 388 376 376 THR THR A . n 
A 1 389 THR 389 377 377 THR THR A . n 
A 1 390 GLU 390 378 378 GLU GLU A . n 
A 1 391 SER 391 379 379 SER SER A . n 
A 1 392 ILE 392 380 380 ILE ILE A . n 
A 1 393 VAL 393 381 381 VAL VAL A . n 
A 1 394 ILE 394 382 382 ILE ILE A . n 
A 1 395 TRP 395 383 383 TRP TRP A . n 
A 1 396 GLY 396 384 384 GLY GLY A . n 
A 1 397 LYS 397 385 385 LYS LYS A . n 
A 1 398 THR 398 386 386 THR THR A . n 
A 1 399 PRO 399 387 387 PRO PRO A . n 
A 1 400 LYS 400 388 388 LYS LYS A . n 
A 1 401 PHE 401 389 389 PHE PHE A . n 
A 1 402 LYS 402 390 390 LYS LYS A . n 
A 1 403 LEU 403 391 391 LEU LEU A . n 
A 1 404 PRO 404 392 392 PRO PRO A . n 
A 1 405 ILE 405 393 393 ILE ILE A . n 
A 1 406 GLN 406 394 394 GLN GLN A . n 
A 1 407 LYS 407 395 395 LYS LYS A . n 
A 1 408 GLU 408 396 396 GLU GLU A . n 
A 1 409 THR 409 397 397 THR THR A . n 
A 1 410 TRP 410 398 398 TRP TRP A . n 
A 1 411 GLU 411 399 399 GLU GLU A . n 
A 1 412 THR 412 400 400 THR THR A . n 
A 1 413 TRP 413 401 401 TRP TRP A . n 
A 1 414 TRP 414 402 402 TRP TRP A . n 
A 1 415 THR 415 403 403 THR THR A . n 
A 1 416 GLU 416 404 404 GLU GLU A . n 
A 1 417 TYR 417 405 405 TYR TYR A . n 
A 1 418 TRP 418 406 406 TRP TRP A . n 
A 1 419 GLN 419 407 407 GLN GLN A . n 
A 1 420 ALA 420 408 408 ALA ALA A . n 
A 1 421 THR 421 409 409 THR THR A . n 
A 1 422 TRP 422 410 410 TRP TRP A . n 
A 1 423 ILE 423 411 411 ILE ILE A . n 
A 1 424 PRO 424 412 412 PRO PRO A . n 
A 1 425 GLU 425 413 413 GLU GLU A . n 
A 1 426 TRP 426 414 414 TRP TRP A . n 
A 1 427 GLU 427 415 415 GLU GLU A . n 
A 1 428 PHE 428 416 416 PHE PHE A . n 
A 1 429 VAL 429 417 417 VAL VAL A . n 
A 1 430 ASN 430 418 418 ASN ASN A . n 
A 1 431 THR 431 419 419 THR THR A . n 
A 1 432 PRO 432 420 420 PRO PRO A . n 
A 1 433 PRO 433 421 421 PRO PRO A . n 
A 1 434 LEU 434 422 422 LEU LEU A . n 
A 1 435 VAL 435 423 423 VAL VAL A . n 
A 1 436 LYS 436 424 424 LYS LYS A . n 
A 1 437 LEU 437 425 425 LEU LEU A . n 
A 1 438 TRP 438 426 426 TRP TRP A . n 
A 1 439 TYR 439 427 427 TYR TYR A . n 
A 1 440 GLN 440 428 428 GLN GLN A . n 
A 1 441 LEU 441 429 429 LEU LEU A . n 
A 1 442 GLU 442 430 430 GLU GLU A . n 
A 1 443 LYS 443 431 431 LYS LYS A . n 
A 1 444 GLU 444 432 432 GLU GLU A . n 
A 1 445 PRO 445 433 433 PRO PRO A . n 
A 1 446 ILE 446 434 434 ILE ILE A . n 
A 1 447 VAL 447 435 435 VAL VAL A . n 
A 1 448 GLY 448 436 436 GLY GLY A . n 
A 1 449 ALA 449 437 437 ALA ALA A . n 
A 1 450 GLU 450 438 438 GLU GLU A . n 
A 1 451 THR 451 439 439 THR THR A . n 
A 1 452 PHE 452 440 440 PHE PHE A . n 
A 1 453 TYR 453 441 441 TYR TYR A . n 
A 1 454 VAL 454 442 442 VAL VAL A . n 
A 1 455 ASP 455 443 443 ASP ASP A . n 
A 1 456 GLY 456 444 444 GLY GLY A . n 
A 1 457 ALA 457 445 445 ALA ALA A . n 
A 1 458 ALA 458 446 446 ALA ALA A . n 
A 1 459 ASN 459 447 447 ASN ASN A . n 
A 1 460 ARG 460 448 448 ARG ARG A . n 
A 1 461 GLU 461 449 449 GLU GLU A . n 
A 1 462 THR 462 450 450 THR THR A . n 
A 1 463 LYS 463 451 451 LYS LYS A . n 
A 1 464 LEU 464 452 452 LEU LEU A . n 
A 1 465 GLY 465 453 453 GLY GLY A . n 
A 1 466 LYS 466 454 454 LYS LYS A . n 
A 1 467 ALA 467 455 455 ALA ALA A . n 
A 1 468 GLY 468 456 456 GLY GLY A . n 
A 1 469 TYR 469 457 457 TYR TYR A . n 
A 1 470 VAL 470 458 458 VAL VAL A . n 
A 1 471 THR 471 459 459 THR THR A . n 
A 1 472 ASN 472 460 460 ASN ASN A . n 
A 1 473 ARG 473 461 461 ARG ARG A . n 
A 1 474 GLY 474 462 462 GLY GLY A . n 
