data_6UJY
# 
_entry.id   6UJY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UJY         
WWPDB D_1000244723 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UJY 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Lansdon, E.B.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0001-9461-1475 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Commun Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2399-3642 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            2 
_citation.language                  ? 
_citation.page_first                469 
_citation.page_last                 469 
_citation.title                     
'Elucidating molecular interactions ofL-nucleotides with HIV-1 reverse transcriptase and mechanism of M184V-caused drug resistance.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s42003-019-0706-x 
_citation.pdbx_database_id_PubMed   31872074 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hung, M.'       1 ? 
primary 'Tokarsky, E.J.' 2 ? 
primary 'Lagpacan, L.'   3 ? 
primary 'Zhang, L.'      4 ? 
primary 'Suo, Z.'        5 ? 
primary 'Lansdon, E.B.'  6 ? 
# 
_cell.angle_alpha                  90.0 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.0 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.0 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UJY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     166.702 
_cell.length_a_esd                 ? 
_cell.length_b                     169.479 
_cell.length_b_esd                 ? 
_cell.length_c                     102.766 
_cell.length_c_esd                 ? 
_cell.volume                       2903395.20832 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UJY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            'C 2c 2' 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'p66 Reverse transcriptase/RNaseH' 65887.328 1   2.7.7.49,2.7.7.7,3.1.26.13 Q845C,C867S ? ? 
2 polymer     man 'p51 Reverse transcriptase/RNaseH' 51382.984 1   2.7.7.49,2.7.7.7,3.1.26.13 C867S       ? ? 
3 polymer     syn 'primer DNA'                       6360.099  1   ?                          ?           ? ? 
4 polymer     syn 'template DNA'                     8448.421  1   ?                          ?           ? ? 
5 non-polymer syn 'Lamivudine Triphosphate'          469.196   1   ?                          ?           ? ? 
6 non-polymer syn 'SULFATE ION'                      96.063    2   ?                          ?           ? ? 
7 non-polymer syn 'MAGNESIUM ION'                    24.305    1   ?                          ?           ? ? 
8 water       nat water                              18.015    189 ?                          ?           ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Exoribonuclease H, p66 RT' 
2 'Exoribonuclease H, p51 RT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVT
LTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
DKLVSAGIRKVL
;
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVT
LTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
DKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(DG)(DC)(DG)(DC)(DC)
(DOC)
;
ACAGTCCCTGTTCGGGCGCCC P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DG)(DG)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGGGGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  PRO n 
1 14  ILE n 
1 15  SER n 
1 16  PRO n 
1 17  ILE n 
1 18  GLU n 
1 19  THR n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LYS n 
1 24  LEU n 
1 25  LYS n 
1 26  PRO n 
1 27  GLY n 
1 28  MET n 
1 29  ASP n 
1 30  GLY n 
1 31  PRO n 
1 32  LYS n 
1 33  VAL n 
1 34  LYS n 
1 35  GLN n 
1 36  TRP n 
1 37  PRO n 
1 38  LEU n 
1 39  THR n 
1 40  GLU n 
1 41  GLU n 
1 42  LYS n 
1 43  ILE n 
1 44  LYS n 
1 45  ALA n 
1 46  LEU n 
1 47  VAL n 
1 48  GLU n 
1 49  ILE n 
1 50  CYS n 
1 51  THR n 
1 52  GLU n 
1 53  MET n 
1 54  GLU n 
1 55  LYS n 
1 56  GLU n 
1 57  GLY n 
1 58  LYS n 
1 59  ILE n 
1 60  SER n 
1 61  LYS n 
1 62  ILE n 
1 63  GLY n 
1 64  PRO n 
1 65  GLU n 
1 66  ASN n 
1 67  PRO n 
1 68  TYR n 
1 69  ASN n 
1 70  THR n 
1 71  PRO n 
1 72  VAL n 
1 73  PHE n 
1 74  ALA n 
1 75  ILE n 
1 76  LYS n 
1 77  LYS n 
1 78  LYS n 
1 79  ASP n 
1 80  SER n 
1 81  THR n 
1 82  LYS n 
1 83  TRP n 
1 84  ARG n 
1 85  LYS n 
1 86  LEU n 
1 87  VAL n 
1 88  ASP n 
1 89  PHE n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  ASN n 
1 94  LYS n 
1 95  ARG n 
1 96  THR n 
1 97  GLN n 
1 98  ASP n 
1 99  PHE n 
1 100 TRP n 
1 101 GLU n 
1 102 VAL n 
1 103 GLN n 
1 104 LEU n 
1 105 GLY n 
1 106 ILE n 
1 107 PRO n 
1 108 HIS n 
1 109 PRO n 
1 110 ALA n 
1 111 GLY n 
1 112 LEU n 
1 113 LYS n 
1 114 LYS n 
1 115 LYS n 
1 116 LYS n 
1 117 SER n 
1 118 VAL n 
1 119 THR n 
1 120 VAL n 
1 121 LEU n 
1 122 ASP n 
1 123 VAL n 
1 124 GLY n 
1 125 ASP n 
1 126 ALA n 
1 127 TYR n 
1 128 PHE n 
1 129 SER n 
1 130 VAL n 
1 131 PRO n 
1 132 LEU n 
1 133 ASP n 
1 134 GLU n 
1 135 ASP n 
1 136 PHE n 
1 137 ARG n 
1 138 LYS n 
1 139 TYR n 
1 140 THR n 
1 141 ALA n 
1 142 PHE n 
1 143 THR n 
1 144 ILE n 
1 145 PRO n 
1 146 SER n 
1 147 ILE n 
1 148 ASN n 
1 149 ASN n 
1 150 GLU n 
1 151 THR n 
1 152 PRO n 
1 153 GLY n 
1 154 ILE n 
1 155 ARG n 
1 156 TYR n 
1 157 GLN n 
1 158 TYR n 
1 159 ASN n 
1 160 VAL n 
1 161 LEU n 
1 162 PRO n 
1 163 GLN n 
1 164 GLY n 
1 165 TRP n 
1 166 LYS n 
1 167 GLY n 
1 168 SER n 
1 169 PRO n 
1 170 ALA n 
1 171 ILE n 
1 172 PHE n 
1 173 GLN n 
1 174 SER n 
1 175 SER n 
1 176 MET n 
1 177 THR n 
1 178 LYS n 
1 179 ILE n 
1 180 LEU n 
1 181 GLU n 
1 182 PRO n 
1 183 PHE n 
1 184 ARG n 
1 185 LYS n 
1 186 GLN n 
1 187 ASN n 
1 188 PRO n 
1 189 ASP n 
1 190 ILE n 
1 191 VAL n 
1 192 ILE n 
1 193 TYR n 
1 194 GLN n 
1 195 TYR n 
1 196 MET n 
1 197 ASP n 
1 198 ASP n 
1 199 LEU n 
1 200 TYR n 
1 201 VAL n 
1 202 GLY n 
1 203 SER n 
1 204 ASP n 
1 205 LEU n 
1 206 GLU n 
1 207 ILE n 
1 208 GLY n 
1 209 GLN n 
1 210 HIS n 
1 211 ARG n 
1 212 THR n 
1 213 LYS n 
1 214 ILE n 
1 215 GLU n 
1 216 GLU n 
1 217 LEU n 
1 218 ARG n 
1 219 GLN n 
1 220 HIS n 
1 221 LEU n 
1 222 LEU n 
1 223 ARG n 
1 224 TRP n 
1 225 GLY n 
1 226 LEU n 
1 227 THR n 
1 228 THR n 
1 229 PRO n 
1 230 ASP n 
1 231 LYS n 
1 232 LYS n 
1 233 HIS n 
1 234 GLN n 
1 235 LYS n 
1 236 GLU n 
1 237 PRO n 
1 238 PRO n 
1 239 PHE n 
1 240 LEU n 
1 241 TRP n 
1 242 MET n 
1 243 GLY n 
1 244 TYR n 
1 245 GLU n 
1 246 LEU n 
1 247 HIS n 
1 248 PRO n 
1 249 ASP n 
1 250 LYS n 
1 251 TRP n 
1 252 THR n 
1 253 VAL n 
1 254 GLN n 
1 255 PRO n 
1 256 ILE n 
1 257 VAL n 
1 258 LEU n 
1 259 PRO n 
1 260 GLU n 
1 261 LYS n 
1 262 ASP n 
1 263 SER n 
1 264 TRP n 
1 265 THR n 
1 266 VAL n 
1 267 ASN n 
1 268 ASP n 
1 269 ILE n 
1 270 CYS n 
1 271 LYS n 
1 272 LEU n 
1 273 VAL n 
1 274 GLY n 
1 275 LYS n 
1 276 LEU n 
1 277 ASN n 
1 278 TRP n 
1 279 ALA n 
1 280 SER n 
1 281 GLN n 
1 282 ILE n 
1 283 TYR n 
1 284 PRO n 
1 285 GLY n 
1 286 ILE n 
1 287 LYS n 
1 288 VAL n 
1 289 ARG n 
1 290 GLN n 
1 291 LEU n 
1 292 SER n 
1 293 LYS n 
1 294 LEU n 
1 295 LEU n 
1 296 ARG n 
1 297 GLY n 
1 298 THR n 
1 299 LYS n 
1 300 ALA n 
1 301 LEU n 
1 302 THR n 
1 303 GLU n 
1 304 VAL n 
1 305 ILE n 
1 306 PRO n 
1 307 LEU n 
1 308 THR n 
1 309 GLU n 
1 310 GLU n 
1 311 ALA n 
1 312 GLU n 
1 313 LEU n 
1 314 GLU n 
1 315 LEU n 
1 316 ALA n 
1 317 GLU n 
1 318 ASN n 
1 319 ARG n 
1 320 GLU n 
1 321 ILE n 
1 322 LEU n 
1 323 LYS n 
1 324 GLU n 
1 325 PRO n 
1 326 VAL n 
1 327 HIS n 
1 328 GLY n 
1 329 VAL n 
1 330 TYR n 
1 331 TYR n 
1 332 ASP n 
1 333 PRO n 
1 334 SER n 
1 335 LYS n 
1 336 ASP n 
1 337 LEU n 
1 338 ILE n 
1 339 ALA n 
1 340 GLU n 
1 341 ILE n 
1 342 GLN n 
1 343 LYS n 
1 344 GLN n 
1 345 GLY n 
1 346 GLN n 
1 347 GLY n 
1 348 GLN n 
1 349 TRP n 
1 350 THR n 
1 351 TYR n 
1 352 GLN n 
1 353 ILE n 
1 354 TYR n 
1 355 GLN n 
1 356 GLU n 
1 357 PRO n 
1 358 PHE n 
1 359 LYS n 
1 360 ASN n 
1 361 LEU n 
1 362 LYS n 
1 363 THR n 
1 364 GLY n 
1 365 LYS n 
1 366 TYR n 
1 367 ALA n 
1 368 ARG n 
1 369 MET n 
1 370 ARG n 
1 371 GLY n 
1 372 ALA n 
1 373 HIS n 
1 374 THR n 
1 375 ASN n 
1 376 ASP n 
1 377 VAL n 
1 378 LYS n 
1 379 GLN n 
1 380 LEU n 
1 381 THR n 
1 382 GLU n 
1 383 ALA n 
1 384 VAL n 
1 385 GLN n 
1 386 LYS n 
1 387 ILE n 
1 388 THR n 
1 389 THR n 
1 390 GLU n 
1 391 SER n 
1 392 ILE n 
1 393 VAL n 
1 394 ILE n 
1 395 TRP n 
1 396 GLY n 
1 397 LYS n 
1 398 THR n 
1 399 PRO n 
1 400 LYS n 
1 401 PHE n 
1 402 LYS n 
1 403 LEU n 
1 404 PRO n 
1 405 ILE n 
1 406 GLN n 
1 407 LYS n 
1 408 GLU n 
1 409 THR n 
1 410 TRP n 
1 411 GLU n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 THR n 
1 416 GLU n 
1 417 TYR n 
1 418 TRP n 
1 419 GLN n 
1 420 ALA n 
1 421 THR n 
1 422 TRP n 
1 423 ILE n 
1 424 PRO n 
1 425 GLU n 
1 426 TRP n 
1 427 GLU n 
1 428 PHE n 
1 429 VAL n 
1 430 ASN n 
1 431 THR n 
1 432 PRO n 
1 433 PRO n 
1 434 LEU n 
1 435 VAL n 
1 436 LYS n 
1 437 LEU n 
1 438 TRP n 
1 439 TYR n 
1 440 GLN n 
1 441 LEU n 
1 442 GLU n 
1 443 LYS n 
1 444 GLU n 
1 445 PRO n 
1 446 ILE n 
1 447 VAL n 
1 448 GLY n 
1 449 ALA n 
1 450 GLU n 
1 451 THR n 
1 452 PHE n 
1 453 TYR n 
1 454 VAL n 
1 455 ASP n 
1 456 GLY n 
1 457 ALA n 
1 458 ALA n 
1 459 ASN n 
1 460 ARG n 
1 461 GLU n 
1 462 THR n 
1 463 LYS n 
1 464 LEU n 
1 465 GLY n 
1 466 LYS n 
1 467 ALA n 
1 468 GLY n 
1 469 TYR n 
1 470 VAL n 
1 471 THR n 
1 472 ASN n 
1 473 ARG n 
1 474 GLY n 
1 475 ARG n 
1 476 GLN n 
1 477 LYS n 
1 478 VAL n 
1 479 VAL n 
1 480 THR n 
1 481 LEU n 
1 482 THR n 
1 483 ASP n 
1 484 THR n 
1 485 THR n 
1 486 ASN n 
1 487 GLN n 
1 488 LYS n 
1 489 THR n 
1 490 GLU n 
1 491 LEU n 
1 492 GLN n 
1 493 ALA n 
1 494 ILE n 
1 495 TYR n 
1 496 LEU n 
1 497 ALA n 
1 498 LEU n 
1 499 GLN n 
1 500 ASP n 
1 501 SER n 
1 502 GLY n 
1 503 LEU n 
1 504 GLU n 
1 505 VAL n 
1 506 ASN n 
1 507 ILE n 
1 508 VAL n 
1 509 THR n 
1 510 ASP n 
1 511 SER n 
1 512 GLN n 
1 513 TYR n 
1 514 ALA n 
1 515 LEU n 
1 516 GLY n 
1 517 ILE n 
1 518 ILE n 
1 519 GLN n 
1 520 ALA n 
1 521 GLN n 
1 522 PRO n 
1 523 ASP n 
1 524 GLN n 
1 525 SER n 
1 526 GLU n 
1 527 SER n 
1 528 GLU n 
1 529 LEU n 
1 530 VAL n 
1 531 ASN n 
1 532 GLN n 
1 533 ILE n 
1 534 ILE n 
1 535 GLU n 
1 536 GLN n 
1 537 LEU n 
1 538 ILE n 
1 539 LYS n 
1 540 LYS n 
1 541 GLU n 
1 542 LYS n 
1 543 VAL n 
1 544 TYR n 
1 545 LEU n 
1 546 ALA n 
1 547 TRP n 
1 548 VAL n 
1 549 PRO n 
1 550 ALA n 
1 551 HIS n 
1 552 LYS n 
1 553 GLY n 
1 554 ILE n 
1 555 GLY n 
1 556 GLY n 
1 557 ASN n 
1 558 GLU n 
1 559 GLN n 
1 560 VAL n 
1 561 ASP n 
1 562 LYS n 
1 563 LEU n 
1 564 VAL n 
1 565 SER n 
1 566 ALA n 
1 567 GLY n 
1 568 ILE n 
1 569 ARG n 
1 570 LYS n 
1 571 VAL n 
1 572 LEU n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
2 429 LEU n 
2 430 GLU n 
2 431 LYS n 
2 432 GLU n 
2 433 PRO n 
2 434 ILE n 
2 435 VAL n 
2 436 GLY n 
2 437 ALA n 
2 438 GLU n 
2 439 THR n 
2 440 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  DG  n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  DOC n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DG  n 
4 6   DG  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 572 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 440 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 21 'Human immunodeficiency virus 1' ? 11676 ? 
4 1 sample 1 27 'Human immunodeficiency virus 1' ? 11676 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1H2 P04585 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
2 UNP POL_HV1H2 P04585 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
3 PDB 6UJY      6UJY   ? 3 ? 1   
4 PDB 6UJY      6UJY   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6UJY A 13 ? 572 ? P04585 588 ? 1147 ? 1   560 
2 2 6UJY B 1  ? 440 ? P04585 588 ? 1027 ? 1   440 
3 3 6UJY P 1  ? 21  ? 6UJY   802 ? 822  ? 802 822 
4 4 6UJY T 1  ? 27  ? 6UJY   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6UJY MET A 1   ? UNP P04585 ?   ?   'initiating methionine' -11 1  
1 6UJY GLY A 2   ? UNP P04585 ?   ?   'expression tag'        -10 2  
1 6UJY SER A 3   ? UNP P04585 ?   ?   'expression tag'        -9  3  
1 6UJY SER A 4   ? UNP P04585 ?   ?   'expression tag'        -8  4  
1 6UJY HIS A 5   ? UNP P04585 ?   ?   'expression tag'        -7  5  
1 6UJY HIS A 6   ? UNP P04585 ?   ?   'expression tag'        -6  6  
1 6UJY HIS A 7   ? UNP P04585 ?   ?   'expression tag'        -5  7  
1 6UJY HIS A 8   ? UNP P04585 ?   ?   'expression tag'        -4  8  
1 6UJY HIS A 9   ? UNP P04585 ?   ?   'expression tag'        -3  9  
1 6UJY HIS A 10  ? UNP P04585 ?   ?   'expression tag'        -2  10 
1 6UJY SER A 11  ? UNP P04585 ?   ?   'expression tag'        -1  11 
1 6UJY SER A 12  ? UNP P04585 ?   ?   'expression tag'        0   12 
1 6UJY CYS A 270 ? UNP P04585 GLN 845 'engineered mutation'   258 13 
1 6UJY SER A 292 ? UNP P04585 CYS 867 'engineered mutation'   280 14 
2 6UJY SER B 280 ? UNP P04585 CYS 867 'engineered mutation'   280 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1RZ non-polymer         . 'Lamivudine Triphosphate'                
;Lamivudine-5'-triphosphate; 3TC Triphosphate; [[(2R,5S)-5-(4-azanyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
'C8 H14 N3 O12 P3 S' 469.196 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'       121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'    331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'     307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'    347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'     291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'    322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'      149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ? 'Mg 2'               24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'         105.093 
SO4 non-polymer         . 'SULFATE ION'                            ? 'O4 S -2'            96.063  
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'        117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UJY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.75 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.24 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2% PEG 4000, 100mM MES pH 6.0, 10mM magnesium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-10 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97395 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97395 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            40.7332583871 
_reflns.entry_id                         6UJY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.59456 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       45025 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.0 
_reflns.pdbx_Rmerge_I_obs                0.068 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.60 
_reflns_shell.d_res_low                   2.64 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2238 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.497 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               48.9837094387 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6UJY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.59456090099 
_refine.ls_d_res_low                             47.4573444442 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     41844 
_refine.ls_number_reflns_R_free                  3363 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    80.4766006316 
_refine.ls_percent_reflns_R_free                 4.79914377453 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.17995419765 
_refine.ls_R_factor_R_free                       0.233541891499 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.177288485104 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33556055346 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3KK1 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.0151723808 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.312528286529 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.59456090099 
_refine_hist.d_res_low                        47.4573444442 
_refine_hist.number_atoms_solvent             189 
_refine_hist.number_atoms_total               8756 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        7709 
_refine_hist.pdbx_number_atoms_nucleic_acid   820 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00942598790251 ? 8893  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.18612198261    ? 12250 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0475461401805  ? 1333  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00630674992081 ? 1391  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 18.3282867541    ? 3413  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5946 2.6316  . . 54  1256 36.2378976487 . . . 0.379284856387 . 0.234430601    . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6316 2.6709  . . 83  1509 43.4616434616 . . . 0.355168626347 . 0.21557607016  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6709 2.7126  . . 77  1661 48.3449235049 . . . 0.350423527643 . 0.225390791309 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7126 2.7571  . . 105 1820 52.2813688213 . . . 0.313026303666 . 0.237849001286 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7571 2.8046  . . 99  1991 58.1363004172 . . . 0.324897889119 . 0.229328128374 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8046 2.8556  . . 112 2173 63.0170987314 . . . 0.304574314008 . 0.250847164409 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8556 2.9105  . . 115 2370 68.4007707129 . . . 0.282839786741 . 0.238914565612 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9105 2.9699  . . 130 2465 71.4285714286 . . . 0.312781464343 . 0.234362241078 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9699 3.0345  . . 125 2586 75.4942912838 . . . 0.317651274281 . 0.234572334389 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0345 3.1051  . . 150 2778 80.5723720418 . . . 0.275190503263 . 0.233908553972 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1051 3.1827  . . 153 2913 84.6026490066 . . . 0.280908020104 . 0.222470558619 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1827 3.2688  . . 156 3021 87.4724669604 . . . 0.28696959115  . 0.210475091823 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2688 3.3649  . . 158 3107 90.5184363737 . . . 0.235622833649 . 0.195206396052 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3649 3.4735  . . 154 3243 93.017524644  . . . 0.236664014851 . 0.192394713019 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4735 3.5976  . . 163 3270 94.4689047881 . . . 0.254757175113 . 0.191201718566 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5976 3.7416  . . 164 3341 96.9303097345 . . . 0.264022030488 . 0.181994024006 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7416 3.9118  . . 171 3353 97.8073827366 . . . 0.255635627207 . 0.169471495361 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9118 4.1179  . . 171 3457 98.8825292995 . . . 0.203676412353 . 0.154567372691 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1179 4.3758  . . 181 3399 99.1140642303 . . . 0.190180422788 . 0.142458599342 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3758 4.7133  . . 157 3393 97.6884975234 . . . 0.197625021076 . 0.141332191582 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7133 5.1871  . . 170 3428 99.3099641181 . . . 0.209420133231 . 0.13617685348  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1871 5.9365  . . 171 3421 99.1443555065 . . . 0.234250022497 . 0.155704510401 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.9365 7.4747  . . 179 3397 98.4310487201 . . . 0.172598748373 . 0.169099922479 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.4747 47.4573 . . 165 3360 96.9471947195 . . . 0.174331264832 . 0.160467874986 . . . . . . . . . . . 
# 
_struct.entry_id                     6UJY 
_struct.title                        'HIV-1 wild-type reverse transcriptase-DNA complex with (-)-3TC-TP' 
_struct.pdbx_descriptor              'Reverse transcriptase/RNaseH/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UJY 
_struct_keywords.text            'HIV-1 reverse transcriptase NRTI polymerase DNA complex, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 39  ? GLU A 56  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE A 89  ? THR A 96  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 108 ? LEU A 112 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 126 ? VAL A 130 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 133 ? ALA A 141 ? ASP A 121 ALA A 129 5 ? 9  
HELX_P HELX_P6  AA6 GLY A 167 ? ASN A 187 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  AA7 GLU A 206 ? TRP A 224 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 229 ? HIS A 233 ? PRO A 217 HIS A 221 5 ? 5  
HELX_P HELX_P9  AA9 VAL A 266 ? SER A 280 ? VAL A 254 SER A 268 1 ? 15 
HELX_P HELX_P10 AB1 VAL A 288 ? LEU A 295 ? VAL A 276 LEU A 283 1 ? 8  
HELX_P HELX_P11 AB2 THR A 308 ? LYS A 323 ? THR A 296 LYS A 311 1 ? 16 
HELX_P HELX_P12 AB3 ASN A 375 ? GLY A 396 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 AB4 GLN A 406 ? TYR A 417 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 AB5 THR A 485 ? ASP A 500 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P15 AB6 SER A 511 ? ALA A 520 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 AB7 SER A 527 ? LYS A 540 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 GLY A 556 ? ALA A 566 ? GLY A 544 ALA A 554 1 ? 11 
HELX_P HELX_P18 AB9 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 77  ? THR B 84  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P20 AC2 PRO B 97  ? LYS B 102 ? PRO B 97  LYS B 102 5 ? 6  
HELX_P HELX_P21 AC3 GLY B 112 ? VAL B 118 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P22 AC4 PHE B 124 ? ALA B 129 ? PHE B 124 ALA B 129 5 ? 6  
HELX_P HELX_P23 AC5 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P24 AC6 LYS B 154 ? ASN B 175 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P25 AC7 GLY B 196 ? ARG B 211 ? GLY B 196 ARG B 211 1 ? 16 
HELX_P HELX_P26 AC8 VAL B 254 ? SER B 268 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P27 AC9 VAL B 276 ? LEU B 282 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P28 AD1 THR B 296 ? LEU B 310 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P29 AD2 ASN B 363 ? GLY B 384 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P30 AD3 GLN B 394 ? TRP B 402 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P31 AD4 THR B 403 ? TYR B 405 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P32 AD5 PRO B 420 ? TYR B 427 ? PRO B 420 TYR B 427 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 122 OD2   ? ? ? 1_555 H MG  .  MG ? ? A ASP 110 A MG  604 1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc2  metalc ?    ? A VAL 123 O     ? ? ? 1_555 H MG  .  MG ? ? A VAL 111 A MG  604 1_555 ? ? ? ? ? ? ?            2.044 ? 
metalc3  metalc ?    ? A ASP 197 OD2   ? ? ? 1_555 H MG  .  MG ? ? A ASP 185 A MG  604 1_555 ? ? ? ? ? ? ?            2.358 ? 
covale1  covale both ? C DC  20  "O3'" ? ? ? 1_555 C DOC 21 P  ? ? P DC  821 P DOC 822 1_555 ? ? ? ? ? ? ?            1.591 ? 
metalc4  metalc ?    ? E 1RZ .   O3G   B ? ? 1_555 H MG  .  MG ? ? A 1RZ 601 A MG  604 1_555 ? ? ? ? ? ? ?            2.612 ? 
metalc5  metalc ?    ? E 1RZ .   O1B   A ? ? 1_555 H MG  .  MG ? ? A 1RZ 601 A MG  604 1_555 ? ? ? ? ? ? ?            2.071 ? 
metalc6  metalc ?    ? E 1RZ .   O2A   A ? ? 1_555 H MG  .  MG ? ? A 1RZ 601 A MG  604 1_555 ? ? ? ? ? ? ?            2.453 ? 
metalc7  metalc ?    ? E 1RZ .   O2C   A ? ? 1_555 H MG  .  MG ? ? A 1RZ 601 A MG  604 1_555 ? ? ? ? ? ? ?            2.711 ? 
hydrog1  hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4 ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6 ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2 ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2 ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2 ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6 ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4 ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6 ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6 ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2 ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4 ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4 ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? C DG  16  N1    ? ? ? 1_555 D DC  11 N3 ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? C DG  16  N2    ? ? ? 1_555 D DC  11 O2 ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? C DG  16  O6    ? ? ? 1_555 D DC  11 N4 ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2 ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4 ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2 ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2 ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? C DOC 21  N3    ? ? ? 1_555 D DG  6  N1 ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? C DOC 21  N4    ? ? ? 1_555 D DG  6  O6 ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? C DOC 21  O2    ? ? ? 1_555 D DG  6  N2 ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 237 A . ? PRO 225 A PRO 238 A ? PRO 226 A 1 -2.30 
2 PRO 432 A . ? PRO 420 A PRO 433 A ? PRO 421 A 1 -2.55 
3 GLY 555 A . ? GLY 543 A GLY 556 A ? GLY 544 A 1 3.84  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 5 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 2 ? 
AB4 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 59  ? LYS A 61  ? ILE A 47  LYS A 49  
AA1 2 ARG A 155 ? TYR A 158 ? ARG A 143 TYR A 146 
AA1 3 PHE A 142 ? THR A 143 ? PHE A 130 THR A 131 
AA2 1 VAL A 72  ? LYS A 76  ? VAL A 60  LYS A 64  
AA2 2 TRP A 83  ? VAL A 87  ? TRP A 71  VAL A 75  
AA3 1 SER A 117 ? ASP A 122 ? SER A 105 ASP A 110 
AA3 2 ASP A 198 ? SER A 203 ? ASP A 186 SER A 191 
AA3 3 VAL A 191 ? TYR A 195 ? VAL A 179 TYR A 183 
AA4 1 PHE A 239 ? TRP A 241 ? PHE A 227 TRP A 229 
AA4 2 TYR A 244 ? LEU A 246 ? TYR A 232 LEU A 234 
AA4 3 TRP A 251 ? VAL A 253 ? TRP A 239 VAL A 241 
AA5 1 TRP A 264 ? THR A 265 ? TRP A 252 THR A 253 
AA5 2 VAL A 304 ? ILE A 305 ? VAL A 292 ILE A 293 
AA6 1 LYS A 359 ? TYR A 366 ? LYS A 347 TYR A 354 
AA6 2 TRP A 349 ? GLU A 356 ? TRP A 337 GLU A 344 
AA6 3 ILE A 338 ? LYS A 343 ? ILE A 326 LYS A 331 
AA6 4 LYS A 400 ? LEU A 403 ? LYS A 388 LEU A 391 
AA6 5 TRP A 426 ? PHE A 428 ? TRP A 414 PHE A 416 
AA7 1 HIS A 373 ? THR A 374 ? HIS A 361 THR A 362 
AA7 2 GLN A 524 ? SER A 525 ? GLN A 512 SER A 513 
AA8 1 GLN A 476 ? LEU A 481 ? GLN A 464 LEU A 469 
AA8 2 GLY A 465 ? THR A 471 ? GLY A 453 THR A 459 
AA8 3 GLU A 450 ? ALA A 458 ? GLU A 438 ALA A 446 
AA8 4 GLU A 504 ? THR A 509 ? GLU A 492 THR A 497 
AA8 5 LYS A 542 ? TRP A 547 ? LYS A 530 TRP A 535 
AA9 1 ILE B 47  ? ILE B 50  ? ILE B 47  ILE B 50  
AA9 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
AA9 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
AB1 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
AB1 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
AB2 1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
AB2 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
AB2 3 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
AB3 1 TRP B 252 ? THR B 253 ? TRP B 252 THR B 253 
AB3 2 VAL B 292 ? ILE B 293 ? VAL B 292 ILE B 293 
AB4 1 ASN B 348 ? ALA B 355 ? ASN B 348 ALA B 355 
AB4 2 GLN B 336 ? TYR B 342 ? GLN B 336 TYR B 342 
AB4 3 ILE B 326 ? GLY B 333 ? ILE B 326 GLY B 333 
AB4 4 LYS B 388 ? LEU B 391 ? LYS B 388 LEU B 391 
AB4 5 TRP B 414 ? PHE B 416 ? TRP B 414 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 60  ? N SER A 48  O GLN A 157 ? O GLN A 145 
AA1 2 3 O TYR A 156 ? O TYR A 144 N PHE A 142 ? N PHE A 130 
AA2 1 2 N ILE A 75  ? N ILE A 63  O ARG A 84  ? O ARG A 72  
AA3 1 2 N THR A 119 ? N THR A 107 O VAL A 201 ? O VAL A 189 
AA3 2 3 O GLY A 202 ? O GLY A 190 N VAL A 191 ? N VAL A 179 
AA4 1 2 N PHE A 239 ? N PHE A 227 O LEU A 246 ? O LEU A 234 
AA4 2 3 N GLU A 245 ? N GLU A 233 O THR A 252 ? O THR A 240 
AA5 1 2 N TRP A 264 ? N TRP A 252 O ILE A 305 ? O ILE A 293 
AA6 1 2 O LYS A 362 ? O LYS A 350 N ILE A 353 ? N ILE A 341 
AA6 2 3 O TYR A 354 ? O TYR A 342 N ILE A 338 ? N ILE A 326 
AA6 3 4 N ALA A 339 ? N ALA A 327 O LYS A 400 ? O LYS A 388 
AA6 4 5 N LEU A 403 ? N LEU A 391 O GLU A 427 ? O GLU A 415 
AA7 1 2 N THR A 374 ? N THR A 362 O GLN A 524 ? O GLN A 512 
AA8 1 2 O VAL A 479 ? O VAL A 467 N ALA A 467 ? N ALA A 455 
AA8 2 3 O VAL A 470 ? O VAL A 458 N TYR A 453 ? N TYR A 441 
AA8 3 4 N PHE A 452 ? N PHE A 440 O ASN A 506 ? O ASN A 494 
AA8 4 5 N ILE A 507 ? N ILE A 495 O TYR A 544 ? O TYR A 532 
AA9 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
AA9 2 3 O ILE B 142 ? O ILE B 142 N ILE B 132 ? N ILE B 132 
AB1 1 2 N ILE B 63  ? N ILE B 63  O ARG B 72  ? O ARG B 72  
AB2 1 2 N THR B 107 ? N THR B 107 O VAL B 189 ? O VAL B 189 
AB2 2 3 O TYR B 188 ? O TYR B 188 N TYR B 181 ? N TYR B 181 
AB3 1 2 N TRP B 252 ? N TRP B 252 O ILE B 293 ? O ILE B 293 
AB4 1 2 O LEU B 349 ? O LEU B 349 N ILE B 341 ? N ILE B 341 
AB4 2 3 O THR B 338 ? O THR B 338 N GLN B 330 ? N GLN B 330 
AB4 3 4 N ALA B 327 ? N ALA B 327 O LYS B 388 ? O LYS B 388 
AB4 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 1RZ 601 ? 15 'binding site for residue 1RZ A 601' 
AC2 Software A SO4 602 ? 7  'binding site for residue SO4 A 602' 
AC3 Software A SO4 603 ? 4  'binding site for residue SO4 A 603' 
AC4 Software A MG  604 ? 4  'binding site for residue MG A 604'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 LYS A 77  ? LYS A 65  . ? 1_555 ? 