A 1 475 ARG 475 463 463 ARG ARG A . n 
A 1 476 GLN 476 464 464 GLN GLN A . n 
A 1 477 LYS 477 465 465 LYS LYS A . n 
A 1 478 VAL 478 466 466 VAL VAL A . n 
A 1 479 VAL 479 467 467 VAL VAL A . n 
A 1 480 THR 480 468 468 THR THR A . n 
A 1 481 LEU 481 469 469 LEU LEU A . n 
A 1 482 THR 482 470 470 THR THR A . n 
A 1 483 ASP 483 471 471 ASP ASP A . n 
A 1 484 THR 484 472 472 THR THR A . n 
A 1 485 THR 485 473 473 THR THR A . n 
A 1 486 ASN 486 474 474 ASN ASN A . n 
A 1 487 GLN 487 475 475 GLN GLN A . n 
A 1 488 LYS 488 476 476 LYS LYS A . n 
A 1 489 THR 489 477 477 THR THR A . n 
A 1 490 GLU 490 478 478 GLU GLU A . n 
A 1 491 LEU 491 479 479 LEU LEU A . n 
A 1 492 GLN 492 480 480 GLN GLN A . n 
A 1 493 ALA 493 481 481 ALA ALA A . n 
A 1 494 ILE 494 482 482 ILE ILE A . n 
A 1 495 TYR 495 483 483 TYR TYR A . n 
A 1 496 LEU 496 484 484 LEU LEU A . n 
A 1 497 ALA 497 485 485 ALA ALA A . n 
A 1 498 LEU 498 486 486 LEU LEU A . n 
A 1 499 GLN 499 487 487 GLN GLN A . n 
A 1 500 ASP 500 488 488 ASP ASP A . n 
A 1 501 SER 501 489 489 SER SER A . n 
A 1 502 GLY 502 490 490 GLY GLY A . n 
A 1 503 LEU 503 491 491 LEU LEU A . n 
A 1 504 GLU 504 492 492 GLU GLU A . n 
A 1 505 VAL 505 493 493 VAL VAL A . n 
A 1 506 ASN 506 494 494 ASN ASN A . n 
A 1 507 ILE 507 495 495 ILE ILE A . n 
A 1 508 VAL 508 496 496 VAL VAL A . n 
A 1 509 THR 509 497 497 THR THR A . n 
A 1 510 ASP 510 498 498 ASP ASP A . n 
A 1 511 SER 511 499 499 SER SER A . n 
A 1 512 GLN 512 500 500 GLN GLN A . n 
A 1 513 TYR 513 501 501 TYR TYR A . n 
A 1 514 ALA 514 502 502 ALA ALA A . n 
A 1 515 LEU 515 503 503 LEU LEU A . n 
A 1 516 GLY 516 504 504 GLY GLY A . n 
A 1 517 ILE 517 505 505 ILE ILE A . n 
A 1 518 ILE 518 506 506 ILE ILE A . n 
A 1 519 GLN 519 507 507 GLN GLN A . n 
A 1 520 ALA 520 508 508 ALA ALA A . n 
A 1 521 GLN 521 509 509 GLN GLN A . n 
A 1 522 PRO 522 510 510 PRO PRO A . n 
A 1 523 ASP 523 511 511 ASP ASP A . n 
A 1 524 GLN 524 512 512 GLN GLN A . n 
A 1 525 SER 525 513 513 SER SER A . n 
A 1 526 GLU 526 514 514 GLU GLU A . n 
A 1 527 SER 527 515 515 SER SER A . n 
A 1 528 GLU 528 516 516 GLU GLU A . n 
A 1 529 LEU 529 517 517 LEU LEU A . n 
A 1 530 VAL 530 518 518 VAL VAL A . n 
A 1 531 ASN 531 519 519 ASN ASN A . n 
A 1 532 GLN 532 520 520 GLN GLN A . n 
A 1 533 ILE 533 521 521 ILE ILE A . n 
A 1 534 ILE 534 522 522 ILE ILE A . n 
A 1 535 GLU 535 523 523 GLU GLU A . n 
A 1 536 GLN 536 524 524 GLN GLN A . n 
A 1 537 LEU 537 525 525 LEU LEU A . n 
A 1 538 ILE 538 526 526 ILE ILE A . n 
A 1 539 LYS 539 527 527 LYS LYS A . n 
A 1 540 LYS 540 528 528 LYS LYS A . n 
A 1 541 GLU 541 529 529 GLU GLU A . n 
A 1 542 LYS 542 530 530 LYS LYS A . n 
A 1 543 VAL 543 531 531 VAL VAL A . n 
A 1 544 TYR 544 532 532 TYR TYR A . n 
A 1 545 LEU 545 533 533 LEU LEU A . n 
A 1 546 ALA 546 534 534 ALA ALA A . n 
A 1 547 TRP 547 535 535 TRP TRP A . n 
A 1 548 VAL 548 536 536 VAL VAL A . n 
A 1 549 PRO 549 537 537 PRO PRO A . n 
A 1 550 ALA 550 538 538 ALA ALA A . n 
A 1 551 HIS 551 539 539 HIS HIS A . n 
A 1 552 LYS 552 540 540 LYS LYS A . n 
A 1 553 GLY 553 541 541 GLY GLY A . n 
A 1 554 ILE 554 542 542 ILE ILE A . n 
A 1 555 GLY 555 543 543 GLY GLY A . n 
A 1 556 GLY 556 544 544 GLY GLY A . n 
A 1 557 ASN 557 545 545 ASN ASN A . n 
A 1 558 GLU 558 546 546 GLU GLU A . n 
A 1 559 GLN 559 547 547 GLN GLN A . n 
A 1 560 VAL 560 548 548 VAL VAL A . n 
A 1 561 ASP 561 549 549 ASP ASP A . n 