2  AC1 15 ARG A 84  ? ARG A 72  . ? 1_555 ? 
3  AC1 15 ASP A 122 ? ASP A 110 . ? 1_555 ? 
4  AC1 15 VAL A 123 ? VAL A 111 . ? 1_555 ? 
5  AC1 15 GLY A 124 ? GLY A 112 . ? 1_555 ? 
6  AC1 15 ASP A 125 ? ASP A 113 . ? 1_555 ? 
7  AC1 15 ALA A 126 ? ALA A 114 . ? 1_555 ? 
8  AC1 15 TYR A 127 ? TYR A 115 . ? 1_555 ? 
9  AC1 15 GLN A 163 ? GLN A 151 . ? 1_555 ? 
10 AC1 15 ASP A 197 ? ASP A 185 . ? 1_555 ? 
11 AC1 15 LYS A 232 ? LYS A 220 . ? 1_555 ? 
12 AC1 15 MG  H .   ? MG  A 604 . ? 1_555 ? 
13 AC1 15 DOC C 21  ? DOC P 822 . ? 1_555 ? 
14 AC1 15 DG  D 5   ? DG  T 705 . ? 1_555 ? 
15 AC1 15 DG  D 6   ? DG  T 706 . ? 1_555 ? 
16 AC2 7  ARG A 218 ? ARG A 206 . ? 7_444 ? 
17 AC2 7  GLY A 448 ? GLY A 436 . ? 1_555 ? 
18 AC2 7  ALA A 449 ? ALA A 437 . ? 1_555 ? 
19 AC2 7  ASN A 472 ? ASN A 460 . ? 1_555 ? 
20 AC2 7  ARG A 473 ? ARG A 461 . ? 1_555 ? 
21 AC2 7  HOH I .   ? HOH A 713 . ? 1_555 ? 
22 AC2 7  ALA B 288 ? ALA B 288 . ? 1_555 ? 
23 AC3 4  GLU A 340 ? GLU A 328 . ? 1_555 ? 
24 AC3 4  GLN A 352 ? GLN A 340 . ? 1_555 ? 
25 AC3 4  HOH I .   ? HOH A 708 . ? 1_555 ? 
26 AC3 4  THR B 200 ? THR B 200 . ? 6_444 ? 
27 AC4 4  ASP A 122 ? ASP A 110 . ? 1_555 ? 
28 AC4 4  VAL A 123 ? VAL A 111 . ? 1_555 ? 
29 AC4 4  ASP A 197 ? ASP A 185 . ? 1_555 ? 
30 AC4 4  1RZ E .   ? 1RZ A 601 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UJY 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005999 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005900 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009731 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG ? ? 9.41153 2.53737 2.59044  63.03566 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135 5.44231 1.42069  35.72801 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 13  ? -43.85900 10.60400  -16.44900 1.000 49.59000  ? 1   PRO A N     1 
ATOM   2    C  CA    . PRO A 1 13  ? -42.91700 11.00800  -15.39500 1.000 59.87000  ? 1   PRO A CA    1 
ATOM   3    C  C     . PRO A 1 13  ? -41.76900 10.01100  -15.28600 1.000 53.55000  ? 1   PRO A C     1 
ATOM   4    O  O     . PRO A 1 13  ? -41.99300 8.82500   -15.51800 1.000 53.64000  ? 1   PRO A O     1 
ATOM   5    C  CB    . PRO A 1 13  ? -43.77600 11.01000  -14.10800 1.000 48.97000  ? 1   PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 13  ? -45.07100 10.25500  -14.47100 1.000 52.83000  ? 1   PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 13  ? -44.92900 9.75000   -15.91000 1.000 56.12000  ? 1   PRO A CD    1 
ATOM   8    N  N     . ILE A 1 14  ? -40.57100 10.48300  -14.94300 1.000 51.43000  ? 2   ILE A N     1 
ATOM   9    C  CA    . ILE A 1 14  ? -39.38900 9.62100   -14.86700 1.000 48.83000  ? 2   ILE A CA    1 
ATOM   10   C  C     . ILE A 1 14  ? -39.23000 9.03200   -13.46600 1.000 48.66000  ? 2   ILE A C     1 
ATOM   11   O  O     . ILE A 1 14  ? -39.21000 9.78100   -12.48900 1.000 52.57000  ? 2   ILE A O     1 
ATOM   12   C  CB    . ILE A 1 14  ? -38.09900 10.40300  -15.25300 1.000 50.76000  ? 2   ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 14  ? -38.08900 10.74600  -16.74600 1.000 50.19000  ? 2   ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 14  ? -36.84500 9.62100   -14.90100 1.000 37.03000  ? 2   ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 14  ? -36.90000 11.61100  -17.15100 1.000 47.10000  ? 2   ILE A CD1   1 
ATOM   16   N  N     . SER A 1 15  ? -39.13400 7.70000   -13.37600 1.000 43.52000  ? 3   SER A N     1 
ATOM   17   C  CA    . SER A 1 15  ? -38.86600 6.98700   -12.11600 1.000 45.46000  ? 3   SER A CA    1 
ATOM   18   C  C     . SER A 1 15  ? -37.62900 7.52500   -11.34400 1.000 49.95000  ? 3   SER A C     1 
ATOM   19   O  O     . SER A 1 15  ? -36.56500 7.75000   -11.94600 1.000 40.30000  ? 3   SER A O     1 
ATOM   20   C  CB    . SER A 1 15  ? -38.67800 5.48300   -12.41000 1.000 49.60000  ? 3   SER A CB    1 
ATOM   21   O  OG    . SER A 1 15  ? -38.67100 4.66900   -11.24500 1.000 39.55000  ? 3   SER A OG    1 
ATOM   22   N  N     . PRO A 1 16  ? -37.77400 7.72800   -10.00600 1.000 49.60000  ? 4   PRO A N     1 
ATOM   23   C  CA    . PRO A 1 16  ? -36.65700 7.95800   -9.08900  1.000 37.50000  ? 4   PRO A CA    1 
ATOM   24   C  C     . PRO A 1 16  ? -35.99700 6.63900   -8.71600  1.000 38.94000  ? 4   PRO A C     1 
ATOM   25   O  O     . PRO A 1 16  ? -35.56800 6.48100   -7.57900  1.000 41.65000  ? 4   PRO A O     1 
ATOM   26   C  CB    . PRO A 1 16  ? -37.33900 8.54400   -7.87200  1.000 36.57000  ? 4   PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 16  ? -38.58700 7.77400   -7.80800  1.000 29.82000  ? 4   PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 16  ? -39.04500 7.67700   -9.25400  1.000 41.68000  ? 4   PRO A CD    1 
ATOM   29   N  N     . ILE A 1 17  ? -35.97500 5.68200   -9.63700  1.000 45.00000  ? 5   ILE A N     1 
ATOM   30   C  CA    . ILE A 1 17  ? -35.28500 4.42900   -9.39300  1.000 41.26000  ? 5   ILE A CA    1 
ATOM   31   C  C     . ILE A 1 17  ? -33.82900 4.65800   -9.72500  1.000 39.73000  ? 5   ILE A C     1 
ATOM   32   O  O     . ILE A 1 17  ? -33.50900 5.46600   -10.60900 1.000 38.40000  ? 5   ILE A O     1 
ATOM   33   C  CB    . ILE A 1 17  ? -35.86100 3.27200   -10.22600 1.000 43.31000  ? 5   ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 17  ? -35.15200 1.95100   -9.88200  1.000 55.95000  ? 5   ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 17  ? -35.77700 3.57800   -11.70400 1.000 40.28000  ? 5   ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 17  ? -35.77300 0.69700   -10.53300 1.000 46.64000  ? 5   ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 18  ? -32.95300 3.99500   -8.97900  1.000 33.88000  ? 6   GLU A N     1 
ATOM   38   C  CA    . GLU A 1 18  ? -31.53700 4.06700   -9.24600  1.000 34.47000  ? 6   GLU A CA    1 
ATOM   39   C  C     . GLU A 1 18  ? -31.30900 3.52300   -10.64400 1.000 35.86000  ? 6   GLU A C     1 
ATOM   40   O  O     . GLU A 1 18  ? -31.96300 2.55100   -11.04400 1.000 40.10000  ? 6   GLU A O     1 
ATOM   41   C  CB    . GLU A 1 18  ? -30.74800 3.27500   -8.20000  1.000 43.45000  ? 6   GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 18  ? -31.11700 3.66600   -6.76400  1.000 57.61000  ? 6   GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 18  ? -30.15800 3.10400   -5.72000  1.000 77.17000  ? 6   GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 18  ? -30.48300 3.17200   -4.50900  1.000 71.32000  ? 6   GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 18  ? -29.08000 2.60000   -6.11500  1.000 81.53000  ? 6   GLU A OE2   1 
ATOM   46   N  N     . THR A 1 19  ? -30.41700 4.16600   -11.39400 1.000 31.43000  ? 7   THR A N     1 
ATOM   47   C  CA    . THR A 1 19  ? -30.04500 3.70500   -12.72400 1.000 29.91000  ? 7   THR A CA    1 
ATOM   48   C  C     . THR A 1 19  ? -29.27300 2.40500   -12.62700 1.000 36.09000  ? 7   THR A C     1 
ATOM   49   O  O     . THR A 1 19  ? -28.76400 2.07300   -11.56700 1.000 42.70000  ? 7   THR A O     1 
ATOM   50   C  CB    . THR A 1 19  ? -29.18000 4.73200   -13.46500 1.000 35.79000  ? 7   THR A CB    1 
ATOM   51   O  OG1   . THR A 1 19  ? -28.02600 5.05400   -12.66500 1.000 31.48000  ? 7   THR A OG1   1 
ATOM   52   C  CG2   . THR A 1 19  ? -29.99400 5.98400   -13.77600 1.000 34.57000  ? 7   THR A CG2   1 
ATOM   53   N  N     . VAL A 1 20  ? -29.16500 1.67800   -13.73400 1.000 33.55000  ? 8   VAL A N     1 
ATOM   54   C  CA    . VAL A 1 20  ? -28.36600 0.46500   -13.76500 1.000 31.43000  ? 8   VAL A CA    1 
ATOM   55   C  C     . VAL A 1 20  ? -27.05700 0.74000   -14.50400 1.000 35.78000  ? 8   VAL A C     1 
ATOM   56   O  O     . VAL A 1 20  ? -27.07300 1.11600   -15.67600 1.000 39.08000  ? 8   VAL A O     1 
ATOM   57   C  CB    . VAL A 1 20  ? -29.14200 -0.68200  -14.43600 1.000 34.68000  ? 8   VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 20  ? -28.22700 -1.87700  -14.73100 1.000 35.97000  ? 8   VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 20  ? -30.35000 -1.08500  -13.57000 1.000 34.90000  ? 8   VAL A CG2   1 
ATOM   60   N  N     . PRO A 1 21  ? -25.91500 0.55300   -13.82500 1.000 41.48000  ? 9   PRO A N     1 
ATOM   61   C  CA    . PRO A 1 21  ? -24.62000 0.94200   -14.41200 1.000 41.26000  ? 9   PRO A CA    1 
ATOM   62   C  C     . PRO A 1 21  ? -24.19100 0.04500   -15.58400 1.000 39.74000  ? 9   PRO A C     1 
ATOM   63   O  O     . PRO A 1 21  ? -24.15400 -1.18500  -15.46200 1.000 39.95000  ? 9   PRO A O     1 
ATOM   64   C  CB    . PRO A 1 21  ? -23.65400 0.80700   -13.23100 1.000 33.16000  ? 9   PRO A CB    1 
ATOM   65   C  CG    . PRO A 1 21  ? -24.26600 -0.30600  -12.39800 1.000 32.74000  ? 9   PRO A CG    1 
ATOM   66   C  CD    . PRO A 1 21  ? -25.75800 -0.08900  -12.50500 1.000 38.69000  ? 9   PRO A CD    1 
ATOM   67   N  N     . VAL A 1 22  ? -23.84500 0.67900   -16.70100 1.000 42.69000  ? 10  VAL A N     1 
ATOM   68   C  CA    . VAL A 1 22  ? -23.52900 -0.01900  -17.94100 1.000 36.39000  ? 10  VAL A CA    1 
ATOM   69   C  C     . VAL A 1 22  ? -22.29200 0.52600   -18.63700 1.000 40.48000  ? 10  VAL A C     1 
ATOM   70   O  O     . VAL A 1 22  ? -22.09200 1.73000   -18.70100 1.000 48.95000  ? 10  VAL A O     1 
ATOM   71   C  CB    . VAL A 1 22  ? -24.68900 0.07100   -18.90700 1.000 38.60000  ? 10  VAL A CB    1 
ATOM   72   C  CG1   . VAL A 1 22  ? -25.77600 -0.90100  -18.49600 1.000 45.47000  ? 10  VAL A CG1   1 
ATOM   73   C  CG2   . VAL A 1 22  ? -25.22100 1.49400   -18.91800 1.000 40.34000  ? 10  VAL A CG2   1 
ATOM   74   N  N     . LYS A 1 23  ? -21.46900 -0.36700  -19.16800 1.000 43.00000  ? 11  LYS A N     1 
ATOM   75   C  CA    . LYS A 1 23  ? -20.25100 0.03000   -19.85700 1.000 43.68000  ? 11  LYS A CA    1 
ATOM   76   C  C     . LYS A 1 23  ? -20.23300 -0.45600  -21.30000 1.000 48.24000  ? 11  LYS A C     1 
ATOM   77   O  O     . LYS A 1 23  ? -20.92000 -1.42900  -21.63600 1.000 42.94000  ? 11  LYS A O     1 
ATOM   78   C  CB    . LYS A 1 23  ? -19.03300 -0.52000  -19.12600 1.000 40.93000  ? 11  LYS A CB    1 
ATOM   79   C  CG    . LYS A 1 23  ? -18.88500 0.00600   -17.71700 1.000 48.50000  ? 11  LYS A CG    1 
ATOM   80   C  CD    . LYS A 1 23  ? -18.76000 -1.14900  -16.72200 1.000 71.19000  ? 11  LYS A CD    1 
ATOM   81   C  CE    . LYS A 1 23  ? -17.83000 -2.25900  -17.23500 1.000 67.57000  ? 11  LYS A CE    1 
ATOM   82   N  NZ    . LYS A 1 23  ? -17.68700 -3.41100  -16.28400 1.000 60.58000  ? 11  LYS A NZ    1 
ATOM   83   N  N     . LEU A 1 24  ? -19.45400 0.22100   -22.14900 1.000 44.98000  ? 12  LEU A N     1 
ATOM   84   C  CA    . LEU A 1 24  ? -19.10000 -0.31500  -23.46200 1.000 41.97000  ? 12  LEU A CA    1 
ATOM   85   C  C     . LEU A 1 24  ? -18.20800 -1.53400  -23.25100 1.000 38.81000  ? 12  LEU A C     1 
ATOM   86   O  O     . LEU A 1 24  ? -17.66600 -1.71300  -22.16500 1.000 43.69000  ? 12  LEU A O     1 
ATOM   87   C  CB    . LEU A 1 24  ? -18.39300 0.74000   -24.31600 1.000 43.02000  ? 12  LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 24  ? -19.21000 1.98000   -24.69100 1.000 45.50000  ? 12  LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 24  ? -18.51200 2.81100   -25.75300 1.000 43.92000  ? 12  LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 24  ? -20.60900 1.58900   -25.16500 1.000 47.53000  ? 12  LEU A CD2   1 
ATOM   91   N  N     . LYS A 1 25  ? -18.08000 -2.40100  -24.25000 1.000 42.68000  ? 13  LYS A N     1 
ATOM   92   C  CA    . LYS A 1 25  ? -17.09000 -3.47400  -24.15100 1.000 49.29000  ? 13  LYS A CA    1 
ATOM   93   C  C     . LYS A 1 25  ? -15.72600 -2.80400  -24.27800 1.000 57.52000  ? 13  LYS A C     1 
ATOM   94   O  O     . LYS A 1 25  ? -15.61000 -1.79500  -24.97400 1.000 60.32000  ? 13  LYS A O     1 
ATOM   95   C  CB    . LYS A 1 25  ? -17.27600 -4.53900  -25.23500 1.000 47.05000  ? 13  LYS A CB    1 
ATOM   96   C  CG    . LYS A 1 25  ? -18.59200 -5.29700  -25.18500 1.000 56.05000  ? 13  LYS A CG    1 
ATOM   97   C  CD    . LYS A 1 25  ? -18.54500 -6.54600  -26.08200 1.000 49.80000  ? 13  LYS A CD    1 
ATOM   98   C  CE    . LYS A 1 25  ? -19.84300 -7.36500  -26.03200 1.000 50.57000  ? 13  LYS A CE    1 
ATOM   99   N  NZ    . LYS A 1 25  ? -19.57600 -8.84500  -25.86400 1.000 50.49000  ? 13  LYS A NZ    1 
ATOM   100  N  N     . PRO A 1 26  ? -14.69400 -3.35600  -23.62400 1.000 54.28000  ? 14  PRO A N     1 
ATOM   101  C  CA    . PRO A 1 26  ? -13.38000 -2.70300  -23.59100 1.000 54.75000  ? 14  PRO A CA    1 
ATOM   102  C  C     . PRO A 1 26  ? -12.81700 -2.34800  -24.97000 1.000 62.25000  ? 14  PRO A C     1 
ATOM   103  O  O     . PRO A 1 26  ? -13.21400 -2.92300  -25.99700 1.000 56.23000  ? 14  PRO A O     1 
ATOM   104  C  CB    . PRO A 1 26  ? -12.49100 -3.74000  -22.91100 1.000 50.20000  ? 14  PRO A CB    1 
ATOM   105  C  CG    . PRO A 1 26  ? -13.43200 -4.59100  -22.11500 1.000 62.80000  ? 14  PRO A CG    1 
ATOM   106  C  CD    . PRO A 1 26  ? -14.68900 -4.65100  -22.92300 1.000 61.23000  ? 14  PRO A CD    1 
ATOM   107  N  N     . GLY A 1 27  ? -11.91400 -1.36800  -24.97100 1.000 61.52000  ? 15  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 27  ? -11.21300 -0.93300  -26.16500 1.000 60.75000  ? 15  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 27  ? -12.13100 -0.37900  -27.23100 1.000 63.66000  ? 15  GLY A C     1 
ATOM   110  O  O     . GLY A 1 27  ? -11.73400 -0.19300  -28.38600 1.000 67.62000  ? 15  GLY A O     1 
ATOM   111  N  N     . MET A 1 28  ? -13.37100 -0.10800  -26.85300 1.000 65.28000  ? 16  MET A N     1 
ATOM   112  C  CA    . MET A 1 28  ? -14.36000 0.27200   -27.84300 1.000 61.06000  ? 16  MET A CA    1 
ATOM   113  C  C     . MET A 1 28  ? -15.04000 1.57600   -27.50400 1.000 57.81000  ? 16  MET A C     1 
ATOM   114  O  O     . MET A 1 28  ? -15.04400 2.02300   -26.35400 1.000 55.31000  ? 16  MET A O     1 
ATOM   115  C  CB    . MET A 1 28  ? -15.38400 -0.84500  -28.01900 1.000 59.72000  ? 16  MET A CB    1 
ATOM   116  C  CG    . MET A 1 28  ? -14.84500 -1.92800  -28.91100 1.000 61.03000  ? 16  MET A CG    1 
ATOM   117  S  SD    . MET A 1 28  ? -15.95700 -3.30300  -29.10100 1.000 91.98000  ? 16  MET A SD    1 
ATOM   118  C  CE    . MET A 1 28  ? -15.93500 -3.52200  -30.88200 1.000 79.27000  ? 16  MET A CE    1 
ATOM   119  N  N     . ASP A 1 29  ? -15.60600 2.18900   -28.53000 1.000 55.51000  ? 17  ASP A N     1 
ATOM   120  C  CA    . ASP A 1 29  ? -16.10700 3.53500   -28.40000 1.000 57.95000  ? 17  ASP A CA    1 
ATOM   121  C  C     . ASP A 1 29  ? -17.44000 3.66500   -29.13300 1.000 58.67000  ? 17  ASP A C     1 
ATOM   122  O  O     . ASP A 1 29  ? -17.72500 2.90700   -30.06100 1.000 57.37000  ? 17  ASP A O     1 
ATOM   123  C  CB    . ASP A 1 29  ? -15.06600 4.52300   -28.93200 1.000 56.39000  ? 17  ASP A CB    1 
ATOM   124  C  CG    . ASP A 1 29  ? -15.54300 5.94700   -28.88000 1.000 65.69000  ? 17  ASP A CG    1 
ATOM   125  O  OD1   . ASP A 1 29  ? -15.77200 6.43500   -27.74600 1.000 61.08000  ? 17  ASP A OD1   1 
ATOM   126  O  OD2   . ASP A 1 29  ? -15.69300 6.56000   -29.97000 1.000 64.94000  ? 17  ASP A OD2   1 
ATOM   127  N  N     . GLY A 1 30  ? -18.25100 4.62500   -28.69800 1.000 59.38000  ? 18  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 30  ? -19.58800 4.83600   -29.22500 1.000 59.80000  ? 18  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 30  ? -19.71600 4.88200   -30.73500 1.000 58.08000  ? 18  GLY A C     1 
ATOM   130  O  O     . GLY A 1 30  ? -18.73600 5.08900   -31.44100 1.000 62.71000  ? 18  GLY A O     1 
ATOM   131  N  N     . PRO A 1 31  ? -20.94300 4.68900   -31.23700 1.000 62.56000  ? 19  PRO A N     1 
ATOM   132  C  CA    . PRO A 1 31  ? -21.18700 4.63200   -32.67700 1.000 60.11000  ? 19  PRO A CA    1 
ATOM   133  C  C     . PRO A 1 31  ? -21.11200 6.00700   -33.34700 1.000 63.37000  ? 19  PRO A C     1 
ATOM   134  O  O     . PRO A 1 31  ? -21.61600 7.00800   -32.82000 1.000 62.86000  ? 19  PRO A O     1 
ATOM   135  C  CB    . PRO A 1 31  ? -22.60100 4.06700   -32.75100 1.000 56.24000  ? 19  PRO A CB    1 
ATOM   136  C  CG    . PRO A 1 31  ? -23.25000 4.58200   -31.51200 1.000 44.54000  ? 19  PRO A CG    1 
ATOM   137  C  CD    . PRO A 1 31  ? -22.19500 4.56500   -30.46300 1.000 50.03000  ? 19  PRO A CD    1 
ATOM   138  N  N     . LYS A 1 32  ? -20.47000 6.06000   -34.50500 1.000 64.65000  ? 20  LYS A N     1 
ATOM   139  C  CA    . LYS A 1 32  ? -20.48100 7.27600   -35.30600 1.000 61.08000  ? 20  LYS A CA    1 
ATOM   140  C  C     . LYS A 1 32  ? -21.05400 6.89500   -36.65600 1.000 69.00000  ? 20  LYS A C     1 
ATOM   141  O  O     . LYS A 1 32  ? -20.33600 6.80300   -37.65200 1.000 71.22000  ? 20  LYS A O     1 
ATOM   142  C  CB    . LYS A 1 32  ? -19.08400 7.88400   -35.42200 1.000 60.89000  ? 20  LYS A CB    1 
ATOM   143  C  CG    . LYS A 1 32  ? -18.44400 8.18400   -34.06200 1.000 62.07000  ? 20  LYS A CG    1 
ATOM   144  C  CD    . LYS A 1 32  ? -17.01600 8.69200   -34.17000 1.000 57.09000  ? 20  LYS A CD    1 
ATOM   145  C  CE    . LYS A 1 32  ? -16.20900 8.29800   -32.93900 1.000 59.93000  ? 20  LYS A CE    1 
ATOM   146  N  NZ    . LYS A 1 32  ? -15.29900 9.38600   -32.49600 1.000 58.78000  ? 20  LYS A NZ    1 
ATOM   147  N  N     . VAL A 1 33  ? -22.35900 6.63600   -36.65200 1.000 65.76000  ? 21  VAL A N     1 
ATOM   148  C  CA    . VAL A 1 33  ? -23.09700 6.19800   -37.82800 1.000 62.32000  ? 21  VAL A CA    1 
ATOM   149  C  C     . VAL A 1 33  ? -24.08700 7.28000   -38.21100 1.000 61.03000  ? 21  VAL A C     1 
ATOM   150  O  O     . VAL A 1 33  ? -24.77200 7.83400   -37.35700 1.000 66.32000  ? 21  VAL A O     1 
ATOM   151  C  CB    . VAL A 1 33  ? -23.82300 4.87000   -37.56700 1.000 62.09000  ? 21  VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 33  ? -24.75200 4.52400   -38.72300 1.000 57.66000  ? 21  VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 33  ? -22.80000 3.75700   -37.29500 1.000 58.71000  ? 21  VAL A CG2   1 
ATOM   154  N  N     . LYS A 1 34  ? -24.16800 7.58100   -39.49700 1.000 66.70000  ? 22  LYS A N     1 
ATOM   155  C  CA    . LYS A 1 34  ? -24.80100 8.81800   -39.92800 1.000 74.22000  ? 22  LYS A CA    1 
ATOM   156  C  C     . LYS A 1 34  ? -26.28400 8.65700   -40.22000 1.000 68.03000  ? 22  LYS A C     1 
ATOM   157  O  O     . LYS A 1 34  ? -26.67100 7.67300   -40.85200 1.000 67.27000  ? 22  LYS A O     1 
ATOM   158  C  CB    . LYS A 1 34  ? -24.05900 9.34400   -41.14900 1.000 72.66000  ? 22  LYS A CB    1 
ATOM   159  C  CG    . LYS A 1 34  ? -22.59900 9.62300   -40.80500 1.000 77.62000  ? 22  LYS A CG    1 
ATOM   160  C  CD    . LYS A 1 34  ? -22.54300 10.56100  -39.59800 1.000 76.66000  ? 22  LYS A CD    1 
ATOM   161  C  CE    . LYS A 1 34  ? -21.14000 10.90000  -39.18200 1.000 73.40000  ? 22  LYS A CE    1 
ATOM   162  N  NZ    . LYS A 1 34  ? -21.20800 11.94400  -38.13600 1.000 81.82000  ? 22  LYS A NZ    1 
ATOM   163  N  N     . GLN A 1 35  ? -27.10600 9.60300   -39.75200 1.000 62.66000  ? 23  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 35  ? -28.55800 9.56300   -39.97200 1.000 62.50000  ? 23  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 35  ? -28.89900 9.20300   -41.40700 1.000 67.60000  ? 23  GLN A C     1 
ATOM   166  O  O     . GLN A 1 35  ? -28.08500 9.36900   -42.30800 1.000 80.36000  ? 23  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 35  ? -29.19600 10.90400  -39.62900 1.000 62.07000  ? 23  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 35  ? -30.71700 10.87100  -39.53700 1.000 64.76000  ? 23  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 35  ? -31.20000 9.83800   -38.51700 1.000 71.99000  ? 23  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 35  ? -32.09800 9.04300   -38.82100 1.000 57.61000  ? 23  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 35  ? -30.60900 9.85900   -37.28300 1.000 60.84000  ? 23  GLN A NE2   1 
ATOM   172  N  N     . TRP A 1 36  ? -30.09500 8.68200   -41.62500 1.000 70.53000  ? 24  TRP A N     1 
ATOM   173  C  CA    . TRP A 1 36  ? -30.50200 8.25000   -42.97800 1.000 80.92000  ? 24  TRP A CA    1 
ATOM   174  C  C     . TRP A 1 36  ? -31.73000 9.03500   -43.45400 1.000 84.43000  ? 24  TRP A C     1 
ATOM   175  O  O     . TRP A 1 36  ? -32.42900 9.61000   -42.59600 1.000 82.45000  ? 24  TRP A O     1 
ATOM   176  C  CB    . TRP A 1 36  ? -30.79100 6.73900   -42.97400 1.000 85.09000  ? 24  TRP A CB    1 
ATOM   177  C  CG    . TRP A 1 36  ? -31.59100 6.25600   -41.79800 1.000 91.49000  ? 24  TRP A CG    1 
ATOM   178  C  CD1   . TRP A 1 36  ? -32.53600 6.96500   -41.08000 1.000 92.49000  ? 24  TRP A CD1   1 
ATOM   179  C  CD2   . TRP A 1 36  ? -31.49700 4.97300   -41.17600 1.000 88.49000  ? 24  TRP A CD2   1 
ATOM   180  N  NE1   . TRP A 1 36  ? -33.03400 6.18800   -40.06300 1.000 101.71000 ? 24  TRP A NE1   1 
ATOM   181  C  CE2   . TRP A 1 36  ? -32.41700 4.96200   -40.10100 1.000 99.19000  ? 24  TRP A CE2   1 
ATOM   182  C  CE3   . TRP A 1 36  ? -30.73400 3.82600   -41.42500 1.000 76.40000  ? 24  TRP A CE3   1 
ATOM   183  C  CZ2   . TRP A 1 36  ? -32.58200 3.85000   -39.27500 1.000 94.31000  ? 24  TRP A CZ2   1 
ATOM   184  C  CZ3   . TRP A 1 36  ? -30.91100 2.72100   -40.60700 1.000 78.79000  ? 24  TRP A CZ3   1 
ATOM   185  C  CH2   . TRP A 1 36  ? -31.82600 2.74100   -39.55000 1.000 89.33000  ? 24  TRP A CH2   1 
ATOM   186  N  N     . PRO A 1 37  ? -32.00500 9.08400   -44.76200 1.000 89.53000  ? 25  PRO A N     1 
ATOM   187  C  CA    . PRO A 1 37  ? -33.20300 9.82600   -45.14600 1.000 82.53000  ? 25  PRO A CA    1 
ATOM   188  C  C     . PRO A 1 37  ? -34.44400 9.35000   -44.42400 1.000 79.09000  ? 25  PRO A C     1 
ATOM   189  O  O     . PRO A 1 37  ? -34.53000 8.19800   -44.02200 1.000 84.15000  ? 25  PRO A O     1 
ATOM   190  C  CB    . PRO A 1 37  ? -33.32400 9.57100   -46.64400 1.000 81.24000  ? 25  PRO A CB    1 
ATOM   191  C  CG    . PRO A 1 37  ? -31.94600 9.35900   -47.08800 1.000 85.76000  ? 25  PRO A CG    1 
ATOM   192  C  CD    . PRO A 1 37  ? -31.31100 8.53900   -45.92300 1.000 85.42000  ? 25  PRO A CD    1 
ATOM   193  N  N     . LEU A 1 38  ? -35.40000 10.25100  -44.26200 1.000 77.64000  ? 26  LEU A N     1 
ATOM   194  C  CA    . LEU A 1 38  ? -36.62900 9.91200   -43.56800 1.000 81.18000  ? 26  LEU A CA    1 
ATOM   195  C  C     . LEU A 1 38  ? -37.84600 10.60100  -44.19500 1.000 77.42000  ? 26  LEU A C     1 
ATOM   196  O  O     . LEU A 1 38  ? -37.80500 11.79300  -44.52400 1.000 74.92000  ? 26  LEU A O     1 
ATOM   197  C  CB    . LEU A 1 38  ? -36.51900 10.28500  -42.08500 1.000 82.67000  ? 26  LEU A CB    1 
ATOM   198  C  CG    . LEU A 1 38  ? -36.96600 9.23500   -41.07000 1.000 73.66000  ? 26  LEU A CG    1 
ATOM   199  C  CD1   . LEU A 1 38  ? -36.20000 7.92000   -41.26200 1.000 72.11000  ? 26  LEU A CD1   1 
ATOM   200  C  CD2   . LEU A 1 38  ? -36.73900 9.79000   -39.69100 1.000 67.29000  ? 26  LEU A CD2   1 
ATOM   201  N  N     . THR A 1 39  ? -38.91400 9.82500   -44.36100 1.000 73.87000  ? 27  THR A N     1 
ATOM   202  C  CA    . THR A 1 39  ? -40.22700 10.31200  -44.77400 1.000 63.40000  ? 27  THR A CA    1 
ATOM   203  C  C     . THR A 1 39  ? -40.60000 11.60500  -44.06400 1.000 73.01000  ? 27  THR A C     1 
ATOM   204  O  O     . THR A 1 39  ? -40.26300 11.80500  -42.89700 1.000 75.50000  ? 27  THR A O     1 
ATOM   205  C  CB    . THR A 1 39  ? -41.30500 9.24200   -44.48900 1.000 68.24000  ? 27  THR A CB    1 
ATOM   206  O  OG1   . THR A 1 39  ? -41.03600 8.08500   -45.28300 1.000 71.88000  ? 27  THR A OG1   1 
ATOM   207  C  CG2   . THR A 1 39  ? -42.70300 9.73900   -44.80100 1.000 71.43000  ? 27  THR A CG2   1 
ATOM   208  N  N     . GLU A 1 40  ? -41.27700 12.49100  -44.78300 1.000 75.09000  ? 28  GLU A N     1 
ATOM   209  C  CA    . GLU A 1 40  ? -41.77700 13.72600  -44.21000 1.000 71.30000  ? 28  GLU A CA    1 
ATOM   210  C  C     . GLU A 1 40  ? -42.73300 13.42900  -43.05600 1.000 74.77000  ? 28  GLU A C     1 
ATOM   211  O  O     . GLU A 1 40  ? -42.71100 14.10200  -42.01600 1.000 72.81000  ? 28  GLU A O     1 
ATOM   212  C  CB    . GLU A 1 40  ? -42.46900 14.55800  -45.29600 1.000 76.25000  ? 28  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 40  ? -43.25300 15.76700  -44.79400 1.000 74.15000  ? 28  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 40  ? -42.38600 16.76400  -44.05600 1.000 73.74000  ? 28  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 40  ? -41.15900 16.79100  -44.30700 1.000 76.31000  ? 28  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 40  ? -42.93300 17.51200  -43.21400 1.000 73.83000  ? 28  GLU A OE2   1 
ATOM   217  N  N     . GLU A 1 41  ? -43.56000 12.40400  -43.24800 1.000 76.88000  ? 29  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 41  ? -44.55200 11.99200  -42.25400 1.000 80.94000  ? 29  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 41  ? -43.90100 11.53800  -40.95100 1.000 77.32000  ? 29  GLU A C     1 
ATOM   220  O  O     . GLU A 1 41  ? -44.34900 11.89300  -39.85700 1.000 73.49000  ? 29  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 41  ? -45.42500 10.86500  -42.81300 1.000 81.72000  ? 29  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 41  ? -46.58400 10.46500  -41.91400 1.000 79.70000  ? 29  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 41  ? -47.40900 9.34900   -42.51500 1.000 86.30000  ? 29  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 41  ? -48.45400 8.98500   -41.92600 1.000 88.76000  ? 29  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 41  ? -47.00600 8.83600   -43.58200 1.000 90.56000  ? 29  GLU A OE2   1 
ATOM   226  N  N     . LYS A 1 42  ? -42.84600 10.74000  -41.09100 1.000 76.85000  ? 30  LYS A N     1 
ATOM   227  C  CA    . LYS A 1 42  ? -42.08900 10.22600  -39.95600 1.000 74.76000  ? 30  LYS A CA    1 
ATOM   228  C  C     . LYS A 1 42  ? -41.43300 11.36000  -39.17400 1.000 70.50000  ? 30  LYS A C     1 
ATOM   229  O  O     . LYS A 1 42  ? -41.47900 11.37700  -37.93500 1.000 66.44000  ? 30  LYS A O     1 
ATOM   230  C  CB    . LYS A 1 42  ? -41.03900 9.21600   -40.43600 1.000 71.80000  ? 30  LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 42  ? -41.64500 7.86600   -40.82700 1.000 73.22000  ? 30  LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 42  ? -40.65200 6.97500   -41.55200 1.000 71.61000  ? 30  LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 42  ? -41.30100 5.66500   -41.94500 1.000 70.17000  ? 30  LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 42  ? -40.41400 4.86100   -42.80300 1.000 75.78000  ? 30  LYS A NZ    1 
ATOM   235  N  N     . ILE A 1 43  ? -40.84800 12.31000  -39.90100 1.000 66.60000  ? 31  ILE A N     1 
ATOM   236  C  CA    . ILE A 1 43  ? -40.16300 13.44300  -39.27700 1.000 69.47000  ? 31  ILE A CA    1 
ATOM   237  C  C     . ILE A 1 43  ? -41.08400 14.27300  -38.38900 1.000 64.32000  ? 31  ILE A C     1 
ATOM   238  O  O     . ILE A 1 43  ? -40.66200 14.75700  -37.33300 1.000 66.40000  ? 31  ILE A O     1 
ATOM   239  C  CB    . ILE A 1 43  ? -39.53300 14.38000  -40.31800 1.000 66.14000  ? 31  ILE A CB    1 
ATOM   240  C  CG1   . ILE A 1 43  ? -38.50300 13.63100  -41.15900 1.000 69.12000  ? 31  ILE A CG1   1 
ATOM   241  C  CG2   . ILE A 1 43  ? -38.84300 15.53700  -39.62800 1.000 61.62000  ? 31  ILE A CG2   1 
ATOM   242  C  CD1   . ILE A 1 43  ? -37.85800 14.48200  -42.21600 1.000 72.49000  ? 31  ILE A CD1   1 
ATOM   243  N  N     . LYS A 1 44  ? -42.33500 14.44000  -38.80400 1.000 60.83000  ? 32  LYS A N     1 
ATOM   244  C  CA    . LYS A 1 44  ? -43.27700 15.18400  -37.97500 1.000 71.63000  ? 32  LYS A CA    1 
ATOM   245  C  C     . LYS A 1 44  ? -43.61400 14.39700  -36.71000 1.000 70.35000  ? 32  LYS A C     1 
ATOM   246  O  O     . LYS A 1 44  ? -43.72900 14.96600  -35.60700 1.000 65.75000  ? 32  LYS A O     1 
ATOM   247  C  CB    . LYS A 1 44  ? -44.56300 15.51400  -38.74300 1.000 76.25000  ? 32  LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 44  ? -45.78900 15.67900  -37.82700 1.000 76.16000  ? 32  LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 44  ? -47.00000 16.24600  -38.56000 1.000 78.57000  ? 32  LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 44  ? -47.80100 15.14200  -39.25000 1.000 87.96000  ? 32  LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 44  ? -48.74400 15.65200  -40.29600 1.000 75.61000  ? 32  LYS A NZ    1 
ATOM   252  N  N     . ALA A 1 45  ? -43.77600 13.08800  -36.87800 1.000 62.20000  ? 33  ALA A N     1 
ATOM   253  C  CA    . ALA A 1 45  ? -44.08200 12.23400  -35.75100 1.000 59.47000  ? 33  ALA A CA    1 
ATOM   254  C  C     . ALA A 1 45  ? -42.94100 12.33200  -34.76000 1.000 59.68000  ? 33  ALA A C     1 
ATOM   255  O  O     . ALA A 1 45  ? -43.16600 12.47200  -33.55600 1.000 58.12000  ? 33  ALA A O     1 
ATOM   256  C  CB    . ALA A 1 45  ? -44.29700 10.81300  -36.19400 1.000 60.72000  ? 33  ALA A CB    1 
ATOM   257  N  N     . LEU A 1 46  ? -41.71700 12.30100  -35.28300 1.000 58.83000  ? 34  LEU A N     1 
ATOM   258  C  CA    . LEU A 1 46  ? -40.52100 12.36500  -34.45000 1.000 50.67000  ? 34  LEU A CA    1 
ATOM   259  C  C     . LEU A 1 46  ? -40.39700 13.68000  -33.69000 1.000 57.74000  ? 34  LEU A C     1 
ATOM   260  O  O     . LEU A 1 46  ? -40.19800 13.67500  -32.47200 1.000 57.45000  ? 34  LEU A O     1 
ATOM   261  C  CB    . LEU A 1 46  ? -39.27600 12.13600  -35.29700 1.000 48.15000  ? 34  LEU A CB    1 
ATOM   262  C  CG    . LEU A 1 46  ? -39.17900 10.72400  -35.87800 1.000 56.03000  ? 34  LEU A CG    1 
ATOM   263  C  CD1   . LEU A 1 46  ? -37.77400 10.43100  -36.36100 1.000 55.56000  ? 34  LEU A CD1   1 
ATOM   264  C  CD2   . LEU A 1 46  ? -39.60600 9.68300   -34.85300 1.000 52.06000  ? 34  LEU A CD2   1 
ATOM   265  N  N     . VAL A 1 47  ? -40.51200 14.80200  -34.40200 1.000 63.60000  ? 35  VAL A N     1 
ATOM   266  C  CA    . VAL A 1 47  ? -40.38900 16.12200  -33.78000 1.000 58.90000  ? 35  VAL A CA    1 
ATOM   267  C  C     . VAL A 1 47  ? -41.44300 16.29200  -32.71000 1.000 57.81000  ? 35  VAL A C     1 
ATOM   268  O  O     . VAL A 1 47  ? -41.16000 16.75500  -31.59900 1.000 60.82000  ? 35  VAL A O     1 
ATOM   269  C  CB    . VAL A 1 47  ? -40.52100 17.25500  -34.80700 1.000 57.45000  ? 35  VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 47  ? -40.78400 18.59600  -34.10000 1.000 54.03000  ? 35  VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 47  ? -39.26900 17.31100  -35.68900 1.000 59.29000  ? 35  VAL A CG2   1 
ATOM   272  N  N     . GLU A 1 48  ? -42.65800 15.89900  -33.06900 1.000 52.90000  ? 36  GLU A N     1 
ATOM   273  C  CA    . GLU A 1 48  ? -43.78700 15.89200  -32.15800 1.000 58.89000  ? 36  GLU A CA    1 
ATOM   274  C  C     . GLU A 1 48  ? -43.47900 15.09500  -30.87200 1.000 65.87000  ? 36  GLU A C     1 
ATOM   275  O  O     . GLU A 1 48  ? -43.75400 15.55200  -29.74800 1.000 61.39000  ? 36  GLU A O     1 
ATOM   276  C  CB    . GLU A 1 48  ? -45.00300 15.32400  -32.89000 1.000 53.83000  ? 36  GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 48  ? -46.07200 14.74200  -32.00500 1.000 67.61000  ? 36  GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 48  ? -46.91200 15.80100  -31.33100 1.000 78.49000  ? 36  GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 48  ? -47.94100 15.42700  -30.72600 1.000 84.88000  ? 36  GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 48  ? -46.55300 17.00000  -31.40500 1.000 83.46000  ? 36  GLU A OE2   1 
ATOM   281  N  N     . ILE A 1 49  ? -42.89400 13.90900  -31.05100 1.000 65.08000  ? 37  ILE A N     1 
ATOM   282  C  CA    . ILE A 1 49  ? -42.44200 13.08100  -29.93200 1.000 62.00000  ? 37  ILE A CA    1 
ATOM   283  C  C     . ILE A 1 49  ? -41.26700 13.74800  -29.21300 1.000 53.79000  ? 37  ILE A C     1 
ATOM   284  O  O     . ILE A 1 49  ? -41.26900 13.88000  -27.99800 1.000 56.37000  ? 37  ILE A O     1 
ATOM   285  C  CB    . ILE A 1 49  ? -42.03600 11.64900  -30.40000 1.000 49.75000  ? 37  ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 49  ? -43.27800 10.84100  -30.77200 1.000 45.26000  ? 37  ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 49  ? -41.24400 10.91100  -29.32300 1.000 45.03000  ? 37  ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 49  ? -43.00700 9.68200   -31.70000 1.000 44.73000  ? 37  ILE A CD1   1 
ATOM   289  N  N     . CYS A 1 50  ? -40.27700 14.20100  -29.96100 1.000 50.49000  ? 38  CYS A N     1 
ATOM   290  C  CA    . CYS A 1 50  ? -39.07500 14.71400  -29.33300 1.000 52.72000  ? 38  CYS A CA    1 
ATOM   291  C  C     . CYS A 1 50  ? -39.24000 16.03200  -28.57700 1.000 58.54000  ? 38  CYS A C     1 
ATOM   292  O  O     . CYS A 1 50  ? -38.58800 16.24200  -27.54800 1.000 55.00000  ? 38  CYS A O     1 
ATOM   293  C  CB    . CYS A 1 50  ? -37.99100 14.86400  -30.37700 1.000 54.38000  ? 38  CYS A CB    1 
ATOM   294  S  SG    . CYS A 1 50  ? -37.23400 13.29500  -30.71600 1.000 56.00000  ? 38  CYS A SG    1 
ATOM   295  N  N     . THR A 1 51  ? -40.09000 16.93000  -29.06200 1.000 55.54000  ? 39  THR A N     1 
ATOM   296  C  CA    . THR A 1 51  ? -40.25200 18.17800  -28.33400 1.000 58.54000  ? 39  THR A CA    1 
ATOM   297  C  C     . THR A 1 51  ? -41.01200 17.88000  -27.04900 1.000 56.91000  ? 39  THR A C     1 
ATOM   298  O  O     . THR A 1 51  ? -40.84900 18.58100  -26.04900 1.000 55.52000  ? 39  THR A O     1 
ATOM   299  C  CB    . THR A 1 51  ? -40.96100 19.26900  -29.16500 1.000 63.37000  ? 39  THR A CB    1 
ATOM   300  O  OG1   . THR A 1 51  ? -42.12200 18.72500  -29.79400 1.000 68.42000  ? 39  THR A OG1   1 
ATOM   301  C  CG2   . THR A 1 51  ? -40.02000 19.80100  -30.24600 1.000 66.74000  ? 39  THR A CG2   1 
ATOM   302  N  N     . GLU A 1 52  ? -41.80500 16.81200  -27.05400 1.000 57.87000  ? 40  GLU A N     1 
ATOM   303  C  CA    . GLU A 1 52  ? -42.51600 16.42400  -25.84200 1.000 59.05000  ? 40  GLU A CA    1 
ATOM   304  C  C     . GLU A 1 52  ? -41.56800 15.76500  -24.84900 1.000 54.72000  ? 40  GLU A C     1 
ATOM   305  O  O     . GLU A 1 52  ? -41.57200 16.07900  -23.65900 1.000 57.75000  ? 40  GLU A O     1 
ATOM   306  C  CB    . GLU A 1 52  ? -43.68900 15.49000  -26.16100 1.000 61.82000  ? 40  GLU A CB    1 
ATOM   307  C  CG    . GLU A 1 52  ? -44.48600 15.02700  -24.92600 1.000 67.32000  ? 40  GLU A CG    1 
ATOM   308  C  CD    . GLU A 1 52  ? -45.11900 16.18600  -24.12800 1.000 89.73000  ? 40  GLU A CD    1 
ATOM   309  O  OE1   . GLU A 1 52  ? -45.12600 17.35500  -24.59900 1.000 86.55000  ? 40  GLU A OE1   1 
ATOM   310  O  OE2   . GLU A 1 52  ? -45.62700 15.92300  -23.01500 1.000 90.38000  ? 40  GLU A OE2   1 
ATOM   311  N  N     . MET A 1 53  ? -40.74700 14.85400  -25.34600 1.000 54.15000  ? 41  MET A N     1 
ATOM   312  C  CA    . MET A 1 53  ? -39.81300 14.14500  -24.48900 1.000 52.72000  ? 41  MET A CA    1 
ATOM   313  C  C     . MET A 1 53  ? -38.79900 15.10200  -23.92500 1.000 52.27000  ? 41  MET A C     1 
ATOM   314  O  O     . MET A 1 53  ? -38.47400 15.04600  -22.74000 1.000 52.95000  ? 41  MET A O     1 
ATOM   315  C  CB    . MET A 1 53  ? -39.09100 13.03800  -25.25000 1.000 49.61000  ? 41  MET A CB    1 
ATOM   316  C  CG    . MET A 1 53  ? -39.96200 11.85100  -25.60400 1.000 50.97000  ? 41  MET A CG    1 
ATOM   317  S  SD    . MET A 1 53  ? -38.99100 10.64400  -26.51400 1.000 55.98000  ? 41  MET A SD    1 
ATOM   318  C  CE    . MET A 1 53  ? -38.10100 9.89400   -25.16600 1.000 37.68000  ? 41  MET A CE    1 
ATOM   319  N  N     . GLU A 1 54  ? -38.29400 15.97000  -24.79600 1.000 54.81000  ? 42  GLU A N     1 
ATOM   320  C  CA    . GLU A 1 54  ? -37.29000 16.94400  -24.41300 1.000 53.97000  ? 42  GLU A CA    1 
ATOM   321  C  C     . GLU A 1 54  ? -37.84600 17.82000  -23.30600 1.000 53.34000  ? 42  GLU A C     1 
ATOM   322  O  O     . GLU A 1 54  ? -37.16400 18.08200  -22.31500 1.000 51.35000  ? 42  GLU A O     1 
ATOM   323  C  CB    . GLU A 1 54  ? -36.85800 17.77600  -25.62100 1.000 53.28000  ? 42  GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 54  ? -35.61700 18.61500  -25.39400 1.000 59.83000  ? 42  GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 54  ? -35.93400 19.96100  -24.76700 1.000 67.52000  ? 42  GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 54  ? -35.12700 20.43100  -23.92600 1.000 63.92000  ? 42  GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 54  ? -36.99000 20.54100  -25.12200 1.000 67.43000  ? 42  GLU A OE2   1 
ATOM   328  N  N     . LYS A 1 55  ? -39.09900 18.24100  -23.46400 1.000 54.15000  ? 43  LYS A N     1 
ATOM   329  C  CA    . LYS A 1 55  ? -39.74600 19.06300  -22.45000 1.000 54.13000  ? 43  LYS A CA    1 
ATOM   330  C  C     . LYS A 1 55  ? -39.78000 18.34600  -21.10900 1.000 56.46000  ? 43  LYS A C     1 
ATOM   331  O  O     . LYS A 1 55  ? -39.63700 18.96900  -20.06200 1.000 59.28000  ? 43  LYS A O     1 
ATOM   332  C  CB    . LYS A 1 55  ? -41.17200 19.45000  -22.86900 1.000 54.37000  ? 43  LYS A CB    1 
ATOM   333  C  CG    . LYS A 1 55  ? -41.95500 20.15700  -21.75000 1.000 69.13000  ? 43  LYS A CG    1 
ATOM   334  C  CD    . LYS A 1 55  ? -43.32300 20.73000  -22.17900 1.000 82.64000  ? 43  LYS A CD    1 
ATOM   335  C  CE    . LYS A 1 55  ? -44.02700 21.45600  -20.99800 1.000 74.58000  ? 43  LYS A CE    1 
ATOM   336  N  NZ    . LYS A 1 55  ? -45.42500 21.93300  -21.29200 1.000 58.52000  ? 43  LYS A NZ    1 
ATOM   337  N  N     . GLU A 1 56  ? -39.95200 17.03000  -21.14300 1.000 58.42000  ? 44  GLU A N     1 
ATOM   338  C  CA    . GLU A 1 56  ? -40.15500 16.27400  -19.91400 1.000 54.86000  ? 44  GLU A CA    1 
ATOM   339  C  C     . GLU A 1 56  ? -38.86000 15.73400  -19.34400 1.000 51.05000  ? 44  GLU A C     1 
ATOM   340  O  O     . GLU A 1 56  ? -38.86800 15.05700  -18.32300 1.000 64.64000  ? 44  GLU A O     1 
ATOM   341  C  CB    . GLU A 1 56  ? -41.14300 15.13000  -20.15400 1.000 55.88000  ? 44  GLU A CB    1 
ATOM   342  C  CG    . GLU A 1 56  ? -42.58800 15.62200  -20.25500 1.000 65.41000  ? 44  GLU A CG    1 
ATOM   343  C  CD    . GLU A 1 56  ? -43.60500 14.49600  -20.32800 1.000 71.43000  ? 44  GLU A CD    1 
ATOM   344  O  OE1   . GLU A 1 56  ? -43.40700 13.45000  -19.66600 1.000 74.51000  ? 44  GLU A OE1   1 
ATOM   345  O  OE2   . GLU A 1 56  ? -44.61400 14.66400  -21.03900 1.000 68.24000  ? 44  GLU A OE2   1 
ATOM   346  N  N     . GLY A 1 57  ? -37.74500 16.03300  -19.99600 1.000 50.30000  ? 45  GLY A N     1 
ATOM   347  C  CA    . GLY A 1 57  ? -36.45200 15.58800  -19.51200 1.000 44.40000  ? 45  GLY A CA    1 
ATOM   348  C  C     . GLY A 1 57  ? -36.03300 14.23100  -20.03000 1.000 44.01000  ? 45  GLY A C     1 
ATOM   349  O  O     . GLY A 1 57  ? -34.92000 13.77300  -19.76300 1.000 41.98000  ? 45  GLY A O     1 
ATOM   350  N  N     . LYS A 1 58  ? -36.92500 13.58500  -20.77200 1.000 47.90000  ? 46  LYS A N     1 
ATOM   351  C  CA    . LYS A 1 58  ? -36.65600 12.25500  -21.31200 1.000 48.84000  ? 46  LYS A CA    1 
ATOM   352  C  C     . LYS A 1 58  ? -35.42300 12.27700  -22.22700 1.000 47.35000  ? 46  LYS A C     1 
ATOM   353  O  O     . LYS A 1 58  ? -34.64500 11.32300  -22.26700 1.000 41.88000  ? 46  LYS A O     1 
ATOM   354  C  CB    . LYS A 1 58  ? -37.87800 11.73800  -22.07700 1.000 48.39000  ? 46  LYS A CB    1 
ATOM   355  C  CG    . LYS A 1 58  ? -38.91200 10.94000  -21.27200 1.000 42.22000  ? 46  LYS A CG    1 
ATOM   356  C  CD    . LYS A 1 58  ? -39.43400 11.66700  -20.04600 1.000 50.28000  ? 46  LYS A CD    1 
ATOM   357  C  CE    . LYS A 1 58  ? -40.57400 10.88500  -19.37500 1.000 48.71000  ? 46  LYS A CE    1 
ATOM   358  N  NZ    . LYS A 1 58  ? -41.72600 10.67500  -20.29700 1.000 52.11000  ? 46  LYS A NZ    1 
ATOM   359  N  N     . ILE A 1 59  ? -35.26100 13.37700  -22.96100 1.000 52.90000  ? 47  ILE A N     1 
ATOM   360  C  CA    . ILE A 1 59  ? -34.09000 13.58900  -23.81200 1.000 48.41000  ? 47  ILE A CA    1 
ATOM   361  C  C     . ILE A 1 59  ? -33.56600 15.01300  -23.64100 1.000 49.95000  ? 47  ILE A C     1 
ATOM   362  O  O     . ILE A 1 59  ? -34.32700 15.95300  -23.35300 1.000 48.31000  ? 47  ILE A O     1 
ATOM   363  C  CB    . ILE A 1 59  ? -34.39300 13.33400  -25.32100 1.000 50.19000  ? 47  ILE A CB    1 
ATOM   364  C  CG1   . ILE A 1 59  ? -35.49700 14.26500  -25.83500 1.000 43.57000  ? 47  ILE A CG1   1 
ATOM   365  C  CG2   . ILE A 1 59  ? -34.78500 11.89500  -25.55100 1.000 48.67000  ? 47  ILE A CG2   1 
ATOM   366  C  CD1   . ILE A 1 59  ? -35.89100 14.01700  -27.26600 1.000 41.74000  ? 47  ILE A CD1   1 
ATOM   367  N  N     . SER A 1 60  ? -32.25800 15.16100  -23.81800 1.000 50.12000  ? 48  SER A N     1 
ATOM   368  C  CA    . SER A 1 60  ? -31.60300 16.45300  -23.69100 1.000 43.18000  ? 48  SER A CA    1 
ATOM   369  C  C     . SER A 1 60  ? -30.92400 16.80400  -24.98900 1.000 49.93000  ? 48  SER A C     1 
ATOM   370  O  O     . SER A 1 60  ? -30.27100 15.94700  -25.59700 1.000 47.77000  ? 48  SER A O     1 
ATOM   371  C  CB    . SER A 1 60  ? -30.58300 16.43000  -22.56500 1.000 36.95000  ? 48  SER A CB    1 
ATOM   372  O  OG    . SER A 1 60  ? -31.22400 16.18800  -21.33200 1.000 36.84000  ? 48  SER A OG    1 
ATOM   373  N  N     . LYS A 1 61  ? -31.08900 18.05600  -25.41800 1.000 56.22000  ? 49  LYS A N     1 
ATOM   374  C  CA    . LYS A 1 61  ? -30.34500 18.58500  -26.55800 1.000 50.04000  ? 49  LYS A CA    1 
ATOM   375  C  C     . LYS A 1 61  ? -28.84900 18.50900  -26.27600 1.000 48.63000  ? 49  LYS A C     1 
ATOM   376  O  O     . LYS A 1 61  ? -28.40700 18.83500  -25.17200 1.000 54.82000  ? 49  LYS A O     1 
ATOM   377  C  CB    . LYS A 1 61  ? -30.75300 20.02600  -26.85300 1.000 50.17000  ? 49  LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 61  ? -32.20800 20.21700  -27.19500 1.000 52.66000  ? 49  LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 61  ? -32.49200 21.69100  -27.44800 1.000 56.90000  ? 49  LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 61  ? -33.98000 21.94700  -27.70900 1.000 73.17000  ? 49  LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 61  ? -34.20300 22.92100  -28.82800 1.000 73.45000  ? 49  LYS A NZ    1 
ATOM   382  N  N     . ILE A 1 62  ? -28.08200 18.04600  -27.26300 1.000 50.53000  ? 50  ILE A N     1 
ATOM   383  C  CA    . ILE A 1 62  ? -26.62000 18.00000  -27.17300 1.000 55.07000  ? 50  ILE A CA    1 
ATOM   384  C  C     . ILE A 1 62  ? -25.95900 18.93800  -28.20800 1.000 65.02000  ? 50  ILE A C     1 
ATOM   385  O  O     . ILE A 1 62  ? -26.58700 19.31900  -29.20800 1.000 59.11000  ? 50  ILE A O     1 
ATOM   386  C  CB    . ILE A 1 62  ? -26.08700 16.57300  -27.39600 1.000 52.60000  ? 50  ILE A CB    1 
ATOM   387  C  CG1   . ILE A 1 62  ? -26.54000 16.05300  -28.76400 1.000 53.44000  ? 50  ILE A CG1   1 
ATOM   388  C  CG2   . ILE A 1 62  ? -26.54200 15.64300  -26.29100 1.000 53.15000  ? 50  ILE A CG2   1 
ATOM   389  C  CD1   . ILE A 1 62  ? -26.02100 14.69000  -29.10900 1.000 52.00000  ? 50  ILE A CD1   1 
ATOM   390  N  N     . GLY A 1 63  ? -24.69800 19.30200  -27.96800 1.000 63.77000  ? 51  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 63  ? -23.92700 20.08200  -28.92800 1.000 69.31000  ? 51  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 63  ? -22.81900 19.27400  -29.59500 1.000 73.53000  ? 51  GLY A C     1 
ATOM   393  O  O     . GLY A 1 63  ? -22.88600 18.04600  -29.61100 1.000 70.16000  ? 51  GLY A O     1 
ATOM   394  N  N     . PRO A 1 64  ? -21.80700 19.95900  -30.16900 1.000 79.40000  ? 52  PRO A N     1 
ATOM   395  C  CA    . PRO A 1 64  ? -20.60400 19.36800  -30.78500 1.000 69.60000  ? 52  PRO A CA    1 
ATOM   396  C  C     . PRO A 1 64  ? -19.65300 18.64900  -29.81800 1.000 69.79000  ? 52  PRO A C     1 
ATOM   397  O  O     . PRO A 1 64  ? -18.68100 18.05400  -30.28400 1.000 73.04000  ? 52  PRO A O     1 
ATOM   398  C  CB    . PRO A 1 64  ? -19.90300 20.57900  -31.40100 1.000 72.52000  ? 52  PRO A CB    1 
ATOM   399  C  CG    . PRO A 1 64  ? -20.99900 21.54800  -31.65500 1.000 78.89000  ? 52  PRO A CG    1 
ATOM   400  C  CD    . PRO A 1 64  ? -21.93700 21.38800  -30.50500 1.000 77.01000  ? 52  PRO A CD    1 
ATOM   401  N  N     . GLU A 1 65  ? -19.91500 18.70700  -28.51300 1.000 66.55000  ? 53  GLU A N     1 
ATOM   402  C  CA    . GLU A 1 65  ? -19.18300 17.89300  -27.53600 1.000 69.45000  ? 53  GLU A CA    1 
ATOM   403  C  C     . GLU A 1 65  ? -19.42100 16.40800  -27.79600 1.000 72.60000  ? 53  GLU A C     1 
ATOM   404  O  O     . GLU A 1 65  ? -18.61200 15.55900  -27.41300 1.000 70.27000  ? 53  GLU A O     1 
ATOM   405  C  CB    . GLU A 1 65  ? -19.60100 18.19900  -26.09000 1.000 73.83000  ? 53  GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 65  ? -19.99200 19.62400  -25.78800 1.000 81.31000  ? 53  GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 65  ? -21.29300 20.02000  -26.45400 1.000 76.08000  ? 53  GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 65  ? -22.38000 19.60000  -25.98500 1.000 73.38000  ? 53  GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 65  ? -21.20700 20.73800  -27.47200 1.000 74.53000  ? 53  GLU A OE2   1 
ATOM   410  N  N     . ASN A 1 66  ? -20.55200 16.10900  -28.42900 1.000 68.22000  ? 54  ASN A N     1 
ATOM   411  C  CA    . ASN A 1 66  ? -20.98300 14.73900  -28.67900 1.000 63.87000  ? 54  ASN A CA    1 
ATOM   412  C  C     . ASN A 1 66  ? -20.64000 14.27100  -30.09600 1.000 60.63000  ? 54  ASN A C     1 
ATOM   413  O  O     . ASN A 1 66  ? -21.35900 14.57500  -31.05100 1.000 63.53000  ? 54  ASN A O     1 
ATOM   414  C  CB    . ASN A 1 66  ? -22.49200 14.62600  -28.43000 1.000 63.98000  ? 54  ASN A CB    1 
ATOM   415  C  CG    . ASN A 1 66  ? -22.92400 13.22600  -28.04600 1.000 56.97000  ? 54  ASN A CG    1 
ATOM   416  O  OD1   . ASN A 1 66  ? -22.60100 12.25800  -28.73500 1.000 60.32000  ? 54  ASN A OD1   1 
ATOM   417  N  ND2   . ASN A 1 66  ? -23.65400 13.11100  -26.93400 1.000 57.08000  ? 54  ASN A ND2   1 
ATOM   418  N  N     . PRO A 1 67  ? -19.53600 13.52500  -30.23700 1.000 52.50000  ? 55  PRO A N     1 
ATOM   419  C  CA    . PRO A 1 67  ? -19.12500 13.01600  -31.54900 1.000 57.27000  ? 55  PRO A CA    1 
ATOM   420  C  C     . PRO A 1 67  ? -20.10300 12.00100  -32.13800 1.000 60.79000  ? 55  PRO A C     1 
ATOM   421  O  O     . PRO A 1 67  ? -20.28500 11.95900  -33.35800 1.000 62.80000  ? 55  PRO A O     1 
ATOM   422  C  CB    . PRO A 1 67  ? -17.77800 12.34600  -31.25700 1.000 51.43000  ? 55  PRO A CB    1 
ATOM   423  C  CG    . PRO A 1 67  ? -17.85200 11.97900  -29.82800 1.000 51.10000  ? 55  PRO A CG    1 
ATOM   424  C  CD    . PRO A 1 67  ? -18.63200 13.07500  -29.16900 1.000 50.48000  ? 55  PRO A CD    1 
ATOM   425  N  N     . TYR A 1 68  ? -20.73200 11.21000  -31.27500 1.000 56.00000  ? 56  TYR A N     1 
ATOM   426  C  CA    . TYR A 1 68  ? -21.47200 10.03400  -31.70700 1.000 53.68000  ? 56  TYR A CA    1 
ATOM   427  C  C     . TYR A 1 68  ? -22.79600 10.32200  -32.38100 1.000 54.51000  ? 56  TYR A C     1 
ATOM   428  O  O     . TYR A 1 68  ? -23.34100 11.42300  -32.28600 1.000 55.39000  ? 56  TYR A O     1 
ATOM   429  C  CB    . TYR A 1 68  ? -21.71600 9.13200   -30.51800 1.000 49.87000  ? 56  TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 68  ? -20.49600 8.97700   -29.66500 1.000 51.42000  ? 56  TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 68  ? -19.41100 8.23700   -30.10700 1.000 54.59000  ? 56  TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 68  ? -20.42000 9.58300   -28.42200 1.000 49.21000  ? 56  TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 68  ? -18.28400 8.09500   -29.32300 1.000 52.79000  ? 56  TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 68  ? -19.30200 9.45300   -27.63800 1.000 51.30000  ? 56  TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 68  ? -18.23900 8.70600   -28.09100 1.000 49.83000  ? 56  TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 68  ? -17.13000 8.58100   -27.30300 1.000 54.28000  ? 56  TYR A OH    1 
ATOM   437  N  N     . ASN A 1 69  ? -23.29900 9.31000   -33.07600 1.000 52.00000  ? 57  ASN A N     1 
ATOM   438  C  CA    . ASN A 1 69  ? -24.63500 9.37100   -33.64100 1.000 56.03000  ? 57  ASN A CA    1 
ATOM   439  C  C     . ASN A 1 69  ? -25.10600 7.99900   -34.08800 1.000 58.98000  ? 57  ASN A C     1 
ATOM   440  O  O     . ASN A 1 69  ? -24.31200 7.16500   -34.55500 1.000 57.00000  ? 57  ASN A O     1 
ATOM   441  C  CB    . ASN A 1 69  ? -24.71100 10.34800  -34.81600 1.000 51.09000  ? 57  ASN A CB    1 
ATOM   442  C  CG    . ASN A 1 69  ? -26.14500 10.61300  -35.26400 1.000 52.23000  ? 57  ASN A CG    1 
ATOM   443  O  OD1   . ASN A 1 69  ? -26.79700 11.53100  -34.76200 1.000 54.33000  ? 57  ASN A OD1   1 
ATOM   444  N  ND2   . ASN A 1 69  ? -26.64400 9.80800   -36.20700 1.000 48.26000  ? 57  ASN A ND2   1 
ATOM   445  N  N     . THR A 1 70  ? -26.41000 7.78700   -33.93200 1.000 52.23000  ? 58  THR A N     1 
ATOM   446  C  CA    . THR A 1 70  ? -27.06600 6.56300   -34.33000 1.000 53.29000  ? 58  THR A CA    1 
ATOM   447  C  C     . THR A 1 70  ? -28.40000 6.95700   -34.98200 1.000 52.28000  ? 58  THR A C     1 
ATOM   448  O  O     . THR A 1 70  ? -29.03400 7.94400   -34.58800 1.000 56.87000  ? 58  THR A O     1 
ATOM   449  C  CB    . THR A 1 70  ? -27.25600 5.61500   -33.11500 1.000 51.27000  ? 58  THR A CB    1 
ATOM   450  O  OG1   . THR A 1 70  ? -26.00600 5.45700   -32.42900 1.000 48.61000  ? 58  THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 70  ? -27.74100 4.24600   -33.55400 1.000 50.12000  ? 58  THR A CG2   1 
ATOM   452  N  N     . PRO A 1 71  ? -28.79900 6.21800   -36.02500 1.000 56.13000  ? 59  PRO A N     1 
ATOM   453  C  CA    . PRO A 1 71  ? -29.98500 6.46700   -36.85900 1.000 59.47000  ? 59  PRO A CA    1 
ATOM   454  C  C     . PRO A 1 71  ? -31.33600 6.15400   -36.20400 1.000 59.47000  ? 59  PRO A C     1 
ATOM   455  O  O     . PRO A 1 71  ? -31.48700 5.15000   -35.51400 1.000 65.86000  ? 59  PRO A O     1 
ATOM   456  C  CB    . PRO A 1 71  ? -29.74500 5.54200   -38.06200 1.000 50.20000  ? 59  PRO A CB    1 
ATOM   457  C  CG    . PRO A 1 71  ? -28.26500 5.36800   -38.10700 1.000 50.58000  ? 59  PRO A CG    1 
ATOM   458  C  CD    . PRO A 1 71  ? -27.88000 5.27100   -36.67900 1.000 50.15000  ? 59  PRO A CD    1 
ATOM   459  N  N     . VAL A 1 72  ? -32.31900 7.01100   -36.44200 1.000 52.61000  ? 60  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 72  ? -33.62100 6.83400   -35.84300 1.000 51.96000  ? 60  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 72  ? -34.69400 6.77800   -36.90900 1.000 56.65000  ? 60  VAL A C     1 
ATOM   462  O  O     . VAL A 1 72  ? -34.57100 7.40600   -37.95300 1.000 63.77000  ? 60  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 72  ? -33.93700 7.96700   -34.84200 1.000 56.68000  ? 60  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 72  ? -32.87300 8.01400   -33.76600 1.000 53.35000  ? 60  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 72  ? -34.02900 9.31500   -35.55000 1.000 59.94000  ? 60  VAL A CG2   1 
ATOM   466  N  N     . PHE A 1 73  ? -35.74000 6.00300   -36.64500 1.000 58.26000  ? 61  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 73  ? -36.90100 5.95500   -37.52000 1.000 56.66000  ? 61  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 73  ? -38.16300 5.83400   -36.67500 1.000 53.86000  ? 61  PHE A C     1 
ATOM   469  O  O     . PHE A 1 73  ? -38.14100 6.06500   -35.46400 1.000 47.33000  ? 61  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 73  ? -36.79400 4.79900   -38.52400 1.000 60.77000  ? 61  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 73  ? -36.48800 3.45700   -37.90000 1.000 63.88000  ? 61  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 73  ? -35.19600 3.12700   -37.52200 1.000 61.61000  ? 61  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 73  ? -37.48800 2.52100   -37.71100 1.000 62.59000  ? 61  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 73  ? -34.90400 1.89600   -36.96700 1.000 57.26000  ? 61  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 73  ? -37.20600 1.28600   -37.15000 1.000 59.97000  ? 61  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 73  ? -35.90800 0.97400   -36.78000 1.000 54.86000  ? 61  PHE A CZ    1 
ATOM   477  N  N     . ALA A 1 74  ? -39.27000 5.49200   -37.31300 1.000 52.45000  ? 62  ALA A N     1 
ATOM   478  C  CA    . ALA A 1 74  ? -40.49700 5.31000   -36.57000 1.000 56.45000  ? 62  ALA A CA    1 
ATOM   479  C  C     . ALA A 1 74  ? -41.42800 4.41500   -37.35200 1.000 69.70000  ? 62  ALA A C     1 
ATOM   480  O  O     . ALA A 1 74  ? -41.49800 4.48400   -38.58400 1.000 76.24000  ? 62  ALA A O     1 
ATOM   481  C  CB    . ALA A 1 74  ? -41.16200 6.64500   -36.26900 1.000 56.91000  ? 62  ALA A CB    1 
ATOM   482  N  N     . ILE A 1 75  ? -42.11500 3.54700   -36.62300 1.000 65.62000  ? 63  ILE A N     1 
ATOM   483  C  CA    . ILE A 1 75  ? -43.15200 2.72700   -37.20000 1.000 59.45000  ? 63  ILE A CA    1 
ATOM   484  C  C     . ILE A 1 75  ? -44.43200 3.05400   -36.45000 1.000 62.57000  ? 63  ILE A C     1 
ATOM   485  O  O     . ILE A 1 75  ? -44.39400 3.52300   -35.31400 1.000 64.66000  ? 63  ILE A O     1 
ATOM   486  C  CB    . ILE A 1 75  ? -42.81200 1.22600   -37.11400 1.000 62.03000  ? 63  ILE A CB    1 
ATOM   487  C  CG1   . ILE A 1 75  ? -42.69000 0.78200   -35.65700 1.000 62.98000  ? 63  ILE A CG1   1 
ATOM   488  C  CG2   . ILE A 1 75  ? -41.52700 0.92900   -37.86300 1.000 61.61000  ? 63  ILE A CG2   1 
ATOM   489  C  CD1   . ILE A 1 75  ? -42.11100 -0.61100  -35.48900 1.000 60.07000  ? 63  ILE A CD1   1 
ATOM   490  N  N     . LYS A 1 76  ? -45.56100 2.83500   -37.10600 1.000 67.70000  ? 64  LYS A N     1 
ATOM   491  C  CA    . LYS A 1 76  ? -46.86900 3.03100   -36.51200 1.000 67.80000  ? 64  LYS A CA    1 
ATOM   492  C  C     . LYS A 1 76  ? -47.28900 1.79600   -35.74100 1.000 69.44000  ? 64  LYS A C     1 
ATOM   493  O  O     . LYS A 1 76  ? -47.04900 0.68900   -36.20200 1.000 68.63000  ? 64  LYS A O     1 
ATOM   494  C  CB    . LYS A 1 76  ? -47.87100 3.32200   -37.61000 1.000 73.80000  ? 64  LYS A CB    1 
ATOM   495  C  CG    . LYS A 1 76  ? -48.49400 4.68200   -37.59200 1.000 79.66000  ? 64  LYS A CG    1 
ATOM   496  C  CD    . LYS A 1 76  ? -49.58900 4.73300   -38.62500 1.000 84.08000  ? 64  LYS A CD    1 
ATOM   497  C  CE    . LYS A 1 76  ? -50.21200 6.10000   -38.69300 1.000 84.64000  ? 64  LYS A CE    1 
ATOM   498  N  NZ    . LYS A 1 76  ? -49.27200 7.11500   -39.23500 1.000 82.19000  ? 64  LYS A NZ    1 
ATOM   499  N  N     . LYS A 1 77  ? -47.92800 1.97200   -34.58800 1.000 70.06000  ? 65  LYS A N     1 
ATOM   500  C  CA    . LYS A 1 77  ? -48.36900 0.82500   -33.73800 1.000 79.24000  ? 65  LYS A CA    1 
ATOM   501  C  C     . LYS A 1 77  ? -49.69600 0.10200   -34.11500 1.000 90.33000  ? 65  LYS A C     1 
ATOM   502  O  O     . LYS A 1 77  ? -50.20400 0.37000   -35.26900 1.000 86.57000  ? 65  LYS A O     1 
ATOM   503  C  CB    . LYS A 1 77  ? -48.50300 1.29400   -32.30100 1.000 69.21000  ? 65  LYS A CB    1 
ATOM   504  C  CG    . LYS A 1 77  ? -47.33500 2.05500   -31.77100 1.000 61.30000  ? 65  LYS A CG    1 
ATOM   505  C  CD    . LYS A 1 77  ? -47.72200 2.80800   -30.54700 1.000 62.16000  ? 65  LYS A CD    1 
ATOM   506  C  CE    . LYS A 1 77  ? -46.57900 2.85100   -29.57500 1.000 64.06000  ? 65  LYS A CE    1 
ATOM   507  N  NZ    . LYS A 1 77  ? -46.69700 3.92400   -28.53800 1.000 58.87000  ? 65  LYS A NZ    1 
ATOM   508  N  N     . LYS A 1 78  ? -50.20500 -0.77600  -33.19900 1.000 95.89000  ? 66  LYS A N     1 
ATOM   509  C  CA    . LYS A 1 78  ? -51.52300 -1.41300  -33.36900 1.000 92.84000  ? 66  LYS A CA    1 
ATOM   510  C  C     . LYS A 1 78  ? -52.66700 -0.41600  -33.23100 1.000 100.88000 ? 66  LYS A C     1 
ATOM   511  O  O     . LYS A 1 78  ? -53.63100 -0.41400  -34.00400 1.000 93.76000  ? 66  LYS A O     1 
ATOM   512  C  CB    . LYS A 1 78  ? -51.75500 -2.50600  -32.34500 1.000 92.85000  ? 66  LYS A CB    1 
ATOM   513  C  CG    . LYS A 1 78  ? -50.92200 -3.77900  -32.49100 1.000 99.54000  ? 66  LYS A CG    1 
ATOM   514  C  CD    . LYS A 1 78  ? -51.28900 -4.84800  -31.42900 1.000 101.65000 ? 66  LYS A CD    1 
ATOM   515  C  CE    . LYS A 1 78  ? -50.36200 -6.06600  -31.56600 1.000 87.19000  ? 66  LYS A CE    1 
ATOM   516  N  NZ    . LYS A 1 78  ? -50.61200 -7.15700  -30.57400 1.000 73.25000  ? 66  LYS A NZ    1 
ATOM   517  N  N     . ASP A 1 79  ? -52.55400 0.41300   -32.19800 1.000 103.87000 ? 67  ASP A N     1 
ATOM   518  C  CA    . ASP A 1 79  ? -53.54700 1.43900   -31.91000 1.000 105.96000 ? 67  ASP A CA    1 
ATOM   519  C  C     . ASP A 1 79  ? -53.81900 2.27700   -33.15800 1.000 105.99000 ? 67  ASP A C     1 
ATOM   520  O  O     . ASP A 1 79  ? -54.80700 3.01200   -33.21600 1.000 109.53000 ? 67  ASP A O     1 
ATOM   521  C  CB    . ASP A 1 79  ? -53.09500 2.34800   -30.75600 1.000 106.41000 ? 67  ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 79  ? -54.25800 3.11600   -30.12400 1.000 113.33000 ? 67  ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 79  ? -55.37700 3.12400   -30.70100 1.000 117.99000 ? 67  ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 79  ? -54.05400 3.72000   -29.04200 1.000 104.47000 ? 67  ASP A OD2   1 
ATOM   525  N  N     . SER A 1 80  ? -52.93900 2.15500   -34.15100 1.000 101.70000 ? 68  SER A N     1 
ATOM   526  C  CA    . SER A 1 80  ? -53.06900 2.85500   -35.41800 1.000 106.82000 ? 68  SER A CA    1 
ATOM   527  C  C     . SER A 1 80  ? -53.37300 4.33100   -35.17400 1.000 106.33000 ? 68  SER A C     1 
ATOM   528  O  O     . SER A 1 80  ? -54.14600 4.94700   -35.91100 1.000 117.42000 ? 68  SER A O     1 
ATOM   529  C  CB    . SER A 1 80  ? -54.16100 2.20400   -36.29000 1.000 109.81000 ? 68  SER A CB    1 
ATOM   530  O  OG    . SER A 1 80  ? -53.81300 0.87500   -36.65900 1.000 96.69000  ? 68  SER A OG    1 
ATOM   531  N  N     . THR A 1 81  ? -52.80500 4.87900   -34.10500 1.000 101.47000 ? 69  THR A N     1 
ATOM   532  C  CA    . THR A 1 81  ? -53.06400 6.26700   -33.75200 1.000 101.12000 ? 69  THR A CA    1 
ATOM   533  C  C     . THR A 1 81  ? -51.82900 6.91900   -33.16100 1.000 96.86000  ? 69  THR A C     1 
ATOM   534  O  O     . THR A 1 81  ? -51.75500 8.14100   -33.05900 1.000 97.67000  ? 69  THR A O     1 
ATOM   535  C  CB    . THR A 1 81  ? -54.23600 6.40700   -32.74500 1.000 106.23000 ? 69  THR A CB    1 
ATOM   536  O  OG1   . THR A 1 81  ? -54.70400 5.10600   -32.36200 1.000 112.33000 ? 69  THR A OG1   1 
ATOM   537  C  CG2   . THR A 1 81  ? -55.38300 7.18700   -33.37300 1.000 100.33000 ? 69  THR A CG2   1 
ATOM   538  N  N     . LYS A 1 82  ? -50.85100 6.11900   -32.76600 1.000 87.47000  ? 70  LYS A N     1 
ATOM   539  C  CA    . LYS A 1 82  ? -49.63300 6.67300   -32.21100 1.000 74.52000  ? 70  LYS A CA    1 
ATOM   540  C  C     . LYS A 1 82  ? -48.41700 6.05500   -32.89800 1.000 70.94000  ? 70  LYS A C     1 
ATOM   541  O  O     . LYS A 1 82  ? -48.47700 4.91700   -33.37400 1.000 70.40000  ? 70  LYS A O     1 
ATOM   542  C  CB    . LYS A 1 82  ? -49.60800 6.42900   -30.69900 1.000 78.19000  ? 70  LYS A CB    1 
ATOM   543  C  CG    . LYS A 1 82  ? -50.74400 7.11700   -29.96000 1.000 89.24000  ? 70  LYS A CG    1 
ATOM   544  C  CD    . LYS A 1 82  ? -50.70300 6.89000   -28.48200 1.000 93.32000  ? 70  LYS A CD    1 
ATOM   545  C  CE    . LYS A 1 82  ? -52.05100 7.13000   -27.84300 1.000 95.44000  ? 70  LYS A CE    1 
ATOM   546  N  NZ    . LYS A 1 82  ? -52.61000 8.44800   -28.25700 1.000 96.40000  ? 70  LYS A NZ    1 
ATOM   547  N  N     . TRP A 1 83  ? -47.34400 6.82200   -33.02600 1.000 62.50000  ? 71  TRP A N     1 
ATOM   548  C  CA    . TRP A 1 83  ? -46.10800 6.29300   -33.59700 1.000 59.41000  ? 71  TRP A CA    1 
ATOM   549  C  C     . TRP A 1 83  ? -45.19700 5.70800   -32.52100 1.000 55.63000  ? 71  TRP A C     1 
ATOM   550  O  O     . TRP A 1 83  ? -45.23300 6.12000   -31.36300 1.000 58.59000  ? 71  TRP A O     1 
ATOM   551  C  CB    . TRP A 1 83  ? -45.34100 7.37600   -34.36400 1.000 62.93000  ? 71  TRP A CB    1 
ATOM   552  C  CG    . TRP A 1 83  ? -45.96500 7.76200   -35.66300 1.000 69.14000  ? 71  TRP A CG    1 
ATOM   553  C  CD1   . TRP A 1 83  ? -46.99000 8.64000   -35.84400 1.000 64.36000  ? 71  TRP A CD1   1 
ATOM   554  C  CD2   . TRP A 1 83  ? -45.60000 7.29400   -36.97400 1.000 71.57000  ? 71  TRP A CD2   1 
ATOM   555  N  NE1   . TRP A 1 83  ? -47.29400 8.74600   -37.17900 1.000 69.06000  ? 71  TRP A NE1   1 
ATOM   556  C  CE2   . TRP A 1 83  ? -46.45700 7.92900   -37.89400 1.000 69.67000  ? 71  TRP A CE2   1 
ATOM   557  C  CE3   . TRP A 1 83  ? -44.63700 6.39400   -37.45700 1.000 70.65000  ? 71  TRP A CE3   1 
ATOM   558  C  CZ2   . TRP A 1 83  ? -46.37900 7.70000   -39.26700 1.000 69.88000  ? 71  TRP A CZ2   1 
ATOM   559  C  CZ3   . TRP A 1 83  ? -44.56300 6.16700   -38.82600 1.000 65.64000  ? 71  TRP A CZ3   1 
ATOM   560  C  CH2   . TRP A 1 83  ? -45.43100 6.81500   -39.71100 1.000 71.06000  ? 71  TRP A CH2   1 
ATOM   561  N  N     . ARG A 1 84  ? -44.37600 4.74400   -32.90200 1.000 51.51000  ? 72  ARG A N     1 
ATOM   562  C  CA    . ARG A 1 84  ? -43.35300 4.23400   -32.00300 1.000 48.74000  ? 72  ARG A CA    1 
ATOM   563  C  C     . ARG A 1 84  ? -41.99500 4.69300   -32.51600 1.000 52.48000  ? 72  ARG A C     1 
ATOM   564  O  O     . ARG A 1 84  ? -41.59600 4.35200   -33.64100 1.000 46.20000  ? 72  ARG A O     1 
ATOM   565  C  CB    . ARG A 1 84  ? -43.43300 2.70500   -31.89400 1.000 48.12000  ? 72  ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 84  ? -42.19700 2.03500   -31.35400 1.000 44.14000  ? 72  ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 84  ? -42.42700 0.54900   -31.02000 1.000 45.10000  ? 72  ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 84  ? -43.08600 0.42600   -29.72200 1.000 47.49000  ? 72  ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 84  ? -44.26000 -0.16700  -29.53000 1.000 52.03000  ? 72  ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 84  ? -44.89800 -0.73500  -30.55700 1.000 53.76000  ? 72  ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 84  ? -44.79200 -0.19800  -28.31000 1.000 50.86000  ? 72  ARG A NH2   1 
ATOM   572  N  N     . LYS A 1 85  ? -41.30800 5.50200   -31.70200 1.000 49.77000  ? 73  LYS A N     1 
ATOM   573  C  CA    . LYS A 1 85  ? -39.95100 5.95800   -32.02000 1.000 48.50000  ? 73  LYS A CA    1 
ATOM   574  C  C     . LYS A 1 85  ? -38.90200 4.87200   -31.74500 1.000 50.83000  ? 73  LYS A C     1 
ATOM   575  O  O     . LYS A 1 85  ? -38.78500 4.38100   -30.61600 1.000 52.09000  ? 73  LYS A O     1 
ATOM   576  C  CB    . LYS A 1 85  ? -39.61400 7.22000   -31.22800 1.000 48.27000  ? 73  LYS A CB    1 
ATOM   577  C  CG    . LYS A 1 85  ? -38.16200 7.67600   -31.33800 1.000 43.48000  ? 73  LYS A CG    1 
ATOM   578  C  CD    . LYS A 1 85  ? -37.96300 8.94800   -30.51000 1.000 53.03000  ? 73  LYS A CD    1 
ATOM   579  C  CE    . LYS A 1 85  ? -36.67400 9.67600   -30.87400 1.000 48.10000  ? 73  LYS A CE    1 
ATOM   580  N  NZ    . LYS A 1 85  ? -35.45900 8.85200   -30.59600 1.000 46.87000  ? 73  LYS A NZ    1 
ATOM   581  N  N     . LEU A 1 86  ? -38.14600 4.50700   -32.78200 1.000 50.30000  ? 74  LEU A N     1 
ATOM   582  C  CA    . LEU A 1 86  ? -37.14900 3.44100   -32.69800 1.000 44.07000  ? 74  LEU A CA    1 
ATOM   583  C  C     . LEU A 1 86  ? -35.79300 3.96400   -33.07100 1.000 44.99000  ? 74  LEU A C     1 
ATOM   584  O  O     . LEU A 1 86  ? -35.68100 4.90600   -33.84000 1.000 51.32000  ? 74  LEU A O     1 
ATOM   585  C  CB    . LEU A 1 86  ? -37.50600 2.28200   -33.62100 1.000 44.16000  ? 74  LEU A CB    1 
ATOM   586  C  CG    . LEU A 1 86  ? -38.84400 1.60200   -33.34200 1.000 48.08000  ? 74  LEU A CG    1 
ATOM   587  C  CD1   . LEU A 1 86  ? -39.06300 0.43300   -34.27800 1.000 47.54000  ? 74  LEU A CD1   1 
ATOM   588  C  CD2   . LEU A 1 86  ? -38.87100 1.13700   -31.90800 1.000 45.75000  ? 74  LEU A CD2   1 
ATOM   589  N  N     . VAL A 1 87  ? -34.75700 3.34100   -32.52900 1.000 48.95000  ? 75  VAL A N     1 
ATOM   590  C  CA    . VAL A 1 87  ? -33.39000 3.69600   -32.86900 1.000 47.51000  ? 75  VAL A CA    1 
ATOM   591  C  C     . VAL A 1 87  ? -32.65200 2.43500   -33.29800 1.000 47.23000  ? 75  VAL A C     1 
ATOM   592  O  O     . VAL A 1 87  ? -32.66200 1.42800   -32.59000 1.000 48.17000  ? 75  VAL A O     1 
ATOM   593  C  CB    . VAL A 1 87  ? -32.65200 4.35300   -31.69000 1.000 41.96000  ? 75  VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 87  ? -31.26800 4.78400   -32.11300 1.000 45.04000  ? 75  VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 87  ? -33.43900 5.53100   -31.15700 1.000 41.20000  ? 75  VAL A CG2   1 
ATOM   596  N  N     . ASP A 1 88  ? -32.03200 2.48100   -34.47000 1.000 51.72000  ? 76  ASP A N     1 
ATOM   597  C  CA    . ASP A 1 88  ? -31.27600 1.33700   -34.95100 1.000 52.45000  ? 76  ASP A CA    1 
ATOM   598  C  C     . ASP A 1 88  ? -29.91100 1.32900   -34.28800 1.000 46.95000  ? 76  ASP A C     1 
ATOM   599  O  O     . ASP A 1 88  ? -28.91800 1.69500   -34.90000 1.000 50.52000  ? 76  ASP A O     1 
ATOM   600  C  CB    . ASP A 1 88  ? -31.15300 1.36900   -36.47400 1.000 52.36000  ? 76  ASP A CB    1 
ATOM   601  C  CG    . ASP A 1 88  ? -30.27100 0.25900   -37.02200 1.000 61.47000  ? 76  ASP A CG    1 
ATOM   602  O  OD1   . ASP A 1 88  ? -29.91500 -0.67800  -36.27000 1.000 56.20000  ? 76  ASP A OD1   1 
ATOM   603  O  OD2   . ASP A 1 88  ? -29.93000 0.33000   -38.22300 1.000 68.13000  ? 76  ASP A OD2   1 
ATOM   604  N  N     . PHE A 1 89  ? -29.87200 0.89200   -33.03500 1.000 44.28000  ? 77  PHE A N     1 
ATOM   605  C  CA    . PHE A 1 89  ? -28.62900 0.86300   -32.26500 1.000 43.62000  ? 77  PHE A CA    1 
ATOM   606  C  C     . PHE A 1 89  ? -27.77500 -0.36800  -32.56200 1.000 40.65000  ? 77  PHE A C     1 
ATOM   607  O  O     . PHE A 1 89  ? -26.92200 -0.72500  -31.74700 1.000 39.27000  ? 77  PHE A O     1 
ATOM   608  C  CB    . PHE A 1 89  ? -28.91400 0.88700   -30.75700 1.000 41.92000  ? 77  PHE A CB    1 
ATOM   609  C  CG    . PHE A 1 89  ? -29.14200 2.25000   -30.18900 1.000 37.63000  ? 77  PHE A CG    1 
ATOM   610  C  CD1   . PHE A 1 89  ? -28.18600 3.23300   -30.31300 1.000 42.79000  ? 77  PHE A CD1   1 
ATOM   611  C  CD2   . PHE A 1 89  ? -30.29400 2.54000   -29.47500 1.000 40.42000  ? 77  PHE A CD2   1 
ATOM   612  C  CE1   . PHE A 1 89  ? -28.38500 4.50800   -29.76300 1.000 41.67000  ? 77  PHE A CE1   1 
ATOM   613  C  CE2   . PHE A 1 89  ? -30.49000 3.81600   -28.91800 1.000 40.35000  ? 77  PHE A CE2   1 
ATOM   614  C  CZ    . PHE A 1 89  ? -29.52800 4.79200   -29.06800 1.000 33.93000  ? 77  PHE A CZ    1 
ATOM   615  N  N     . ARG A 1 90  ? -27.99700 -1.01800  -33.70500 1.000 44.24000  ? 78  ARG A N     1 
ATOM   616  C  CA    . ARG A 1 90  ? -27.29400 -2.26500  -34.02800 1.000 39.67000  ? 78  ARG A CA    1 
ATOM   617  C  C     . ARG A 1 90  ? -25.79100 -2.16000  -33.82000 1.000 40.50000  ? 78  ARG A C     1 
ATOM   618  O  O     . ARG A 1 90  ? -25.13800 -3.14900  -33.47100 1.000 46.57000  ? 78  ARG A O     1 
ATOM   619  C  CB    . ARG A 1 90  ? -27.55400 -2.67900  -35.47100 1.000 43.81000  ? 78  ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 90  ? -28.76300 -3.53700  -35.71300 1.000 40.97000  ? 78  ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 90  ? -28.82800 -3.90300  -37.19400 1.000 49.82000  ? 78  ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 90  ? -28.90100 -2.71700  -38.04300 1.000 58.11000  ? 78  ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 90  ? -29.80500 -2.53800  -39.00500 1.000 71.10000  ? 78  ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 90  ? -30.70800 -3.48200  -39.25200 1.000 72.53000  ? 78  ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 90  ? -29.80700 -1.41700  -39.72400 1.000 64.07000  ? 78  ARG A NH2   1 
ATOM   626  N  N     . GLU A 1 91  ? -25.24400 -0.96900  -34.04400 1.000 39.96000  ? 79  GLU A N     1 
ATOM   627  C  CA    . GLU A 1 91  ? -23.80400 -0.76700  -33.91100 1.000 44.42000  ? 79  GLU A CA    1 
ATOM   628  C  C     . GLU A 1 91  ? -23.39600 -0.59900  -32.45000 1.000 47.49000  ? 79  GLU A C     1 
ATOM   629  O  O     . GLU A 1 91  ? -22.43600 -1.22700  -32.00200 1.000 48.33000  ? 79  GLU A O     1 
ATOM   630  C  CB    . GLU A 1 91  ? -23.34900 0.43900   -34.72200 1.000 49.81000  ? 79  GLU A CB    1 
ATOM   631  C  CG    . GLU A 1 91  ? -21.85800 0.67200   -34.64500 1.000 59.34000  ? 79  GLU A CG    1 
ATOM   632  C  CD    . GLU A 1 91  ? -21.07300 -0.46200  -35.27200 1.000 66.67000  ? 79  GLU A CD    1 
ATOM   633  O  OE1   . GLU A 1 91  ? -21.58000 -1.03800  -36.26600 1.000 63.57000  ? 79  GLU A OE1   1 
ATOM   634  O  OE2   . GLU A 1 91  ? -19.96200 -0.77400  -34.77100 1.000 66.95000  ? 79  GLU A OE2   1 
ATOM   635  N  N     . LEU A 1 92  ? -24.13300 0.23900   -31.71300 1.000 45.77000  ? 80  LEU A N     1 
ATOM   636  C  CA    . LEU A 1 92  ? -23.91900 0.41800   -30.26900 1.000 43.64000  ? 80  LEU A CA    1 
ATOM   637  C  C     . LEU A 1 92  ? -24.16300 -0.87700  -29.48900 1.000 46.00000  ? 80  LEU A C     1 
ATOM   638  O  O     . LEU A 1 92  ? -23.45100 -1.18900  -28.52300 1.000 46.67000  ? 80  LEU A O     1 
ATOM   639  C  CB    . LEU A 1 92  ? -24.81800 1.52500   -29.72400 1.000 46.04000  ? 80  LEU A CB    1 
ATOM   640  C  CG    . LEU A 1 92  ? -24.88000 1.58200   -28.19800 1.000 42.48000  ? 80  LEU A CG    1 
ATOM   641  C  CD1   . LEU A 1 92  ? -23.53900 2.00500   -27.61600 1.000 39.69000  ? 80  LEU A CD1   1 
ATOM   642  C  CD2   . LEU A 1 92  ? -26.00200 2.48500   -27.72900 1.000 36.74000  ? 80  LEU A CD2   1 
ATOM   643  N  N     . ASN A 1 93  ? -25.16800 -1.63300  -29.91800 1.000 42.24000  ? 81  ASN A N     1 
ATOM   644  C  CA    . ASN A 1 93  ? -25.43000 -2.94500  -29.34500 1.000 40.92000  ? 81  ASN A CA    1 
ATOM   645  C  C     . ASN A 1 93  ? -24.20200 -3.86100  -29.35000 1.000 45.10000  ? 81  ASN A C     1 
ATOM   646  O  O     . ASN A 1 93  ? -23.85700 -4.43100  -28.31200 1.000 51.30000  ? 81  ASN A O     1 
ATOM   647  C  CB    . ASN A 1 93  ? -26.59800 -3.61000  -30.08000 1.000 37.56000  ? 81  ASN A CB    1 
ATOM   648  C  CG    . ASN A 1 93  ? -27.93400 -2.95100  -29.75400 1.000 39.47000  ? 81  ASN A CG    1 