A 1 562 LYS 562 550 550 LYS LYS A . n 
A 1 563 LEU 563 551 551 LEU LEU A . n 
A 1 564 VAL 564 552 552 VAL VAL A . n 
A 1 565 SER 565 553 553 SER SER A . n 
A 1 566 ALA 566 554 554 ALA ALA A . n 
A 1 567 GLY 567 555 555 GLY GLY A . n 
A 1 568 ILE 568 556 ?   ?   ?   A . n 
A 1 569 ARG 569 557 ?   ?   ?   A . n 
A 1 570 LYS 570 558 ?   ?   ?   A . n 
A 1 571 VAL 571 559 ?   ?   ?   A . n 
A 1 572 LEU 572 560 ?   ?   ?   A . n 
B 2 1   PRO 1   1   ?   ?   ?   B . n 
B 2 2   ILE 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   PRO 4   4   ?   ?   ?   B . n 
B 2 5   ILE 5   5   5   ILE ILE B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  MET 16  16  16  MET MET B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  TRP 24  24  24  TRP TRP B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  45  45  GLY GLY B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  PRO 52  52  52  PRO PRO B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ASN 54  54  54  ASN ASN B . n 
B 2 55  PRO 55  55  55  PRO PRO B . n 
B 2 56  TYR 56  56  56  TYR TYR B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  LYS 64  64  64  LYS LYS B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  ASP 67  67  67  ASP ASP B . n 
B 2 68  SER 68  68  68  SER SER B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  TRP 71  71  71  TRP TRP B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  LEU 74  74  74  LEU LEU B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  ARG 78  78  78  ARG ARG B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  GLN 85  85  85  GLN GLN B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  PHE 87  87  ?   ?   ?   B . n 
B 2 88  TRP 88  88  ?   ?   ?   B . n 
B 2 89  GLU 89  89  ?   ?   ?   B . n 
B 2 90  VAL 90  90  ?   ?   ?   B . n 
B 2 91  GLN 91  91  ?   ?   ?   B . n 
B 2 92  LEU 92  92  ?   ?   ?   B . n 
B 2 93  GLY 93  93  ?   ?   ?   B . n 
B 2 94  ILE 94  94  ?   ?   ?   B . n 
B 2 95  PRO 95  95  95  PRO PRO B . n 
B 2 96  HIS 96  96  96  HIS HIS B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  GLY 99  99  99  GLY GLY B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 LYS 103 103 103 LYS LYS B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 ASP 113 113 113 ASP ASP B . n 
B 2 114 ALA 114 114 114 ALA ALA B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 PHE 116 116 116 PHE PHE B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 GLU 122 122 122 GLU GLU B . n 
B 2 123 ASP 123 123 123 ASP ASP B . n 
B 2 124 PHE 124 124 124 PHE PHE B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 THR 128 128 128 THR THR B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 THR 131 131 131 THR THR B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 ASN 137 137 137 ASN ASN B . n 
B 2 138 GLU 138 138 138 GLU GLU B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 ARG 143 143 143 ARG ARG B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 TYR 146 146 146 TYR TYR B . n 
B 2 147 ASN 147 147 147 ASN ASN B . n 
B 2 148 VAL 148 148 148 VAL VAL B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 PRO 150 150 150 PRO PRO B . n 
B 2 151 GLN 151 151 151 GLN GLN B . n 
B 2 152 GLY 152 152 152 GLY GLY B . n 
B 2 153 TRP 153 153 153 TRP TRP B . n 
B 2 154 LYS 154 154 154 LYS LYS B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 PRO 157 157 157 PRO PRO B . n 