ATOM   649  O  OD1   . ASN A 1 93  ? -28.07200 -2.29200  -28.71300 1.000 41.81000  ? 81  ASN A OD1   1 
ATOM   650  N  ND2   . ASN A 1 93  ? -28.91800 -3.11200  -30.63700 1.000 34.36000  ? 81  ASN A ND2   1 
ATOM   651  N  N     . LYS A 1 94  ? -23.53200 -3.98400  -30.49500 1.000 45.74000  ? 82  LYS A N     1 
ATOM   652  C  CA    . LYS A 1 94  ? -22.32900 -4.81400  -30.59500 1.000 43.45000  ? 82  LYS A CA    1 
ATOM   653  C  C     . LYS A 1 94  ? -21.21900 -4.35200  -29.66300 1.000 40.53000  ? 82  LYS A C     1 
ATOM   654  O  O     . LYS A 1 94  ? -20.43700 -5.15900  -29.17200 1.000 39.18000  ? 82  LYS A O     1 
ATOM   655  C  CB    . LYS A 1 94  ? -21.81400 -4.83900  -32.03400 1.000 49.84000  ? 82  LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 94  ? -22.06400 -6.17600  -32.73200 1.000 59.78000  ? 82  LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 94  ? -21.87700 -6.09600  -34.24800 1.000 63.52000  ? 82  LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 94  ? -22.59600 -4.89900  -34.83900 1.000 57.64000  ? 82  LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 94  ? -22.82800 -5.07800  -36.29200 1.000 61.86000  ? 82  LYS A NZ    1 
ATOM   660  N  N     . ARG A 1 95  ? -21.16600 -3.05000  -29.41300 1.000 47.47000  ? 83  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 95  ? -20.09900 -2.46400  -28.60600 1.000 47.30000  ? 83  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 95  ? -20.46900 -2.33900  -27.12900 1.000 47.29000  ? 83  ARG A C     1 
ATOM   663  O  O     . ARG A 1 95  ? -19.62100 -1.96900  -26.31400 1.000 46.14000  ? 83  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 95  ? -19.72000 -1.08600  -29.15700 1.000 49.37000  ? 83  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 95  ? -19.13900 -1.11400  -30.56900 1.000 60.06000  ? 83  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 95  ? -19.04000 0.29200   -31.15100 1.000 68.01000  ? 83  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 95  ? -18.34900 0.32900   -32.43900 1.000 76.86000  ? 83  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 95  ? -17.08600 0.72100   -32.60100 1.000 83.23000  ? 83  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 95  ? -16.35900 1.11400   -31.55800 1.000 76.22000  ? 83  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 95  ? -16.54400 0.72200   -33.81100 1.000 87.26000  ? 83  ARG A NH2   1 
ATOM   671  N  N     . THR A 1 96  ? -21.73200 -2.63500  -26.79800 1.000 49.05000  ? 84  THR A N     1 
ATOM   672  C  CA    . THR A 1 96  ? -22.23400 -2.59900  -25.41500 1.000 45.47000  ? 84  THR A CA    1 
ATOM   673  C  C     . THR A 1 96  ? -21.99500 -3.93500  -24.70100 1.000 41.81000  ? 84  THR A C     1 
ATOM   674  O  O     . THR A 1 96  ? -22.10400 -5.00000  -25.31600 1.000 49.34000  ? 84  THR A O     1 
ATOM   675  C  CB    . THR A 1 96  ? -23.74700 -2.24000  -25.37300 1.000 42.67000  ? 84  THR A CB    1 
ATOM   676  O  OG1   . THR A 1 96  ? -23.93500 -0.91000  -25.86200 1.000 41.55000  ? 84  THR A OG1   1 
ATOM   677  C  CG2   . THR A 1 96  ? -24.30000 -2.30300  -23.96000 1.000 37.56000  ? 84  THR A CG2   1 
ATOM   678  N  N     . GLN A 1 97  ? -21.65800 -3.86400  -23.41200 1.000 40.33000  ? 85  GLN A N     1 
ATOM   679  C  CA    . GLN A 1 97  ? -21.37600 -5.04600  -22.57600 1.000 43.63000  ? 85  GLN A CA    1 
ATOM   680  C  C     . GLN A 1 97  ? -22.47200 -6.08800  -22.58100 1.000 43.28000  ? 85  GLN A C     1 
ATOM   681  O  O     . GLN A 1 97  ? -23.60900 -5.80600  -22.94800 1.000 45.01000  ? 85  GLN A O     1 
ATOM   682  C  CB    . GLN A 1 97  ? -21.24900 -4.60400  -21.11000 1.000 37.76000  ? 85  GLN A CB    1 
ATOM   683  C  CG    . GLN A 1 97  ? -22.60400 -4.13000  -20.57000 1.000 40.65000  ? 85  GLN A CG    1 
ATOM   684  C  CD    . GLN A 1 97  ? -22.59400 -3.85900  -19.08500 1.000 40.95000  ? 85  GLN A CD    1 
ATOM   685  O  OE1   . GLN A 1 97  ? -22.12700 -2.80600  -18.64200 1.000 46.47000  ? 85  GLN A OE1   1 
ATOM   686  N  NE2   . GLN A 1 97  ? -23.10800 -4.81000  -18.29800 1.000 36.68000  ? 85  GLN A NE2   1 
ATOM   687  N  N     . ASP A 1 98  ? -22.15500 -7.29400  -22.12500 1.000 41.75000  ? 86  ASP A N     1 
ATOM   688  C  CA    . ASP A 1 98  ? -23.18200 -8.34400  -22.03100 1.000 38.74000  ? 86  ASP A CA    1 
ATOM   689  C  C     . ASP A 1 98  ? -24.07300 -8.22000  -20.79200 1.000 44.73000  ? 86  ASP A C     1 
ATOM   690  O  O     . ASP A 1 98  ? -23.61900 -7.78500  -19.72200 1.000 44.37000  ? 86  ASP A O     1 
ATOM   691  C  CB    . ASP A 1 98  ? -22.52300 -9.68600  -22.04800 1.000 31.85000  ? 86  ASP A CB    1 
ATOM   692  C  CG    . ASP A 1 98  ? -21.93300 -10.00400 -23.40700 1.000 49.33000  ? 86  ASP A CG    1 
ATOM   693  O  OD1   . ASP A 1 98  ? -22.45600 -9.47200  -24.42400 1.000 53.12000  ? 86  ASP A OD1   1 
ATOM   694  O  OD2   . ASP A 1 98  ? -20.95800 -10.78700 -23.45600 1.000 54.55000  ? 86  ASP A OD2   1 
ATOM   695  N  N     . PHE A 1 99  ? -25.34600 -8.58400  -20.95300 1.000 39.67000  ? 87  PHE A N     1 
ATOM   696  C  CA    . PHE A 1 99  ? -26.26000 -8.64600  -19.81500 1.000 34.74000  ? 87  PHE A CA    1 
ATOM   697  C  C     . PHE A 1 99  ? -26.67000 -10.07200 -19.62900 1.000 39.37000  ? 87  PHE A C     1 
ATOM   698  O  O     . PHE A 1 99  ? -26.59400 -10.85600 -20.56700 1.000 43.93000  ? 87  PHE A O     1 
ATOM   699  C  CB    . PHE A 1 99  ? -27.50600 -7.79500  -20.01600 1.000 33.59000  ? 87  PHE A CB    1 
ATOM   700  C  CG    . PHE A 1 99  ? -27.21500 -6.38800  -20.38100 1.000 39.84000  ? 87  PHE A CG    1 
ATOM   701  C  CD1   . PHE A 1 99  ? -26.98500 -6.03800  -21.70500 1.000 44.38000  ? 87  PHE A CD1   1 
ATOM   702  C  CD2   . PHE A 1 99  ? -27.16600 -5.41200  -19.41400 1.000 34.38000  ? 87  PHE A CD2   1 
ATOM   703  C  CE1   . PHE A 1 99  ? -26.70900 -4.74000  -22.05100 1.000 40.29000  ? 87  PHE A CE1   1 
ATOM   704  C  CE2   . PHE A 1 99  ? -26.89000 -4.11400  -19.75500 1.000 38.77000  ? 87  PHE A CE2   1 
ATOM   705  C  CZ    . PHE A 1 99  ? -26.66100 -3.77500  -21.07100 1.000 40.59000  ? 87  PHE A CZ    1 
ATOM   706  N  N     . TRP A 1 100 ? -27.09600 -10.41800 -18.42000 1.000 40.44000  ? 88  TRP A N     1 
ATOM   707  C  CA    . TRP A 1 100 ? -27.76000 -11.69600 -18.22900 1.000 38.23000  ? 88  TRP A CA    1 
ATOM   708  C  C     . TRP A 1 100 ? -29.25100 -11.42800 -18.25900 1.000 36.42000  ? 88  TRP A C     1 
ATOM   709  O  O     . TRP A 1 100 ? -29.80100 -10.80100 -17.34800 1.000 37.69000  ? 88  TRP A O     1 
ATOM   710  C  CB    . TRP A 1 100 ? -27.36000 -12.37100 -16.92400 1.000 35.15000  ? 88  TRP A CB    1 
ATOM   711  C  CG    . TRP A 1 100 ? -27.87800 -13.74800 -16.85200 1.000 32.69000  ? 88  TRP A CG    1 
ATOM   712  C  CD1   . TRP A 1 100 ? -28.98200 -14.18200 -16.16600 1.000 31.20000  ? 88  TRP A CD1   1 
ATOM   713  C  CD2   . TRP A 1 100 ? -27.34100 -14.89400 -17.52000 1.000 32.85000  ? 88  TRP A CD2   1 
ATOM   714  N  NE1   . TRP A 1 100 ? -29.14500 -15.53500 -16.35000 1.000 31.06000  ? 88  TRP A NE1   1 
ATOM   715  C  CE2   . TRP A 1 100 ? -28.15700 -15.99400 -17.18300 1.000 30.25000  ? 88  TRP A CE2   1 
ATOM   716  C  CE3   . TRP A 1 100 ? -26.24800 -15.09700 -18.36800 1.000 29.70000  ? 88  TRP A CE3   1 
ATOM   717  C  CZ2   . TRP A 1 100 ? -27.91000 -17.27800 -17.66500 1.000 31.42000  ? 88  TRP A CZ2   1 
ATOM   718  C  CZ3   . TRP A 1 100 ? -26.00000 -16.36100 -18.84100 1.000 23.07000  ? 88  TRP A CZ3   1 
ATOM   719  C  CH2   . TRP A 1 100 ? -26.82700 -17.44300 -18.48700 1.000 34.79000  ? 88  TRP A CH2   1 
ATOM   720  N  N     . GLU A 1 101 ? -29.88900 -11.86500 -19.33600 1.000 32.13000  ? 89  GLU A N     1 
ATOM   721  C  CA    . GLU A 1 101 ? -31.31200 -11.68500 -19.50600 1.000 34.93000  ? 89  GLU A CA    1 
ATOM   722  C  C     . GLU A 1 101 ? -32.04800 -12.30400 -18.34100 1.000 34.90000  ? 89  GLU A C     1 
ATOM   723  O  O     . GLU A 1 101 ? -31.74400 -13.43600 -17.94600 1.000 35.16000  ? 89  GLU A O     1 
ATOM   724  C  CB    . GLU A 1 101 ? -31.76000 -12.30000 -20.82500 1.000 25.92000  ? 89  GLU A CB    1 
ATOM   725  C  CG    . GLU A 1 101 ? -31.02100 -11.70300 -22.00600 1.000 29.32000  ? 89  GLU A CG    1 
ATOM   726  C  CD    . GLU A 1 101 ? -31.22800 -10.18500 -22.14400 1.000 44.28000  ? 89  GLU A CD    1 
ATOM   727  O  OE1   . GLU A 1 101 ? -32.30400 -9.66900  -21.71400 1.000 38.23000  ? 89  GLU A OE1   1 
ATOM   728  O  OE2   . GLU A 1 101 ? -30.31100 -9.51600  -22.70300 1.000 45.52000  ? 89  GLU A OE2   1 
ATOM   729  N  N     . VAL A 1 102 ? -33.00000 -11.56300 -17.78000 1.000 29.53000  ? 90  VAL A N     1 
ATOM   730  C  CA    . VAL A 1 102 ? -33.78200 -12.09300 -16.66900 1.000 31.30000  ? 90  VAL A CA    1 
ATOM   731  C  C     . VAL A 1 102 ? -35.14900 -12.67700 -17.07500 1.000 29.50000  ? 90  VAL A C     1 
ATOM   732  O  O     . VAL A 1 102 ? -35.78700 -13.35500 -16.26700 1.000 30.60000  ? 90  VAL A O     1 
ATOM   733  C  CB    . VAL A 1 102 ? -34.00100 -11.02700 -15.61600 1.000 29.39000  ? 90  VAL A CB    1 
ATOM   734  C  CG1   . VAL A 1 102 ? -32.66900 -10.63600 -15.03300 1.000 30.82000  ? 90  VAL A CG1   1 
ATOM   735  C  CG2   . VAL A 1 102 ? -34.67800 -9.83600  -16.24000 1.000 22.65000  ? 90  VAL A CG2   1 
ATOM   736  N  N     . GLN A 1 103 ? -35.60200 -12.42600 -18.30400 1.000 29.27000  ? 91  GLN A N     1 
ATOM   737  C  CA    . GLN A 1 103 ? -36.81500 -13.08000 -18.80600 1.000 24.46000  ? 91  GLN A CA    1 
ATOM   738  C  C     . GLN A 1 103 ? -36.49600 -14.52100 -19.22600 1.000 32.12000  ? 91  GLN A C     1 
ATOM   739  O  O     . GLN A 1 103 ? -35.78900 -14.75700 -20.21200 1.000 34.30000  ? 91  GLN A O     1 
ATOM   740  C  CB    . GLN A 1 103 ? -37.41400 -12.31400 -19.97900 1.000 22.42000  ? 91  GLN A CB    1 
ATOM   741  C  CG    . GLN A 1 103 ? -38.84400 -12.70800 -20.33500 1.000 27.79000  ? 91  GLN A CG    1 
ATOM   742  C  CD    . GLN A 1 103 ? -39.85600 -12.30500 -19.25100 1.000 34.57000  ? 91  GLN A CD    1 
ATOM   743  O  OE1   . GLN A 1 103 ? -39.78100 -11.21100 -18.67900 1.000 32.75000  ? 91  GLN A OE1   1 
ATOM   744  N  NE2   . GLN A 1 103 ? -40.80500 -13.19200 -18.97000 1.000 31.58000  ? 91  GLN A NE2   1 
ATOM   745  N  N     . LEU A 1 104 ? -37.02500 -15.49000 -18.48800 1.000 26.35000  ? 92  LEU A N     1 
ATOM   746  C  CA    . LEU A 1 104 ? -36.59900 -16.87200 -18.66500 1.000 27.63000  ? 92  LEU A CA    1 
ATOM   747  C  C     . LEU A 1 104 ? -37.53200 -17.69300 -19.56800 1.000 29.66000  ? 92  LEU A C     1 
ATOM   748  O  O     . LEU A 1 104 ? -37.24300 -18.85900 -19.86700 1.000 29.89000  ? 92  LEU A O     1 
ATOM   749  C  CB    . LEU A 1 104 ? -36.47200 -17.55400 -17.29700 1.000 27.72000  ? 92  LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 104 ? -35.58000 -16.83200 -16.28600 1.000 26.52000  ? 92  LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 104 ? -35.29200 -17.71400 -15.08100 1.000 23.23000  ? 92  LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 104 ? -34.28600 -16.35900 -16.93700 1.000 24.10000  ? 92  LEU A CD2   1 
ATOM   753  N  N     . GLY A 1 105 ? -38.63500 -17.08000 -20.00000 1.000 28.96000  ? 93  GLY A N     1 
ATOM   754  C  CA    . GLY A 1 105 ? -39.68700 -17.77900 -20.71700 1.000 22.42000  ? 93  GLY A CA    1 
ATOM   755  C  C     . GLY A 1 105 ? -40.95700 -16.93900 -20.83000 1.000 30.26000  ? 93  GLY A C     1 
ATOM   756  O  O     . GLY A 1 105 ? -40.97900 -15.75600 -20.46800 1.000 28.49000  ? 93  GLY A O     1 
ATOM   757  N  N     . ILE A 1 106 ? -42.02000 -17.55900 -21.34200 1.000 30.14000  ? 94  ILE A N     1 
ATOM   758  C  CA    . ILE A 1 106 ? -43.26600 -16.86800 -21.65100 1.000 25.70000  ? 94  ILE A CA    1 
ATOM   759  C  C     . ILE A 1 106 ? -44.39000 -17.46100 -20.81500 1.000 25.53000  ? 94  ILE A C     1 
ATOM   760  O  O     . ILE A 1 106 ? -44.60300 -18.66700 -20.83200 1.000 25.37000  ? 94  ILE A O     1 
ATOM   761  C  CB    . ILE A 1 106 ? -43.61600 -16.99600 -23.15300 1.000 26.93000  ? 94  ILE A CB    1 
ATOM   762  C  CG1   . ILE A 1 106 ? -42.37800 -16.73800 -24.00400 1.000 30.43000  ? 94  ILE A CG1   1 
ATOM   763  C  CG2   . ILE A 1 106 ? -44.74600 -16.04400 -23.54100 1.000 26.64000  ? 94  ILE A CG2   1 
ATOM   764  C  CD1   . ILE A 1 106 ? -41.69400 -15.38700 -23.66000 1.000 31.27000  ? 94  ILE A CD1   1 
ATOM   765  N  N     . PRO A 1 107 ? -45.10700 -16.62600 -20.06400 1.000 25.99000  ? 95  PRO A N     1 
ATOM   766  C  CA    . PRO A 1 107 ? -46.20000 -17.23200 -19.30200 1.000 20.67000  ? 95  PRO A CA    1 
ATOM   767  C  C     . PRO A 1 107 ? -47.29300 -17.77500 -20.22000 1.000 28.38000  ? 95  PRO A C     1 
ATOM   768  O  O     . PRO A 1 107 ? -47.52000 -17.25800 -21.31700 1.000 24.05000  ? 95  PRO A O     1 
ATOM   769  C  CB    . PRO A 1 107 ? -46.72800 -16.07900 -18.44600 1.000 24.29000  ? 95  PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 107 ? -46.21700 -14.83300 -19.08100 1.000 22.26000  ? 95  PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 107 ? -44.92900 -15.19300 -19.76900 1.000 24.92000  ? 95  PRO A CD    1 
ATOM   772  N  N     . HIS A 1 108 ? -47.96400 -18.82900 -19.76200 1.000 29.90000  ? 96  HIS A N     1 
ATOM   773  C  CA    . HIS A 1 108 ? -48.99500 -19.46700 -20.55200 1.000 28.71000  ? 96  HIS A CA    1 
ATOM   774  C  C     . HIS A 1 108 ? -50.33300 -19.49400 -19.81600 1.000 27.00000  ? 96  HIS A C     1 
ATOM   775  O  O     . HIS A 1 108 ? -50.37600 -19.84500 -18.63600 1.000 29.79000  ? 96  HIS A O     1 
ATOM   776  C  CB    . HIS A 1 108 ? -48.57400 -20.88700 -20.91100 1.000 27.86000  ? 96  HIS A CB    1 
ATOM   777  C  CG    . HIS A 1 108 ? -49.34500 -21.44500 -22.05100 1.000 28.38000  ? 96  HIS A CG    1 
ATOM   778  N  ND1   . HIS A 1 108 ? -50.67200 -21.83400 -21.93000 1.000 30.40000  ? 96  HIS A ND1   1 
ATOM   779  C  CD2   . HIS A 1 108 ? -49.02800 -21.61400 -23.35600 1.000 26.55000  ? 96  HIS A CD2   1 
ATOM   780  C  CE1   . HIS A 1 108 ? -51.11300 -22.24700 -23.09800 1.000 30.41000  ? 96  HIS A CE1   1 
ATOM   781  N  NE2   . HIS A 1 108 ? -50.13200 -22.12900 -23.98800 1.000 33.95000  ? 96  HIS A NE2   1 
ATOM   782  N  N     . PRO A 1 109 ? -51.43400 -19.14400 -20.50400 1.000 27.45000  ? 97  PRO A N     1 
ATOM   783  C  CA    . PRO A 1 109 ? -52.72700 -19.08300 -19.80400 1.000 28.21000  ? 97  PRO A CA    1 
ATOM   784  C  C     . PRO A 1 109 ? -53.09500 -20.41200 -19.13700 1.000 28.99000  ? 97  PRO A C     1 
ATOM   785  O  O     . PRO A 1 109 ? -53.79700 -20.41100 -18.12800 1.000 29.88000  ? 97  PRO A O     1 
ATOM   786  C  CB    . PRO A 1 109 ? -53.72900 -18.72200 -20.91800 1.000 23.39000  ? 97  PRO A CB    1 
ATOM   787  C  CG    . PRO A 1 109 ? -53.03200 -18.99300 -22.20100 1.000 23.89000  ? 97  PRO A CG    1 
ATOM   788  C  CD    . PRO A 1 109 ? -51.56100 -18.77500 -21.91900 1.000 27.75000  ? 97  PRO A CD    1 
ATOM   789  N  N     . ALA A 1 110 ? -52.59700 -21.53100 -19.65400 1.000 24.96000  ? 98  ALA A N     1 
ATOM   790  C  CA    . ALA A 1 110 ? -52.96600 -22.82300 -19.08000 1.000 23.99000  ? 98  ALA A CA    1 
ATOM   791  C  C     . ALA A 1 110 ? -52.41000 -23.00200 -17.66500 1.000 27.61000  ? 98  ALA A C     1 
ATOM   792  O  O     . ALA A 1 110 ? -52.83000 -23.90400 -16.93800 1.000 28.43000  ? 98  ALA A O     1 
ATOM   793  C  CB    . ALA A 1 110 ? -52.49900 -23.95800 -19.97900 1.000 22.59000  ? 98  ALA A CB    1 
ATOM   794  N  N     . GLY A 1 111 ? -51.47300 -22.14600 -17.27200 1.000 23.01000  ? 99  GLY A N     1 
ATOM   795  C  CA    . GLY A 1 111 ? -50.86700 -22.26600 -15.96400 1.000 21.71000  ? 99  GLY A CA    1 
ATOM   796  C  C     . GLY A 1 111 ? -51.48800 -21.32000 -14.95100 1.000 29.44000  ? 99  GLY A C     1 
ATOM   797  O  O     . GLY A 1 111 ? -51.12400 -21.35600 -13.77300 1.000 30.32000  ? 99  GLY A O     1 
ATOM   798  N  N     . LEU A 1 112 ? -52.41400 -20.47000 -15.40100 1.000 25.71000  ? 100 LEU A N     1 
ATOM   799  C  CA    . LEU A 1 112 ? -53.16600 -19.60700 -14.48800 1.000 29.83000  ? 100 LEU A CA    1 
ATOM   800  C  C     . LEU A 1 112 ? -54.20600 -20.41300 -13.73400 1.000 28.38000  ? 100 LEU A C     1 
ATOM   801  O  O     . LEU A 1 112 ? -54.87600 -21.26100 -14.32100 1.000 31.10000  ? 100 LEU A O     1 
ATOM   802  C  CB    . LEU A 1 112 ? -53.88000 -18.47300 -15.23700 1.000 25.91000  ? 100 LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 112 ? -53.08500 -17.54400 -16.14500 1.000 25.51000  ? 100 LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 112 ? -54.04500 -16.83700 -17.06800 1.000 22.29000  ? 100 LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 112 ? -52.28300 -16.53600 -15.32100 1.000 28.29000  ? 100 LEU A CD2   1 
ATOM   806  N  N     . LYS A 1 113 ? -54.35300 -20.13000 -12.44700 1.000 29.02000  ? 101 LYS A N     1 
ATOM   807  C  CA    . LYS A 1 113 ? -55.39000 -20.74000 -11.63100 1.000 31.82000  ? 101 LYS A CA    1 
ATOM   808  C  C     . LYS A 1 113 ? -56.63600 -19.85000 -11.62700 1.000 31.91000  ? 101 LYS A C     1 
ATOM   809  O  O     . LYS A 1 113 ? -56.53500 -18.65300 -11.87100 1.000 35.98000  ? 101 LYS A O     1 
ATOM   810  C  CB    . LYS A 1 113 ? -54.86900 -20.95900 -10.21200 1.000 37.01000  ? 101 LYS A CB    1 
ATOM   811  C  CG    . LYS A 1 113 ? -53.48200 -21.58600 -10.15400 1.000 36.43000  ? 101 LYS A CG    1 
ATOM   812  C  CD    . LYS A 1 113 ? -52.99700 -21.69900 -8.72500  1.000 40.42000  ? 101 LYS A CD    1 
ATOM   813  C  CE    . LYS A 1 113 ? -51.53600 -22.12600 -8.65800  1.000 34.43000  ? 101 LYS A CE    1 
ATOM   814  N  NZ    . LYS A 1 113 ? -51.22000 -22.72000 -7.31100  1.000 44.56000  ? 101 LYS A NZ    1 
ATOM   815  N  N     . LYS A 1 114 ? -57.80600 -20.42400 -11.35900 1.000 28.67000  ? 102 LYS A N     1 
ATOM   816  C  CA    . LYS A 1 114 ? -59.03500 -19.63600 -11.37400 1.000 35.33000  ? 102 LYS A CA    1 
ATOM   817  C  C     . LYS A 1 114 ? -59.00600 -18.55100 -10.30800 1.000 36.58000  ? 102 LYS A C     1 
ATOM   818  O  O     . LYS A 1 114 ? -58.66900 -18.81200 -9.14900  1.000 35.68000  ? 102 LYS A O     1 
ATOM   819  C  CB    . LYS A 1 114 ? -60.26200 -20.52400 -11.17600 1.000 35.21000  ? 102 LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 114 ? -61.14400 -20.67900 -12.44100 1.000 52.41000  ? 102 LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 114 ? -61.10800 -22.13500 -12.99700 1.000 53.26000  ? 102 LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 114 ? -61.91900 -22.31100 -14.31000 1.000 49.95000  ? 102 LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 114 ? -61.36400 -23.40400 -15.22800 1.000 44.09000  ? 102 LYS A NZ    1 
ATOM   824  N  N     . LYS A 1 115 ? -59.35100 -17.32900 -10.70400 1.000 34.77000  ? 103 LYS A N     1 
ATOM   825  C  CA    . LYS A 1 115 ? -59.30900 -16.19700 -9.78700  1.000 37.21000  ? 103 LYS A CA    1 
ATOM   826  C  C     . LYS A 1 115 ? -60.66900 -15.55100 -9.64300  1.000 36.38000  ? 103 LYS A C     1 
ATOM   827  O  O     . LYS A 1 115 ? -61.42300 -15.45000 -10.61400 1.000 40.14000  ? 103 LYS A O     1 
ATOM   828  C  CB    . LYS A 1 115 ? -58.29000 -15.16700 -10.26300 1.000 33.91000  ? 103 LYS A CB    1 
ATOM   829  C  CG    . LYS A 1 115 ? -56.86900 -15.63700 -10.09100 1.000 34.44000  ? 103 LYS A CG    1 
ATOM   830  C  CD    . LYS A 1 115 ? -56.58100 -15.77100 -8.62400  1.000 34.40000  ? 103 LYS A CD    1 
ATOM   831  C  CE    . LYS A 1 115 ? -55.25000 -16.40900 -8.38400  1.000 30.45000  ? 103 LYS A CE    1 
ATOM   832  N  NZ    . LYS A 1 115 ? -55.06700 -16.54000 -6.91300  1.000 40.26000  ? 103 LYS A NZ    1 
ATOM   833  N  N     . LYS A 1 116 ? -60.98200 -15.10000 -8.43600  1.000 36.06000  ? 104 LYS A N     1 
ATOM   834  C  CA    . LYS A 1 116 ? -62.27500 -14.48300 -8.19600  1.000 32.62000  ? 104 LYS A CA    1 
ATOM   835  C  C     . LYS A 1 116 ? -62.33200 -13.15900 -8.93800  1.000 30.65000  ? 104 LYS A C     1 
ATOM   836  O  O     . LYS A 1 116 ? -63.36200 -12.78200 -9.48200  1.000 34.51000  ? 104 LYS A O     1 
ATOM   837  C  CB    . LYS A 1 116 ? -62.51600 -14.29600 -6.69600  1.000 31.90000  ? 104 LYS A CB    1 
ATOM   838  C  CG    . LYS A 1 116 ? -63.96800 -14.02400 -6.32400  1.000 47.31000  ? 104 LYS A CG    1 
ATOM   839  C  CD    . LYS A 1 116 ? -64.33100 -14.68000 -4.98500  1.000 57.91000  ? 104 LYS A CD    1 
ATOM   840  C  CE    . LYS A 1 116 ? -65.83900 -14.90900 -4.85400  1.000 55.80000  ? 104 LYS A CE    1 
ATOM   841  N  NZ    . LYS A 1 116 ? -66.57400 -13.62300 -4.72000  1.000 55.24000  ? 104 LYS A NZ    1 
ATOM   842  N  N     . SER A 1 117 ? -61.20700 -12.46200 -8.98600  1.000 35.65000  ? 105 SER A N     1 
ATOM   843  C  CA    . SER A 1 117 ? -61.17100 -11.13400 -9.58600  1.000 28.31000  ? 105 SER A CA    1 
ATOM   844  C  C     . SER A 1 117 ? -59.87400 -10.91200 -10.36000 1.000 30.15000  ? 105 SER A C     1 
ATOM   845  O  O     . SER A 1 117 ? -58.80700 -11.39100 -9.98200  1.000 31.73000  ? 105 SER A O     1 
ATOM   846  C  CB    . SER A 1 117 ? -61.33500 -10.08100 -8.51000  1.000 30.79000  ? 105 SER A CB    1 
ATOM   847  O  OG    . SER A 1 117 ? -62.60400 -10.17100 -7.90000  1.000 34.60000  ? 105 SER A OG    1 
ATOM   848  N  N     . VAL A 1 118 ? -59.96600 -10.18400 -11.45700 1.000 28.22000  ? 106 VAL A N     1 
ATOM   849  C  CA    . VAL A 1 118 ? -58.85100 -10.10600 -12.38500 1.000 28.31000  ? 106 VAL A CA    1 
ATOM   850  C  C     . VAL A 1 118 ? -58.77200 -8.71800  -13.02100 1.000 32.07000  ? 106 VAL A C     1 
ATOM   851  O  O     . VAL A 1 118 ? -59.79300 -8.12400  -13.37600 1.000 32.98000  ? 106 VAL A O     1 
ATOM   852  C  CB    . VAL A 1 118 ? -58.98200 -11.16400 -13.49800 1.000 32.94000  ? 106 VAL A CB    1 
ATOM   853  C  CG1   . VAL A 1 118 ? -58.00600 -10.87700 -14.64400 1.000 26.73000  ? 106 VAL A CG1   1 
ATOM   854  C  CG2   . VAL A 1 118 ? -58.83400 -12.59300 -12.94700 1.000 28.77000  ? 106 VAL A CG2   1 
ATOM   855  N  N     . THR A 1 119 ? -57.55500 -8.20800  -13.16600 1.000 32.77000  ? 107 THR A N     1 
ATOM   856  C  CA    . THR A 1 119 ? -57.33100 -6.94000  -13.83200 1.000 30.06000  ? 107 THR A CA    1 
ATOM   857  C  C     . THR A 1 119 ? -56.13000 -7.05300  -14.76100 1.000 31.00000  ? 107 THR A C     1 
ATOM   858  O  O     . THR A 1 119 ? -55.17600 -7.77500  -14.45200 1.000 33.10000  ? 107 THR A O     1 
ATOM   859  C  CB    . THR A 1 119 ? -57.08000 -5.82800  -12.82200 1.000 28.71000  ? 107 THR A CB    1 
ATOM   860  O  OG1   . THR A 1 119 ? -58.16100 -5.79300  -11.89000 1.000 30.77000  ? 107 THR A OG1   1 
ATOM   861  C  CG2   . THR A 1 119 ? -56.97900 -4.50600  -13.52200 1.000 26.72000  ? 107 THR A CG2   1 
ATOM   862  N  N     . VAL A 1 120 ? -56.16700 -6.34700  -15.89100 1.000 30.86000  ? 108 VAL A N     1 
ATOM   863  C  CA    . VAL A 1 120 ? -54.99300 -6.24700  -16.74500 1.000 25.95000  ? 108 VAL A CA    1 
ATOM   864  C  C     . VAL A 1 120 ? -54.65000 -4.77700  -16.89500 1.000 32.50000  ? 108 VAL A C     1 
ATOM   865  O  O     . VAL A 1 120 ? -55.48600 -3.97000  -17.28300 1.000 33.99000  ? 108 VAL A O     1 
ATOM   866  C  CB    . VAL A 1 120 ? -55.22000 -6.90300  -18.10300 1.000 27.10000  ? 108 VAL A CB    1 
ATOM   867  C  CG1   . VAL A 1 120 ? -54.02600 -6.71900  -18.97700 1.000 28.40000  ? 108 VAL A CG1   1 
ATOM   868  C  CG2   . VAL A 1 120 ? -55.52700 -8.40100  -17.92700 1.000 23.48000  ? 108 VAL A CG2   1 
ATOM   869  N  N     . LEU A 1 121 ? -53.42400 -4.43200  -16.51800 1.000 36.36000  ? 109 LEU A N     1 
ATOM   870  C  CA    . LEU A 1 121 ? -52.92500 -3.06600  -16.58900 1.000 33.43000  ? 109 LEU A CA    1 
ATOM   871  C  C     . LEU A 1 121 ? -51.73500 -2.98700  -17.52900 1.000 38.02000  ? 109 LEU A C     1 
ATOM   872  O  O     . LEU A 1 121 ? -50.89200 -3.88500  -17.54900 1.000 34.98000  ? 109 LEU A O     1 
ATOM   873  C  CB    . LEU A 1 121 ? -52.47700 -2.56700  -15.22300 1.000 30.32000  ? 109 LEU A CB    1 
ATOM   874  C  CG    . LEU A 1 121 ? -53.43300 -2.56900  -14.05500 1.000 30.50000  ? 109 LEU A CG    1 
ATOM   875  C  CD1   . LEU A 1 121 ? -52.60900 -2.41800  -12.80600 1.000 29.48000  ? 109 LEU A CD1   1 
ATOM   876  C  CD2   . LEU A 1 121 ? -54.40100 -1.40700  -14.18200 1.000 35.51000  ? 109 LEU A CD2   1 
ATOM   877  N  N     . ASP A 1 122 ? -51.66000 -1.89700  -18.27800 1.000 36.61000  ? 110 ASP A N     1 
ATOM   878  C  CA    . ASP A 1 122 ? -50.50900 -1.59600  -19.10500 1.000 36.64000  ? 110 ASP A CA    1 
ATOM   879  C  C     . ASP A 1 122 ? -49.84300 -0.38400  -18.47000 1.000 41.18000  ? 110 ASP A C     1 
ATOM   880  O  O     . ASP A 1 122 ? -50.54600 0.47300   -17.92400 1.000 34.91000  ? 110 ASP A O     1 
ATOM   881  C  CB    . ASP A 1 122 ? -50.93800 -1.31000  -20.54900 1.000 43.19000  ? 110 ASP A CB    1 
ATOM   882  C  CG    . ASP A 1 122 ? -49.85700 -1.64600  -21.57100 1.000 54.48000  ? 110 ASP A CG    1 
ATOM   883  O  OD1   . ASP A 1 122 ? -49.81500 -2.81100  -22.05300 1.000 67.59000  ? 110 ASP A OD1   1 
ATOM   884  O  OD2   . ASP A 1 122 ? -49.05700 -0.74000  -21.90800 1.000 55.90000  ? 110 ASP A OD2   1 
ATOM   885  N  N     . VAL A 1 123 ? -48.50800 -0.32800  -18.49700 1.000 35.76000  ? 111 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 123 ? -47.77700 0.84100   -18.02300 1.000 34.58000  ? 111 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 123 ? -47.62900 1.78900   -19.20200 1.000 38.78000  ? 111 VAL A C     1 
ATOM   888  O  O     . VAL A 1 123 ? -47.40300 1.34400   -20.32800 1.000 42.22000  ? 111 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 123 ? -46.38500 0.47000   -17.44900 1.000 40.79000  ? 111 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 123 ? -45.53400 1.70100   -17.27000 1.000 39.12000  ? 111 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 123 ? -46.51200 -0.24600  -16.11900 1.000 40.63000  ? 111 VAL A CG2   1 
ATOM   892  N  N     . GLY A 1 124 ? -47.78300 3.08600   -18.95800 1.000 36.30000  ? 112 GLY A N     1 
ATOM   893  C  CA    . GLY A 1 124 ? -47.70600 4.06900   -20.02600 1.000 34.79000  ? 112 GLY A CA    1 
ATOM   894  C  C     . GLY A 1 124 ? -46.29100 4.54500   -20.24200 1.000 39.41000  ? 112 GLY A C     1 
ATOM   895  O  O     . GLY A 1 124 ? -45.58100 4.83800   -19.27500 1.000 37.94000  ? 112 GLY A O     1 
ATOM   896  N  N     . ASP A 1 125 ? -45.89600 4.62300   -21.51200 1.000 45.05000  ? 113 ASP A N     1 
ATOM   897  C  CA    . ASP A 1 125 ? -44.54800 5.01800   -21.93700 1.000 42.17000  ? 113 ASP A CA    1 
ATOM   898  C  C     . ASP A 1 125 ? -43.48100 4.47900   -21.00100 1.000 42.16000  ? 113 ASP A C     1 
ATOM   899  O  O     . ASP A 1 125 ? -42.60200 5.20400   -20.51600 1.000 41.65000  ? 113 ASP A O     1 
ATOM   900  C  CB    . ASP A 1 125 ? -44.46500 6.53200   -22.08400 1.000 47.55000  ? 113 ASP A CB    1 
ATOM   901  C  CG    . ASP A 1 125 ? -45.13700 7.01200   -23.36800 1.000 65.12000  ? 113 ASP A CG    1 
ATOM   902  O  OD1   . ASP A 1 125 ? -45.18800 6.19900   -24.32400 1.000 66.34000  ? 113 ASP A OD1   1 
ATOM   903  O  OD2   . ASP A 1 125 ? -45.61800 8.17200   -23.42900 1.000 72.67000  ? 113 ASP A OD2   1 
ATOM   904  N  N     . ALA A 1 126 ? -43.58600 3.17200   -20.78300 1.000 40.15000  ? 114 ALA A N     1 
ATOM   905  C  CA    . ALA A 1 126 ? -42.79800 2.41800   -19.81900 1.000 36.86000  ? 114 ALA A CA    1 
ATOM   906  C  C     . ALA A 1 126 ? -41.28300 2.64700   -19.86900 1.000 38.03000  ? 114 ALA A C     1 
ATOM   907  O  O     . ALA A 1 126 ? -40.69200 3.06000   -18.87100 1.000 34.51000  ? 114 ALA A O     1 
ATOM   908  C  CB    . ALA A 1 126 ? -43.09100 0.95000   -20.00300 1.000 40.72000  ? 114 ALA A CB    1 
ATOM   909  N  N     . TYR A 1 127 ? -40.65800 2.34200   -21.00700 1.000 35.68000  ? 115 TYR A N     1 
ATOM   910  C  CA    . TYR A 1 127 ? -39.23400 2.58300   -21.17400 1.000 33.16000  ? 115 TYR A CA    1 
ATOM   911  C  C     . TYR A 1 127 ? -38.86400 4.00800   -20.78400 1.000 36.39000  ? 115 TYR A C     1 
ATOM   912  O  O     . TYR A 1 127 ? -37.94100 4.23000   -20.01200 1.000 37.19000  ? 115 TYR A O     1 
ATOM   913  C  CB    . TYR A 1 127 ? -38.80500 2.34000   -22.60700 1.000 28.70000  ? 115 TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 127 ? -38.52300 0.90100   -22.93000 1.000 39.72000  ? 115 TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 127 ? -39.06000 -0.12600  -22.16900 1.000 40.41000  ? 115 TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 127 ? -37.68900 0.56400   -23.98900 1.000 39.46000  ? 115 TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 127 ? -38.79400 -1.46500  -22.47500 1.000 36.95000  ? 115 TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 127 ? -37.41500 -0.75700  -24.29300 1.000 40.98000  ? 115 TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 127 ? -37.97000 -1.77000  -23.54000 1.000 38.78000  ? 115 TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 127 ? -37.69200 -3.08200  -23.86300 1.000 35.88000  ? 115 TYR A OH    1 
ATOM   921  N  N     . PHE A 1 128 ? -39.60900 4.97100   -21.30600 1.000 37.24000  ? 116 PHE A N     1 
ATOM   922  C  CA    . PHE A 1 128 ? -39.27100 6.37400   -21.11600 1.000 38.30000  ? 116 PHE A CA    1 
ATOM   923  C  C     . PHE A 1 128 ? -39.55100 6.85000   -19.68300 1.000 40.48000  ? 116 PHE A C     1 
ATOM   924  O  O     . PHE A 1 128 ? -39.43300 8.04000   -19.38400 1.000 38.40000  ? 116 PHE A O     1 
ATOM   925  C  CB    . PHE A 1 128 ? -40.04300 7.24600   -22.11100 1.000 36.24000  ? 116 PHE A CB    1 
ATOM   926  C  CG    . PHE A 1 128 ? -39.83200 6.87200   -23.55100 1.000 34.84000  ? 116 PHE A CG    1 
ATOM   927  C  CD1   . PHE A 1 128 ? -38.69200 6.19900   -23.95900 1.000 41.24000  ? 116 PHE A CD1   1 
ATOM   928  C  CD2   . PHE A 1 128 ? -40.77600 7.21100   -24.50600 1.000 43.83000  ? 116 PHE A CD2   1 
ATOM   929  C  CE1   . PHE A 1 128 ? -38.50400 5.85700   -25.30200 1.000 43.21000  ? 116 PHE A CE1   1 
ATOM   930  C  CE2   . PHE A 1 128 ? -40.59700 6.87900   -25.84400 1.000 43.04000  ? 116 PHE A CE2   1 
ATOM   931  C  CZ    . PHE A 1 128 ? -39.46200 6.20000   -26.24200 1.000 43.78000  ? 116 PHE A CZ    1 
ATOM   932  N  N     . SER A 1 129 ? -39.93300 5.93000   -18.80300 1.000 36.93000  ? 117 SER A N     1 
ATOM   933  C  CA    . SER A 1 129 ? -40.14300 6.27600   -17.40700 1.000 33.66000  ? 117 SER A CA    1 
ATOM   934  C  C     . SER A 1 129 ? -39.04000 5.67700   -16.53500 1.000 37.86000  ? 117 SER A C     1 
ATOM   935  O  O     . SER A 1 129 ? -39.12300 5.75000   -15.31200 1.000 41.49000  ? 117 SER A O     1 
ATOM   936  C  CB    . SER A 1 129 ? -41.52200 5.80500   -16.92500 1.000 36.43000  ? 117 SER A CB    1 
ATOM   937  O  OG    . SER A 1 129 ? -42.58500 6.54300   -17.52500 1.000 37.35000  ? 117 SER A OG    1 
ATOM   938  N  N     . VAL A 1 130 ? -38.01300 5.09400   -17.16000 1.000 30.61000  ? 118 VAL A N     1 
ATOM   939  C  CA    . VAL A 1 130 ? -36.89800 4.48100   -16.43300 1.000 32.68000  ? 118 VAL A CA    1 
ATOM   940  C  C     . VAL A 1 130 ? -35.58200 5.15400   -16.83900 1.000 34.92000  ? 118 VAL A C     1 
ATOM   941  O  O     . VAL A 1 130 ? -35.21200 5.16100   -18.00800 1.000 35.53000  ? 118 VAL A O     1 
ATOM   942  C  CB    . VAL A 1 130 ? -36.83000 2.94700   -16.68200 1.000 32.57000  ? 118 VAL A CB    1 
ATOM   943  C  CG1   . VAL A 1 130 ? -35.54000 2.34500   -16.14400 1.000 26.66000  ? 118 VAL A CG1   1 
ATOM   944  C  CG2   . VAL A 1 130 ? -38.01600 2.26000   -16.04800 1.000 29.76000  ? 118 VAL A CG2   1 
ATOM   945  N  N     . PRO A 1 131 ? -34.87400 5.74800   -15.87200 1.000 38.76000  ? 119 PRO A N     1 
ATOM   946  C  CA    . PRO A 1 131 ? -33.71200 6.53800   -16.27800 1.000 30.83000  ? 119 PRO A CA    1 
ATOM   947  C  C     . PRO A 1 131 ? -32.58400 5.65500   -16.77800 1.000 37.09000  ? 119 PRO A C     1 
ATOM   948  O  O     . PRO A 1 131 ? -32.45500 4.51200   -16.33200 1.000 35.42000  ? 119 PRO A O     1 
ATOM   949  C  CB    . PRO A 1 131 ? -33.31800 7.26300   -14.99400 1.000 28.04000  ? 119 PRO A CB    1 
ATOM   950  C  CG    . PRO A 1 131 ? -33.78000 6.34700   -13.89100 1.000 38.29000  ? 119 PRO A CG    1 
ATOM   951  C  CD    . PRO A 1 131 ? -35.05900 5.73800   -14.40800 1.000 41.02000  ? 119 PRO A CD    1 
ATOM   952  N  N     . LEU A 1 132 ? -31.79900 6.19600   -17.71000 1.000 40.04000  ? 120 LEU A N     1 
ATOM   953  C  CA    . LEU A 1 132 ? -30.60900 5.55500   -18.25900 1.000 37.03000  ? 120 LEU A CA    1 
ATOM   954  C  C     . LEU A 1 132 ? -29.35600 6.04700   -17.52800 1.000 39.82000  ? 120 LEU A C     1 
ATOM   955  O  O     . LEU A 1 132 ? -29.27600 7.22600   -17.18800 1.000 43.39000  ? 120 LEU A O     1 
ATOM   956  C  CB    . LEU A 1 132 ? -30.49800 5.85300   -19.75500 1.000 36.37000  ? 120 LEU A CB    1 
ATOM   957  C  CG    . LEU A 1 132 ? -29.21900 5.39500   -20.44700 1.000 33.18000  ? 120 LEU A CG    1 
ATOM   958  C  CD1   . LEU A 1 132 ? -29.13400 3.89400   -20.38000 1.000 33.40000  ? 120 LEU A CD1   1 
ATOM   959  C  CD2   . LEU A 1 132 ? -29.22800 5.84900   -21.87700 1.000 34.65000  ? 120 LEU A CD2   1 
ATOM   960  N  N     . ASP A 1 133 ? -28.39900 5.14900   -17.28800 1.000 41.63000  ? 121 ASP A N     1 
ATOM   961  C  CA    . ASP A 1 133 ? -27.12800 5.47500   -16.63300 1.000 44.17000  ? 121 ASP A CA    1 
ATOM   962  C  C     . ASP A 1 133 ? -26.49200 6.73500   -17.20800 1.000 46.50000  ? 121 ASP A C     1 
ATOM   963  O  O     . ASP A 1 133 ? -26.25300 6.82500   -18.41400 1.000 43.98000  ? 121 ASP A O     1 
ATOM   964  C  CB    . ASP A 1 133 ? -26.14900 4.30900   -16.76500 1.000 40.29000  ? 121 ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 133 ? -24.81400 4.57700   -16.08000 1.000 46.94000  ? 121 ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 133 ? -24.69300 5.59900   -15.36700 1.000 59.30000  ? 121 ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 133 ? -23.88600 3.74500   -16.23000 1.000 47.51000  ? 121 ASP A OD2   1 
ATOM   968  N  N     . GLU A 1 134 ? -26.19200 7.69200   -16.33600 1.000 39.60000  ? 122 GLU A N     1 
ATOM   969  C  CA    . GLU A 1 134 ? -25.75500 8.99500   -16.80300 1.000 49.45000  ? 122 GLU A CA    1 
ATOM   970  C  C     . GLU A 1 134 ? -24.46300 8.95600   -17.62500 1.000 51.30000  ? 122 GLU A C     1 
ATOM   971  O  O     . GLU A 1 134 ? -24.37800 9.58900   -18.68200 1.000 51.82000  ? 122 GLU A O     1 
ATOM   972  C  CB    . GLU A 1 134 ? -25.58400 9.94200   -15.63200 1.000 50.76000  ? 122 GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 134 ? -25.29600 11.34700  -16.07500 1.000 55.97000  ? 122 GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 134 ? -25.30000 12.30700  -14.91400 1.000 87.29000  ? 122 GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 134 ? -25.90400 11.95200  -13.87100 1.000 90.83000  ? 122 GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 134 ? -24.70300 13.40300  -15.04400 1.000 86.39000  ? 122 GLU A OE2   1 
ATOM   977  N  N     . ASP A 1 135 ? -23.46800 8.20500   -17.16700 1.000 50.43000  ? 123 ASP A N     1 
ATOM   978  C  CA    . ASP A 1 135 ? -22.20900 8.13300   -17.90300 1.000 47.35000  ? 123 ASP A CA    1 
ATOM   979  C  C     . ASP A 1 135 ? -22.35900 7.46700   -19.27000 1.000 42.95000  ? 123 ASP A C     1 
ATOM   980  O  O     . ASP A 1 135 ? -21.47100 7.55700   -20.10600 1.000 56.84000  ? 123 ASP A O     1 
ATOM   981  C  CB    . ASP A 1 135 ? -21.15200 7.39800   -17.07900 1.000 50.63000  ? 123 ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 135 ? -20.61700 8.24300   -15.91500 1.000 70.94000  ? 123 ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 135 ? -20.54500 9.49500   -16.03600 1.000 62.03000  ? 123 ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 135 ? -20.26800 7.64300   -14.87200 1.000 76.31000  ? 123 ASP A OD2   1 
ATOM   985  N  N     . PHE A 1 136 ? -23.48200 6.80600   -19.50500 1.000 45.10000  ? 124 PHE A N     1 
ATOM   986  C  CA    . PHE A 1 136 ? -23.68100 6.08500   -20.76100 1.000 44.42000  ? 124 PHE A CA    1 
ATOM   987  C  C     . PHE A 1 136 ? -24.52800 6.88500   -21.75700 1.000 43.87000  ? 124 PHE A C     1 
ATOM   988  O  O     . PHE A 1 136 ? -24.57400 6.55200   -22.93700 1.000 44.62000  ? 124 PHE A O     1 
ATOM   989  C  CB    . PHE A 1 136 ? -24.33600 4.72800   -20.47600 1.000 41.64000  ? 124 PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 136 ? -24.23300 3.73100   -21.60100 1.000 34.99000  ? 124 PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 136 ? -23.16600 2.84200   -21.66300 1.000 34.87000  ? 124 PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 136 ? -25.23200 3.64300   -22.56400 1.000 33.52000  ? 124 PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 136 ? -23.07800 1.90700   -22.68100 1.000 37.49000  ? 124 PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 136 ? -25.15700 2.70500   -23.59300 1.000 34.16000  ? 124 PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 136 ? -24.08200 1.83000   -23.65100 1.000 37.26000  ? 124 PHE A CZ    1 
ATOM   996  N  N     . ARG A 1 137 ? -25.18600 7.94100   -21.28800 1.000 31.42000  ? 125 ARG A N     1 
ATOM   997  C  CA    . ARG A 1 137 ? -26.12600 8.66500   -22.12900 1.000 37.40000  ? 125 ARG A CA    1 
ATOM   998  C  C     . ARG A 1 137 ? -25.50900 9.14700   -23.44900 1.000 46.27000  ? 125 ARG A C     1 
ATOM   999  O  O     . ARG A 1 137 ? -26.16600 9.10700   -24.51000 1.000 43.05000  ? 125 ARG A O     1 
ATOM   1000 C  CB    . ARG A 1 137 ? -26.72100 9.83400   -21.33900 1.000 41.33000  ? 125 ARG A CB    1 
ATOM   1001 C  CG    . ARG A 1 137 ? -27.51100 9.33600   -20.13000 1.000 45.96000  ? 125 ARG A CG    1 
ATOM   1002 C  CD    . ARG A 1 137 ? -28.14100 10.42900  -19.28100 1.000 42.20000  ? 125 ARG A CD    1 
ATOM   1003 N  NE    . ARG A 1 137 ? -28.86800 9.83100   -18.16400 1.000 38.81000  ? 125 ARG A NE    1 
ATOM   1004 C  CZ    . ARG A 1 137 ? -29.63500 10.50300  -17.31800 1.000 33.82000  ? 125 ARG A CZ    1 
ATOM   1005 N  NH1   . ARG A 1 137 ? -29.78500 11.80400  -17.45400 1.000 37.82000  ? 125 ARG A NH1   1 
ATOM   1006 N  NH2   . ARG A 1 137 ? -30.25700 9.87000   -16.34100 1.000 30.56000  ? 125 ARG A NH2   1 
ATOM   1007 N  N     . LYS A 1 138 ? -24.23800 9.54900   -23.38900 1.000 47.02000  ? 126 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 138 ? -23.58400 10.19500  -24.52500 1.000 46.38000  ? 126 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 138 ? -23.59200 9.32500   -25.79700 1.000 48.97000  ? 126 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 138 ? -23.72200 9.84500   -26.90800 1.000 50.02000  ? 126 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 138 ? -22.15100 10.59600  -24.15000 1.000 44.30000  ? 126 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 138 ? -21.17700 9.44600   -24.02200 1.000 54.39000  ? 126 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 138 ? -19.81600 9.90900   -23.53300 1.000 46.20000  ? 126 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 138 ? -19.86000 10.27200  -22.06000 1.000 53.67000  ? 126 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 138 ? -18.49000 10.44500  -21.48800 1.000 68.61000  ? 126 LYS A NZ    1 
ATOM   1016 N  N     . TYR A 1 139 ? -23.50700 8.00700   -25.63500 1.000 49.70000  ? 127 TYR A N     1 
ATOM   1017 C  CA    . TYR A 1 139 ? -23.45900 7.09200   -26.78100 1.000 45.75000  ? 127 TYR A CA    1 
ATOM   1018 C  C     . TYR A 1 139 ? -24.78300 6.91700   -27.48900 1.000 43.00000  ? 127 TYR A C     1 
ATOM   1019 O  O     . TYR A 1 139 ? -24.81700 6.33300   -28.56800 1.000 44.54000  ? 127 TYR A O     1 
ATOM   1020 C  CB    . TYR A 1 139 ? -22.97200 5.72400   -26.34900 1.000 42.57000  ? 127 TYR A CB    1 
ATOM   1021 C  CG    . TYR A 1 139 ? -21.71800 5.77400   -25.52200 1.000 48.63000  ? 127 TYR A CG    1 
ATOM   1022 C  CD1   . TYR A 1 139 ? -20.54300 6.30000   -26.03900 1.000 50.70000  ? 127 TYR A CD1   1 
ATOM   1023 C  CD2   . TYR A 1 139 ? -21.70500 5.28700   -24.22000 1.000 46.48000  ? 127 TYR A CD2   1 
ATOM   1024 C  CE1   . TYR A 1 139 ? -19.38700 6.34500   -25.27800 1.000 56.31000  ? 127 TYR A CE1   1 
ATOM   1025 C  CE2   . TYR A 1 139 ? -20.55600 5.31500   -23.45600 1.000 48.66000  ? 127 TYR A CE2   1 
ATOM   1026 C  CZ    . TYR A 1 139 ? -19.39900 5.84800   -23.99000 1.000 54.37000  ? 127 TYR A CZ    1 
ATOM   1027 O  OH    . TYR A 1 139 ? -18.25500 5.88900   -23.23300 1.000 50.50000  ? 127 TYR A OH    1 
ATOM   1028 N  N     . THR A 1 140 ? -25.86400 7.41600   -26.88800 1.000 44.64000  ? 128 THR A N     1 
ATOM   1029 C  CA    . THR A 1 140 ? -27.19400 7.27400   -27.48100 1.000 48.51000  ? 128 THR A CA    1 
ATOM   1030 C  C     . THR A 1 140 ? -27.54200 8.48900   -28.33400 1.000 51.31000  ? 128 THR A C     1 
ATOM   1031 O  O     . THR A 1 140 ? -28.71000 8.70800   -28.68400 1.000 47.92000  ? 128 THR A O     1 
ATOM   1032 C  CB    . THR A 1 140 ? -28.30400 7.08100   -26.41200 1.000 44.24000  ? 128 THR A CB    1 
ATOM   1033 O  OG1   . THR A 1 140 ? -28.53700 8.31200   -25.71800 1.000 48.96000  ? 128 THR A OG1   1 
ATOM   1034 C  CG2   . THR A 1 140 ? -27.91100 6.01800   -25.41700 1.000 40.50000  ? 128 THR A CG2   1 
ATOM   1035 N  N     . ALA A 1 141 ? -26.52800 9.28500   -28.65800 1.000 55.28000  ? 129 ALA A N     1 
ATOM   1036 C  CA    . ALA A 1 141 ? -26.74500 10.49800  -29.44100 1.000 52.11000  ? 129 ALA A CA    1 
ATOM   1037 C  C     . ALA A 1 141 ? -27.48700 10.16400  -30.73300 1.000 46.49000  ? 129 ALA A C     1 
ATOM   1038 O  O     . ALA A 1 141 ? -27.15800 9.19100   -31.41400 1.000 47.73000  ? 129 ALA A O     1 
ATOM   1039 C  CB    . ALA A 1 141 ? -25.41700 11.18700  -29.73500 1.000 46.85000  ? 129 ALA A CB    1 
ATOM   1040 N  N     . PHE A 1 142 ? -28.52100 10.94300  -31.03200 1.000 45.58000  ? 130 PHE A N     1 
ATOM   1041 C  CA    . PHE A 1 142 ? -29.22500 10.81700  -32.30200 1.000 47.09000  ? 130 PHE A CA    1 
ATOM   1042 C  C     . PHE A 1 142 ? -29.63000 12.18800  -32.85500 1.000 52.95000  ? 130 PHE A C     1 
ATOM   1043 O  O     . PHE A 1 142 ? -29.72400 13.17100  -32.11100 1.000 50.06000  ? 130 PHE A O     1 
ATOM   1044 C  CB    . PHE A 1 142 ? -30.45600 9.91600   -32.16200 1.000 44.16000  ? 130 PHE A CB    1 
ATOM   1045 C  CG    . PHE A 1 142 ? -31.58500 10.53600  -31.40200 1.000 39.63000  ? 130 PHE A CG    1 
ATOM   1046 C  CD1   . PHE A 1 142 ? -31.59300 10.51900  -30.01700 1.000 40.35000  ? 130 PHE A CD1   1 
ATOM   1047 C  CD2   . PHE A 1 142 ? -32.65000 11.13300  -32.07300 1.000 46.49000  ? 130 PHE A CD2   1 
ATOM   1048 C  CE1   . PHE A 1 142 ? -32.64100 11.09900  -29.30600 1.000 45.08000  ? 130 PHE A CE1   1 
ATOM   1049 C  CE2   . PHE A 1 142 ? -33.70200 11.72000  -31.37000 1.000 47.16000  ? 130 PHE A CE2   1 
ATOM   1050 C  CZ    . PHE A 1 142 ? -33.70000 11.70000  -29.98600 1.000 43.30000  ? 130 PHE A CZ    1 
ATOM   1051 N  N     . THR A 1 143 ? -29.87400 12.23300  -34.16800 1.000 63.08000  ? 131 THR A N     1 
ATOM   1052 C  CA    . THR A 1 143 ? -30.22400 13.46500  -34.87900 1.000 56.77000  ? 131 THR A CA    1 
ATOM   1053 C  C     . THR A 1 143 ? -31.60000 13.39200  -35.52200 1.000 57.98000  ? 131 THR A C     1 
ATOM   1054 O  O     . THR A 1 143 ? -31.84600 12.50800  -36.34500 1.000 62.29000  ? 131 THR A O     1 
ATOM   1055 C  CB    . THR A 1 143 ? -29.21000 13.76800  -35.98500 1.000 47.86000  ? 131 THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 143 ? -27.90600 13.40100  -35.53600 1.000 57.03000  ? 131 THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 143 ? -29.22400 15.22900  -36.32200 1.000 57.76000  ? 131 THR A CG2   1 
ATOM   1058 N  N     . ILE A 1 144 ? -32.49000 14.31200  -35.15500 1.000 58.03000  ? 132 ILE A N     1 
ATOM   1059 C  CA    . ILE A 1 144 ? -33.78400 14.43300  -35.83600 1.000 65.46000  ? 132 ILE A CA    1 
ATOM   1060 C  C     . ILE A 1 144 ? -33.63300 15.40400  -37.01500 1.000 71.23000  ? 132 ILE A C     1 
ATOM   1061 O  O     . ILE A 1 144 ? -33.52400 16.61700  -36.80800 1.000 67.60000  ? 132 ILE A O     1 
ATOM   1062 C  CB    . ILE A 1 144 ? -34.91700 14.92200  -34.87700 1.000 66.71000  ? 132 ILE A CB    1 
ATOM   1063 C  CG1   . ILE A 1 144 ? -35.09400 13.95600  -33.69900 1.000 71.26000  ? 132 ILE A CG1   1 
ATOM   1064 C  CG2   . ILE A 1 144 ? -36.25300 15.06700  -35.61900 1.000 56.69000  ? 132 ILE A CG2   1 
ATOM   1065 C  CD1   . ILE A 1 144 ? -35.57800 12.56000  -34.10900 1.000 71.44000  ? 132 ILE A CD1   1 
ATOM   1066 N  N     . PRO A 1 145 ? -33.61000 14.86900  -38.25600 1.000 76.45000  ? 133 PRO A N     1 
ATOM   1067 C  CA    . PRO A 1 145 ? -33.37100 15.67700  -39.46100 1.000 68.30000  ? 133 PRO A CA    1 
ATOM   1068 C  C     . PRO A 1 145 ? -34.52000 16.63200  -39.75300 1.000 75.96000  ? 133 PRO A C     1 
ATOM   1069 O  O     . PRO A 1 145 ? -35.67500 16.29500  -39.47500 1.000 72.69000  ? 133 PRO A O     1 
ATOM   1070 C  CB    . PRO A 1 145 ? -33.24200 14.62700  -40.57200 1.000 69.15000  ? 133 PRO A CB    1 
ATOM   1071 C  CG    . PRO A 1 145 ? -34.04400 13.47300  -40.09100 1.000 72.17000  ? 133 PRO A CG    1 
ATOM   1072 C  CD    . PRO A 1 145 ? -33.84700 13.45000  -38.59000 1.000 76.38000  ? 133 PRO A CD    1 
ATOM   1073 N  N     . SER A 1 146 ? -34.20200 17.79800  -40.31700 1.000 83.93000  ? 134 SER A N     1 
ATOM   1074 C  CA    . SER A 1 146 ? -35.19300 18.85200  -40.56900 1.000 78.05000  ? 134 SER A CA    1 
ATOM   1075 C  C     . SER A 1 146 ? -36.25100 18.44900  -41.59300 1.000 71.90000  ? 134 SER A C     1 
ATOM   1076 O  O     . SER A 1 146 ? -37.22600 19.17300  -41.80900 1.000 76.65000  ? 134 SER A O     1 
ATOM   1077 C  CB    . SER A 1 146 ? -34.49600 20.12900  -41.04000 1.000 86.89000  ? 134 SER A CB    1 
ATOM   1078 O  OG    . SER A 1 146 ? -33.93500 19.94600  -42.32900 1.000 89.97000  ? 134 SER A OG    1 
ATOM   1079 N  N     . ILE A 1 154 ? -32.32700 19.05100  -35.15500 1.000 53.62000  ? 142 ILE A N     1 
ATOM   1080 C  CA    . ILE A 1 154 ? -31.91800 19.05200  -33.74900 1.000 59.93000  ? 142 ILE A CA    1 
ATOM   1081 C  C     . ILE A 1 154 ? -31.10700 17.79600  -33.40900 1.000 60.42000  ? 142 ILE A C     1 
ATOM   1082 O  O     . ILE A 1 154 ? -31.28900 16.74600  -34.02200 1.000 67.22000  ? 142 ILE A O     1 
ATOM   1083 C  CB    . ILE A 1 154 ? -33.13800 19.15600  -32.78300 1.000 56.52000  ? 142 ILE A CB    1 
ATOM   1084 C  CG1   . ILE A 1 154 ? -34.18500 20.13800  -33.32400 1.000 53.34000  ? 142 ILE A CG1   1 
ATOM   1085 C  CG2   . ILE A 1 154 ? -32.69100 19.61500  -31.38400 1.000 54.62000  ? 142 ILE A CG2   1 
ATOM   1086 C  CD1   . ILE A 1 154 ? -35.35200 19.48000  -34.02200 1.000 60.70000  ? 142 ILE A CD1   1 
ATOM   1087 N  N     . ARG A 1 155 ? -30.20000 17.91900  -32.44100 1.000 62.22000  ? 143 ARG A N     1 
ATOM   1088 C  CA    . ARG A 1 155 ? -29.40000 16.79100  -31.96200 1.000 57.16000  ? 143 ARG A CA    1 
ATOM   1089 C  C     . ARG A 1 155 ? -29.68100 16.46900  -30.48500 1.000 57.65000  ? 143 ARG A C     1 
ATOM   1090 O  O     . ARG A 1 155 ? -29.50800 17.32500  -29.61200 1.000 56.92000  ? 143 ARG A O     1 
ATOM   1091 C  CB    . ARG A 1 155 ? -27.91800 17.08800  -32.15600 1.000 52.03000  ? 143 ARG A CB    1 
ATOM   1092 C  CG    . ARG A 1 155 ? -27.44100 16.86600  -33.56400 1.000 55.93000  ? 143 ARG A CG    1 
ATOM   1093 C  CD    . ARG A 1 155 ? -26.43700 15.73600  -33.61000 1.000 59.36000  ? 143 ARG A CD    1 
ATOM   1094 N  NE    . ARG A 1 155 ? -25.23700 16.06800  -32.84900 1.000 57.69000  ? 143 ARG A NE    1 
ATOM   1095 C  CZ    . ARG A 1 155 ? -24.37200 15.17100  -32.37700 1.000 66.38000  ? 143 ARG A CZ    1 
ATOM   1096 N  NH1   . ARG A 1 155 ? -24.57400 13.86800  -32.57200 1.000 64.82000  ? 143 ARG A NH1   1 
ATOM   1097 N  NH2   . ARG A 1 155 ? -23.30300 15.57800  -31.70000 1.000 64.94000  ? 143 ARG A NH2   1 
ATOM   1098 N  N     . TYR A 1 156 ? -30.10400 15.23800  -30.20100 1.000 55.41000  ? 144 TYR A N     1 
ATOM   1099 C  CA    . TYR A 1 156 ? -30.44200 14.86200  -28.82600 1.000 51.54000  ? 144 TYR A CA    1 
ATOM   1100 C  C     . TYR A 1 156 ? -29.65100 13.65900  -28.29100 1.000 49.15000  ? 144 TYR A C     1 
ATOM   1101 O  O     . TYR A 1 156 ? -29.02000 12.92000  -29.05200 1.000 48.28000  ? 144 TYR A O     1 
ATOM   1102 C  CB    . TYR A 1 156 ? -31.91900 14.51600  -28.70800 1.000 45.91000  ? 144 TYR A CB    1 
ATOM   1103 C  CG    . TYR A 1 156 ? -32.95200 15.55400  -29.09300 1.000 49.82000  ? 144 TYR A CG    1 
ATOM   1104 C  CD1   . TYR A 1 156 ? -33.35500 16.53900  -28.19400 1.000 54.76000  ? 144 TYR A CD1   1 
ATOM   1105 C  CD2   . TYR A 1 156 ? -33.60500 15.48400  -30.32000 1.000 50.09000  ? 144 TYR A CD2   1 
ATOM   1106 C  CE1   . TYR A 1 156 ? -34.35100 17.45500  -28.52900 1.000 52.35000  ? 144 TYR A CE1   1 
ATOM   1107 C  CE2   . TYR A 1 156 ? -34.59300 16.38300  -30.66100 1.000 51.71000  ? 144 TYR A CE2   1 
ATOM   1108 C  CZ    . TYR A 1 156 ? -34.96600 17.36300  -29.76500 1.000 55.71000  ? 144 TYR A CZ    1 
ATOM   1109 O  OH    . TYR A 1 156 ? -35.95100 18.25300  -30.12000 1.000 57.27000  ? 144 TYR A OH    1 
ATOM   1110 N  N     . GLN A 1 157 ? -29.71800 13.46000  -26.97500 1.000 50.69000  ? 145 GLN A N     1 
ATOM   1111 C  CA    . GLN A 1 157 ? -29.30200 12.20200  -26.34900 1.000 49.63000  ? 145 GLN A CA    1 
ATOM   1112 C  C     . GLN A 1 157 ? -30.43000 11.67300  -25.45100 1.000 45.05000  ? 145 GLN A C     1 
ATOM   1113 O  O     . GLN A 1 157 ? -31.33100 12.42600  -25.05800 1.000 41.63000  ? 145 GLN A O     1 
ATOM   1114 C  CB    . GLN A 1 157 ? -28.01800 12.38000  -25.53200 1.000 44.99000  ? 145 GLN A CB    1 
ATOM   1115 C  CG    . GLN A 1 157 ? -28.28400 12.80200  -24.09500 1.000 44.65000  ? 145 GLN A CG    1 
ATOM   1116 C  CD    . GLN A 1 157 ? -27.01100 13.03500  -23.31100 1.000 50.81000  ? 145 GLN A CD    1 
ATOM   1117 O  OE1   . GLN A 1 157 ? -25.92100 13.15400  -23.89000 1.000 47.90000  ? 145 GLN A OE1   1 
ATOM   1118 N  NE2   . GLN A 1 157 ? -27.13900 13.10600  -21.98200 1.000 51.51000  ? 145 GLN A NE2   1 
ATOM   1119 N  N     . TYR A 1 158 ? -30.38200 10.38200  -25.12800 1.000 42.46000  ? 146 TYR A N     1 
ATOM   1120 C  CA    . TYR A 1 158 ? -31.40200 9.78600   -24.27600 1.000 40.02000  ? 146 TYR A CA    1 
ATOM   1121 C  C     . TYR A 1 158 ? -31.06600 9.94100   -22.79700 1.000 44.18000  ? 146 TYR A C     1 
ATOM   1122 O  O     . TYR A 1 158 ? -29.92100 9.74600   -22.38800 1.000 46.02000  ? 146 TYR A O     1 
ATOM   1123 C  CB    . TYR A 1 158 ? -31.59500 8.30400   -24.61800 1.000 40.27000  ? 146 TYR A CB    1 
ATOM   1124 C  CG    . TYR A 1 158 ? -32.69100 8.06000   -25.63600 1.000 44.20000  ? 146 TYR A CG    1 
ATOM   1125 C  CD1   . TYR A 1 158 ? -32.41800 8.08400   -27.00300 1.000 44.24000  ? 146 TYR A CD1   1 
ATOM   1126 C  CD2   . TYR A 1 158 ? -34.00300 7.82700   -25.23600 1.000 41.62000  ? 146 TYR A CD2   1 
ATOM   1127 C  CE1   . TYR A 1 158 ? -33.42000 7.86900   -27.95300 1.000 37.55000  ? 146 TYR A CE1   1 
ATOM   1128 C  CE2   . TYR A 1 158 ? -35.01800 7.61900   -26.18000 1.000 40.02000  ? 146 TYR A CE2   1 
ATOM   1129 C  CZ    . TYR A 1 158 ? -34.71500 7.63400   -27.53700 1.000 40.40000  ? 146 TYR A CZ    1 
ATOM   1130 O  OH    . TYR A 1 158 ? -35.70900 7.42000   -28.47100 1.000 41.62000  ? 146 TYR A OH    1 
ATOM   1131 N  N     . ASN A 1 159 ? -32.06400 10.30100  -21.99600 1.000 44.33000  ? 147 ASN A N     1 
ATOM   1132 C  CA    . ASN A 1 159 ? -31.91900 10.24700  -20.54300 1.000 42.51000  ? 147 ASN A CA    1 
ATOM   1133 C  C     . ASN A 1 159 ? -32.67300 9.07400   -19.94700 1.000 39.02000  ? 147 ASN A C     1 
ATOM   1134 O  O     . ASN A 1 159 ? -32.60400 8.84200   -18.74300 1.000 39.73000  ? 147 ASN A O     1 
ATOM   1135 C  CB    . ASN A 1 159 ? -32.43000 11.52400  -19.88500 1.000 47.77000  ? 147 ASN A CB    1 
ATOM   1136 C  CG    . ASN A 1 159 ? -31.74800 12.75700  -20.39800 1.000 42.09000  ? 147 ASN A CG    1 
ATOM   1137 O  OD1   . ASN A 1 159 ? -30.53000 12.78100  -20.57800 1.000 44.34000  ? 147 ASN A OD1   1 
ATOM   1138 N  ND2   . ASN A 1 159 ? -32.53300 13.80300  -20.64000 1.000 44.40000  ? 147 ASN A ND2   1 
ATOM   1139 N  N     . VAL A 1 160 ? -33.41900 8.36700   -20.79200 1.000 39.66000  ? 148 VAL A N     1 
ATOM   1140 C  CA    . VAL A 1 160 ? -34.25400 7.24600   -20.37500 1.000 32.93000  ? 148 VAL A CA    1 
ATOM   1141 C  C     . VAL A 1 160 ? -33.87000 6.09800   -21.26700 1.000 33.53000  ? 148 VAL A C     1 
ATOM   1142 O  O     . VAL A 1 160 ? -33.01800 6.28600   -22.11300 1.000 40.99000  ? 148 VAL A O     1 
ATOM   1143 C  CB    . VAL A 1 160 ? -35.75200 7.55800   -20.50700 1.000 36.80000  ? 148 VAL A CB    1 
ATOM   1144 C  CG1   . VAL A 1 160 ? -36.17400 8.57600   -19.47100 1.000 33.14000  ? 148 VAL A CG1   1 
ATOM   1145 C  CG2   . VAL A 1 160 ? -36.07000 8.06200   -21.91600 1.000 34.84000  ? 148 VAL A CG2   1 
ATOM   1146 N  N     . LEU A 1 161 ? -34.47600 4.92100   -21.08900 1.000 34.99000  ? 149 LEU A N     1 
ATOM   1147 C  CA    . LEU A 1 161 ? -34.19500 3.75900   -21.94500 1.000 30.39000  ? 149 LEU A CA    1 
ATOM   1148 C  C     . LEU A 1 161 ? -34.69200 3.93300   -23.39200 1.000 33.35000  ? 149 LEU A C     1 
ATOM   1149 O  O     . LEU A 1 161 ? -35.85500 4.27200   -23.62900 1.000 35.67000  ? 149 LEU A O     1 
ATOM   1150 C  CB    . LEU A 1 161 ? -34.82800 2.50200   -21.35500 1.000 30.85000  ? 149 LEU A CB    1 
ATOM   1151 C  CG    . LEU A 1 161 ? -34.42700 2.11200   -19.93800 1.000 33.97000  ? 149 LEU A CG    1 
ATOM   1152 C  CD1   . LEU A 1 161 ? -35.26100 0.91500   -19.49200 1.000 31.35000  ? 149 LEU A CD1   1 
ATOM   1153 C  CD2   . LEU A 1 161 ? -32.94600 1.80200   -19.83100 1.000 29.84000  ? 149 LEU A CD2   1 
ATOM   1154 N  N     . PRO A 1 162 ? -33.81500 3.69400   -24.37400 1.000 34.30000  ? 150 PRO A N     1 
ATOM   1155 C  CA    . PRO A 1 162 ? -34.22500 3.80500   -25.78300 1.000 34.36000  ? 150 PRO A CA    1 
ATOM   1156 C  C     . PRO A 1 162 ? -34.78400 2.51400   -26.33600 1.000 33.33000  ? 150 PRO A C     1 
ATOM   1157 O  O     . PRO A 1 162 ? -34.28000 1.45100   -25.99300 1.000 33.53000  ? 150 PRO A O     1 
ATOM   1158 C  CB    . PRO A 1 162 ? -32.91900 4.15300   -26.51000 1.000 36.80000  ? 150 PRO A CB    1 
ATOM   1159 C  CG    . PRO A 1 162 ? -31.78200 3.90500   -25.49800 1.000 34.86000  ? 150 PRO A CG    1 
ATOM   1160 C  CD    . PRO A 1 162 ? -32.38900 3.35300   -24.23400 1.000 30.99000  ? 150 PRO A CD    1 
ATOM   1161 N  N     . GLN A 1 163 ? -35.78100 2.59700   -27.20800 1.000 39.72000  ? 151 GLN A N     1 
ATOM   1162 C  CA    . GLN A 1 163 ? -36.27300 1.39500   -27.87900 1.000 37.87000  ? 151 GLN A CA    1 
ATOM   1163 C  C     . GLN A 1 163 ? -35.39500 1.03400   -29.07900 1.000 40.24000  ? 151 GLN A C     1 
ATOM   1164 O  O     . GLN A 1 163 ? -35.47300 1.68000   -30.11600 1.000 43.97000  ? 151 GLN A O     1 
ATOM   1165 C  CB    . GLN A 1 163 ? -37.73000 1.58500   -28.30000 1.000 35.68000  ? 151 GLN A CB    1 
ATOM   1166 C  CG    . GLN A 1 163 ? -38.63000 1.87100   -27.11700 1.000 34.51000  ? 151 GLN A CG    1 
ATOM   1167 C  CD    . GLN A 1 163 ? -40.08900 1.83900   -27.47100 1.000 43.03000  ? 151 GLN A CD    1 
ATOM   1168 O  OE1   . GLN A 1 163 ? -40.53700 0.98400   -28.23200 1.000 43.71000  ? 151 GLN A OE1   1 
ATOM   1169 N  NE2   . GLN A 1 163 ? -40.85100 2.77400   -26.91600 1.000 51.78000  ? 151 GLN A NE2   1 
ATOM   1170 N  N     . GLY A 1 164 ? -34.55300 0.01100   -28.92100 1.000 40.37000  ? 152 GLY A N     1 
ATOM   1171 C  CA    . GLY A 1 164 ? -33.64000 -0.41400  -29.97300 1.000 39.58000  ? 152 GLY A CA    1 
ATOM   1172 C  C     . GLY A 1 164 ? -32.29900 -0.82100  -29.39300 1.000 40.96000  ? 152 GLY A C     1 
ATOM   1173 O  O     . GLY A 1 164 ? -31.53500 -1.59500  -29.98200 1.000 40.90000  ? 152 GLY A O     1 
ATOM   1174 N  N     . TRP A 1 165 ? -32.00700 -0.27700  -28.21900 1.000 40.37000  ? 153 TRP A N     1 
ATOM   1175 C  CA    . TRP A 1 165 ? -30.83200 -0.66800  -27.44800 1.000 34.02000  ? 153 TRP A CA    1 
ATOM   1176 C  C     . TRP A 1 165 ? -31.06400 -2.06500  -26.86600 1.000 37.37000  ? 153 TRP A C     1 
ATOM   1177 O  O     . TRP A 1 165 ? -32.20200 -2.41500  -26.51200 1.000 37.12000  ? 153 TRP A O     1 
ATOM   1178 C  CB    . TRP A 1 165 ? -30.56700 0.36000   -26.33100 1.000 33.24000  ? 153 TRP A CB    1 
ATOM   1179 C  CG    . TRP A 1 165 ? -29.31800 0.11300   -25.54100 1.000 36.71000  ? 153 TRP A CG    1 
ATOM   1180 C  CD1   . TRP A 1 165 ? -28.08900 -0.28100  -26.02400 1.000 33.39000  ? 153 TRP A CD1   1 
ATOM   1181 C  CD2   . TRP A 1 165 ? -29.17900 0.20300   -24.11800 1.000 33.10000  ? 153 TRP A CD2   1 
ATOM   1182 N  NE1   . TRP A 1 165 ? -27.20100 -0.42300  -24.98300 1.000 34.33000  ? 153 TRP A NE1   1 
ATOM   1183 C  CE2   . TRP A 1 165 ? -27.84200 -0.13300  -23.80600 1.000 34.29000  ? 153 TRP A CE2   1 
ATOM   1184 C  CE3   . TRP A 1 165 ? -30.05500 0.53300   -23.08300 1.000 33.36000  ? 153 TRP A CE3   1 
ATOM   1185 C  CZ2   . TRP A 1 165 ? -27.35800 -0.13400  -22.49000 1.000 33.76000  ? 153 TRP A CZ2   1 
ATOM   1186 C  CZ3   . TRP A 1 165 ? -29.56800 0.52700   -21.77600 1.000 38.33000  ? 153 TRP A CZ3   1 
ATOM   1187 C  CH2   . TRP A 1 165 ? -28.23300 0.19400   -21.49500 1.000 35.57000  ? 153 TRP A CH2   1 
ATOM   1188 N  N     . LYS A 1 166 ? -29.99800 -2.85300  -26.75400 1.000 35.82000  ? 154 LYS A N     1 
ATOM   1189 C  CA    . LYS A 1 166 ? -30.12200 -4.23200  -26.32200 1.000 31.23000  ? 154 LYS A CA    1 
ATOM   1190 C  C     . LYS A 1 166 ? -30.20300 -4.40900  -24.79900 1.000 34.77000  ? 154 LYS A C     1 
ATOM   1191 O  O     . LYS A 1 166 ? -30.60400 -5.46900  -24.32800 1.000 33.61000  ? 154 LYS A O     1 
ATOM   1192 C  CB    . LYS A 1 166 ? -28.95600 -5.05500  -26.85800 1.000 35.96000  ? 154 LYS A CB    1 
ATOM   1193 C  CG    . LYS A 1 166 ? -27.71900 -5.03200  -25.98100 1.000 38.34000  ? 154 LYS A CG    1 
ATOM   1194 C  CD    . LYS A 1 166 ? -26.76800 -6.18200  -26.31500 1.000 35.47000  ? 154 LYS A CD    1 
ATOM   1195 C  CE    . LYS A 1 166 ? -25.37800 -5.88400  -25.79200 1.000 37.78000  ? 154 LYS A CE    1 
ATOM   1196 N  NZ    . LYS A 1 166 ? -24.41600 -6.96400  -26.11900 1.000 43.64000  ? 154 LYS A NZ    1 
ATOM   1197 N  N     . GLY A 1 167 ? -29.81900 -3.39300  -24.03000 1.000 35.76000  ? 155 GLY A N     1 
ATOM   1198 C  CA    . GLY A 1 167 ? -29.89700 -3.47400  -22.57700 1.000 30.30000  ? 155 GLY A CA    1 
ATOM   1199 C  C     . GLY A 1 167 ? -31.27100 -3.09000  -22.04100 1.000 34.92000  ? 155 GLY A C     1 
ATOM   1200 O  O     . GLY A 1 167 ? -31.59500 -3.29800  -20.86000 1.000 34.02000  ? 155 GLY A O     1 
ATOM   1201 N  N     . SER A 1 168 ? -32.10600 -2.54600  -22.91900 1.000 38.60000  ? 156 SER A N     1 
ATOM   1202 C  CA    . SER A 1 168 ? -33.37100 -1.98000  -22.48200 1.000 32.53000  ? 156 SER A CA    1 
ATOM   1203 C  C     . SER A 1 168 ? -34.33500 -3.00200  -21.92700 1.000 29.65000  ? 156 SER A C     1 
ATOM   1204 O  O     . SER A 1 168 ? -34.97100 -2.72500  -20.92200 1.000 36.91000  ? 156 SER A O     1 
ATOM   1205 C  CB    . SER A 1 168 ? -34.03600 -1.21100  -23.61900 1.000 35.66000  ? 156 SER A CB    1 
ATOM   1206 O  OG    . SER A 1 168 ? -33.52900 0.10700   -23.68200 1.000 30.72000  ? 156 SER A OG    1 
ATOM   1207 N  N     . PRO A 1 169 ? -34.47600 -4.17100  -22.57000 1.000 31.10000  ? 157 PRO A N     1 
ATOM   1208 C  CA    . PRO A 1 169 ? -35.42800 -5.10800  -21.95600 1.000 32.94000  ? 157 PRO A CA    1 
ATOM   1209 C  C     . PRO A 1 169 ? -35.02500 -5.60200  -20.55200 1.000 31.56000  ? 157 PRO A C     1 
ATOM   1210 O  O     . PRO A 1 169 ? -35.85400 -5.50500  -19.64700 1.000 32.81000  ? 157 PRO A O     1 
ATOM   1211 C  CB    . PRO A 1 169 ? -35.45800 -6.27200  -22.95800 1.000 26.96000  ? 157 PRO A CB    1 
ATOM   1212 C  CG    . PRO A 1 169 ? -35.15200 -5.62000  -24.26800 1.000 28.64000  ? 157 PRO A CG    1 
ATOM   1213 C  CD    . PRO A 1 169 ? -34.09800 -4.60700  -23.92800 1.000 32.62000  ? 157 PRO A CD    1 
ATOM   1214 N  N     . ALA A 1 170 ? -33.81200 -6.11500  -20.36100 1.000 33.31000  ? 158 ALA A N     1 
ATOM   1215 C  CA    . ALA A 1 170 ? -33.43900 -6.66000  -19.05200 1.000 26.62000  ? 158 ALA A CA    1 
ATOM   1216 C  C     . ALA A 1 170 ? -33.45700 -5.56000  -17.99600 1.000 29.74000  ? 158 ALA A C     1 
ATOM   1217 O  O     . ALA A 1 170 ? -33.93600 -5.76600  -16.88100 1.000 30.25000  ? 158 ALA A O     1 
ATOM   1218 C  CB    . ALA A 1 170 ? -32.07800 -7.31900  -19.10400 1.000 25.18000  ? 158 ALA A CB    1 
ATOM   1219 N  N     . ILE A 1 171 ? -32.94700 -4.38000  -18.33500 1.000 32.38000  ? 159 ILE A N     1 
ATOM   1220 C  CA    . ILE A 1 171 ? -32.95300 -3.29100  -17.35600 1.000 31.27000  ? 159 ILE A CA    1 
ATOM   1221 C  C     . ILE A 1 171 ? -34.39100 -2.88400  -17.01300 1.000 31.14000  ? 159 ILE A C     1 
ATOM   1222 O  O     . ILE A 1 171 ? -34.69400 -2.58500  -15.85400 1.000 31.06000  ? 159 ILE A O     1 
ATOM   1223 C  CB    . ILE A 1 171 ? -32.15900 -2.07300  -17.84300 1.000 28.01000  ? 159 ILE A CB    1 
ATOM   1224 C  CG1   . ILE A 1 171 ? -30.67400 -2.39900  -17.78100 1.000 28.79000  ? 159 ILE A CG1   1 
ATOM   1225 C  CG2   . ILE A 1 171 ? -32.44100 -0.85800  -16.96300 1.000 26.66000  ? 159 ILE A CG2   1 
ATOM   1226 C  CD1   . ILE A 1 171 ? -29.79900 -1.30400  -18.27300 1.000 37.10000  ? 159 ILE A CD1   1 
ATOM   1227 N  N     . PHE A 1 172 ? -35.29000 -2.90300  -17.99600 1.000 33.30000  ? 160 PHE A N     1 
ATOM   1228 C  CA    . PHE A 1 172 ? -36.68100 -2.61500  -17.68900 1.000 27.08000  ? 160 PHE A CA    1 
ATOM   1229 C  C     . PHE A 1 172 ? -37.27700 -3.71100  -16.83500 1.000 27.49000  ? 160 PHE A C     1 
ATOM   1230 O  O     . PHE A 1 172 ? -37.86000 -3.42800  -15.79900 1.000 32.26000  ? 160 PHE A O     1 
ATOM   1231 C  CB    . PHE A 1 172 ? -37.54600 -2.44500  -18.92700 1.000 28.89000  ? 160 PHE A CB    1 
ATOM   1232 C  CG    . PHE A 1 172 ? -38.94700 -2.03100  -18.58800 1.000 28.57000  ? 160 PHE A CG    1 
ATOM   1233 C  CD1   . PHE A 1 172 ? -39.23400 -0.71100  -18.31100 1.000 33.22000  ? 160 PHE A CD1   1 
ATOM   1234 C  CD2   . PHE A 1 172 ? -39.95700 -2.96100  -18.47700 1.000 23.81000  ? 160 PHE A CD2   1 
ATOM   1235 C  CE1   . PHE A 1 172 ? -40.52900 -0.32300  -17.96300 1.000 32.42000  ? 160 PHE A CE1   1 
ATOM   1236 C  CE2   . PHE A 1 172 ? -41.24800 -2.58100  -18.12000 1.000 27.47000  ? 160 PHE A CE2   1 
ATOM   1237 C  CZ    . PHE A 1 172 ? -41.53400 -1.27000  -17.86000 1.000 27.50000  ? 160 PHE A CZ    1 
ATOM   1238 N  N     . GLN A 1 173 ? -37.14700 -4.95900  -17.26300 1.000 27.62000  ? 161 GLN A N     1 
ATOM   1239 C  CA    . GLN A 1 173 ? -37.78400 -6.04900  -16.53400 1.000 30.44000  ? 161 GLN A CA    1 
ATOM   1240 C  C     . GLN A 1 173 ? -37.27100 -6.13700  -15.11000 1.000 28.59000  ? 161 GLN A C     1 
ATOM   1241 O  O     . GLN A 1 173 ? -38.03300 -6.38700  -14.17200 1.000 30.41000  ? 161 GLN A O     1 
ATOM   1242 C  CB    . GLN A 1 173 ? -37.55600 -7.37300  -17.24000 1.000 25.17000  ? 161 GLN A CB    1 
ATOM   1243 C  CG    . GLN A 1 173 ? -38.28500 -7.47500  -18.54100 1.000 24.13000  ? 161 GLN A CG    1 
ATOM   1244 C  CD    . GLN A 1 173 ? -37.47800 -8.24900  -19.52100 1.000 28.74000  ? 161 GLN A CD    1 
ATOM   1245 O  OE1   . GLN A 1 173 ? -37.87400 -8.42200  -20.67000 1.000 28.32000  ? 161 GLN A OE1   1 
ATOM   1246 N  NE2   . GLN A 1 173 ? -36.30900 -8.72100  -19.07700 1.000 30.90000  ? 161 GLN A NE2   1 
ATOM   1247 N  N     . SER A 1 174 ? -35.97500 -5.92900  -14.96500 1.000 24.24000  ? 162 SER A N     1 
ATOM   1248 C  CA    . SER A 1 174 ? -35.34900 -5.98700  -13.66600 1.000 28.50000  ? 162 SER A CA    1 
ATOM   1249 C  C     . SER A 1 174 ? -35.80000 -4.82400  -12.77100 1.000 29.89000  ? 162 SER A C     1 
ATOM   1250 O  O     . SER A 1 174 ? -36.08600 -5.00400  -11.57400 1.000 29.54000  ? 162 SER A O     1 
ATOM   1251 C  CB    . SER A 1 174 ? -33.84100 -5.97600  -13.81300 1.000 24.25000  ? 162 SER A CB    1 
ATOM   1252 O  OG    . SER A 1 174 ? -33.27300 -6.14000  -12.53800 1.000 39.68000  ? 162 SER A OG    1 
ATOM   1253 N  N     . SER A 1 175 ? -35.84100 -3.63000  -13.35000 1.000 27.28000  ? 163 SER A N     1 
ATOM   1254 C  CA    . SER A 1 175 ? -36.30500 -2.45700  -12.62700 1.000 32.58000  ? 163 SER A CA    1 
ATOM   1255 C  C     . SER A 1 175 ? -37.72200 -2.65300  -12.13800 1.000 27.41000  ? 163 SER A C     1 
ATOM   1256 O  O     . SER A 1 175 ? -38.04600 -2.30300  -11.01300 1.000 29.22000  ? 163 SER A O     1 
ATOM   1257 C  CB    . SER A 1 175 ? -36.22900 -1.21600  -13.51300 1.000 30.00000  ? 163 SER A CB    1 
ATOM   1258 O  OG    . SER A 1 175 ? -34.86800 -0.93000  -13.80200 1.000 35.39000  ? 163 SER A OG    1 
ATOM   1259 N  N     . MET A 1 176 ? -38.55600 -3.21300  -13.00700 1.000 29.26000  ? 164 MET A N     1 
ATOM   1260 C  CA    . MET A 1 176 ? -39.96500 -3.47800  -12.72900 1.000 23.76000  ? 164 MET A CA    1 
ATOM   1261 C  C     . MET A 1 176 ? -40.11000 -4.43700  -11.54200 1.000 25.16000  ? 164 MET A C     1 
ATOM   1262 O  O     . MET A 1 176 ? -41.01300 -4.28800  -10.71200 1.000 27.29000  ? 164 MET A O     1 
ATOM   1263 C  CB    . MET A 1 176 ? -40.63300 -4.04800  -13.98800 1.000 25.23000  ? 164 MET A CB    1 
ATOM   1264 C  CG    . MET A 1 176 ? -42.13600 -4.27400  -13.90700 1.000 27.55000  ? 164 MET A CG    1 
ATOM   1265 S  SD    . MET A 1 176 ? -43.05900 -2.75800  -13.60000 1.000 39.75000  ? 164 MET A SD    1 
ATOM   1266 C  CE    . MET A 1 176 ? -44.21800 -2.72600  -14.96400 1.000 30.55000  ? 164 MET A CE    1 
ATOM   1267 N  N     . THR A 1 177 ? -39.20900 -5.41300  -11.46600 1.000 27.44000  ? 165 THR A N     1 
ATOM   1268 C  CA    . THR A 1 177 ? -39.24900 -6.43400  -10.43000 1.000 25.29000  ? 165 THR A CA    1 
ATOM   1269 C  C     . THR A 1 177 ? -38.88800 -5.78200  -9.09300  1.000 30.26000  ? 165 THR A C     1 
ATOM   1270 O  O     . THR A 1 177 ? -39.53200 -6.06700  -8.06800  1.000 30.40000  ? 165 THR A O     1 
ATOM   1271 C  CB    . THR A 1 177 ? -38.30500 -7.62100  -10.77000 1.000 21.29000  ? 165 THR A CB    1 
ATOM   1272 O  OG1   . THR A 1 177 ? -38.68400 -8.15900  -12.03500 1.000 23.92000  ? 165 THR A OG1   1 
ATOM   1273 C  CG2   . THR A 1 177 ? -38.40200 -8.74800  -9.76700  1.000 18.72000  ? 165 THR A CG2   1 
ATOM   1274 N  N     . LYS A 1 178 ? -37.89200 -4.89200  -9.09800  1.000 25.65000  ? 166 LYS A N     1 
ATOM   1275 C  CA    . LYS A 1 178 ? -37.55800 -4.13800  -7.88600  1.000 27.93000  ? 166 LYS A CA    1 
ATOM   1276 C  C     . LYS A 1 178 ? -38.75800 -3.34300  -7.39900  1.000 28.13000  ? 166 LYS A C     1 
ATOM   1277 O  O     . LYS A 1 178 ? -39.11800 -3.39100  -6.22400  1.000 36.81000  ? 166 LYS A O     1 
ATOM   1278 C  CB    . LYS A 1 178 ? -36.36600 -3.19700  -8.11600  1.000 28.39000  ? 166 LYS A CB    1 
ATOM   1279 C  CG    . LYS A 1 178 ? -35.04700 -3.91800  -7.96000  1.000 36.10000  ? 166 LYS A CG    1 
ATOM   1280 C  CD    . LYS A 1 178 ? -33.85100 -2.98000  -7.92400  1.000 46.50000  ? 166 LYS A CD    1 
ATOM   1281 C  CE    . LYS A 1 178 ? -32.58700 -3.66800  -8.51000  1.000 57.72000  ? 166 LYS A CE    1 
ATOM   1282 N  NZ    . LYS A 1 178 ? -32.21600 -5.00500  -7.91000  1.000 48.54000  ? 166 LYS A NZ    1 
ATOM   1283 N  N     . ILE A 1 179 ? -39.38800 -2.63200  -8.31900  1.000 28.02000  ? 167 ILE A N     1 
ATOM   1284 C  CA    . ILE A 1 179 ? -40.52000 -1.78100  -8.00100  1.000 26.37000  ? 167 ILE A CA    1 
ATOM   1285 C  C     . ILE A 1 179 ? -41.69400 -2.57400  -7.41400  1.000 27.33000  ? 167 ILE A C     1 
ATOM   1286 O  O     . ILE A 1 179 ? -42.35000 -2.13100  -6.47700  1.000 29.80000  ? 167 ILE A O     1 
ATOM   1287 C  CB    . ILE A 1 179 ? -40.95300 -1.00700  -9.25400  1.000 24.63000  ? 167 ILE A CB    1 
ATOM   1288 C  CG1   . ILE A 1 179 ? -39.81300 -0.09000  -9.69600  1.000 22.24000  ? 167 ILE A CG1   1 
ATOM   1289 C  CG2   . ILE A 1 179 ? -42.19900 -0.19100  -8.98100  1.000 31.83000  ? 167 ILE A CG2   1 
ATOM   1290 C  CD1   . ILE A 1 179 ? -40.15500 0.87900   -10.80100 1.000 20.72000  ? 167 ILE A CD1   1 
ATOM   1291 N  N     . LEU A 1 180 ? -41.95100 -3.75800  -7.94800  1.000 29.07000  ? 168 LEU A N     1 
ATOM   1292 C  CA    . LEU A 1 180 ? -43.10200 -4.56000  -7.50800  1.000 30.57000  ? 168 LEU A CA    1 
ATOM   1293 C  C     . LEU A 1 180 ? -42.83700 -5.38500  -6.25100  1.000 31.47000  ? 168 LEU A C     1 
ATOM   1294 O  O     . LEU A 1 180 ? -43.77000 -5.93600  -5.65300  1.000 29.76000  ? 168 LEU A O     1 
ATOM   1295 C  CB    . LEU A 1 180 ? -43.55300 -5.51100  -8.63000  1.000 24.53000  ? 168 LEU A CB    1 
ATOM   1296 C  CG    . LEU A 1 180 ? -44.29900 -4.87400  -9.79400  1.000 21.49000  ? 168 LEU A CG    1 
ATOM   1297 C  CD1   . LEU A 1 180 ? -44.52200 -5.91200  -10.83000 1.000 23.51000  ? 168 LEU A CD1   1 
ATOM   1298 C  CD2   . LEU A 1 180 ? -45.62400 -4.29900  -9.31500  1.000 18.89000  ? 168 LEU A CD2   1 
ATOM   1299 N  N     . GLU A 1 181 ? -41.57400 -5.50100  -5.85600  1.000 34.87000  ? 169 GLU A N     1 
ATOM   1300 C  CA    . GLU A 1 181 ? -41.24900 -6.39800  -4.75300  1.000 34.87000  ? 169 GLU A CA    1 
ATOM   1301 C  C     . GLU A 1 181 ? -41.88100 -5.98500  -3.40900  1.000 36.88000  ? 169 GLU A C     1 
ATOM   1302 O  O     . GLU A 1 181 ? -42.46900 -6.84100  -2.73300  1.000 38.11000  ? 169 GLU A O     1 
ATOM   1303 C  CB    . GLU A 1 181 ? -39.74000 -6.53200  -4.61000  1.000 34.01000  ? 169 GLU A CB    1 
ATOM   1304 C  CG    . GLU A 1 181 ? -39.35000 -7.68400  -3.72600  1.000 49.79000  ? 169 GLU A CG    1 
ATOM   1305 C  CD    . GLU A 1 181 ? -38.78300 -7.23100  -2.39600  1.000 62.24000  ? 169 GLU A CD    1 
ATOM   1306 O  OE1   . GLU A 1 181 ? -38.86900 -6.01800  -2.07700  1.000 55.86000  ? 169 GLU A OE1   1 
ATOM   1307 O  OE2   . GLU A 1 181 ? -38.24200 -8.09800  -1.67100  1.000 78.51000  ? 169 GLU A OE2   1 
ATOM   1308 N  N     . PRO A 1 182 ? -41.76500 -4.69400  -3.01400  1.000 30.59000  ? 170 PRO A N     1 
ATOM   1309 C  CA    . PRO A 1 182 ? -42.46500 -4.22800  -1.81300  1.000 35.50000  ? 170 PRO A CA    1 
ATOM   1310 C  C     . PRO A 1 182 ? -43.94100 -4.57100  -1.81100  1.000 38.76000  ? 170 PRO A C     1 
ATOM   1311 O  O     . PRO A 1 182 ? -44.48300 -4.98600  -0.77800  1.000 41.83000  ? 170 PRO A O     1 
ATOM   1312 C  CB    . PRO A 1 182 ? -42.29800 -2.70700  -1.86900  1.000 31.45000  ? 170 PRO A CB    1 
ATOM   1313 C  CG    . PRO A 1 182 ? -41.07700 -2.49300  -2.57900  1.000 28.62000  ? 170 PRO A CG    1 
ATOM   1314 C  CD    . PRO A 1 182 ? -40.91600 -3.62200  -3.57000  1.000 34.79000  ? 170 PRO A CD    1 
ATOM   1315 N  N     . PHE A 1 183 ? -44.58800 -4.36800  -2.95200  1.000 34.04000  ? 171 PHE A N     1 
ATOM   1316 C  CA    . PHE A 1 183 ? -46.00700 -4.64700  -3.07100  1.000 30.81000  ? 171 PHE A CA    1 
ATOM   1317 C  C     . PHE A 1 183 ? -46.26600 -6.13500  -2.99700  1.000 31.48000  ? 171 PHE A C     1 