B 2 158 ALA 158 158 158 ALA ALA B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 GLN 161 161 161 GLN GLN B . n 
B 2 162 SER 162 162 162 SER SER B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 MET 164 164 164 MET MET B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 LYS 166 166 166 LYS LYS B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 GLU 169 169 169 GLU GLU B . n 
B 2 170 PRO 170 170 170 PRO PRO B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 ARG 172 172 172 ARG ARG B . n 
B 2 173 LYS 173 173 173 LYS LYS B . n 
B 2 174 GLN 174 174 174 GLN GLN B . n 
B 2 175 ASN 175 175 175 ASN ASN B . n 
B 2 176 PRO 176 176 176 PRO PRO B . n 
B 2 177 ASP 177 177 177 ASP ASP B . n 
B 2 178 ILE 178 178 178 ILE ILE B . n 
B 2 179 VAL 179 179 179 VAL VAL B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 GLN 182 182 182 GLN GLN B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 MET 184 184 184 MET MET B . n 
B 2 185 ASP 185 185 185 ASP ASP B . n 
B 2 186 ASP 186 186 186 ASP ASP B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 TYR 188 188 188 TYR TYR B . n 
B 2 189 VAL 189 189 189 VAL VAL B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 GLU 194 194 194 GLU GLU B . n 
B 2 195 ILE 195 195 195 ILE ILE B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLN 197 197 197 GLN GLN B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 ARG 199 199 199 ARG ARG B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 ARG 206 206 206 ARG ARG B . n 
B 2 207 GLN 207 207 207 GLN GLN B . n 
B 2 208 HIS 208 208 208 HIS HIS B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 LEU 210 210 210 LEU LEU B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 TRP 212 212 212 TRP TRP B . n 
B 2 213 GLY 213 213 213 GLY GLY B . n 
B 2 214 LEU 214 214 ?   ?   ?   B . n 
B 2 215 THR 215 215 ?   ?   ?   B . n 
B 2 216 THR 216 216 ?   ?   ?   B . n 
B 2 217 PRO 217 217 ?   ?   ?   B . n 
B 2 218 ASP 218 218 ?   ?   ?   B . n 
B 2 219 LYS 219 219 ?   ?   ?   B . n 
B 2 220 LYS 220 220 ?   ?   ?   B . n 
B 2 221 HIS 221 221 ?   ?   ?   B . n 
B 2 222 GLN 222 222 ?   ?   ?   B . n 
B 2 223 LYS 223 223 ?   ?   ?   B . n 
B 2 224 GLU 224 224 ?   ?   ?   B . n 
B 2 225 PRO 225 225 ?   ?   ?   B . n 
B 2 226 PRO 226 226 ?   ?   ?   B . n 
B 2 227 PHE 227 227 ?   ?   ?   B . n 
B 2 228 LEU 228 228 ?   ?   ?   B . n 
B 2 229 TRP 229 229 ?   ?   ?   B . n 
B 2 230 MET 230 230 ?   ?   ?   B . n 
B 2 231 GLY 231 231 ?   ?   ?   B . n 
B 2 232 TYR 232 232 ?   ?   ?   B . n 
B 2 233 GLU 233 233 233 GLU GLU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 HIS 235 235 235 HIS HIS B . n 
B 2 236 PRO 236 236 236 PRO PRO B . n 
B 2 237 ASP 237 237 237 ASP ASP B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 TRP 239 239 239 TRP TRP B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 VAL 241 241 241 VAL VAL B . n 
B 2 242 GLN 242 242 242 GLN GLN B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 VAL 245 245 245 VAL VAL B . n 
B 2 246 LEU 246 246 246 LEU LEU B . n 
B 2 247 PRO 247 247 247 PRO PRO B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 LYS 249 249 249 LYS LYS B . n 
B 2 250 ASP 250 250 250 ASP ASP B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 TRP 252 252 252 TRP TRP B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 VAL 254 254 254 VAL VAL B . n 
B 2 255 ASN 255 255 255 ASN ASN B . n 
B 2 256 ASP 256 256 256 ASP ASP B . n 
B 2 257 ILE 257 257 257 ILE ILE B . n 
B 2 258 GLN 258 258 258 GLN GLN B . n 
B 2 259 LYS 259 259 259 LYS LYS B . n 
B 2 260 LEU 260 260 260 LEU LEU B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 GLY 262 262 262 GLY GLY B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 LEU 264 264 264 LEU LEU B . n 
B 2 265 ASN 265 265 265 ASN ASN B . n 
B 2 266 TRP 266 266 266 TRP TRP B . n 
B 2 267 ALA 267 267 267 ALA ALA B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 ILE 270 270 270 ILE ILE B . n 
B 2 271 TYR 271 271 271 TYR TYR B . n 
B 2 272 PRO 272 272 272 PRO PRO B . n 
B 2 273 GLY 273 273 273 GLY GLY B . n 
B 2 274 ILE 274 274 274 ILE ILE B . n 
B 2 275 LYS 275 275 275 LYS LYS B . n 
B 2 276 VAL 276 276 276 VAL VAL B . n 
B 2 277 ARG 277 277 277 ARG ARG B . n 
B 2 278 GLN 278 278 278 GLN GLN B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 SER 280 280 280 SER SER B . n 
B 2 281 LYS 281 281 281 LYS LYS B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 LEU 283 283 283 LEU LEU B . n 
B 2 284 ARG 284 284 284 ARG ARG B . n 
B 2 285 GLY 285 285 285 GLY GLY B . n 
B 2 286 THR 286 286 286 THR THR B . n 
B 2 287 LYS 287 287 287 LYS LYS B . n 
B 2 288 ALA 288 288 288 ALA ALA B . n 
B 2 289 LEU 289 289 289 LEU LEU B . n 
B 2 290 THR 290 290 290 THR THR B . n 
B 2 291 GLU 291 291 291 GLU GLU B . n 
B 2 292 VAL 292 292 292 VAL VAL B . n 
B 2 293 ILE 293 293 293 ILE ILE B . n 
B 2 294 PRO 294 294 294 PRO PRO B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 THR 296 296 296 THR THR B . n 
B 2 297 GLU 297 297 297 GLU GLU B . n 
B 2 298 GLU 298 298 298 GLU GLU B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 GLU 300 300 300 GLU GLU B . n 
B 2 301 LEU 301 301 301 LEU LEU B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 LEU 303 303 303 LEU LEU B . n 
B 2 304 ALA 304 304 304 ALA ALA B . n 
B 2 305 GLU 305 305 305 GLU GLU B . n 
B 2 306 ASN 306 306 306 ASN ASN B . n 
B 2 307 ARG 307 307 307 ARG ARG B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ILE 309 309 309 ILE ILE B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LYS 311 311 311 LYS LYS B . n 
B 2 312 GLU 312 312 312 GLU GLU B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 HIS 315 315 315 HIS HIS B . n 
B 2 316 GLY 316 316 316 GLY GLY B . n 
B 2 317 VAL 317 317 317 VAL VAL B . n 
B 2 318 TYR 318 318 318 TYR TYR B . n 
B 2 319 TYR 319 319 319 TYR TYR B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 SER 322 322 322 SER SER B . n 
B 2 323 LYS 323 323 323 LYS LYS B . n 
B 2 324 ASP 324 324 324 ASP ASP B . n 
B 2 325 LEU 325 325 325 LEU LEU B . n 
B 2 326 ILE 326 326 326 ILE ILE B . n 
B 2 327 ALA 327 327 327 ALA ALA B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 ILE 329 329 329 ILE ILE B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 LYS 331 331 331 LYS LYS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLY 333 333 333 GLY GLY B . n 
B 2 334 GLN 334 334 334 GLN GLN B . n 
B 2 335 GLY 335 335 335 GLY GLY B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 TRP 337 337 337 TRP TRP B . n 
B 2 338 THR 338 338 338 THR THR B . n 
B 2 339 TYR 339 339 339 TYR TYR B . n 
B 2 340 GLN 340 340 340 GLN GLN B . n 
B 2 341 ILE 341 341 341 ILE ILE B . n 
B 2 342 TYR 342 342 342 TYR TYR B . n 
B 2 343 GLN 343 343 343 GLN GLN B . n 
B 2 344 GLU 344 344 344 GLU GLU B . n 
B 2 345 PRO 345 345 345 PRO PRO B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 ASN 348 348 348 ASN ASN B . n 