ATOM   1318 O  O     . PHE A 1 183 ? -47.30600 -6.56200  -2.48600  1.000 32.00000  ? 171 PHE A O     1 
ATOM   1319 C  CB    . PHE A 1 183 ? -46.56800 -4.09300  -4.37800  1.000 28.14000  ? 171 PHE A CB    1 
ATOM   1320 C  CG    . PHE A 1 183 ? -48.06400 -4.21100  -4.49000  1.000 28.98000  ? 171 PHE A CG    1 
ATOM   1321 C  CD1   . PHE A 1 183 ? -48.65800 -5.39000  -4.90900  1.000 22.22000  ? 171 PHE A CD1   1 
ATOM   1322 C  CD2   . PHE A 1 183 ? -48.87700 -3.13400  -4.18200  1.000 28.02000  ? 171 PHE A CD2   1 
ATOM   1323 C  CE1   . PHE A 1 183 ? -50.01800 -5.49200  -5.01100  1.000 24.22000  ? 171 PHE A CE1   1 
ATOM   1324 C  CE2   . PHE A 1 183 ? -50.24700 -3.24300  -4.28400  1.000 32.24000  ? 171 PHE A CE2   1 
ATOM   1325 C  CZ    . PHE A 1 183 ? -50.81900 -4.41300  -4.69700  1.000 23.87000  ? 171 PHE A CZ    1 
ATOM   1326 N  N     . ARG A 1 184 ? -45.34200 -6.92900  -3.53100  1.000 28.95000  ? 172 ARG A N     1 
ATOM   1327 C  CA    . ARG A 1 184 ? -45.57400 -8.35500  -3.55500  1.000 28.24000  ? 172 ARG A CA    1 
ATOM   1328 C  C     . ARG A 1 184 ? -45.46000 -8.85900  -2.13700  1.000 30.20000  ? 172 ARG A C     1 
ATOM   1329 O  O     . ARG A 1 184 ? -46.30300 -9.62200  -1.69300  1.000 34.49000  ? 172 ARG A O     1 
ATOM   1330 C  CB    . ARG A 1 184 ? -44.60400 -9.08400  -4.49900  1.000 27.15000  ? 172 ARG A CB    1 
ATOM   1331 C  CG    . ARG A 1 184 ? -44.95000 -8.96600  -5.99600  1.000 22.25000  ? 172 ARG A CG    1 
ATOM   1332 C  CD    . ARG A 1 184 ? -44.17600 -9.95500  -6.84500  1.000 21.37000  ? 172 ARG A CD    1 
ATOM   1333 N  NE    . ARG A 1 184 ? -44.69000 -10.03100 -8.21600  1.000 26.26000  ? 172 ARG A NE    1 
ATOM   1334 C  CZ    . ARG A 1 184 ? -44.05800 -9.55900  -9.29000  1.000 27.35000  ? 172 ARG A CZ    1 
ATOM   1335 N  NH1   . ARG A 1 184 ? -42.87500 -8.96600  -9.17100  1.000 28.01000  ? 172 ARG A NH1   1 
ATOM   1336 N  NH2   . ARG A 1 184 ? -44.60500 -9.68400  -10.49100 1.000 26.42000  ? 172 ARG A NH2   1 
ATOM   1337 N  N     . LYS A 1 185 ? -44.43600 -8.39500  -1.42200  1.000 35.83000  ? 173 LYS A N     1 
ATOM   1338 C  CA    . LYS A 1 185 ? -44.17900 -8.78900  -0.02700  1.000 35.90000  ? 173 LYS A CA    1 
ATOM   1339 C  C     . LYS A 1 185 ? -45.37000 -8.46900  0.88100   1.000 35.11000  ? 173 LYS A C     1 
ATOM   1340 O  O     . LYS A 1 185 ? -45.84300 -9.30200  1.65800   1.000 39.56000  ? 173 LYS A O     1 
ATOM   1341 C  CB    . LYS A 1 185 ? -42.91900 -8.08000  0.48800   1.000 38.24000  ? 173 LYS A CB    1 
ATOM   1342 C  CG    . LYS A 1 185 ? -41.92800 -8.98400  1.19800   1.000 44.82000  ? 173 LYS A CG    1 
ATOM   1343 C  CD    . LYS A 1 185 ? -40.86500 -9.51800  0.25300   1.000 56.32000  ? 173 LYS A CD    1 
ATOM   1344 C  CE    . LYS A 1 185 ? -40.07200 -10.65000 0.91400   1.000 67.31000  ? 173 LYS A CE    1 
ATOM   1345 N  NZ    . LYS A 1 185 ? -38.78300 -10.96300 0.21100   1.000 75.65000  ? 173 LYS A NZ    1 
ATOM   1346 N  N     . GLN A 1 186 ? -45.85700 -7.24600  0.73700   1.000 36.14000  ? 174 GLN A N     1 
ATOM   1347 C  CA    . GLN A 1 186 ? -47.00700 -6.73600  1.45800   1.000 37.77000  ? 174 GLN A CA    1 
ATOM   1348 C  C     . GLN A 1 186 ? -48.31200 -7.41400  1.05900   1.000 33.88000  ? 174 GLN A C     1 
ATOM   1349 O  O     . GLN A 1 186 ? -49.24500 -7.47700  1.84400   1.000 36.62000  ? 174 GLN A O     1 
ATOM   1350 C  CB    . GLN A 1 186 ? -47.10600 -5.23000  1.21900   1.000 36.13000  ? 174 GLN A CB    1 
ATOM   1351 C  CG    . GLN A 1 186 ? -48.17700 -4.52200  1.98900   1.000 36.94000  ? 174 GLN A CG    1 
ATOM   1352 C  CD    . GLN A 1 186 ? -48.11600 -3.00800  1.79200   1.000 49.04000  ? 174 GLN A CD    1 
ATOM   1353 O  OE1   . GLN A 1 186 ? -47.03200 -2.44400  1.54100   1.000 54.31000  ? 174 GLN A OE1   1 
ATOM   1354 N  NE2   . GLN A 1 186 ? -49.27800 -2.34100  1.90500   1.000 41.64000  ? 174 GLN A NE2   1 
ATOM   1355 N  N     . ASN A 1 187 ? -48.38000 -7.90600  -0.16800  1.000 32.72000  ? 175 ASN A N     1 
ATOM   1356 C  CA    . ASN A 1 187 ? -49.60500 -8.50400  -0.67400  1.000 31.78000  ? 175 ASN A CA    1 
ATOM   1357 C  C     . ASN A 1 187 ? -49.30700 -9.87800  -1.27000  1.000 39.17000  ? 175 ASN A C     1 
ATOM   1358 O  O     . ASN A 1 187 ? -49.39300 -10.08500 -2.48400  1.000 44.10000  ? 175 ASN A O     1 
ATOM   1359 C  CB    . ASN A 1 187 ? -50.25300 -7.59200  -1.71100  1.000 27.37000  ? 175 ASN A CB    1 
ATOM   1360 C  CG    . ASN A 1 187 ? -50.65600 -6.23400  -1.13800  1.000 34.00000  ? 175 ASN A CG    1 
ATOM   1361 O  OD1   . ASN A 1 187 ? -51.77200 -6.07300  -0.65200  1.000 36.90000  ? 175 ASN A OD1   1 
ATOM   1362 N  ND2   . ASN A 1 187 ? -49.76100 -5.24800  -1.22000  1.000 29.24000  ? 175 ASN A ND2   1 
ATOM   1363 N  N     . PRO A 1 188 ? -48.94100 -10.83000 -0.41000  1.000 43.13000  ? 176 PRO A N     1 
ATOM   1364 C  CA    . PRO A 1 188 ? -48.46600 -12.12900 -0.87100  1.000 39.55000  ? 176 PRO A CA    1 
ATOM   1365 C  C     . PRO A 1 188 ? -49.52600 -12.87400 -1.64700  1.000 41.91000  ? 176 PRO A C     1 
ATOM   1366 O  O     . PRO A 1 188 ? -49.20000 -13.69700 -2.48500  1.000 48.71000  ? 176 PRO A O     1 
ATOM   1367 C  CB    . PRO A 1 188 ? -48.14300 -12.86300 0.42600   1.000 33.10000  ? 176 PRO A CB    1 
ATOM   1368 C  CG    . PRO A 1 188 ? -48.04900 -11.79100 1.47300   1.000 38.23000  ? 176 PRO A CG    1 
ATOM   1369 C  CD    . PRO A 1 188 ? -49.04200 -10.78200 1.05600   1.000 45.23000  ? 176 PRO A CD    1 
ATOM   1370 N  N     . ASP A 1 189 ? -50.79000 -12.57700 -1.39600  1.000 46.21000  ? 177 ASP A N     1 
ATOM   1371 C  CA    . ASP A 1 189 ? -51.83400 -13.41100 -1.96100  1.000 45.18000  ? 177 ASP A CA    1 
ATOM   1372 C  C     . ASP A 1 189 ? -52.53600 -12.76300 -3.14700  1.000 37.64000  ? 177 ASP A C     1 
ATOM   1373 O  O     . ASP A 1 189 ? -53.54000 -13.27000 -3.63500  1.000 42.69000  ? 177 ASP A O     1 
ATOM   1374 C  CB    . ASP A 1 189 ? -52.79800 -13.80100 -0.84000  1.000 50.14000  ? 177 ASP A CB    1 
ATOM   1375 C  CG    . ASP A 1 189 ? -52.11600 -14.72100 0.20400   1.000 64.53000  ? 177 ASP A CG    1 
ATOM   1376 O  OD1   . ASP A 1 189 ? -51.22400 -15.51800 -0.18700  1.000 62.16000  ? 177 ASP A OD1   1 
ATOM   1377 O  OD2   . ASP A 1 189 ? -52.41900 -14.62000 1.41600   1.000 63.37000  ? 177 ASP A OD2   1 
ATOM   1378 N  N     . ILE A 1 190 ? -51.97300 -11.65700 -3.62200  1.000 34.93000  ? 178 ILE A N     1 
ATOM   1379 C  CA    . ILE A 1 190 ? -52.35400 -11.05100 -4.89400  1.000 33.31000  ? 178 ILE A CA    1 
ATOM   1380 C  C     . ILE A 1 190 ? -51.37700 -11.54700 -5.96600  1.000 33.84000  ? 178 ILE A C     1 
ATOM   1381 O  O     . ILE A 1 190 ? -50.17000 -11.48500 -5.77700  1.000 34.00000  ? 178 ILE A O     1 
ATOM   1382 C  CB    . ILE A 1 190 ? -52.30200 -9.50200  -4.83500  1.000 34.98000  ? 178 ILE A CB    1 
ATOM   1383 C  CG1   . ILE A 1 190 ? -53.23900 -8.94300  -3.76600  1.000 31.11000  ? 178 ILE A CG1   1 
ATOM   1384 C  CG2   . ILE A 1 190 ? -52.64400 -8.89700  -6.17900  1.000 27.41000  ? 178 ILE A CG2   1 
ATOM   1385 C  CD1   . ILE A 1 190 ? -54.65000 -8.83400  -4.21900  1.000 30.53000  ? 178 ILE A CD1   1 
ATOM   1386 N  N     . VAL A 1 191 ? -51.86600 -12.04400 -7.08900  1.000 29.81000  ? 179 VAL A N     1 
ATOM   1387 C  CA    . VAL A 1 191 ? -50.93200 -12.57600 -8.06300  1.000 29.40000  ? 179 VAL A CA    1 
ATOM   1388 C  C     . VAL A 1 191 ? -50.75300 -11.59700 -9.21100  1.000 29.84000  ? 179 VAL A C     1 
ATOM   1389 O  O     . VAL A 1 191 ? -51.71900 -11.18500 -9.85000  1.000 30.58000  ? 179 VAL A O     1 
ATOM   1390 C  CB    . VAL A 1 191 ? -51.37600 -13.96800 -8.59000  1.000 30.38000  ? 179 VAL A CB    1 
ATOM   1391 C  CG1   . VAL A 1 191 ? -52.78900 -13.94300 -9.04200  1.000 40.02000  ? 179 VAL A CG1   1 
ATOM   1392 C  CG2   . VAL A 1 191 ? -50.49800 -14.41300 -9.73200  1.000 38.26000  ? 179 VAL A CG2   1 
ATOM   1393 N  N     . ILE A 1 192 ? -49.49900 -11.22300 -9.45200  1.000 28.74000  ? 180 ILE A N     1 
ATOM   1394 C  CA    . ILE A 1 192 ? -49.13900 -10.28500 -10.50300 1.000 21.90000  ? 180 ILE A CA    1 
ATOM   1395 C  C     . ILE A 1 192 ? -48.26000 -10.95000 -11.54500 1.000 27.11000  ? 180 ILE A C     1 
ATOM   1396 O  O     . ILE A 1 192 ? -47.05000 -11.13100 -11.32300 1.000 27.20000  ? 180 ILE A O     1 
ATOM   1397 C  CB    . ILE A 1 192 ? -48.39700 -9.06500  -9.92600  1.000 23.17000  ? 180 ILE A CB    1 
ATOM   1398 C  CG1   . ILE A 1 192 ? -49.18200 -8.48100  -8.74900  1.000 26.15000  ? 180 ILE A CG1   1 
ATOM   1399 C  CG2   . ILE A 1 192 ? -48.11700 -8.00100  -11.01700 1.000 20.51000  ? 180 ILE A CG2   1 
ATOM   1400 C  CD1   . ILE A 1 192 ? -48.44300 -7.34900  -8.04400  1.000 22.10000  ? 180 ILE A CD1   1 
ATOM   1401 N  N     . TYR A 1 193 ? -48.86400 -11.34600 -12.66500 1.000 29.21000  ? 181 TYR A N     1 
ATOM   1402 C  CA    . TYR A 1 193 ? -48.09200 -11.81400 -13.81900 1.000 22.75000  ? 181 TYR A CA    1 
ATOM   1403 C  C     . TYR A 1 193 ? -47.53700 -10.61200 -14.55500 1.000 26.54000  ? 181 TYR A C     1 
ATOM   1404 O  O     . TYR A 1 193 ? -48.28200 -9.75200  -15.01200 1.000 27.69000  ? 181 TYR A O     1 
ATOM   1405 C  CB    . TYR A 1 193 ? -48.94700 -12.65800 -14.75300 1.000 23.43000  ? 181 TYR A CB    1 
ATOM   1406 C  CG    . TYR A 1 193 ? -48.91100 -14.13300 -14.45800 1.000 23.91000  ? 181 TYR A CG    1 
ATOM   1407 C  CD1   . TYR A 1 193 ? -49.59100 -14.66400 -13.37400 1.000 21.72000  ? 181 TYR A CD1   1 
ATOM   1408 C  CD2   . TYR A 1 193 ? -48.19100 -15.00200 -15.27700 1.000 25.64000  ? 181 TYR A CD2   1 
ATOM   1409 C  CE1   . TYR A 1 193 ? -49.56600 -16.03100 -13.11800 1.000 24.68000  ? 181 TYR A CE1   1 
ATOM   1410 C  CE2   . TYR A 1 193 ? -48.15500 -16.36000 -15.03900 1.000 25.86000  ? 181 TYR A CE2   1 
ATOM   1411 C  CZ    . TYR A 1 193 ? -48.84700 -16.87700 -13.95800 1.000 30.55000  ? 181 TYR A CZ    1 
ATOM   1412 O  OH    . TYR A 1 193 ? -48.79800 -18.24500 -13.72400 1.000 28.80000  ? 181 TYR A OH    1 
ATOM   1413 N  N     . GLN A 1 194 ? -46.22100 -10.57500 -14.67400 1.000 28.02000  ? 182 GLN A N     1 
ATOM   1414 C  CA    . GLN A 1 194 ? -45.49700 -9.38700  -15.08300 1.000 24.95000  ? 182 GLN A CA    1 
ATOM   1415 C  C     . GLN A 1 194 ? -44.68500 -9.62400  -16.37400 1.000 31.22000  ? 182 GLN A C     1 
ATOM   1416 O  O     . GLN A 1 194 ? -43.57000 -10.14600 -16.31500 1.000 31.06000  ? 182 GLN A O     1 
ATOM   1417 C  CB    . GLN A 1 194 ? -44.59000 -8.98200  -13.93400 1.000 23.01000  ? 182 GLN A CB    1 
ATOM   1418 C  CG    . GLN A 1 194 ? -43.62000 -7.88100  -14.23700 1.000 24.64000  ? 182 GLN A CG    1 
ATOM   1419 C  CD    . GLN A 1 194 ? -42.43400 -7.94700  -13.32400 1.000 26.50000  ? 182 GLN A CD    1 
ATOM   1420 O  OE1   . GLN A 1 194 ? -42.52500 -8.46000  -12.19300 1.000 25.61000  ? 182 GLN A OE1   1 
ATOM   1421 N  NE2   . GLN A 1 194 ? -41.29500 -7.44200  -13.80300 1.000 29.53000  ? 182 GLN A NE2   1 
ATOM   1422 N  N     . TYR A 1 195 ? -45.24900 -9.28400  -17.53600 1.000 30.15000  ? 183 TYR A N     1 
ATOM   1423 C  CA    . TYR A 1 195 ? -44.54900 -9.49000  -18.80800 1.000 24.49000  ? 183 TYR A CA    1 
ATOM   1424 C  C     . TYR A 1 195 ? -44.26500 -8.14300  -19.42600 1.000 31.02000  ? 183 TYR A C     1 
ATOM   1425 O  O     . TYR A 1 195 ? -45.19100 -7.46300  -19.89700 1.000 33.46000  ? 183 TYR A O     1 
ATOM   1426 C  CB    . TYR A 1 195 ? -45.36500 -10.34400 -19.77700 1.000 24.76000  ? 183 TYR A CB    1 
ATOM   1427 C  CG    . TYR A 1 195 ? -44.53900 -10.85700 -20.93600 1.000 26.05000  ? 183 TYR A CG    1 
ATOM   1428 C  CD1   . TYR A 1 195 ? -43.73700 -11.98300 -20.79700 1.000 24.26000  ? 183 TYR A CD1   1 
ATOM   1429 C  CD2   . TYR A 1 195 ? -44.53200 -10.19900 -22.15600 1.000 25.98000  ? 183 TYR A CD2   1 
ATOM   1430 C  CE1   . TYR A 1 195 ? -42.96100 -12.43600 -21.84600 1.000 22.68000  ? 183 TYR A CE1   1 
ATOM   1431 C  CE2   . TYR A 1 195 ? -43.75600 -10.64500 -23.21300 1.000 23.03000  ? 183 TYR A CE2   1 
ATOM   1432 C  CZ    . TYR A 1 195 ? -42.98000 -11.76100 -23.05600 1.000 24.89000  ? 183 TYR A CZ    1 
ATOM   1433 O  OH    . TYR A 1 195 ? -42.22300 -12.22200 -24.11300 1.000 27.65000  ? 183 TYR A OH    1 
ATOM   1434 N  N     . MET A 1 196 ? -42.99100 -7.75300  -19.42000 1.000 26.73000  ? 184 MET A N     1 
ATOM   1435 C  CA    . MET A 1 196 ? -42.59500 -6.38300  -19.73600 1.000 27.11000  ? 184 MET A CA    1 
ATOM   1436 C  C     . MET A 1 196 ? -43.35800 -5.37500  -18.87800 1.000 31.78000  ? 184 MET A C     1 
ATOM   1437 O  O     . MET A 1 196 ? -43.20000 -5.33500  -17.65600 1.000 29.60000  ? 184 MET A O     1 
ATOM   1438 C  CB    . MET A 1 196 ? -42.80400 -6.05800  -21.21900 1.000 26.07000  ? 184 MET A CB    1 
ATOM   1439 C  CG    . MET A 1 196 ? -41.66600 -6.49200  -22.10300 1.000 35.02000  ? 184 MET A CG    1 
ATOM   1440 S  SD    . MET A 1 196 ? -40.08300 -5.65600  -21.78100 1.000 39.12000  ? 184 MET A SD    1 
ATOM   1441 C  CE    . MET A 1 196 ? -39.10300 -6.69700  -22.86900 1.000 34.44000  ? 184 MET A CE    1 
ATOM   1442 N  N     . ASP A 1 197 ? -44.17500 -4.56000  -19.53400 1.000 29.66000  ? 185 ASP A N     1 
ATOM   1443 C  CA    . ASP A 1 197 ? -44.88200 -3.46400  -18.88400 1.000 34.21000  ? 185 ASP A CA    1 
ATOM   1444 C  C     . ASP A 1 197 ? -46.34500 -3.84000  -18.65600 1.000 37.51000  ? 185 ASP A C     1 
ATOM   1445 O  O     . ASP A 1 197 ? -47.15700 -3.06100  -18.17000 1.000 34.26000  ? 185 ASP A O     1 
ATOM   1446 C  CB    . ASP A 1 197 ? -44.78800 -2.20800  -19.74400 1.000 37.68000  ? 185 ASP A CB    1 
ATOM   1447 C  CG    . ASP A 1 197 ? -45.48000 -2.36700  -21.09300 1.000 42.66000  ? 185 ASP A CG    1 
ATOM   1448 O  OD1   . ASP A 1 197 ? -45.76200 -3.51500  -21.51400 1.000 43.88000  ? 185 ASP A OD1   1 
ATOM   1449 O  OD2   . ASP A 1 197 ? -45.75500 -1.33300  -21.73200 1.000 50.74000  ? 185 ASP A OD2   1 
ATOM   1450 N  N     . ASP A 1 198 ? -46.66300 -5.06600  -19.02100 1.000 35.15000  ? 186 ASP A N     1 
ATOM   1451 C  CA    . ASP A 1 198 ? -48.01600 -5.55200  -18.96900 1.000 36.69000  ? 186 ASP A CA    1 
ATOM   1452 C  C     . ASP A 1 198 ? -48.26000 -6.37400  -17.68400 1.000 32.63000  ? 186 ASP A C     1 
ATOM   1453 O  O     . ASP A 1 198 ? -47.52300 -7.31500  -17.40400 1.000 38.77000  ? 186 ASP A O     1 
ATOM   1454 C  CB    . ASP A 1 198 ? -48.24200 -6.36300  -20.24100 1.000 44.39000  ? 186 ASP A CB    1 
ATOM   1455 C  CG    . ASP A 1 198 ? -49.54400 -7.06500  -20.25700 1.000 48.64000  ? 186 ASP A CG    1 
ATOM   1456 O  OD1   . ASP A 1 198 ? -50.52500 -6.46100  -19.77000 1.000 52.63000  ? 186 ASP A OD1   1 
ATOM   1457 O  OD2   . ASP A 1 198 ? -49.57300 -8.21700  -20.76800 1.000 52.23000  ? 186 ASP A OD2   1 
ATOM   1458 N  N     . LEU A 1 199 ? -49.27200 -6.01700  -16.89600 1.000 31.78000  ? 187 LEU A N     1 
ATOM   1459 C  CA    . LEU A 1 199 ? -49.56900 -6.75000  -15.65800 1.000 32.48000  ? 187 LEU A CA    1 
ATOM   1460 C  C     . LEU A 1 199 ? -50.97300 -7.42400  -15.61300 1.000 34.37000  ? 187 LEU A C     1 
ATOM   1461 O  O     . LEU A 1 199 ? -52.01000 -6.76700  -15.79200 1.000 35.63000  ? 187 LEU A O     1 
ATOM   1462 C  CB    . LEU A 1 199 ? -49.42100 -5.81200  -14.45800 1.000 26.14000  ? 187 LEU A CB    1 
ATOM   1463 C  CG    . LEU A 1 199 ? -48.14900 -4.96500  -14.43500 1.000 29.54000  ? 187 LEU A CG    1 
ATOM   1464 C  CD1   . LEU A 1 199 ? -48.28800 -3.83800  -13.42700 1.000 23.56000  ? 187 LEU A CD1   1 
ATOM   1465 C  CD2   . LEU A 1 199 ? -46.91400 -5.79700  -14.14300 1.000 26.36000  ? 187 LEU A CD2   1 
ATOM   1466 N  N     . TYR A 1 200 ? -50.99500 -8.73600  -15.36800 1.000 29.93000  ? 188 TYR A N     1 
ATOM   1467 C  CA    . TYR A 1 200 ? -52.22900 -9.44600  -15.02200 1.000 28.66000  ? 188 TYR A CA    1 
ATOM   1468 C  C     . TYR A 1 200 ? -52.30500 -9.51500  -13.48900 1.000 29.74000  ? 188 TYR A C     1 
ATOM   1469 O  O     . TYR A 1 200 ? -51.36800 -9.98600  -12.83700 1.000 28.85000  ? 188 TYR A O     1 
ATOM   1470 C  CB    . TYR A 1 200 ? -52.23100 -10.83700 -15.68200 1.000 32.14000  ? 188 TYR A CB    1 
ATOM   1471 C  CG    . TYR A 1 200 ? -53.23600 -11.87300 -15.17200 1.000 28.58000  ? 188 TYR A CG    1 
ATOM   1472 C  CD1   . TYR A 1 200 ? -53.04500 -12.51800 -13.96300 1.000 27.51000  ? 188 TYR A CD1   1 
ATOM   1473 C  CD2   . TYR A 1 200 ? -54.33300 -12.25000 -15.94200 1.000 26.58000  ? 188 TYR A CD2   1 
ATOM   1474 C  CE1   . TYR A 1 200 ? -53.93900 -13.48000 -13.50800 1.000 36.37000  ? 188 TYR A CE1   1 
ATOM   1475 C  CE2   . TYR A 1 200 ? -55.22400 -13.18700 -15.49800 1.000 31.80000  ? 188 TYR A CE2   1 
ATOM   1476 C  CZ    . TYR A 1 200 ? -55.02500 -13.80900 -14.27700 1.000 36.27000  ? 188 TYR A CZ    1 
ATOM   1477 O  OH    . TYR A 1 200 ? -55.90800 -14.76800 -13.82400 1.000 43.15000  ? 188 TYR A OH    1 
ATOM   1478 N  N     . VAL A 1 201 ? -53.38600 -9.01100  -12.90300 1.000 28.65000  ? 189 VAL A N     1 
ATOM   1479 C  CA    . VAL A 1 201 ? -53.49400 -9.02900  -11.45000 1.000 28.67000  ? 189 VAL A CA    1 
ATOM   1480 C  C     . VAL A 1 201 ? -54.69000 -9.85700  -11.01400 1.000 32.61000  ? 189 VAL A C     1 
ATOM   1481 O  O     . VAL A 1 201 ? -55.82800 -9.53400  -11.36200 1.000 32.14000  ? 189 VAL A O     1 
ATOM   1482 C  CB    . VAL A 1 201 ? -53.63500 -7.61900  -10.84300 1.000 29.06000  ? 189 VAL A CB    1 
ATOM   1483 C  CG1   . VAL A 1 201 ? -53.60300 -7.72100  -9.33200  1.000 26.97000  ? 189 VAL A CG1   1 
ATOM   1484 C  CG2   . VAL A 1 201 ? -52.52800 -6.69100  -11.31800 1.000 28.30000  ? 189 VAL A CG2   1 
ATOM   1485 N  N     . GLY A 1 202 ? -54.43700 -10.92600 -10.26000 1.000 30.30000  ? 190 GLY A N     1 
ATOM   1486 C  CA    . GLY A 1 202 ? -55.50100 -11.81100 -9.82900  1.000 29.03000  ? 190 GLY A CA    1 
ATOM   1487 C  C     . GLY A 1 202 ? -55.64200 -11.83100 -8.32100  1.000 28.45000  ? 190 GLY A C     1 
ATOM   1488 O  O     . GLY A 1 202 ? -54.65100 -11.74900 -7.60000  1.000 34.92000  ? 190 GLY A O     1 
ATOM   1489 N  N     . SER A 1 203 ? -56.87000 -11.93600 -7.83700  1.000 26.05000  ? 191 SER A N     1 
ATOM   1490 C  CA    . SER A 1 203 ? -57.10200 -12.00700 -6.40200  1.000 32.62000  ? 191 SER A CA    1 
ATOM   1491 C  C     . SER A 1 203 ? -58.32600 -12.84000 -6.08400  1.000 35.02000  ? 191 SER A C     1 
ATOM   1492 O  O     . SER A 1 203 ? -59.19200 -13.03400 -6.93800  1.000 33.58000  ? 191 SER A O     1 
ATOM   1493 C  CB    . SER A 1 203 ? -57.28300 -10.62200 -5.81400  1.000 30.70000  ? 191 SER A CB    1 
ATOM   1494 O  OG    . SER A 1 203 ? -58.59600 -10.16800 -6.06400  1.000 33.55000  ? 191 SER A OG    1 
ATOM   1495 N  N     . ASP A 1 204 ? -58.39300 -13.32400 -4.84800  1.000 32.01000  ? 192 ASP A N     1 
ATOM   1496 C  CA    . ASP A 1 204 ? -59.53400 -14.12200 -4.41000  1.000 37.30000  ? 192 ASP A CA    1 
ATOM   1497 C  C     . ASP A 1 204 ? -60.46500 -13.26300 -3.56700  1.000 38.71000  ? 192 ASP A C     1 
ATOM   1498 O  O     . ASP A 1 204 ? -61.22000 -13.76000 -2.73900  1.000 38.69000  ? 192 ASP A O     1 
ATOM   1499 C  CB    . ASP A 1 204 ? -59.05900 -15.35300 -3.64300  1.000 36.57000  ? 192 ASP A CB    1 
ATOM   1500 C  CG    . ASP A 1 204 ? -58.50600 -16.43100 -4.57100  1.000 44.61000  ? 192 ASP A CG    1 
ATOM   1501 O  OD1   . ASP A 1 204 ? -59.25500 -16.85000 -5.49000  1.000 41.61000  ? 192 ASP A OD1   1 
ATOM   1502 O  OD2   . ASP A 1 204 ? -57.32800 -16.83100 -4.40100  1.000 41.56000  ? 192 ASP A OD2   1 
ATOM   1503 N  N     . LEU A 1 205 ? -60.38900 -11.95800 -3.81400  1.000 38.36000  ? 193 LEU A N     1 
ATOM   1504 C  CA    . LEU A 1 205 ? -61.19000 -10.94700 -3.14200  1.000 36.90000  ? 193 LEU A CA    1 
ATOM   1505 C  C     . LEU A 1 205 ? -62.47200 -10.70500 -3.91000  1.000 39.40000  ? 193 LEU A C     1 
ATOM   1506 O  O     . LEU A 1 205 ? -62.53800 -10.95900 -5.11400  1.000 36.41000  ? 193 LEU A O     1 
ATOM   1507 C  CB    . LEU A 1 205 ? -60.39300 -9.64000  -3.02000  1.000 35.62000  ? 193 LEU A CB    1 
ATOM   1508 C  CG    . LEU A 1 205 ? -59.06000 -9.83500  -2.30400  1.000 34.15000  ? 193 LEU A CG    1 
ATOM   1509 C  CD1   . LEU A 1 205 ? -58.15600 -8.63500  -2.48700  1.000 29.04000  ? 193 LEU A CD1   1 
ATOM   1510 C  CD2   . LEU A 1 205 ? -59.29200 -10.14800 -0.81500  1.000 30.51000  ? 193 LEU A CD2   1 
ATOM   1511 N  N     . GLU A 1 206 ? -63.49400 -10.21000 -3.22500  1.000 46.52000  ? 194 GLU A N     1 
ATOM   1512 C  CA    . GLU A 1 206 ? -64.70600 -9.79400  -3.92200  1.000 42.17000  ? 194 GLU A CA    1 
ATOM   1513 C  C     . GLU A 1 206 ? -64.43500 -8.45900  -4.59700  1.000 43.86000  ? 194 GLU A C     1 
ATOM   1514 O  O     . GLU A 1 206 ? -63.58100 -7.68600  -4.14300  1.000 41.33000  ? 194 GLU A O     1 
ATOM   1515 C  CB    . GLU A 1 206 ? -65.88800 -9.73600  -2.96000  1.000 45.97000  ? 194 GLU A CB    1 
ATOM   1516 C  CG    . GLU A 1 206 ? -66.26600 -11.14600 -2.51000  1.000 66.40000  ? 194 GLU A CG    1 
ATOM   1517 C  CD    . GLU A 1 206 ? -67.42800 -11.20500 -1.53500  1.000 82.20000  ? 194 GLU A CD    1 
ATOM   1518 O  OE1   . GLU A 1 206 ? -67.37100 -10.51400 -0.48600  1.000 82.94000  ? 194 GLU A OE1   1 
ATOM   1519 O  OE2   . GLU A 1 206 ? -68.38200 -11.97000 -1.81700  1.000 76.67000  ? 194 GLU A OE2   1 
ATOM   1520 N  N     . ILE A 1 207 ? -65.14600 -8.20500  -5.69000  1.000 44.33000  ? 195 ILE A N     1 
ATOM   1521 C  CA    . ILE A 1 207 ? -64.76900 -7.16600  -6.64300  1.000 35.96000  ? 195 ILE A CA    1 
ATOM   1522 C  C     . ILE A 1 207 ? -64.51400 -5.79800  -6.01100  1.000 40.54000  ? 195 ILE A C     1 
ATOM   1523 O  O     . ILE A 1 207 ? -63.69500 -5.01900  -6.50600  1.000 35.38000  ? 195 ILE A O     1 
ATOM   1524 C  CB    . ILE A 1 207 ? -65.84400 -7.03400  -7.73200  1.000 35.87000  ? 195 ILE A CB    1 
ATOM   1525 C  CG1   . ILE A 1 207 ? -65.24600 -6.39500  -8.97600  1.000 39.48000  ? 195 ILE A CG1   1 
ATOM   1526 C  CG2   . ILE A 1 207 ? -67.04700 -6.27900  -7.22300  1.000 36.95000  ? 195 ILE A CG2   1 
ATOM   1527 C  CD1   . ILE A 1 207 ? -64.06300 -7.17400  -9.50500  1.000 45.83000  ? 195 ILE A CD1   1 
ATOM   1528 N  N     . GLY A 1 208 ? -65.18800 -5.51700  -4.90100  1.000 42.05000  ? 196 GLY A N     1 
ATOM   1529 C  CA    . GLY A 1 208 ? -65.00200 -4.24800  -4.22500  1.000 39.06000  ? 196 GLY A CA    1 
ATOM   1530 C  C     . GLY A 1 208 ? -63.63700 -4.14300  -3.58500  1.000 38.57000  ? 196 GLY A C     1 
ATOM   1531 O  O     . GLY A 1 208 ? -62.90400 -3.17300  -3.79800  1.000 46.35000  ? 196 GLY A O     1 
ATOM   1532 N  N     . GLN A 1 209 ? -63.28900 -5.15100  -2.79500  1.000 40.50000  ? 197 GLN A N     1 
ATOM   1533 C  CA    . GLN A 1 209 ? -61.97800 -5.20900  -2.14900  1.000 39.48000  ? 197 GLN A CA    1 
ATOM   1534 C  C     . GLN A 1 209 ? -60.80700 -5.35600  -3.14000  1.000 40.22000  ? 197 GLN A C     1 
ATOM   1535 O  O     . GLN A 1 209 ? -59.70300 -4.86200  -2.89100  1.000 35.83000  ? 197 GLN A O     1 
ATOM   1536 C  CB    . GLN A 1 209 ? -61.95600 -6.35800  -1.16400  1.000 38.73000  ? 197 GLN A CB    1 
ATOM   1537 C  CG    . GLN A 1 209 ? -60.76500 -6.36200  -0.26800  1.000 47.81000  ? 197 GLN A CG    1 
ATOM   1538 C  CD    . GLN A 1 209 ? -61.04800 -7.16400  0.97100   1.000 56.02000  ? 197 GLN A CD    1 
ATOM   1539 O  OE1   . GLN A 1 209 ? -62.20100 -7.55100  1.22300   1.000 53.69000  ? 197 GLN A OE1   1 
ATOM   1540 N  NE2   . GLN A 1 209 ? -60.00900 -7.41300  1.76700   1.000 50.82000  ? 197 GLN A NE2   1 
ATOM   1541 N  N     . HIS A 1 210 ? -61.05700 -6.03600  -4.26100  1.000 39.58000  ? 198 HIS A N     1 
ATOM   1542 C  CA    . HIS A 1 210 ? -60.05300 -6.21400  -5.31000  1.000 32.35000  ? 198 HIS A CA    1 
ATOM   1543 C  C     . HIS A 1 210 ? -59.71400 -4.87000  -5.95500  1.000 34.79000  ? 198 HIS A C     1 
ATOM   1544 O  O     . HIS A 1 210 ? -58.54000 -4.52900  -6.12100  1.000 34.05000  ? 198 HIS A O     1 
ATOM   1545 C  CB    . HIS A 1 210 ? -60.55200 -7.22300  -6.35000  1.000 30.59000  ? 198 HIS A CB    1 
ATOM   1546 C  CG    . HIS A 1 210 ? -59.69100 -7.32300  -7.58100  1.000 27.94000  ? 198 HIS A CG    1 
ATOM   1547 N  ND1   . HIS A 1 210 ? -58.66800 -8.23400  -7.69000  1.000 25.39000  ? 198 HIS A ND1   1 
ATOM   1548 C  CD2   . HIS A 1 210 ? -59.73400 -6.63600  -8.74400  1.000 25.77000  ? 198 HIS A CD2   1 
ATOM   1549 C  CE1   . HIS A 1 210 ? -58.09900 -8.09900  -8.89100  1.000 28.24000  ? 198 HIS A CE1   1 
ATOM   1550 N  NE2   . HIS A 1 210 ? -58.72600 -7.14100  -9.54000  1.000 27.01000  ? 198 HIS A NE2   1 
ATOM   1551 N  N     . ARG A 1 211 ? -60.74400 -4.09700  -6.29300  1.000 41.49000  ? 199 ARG A N     1 
ATOM   1552 C  CA    . ARG A 1 211 ? -60.55200 -2.78800  -6.91500  1.000 35.62000  ? 199 ARG A CA    1 
ATOM   1553 C  C     . ARG A 1 211 ? -59.77600 -1.88100  -5.99700  1.000 34.53000  ? 199 ARG A C     1 
ATOM   1554 O  O     . ARG A 1 211 ? -58.98600 -1.05200  -6.44100  1.000 35.65000  ? 199 ARG A O     1 
ATOM   1555 C  CB    . ARG A 1 211 ? -61.89100 -2.16500  -7.28200  1.000 35.43000  ? 199 ARG A CB    1 
ATOM   1556 C  CG    . ARG A 1 211 ? -62.56100 -2.92400  -8.40400  1.000 46.42000  ? 199 ARG A CG    1 
ATOM   1557 C  CD    . ARG A 1 211 ? -63.64000 -2.11200  -9.10900  1.000 53.98000  ? 199 ARG A CD    1 
ATOM   1558 N  NE    . ARG A 1 211 ? -63.81800 -2.61600  -10.47000 1.000 56.45000  ? 199 ARG A NE    1 
ATOM   1559 C  CZ    . ARG A 1 211 ? -64.93100 -3.18100  -10.91900 1.000 62.28000  ? 199 ARG A CZ    1 
ATOM   1560 N  NH1   . ARG A 1 211 ? -65.98600 -3.29800  -10.11400 1.000 61.35000  ? 199 ARG A NH1   1 
ATOM   1561 N  NH2   . ARG A 1 211 ? -64.98800 -3.62100  -12.17400 1.000 59.06000  ? 199 ARG A NH2   1 
ATOM   1562 N  N     . THR A 1 212 ? -59.98100 -2.06200  -4.70300  1.000 39.66000  ? 200 THR A N     1 
ATOM   1563 C  CA    . THR A 1 212 ? -59.20900 -1.31500  -3.71800  1.000 39.61000  ? 200 THR A CA    1 
ATOM   1564 C  C     . THR A 1 212 ? -57.71500 -1.65500  -3.81500  1.000 38.19000  ? 200 THR A C     1 
ATOM   1565 O  O     . THR A 1 212 ? -56.86800 -0.75200  -3.83300  1.000 42.45000  ? 200 THR A O     1 
ATOM   1566 C  CB    . THR A 1 212 ? -59.74100 -1.58100  -2.30800  1.000 40.51000  ? 200 THR A CB    1 
ATOM   1567 O  OG1   . THR A 1 212 ? -60.78700 -0.63900  -2.03800  1.000 38.74000  ? 200 THR A OG1   1 
ATOM   1568 C  CG2   . THR A 1 212 ? -58.63900 -1.43700  -1.27000  1.000 35.73000  ? 200 THR A CG2   1 
ATOM   1569 N  N     . LYS A 1 213 ? -57.39400 -2.94400  -3.91500  1.000 33.66000  ? 201 LYS A N     1 
ATOM   1570 C  CA    . LYS A 1 213 ? -56.00300 -3.36200  -4.07200  1.000 35.63000  ? 201 LYS A CA    1 
ATOM   1571 C  C     . LYS A 1 213 ? -55.37700 -2.88200  -5.38200  1.000 34.55000  ? 201 LYS A C     1 
ATOM   1572 O  O     . LYS A 1 213 ? -54.20800 -2.49200  -5.39400  1.000 36.27000  ? 201 LYS A O     1 
ATOM   1573 C  CB    . LYS A 1 213 ? -55.88200 -4.87800  -3.98300  1.000 32.26000  ? 201 LYS A CB    1 
ATOM   1574 C  CG    . LYS A 1 213 ? -56.00500 -5.41200  -2.56000  1.000 41.92000  ? 201 LYS A CG    1 
ATOM   1575 C  CD    . LYS A 1 213 ? -54.83100 -4.98900  -1.68300  1.000 32.33000  ? 201 LYS A CD    1 
ATOM   1576 C  CE    . LYS A 1 213 ? -55.12900 -5.25700  -0.23000  1.000 28.89000  ? 201 LYS A CE    1 
ATOM   1577 N  NZ    . LYS A 1 213 ? -54.21700 -4.45100  0.64700   1.000 45.96000  ? 201 LYS A NZ    1 
ATOM   1578 N  N     . ILE A 1 214 ? -56.13900 -2.92400  -6.47500  1.000 32.98000  ? 202 ILE A N     1 
ATOM   1579 C  CA    . ILE A 1 214 ? -55.65900 -2.39500  -7.74200  1.000 32.47000  ? 202 ILE A CA    1 
ATOM   1580 C  C     . ILE A 1 214 ? -55.24200 -0.94500  -7.60700  1.000 29.77000  ? 202 ILE A C     1 
ATOM   1581 O  O     . ILE A 1 214 ? -54.17200 -0.55700  -8.09000  1.000 32.85000  ? 202 ILE A O     1 
ATOM   1582 C  CB    . ILE A 1 214 ? -56.70700 -2.48800  -8.85200  1.000 33.73000  ? 202 ILE A CB    1 
ATOM   1583 C  CG1   . ILE A 1 214 ? -57.00000 -3.94600  -9.14800  1.000 29.73000  ? 202 ILE A CG1   1 
ATOM   1584 C  CG2   . ILE A 1 214 ? -56.18600 -1.80200  -10.12300 1.000 28.52000  ? 202 ILE A CG2   1 
ATOM   1585 C  CD1   . ILE A 1 214 ? -55.75000 -4.73000  -9.41900  1.000 25.23000  ? 202 ILE A CD1   1 
ATOM   1586 N  N     . GLU A 1 215 ? -56.06400 -0.14500  -6.93900  1.000 30.65000  ? 203 GLU A N     1 
ATOM   1587 C  CA    . GLU A 1 215 ? -55.73000 1.26700   -6.75700  1.000 32.38000  ? 203 GLU A CA    1 
ATOM   1588 C  C     . GLU A 1 215 ? -54.46100 1.43700   -5.94100  1.000 32.80000  ? 203 GLU A C     1 
ATOM   1589 O  O     . GLU A 1 215 ? -53.64200 2.30700   -6.24300  1.000 33.89000  ? 203 GLU A O     1 
ATOM   1590 C  CB    . GLU A 1 215 ? -56.88000 2.02400   -6.10300  1.000 34.82000  ? 203 GLU A CB    1 
ATOM   1591 C  CG    . GLU A 1 215 ? -57.98400 2.37500   -7.08700  1.000 43.01000  ? 203 GLU A CG    1 
ATOM   1592 C  CD    . GLU A 1 215 ? -57.42200 3.00700   -8.35000  1.000 49.82000  ? 203 GLU A CD    1 
ATOM   1593 O  OE1   . GLU A 1 215 ? -56.65200 3.99500   -8.22000  1.000 48.23000  ? 203 GLU A OE1   1 
ATOM   1594 O  OE2   . GLU A 1 215 ? -57.72600 2.49700   -9.46200  1.000 51.07000  ? 203 GLU A OE2   1 
ATOM   1595 N  N     . GLU A 1 216 ? -54.29500 0.60200   -4.91800  1.000 31.33000  ? 204 GLU A N     1 
ATOM   1596 C  CA    . GLU A 1 216 ? -53.06500 0.58900   -4.13800  1.000 28.70000  ? 204 GLU A CA    1 
ATOM   1597 C  C     . GLU A 1 216 ? -51.88600 0.20700   -5.03400  1.000 33.57000  ? 204 GLU A C     1 
ATOM   1598 O  O     . GLU A 1 216 ? -50.82600 0.83800   -4.96600  1.000 38.15000  ? 204 GLU A O     1 
ATOM   1599 C  CB    . GLU A 1 216 ? -53.17900 -0.37800  -2.96100  1.000 36.91000  ? 204 GLU A CB    1 
ATOM   1600 C  CG    . GLU A 1 216 ? -51.91200 -0.51300  -2.13100  1.000 42.97000  ? 204 GLU A CG    1 
ATOM   1601 C  CD    . GLU A 1 216 ? -52.02800 -1.58000  -1.04200  1.000 52.77000  ? 204 GLU A CD    1 
ATOM   1602 O  OE1   . GLU A 1 216 ? -53.17200 -1.83100  -0.55700  1.000 53.26000  ? 204 GLU A OE1   1 
ATOM   1603 O  OE2   . GLU A 1 216 ? -50.97000 -2.16900  -0.67900  1.000 56.84000  ? 204 GLU A OE2   1 
ATOM   1604 N  N     . LEU A 1 217 ? -52.06300 -0.80200  -5.89200  1.000 28.70000  ? 205 LEU A N     1 
ATOM   1605 C  CA    . LEU A 1 217 ? -51.00600 -1.15700  -6.84200  1.000 29.03000  ? 205 LEU A CA    1 
ATOM   1606 C  C     . LEU A 1 217 ? -50.69300 -0.03100  -7.82500  1.000 31.72000  ? 205 LEU A C     1 
ATOM   1607 O  O     . LEU A 1 217 ? -49.54700 0.14400   -8.21500  1.000 34.80000  ? 205 LEU A O     1 
ATOM   1608 C  CB    . LEU A 1 217 ? -51.36900 -2.41100  -7.61500  1.000 31.49000  ? 205 LEU A CB    1 
ATOM   1609 C  CG    . LEU A 1 217 ? -50.39500 -2.85900  -8.70200  1.000 25.84000  ? 205 LEU A CG    1 
ATOM   1610 C  CD1   . LEU A 1 217 ? -49.00900 -3.08700  -8.16400  1.000 18.52000  ? 205 LEU A CD1   1 
ATOM   1611 C  CD2   . LEU A 1 217 ? -50.93100 -4.11900  -9.33200  1.000 21.88000  ? 205 LEU A CD2   1 
ATOM   1612 N  N     . ARG A 1 218 ? -51.69900 0.73700   -8.22300  1.000 32.26000  ? 206 ARG A N     1 
ATOM   1613 C  CA    . ARG A 1 218 ? -51.46100 1.83200   -9.15800  1.000 29.54000  ? 206 ARG A CA    1 
ATOM   1614 C  C     . ARG A 1 218 ? -50.80200 3.03400   -8.46400  1.000 32.54000  ? 206 ARG A C     1 
ATOM   1615 O  O     . ARG A 1 218 ? -49.94200 3.69400   -9.04800  1.000 34.41000  ? 206 ARG A O     1 
ATOM   1616 C  CB    . ARG A 1 218 ? -52.76300 2.24600   -9.83600  1.000 32.47000  ? 206 ARG A CB    1 
ATOM   1617 C  CG    . ARG A 1 218 ? -53.34900 1.18500   -10.75400 1.000 32.08000  ? 206 ARG A CG    1 
ATOM   1618 C  CD    . ARG A 1 218 ? -54.61500 1.69600   -11.44100 1.000 30.84000  ? 206 ARG A CD    1 
ATOM   1619 N  NE    . ARG A 1 218 ? -54.36200 2.96300   -12.11400 1.000 35.76000  ? 206 ARG A NE    1 
ATOM   1620 C  CZ    . ARG A 1 218 ? -54.91300 4.11400   -11.74800 1.000 42.35000  ? 206 ARG A CZ    1 
ATOM   1621 N  NH1   . ARG A 1 218 ? -55.76100 4.14300   -10.72800 1.000 44.26000  ? 206 ARG A NH1   1 
ATOM   1622 N  NH2   . ARG A 1 218 ? -54.63500 5.23200   -12.40500 1.000 46.99000  ? 206 ARG A NH2   1 
ATOM   1623 N  N     . GLN A 1 219 ? -51.19500 3.33100   -7.22900  1.000 35.62000  ? 207 GLN A N     1 
ATOM   1624 C  CA    . GLN A 1 219 ? -50.51900 4.38300   -6.47000  1.000 31.49000  ? 207 GLN A CA    1 
ATOM   1625 C  C     . GLN A 1 219 ? -49.07000 3.99700   -6.22800  1.000 35.88000  ? 207 GLN A C     1 
ATOM   1626 O  O     . GLN A 1 219 ? -48.20200 4.86600   -6.20400  1.000 37.45000  ? 207 GLN A O     1 
ATOM   1627 C  CB    . GLN A 1 219 ? -51.20000 4.64000   -5.12600  1.000 31.74000  ? 207 GLN A CB    1 
ATOM   1628 C  CG    . GLN A 1 219 ? -52.42000 5.53200   -5.19700  1.000 38.76000  ? 207 GLN A CG    1 
ATOM   1629 C  CD    . GLN A 1 219 ? -52.10100 6.90700   -5.72100  1.000 44.21000  ? 207 GLN A CD    1 
ATOM   1630 O  OE1   . GLN A 1 219 ? -51.30200 7.64100   -5.13100  1.000 53.69000  ? 207 GLN A OE1   1 
ATOM   1631 N  NE2   . GLN A 1 219 ? -52.71800 7.26900   -6.84200  1.000 43.02000  ? 207 GLN A NE2   1 
ATOM   1632 N  N     . HIS A 1 220 ? -48.81500 2.69800   -6.03600  1.000 34.89000  ? 208 HIS A N     1 
ATOM   1633 C  CA    . HIS A 1 220 ? -47.46100 2.20600   -5.74800  1.000 31.64000  ? 208 HIS A CA    1 
ATOM   1634 C  C     . HIS A 1 220 ? -46.59500 2.43600   -6.95900  1.000 29.00000  ? 208 HIS A C     1 
ATOM   1635 O  O     . HIS A 1 220 ? -45.46900 2.90100   -6.85200  1.000 32.47000  ? 208 HIS A O     1 
ATOM   1636 C  CB    . HIS A 1 220 ? -47.45700 0.71000   -5.37700  1.000 30.32000  ? 208 HIS A CB    1 
ATOM   1637 C  CG    . HIS A 1 220 ? -46.08500 0.15700   -5.11200  1.000 35.98000  ? 208 HIS A CG    1 
ATOM   1638 N  ND1   . HIS A 1 220 ? -45.53100 0.10000   -3.85100  1.000 37.62000  ? 208 HIS A ND1   1 
ATOM   1639 C  CD2   . HIS A 1 220 ? -45.15200 -0.35600  -5.95400  1.000 35.55000  ? 208 HIS A CD2   1 
ATOM   1640 C  CE1   . HIS A 1 220 ? -44.31700 -0.41400  -3.92600  1.000 33.98000  ? 208 HIS A CE1   1 
ATOM   1641 N  NE2   . HIS A 1 220 ? -44.06200 -0.70100  -5.19100  1.000 33.24000  ? 208 HIS A NE2   1 
ATOM   1642 N  N     . LEU A 1 221 ? -47.14700 2.08600   -8.11400  1.000 34.02000  ? 209 LEU A N     1 
ATOM   1643 C  CA    . LEU A 1 221 ? -46.48800 2.25900   -9.39400  1.000 31.72000  ? 209 LEU A CA    1 
ATOM   1644 C  C     . LEU A 1 221 ? -46.27500 3.73200   -9.70600  1.000 30.21000  ? 209 LEU A C     1 
ATOM   1645 O  O     . LEU A 1 221 ? -45.19600 4.11400   -10.15700 1.000 32.08000  ? 209 LEU A O     1 
ATOM   1646 C  CB    . LEU A 1 221 ? -47.31200 1.59600   -10.49700 1.000 30.73000  ? 209 LEU A CB    1 
ATOM   1647 C  CG    . LEU A 1 221 ? -47.30100 0.07700   -10.45700 1.000 28.23000  ? 209 LEU A CG    1 
ATOM   1648 C  CD1   . LEU A 1 221 ? -48.34700 -0.49800  -11.40600 1.000 28.42000  ? 209 LEU A CD1   1 
ATOM   1649 C  CD2   . LEU A 1 221 ? -45.89600 -0.42200  -10.80900 1.000 27.72000  ? 209 LEU A CD2   1 
ATOM   1650 N  N     . LEU A 1 222 ? -47.30000 4.55200   -9.47800  1.000 30.57000  ? 210 LEU A N     1 
ATOM   1651 C  CA    . LEU A 1 222 ? -47.21200 5.99500   -9.74700  1.000 30.69000  ? 210 LEU A CA    1 
ATOM   1652 C  C     . LEU A 1 222 ? -46.11600 6.67800   -8.94000  1.000 35.38000  ? 210 LEU A C     1 
ATOM   1653 O  O     . LEU A 1 222 ? -45.41000 7.56500   -9.44900  1.000 34.35000  ? 210 LEU A O     1 
ATOM   1654 C  CB    . LEU A 1 222 ? -48.54000 6.68300   -9.44800  1.000 29.82000  ? 210 LEU A CB    1 
ATOM   1655 C  CG    . LEU A 1 222 ? -48.64800 8.17800   -9.75500  1.000 27.34000  ? 210 LEU A CG    1 
ATOM   1656 C  CD1   . LEU A 1 222 ? -48.62100 8.43500   -11.26900 1.000 27.14000  ? 210 LEU A CD1   1 
ATOM   1657 C  CD2   . LEU A 1 222 ? -49.90600 8.77400   -9.10500  1.000 32.20000  ? 210 LEU A CD2   1 
ATOM   1658 N  N     . ARG A 1 223 ? -45.98400 6.27300   -7.67800  1.000 36.08000  ? 211 ARG A N     1 
ATOM   1659 C  CA    . ARG A 1 223 ? -44.92800 6.78800   -6.81200  1.000 28.92000  ? 211 ARG A CA    1 
ATOM   1660 C  C     . ARG A 1 223 ? -43.56900 6.57100   -7.43100  1.000 30.71000  ? 211 ARG A C     1 
ATOM   1661 O  O     . ARG A 1 223 ? -42.69700 7.42200   -7.32900  1.000 33.58000  ? 211 ARG A O     1 
ATOM   1662 C  CB    . ARG A 1 223 ? -44.96900 6.12000   -5.44500  1.000 31.41000  ? 211 ARG A CB    1 
ATOM   1663 C  CG    . ARG A 1 223 ? -43.66900 6.25500   -4.68200  1.000 37.04000  ? 211 ARG A CG    1 
ATOM   1664 C  CD    . ARG A 1 223 ? -43.57100 5.11100   -3.80600  1.000 49.30000  ? 211 ARG A CD    1 
ATOM   1665 N  NE    . ARG A 1 223 ? -42.29100 4.95200   -3.13100  1.000 58.26000  ? 211 ARG A NE    1 
ATOM   1666 C  CZ    . ARG A 1 223 ? -42.07500 3.94400   -2.26800  1.000 74.91000  ? 211 ARG A CZ    1 
ATOM   1667 N  NH1   . ARG A 1 223 ? -43.05600 3.05400   -2.00100  1.000 57.79000  ? 211 ARG A NH1   1 
ATOM   1668 N  NH2   . ARG A 1 223 ? -40.89300 3.80700   -1.66100  1.000 73.52000  ? 211 ARG A NH2   1 
ATOM   1669 N  N     . TRP A 1 224 ? -43.38700 5.42100   -8.07100  1.000 34.14000  ? 212 TRP A N     1 
ATOM   1670 C  CA    . TRP A 1 224 ? -42.13400 5.12600   -8.77600  1.000 35.35000  ? 212 TRP A CA    1 
ATOM   1671 C  C     . TRP A 1 224 ? -42.11000 5.62300   -10.19600 1.000 32.65000  ? 212 TRP A C     1 
ATOM   1672 O  O     . TRP A 1 224 ? -41.30100 5.14500   -10.96800 1.000 38.36000  ? 212 TRP A O     1 
ATOM   1673 C  CB    . TRP A 1 224 ? -41.84900 3.62100   -8.80000  1.000 33.36000  ? 212 TRP A CB    1 
ATOM   1674 C  CG    . TRP A 1 224 ? -41.46300 3.12500   -7.47500  1.000 33.52000  ? 212 TRP A CG    1 
ATOM   1675 C  CD1   . TRP A 1 224 ? -42.23300 2.41100   -6.61600  1.000 34.77000  ? 212 TRP A CD1   1 
ATOM   1676 C  CD2   . TRP A 1 224 ? -40.22100 3.36600   -6.80900  1.000 31.68000  ? 212 TRP A CD2   1 
ATOM   1677 N  NE1   . TRP A 1 224 ? -41.53200 2.15900   -5.45900  1.000 43.10000  ? 212 TRP A NE1   1 
ATOM   1678 C  CE2   . TRP A 1 224 ? -40.29500 2.73800   -5.55400  1.000 33.10000  ? 212 TRP A CE2   1 
ATOM   1679 C  CE3   . TRP A 1 224 ? -39.04900 4.03100   -7.16200  1.000 34.23000  ? 212 TRP A CE3   1 
ATOM   1680 C  CZ2   . TRP A 1 224 ? -39.24800 2.75500   -4.65200  1.000 27.16000  ? 212 TRP A CZ2   1 
ATOM   1681 C  CZ3   . TRP A 1 224 ? -38.01000 4.05200   -6.26500  1.000 34.51000  ? 212 TRP A CZ3   1 
ATOM   1682 C  CH2   . TRP A 1 224 ? -38.11600 3.41400   -5.02000  1.000 31.57000  ? 212 TRP A CH2   1 
ATOM   1683 N  N     . GLY A 1 225 ? -42.99800 6.55300   -10.53900 1.000 34.49000  ? 213 GLY A N     1 
ATOM   1684 C  CA    . GLY A 1 225 ? -43.04500 7.13500   -11.86900 1.000 35.56000  ? 213 GLY A CA    1 
ATOM   1685 C  C     . GLY A 1 225 ? -43.69900 6.31600   -12.97700 1.000 35.14000  ? 213 GLY A C     1 
ATOM   1686 O  O     . GLY A 1 225 ? -43.66600 6.72600   -14.14200 1.000 38.52000  ? 213 GLY A O     1 
ATOM   1687 N  N     . LEU A 1 226 ? -44.29900 5.17400   -12.64700 1.000 28.90000  ? 214 LEU A N     1 
ATOM   1688 C  CA    . LEU A 1 226 ? -44.94500 4.36100   -13.67600 1.000 24.74000  ? 214 LEU A CA    1 
ATOM   1689 C  C     . LEU A 1 226 ? -46.45100 4.60000   -13.68500 1.000 30.18000  ? 214 LEU A C     1 
ATOM   1690 O  O     . LEU A 1 226 ? -47.13600 4.32800   -12.69900 1.000 30.81000  ? 214 LEU A O     1 
ATOM   1691 C  CB    . LEU A 1 226 ? -44.62800 2.88500   -13.45900 1.000 34.39000  ? 214 LEU A CB    1 
ATOM   1692 C  CG    . LEU A 1 226 ? -43.12800 2.56600   -13.46000 1.000 32.52000  ? 214 LEU A CG    1 
ATOM   1693 C  CD1   . LEU A 1 226 ? -42.88100 1.11900   -13.14200 1.000 27.25000  ? 214 LEU A CD1   1 
ATOM   1694 C  CD2   . LEU A 1 226 ? -42.52900 2.92100   -14.79500 1.000 31.83000  ? 214 LEU A CD2   1 
ATOM   1695 N  N     . THR A 1 227 ? -46.96300 5.14400   -14.79100 1.000 32.90000  ? 215 THR A N     1 
ATOM   1696 C  CA    . THR A 1 227 ? -48.39200 5.45200   -14.91100 1.000 25.96000  ? 215 THR A CA    1 
ATOM   1697 C  C     . THR A 1 227 ? -49.19400 4.28000   -15.46100 1.000 35.67000  ? 215 THR A C     1 
ATOM   1698 O  O     . THR A 1 227 ? -48.68400 3.42900   -16.22000 1.000 36.07000  ? 215 THR A O     1 
ATOM   1699 C  CB    . THR A 1 227 ? -48.66000 6.64500   -15.82700 1.000 26.66000  ? 215 THR A CB    1 
ATOM   1700 O  OG1   . THR A 1 227 ? -48.21500 6.33300   -17.15300 1.000 28.93000  ? 215 THR A OG1   1 
ATOM   1701 C  CG2   . THR A 1 227 ? -47.94700 7.90200   -15.31400 1.000 30.16000  ? 215 THR A CG2   1 
ATOM   1702 N  N     . THR A 1 228 ? -50.46300 4.23800   -15.08200 1.000 28.32000  ? 216 THR A N     1 
ATOM   1703 C  CA    . THR A 1 228 ? -51.34000 3.23500   -15.62500 1.000 31.17000  ? 216 THR A CA    1 
ATOM   1704 C  C     . THR A 1 228 ? -52.61900 3.87100   -16.17800 1.000 33.49000  ? 216 THR A C     1 
ATOM   1705 O  O     . THR A 1 228 ? -53.61800 4.05700   -15.45100 1.000 37.61000  ? 216 THR A O     1 
ATOM   1706 C  CB    . THR A 1 228 ? -51.64700 2.15500   -14.57300 1.000 30.54000  ? 216 THR A CB    1 
ATOM   1707 O  OG1   . THR A 1 228 ? -51.83500 2.77200   -13.29600 1.000 34.36000  ? 216 THR A OG1   1 
ATOM   1708 C  CG2   . THR A 1 228 ? -50.46900 1.20900   -14.48600 1.000 28.08000  ? 216 THR A CG2   1 
ATOM   1709 N  N     . PRO A 1 229 ? -52.59100 4.19600   -17.48400 1.000 29.62000  ? 217 PRO A N     1 
ATOM   1710 C  CA    . PRO A 1 229 ? -53.67000 4.91400   -18.16300 1.000 33.77000  ? 217 PRO A CA    1 
ATOM   1711 C  C     . PRO A 1 229 ? -54.92000 4.06800   -18.18700 1.000 39.49000  ? 217 PRO A C     1 
ATOM   1712 O  O     . PRO A 1 229 ? -54.85000 2.88500   -18.52800 1.000 35.75000  ? 217 PRO A O     1 
ATOM   1713 C  CB    . PRO A 1 229 ? -53.12900 5.12300   -19.58300 1.000 29.60000  ? 217 PRO A CB    1 
ATOM   1714 C  CG    . PRO A 1 229 ? -51.67600 4.83500   -19.50500 1.000 31.44000  ? 217 PRO A CG    1 
ATOM   1715 C  CD    . PRO A 1 229 ? -51.53200 3.80900   -18.42500 1.000 29.12000  ? 217 PRO A CD    1 
ATOM   1716 N  N     . ASP A 1 230 ? -56.04300 4.66600   -17.81100 1.000 45.01000  ? 218 ASP A N     1 
ATOM   1717 C  CA    . ASP A 1 230 ? -57.33000 3.97800   -17.84100 1.000 40.49000  ? 218 ASP A CA    1 
ATOM   1718 C  C     . ASP A 1 230 ? -57.60900 3.33400   -19.20900 1.000 33.63000  ? 218 ASP A C     1 
ATOM   1719 O  O     . ASP A 1 230 ? -58.12200 2.22900   -19.27600 1.000 39.16000  ? 218 ASP A O     1 
ATOM   1720 C  CB    . ASP A 1 230 ? -58.44200 4.96100   -17.46000 1.000 36.65000  ? 218 ASP A CB    1 
ATOM   1721 C  CG    . ASP A 1 230 ? -59.75200 4.27000   -17.14200 1.000 44.72000  ? 218 ASP A CG    1 
ATOM   1722 O  OD1   . ASP A 1 230 ? -59.89100 3.74000   -16.01200 1.000 49.82000  ? 218 ASP A OD1   1 
ATOM   1723 O  OD2   . ASP A 1 230 ? -60.64500 4.26300   -18.01900 1.000 45.93000  ? 218 ASP A OD2   1 
ATOM   1724 N  N     . LYS A 1 231 ? -57.22600 4.02000   -20.28500 1.000 40.66000  ? 219 LYS A N     1 
ATOM   1725 C  CA    . LYS A 1 231 ? -57.35500 3.52200   -21.66100 1.000 37.16000  ? 219 LYS A CA    1 
ATOM   1726 C  C     . LYS A 1 231 ? -56.89200 2.06300   -21.82400 1.000 42.70000  ? 219 LYS A C     1 
ATOM   1727 O  O     . LYS A 1 231 ? -57.48400 1.29800   -22.58400 1.000 45.55000  ? 219 LYS A O     1 
ATOM   1728 C  CB    . LYS A 1 231 ? -56.56500 4.43300   -22.61200 1.000 37.14000  ? 219 LYS A CB    1 
ATOM   1729 C  CG    . LYS A 1 231 ? -56.60200 4.03600   -24.09600 1.000 53.24000  ? 219 LYS A CG    1 
ATOM   1730 C  CD    . LYS A 1 231 ? -57.52300 4.95700   -24.93300 1.000 75.56000  ? 219 LYS A CD    1 
ATOM   1731 C  CE    . LYS A 1 231 ? -57.20400 4.92000   -26.44700 1.000 70.09000  ? 219 LYS A CE    1 
ATOM   1732 N  NZ    . LYS A 1 231 ? -57.85100 3.78900   -27.17300 1.000 67.35000  ? 219 LYS A NZ    1 
ATOM   1733 N  N     . LYS A 1 232 ? -55.84600 1.66900   -21.10500 1.000 41.07000  ? 220 LYS A N     1 
ATOM   1734 C  CA    . LYS A 1 232 ? -55.31800 0.31200   -21.23600 1.000 43.23000  ? 220 LYS A CA    1 
ATOM   1735 C  C     . LYS A 1 232 ? -55.53300 -0.52900  -19.95800 1.000 37.25000  ? 220 LYS A C     1 
ATOM   1736 O  O     . LYS A 1 232 ? -54.93500 -1.60300  -19.76800 1.000 33.37000  ? 220 LYS A O     1 
ATOM   1737 C  CB    . LYS A 1 232 ? -53.83800 0.37700   -21.62800 1.000 41.28000  ? 220 LYS A CB    1 
ATOM   1738 C  CG    . LYS A 1 232 ? -53.63700 0.59900   -23.11200 1.000 44.38000  ? 220 LYS A CG    1 
ATOM   1739 C  CD    . LYS A 1 232 ? -52.34000 1.32500   -23.39100 1.000 57.93000  ? 220 LYS A CD    1 
ATOM   1740 C  CE    . LYS A 1 232 ? -51.71200 0.87200   -24.70700 1.000 54.12000  ? 220 LYS A CE    1 
ATOM   1741 N  NZ    . LYS A 1 232 ? -50.73400 -0.25500  -24.50600 1.000 57.59000  ? 220 LYS A NZ    1 
ATOM   1742 N  N     . HIS A 1 233 ? -56.42600 -0.03600  -19.10600 1.000 33.87000  ? 221 HIS A N     1 
ATOM   1743 C  CA    . HIS A 1 233 ? -56.84600 -0.72900  -17.89400 1.000 33.76000  ? 221 HIS A CA    1 
ATOM   1744 C  C     . HIS A 1 233 ? -58.14100 -1.52200  -18.15800 1.000 34.47000  ? 221 HIS A C     1 
ATOM   1745 O  O     . HIS A 1 233 ? -59.22100 -0.93800  -18.31000 1.000 34.31000  ? 221 HIS A O     1 
ATOM   1746 C  CB    . HIS A 1 233 ? -57.02400 0.30400   -16.78100 1.000 33.96000  ? 221 HIS A CB    1 
ATOM   1747 C  CG    . HIS A 1 233 ? -57.45300 -0.25500  -15.46100 1.000 31.19000  ? 221 HIS A CG    1 
ATOM   1748 N  ND1   . HIS A 1 233 ? -57.57000 0.52900   -14.34300 1.000 36.32000  ? 221 HIS A ND1   1 
ATOM   1749 C  CD2   . HIS A 1 233 ? -57.80100 -1.50700  -15.08400 1.000 37.90000  ? 221 HIS A CD2   1 
ATOM   1750 C  CE1   . HIS A 1 233 ? -57.96700 -0.21300  -13.32000 1.000 37.67000  ? 221 HIS A CE1   1 
ATOM   1751 N  NE2   . HIS A 1 233 ? -58.11800 -1.44800  -13.74400 1.000 34.10000  ? 221 HIS A NE2   1 
ATOM   1752 N  N     . GLN A 1 234 ? -58.02400 -2.84500  -18.23700 1.000 28.07000  ? 222 GLN A N     1 
ATOM   1753 C  CA    . GLN A 1 234 ? -59.18300 -3.69700  -18.49100 1.000 32.82000  ? 222 GLN A CA    1 
ATOM   1754 C  C     . GLN A 1 234 ? -59.82200 -4.16800  -17.19900 1.000 38.22000  ? 222 GLN A C     1 
ATOM   1755 O  O     . GLN A 1 234 ? -59.13300 -4.71600  -16.32800 1.000 33.08000  ? 222 GLN A O     1 
ATOM   1756 C  CB    . GLN A 1 234 ? -58.80600 -4.91900  -19.32100 1.000 25.66000  ? 222 GLN A CB    1 
ATOM   1757 C  CG    . GLN A 1 234 ? -57.83400 -4.64200  -20.42200 1.000 28.48000  ? 222 GLN A CG    1 
ATOM   1758 C  CD    . GLN A 1 234 ? -57.53900 -5.89600  -21.19800 1.000 33.70000  ? 222 GLN A CD    1 
ATOM   1759 O  OE1   . GLN A 1 234 ? -58.45900 -6.66500  -21.49100 1.000 32.18000  ? 222 GLN A OE1   1 
ATOM   1760 N  NE2   . GLN A 1 234 ? -56.25400 -6.13800  -21.51100 1.000 26.76000  ? 222 GLN A NE2   1 
ATOM   1761 N  N     . LYS A 1 235 ? -61.14000 -3.99000  -17.09500 1.000 41.87000  ? 223 LYS A N     1 
ATOM   1762 C  CA    . LYS A 1 235 ? -61.84400 -4.30700  -15.86200 1.000 41.31000  ? 223 LYS A CA    1 
ATOM   1763 C  C     . LYS A 1 235 ? -62.83700 -5.47200  -15.96100 1.000 40.23000  ? 223 LYS A C     1 
ATOM   1764 O  O     . LYS A 1 235 ? -63.28100 -5.98000  -14.93100 1.000 42.16000  ? 223 LYS A O     1 
ATOM   1765 C  CB    . LYS A 1 235 ? -62.56800 -3.06400  -15.36000 1.000 42.78000  ? 223 LYS A CB    1 
ATOM   1766 C  CG    . LYS A 1 235 ? -61.63900 -1.90200  -15.04100 1.000 43.05000  ? 223 LYS A CG    1 
ATOM   1767 C  CD    . LYS A 1 235 ? -62.17700 -0.60100  -15.64500 1.000 44.23000  ? 223 LYS A CD    1 
ATOM   1768 C  CE    . LYS A 1 235 ? -61.30500 0.58600   -15.29200 1.000 44.90000  ? 223 LYS A CE    1 
ATOM   1769 N  NZ    . LYS A 1 235 ? -61.48900 1.67100   -16.30400 1.000 53.74000  ? 223 LYS A NZ    1 
ATOM   1770 N  N     . GLU A 1 236 ? -63.18100 -5.90200  -17.17500 1.000 40.53000  ? 224 GLU A N     1 
ATOM   1771 C  CA    . GLU A 1 236 ? -64.21900 -6.93500  -17.34900 1.000 45.72000  ? 224 GLU A CA    1 
ATOM   1772 C  C     . GLU A 1 236 ? -63.81100 -8.01700  -18.34400 1.000 43.67000  ? 224 GLU A C     1 
ATOM   1773 O  O     . GLU A 1 236 ? -63.11700 -7.72900  -19.31700 1.000 39.77000  ? 224 GLU A O     1 
ATOM   1774 C  CB    . GLU A 1 236 ? -65.54600 -6.31300  -17.82500 1.000 46.88000  ? 224 GLU A CB    1 
ATOM   1775 C  CG    . GLU A 1 236 ? -66.21600 -5.32700  -16.84900 1.000 56.57000  ? 224 GLU A CG    1 
ATOM   1776 C  CD    . GLU A 1 236 ? -66.53200 -5.94100  -15.47700 1.000 71.03000  ? 224 GLU A CD    1 
ATOM   1777 O  OE1   . GLU A 1 236 ? -66.99100 -7.11000  -15.41500 1.000 79.96000  ? 224 GLU A OE1   1 
ATOM   1778 O  OE2   . GLU A 1 236 ? -66.31600 -5.24600  -14.45500 1.000 75.16000  ? 224 GLU A OE2   1 
ATOM   1779 N  N     . PRO A 1 237 ? -64.27800 -9.26400  -18.13300 1.000 47.19000  ? 225 PRO A N     1 
ATOM   1780 C  CA    . PRO A 1 237 ? -63.94000 -10.30800 -19.11000 1.000 42.78000  ? 225 PRO A CA    1 
ATOM   1781 C  C     . PRO A 1 237 ? -64.62800 -10.00100 -20.42700 1.000 43.25000  ? 225 PRO A C     1 
ATOM   1782 O  O     . PRO A 1 237 ? -65.64900 -9.31400  -20.39300 1.000 40.85000  ? 225 PRO A O     1 
ATOM   1783 C  CB    . PRO A 1 237 ? -64.49300 -11.59100 -18.47500 1.000 38.36000  ? 225 PRO A CB    1 
ATOM   1784 C  CG    . PRO A 1 237 ? -64.86800 -11.19600 -17.03900 1.000 40.20000  ? 225 PRO A CG    1 
ATOM   1785 C  CD    . PRO A 1 237 ? -65.21700 -9.75600  -17.11000 1.000 37.47000  ? 225 PRO A CD    1 
ATOM   1786 N  N     . PRO A 1 238 ? -64.07900 -10.47500 -21.56000 1.000 42.98000  ? 226 PRO A N     1 
ATOM   1787 C  CA    . PRO A 1 238 ? -62.82900 -11.23500 -21.64200 1.000 42.62000  ? 226 PRO A CA    1 
ATOM   1788 C  C     . PRO A 1 238 ? -61.62800 -10.31900 -21.64500 1.000 37.94000  ? 226 PRO A C     1 
ATOM   1789 O  O     . PRO A 1 238 ? -61.66900 -9.26200  -22.27600 1.000 42.06000  ? 226 PRO A O     1 
ATOM   1790 C  CB    . PRO A 1 238 ? -62.94700 -11.95600 -22.98200 1.000 40.30000  ? 226 PRO A CB    1 
ATOM   1791 C  CG    . PRO A 1 238 ? -63.70600 -10.99400 -23.82200 1.000 44.73000  ? 226 PRO A CG    1 
ATOM   1792 C  CD    . PRO A 1 238 ? -64.68800 -10.30400 -22.89100 1.000 31.43000  ? 226 PRO A CD    1 
ATOM   1793 N  N     . PHE A 1 239 ? -60.56900 -10.71900 -20.95500 1.000 37.08000  ? 227 PHE A N     1 
ATOM   1794 C  CA    . PHE A 1 239 ? -59.35500 -9.92400  -20.93000 1.000 31.31000  ? 227 PHE A CA    1 
ATOM   1795 C  C     . PHE A 1 239 ? -58.41000 -10.22600 -22.08700 1.000 32.01000  ? 227 PHE A C     1 
ATOM   1796 O  O     . PHE A 1 239 ? -58.22000 -11.39100 -22.44500 1.000 38.27000  ? 227 PHE A O     1 
ATOM   1797 C  CB    . PHE A 1 239 ? -58.65600 -10.15400 -19.62100 1.000 26.06000  ? 227 PHE A CB    1 
ATOM   1798 C  CG    . PHE A 1 239 ? -59.47900 -9.78300  -18.46400 1.000 28.74000  ? 227 PHE A CG    1 
ATOM   1799 C  CD1   . PHE A 1 239 ? -60.32600 -10.69600 -17.88800 1.000 30.45000  ? 227 PHE A CD1   1 
ATOM   1800 C  CD2   . PHE A 1 239 ? -59.42000 -8.50300  -17.95200 1.000 31.57000  ? 227 PHE A CD2   1 
ATOM   1801 C  CE1   . PHE A 1 239 ? -61.09800 -10.35300 -16.80200 1.000 33.97000  ? 227 PHE A CE1   1 
ATOM   1802 C  CE2   . PHE A 1 239 ? -60.18800 -8.15000  -16.85900 1.000 33.22000  ? 227 PHE A CE2   1 
ATOM   1803 C  CZ    . PHE A 1 239 ? -61.03200 -9.07500  -16.28800 1.000 31.89000  ? 227 PHE A CZ    1 
ATOM   1804 N  N     . LEU A 1 240 ? -57.82400 -9.18500  -22.67800 1.000 28.23000  ? 228 LEU A N     1 
ATOM   1805 C  CA    . LEU A 1 240 ? -56.80500 -9.39600  -23.70000 1.000 34.52000  ? 228 LEU A CA    1 
ATOM   1806 C  C     . LEU A 1 240 ? -55.42400 -9.45000  -23.06000 1.000 34.38000  ? 228 LEU A C     1 
ATOM   1807 O  O     . LEU A 1 240 ? -54.92600 -8.46800  -22.50800 1.000 38.05000  ? 228 LEU A O     1 
ATOM   1808 C  CB    . LEU A 1 240 ? -56.86100 -8.31400  -24.77500 1.000 34.90000  ? 228 LEU A CB    1 
ATOM   1809 C  CG    . LEU A 1 240 ? -57.81600 -8.60900  -25.93800 1.000 46.58000  ? 228 LEU A CG    1 
ATOM   1810 C  CD1   . LEU A 1 240 ? -59.22600 -9.02400  -25.44900 1.000 45.27000  ? 228 LEU A CD1   1 
ATOM   1811 C  CD2   . LEU A 1 240 ? -57.90200 -7.42000  -26.88800 1.000 42.51000  ? 228 LEU A CD2   1 
ATOM   1812 N  N     . TRP A 1 241 ? -54.80600 -10.61400 -23.15100 1.000 31.54000  ? 229 TRP A N     1 
ATOM   1813 C  CA    . TRP A 1 241 ? -53.58400 -10.87300 -22.42800 1.000 30.16000  ? 229 TRP A CA    1 
ATOM   1814 C  C     . TRP A 1 241 ? -52.70700 -11.85400 -23.19000 1.000 28.60000  ? 229 TRP A C     1 
ATOM   1815 O  O     . TRP A 1 241 ? -53.12500 -12.97400 -23.48700 1.000 29.10000  ? 229 TRP A O     1 
ATOM   1816 C  CB    . TRP A 1 241 ? -53.91200 -11.40700 -21.04000 1.000 29.43000  ? 229 TRP A CB    1 
ATOM   1817 C  CG    . TRP A 1 241 ? -52.71500 -11.67100 -20.20900 1.000 35.84000  ? 229 TRP A CG    1 
ATOM   1818 C  CD1   . TRP A 1 241 ? -51.93000 -10.74600 -19.56500 1.000 31.92000  ? 229 TRP A CD1   1 
ATOM   1819 C  CD2   . TRP A 1 241 ? -52.15700 -12.95300 -19.90300 1.000 31.60000  ? 229 TRP A CD2   1 
ATOM   1820 N  NE1   . TRP A 1 241 ? -50.91800 -11.38300 -18.88200 1.000 31.63000  ? 229 TRP A NE1   1 
ATOM   1821 C  CE2   . TRP A 1 241 ? -51.03500 -12.73600 -19.07900 1.000 32.93000  ? 229 TRP A CE2   1 
ATOM   1822 C  CE3   . TRP A 1 241 ? -52.48700 -14.26100 -20.26100 1.000 32.95000  ? 229 TRP A CE3   1 
ATOM   1823 C  CZ2   . TRP A 1 241 ? -50.24600 -13.79100 -18.60100 1.000 31.09000  ? 229 TRP A CZ2   1 
ATOM   1824 C  CZ3   . TRP A 1 241 ? -51.70400 -15.30000 -19.78600 1.000 28.37000  ? 229 TRP A CZ3   1 
ATOM   1825 C  CH2   . TRP A 1 241 ? -50.60100 -15.05800 -18.95900 1.000 25.53000  ? 229 TRP A CH2   1 
ATOM   1826 N  N     . MET A 1 242 ? -51.50100 -11.40200 -23.52800 1.000 31.71000  ? 230 MET A N     1 
ATOM   1827 C  CA    . MET A 1 242 ? -50.45400 -12.23300 -24.13500 1.000 31.39000  ? 230 MET A CA    1 
ATOM   1828 C  C     . MET A 1 242 ? -50.83700 -12.93100 -25.44400 1.000 31.62000  ? 230 MET A C     1 
ATOM   1829 O  O     . MET A 1 242 ? -50.27800 -13.98200 -25.77400 1.000 30.92000  ? 230 MET A O     1 
ATOM   1830 C  CB    . MET A 1 242 ? -49.98900 -13.28400 -23.12800 1.000 28.83000  ? 230 MET A CB    1 
ATOM   1831 C  CG    . MET A 1 242 ? -49.28600 -12.69800 -21.93500 1.000 25.69000  ? 230 MET A CG    1 
ATOM   1832 S  SD    . MET A 1 242 ? -47.81500 -11.80100 -22.43500 1.000 31.88000  ? 230 MET A SD    1 
ATOM   1833 C  CE    . MET A 1 242 ? -46.70600 -13.14000 -22.86400 1.000 25.21000  ? 230 MET A CE    1 
ATOM   1834 N  N     . GLY A 1 243 ? -51.75300 -12.33300 -26.20000 1.000 30.94000  ? 231 GLY A N     1 
ATOM   1835 C  CA    . GLY A 1 243 ? -52.22800 -12.92700 -27.44000 1.000 34.46000  ? 231 GLY A CA    1 
ATOM   1836 C  C     . GLY A 1 243 ? -53.43600 -13.83500 -27.24500 1.000 36.24000  ? 231 GLY A C     1 
ATOM   1837 O  O     . GLY A 1 243 ? -53.83200 -14.56800 -28.15800 1.000 32.42000  ? 231 GLY A O     1 
ATOM   1838 N  N     . TYR A 1 244 ? -54.02400 -13.78500 -26.05200 1.000 33.28000  ? 232 TYR A N     1 
ATOM   1839 C  CA    . TYR A 1 244 ? -55.16500 -14.62600 -25.71700 1.000 30.27000  ? 232 TYR A CA    1 
ATOM   1840 C  C     . TYR A 1 244 ? -56.37800 -13.77600 -25.33600 1.000 35.25000  ? 232 TYR A C     1 
ATOM   1841 O  O     . TYR A 1 244 ? -56.28400 -12.56800 -25.13800 1.000 37.71000  ? 232 TYR A O     1 
ATOM   1842 C  CB    . TYR A 1 244 ? -54.81500 -15.58700 -24.56200 1.000 31.00000  ? 232 TYR A CB    1 
ATOM   1843 C  CG    . TYR A 1 244 ? -53.53400 -16.38300 -24.76000 1.000 31.67000  ? 232 TYR A CG    1 
ATOM   1844 C  CD1   . TYR A 1 244 ? -53.52100 -17.54200 -25.52800 1.000 27.29000  ? 232 TYR A CD1   1 
ATOM   1845 C  CD2   . TYR A 1 244 ? -52.33800 -15.97900 -24.17200 1.000 32.38000  ? 232 TYR A CD2   1 
ATOM   1846 C  CE1   . TYR A 1 244 ? -52.35400 -18.26600 -25.72000 1.000 31.03000  ? 232 TYR A CE1   1 
ATOM   1847 C  CE2   . TYR A 1 244 ? -51.15100 -16.70000 -24.36600 1.000 26.59000  ? 232 TYR A CE2   1 
ATOM   1848 C  CZ    . TYR A 1 244 ? -51.17100 -17.84400 -25.13200 1.000 34.20000  ? 232 TYR A CZ    1 
ATOM   1849 O  OH    . TYR A 1 244 ? -50.00700 -18.57300 -25.31600 1.000 29.82000  ? 232 TYR A OH    1 
ATOM   1850 N  N     . GLU A 1 245 ? -57.52800 -14.42300 -25.26000 1.000 40.85000  ? 233 GLU A N     1 
ATOM   1851 C  CA    . GLU A 1 245 ? -58.70400 -13.84100 -24.65800 1.000 38.30000  ? 233 GLU A CA    1 
ATOM   1852 C  C     . GLU A 1 245 ? -58.99200 -14.65100 -23.40700 1.000 35.58000  ? 233 GLU A C     1 
ATOM   1853 O  O     . GLU A 1 245 ? -59.18200 -15.86200 -23.49600 1.000 37.92000  ? 233 GLU A O     1 
ATOM   1854 C  CB    . GLU A 1 245 ? -59.88700 -13.88600 -25.61600 1.000 43.08000  ? 233 GLU A CB    1 
ATOM   1855 C  CG    . GLU A 1 245 ? -59.95500 -12.74200 -26.61100 1.000 57.55000  ? 233 GLU A CG    1 
ATOM   1856 C  CD    . GLU A 1 245 ? -61.14900 -12.87600 -27.56600 1.000 72.52000  ? 233 GLU A CD    1 
ATOM   1857 O  OE1   . GLU A 1 245 ? -61.14700 -13.82300 -28.38800 1.000 82.10000  ? 233 GLU A OE1   1 
ATOM   1858 O  OE2   . GLU A 1 245 ? -62.09500 -12.05400 -27.48500 1.000 64.88000  ? 233 GLU A OE2   1 
ATOM   1859 N  N     . LEU A 1 246 ? -58.99200 -14.01100 -22.24100 1.000 34.75000  ? 234 LEU A N     1 
ATOM   1860 C  CA    . LEU A 1 246 ? -59.26100 -14.74600 -21.00200 1.000 38.21000  ? 234 LEU A CA    1 
ATOM   1861 C  C     . LEU A 1 246 ? -60.71200 -14.56700 -20.55000 1.000 40.49000  ? 234 LEU A C     1 
ATOM   1862 O  O     . LEU A 1 246 ? -61.10000 -13.47700 -20.13300 1.000 41.89000  ? 234 LEU A O     1 
ATOM   1863 C  CB    . LEU A 1 246 ? -58.31300 -14.30000 -19.88400 1.000 32.84000  ? 234 LEU A CB    1 
ATOM   1864 C  CG    . LEU A 1 246 ? -56.81800 -14.27500 -20.19200 1.000 28.61000  ? 234 LEU A CG    1 
ATOM   1865 C  CD1   . LEU A 1 246 ? -56.04600 -13.80400 -18.97200 1.000 23.96000  ? 234 LEU A CD1   1 
ATOM   1866 C  CD2   . LEU A 1 246 ? -56.34500 -15.65500 -20.63900 1.000 29.68000  ? 234 LEU A CD2   1 
ATOM   1867 N  N     . HIS A 1 247 ? -61.51200 -15.62600 -20.65500 1.000 35.92000  ? 235 HIS A N     1 
ATOM   1868 C  CA    . HIS A 1 247 ? -62.86000 -15.61600 -20.10900 1.000 36.27000  ? 235 HIS A CA    1 
ATOM   1869 C  C     . HIS A 1 247 ? -62.81400 -16.23000 -18.70000 1.000 43.31000  ? 235 HIS A C     1 
ATOM   1870 O  O     . HIS A 1 247 ? -61.77400 -16.74200 -18.28100 1.000 45.31000  ? 235 HIS A O     1 
ATOM   1871 C  CB    . HIS A 1 247 ? -63.81500 -16.38000 -21.02000 1.000 34.40000  ? 235 HIS A CB    1 
ATOM   1872 C  CG    . HIS A 1 247 ? -63.81800 -15.90000 -22.42900 1.000 35.39000  ? 235 HIS A CG    1 
ATOM   1873 N  ND1   . HIS A 1 247 ? -62.87500 -16.30700 -23.35800 1.000 38.62000  ? 235 HIS A ND1   1 
ATOM   1874 C  CD2   . HIS A 1 247 ? -64.64800 -15.05300 -23.08600 1.000 35.26000  ? 235 HIS A CD2   1 
ATOM   1875 C  CE1   . HIS A 1 247 ? -63.12500 -15.72900 -24.51800 1.000 46.16000  ? 235 HIS A CE1   1 
ATOM   1876 N  NE2   . HIS A 1 247 ? -64.19600 -14.95900 -24.38000 1.000 47.08000  ? 235 HIS A NE2   1 
ATOM   1877 N  N     . PRO A 1 248 ? -63.92600 -16.17300 -17.95300 1.000 45.38000  ? 236 PRO A N     1 
ATOM   1878 C  CA    . PRO A 1 248 ? -63.78400 -16.60900 -16.56200 1.000 41.07000  ? 236 PRO A CA    1 
ATOM   1879 C  C     . PRO A 1 248 ? -63.42200 -18.08700 -16.37600 1.000 45.44000  ? 236 PRO A C     1 
ATOM   1880 O  O     . PRO A 1 248 ? -62.71800 -18.40600 -15.40500 1.000 46.87000  ? 236 PRO A O     1 
ATOM   1881 C  CB    . PRO A 1 248 ? -65.16900 -16.31600 -15.97300 1.000 39.83000  ? 236 PRO A CB    1 
ATOM   1882 C  CG    . PRO A 1 248 ? -65.68600 -15.19200 -16.78600 1.000 39.62000  ? 236 PRO A CG    1 
ATOM   1883 C  CD    . PRO A 1 248 ? -65.19800 -15.45600 -18.17500 1.000 42.08000  ? 236 PRO A CD    1 
ATOM   1884 N  N     . ASP A 1 249 ? -63.87900 -18.96600 -17.26800 1.000 42.50000  ? 237 ASP A N     1 
ATOM   1885 C  CA    . ASP A 1 249 ? -63.65700 -20.40500 -17.08800 1.000 38.16000  ? 237 ASP A CA    1 
ATOM   1886 C  C     . ASP A 1 249 ? -62.96200 -21.03200 -18.28600 1.000 38.44000  ? 237 ASP A C     1 
ATOM   1887 O  O     . ASP A 1 249 ? -62.81400 -22.25400 -18.36900 1.000 40.29000  ? 237 ASP A O     1 
ATOM   1888 C  CB    . ASP A 1 249 ? -64.98500 -21.13200 -16.82600 1.000 46.61000  ? 237 ASP A CB    1 
ATOM   1889 C  CG    . ASP A 1 249 ? -65.67100 -20.66000 -15.54500 1.000 69.02000  ? 237 ASP A CG    1 
ATOM   1890 O  OD1   . ASP A 1 249 ? -65.08900 -20.87100 -14.44700 1.000 70.50000  ? 237 ASP A OD1   1 
ATOM   1891 O  OD2   . ASP A 1 249 ? -66.78300 -20.07800 -15.63800 1.000 72.18000  ? 237 ASP A OD2   1 
ATOM   1892 N  N     . LYS A 1 250 ? -62.54300 -20.19700 -19.22400 1.000 38.47000  ? 238 LYS A N     1 
ATOM   1893 C  CA    . LYS A 1 250 ? -61.86300 -20.69600 -20.40100 1.000 35.94000  ? 238 LYS A CA    1 
ATOM   1894 C  C     . LYS A 1 250 ? -61.05000 -19.60000 -21.08800 1.000 37.45000  ? 238 LYS A C     1 
ATOM   1895 O  O     . LYS A 1 250 ? -61.34200 -18.40100 -20.96900 1.000 36.94000  ? 238 LYS A O     1 
ATOM   1896 C  CB    . LYS A 1 250 ? -62.87200 -21.32000 -21.37500 1.000 36.31000  ? 238 LYS A CB    1 
ATOM   1897 C  CG    . LYS A 1 250 ? -63.81500 -20.34200 -22.05700 1.000 35.61000  ? 238 LYS A CG    1 
ATOM   1898 C  CD    . LYS A 1 250 ? -64.96500 -21.08100 -22.75600 1.000 48.42000  ? 238 LYS A CD    1 
ATOM   1899 C  CE    . LYS A 1 250 ? -66.05100 -20.12300 -23.26500 1.000 60.84000  ? 238 LYS A CE    1 
ATOM   1900 N  NZ    . LYS A 1 250 ? -65.55800 -19.21400 -24.35600 1.000 57.61000  ? 238 LYS A NZ    1 
ATOM   1901 N  N     . TRP A 1 251 ? -60.00500 -20.02200 -21.78800 1.000 36.47000  ? 239 TRP A N     1 
ATOM   1902 C  CA    . TRP A 1 251 ? -59.21500 -19.09900 -22.58000 1.000 36.89000  ? 239 TRP A CA    1 
ATOM   1903 C  C     . TRP A 1 251 ? -59.22900 -19.55100 -24.02100 1.000 35.01000  ? 239 TRP A C     1 
ATOM   1904 O  O     . TRP A 1 251 ? -59.44800 -20.72900 -24.34000 1.000 36.24000  ? 239 TRP A O     1 
ATOM   1905 C  CB    . TRP A 1 251 ? -57.76400 -18.98600 -22.05400 1.000 37.54000  ? 239 TRP A CB    1 
ATOM   1906 C  CG    . TRP A 1 251 ? -56.99300 -20.29000 -21.99900 1.000 30.37000  ? 239 TRP A CG    1 
ATOM   1907 C  CD1   . TRP A 1 251 ? -56.96900 -21.19100 -20.96700 1.000 30.52000  ? 239 TRP A CD1   1 
ATOM   1908 C  CD2   . TRP A 1 251 ? -56.12900 -20.82200 -23.01300 1.000 28.32000  ? 239 TRP A CD2   1 
ATOM   1909 N  NE1   . TRP A 1 251 ? -56.15700 -22.25700 -21.28500 1.000 26.47000  ? 239 TRP A NE1   1 
ATOM   1910 C  CE2   . TRP A 1 251 ? -55.63200 -22.05200 -22.53500 1.000 26.98000  ? 239 TRP A CE2   1 
ATOM   1911 C  CE3   . TRP A 1 251 ? -55.74200 -20.38300 -24.28100 1.000 28.66000  ? 239 TRP A CE3   1 
ATOM   1912 C  CZ2   . TRP A 1 251 ? -54.76400 -22.84500 -23.28500 1.000 28.58000  ? 239 TRP A CZ2   1 
ATOM   1913 C  CZ3   . TRP A 1 251 ? -54.88000 -21.17200 -25.02100 1.000 31.26000  ? 239 TRP A CZ3   1 
ATOM   1914 C  CH2   . TRP A 1 251 ? -54.40000 -22.39100 -24.52100 1.000 31.28000  ? 239 TRP A CH2   1 
ATOM   1915 N  N     . THR A 1 252 ? -58.96600 -18.59100 -24.88700 1.000 40.58000  ? 240 THR A N     1 
ATOM   1916 C  CA    . THR A 1 252 ? -59.00900 -18.79100 -26.32000 1.000 41.85000  ? 240 THR A CA    1 
ATOM   1917 C  C     . THR A 1 252 ? -57.82800 -18.03700 -26.94100 1.000 44.07000  ? 240 THR A C     1 
ATOM   1918 O  O     . THR A 1 252 ? -57.41400 -16.98400 -26.43300 1.000 39.89000  ? 240 THR A O     1 
ATOM   1919 C  CB    . THR A 1 252 ? -60.36500 -18.30900 -26.87300 1.000 48.06000  ? 240 THR A CB    1 
ATOM   1920 O  OG1   . THR A 1 252 ? -61.27700 -19.41300 -26.91800 1.000 48.49000  ? 240 THR A OG1   1 
ATOM   1921 C  CG2   . THR A 1 252 ? -60.23400 -17.71300 -28.24500 1.000 48.84000  ? 240 THR A CG2   1 
ATOM   1922 N  N     . VAL A 1 253 ? -57.23600 -18.59400 -27.99100 1.000 45.22000  ? 241 VAL A N     1 
ATOM   1923 C  CA    . VAL A 1 253 ? -56.14000 -17.89200 -28.63400 1.000 39.57000  ? 241 VAL A CA    1 
ATOM   1924 C  C     . VAL A 1 253 ? -56.79700 -16.92500 -29.58800 1.000 42.15000  ? 241 VAL A C     1 
ATOM   1925 O  O     . VAL A 1 253 ? -57.86100 -17.20500 -30.14500 1.000 44.09000  ? 241 VAL A O     1 
ATOM   1926 C  CB    . VAL A 1 253 ? -55.15400 -18.84000 -29.35100 1.000 33.64000  ? 241 VAL A CB    1 
ATOM   1927 C  CG1   . VAL A 1 253 ? -55.74100 -19.38800 -30.65800 1.000 37.61000  ? 241 VAL A CG1   1 
ATOM   1928 C  CG2   . VAL A 1 253 ? -53.85300 -18.13200 -29.60600 1.000 39.10000  ? 241 VAL A CG2   1 
ATOM   1929 N  N     . GLN A 1 254 ? -56.20800 -15.75300 -29.73200 1.000 46.82000  ? 242 GLN A N     1 
ATOM   1930 C  CA    . GLN A 1 254 ? -56.73400 -14.80800 -30.69500 1.000 48.02000  ? 242 GLN A CA    1 
ATOM   1931 C  C     . GLN A 1 254 ? -56.54500 -15.43500 -32.08900 1.000 48.65000  ? 242 GLN A C     1 
ATOM   1932 O  O     . GLN A 1 254 ? -55.55000 -16.13000 -32.33500 1.000 58.66000  ? 242 GLN A O     1 
ATOM   1933 C  CB    . GLN A 1 254 ? -56.05200 -13.44400 -30.53300 1.000 51.62000  ? 242 GLN A CB    1 
ATOM   1934 C  CG    . GLN A 1 254 ? -56.37200 -12.75200 -29.19500 1.000 48.57000  ? 242 GLN A CG    1 
ATOM   1935 C  CD    . GLN A 1 254 ? -55.77000 -11.33800 -29.08800 1.000 60.00000  ? 242 GLN A CD    1 
ATOM   1936 O  OE1   . GLN A 1 254 ? -55.31800 -10.76200 -30.09300 1.000 61.67000  ? 242 GLN A OE1   1 
ATOM   1937 N  NE2   . GLN A 1 254 ? -55.75400 -10.78200 -27.86500 1.000 41.88000  ? 242 GLN A NE2   1 
ATOM   1938 N  N     . PRO A 1 255 ? -57.50800 -15.20600 -32.99400 1.000 54.04000  ? 243 PRO A N     1 
ATOM   1939 C  CA    . PRO A 1 255 ? -57.67800 -15.96400 -34.23900 1.000 56.77000  ? 243 PRO A CA    1 
ATOM   1940 C  C     . PRO A 1 255 ? -56.41300 -16.05600 -35.07300 1.000 62.18000  ? 243 PRO A C     1 
ATOM   1941 O  O     . PRO A 1 255 ? -55.68100 -15.07000 -35.19200 1.000 61.20000  ? 243 PRO A O     1 
ATOM   1942 C  CB    . PRO A 1 255 ? -58.74900 -15.16300 -34.98500 1.000 57.86000  ? 243 PRO A CB    1 
ATOM   1943 C  CG    . PRO A 1 255 ? -58.61100 -13.77800 -34.44100 1.000 57.16000  ? 243 PRO A CG    1 
ATOM   1944 C  CD    . PRO A 1 255 ? -58.33400 -13.98300 -32.99400 1.000 60.65000  ? 243 PRO A CD    1 
ATOM   1945 N  N     . ILE A 1 256 ? -56.17200 -17.23200 -35.64500 1.000 63.53000  ? 244 ILE A N     1 
ATOM   1946 C  CA    . ILE A 1 256 ? -54.97500 -17.47400 -36.44400 1.000 57.25000  ? 244 ILE A CA    1 
ATOM   1947 C  C     . ILE A 1 256 ? -55.33200 -17.60700 -37.90600 1.000 59.73000  ? 244 ILE A C     1 
ATOM   1948 O  O     . ILE A 1 256 ? -56.08500 -18.50200 -38.28300 1.000 67.55000  ? 244 ILE A O     1 
ATOM   1949 C  CB    . ILE A 1 256 ? -54.24500 -18.74800 -36.00100 1.000 54.50000  ? 244 ILE A CB    1 
ATOM   1950 C  CG1   . ILE A 1 256 ? -53.77300 -18.60800 -34.55300 1.000 53.92000  ? 244 ILE A CG1   1 
ATOM   1951 C  CG2   . ILE A 1 256 ? -53.07700 -19.04500 -36.93100 1.000 52.29000  ? 244 ILE A CG2   1 
ATOM   1952 C  CD1   . ILE A 1 256 ? -53.37300 -19.91200 -33.92300 1.000 40.23000  ? 244 ILE A CD1   1 
ATOM   1953 N  N     . VAL A 1 257 ? -54.78700 -16.71800 -38.73000 1.000 66.15000  ? 245 VAL A N     1 
ATOM   1954 C  CA    . VAL A 1 257 ? -55.12000 -16.71100 -40.14600 1.000 67.67000  ? 245 VAL A CA    1 
ATOM   1955 C  C     . VAL A 1 257 ? -53.94600 -17.17600 -40.97700 1.000 66.33000  ? 245 VAL A C     1 
ATOM   1956 O  O     . VAL A 1 257 ? -52.93400 -16.48200 -41.06400 1.000 64.70000  ? 245 VAL A O     1 
ATOM   1957 C  CB    . VAL A 1 257 ? -55.54000 -15.31100 -40.64000 1.000 64.75000  ? 245 VAL A CB    1 
ATOM   1958 C  CG1   . VAL A 1 257 ? -56.29400 -15.43700 -41.94600 1.000 67.26000  ? 245 VAL A CG1   1 
ATOM   1959 C  CG2   . VAL A 1 257 ? -56.39600 -14.59700 -39.60000 1.000 52.13000  ? 245 VAL A CG2   1 
ATOM   1960 N  N     . LEU A 1 258 ? -54.08500 -18.34900 -41.58700 1.000 66.62000  ? 246 LEU A N     1 
ATOM   1961 C  CA    . LEU A 1 258 ? -53.06000 -18.86900 -42.48800 1.000 70.31000  ? 246 LEU A CA    1 
ATOM   1962 C  C     . LEU A 1 258 ? -53.17100 -18.26600 -43.87500 1.000 78.69000  ? 246 LEU A C     1 
ATOM   1963 O  O     . LEU A 1 258 ? -54.27300 -18.15900 -44.41700 1.000 80.76000  ? 246 LEU A O     1 
ATOM   1964 C  CB    . LEU A 1 258 ? -53.16100 -20.38200 -42.61100 1.000 71.39000  ? 246 LEU A CB    1 
ATOM   1965 C  CG    . LEU A 1 258 ? -53.03000 -21.21300 -41.34600 1.000 71.18000  ? 246 LEU A CG    1 
ATOM   1966 C  CD1   . LEU A 1 258 ? -53.55700 -22.60400 -41.63300 1.000 63.92000  ? 246 LEU A CD1   1 
ATOM   1967 C  CD2   . LEU A 1 258 ? -51.57300 -21.25100 -40.91100 1.000 59.48000  ? 246 LEU A CD2   1 
ATOM   1968 N  N     . PRO A 1 259 ? -52.02500 -17.89700 -44.46600 1.000 80.63000  ? 247 PRO A N     1 
ATOM   1969 C  CA    . PRO A 1 259 ? -51.91400 -17.40600 -45.84900 1.000 81.42000  ? 247 PRO A CA    1 
ATOM   1970 C  C     . PRO A 1 259 ? -52.62100 -18.31500 -46.86800 1.000 83.75000  ? 247 PRO A C     1 
ATOM   1971 O  O     . PRO A 1 259 ? -53.01800 -19.42800 -46.51700 1.000 79.64000  ? 247 PRO A O     1 
ATOM   1972 C  CB    . PRO A 1 259 ? -50.40300 -17.39100 -46.08500 1.000 80.38000  ? 247 PRO A CB    1 
ATOM   1973 C  CG    . PRO A 1 259 ? -49.82500 -17.14800 -44.72500 1.000 77.50000  ? 247 PRO A CG    1 
ATOM   1974 C  CD    . PRO A 1 259 ? -50.72400 -17.89000 -43.77100 1.000 74.64000  ? 247 PRO A CD    1 
ATOM   1975 N  N     . GLU A 1 260 ? -52.77300 -17.85100 -48.10900 1.000 87.03000  ? 248 GLU A N     1 
ATOM   1976 C  CA    . GLU A 1 260 ? -53.51500 -18.60800 -49.12300 1.000 86.38000  ? 248 GLU A CA    1 
ATOM   1977 C  C     . GLU A 1 260 ? -52.92400 -18.48200 -50.52300 1.000 84.52000  ? 248 GLU A C     1 
ATOM   1978 O  O     . GLU A 1 260 ? -53.65700 -18.47900 -51.51000 1.000 89.23000  ? 248 GLU A O     1 
ATOM   1979 C  CB    . GLU A 1 260 ? -54.98100 -18.16200 -49.15700 1.000 84.72000  ? 248 GLU A CB    1 
ATOM   1980 C  CG    . GLU A 1 260 ? -55.90200 -19.01500 -48.31500 1.000 84.74000  ? 248 GLU A CG    1 
ATOM   1981 C  CD    . GLU A 1 260 ? -57.16900 -18.28700 -47.92900 1.000 97.60000  ? 248 GLU A CD    1 
ATOM   1982 O  OE1   . GLU A 1 260 ? -57.80500 -18.69200 -46.93000 1.000 96.82000  ? 248 GLU A OE1   1 
ATOM   1983 O  OE2   . GLU A 1 260 ? -57.52300 -17.30900 -48.62400 1.000 98.39000  ? 248 GLU A OE2   1 
ATOM   1984 N  N     . LYS A 1 261 ? -51.60100 -18.39700 -50.60400 1.000 82.33000  ? 249 LYS A N     1 
ATOM   1985 C  CA    . LYS A 1 261 ? -50.90600 -18.24600 -51.88000 1.000 80.34000  ? 249 LYS A CA    1 
ATOM   1986 C  C     . LYS A 1 261 ? -51.12000 -19.39400 -52.85300 1.000 83.48000  ? 249 LYS A C     1 
ATOM   1987 O  O     . LYS A 1 261 ? -51.81000 -20.37700 -52.55900 1.000 82.19000  ? 249 LYS A O     1 
ATOM   1988 C  CB    . LYS A 1 261 ? -49.40700 -18.09300 -51.64100 1.000 78.31000  ? 249 LYS A CB    1 
ATOM   1989 C  CG    . LYS A 1 261 ? -49.06600 -16.89300 -50.81500 1.000 77.90000  ? 249 LYS A CG    1 
ATOM   1990 C  CD    . LYS A 1 261 ? -48.06500 -17.20600 -49.73000 1.000 81.28000  ? 249 LYS A CD    1 
ATOM   1991 C  CE    . LYS A 1 261 ? -48.27200 -16.19600 -48.61900 1.000 85.79000  ? 249 LYS A CE    1 
ATOM   1992 N  NZ    . LYS A 1 261 ? -47.10300 -16.00700 -47.73200 1.000 90.40000  ? 249 LYS A NZ    1 
ATOM   1993 N  N     . ASP A 1 262 ? -50.52400 -19.23800 -54.02900 1.000 81.79000  ? 250 ASP A N     1 
ATOM   1994 C  CA    . ASP A 1 262 ? -50.43300 -20.30000 -55.01800 1.000 85.18000  ? 250 ASP A CA    1 
ATOM   1995 C  C     . ASP A 1 262 ? -48.95500 -20.51900 -55.30300 1.000 82.61000  ? 250 ASP A C     1 
ATOM   1996 O  O     . ASP A 1 262 ? -48.52000 -21.63100 -55.59400 1.000 73.91000  ? 250 ASP A O     1 
ATOM   1997 C  CB    . ASP A 1 262 ? -51.19800 -19.94100 -56.29100 1.000 89.75000  ? 250 ASP A CB    1 
ATOM   1998 C  CG    . ASP A 1 262 ? -52.68800 -19.73800 -56.04500 1.000 98.70000  ? 250 ASP A CG    1 
ATOM   1999 O  OD1   . ASP A 1 262 ? -53.07700 -19.39600 -54.90800 1.000 95.96000  ? 250 ASP A OD1   1 
ATOM   2000 O  OD2   . ASP A 1 262 ? -53.47800 -19.91700 -56.99600 1.000 107.51000 ? 250 ASP A OD2   1 
ATOM   2001 N  N     . SER A 1 263 ? -48.19400 -19.43400 -55.21000 1.000 81.76000  ? 251 SER A N     1 
ATOM   2002 C  CA    . SER A 1 263 ? -46.74000 -19.50100 -55.22800 1.000 82.16000  ? 251 SER A CA    1 
ATOM   2003 C  C     . SER A 1 263 ? -46.20400 -19.28200 -53.80700 1.000 84.22000  ? 251 SER A C     1 
ATOM   2004 O  O     . SER A 1 263 ? -46.38100 -18.21200 -53.21500 1.000 86.83000  ? 251 SER A O     1 
ATOM   2005 C  CB    . SER A 1 263 ? -46.15500 -18.46500 -56.19600 1.000 74.56000  ? 251 SER A CB    1 
ATOM   2006 O  OG    . SER A 1 263 ? -44.73600 -18.46000 -56.14600 1.000 72.43000  ? 251 SER A OG    1 
ATOM   2007 N  N     . TRP A 1 264 ? -45.56100 -20.30400 -53.25400 1.000 79.04000  ? 252 TRP A N     1 
ATOM   2008 C  CA    . TRP A 1 264 ? -45.03200 -20.20900 -51.90500 1.000 74.02000  ? 252 TRP A CA    1 
ATOM   2009 C  C     . TRP A 1 264 ? -43.52000 -20.09400 -51.94500 1.000 74.28000  ? 252 TRP A C     1 
ATOM   2010 O  O     . TRP A 1 264 ? -42.84200 -20.88900 -52.59800 1.000 78.01000  ? 252 TRP A O     1 
ATOM   2011 C  CB    . TRP A 1 264 ? -45.45200 -21.42000 -51.06300 1.000 72.27000  ? 252 TRP A CB    1 
ATOM   2012 C  CG    . TRP A 1 264 ? -46.93800 -21.60200 -50.95800 1.000 71.72000  ? 252 TRP A CG    1 
ATOM   2013 C  CD1   . TRP A 1 264 ? -47.77500 -22.07000 -51.93200 1.000 75.30000  ? 252 TRP A CD1   1 
ATOM   2014 C  CD2   . TRP A 1 264 ? -47.76400 -21.33000 -49.81500 1.000 69.72000  ? 252 TRP A CD2   1 
ATOM   2015 N  NE1   . TRP A 1 264 ? -49.07000 -22.10400 -51.46900 1.000 80.59000  ? 252 TRP A NE1   1 
ATOM   2016 C  CE2   . TRP A 1 264 ? -49.09500 -21.65500 -50.17500 1.000 72.66000  ? 252 TRP A CE2   1 
ATOM   2017 C  CE3   . TRP A 1 264 ? -47.51300 -20.84400 -48.52700 1.000 59.96000  ? 252 TRP A CE3   1 
ATOM   2018 C  CZ2   . TRP A 1 264 ? -50.16900 -21.50500 -49.29600 1.000 71.70000  ? 252 TRP A CZ2   1 
ATOM   2019 C  CZ3   . TRP A 1 264 ? -48.58500 -20.69700 -47.65100 1.000 67.02000  ? 252 TRP A CZ3   1 
ATOM   2020 C  CH2   . TRP A 1 264 ? -49.89500 -21.02800 -48.04200 1.000 70.87000  ? 252 TRP A CH2   1 
ATOM   2021 N  N     . THR A 1 265 ? -43.00000 -19.09300 -51.24300 1.000 74.90000  ? 253 THR A N     1 
ATOM   2022 C  CA    . THR A 1 265 ? -41.56100 -18.93100 -51.07700 1.000 72.75000  ? 253 THR A CA    1 
ATOM   2023 C  C     . THR A 1 265 ? -41.06900 -19.63500 -49.80200 1.000 69.20000  ? 253 THR A C     1 
ATOM   2024 O  O     . THR A 1 265 ? -41.88200 -20.02300 -48.96300 1.000 69.07000  ? 253 THR A O     1 
ATOM   2025 C  CB    . THR A 1 265 ? -41.18300 -17.44600 -51.01300 1.000 71.89000  ? 253 THR A CB    1 
ATOM   2026 O  OG1   . THR A 1 265 ? -41.31500 -16.97800 -49.66600 1.000 75.60000  ? 253 THR A OG1   1 
ATOM   2027 C  CG2   . THR A 1 265 ? -42.09200 -16.63200 -51.91100 1.000 73.62000  ? 253 THR A CG2   1 
ATOM   2028 N  N     . VAL A 1 266 ? -39.75300 -19.79900 -49.66100 1.000 65.18000  ? 254 VAL A N     1 
ATOM   2029 C  CA    . VAL A 1 266 ? -39.16600 -20.25200 -48.39400 1.000 66.58000  ? 254 VAL A CA    1 
ATOM   2030 C  C     . VAL A 1 266 ? -39.68000 -19.39000 -47.25500 1.000 67.48000  ? 254 VAL A C     1 
ATOM   2031 O  O     . VAL A 1 266 ? -40.17800 -19.91000 -46.25000 1.000 71.77000  ? 254 VAL A O     1 
ATOM   2032 C  CB    . VAL A 1 266 ? -37.61200 -20.18800 -48.38200 1.000 66.53000  ? 254 VAL A CB    1 
ATOM   2033 C  CG1   . VAL A 1 266 ? -37.09200 -19.94200 -46.96800 1.000 62.43000  ? 254 VAL A CG1   1 
ATOM   2034 C  CG2   . VAL A 1 266 ? -37.00800 -21.45700 -48.92200 1.000 66.34000  ? 254 VAL A CG2   1 
ATOM   2035 N  N     . ASN A 1 267 ? -39.57600 -18.07200 -47.43400 1.000 66.23000  ? 255 ASN A N     1 
ATOM   2036 C  CA    . ASN A 1 267 ? -39.99500 -17.12700 -46.40900 1.000 72.34000  ? 255 ASN A CA    1 
ATOM   2037 C  C     . ASN A 1 267 ? -41.45400 -17.34200 -46.06400 1.000 68.29000  ? 255 ASN A C     1 
ATOM   2038 O  O     . ASN A 1 267 ? -41.83600 -17.08600 -44.95000 1.000 72.02000  ? 255 ASN A O     1 
ATOM   2039 C  CB    . ASN A 1 267 ? -39.76400 -15.66300 -46.83500 1.000 77.48000  ? 255 ASN A CB    1 
ATOM   2040 C  CG    . ASN A 1 267 ? -40.26800 -14.64600 -45.79000 1.000 75.11000  ? 255 ASN A CG    1 
ATOM   2041 O  OD1   . ASN A 1 267 ? -39.50100 -14.15300 -44.95800 1.000 78.05000  ? 255 ASN A OD1   1 
ATOM   2042 N  ND2   . ASN A 1 267 ? -41.55800 -14.31400 -45.85800 1.000 72.51000  ? 255 ASN A ND2   1 
ATOM   2043 N  N     . ASP A 1 268 ? -42.24700 -17.85600 -46.99800 1.000 66.76000  ? 256 ASP A N     1 
ATOM   2044 C  CA    . ASP A 1 268 ? -43.67700 -17.97900 -46.76200 1.000 65.10000  ? 256 ASP A CA    1 
ATOM   2045 C  C     . ASP A 1 268 ? -44.08500 -19.37100 -46.29000 1.000 69.79000  ? 256 ASP A C     1 
ATOM   2046 O  O     . ASP A 1 268 ? -45.16200 -19.56300 -45.70500 1.000 69.83000  ? 256 ASP A O     1 
ATOM   2047 C  CB    . ASP A 1 268 ? -44.42700 -17.58300 -48.02200 1.000 75.34000  ? 256 ASP A CB    1 
ATOM   2048 C  CG    . ASP A 1 268 ? -44.24600 -16.11200 -48.34500 1.000 86.56000  ? 256 ASP A CG    1 
ATOM   2049 O  OD1   . ASP A 1 268 ? -44.55200 -15.26900 -47.46700 1.000 85.01000  ? 256 ASP A OD1   1 
ATOM   2050 O  OD2   . ASP A 1 268 ? -43.78600 -15.79700 -49.46200 1.000 93.38000  ? 256 ASP A OD2   1 
ATOM   2051 N  N     . ILE A 1 269 ? -43.22200 -20.34500 -46.54400 1.000 66.33000  ? 257 ILE A N     1 
ATOM   2052 C  CA    . ILE A 1 269 ? -43.33400 -21.61600 -45.84900 1.000 65.00000  ? 257 ILE A CA    1 
ATOM   2053 C  C     . ILE A 1 269 ? -42.96400 -21.37600 -44.38500 1.000 62.53000  ? 257 ILE A C     1 
ATOM   2054 O  O     . ILE A 1 269 ? -43.71900 -21.73900 -43.47400 1.000 56.48000  ? 257 ILE A O     1 
ATOM   2055 C  CB    . ILE A 1 269 ? -42.42200 -22.70400 -46.44800 1.000 63.44000  ? 257 ILE A CB    1 
ATOM   2056 C  CG1   . ILE A 1 269 ? -42.70000 -22.87500 -47.93700 1.000 58.88000  ? 257 ILE A CG1   1 
ATOM   2057 C  CG2   . ILE A 1 269 ? -42.62400 -24.03000 -45.71300 1.000 65.46000  ? 257 ILE A CG2   1 
ATOM   2058 C  CD1   . ILE A 1 269 ? -44.06700 -23.42500 -48.23500 1.000 65.54000  ? 257 ILE A CD1   1 
ATOM   2059 N  N     . CYS A 1 270 ? -41.80600 -20.74600 -44.17600 1.000 61.96000  ? 258 CYS A N     1 
ATOM   2060 C  CA    . CYS A 1 270 ? -41.32200 -20.44000 -42.83700 1.000 52.98000  ? 258 CYS A CA    1 
ATOM   2061 C  C     . CYS A 1 270 ? -42.32800 -19.63200 -42.03300 1.000 55.47000  ? 258 CYS A C     1 
ATOM   2062 O  O     . CYS A 1 270 ? -42.39400 -19.81100 -40.81800 1.000 63.33000  ? 258 CYS A O     1 
ATOM   2063 C  CB    . CYS A 1 270 ? -39.99200 -19.69400 -42.88100 1.000 49.11000  ? 258 CYS A CB    1 
ATOM   2064 S  SG    . CYS A 1 270 ? -38.56600 -20.76400 -42.66300 1.000 61.34000  ? 258 CYS A SG    1 
ATOM   2065 N  N     . LYS A 1 271 ? -43.11700 -18.75400 -42.66500 1.000 56.10000  ? 259 LYS A N     1 
ATOM   2066 C  CA    . LYS A 1 271 ? -44.11800 -18.01000 -41.87600 1.000 57.14000  ? 259 LYS A CA    1 
ATOM   2067 C  C     . LYS A 1 271 ? -45.31400 -18.88300 -41.64900 1.000 52.77000  ? 259 LYS A C     1 
ATOM   2068 O  O     . LYS A 1 271 ? -46.02700 -18.69400 -40.67700 1.000 46.19000  ? 259 LYS A O     1 
ATOM   2069 C  CB    . LYS A 1 271 ? -44.55900 -16.68800 -42.52800 1.000 52.13000  ? 259 LYS A CB    1 
ATOM   2070 C  CG    . LYS A 1 271 ? -43.41100 -16.00500 -43.20300 1.000 67.18000  ? 259 LYS A CG    1 
ATOM   2071 C  CD    . LYS A 1 271 ? -43.40700 -14.49200 -43.19000 1.000 70.45000  ? 259 LYS A CD    1 
ATOM   2072 C  CE    . LYS A 1 271 ? -44.67200 -13.91000 -43.73200 1.000 74.43000  ? 259 LYS A CE    1 
ATOM   2073 N  NZ    . LYS A 1 271 ? -44.66400 -12.43700 -43.50400 1.000 71.13000  ? 259 LYS A NZ    1 
ATOM   2074 N  N     . LEU A 1 272 ? -45.53200 -19.84000 -42.54500 1.000 56.27000  ? 260 LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 272 ? -46.66800 -20.74500 -42.41700 1.000 53.03000  ? 260 LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 272 ? -46.46800 -21.73200 -41.27700 1.000 49.20000  ? 260 LEU A C     1 
ATOM   2077 O  O     . LEU A 1 272 ? -47.36300 -21.92300 -40.44700 1.000 47.17000  ? 260 LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 272 ? -46.89700 -21.50400 -43.72700 1.000 61.14000  ? 260 LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 272 ? -47.92700 -22.63600 -43.70500 1.000 57.37000  ? 260 LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 272 ? -49.36400 -22.10600 -43.53900 1.000 53.00000  ? 260 LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 272 ? -47.78600 -23.48700 -44.94700 1.000 50.11000  ? 260 LEU A CD2   1 
ATOM   2082 N  N     . VAL A 1 273 ? -45.29200 -22.36200 -41.25500 1.000 49.03000  ? 261 VAL A N     1 
ATOM   2083 C  CA    . VAL A 1 273 ? -44.91800 -23.31700 -40.20200 1.000 52.06000  ? 261 VAL A CA    1 
ATOM   2084 C  C     . VAL A 1 273 ? -45.02100 -22.67900 -38.81400 1.000 52.46000  ? 261 VAL A C     1 
ATOM   2085 O  O     . VAL A 1 273 ? -45.53200 -23.29300 -37.86900 1.000 49.35000  ? 261 VAL A O     1 
ATOM   2086 C  CB    . VAL A 1 273 ? -43.48300 -23.85500 -40.40600 1.000 49.74000  ? 261 VAL A CB    1 
ATOM   2087 C  CG1   . VAL A 1 273 ? -43.13100 -24.85100 -39.33000 1.000 49.62000  ? 261 VAL A CG1   1 
ATOM   2088 C  CG2   . VAL A 1 273 ? -43.35100 -24.50000 -41.77200 1.000 57.94000  ? 261 VAL A CG2   1 
ATOM   2089 N  N     . GLY A 1 274 ? -44.54500 -21.44000 -38.71400 1.000 47.95000  ? 262 GLY A N     1 
ATOM   2090 C  CA    . GLY A 1 274 ? -44.63900 -20.66500 -37.49500 1.000 42.15000  ? 262 GLY A CA    1 
ATOM   2091 C  C     . GLY A 1 274 ? -46.04400 -20.52600 -36.93300 1.000 42.95000  ? 262 GLY A C     1 
ATOM   2092 O  O     . GLY A 1 274 ? -46.24300 -20.76700 -35.74500 1.000 45.48000  ? 262 GLY A O     1 
ATOM   2093 N  N     . LYS A 1 275 ? -47.01700 -20.13200 -37.75700 1.000 43.56000  ? 263 LYS A N     1 
ATOM   2094 C  CA    . LYS A 1 275 ? -48.38200 -19.96500 -37.25900 1.000 39.66000  ? 263 LYS A CA    1 
ATOM   2095 C  C     . LYS A 1 275 ? -48.97500 -21.31000 -36.85600 1.000 40.93000  ? 263 LYS A C     1 
ATOM   2096 O  O     . LYS A 1 275 ? -49.82800 -21.37700 -35.96200 1.000 40.12000  ? 263 LYS A O     1 
ATOM   2097 C  CB    . LYS A 1 275 ? -49.29200 -19.30800 -38.30300 1.000 44.13000  ? 263 LYS A CB    1 
ATOM   2098 C  CG    . LYS A 1 275 ? -48.61400 -18.33700 -39.24700 1.000 46.33000  ? 263 LYS A CG    1 
ATOM   2099 C  CD    . LYS A 1 275 ? -48.91700 -16.88300 -38.89300 1.000 46.65000  ? 263 LYS A CD    1 
ATOM   2100 C  CE    . LYS A 1 275 ? -50.11800 -16.37500 -39.65400 1.000 55.57000  ? 263 LYS A CE    1 
ATOM   2101 N  NZ    . LYS A 1 275 ? -50.56900 -15.05200 -39.15000 1.000 53.31000  ? 263 LYS A NZ    1 
ATOM   2102 N  N     . LEU A 1 276 ? -48.54600 -22.37800 -37.52700 1.000 38.33000  ? 264 LEU A N     1 
ATOM   2103 C  CA    . LEU A 1 276 ? -49.06800 -23.70100 -37.22000 1.000 40.86000  ? 264 LEU A CA    1 
ATOM   2104 C  C     . LEU A 1 276 ? -48.53200 -24.14200 -35.86600 1.000 42.95000  ? 264 LEU A C     1 
ATOM   2105 O  O     . LEU A 1 276 ? -49.29000 -24.60600 -35.00100 1.000 39.30000  ? 264 LEU A O     1 
ATOM   2106 C  CB    . LEU A 1 276 ? -48.70300 -24.71300 -38.31100 1.000 43.63000  ? 264 LEU A CB    1 
ATOM   2107 C  CG    . LEU A 1 276 ? -49.48900 -24.62300 -39.62600 1.000 45.48000  ? 264 LEU A CG    1 
ATOM   2108 C  CD1   . LEU A 1 276 ? -48.98000 -25.63800 -40.64600 1.000 42.55000  ? 264 LEU A CD1   1 
ATOM   2109 C  CD2   . LEU A 1 276 ? -50.98600 -24.79600 -39.39500 1.000 42.40000  ? 264 LEU A CD2   1 
ATOM   2110 N  N     . ASN A 1 277 ? -47.22200 -23.97900 -35.68200 1.000 43.66000  ? 265 ASN A N     1 
ATOM   2111 C  CA    . ASN A 1 277 ? -46.57900 -24.28800 -34.40900 1.000 41.01000  ? 265 ASN A CA    1 
ATOM   2112 C  C     . ASN A 1 277 ? -47.18700 -23.48900 -33.26200 1.000 37.29000  ? 265 ASN A C     1 
ATOM   2113 O  O     . ASN A 1 277 ? -47.53400 -24.03500 -32.22900 1.000 42.11000  ? 265 ASN A O     1 
ATOM   2114 C  CB    . ASN A 1 277 ? -45.07700 -24.03700 -34.50600 1.000 44.61000  ? 265 ASN A CB    1 
ATOM   2115 C  CG    . ASN A 1 277 ? -44.34800 -25.14500 -35.27800 1.000 50.66000  ? 265 ASN A CG    1 
ATOM   2116 O  OD1   . ASN A 1 277 ? -44.65500 -26.33400 -35.12600 1.000 47.47000  ? 265 ASN A OD1   1 
ATOM   2117 N  ND2   . ASN A 1 277 ? -43.38300 -24.75500 -36.11000 1.000 52.66000  ? 265 ASN A ND2   1 
ATOM   2118 N  N     . TRP A 1 278 ? -47.34200 -22.19400 -33.46500 1.000 40.17000  ? 266 TRP A N     1 
ATOM   2119 C  CA    . TRP A 1 278 ? -48.09400 -21.35100 -32.54400 1.000 33.85000  ? 266 TRP A CA    1 
ATOM   2120 C  C     . TRP A 1 278 ? -49.48200 -21.89300 -32.28300 1.000 36.37000  ? 266 TRP A C     1 
ATOM   2121 O  O     . TRP A 1 278 ? -49.96500 -21.83200 -31.16100 1.000 40.58000  ? 266 TRP A O     1 
ATOM   2122 C  CB    . TRP A 1 278 ? -48.19300 -19.93400 -33.10300 1.000 34.06000  ? 266 TRP A CB    1 
ATOM   2123 C  CG    . TRP A 1 278 ? -49.18100 -19.05200 -32.40700 1.000 34.31000  ? 266 TRP A CG    1 
ATOM   2124 C  CD1   . TRP A 1 278 ? -50.38100 -18.63400 -32.89700 1.000 35.90000  ? 266 TRP A CD1   1 
ATOM   2125 C  CD2   . TRP A 1 278 ? -49.04600 -18.44800 -31.11100 1.000 38.82000  ? 266 TRP A CD2   1 
ATOM   2126 N  NE1   . TRP A 1 278 ? -51.01400 -17.81300 -31.98700 1.000 37.54000  ? 266 TRP A NE1   1 
ATOM   2127 C  CE2   . TRP A 1 278 ? -50.21600 -17.68200 -30.88200 1.000 38.52000  ? 266 TRP A CE2   1 
ATOM   2128 C  CE3   . TRP A 1 278 ? -48.05400 -18.47500 -30.12300 1.000 35.08000  ? 266 TRP A CE3   1 
ATOM   2129 C  CZ2   . TRP A 1 278 ? -50.42500 -16.96400 -29.70000 1.000 29.97000  ? 266 TRP A CZ2   1 
ATOM   2130 C  CZ3   . TRP A 1 278 ? -48.26500 -17.75900 -28.94900 1.000 32.90000  ? 266 TRP A CZ3   1 
ATOM   2131 C  CH2   . TRP A 1 278 ? -49.43800 -17.01100 -28.75200 1.000 31.76000  ? 266 TRP A CH2   1 
ATOM   2132 N  N     . ALA A 1 279 ? -50.12300 -22.42700 -33.32100 1.000 39.61000  ? 267 ALA A N     1 
ATOM   2133 C  CA    . ALA A 1 279 ? -51.50300 -22.90000 -33.22500 1.000 38.82000  ? 267 ALA A CA    1 
ATOM   2134 C  C     . ALA A 1 279 ? -51.61800 -24.18400 -32.40900 1.000 35.24000  ? 267 ALA A C     1 
ATOM   2135 O  O     . ALA A 1 279 ? -52.66100 -24.46000 -31.77800 1.000 29.09000  ? 267 ALA A O     1 
ATOM   2136 C  CB    . ALA A 1 279 ? -52.07200 -23.12300 -34.61800 1.000 39.62000  ? 267 ALA A CB    1 
ATOM   2137 N  N     . SER A 1 280 ? -50.54900 -24.97400 -32.43600 1.000 26.94000  ? 268 SER A N     1 
ATOM   2138 C  CA    . SER A 1 280 ? -50.62500 -26.32300 -31.90700 1.000 35.42000  ? 268 SER A CA    1 
ATOM   2139 C  C     . SER A 1 280 ? -50.69600 -26.33300 -30.37800 1.000 32.01000  ? 268 SER A C     1 
ATOM   2140 O  O     . SER A 1 280 ? -50.88400 -27.37700 -29.76900 1.000 30.56000  ? 268 SER A O     1 
ATOM   2141 C  CB    . SER A 1 280 ? -49.45000 -27.16900 -32.40800 1.000 32.98000  ? 268 SER A CB    1 
ATOM   2142 O  OG    . SER A 1 280 ? -48.20300 -26.55000 -32.16500 1.000 37.26000  ? 268 SER A OG    1 
ATOM   2143 N  N     . GLN A 1 281 ? -50.59300 -25.16400 -29.76200 1.000 29.99000  ? 269 GLN A N     1 
ATOM   2144 C  CA    . GLN A 1 281 ? -50.70200 -25.07300 -28.31800 1.000 24.26000  ? 269 GLN A CA    1 
ATOM   2145 C  C     . GLN A 1 281 ? -52.12400 -25.32100 -27.87600 1.000 28.57000  ? 269 GLN A C     1 
ATOM   2146 O  O     . GLN A 1 281 ? -52.36500 -25.60300 -26.69300 1.000 31.17000  ? 269 GLN A O     1 
ATOM   2147 C  CB    . GLN A 1 281 ? -50.24100 -23.71300 -27.80700 1.000 23.50000  ? 269 GLN A CB    1 
ATOM   2148 C  CG    . GLN A 1 281 ? -51.05400 -22.60200 -28.35200 1.000 26.50000  ? 269 GLN A CG    1 
ATOM   2149 C  CD    . GLN A 1 281 ? -50.66100 -21.28500 -27.80500 1.000 30.16000  ? 269 GLN A CD    1 
ATOM   2150 O  OE1   . GLN A 1 281 ? -50.68300 -21.08000 -26.59400 1.000 32.97000  ? 269 GLN A OE1   1 
ATOM   2151 N  NE2   . GLN A 1 281 ? -50.30100 -20.36200 -28.68700 1.000 30.32000  ? 269 GLN A NE2   1 
ATOM   2152 N  N     . ILE A 1 282 ? -53.08300 -25.23000 -28.79400 1.000 32.16000  ? 270 ILE A N     1 
ATOM   2153 C  CA    . ILE A 1 282 ? -54.48100 -25.46600 -28.37300 1.000 39.95000  ? 270 ILE A CA    1 
ATOM   2154 C  C     . ILE A 1 282 ? -55.31600 -26.23700 -29.41700 1.000 29.98000  ? 270 ILE A C     1 
ATOM   2155 O  O     . ILE A 1 282 ? -56.30200 -26.87100 -29.06900 1.000 30.95000  ? 270 ILE A O     1 
ATOM   2156 C  CB    . ILE A 1 282 ? -55.17800 -24.10900 -27.98400 1.000 30.09000  ? 270 ILE A CB    1 
ATOM   2157 C  CG1   . ILE A 1 282 ? -56.50800 -24.33800 -27.26900 1.000 32.59000  ? 270 ILE A CG1   1 
ATOM   2158 C  CG2   . ILE A 1 282 ? -55.34500 -23.23200 -29.19500 1.000 36.18000  ? 270 ILE A CG2   1 
ATOM   2159 C  CD1   . ILE A 1 282 ? -56.45000 -25.30500 -26.10100 1.000 28.91000  ? 270 ILE A CD1   1 
ATOM   2160 N  N     . TYR A 1 283 ? -54.89100 -26.20800 -30.67800 1.000 34.31000  ? 271 TYR A N     1 
ATOM   2161 C  CA    . TYR A 1 283 ? -55.49400 -27.02300 -31.74100 1.000 36.76000  ? 271 TYR A CA    1 
ATOM   2162 C  C     . TYR A 1 283 ? -54.82300 -28.38900 -31.88400 1.000 40.04000  ? 271 TYR A C     1 
ATOM   2163 O  O     . TYR A 1 283 ? -53.74800 -28.48400 -32.47900 1.000 42.58000  ? 271 TYR A O     1 
ATOM   2164 C  CB    . TYR A 1 283 ? -55.38800 -26.32500 -33.10000 1.000 39.93000  ? 271 TYR A CB    1 
ATOM   2165 C  CG    . TYR A 1 283 ? -56.27400 -25.13600 -33.28200 1.000 38.71000  ? 271 TYR A CG    1 
ATOM   2166 C  CD1   . TYR A 1 283 ? -55.86900 -23.86900 -32.86300 1.000 42.50000  ? 271 TYR A CD1   1 
ATOM   2167 C  CD2   . TYR A 1 283 ? -57.50900 -25.26500 -33.89700 1.000 47.72000  ? 271 TYR A CD2   1 
ATOM   2168 C  CE1   . TYR A 1 283 ? -56.69500 -22.76200 -33.04100 1.000 47.13000  ? 271 TYR A CE1   1 
ATOM   2169 C  CE2   . TYR A 1 283 ? -58.34200 -24.16800 -34.08500 1.000 54.04000  ? 271 TYR A CE2   1 
ATOM   2170 C  CZ    . TYR A 1 283 ? -57.93100 -22.92400 -33.65600 1.000 56.43000  ? 271 TYR A CZ    1 
ATOM   2171 O  OH    . TYR A 1 283 ? -58.76800 -21.84800 -33.84400 1.000 62.37000  ? 271 TYR A OH    1 
ATOM   2172 N  N     . PRO A 1 284 ? -55.46800 -29.45700 -31.39400 1.000 38.35000  ? 272 PRO A N     1 
ATOM   2173 C  CA    . PRO A 1 284 ? -54.84200 -30.78600 -31.44500 1.000 37.80000  ? 272 PRO A CA    1 
ATOM   2174 C  C     . PRO A 1 284 ? -54.68400 -31.30200 -32.87300 1.000 42.10000  ? 272 PRO A C     1 
ATOM   2175 O  O     . PRO A 1 284 ? -55.54800 -31.02700 -33.70500 1.000 47.54000  ? 272 PRO A O     1 
ATOM   2176 C  CB    . PRO A 1 284 ? -55.82700 -31.66500 -30.66400 1.000 35.11000  ? 272 PRO A CB    1 
ATOM   2177 C  CG    . PRO A 1 284 ? -57.14900 -30.98700 -30.86400 1.000 38.21000  ? 272 PRO A CG    1 
ATOM   2178 C  CD    . PRO A 1 284 ? -56.85900 -29.51000 -30.90700 1.000 36.35000  ? 272 PRO A CD    1 
ATOM   2179 N  N     . GLY A 1 285 ? -53.60700 -32.03000 -33.15500 1.000 35.55000  ? 273 GLY A N     1 
ATOM   2180 C  CA    . GLY A 1 285 ? -53.47600 -32.70200 -34.43100 1.000 30.79000  ? 273 GLY A CA    1 
ATOM   2181 C  C     . GLY A 1 285 ? -52.61700 -32.04100 -35.48700 1.000 43.59000  ? 273 GLY A C     1 
ATOM   2182 O  O     . GLY A 1 285 ? -52.31900 -32.65600 -36.51600 1.000 48.36000  ? 273 GLY A O     1 
ATOM   2183 N  N     . ILE A 1 286 ? -52.22400 -30.79200 -35.25100 1.000 47.16000  ? 274 ILE A N     1 
ATOM   2184 C  CA    . ILE A 1 286 ? -51.41500 -30.05600 -36.21600 1.000 40.95000  ? 274 ILE A CA    1 
ATOM   2185 C  C     . ILE A 1 286 ? -50.13300 -30.81800 -36.57000 1.000 43.00000  ? 274 ILE A C     1 
ATOM   2186 O  O     . ILE A 1 286 ? -49.49800 -31.42000 -35.69800 1.000 48.03000  ? 274 ILE A O     1 
ATOM   2187 C  CB    . ILE A 1 286 ? -51.06500 -28.67200 -35.68000 1.000 41.20000  ? 274 ILE A CB    1 
ATOM   2188 C  CG1   . ILE A 1 286 ? -52.34300 -27.91500 -35.33800 1.000 34.25000  ? 274 ILE A CG1   1 
ATOM   2189 C  CG2   . ILE A 1 286 ? -50.25200 -27.89500 -36.71300 1.000 44.37000  ? 274 ILE A CG2   1 
ATOM   2190 C  CD1   . ILE A 1 286 ? -52.94400 -27.24800 -36.52800 1.000 39.61000  ? 274 ILE A CD1   1 
ATOM   2191 N  N     . LYS A 1 287 ? -49.78200 -30.81200 -37.85900 1.000 46.65000  ? 275 LYS A N     1 
ATOM   2192 C  CA    . LYS A 1 287 ? -48.61000 -31.52800 -38.37700 1.000 43.61000  ? 275 LYS A CA    1 
ATOM   2193 C  C     . LYS A 1 287 ? -47.81300 -30.65400 -39.35300 1.000 47.18000  ? 275 LYS A C     1 
ATOM   2194 O  O     . LYS A 1 287 ? -48.38400 -29.96000 -40.19400 1.000 47.23000  ? 275 LYS A O     1 
ATOM   2195 C  CB    . LYS A 1 287 ? -49.03900 -32.83200 -39.06600 1.000 46.00000  ? 275 LYS A CB    1 
ATOM   2196 C  CG    . LYS A 1 287 ? -49.94300 -33.71800 -38.21200 1.000 42.36000  ? 275 LYS A CG    1 
ATOM   2197 C  CD    . LYS A 1 287 ? -49.92300 -35.16500 -38.66300 1.000 47.87000  ? 275 LYS A CD    1 
ATOM   2198 C  CE    . LYS A 1 287 ? -50.99500 -35.46200 -39.71300 1.000 58.50000  ? 275 LYS A CE    1 
ATOM   2199 N  NZ    . LYS A 1 287 ? -50.44100 -35.54400 -41.09700 1.000 62.21000  ? 275 LYS A NZ    1 
ATOM   2200 N  N     . VAL A 1 288 ? -46.49100 -30.66100 -39.23900 1.000 45.77000  ? 276 VAL A N     1 
ATOM   2201 C  CA    . VAL A 1 288 ? -45.70900 -29.79000 -40.09500 1.000 45.34000  ? 276 VAL A CA    1 
ATOM   2202 C  C     . VAL A 1 288 ? -44.51100 -30.49200 -40.70700 1.000 49.12000  ? 276 VAL A C     1 
ATOM   2203 O  O     . VAL A 1 288 ? -43.58400 -29.83400 -41.16000 1.000 56.02000  ? 276 VAL A O     1 
ATOM   2204 C  CB    . VAL A 1 288 ? -45.22000 -28.52000 -39.33400 1.000 48.13000  ? 276 VAL A CB    1 
ATOM   2205 C  CG1   . VAL A 1 288 ? -46.40400 -27.77400 -38.72000 1.000 48.75000  ? 276 VAL A CG1   1 
ATOM   2206 C  CG2   . VAL A 1 288 ? -44.17600 -28.85000 -38.27500 1.000 48.58000  ? 276 VAL A CG2   1 
ATOM   2207 N  N     . ARG A 1 289 ? -44.53700 -31.81900 -40.75500 1.000 50.94000  ? 277 ARG A N     1 
ATOM   2208 C  CA    . ARG A 1 289 ? -43.40400 -32.57200 -41.30700 1.000 61.36000  ? 277 ARG A CA    1 
ATOM   2209 C  C     . ARG A 1 289 ? -43.18800 -32.30400 -42.78600 1.000 60.09000  ? 277 ARG A C     1 
ATOM   2210 O  O     . ARG A 1 289 ? -42.08200 -31.98000 -43.20700 1.000 63.18000  ? 277 ARG A O     1 
ATOM   2211 C  CB    . ARG A 1 289 ? -43.58300 -34.08400 -41.11000 1.000 59.09000  ? 277 ARG A CB    1 
ATOM   2212 C  CG    . ARG A 1 289 ? -42.47200 -34.95300 -41.73300 1.000 55.98000  ? 277 ARG A CG    1 
ATOM   2213 C  CD    . ARG A 1 289 ? -41.08200 -34.56300 -41.22000 1.000 65.52000  ? 277 ARG A CD    1 
ATOM   2214 N  NE    . ARG A 1 289 ? -41.07400 -34.39000 -39.76800 1.000 64.65000  ? 277 ARG A NE    1 
ATOM   2215 C  CZ    . ARG A 1 289 ? -40.96400 -35.39400 -38.90600 1.000 63.38000  ? 277 ARG A CZ    1 
ATOM   2216 N  NH1   . ARG A 1 289 ? -40.83800 -36.63800 -39.35900 1.000 70.15000  ? 277 ARG A NH1   1 
ATOM   2217 N  NH2   . ARG A 1 289 ? -40.98200 -35.15800 -37.60000 1.000 56.52000  ? 277 ARG A NH2   1 
ATOM   2218 N  N     . GLN A 1 290 ? -44.25000 -32.46500 -43.56700 1.000 57.18000  ? 278 GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 290 ? -44.16400 -32.36200 -45.01800 1.000 63.99000  ? 278 GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 290 ? -43.88300 -30.92200 -45.45500 1.000 65.98000  ? 278 GLN A C     1 
ATOM   2221 O  O     . GLN A 1 290 ? -43.14200 -30.67300 -46.42600 1.000 61.62000  ? 278 GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 290 ? -45.45400 -32.88500 -45.65900 1.000 69.38000  ? 278 GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 290 ? -45.72900 -34.35200 -45.37300 1.000 59.70000  ? 278 GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 290 ? -44.53100 -35.22700 -45.66800 1.000 60.24000  ? 278 GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 290 ? -43.91400 -35.12100 -46.73200 1.000 59.48000  ? 278 GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 290 ? -44.18200 -36.09200 -44.71500 1.000 59.70000  ? 278 GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 291 ? -44.47200 -29.97600 -44.72700 1.000 63.62000  ? 279 LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 291 ? -44.16400 -28.57000 -44.93400 1.000 59.28000  ? 279 LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 291 ? -42.71500 -28.26200 -44.53900 1.000 62.77000  ? 279 LEU A C     1 
ATOM   2230 O  O     . LEU A 1 291 ? -41.99100 -27.59100 -45.28400 1.000 62.38000  ? 279 LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 291 ? -45.14100 -27.70200 -44.15400 1.000 52.37000  ? 279 LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 291 ? -46.56300 -27.89600 -44.67600 1.000 59.41000  ? 279 LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 291 ? -47.62200 -27.44400 -43.67000 1.000 58.90000  ? 279 LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 291 ? -46.71600 -27.16900 -46.01000 1.000 57.19000  ? 279 LEU A CD2   1 
ATOM   2235 N  N     . SER A 1 292 ? -42.28200 -28.76200 -43.38400 1.000 58.22000  ? 280 SER A N     1 
ATOM   2236 C  CA    . SER A 1 292 ? -40.92800 -28.47000 -42.91400 1.000 57.26000  ? 280 SER A CA    1 
ATOM   2237 C  C     . SER A 1 292 ? -39.86800 -29.00200 -43.85500 1.000 58.63000  ? 280 SER A C     1 
ATOM   2238 O  O     . SER A 1 292 ? -38.84600 -28.35700 -44.07200 1.000 64.21000  ? 280 SER A O     1 
ATOM   2239 C  CB    . SER A 1 292 ? -40.69100 -29.03800 -41.51600 1.000 60.76000  ? 280 SER A CB    1 
ATOM   2240 O  OG    . SER A 1 292 ? -41.09500 -28.10500 -40.53000 1.000 62.15000  ? 280 SER A OG    1 
ATOM   2241 N  N     . LYS A 1 293 ? -40.11500 -30.17200 -44.42800 1.000 66.04000  ? 281 LYS A N     1 
ATOM   2242 C  CA    . LYS A 1 293 ? -39.12800 -30.78700 -45.30100 1.000 67.31000  ? 281 LYS A CA    1 
ATOM   2243 C  C     . LYS A 1 293 ? -38.86100 -29.96100 -46.56000 1.000 70.18000  ? 281 LYS A C     1 
ATOM   2244 O  O     . LYS A 1 293 ? -37.74000 -29.98700 -47.06300 1.000 74.62000  ? 281 LYS A O     1 
ATOM   2245 C  CB    . LYS A 1 293 ? -39.54400 -32.21100 -45.67200 1.000 68.15000  ? 281 LYS A CB    1 
ATOM   2246 C  CG    . LYS A 1 293 ? -38.91200 -33.25000 -44.74900 1.000 78.86000  ? 281 LYS A CG    1 
ATOM   2247 C  CD    . LYS A 1 293 ? -38.99800 -34.66000 -45.31700 1.000 88.89000  ? 281 LYS A CD    1 
ATOM   2248 C  CE    . LYS A 1 293 ? -38.86300 -34.67400 -46.83900 1.000 85.00000  ? 281 LYS A CE    1 
ATOM   2249 N  NZ    . LYS A 1 293 ? -37.96400 -35.76500 -47.36000 1.000 80.38000  ? 281 LYS A NZ    1 
ATOM   2250 N  N     . LEU A 1 294 ? -39.85800 -29.21800 -47.05200 1.000 65.15000  ? 282 LEU A N     1 
ATOM   2251 C  CA    . LEU A 1 294 ? -39.64800 -28.32600 -48.20200 1.000 62.53000  ? 282 LEU A CA    1 
ATOM   2252 C  C     . LEU A 1 294 ? -38.50700 -27.33600 -47.97100 1.000 63.21000  ? 282 LEU A C     1 
ATOM   2253 O  O     . LEU A 1 294 ? -37.82500 -26.92800 -48.90900 1.000 64.84000  ? 282 LEU A O     1 
ATOM   2254 C  CB    . LEU A 1 294 ? -40.91900 -27.54500 -48.53200 1.000 55.33000  ? 282 LEU A CB    1 
ATOM   2255 C  CG    . LEU A 1 294 ? -42.13100 -28.40000 -48.84000 1.000 60.20000  ? 282 LEU A CG    1 
ATOM   2256 C  CD1   . LEU A 1 294 ? -43.24300 -27.51900 -49.32500 1.000 60.90000  ? 282 LEU A CD1   1 
ATOM   2257 C  CD2   . LEU A 1 294 ? -41.76900 -29.43700 -49.87900 1.000 70.12000  ? 282 LEU A CD2   1 
ATOM   2258 N  N     . LEU A 1 295 ? -38.30600 -26.94900 -46.71800 1.000 64.68000  ? 283 LEU A N     1 
ATOM   2259 C  CA    . LEU A 1 295 ? -37.26500 -25.99800 -46.37600 1.000 59.86000  ? 283 LEU A CA    1 
ATOM   2260 C  C     . LEU A 1 295 ? -35.88100 -26.58500 -46.56600 1.000 65.30000  ? 283 LEU A C     1 
ATOM   2261 O  O     . LEU A 1 295 ? -34.90200 -25.85000 -46.52100 1.000 74.04000  ? 283 LEU A O     1 
ATOM   2262 C  CB    . LEU A 1 295 ? -37.42400 -25.52600 -44.93300 1.000 55.25000  ? 283 LEU A CB    1 
ATOM   2263 C  CG    . LEU A 1 295 ? -38.62400 -24.61600 -44.68600 1.000 60.79000  ? 283 LEU A CG    1 
ATOM   2264 C  CD1   . LEU A 1 295 ? -38.89700 -24.47200 -43.19100 1.000 61.18000  ? 283 LEU A CD1   1 
ATOM   2265 C  CD2   . LEU A 1 295 ? -38.39400 -23.25700 -45.31900 1.000 62.00000  ? 283 LEU A CD2   1 
ATOM   2266 N  N     . ARG A 1 296 ? -35.79100 -27.89800 -46.77600 1.000 65.40000  ? 284 ARG A N     1 
ATOM   2267 C  CA    . ARG A 1 296 ? -34.48600 -28.56400 -46.79800 1.000 69.87000  ? 284 ARG A CA    1 
ATOM   2268 C  C     . ARG A 1 296 ? -33.63600 -28.19300 -48.00800 1.000 74.33000  ? 284 ARG A C     1 
ATOM   2269 O  O     . ARG A 1 296 ? -34.09900 -28.25700 -49.14600 1.000 74.96000  ? 284 ARG A O     1 
ATOM   2270 C  CB    . ARG A 1 296 ? -34.65000 -30.08300 -46.74200 1.000 71.74000  ? 284 ARG A CB    1 
ATOM   2271 C  CG    . ARG A 1 296 ? -35.20900 -30.59900 -45.42500 1.000 69.88000  ? 284 ARG A CG    1 
ATOM   2272 C  CD    . ARG A 1 296 ? -34.49100 -31.85700 -44.95900 1.000 78.85000  ? 284 ARG A CD    1 
ATOM   2273 N  NE    . ARG A 1 296 ? -35.25500 -32.55500 -43.92400 1.000 84.56000  ? 284 ARG A NE    1 
ATOM   2274 C  CZ    . ARG A 1 296 ? -35.35900 -33.87800 -43.83300 1.000 86.86000  ? 284 ARG A CZ    1 
ATOM   2275 N  NH1   . ARG A 1 296 ? -34.74600 -34.66100 -44.71900 1.000 95.65000  ? 284 ARG A NH1   1 
ATOM   2276 N  NH2   . ARG A 1 296 ? -36.08200 -34.41700 -42.86000 1.000 75.12000  ? 284 ARG A NH2   1 
ATOM   2277 N  N     . GLY A 1 297 ? -32.39200 -27.79600 -47.74100 1.000 78.08000  ? 285 GLY A N     1 
ATOM   2278 C  CA    . GLY A 1 297 ? -31.40900 -27.51400 -48.77700 1.000 76.35000  ? 285 GLY A CA    1 
ATOM   2279 C  C     . GLY A 1 297 ? -31.44900 -26.12900 -49.41100 1.000 76.47000  ? 285 GLY A C     1 
ATOM   2280 O  O     . GLY A 1 297 ? -30.46600 -25.70100 -50.01400 1.000 73.67000  ? 285 GLY A O     1 
ATOM   2281 N  N     . THR A 1 298 ? -32.57300 -25.43000 -49.27300 1.000 77.88000  ? 286 THR A N     1 
ATOM   2282 C  CA    . THR A 1 298 ? -32.80300 -24.17800 -49.99400 1.000 80.57000  ? 286 THR A CA    1 
ATOM   2283 C  C     . THR A 1 298 ? -31.68200 -23.16200 -49.75400 1.000 88.48000  ? 286 THR A C     1 
ATOM   2284 O  O     . THR A 1 298 ? -30.91600 -23.28800 -48.80000 1.000 90.21000  ? 286 THR A O     1 
ATOM   2285 C  CB    . THR A 1 298 ? -34.16500 -23.54700 -49.61300 1.000 79.57000  ? 286 THR A CB    1 
ATOM   2286 O  OG1   . THR A 1 298 ? -34.07300 -22.89600 -48.34100 1.000 85.61000  ? 286 THR A OG1   1 
ATOM   2287 C  CG2   . THR A 1 298 ? -35.26600 -24.60000 -49.58900 1.000 70.55000  ? 286 THR A CG2   1 
ATOM   2288 N  N     . LYS A 1 299 ? -31.57600 -22.16800 -50.63300 1.000 87.12000  ? 287 LYS A N     1 
ATOM   2289 C  CA    . LYS A 1 299 ? -30.43200 -21.26100 -50.60500 1.000 84.08000  ? 287 LYS A CA    1 
ATOM   2290 C  C     . LYS A 1 299 ? -30.78100 -19.96900 -49.86700 1.000 84.68000  ? 287 LYS A C     1 
ATOM   2291 O  O     . LYS A 1 299 ? -29.99800 -19.50400 -49.04200 1.000 84.48000  ? 287 LYS A O     1 
ATOM   2292 C  CB    . LYS A 1 299 ? -29.93700 -20.95100 -52.03500 1.000 90.89000  ? 287 LYS A CB    1 
ATOM   2293 C  CG    . LYS A 1 299 ? -29.94200 -22.14600 -53.03200 1.000 90.85000  ? 287 LYS A CG    1 
ATOM   2294 C  CD    . LYS A 1 299 ? -30.40000 -21.71700 -54.44900 1.000 85.70000  ? 287 LYS A CD    1 
ATOM   2295 C  CE    . LYS A 1 299 ? -30.80800 -22.91400 -55.32500 1.000 82.85000  ? 287 LYS A CE    1 
ATOM   2296 N  NZ    . LYS A 1 299 ? -31.76900 -22.55500 -56.42300 1.000 77.48000  ? 287 LYS A NZ    1 
ATOM   2297 N  N     . ALA A 1 300 ? -31.95200 -19.39900 -50.15900 1.000 85.95000  ? 288 ALA A N     1 
ATOM   2298 C  CA    . ALA A 1 300 ? -32.37400 -18.13600 -49.54400 1.000 80.28000  ? 288 ALA A CA    1 
ATOM   2299 C  C     . ALA A 1 300 ? -33.89800 -18.01800 -49.42700 1.000 79.11000  ? 288 ALA A C     1 
ATOM   2300 O  O     . ALA A 1 300 ? -34.64000 -18.86800 -49.92900 1.000 77.77000  ? 288 ALA A O     1 
ATOM   2301 C  CB    . ALA A 1 300 ? -31.81400 -16.95100 -50.32600 1.000 73.54000  ? 288 ALA A CB    1 
ATOM   2302 N  N     . LEU A 1 301 ? -34.34700 -16.95500 -48.75700 1.000 76.39000  ? 289 LEU A N     1 
ATOM   2303 C  CA    . LEU A 1 301 ? -35.76200 -16.75400 -48.45200 1.000 74.61000  ? 289 LEU A CA    1 
ATOM   2304 C  C     . LEU A 1 301 ? -36.57800 -16.49200 -49.70700 1.000 75.42000  ? 289 LEU A C     1 
ATOM   2305 O  O     . LEU A 1 301 ? -37.74200 -16.88100 -49.79600 1.000 70.79000  ? 289 LEU A O     1 
ATOM   2306 C  CB    . LEU A 1 301 ? -35.94300 -15.58800 -47.46700 1.000 75.00000  ? 289 LEU A CB    1 
ATOM   2307 C  CG    . LEU A 1 301 ? -36.27700 -15.89800 -46.00100 1.000 73.50000  ? 289 LEU A CG    1 
ATOM   2308 C  CD1   . LEU A 1 301 ? -35.22000 -16.80000 -45.34500 1.000 65.58000  ? 289 LEU A CD1   1 
ATOM   2309 C  CD2   . LEU A 1 301 ? -36.43800 -14.60300 -45.22700 1.000 71.14000  ? 289 LEU A CD2   1 
ATOM   2310 N  N     . THR A 1 302 ? -35.95400 -15.82300 -50.67000 1.000 81.91000  ? 290 THR A N     1 
ATOM   2311 C  CA    . THR A 1 302 ? -36.62800 -15.42200 -51.89900 1.000 80.02000  ? 290 THR A CA    1 
ATOM   2312 C  C     . THR A 1 302 ? -37.20700 -16.62700 -52.61700 1.000 77.86000  ? 290 THR A C     1 
ATOM   2313 O  O     . THR A 1 302 ? -38.32600 -16.58400 -53.13100 1.000 78.35000  ? 290 THR A O     1 
ATOM   2314 C  CB    . THR A 1 302 ? -35.66200 -14.66000 -52.83400 1.000 87.23000  ? 290 THR A CB    1 
ATOM   2315 O  OG1   . THR A 1 302 ? -35.72600 -13.26000 -52.53500 1.000 92.69000  ? 290 THR A OG1   1 
ATOM   2316 C  CG2   . THR A 1 302 ? -36.01700 -14.87400 -54.30600 1.000 87.50000  ? 290 THR A CG2   1 
ATOM   2317 N  N     . GLU A 1 303 ? -36.43800 -17.70900 -52.60000 1.000 83.22000  ? 291 GLU A N     1 
ATOM   2318 C  CA    . GLU A 1 303 ? -36.75100 -18.94500 -53.31000 1.000 78.99000  ? 291 GLU A CA    1 
ATOM   2319 C  C     . GLU A 1 303 ? -38.18900 -19.40500 -53.33000 1.000 73.54000  ? 291 GLU A C     1 
ATOM   2320 O  O     . GLU A 1 303 ? -38.87400 -19.35600 -52.32400 1.000 81.73000  ? 291 GLU A O     1 
ATOM   2321 C  CB    . GLU A 1 303 ? -35.94100 -20.06200 -52.71600 1.000 79.16000  ? 291 GLU A CB    1 
ATOM   2322 C  CG    . GLU A 1 303 ? -35.10700 -20.71900 -53.72600 1.000 79.25000  ? 291 GLU A CG    1 
ATOM   2323 C  CD    . GLU A 1 303 ? -34.02500 -21.45400 -53.06500 1.000 87.86000  ? 291 GLU A CD    1 
ATOM   2324 O  OE1   . GLU A 1 303 ? -34.33300 -22.45100 -52.39400 1.000 98.35000  ? 291 GLU A OE1   1 
ATOM   2325 O  OE2   . GLU A 1 303 ? -32.87600 -21.02300 -53.19700 1.000 91.38000  ? 291 GLU A OE2   1 
ATOM   2326 N  N     . VAL A 1 304 ? -38.63300 -19.88600 -54.47800 1.000 71.15000  ? 292 VAL A N     1 
ATOM   2327 C  CA    . VAL A 1 304 ? -39.94700 -20.48500 -54.55000 1.000 73.19000  ? 292 VAL A CA    1 
ATOM   2328 C