B 2 349 LEU 349 349 349 LEU LEU B . n 
B 2 350 LYS 350 350 350 LYS LYS B . n 
B 2 351 THR 351 351 351 THR THR B . n 
B 2 352 GLY 352 352 352 GLY GLY B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 TYR 354 354 354 TYR TYR B . n 
B 2 355 ALA 355 355 355 ALA ALA B . n 
B 2 356 ARG 356 356 356 ARG ARG B . n 
B 2 357 MET 357 357 357 MET MET B . n 
B 2 358 ARG 358 358 358 ARG ARG B . n 
B 2 359 GLY 359 359 359 GLY GLY B . n 
B 2 360 ALA 360 360 360 ALA ALA B . n 
B 2 361 HIS 361 361 361 HIS HIS B . n 
B 2 362 THR 362 362 362 THR THR B . n 
B 2 363 ASN 363 363 363 ASN ASN B . n 
B 2 364 ASP 364 364 364 ASP ASP B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 LYS 366 366 366 LYS LYS B . n 
B 2 367 GLN 367 367 367 GLN GLN B . n 
B 2 368 LEU 368 368 368 LEU LEU B . n 
B 2 369 THR 369 369 369 THR THR B . n 
B 2 370 GLU 370 370 370 GLU GLU B . n 
B 2 371 ALA 371 371 371 ALA ALA B . n 
B 2 372 VAL 372 372 372 VAL VAL B . n 
B 2 373 GLN 373 373 373 GLN GLN B . n 
B 2 374 LYS 374 374 374 LYS LYS B . n 
B 2 375 ILE 375 375 375 ILE ILE B . n 
B 2 376 THR 376 376 376 THR THR B . n 
B 2 377 THR 377 377 377 THR THR B . n 
B 2 378 GLU 378 378 378 GLU GLU B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 ILE 380 380 380 ILE ILE B . n 
B 2 381 VAL 381 381 381 VAL VAL B . n 
B 2 382 ILE 382 382 382 ILE ILE B . n 
B 2 383 TRP 383 383 383 TRP TRP B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 LYS 385 385 385 LYS LYS B . n 
B 2 386 THR 386 386 386 THR THR B . n 
B 2 387 PRO 387 387 387 PRO PRO B . n 
B 2 388 LYS 388 388 388 LYS LYS B . n 
B 2 389 PHE 389 389 389 PHE PHE B . n 
B 2 390 LYS 390 390 390 LYS LYS B . n 
B 2 391 LEU 391 391 391 LEU LEU B . n 
B 2 392 PRO 392 392 392 PRO PRO B . n 
B 2 393 ILE 393 393 393 ILE ILE B . n 
B 2 394 GLN 394 394 394 GLN GLN B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 GLU 396 396 396 GLU GLU B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 TRP 398 398 398 TRP TRP B . n 
B 2 399 GLU 399 399 399 GLU GLU B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 TRP 401 401 401 TRP TRP B . n 
B 2 402 TRP 402 402 402 TRP TRP B . n 
B 2 403 THR 403 403 403 THR THR B . n 
B 2 404 GLU 404 404 404 GLU GLU B . n 
B 2 405 TYR 405 405 405 TYR TYR B . n 
B 2 406 TRP 406 406 406 TRP TRP B . n 
B 2 407 GLN 407 407 407 GLN GLN B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 THR 409 409 409 THR THR B . n 
B 2 410 TRP 410 410 410 TRP TRP B . n 
B 2 411 ILE 411 411 411 ILE ILE B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 GLU 413 413 413 GLU GLU B . n 
B 2 414 TRP 414 414 414 TRP TRP B . n 
B 2 415 GLU 415 415 415 GLU GLU B . n 
B 2 416 PHE 416 416 416 PHE PHE B . n 
B 2 417 VAL 417 417 417 VAL VAL B . n 
B 2 418 ASN 418 418 418 ASN ASN B . n 
B 2 419 THR 419 419 419 THR THR B . n 
B 2 420 PRO 420 420 420 PRO PRO B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 VAL 423 423 423 VAL VAL B . n 
B 2 424 LYS 424 424 424 LYS LYS B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 TRP 426 426 426 TRP TRP B . n 
B 2 427 TYR 427 427 427 TYR TYR B . n 
B 2 428 GLN 428 428 428 GLN GLN B . n 
B 2 429 LEU 429 429 429 LEU LEU B . n 
B 2 430 GLU 430 430 ?   ?   ?   B . n 
B 2 431 LYS 431 431 ?   ?   ?   B . n 
B 2 432 GLU 432 432 ?   ?   ?   B . n 
B 2 433 PRO 433 433 ?   ?   ?   B . n 
B 2 434 ILE 434 434 ?   ?   ?   B . n 
B 2 435 VAL 435 435 ?   ?   ?   B . n 
B 2 436 GLY 436 436 ?   ?   ?   B . n 
B 2 437 ALA 437 437 ?   ?   ?   B . n 
B 2 438 GLU 438 438 ?   ?   ?   B . n 
B 2 439 THR 439 439 ?   ?   ?   B . n 
B 2 440 PHE 440 440 ?   ?   ?   B . n 
C 3 1   DA  1   802 ?   ?   ?   P . n 
C 3 2   DC  2   803 ?   ?   ?   P . n 
C 3 3   DA  3   804 ?   ?   ?   P . n 
C 3 4   DG  4   805 805 DG  DG  P . n 
C 3 5   DT  5   806 806 DT  DT  P . n 
C 3 6   DC  6   807 807 DC  DC  P . n 
C 3 7   DC  7   808 808 DC  DC  P . n 
C 3 8   DC  8   809 809 DC  DC  P . n 
C 3 9   DT  9   810 810 DT  DT  P . n 
C 3 10  DG  10  811 811 DG  DG  P . n 
C 3 11  DT  11  812 812 DT  DT  P . n 
C 3 12  DT  12  813 813 DT  DT  P . n 
C 3 13  DC  13  814 814 DC  DC  P . n 
C 3 14  DG  14  815 815 DG  DG  P . n 
C 3 15  DG  15  816 816 DG  DG  P . n 
C 3 16  DG  16  817 817 DG  DG  P . n 
C 3 17  DC  17  818 818 DC  DC  P . n 
C 3 18  DG  18  819 819 DG  DG  P . n 
C 3 19  DC  19  820 820 DC  DC  P . n 
C 3 20  DC  20  821 821 DC  DC  P . n 
C 3 21  DOC 21  822 822 DOC DOC P . n 
D 4 1   DA  1   701 ?   ?   ?   T . n 
D 4 2   DT  2   702 ?   ?   ?   T . n 
D 4 3   DG  3   703 703 DG  DG  T . n 
D 4 4   DG  4   704 704 DG  DG  T . n 
D 4 5   DG  5   705 705 DG  DG  T . n 
D 4 6   DG  6   706 706 DG  DG  T . n 
D 4 7   DG  7   707 707 DG  DG  T . n 
D 4 8   DG  8   708 708 DG  DG  T . n 
D 4 9   DC  9   709 709 DC  DC  T . n 
D 4 10  DG  10  710 710 DG  DG  T . n 
D 4 11  DC  11  711 711 DC  DC  T . n 
D 4 12  DC  12  712 712 DC  DC  T . n 
D 4 13  DC  13  713 713 DC  DC  T . n 
D 4 14  DG  14  714 714 DG  DG  T . n 
D 4 15  DA  15  715 715 DA  DA  T . n 
D 4 16  DA  16  716 716 DA  DA  T . n 
D 4 17  DC  17  717 717 DC  DC  T . n 
D 4 18  DA  18  718 718 DA  DA  T . n 
D 4 19  DG  19  719 719 DG  DG  T . n 
D 4 20  DG  20  720 720 DG  DG  T . n 
D 4 21  DG  21  721 721 DG  DG  T . n 
D 4 22  DA  22  722 722 DA  DA  T . n 
D 4 23  DC  23  723 723 DC  DC  T . n 
D 4 24  DT  24  724 724 DT  DT  T . n 
D 4 25  DG  25  725 ?   ?   ?   T . n 
D 4 26  DT  26  726 ?   ?   ?   T . n 
D 4 27  DG  27  727 ?   ?   ?   T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 SO4 1  601  561 SO4 SO4 A . 
F 5 SO4 1  602  562 SO4 SO4 A . 
G 6 MG  1  603  600 MG  MG  A . 
H 7 1RY 1  604  651 1RY 1RY A . 
I 5 SO4 1  901  2   SO4 SO4 P . 
J 5 SO4 1  801  1   SO4 SO4 T . 
K 8 HOH 1  701  19  HOH HOH A . 
K 8 HOH 2  702  35  HOH HOH A . 
K 8 HOH 3  703  25  HOH HOH A . 
K 8 HOH 4  704  53  HOH HOH A . 
K 8 HOH 5  705  55  HOH HOH A . 
K 8 HOH 6  706  4   HOH HOH A . 
K 8 HOH 7  707  52  HOH HOH A . 
K 8 HOH 8  708  17  HOH HOH A . 
K 8 HOH 9  709  103 HOH HOH A . 
K 8 HOH 10 710  18  HOH HOH A . 
K 8 HOH 11 711  24  HOH HOH A . 
K 8 HOH 12 712  42  HOH HOH A . 
K 8 HOH 13 713  67  HOH HOH A . 
K 8 HOH 14 714  58  HOH HOH A . 
K 8 HOH 15 715  50  HOH HOH A . 
K 8 HOH 16 716  34  HOH HOH A . 
K 8 HOH 17 717  14  HOH HOH A . 
K 8 HOH 18 718  57  HOH HOH A . 
K 8 HOH 19 719  15  HOH HOH A . 
K 8 HOH 20 720  13  HOH HOH A . 
K 8 HOH 21 721  43  HOH HOH A . 
K 8 HOH 22 722  98  HOH HOH A . 
K 8 HOH 23 723  66  HOH HOH A . 
K 8 HOH 24 724  48  HOH HOH A . 
K 8 HOH 25 725  88  HOH HOH A . 
K 8 HOH 26 726  2   HOH HOH A . 
K 8 HOH 27 727  12  HOH HOH A . 
K 8 HOH 28 728  6   HOH HOH A . 
K 8 HOH 29 729  70  HOH HOH A . 
K 8 HOH 30 730  102 HOH HOH A . 
K 8 HOH 31 731  40  HOH HOH A . 
K 8 HOH 32 732  10  HOH HOH A . 
K 8 HOH 33 733  44  HOH HOH A . 
K 8 HOH 34 734  109 HOH HOH A . 
K 8 HOH 35 735  95  HOH HOH A . 
K 8 HOH 36 736  71  HOH HOH A . 
K 8 HOH 37 737  69  HOH HOH A . 
K 8 HOH 38 738  9   HOH HOH A . 
K 8 HOH 39 739  7   HOH HOH A . 
K 8 HOH 40 740  21  HOH HOH A . 
K 8 HOH 41 741  101 HOH HOH A . 
K 8 HOH 42 742  72  HOH HOH A . 
K 8 HOH 43 743  108 HOH HOH A . 
K 8 HOH 44 744  76  HOH HOH A . 
K 8 HOH 45 745  29  HOH HOH A . 
K 8 HOH 46 746  28  HOH HOH A . 
K 8 HOH 47 747  49  HOH HOH A . 
K 8 HOH 48 748  54  HOH HOH A . 
K 8 HOH 49 749  22  HOH HOH A . 
K 8 HOH 50 750  77  HOH HOH A . 
K 8 HOH 51 751  30  HOH HOH A . 
K 8 HOH 52 752  11  HOH HOH A . 
K 8 HOH 53 753  26  HOH HOH A . 
K 8 HOH 54 754  75  HOH HOH A . 
K 8 HOH 55 755  36  HOH HOH A . 
K 8 HOH 56 756  110 HOH HOH A . 
K 8 HOH 57 757  74  HOH HOH A . 
K 8 HOH 58 758  105 HOH HOH A . 
K 8 HOH 59 759  107 HOH HOH A . 
K 8 HOH 60 760  62  HOH HOH A . 
K 8 HOH 61 761  65  HOH HOH A . 
K 8 HOH 62 762  41  HOH HOH A . 
K 8 HOH 63 763  106 HOH HOH A . 
K 8 HOH 64 764  23  HOH HOH A . 
K 8 HOH 65 765  60  HOH HOH A . 
K 8 HOH 66 766  78  HOH HOH A . 
K 8 HOH 67 767  100 HOH HOH A . 
L 8 HOH 1  501  37  HOH HOH B . 
L 8 HOH 2  502  16  HOH HOH B . 
L 8 HOH 3  503  87  HOH HOH B . 
L 8 HOH 4  504  32  HOH HOH B . 
L 8 HOH 5  505  8   HOH HOH B . 
L 8 HOH 6  506  111 HOH HOH B . 
L 8 HOH 7  507  56  HOH HOH B . 
L 8 HOH 8  508  92  HOH HOH B . 
L 8 HOH 9  509  64  HOH HOH B . 
L 8 HOH 10 510  1   HOH HOH B . 
L 8 HOH 11 511  33  HOH HOH B . 
L 8 HOH 12 512  31  HOH HOH B . 
L 8 HOH 13 513  5   HOH HOH B . 
L 8 HOH 14 514  79  HOH HOH B . 
L 8 HOH 15 515  51  HOH HOH B . 
L 8 HOH 16 516  45  HOH HOH B . 
L 8 HOH 17 517  82  HOH HOH B . 
L 8 HOH 18 518  39  HOH HOH B . 
L 8 HOH 19 519  85  HOH HOH B . 
L 8 HOH 20 520  20  HOH HOH B . 
L 8 HOH 21 521  84  HOH HOH B . 
L 8 HOH 22 522  90  HOH HOH B . 
L 8 HOH 23 523  81  HOH HOH B . 
L 8 HOH 24 524  83  HOH HOH B . 
L 8 HOH 25 525  86  HOH HOH B . 
L 8 HOH 26 526  73  HOH HOH B . 
L 8 HOH 27 527  97  HOH HOH B . 
L 8 HOH 28 528  46  HOH HOH B . 
L 8 HOH 29 529  96  HOH HOH B . 
L 8 HOH 30 530  93  HOH HOH B . 
L 8 HOH 31 531  91  HOH HOH B . 
L 8 HOH 32 532  80  HOH HOH B . 
L 8 HOH 33 533  89  HOH HOH B . 
L 8 HOH 34 534  112 HOH HOH B . 
M 8 HOH 1  1001 3   HOH HOH P . 
M 8 HOH 2  1002 94  HOH HOH P . 
M 8 HOH 3  1003 99  HOH HOH P . 
M 8 HOH 4  1004 61  HOH HOH P . 
M 8 HOH 5  1005 63  HOH HOH P . 
N 8 HOH 1  901  27  HOH HOH T . 
N 8 HOH 2  902  38  HOH HOH T . 
N 8 HOH 3  903  68  HOH HOH T . 
N 8 HOH 4  904  59  HOH HOH T . 
N 8 HOH 5  905  104 HOH HOH T . 
N 8 HOH 6  906  47  HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13480 ? 
1 MORE         -98   ? 
1 'SSA (A^2)'  46950 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd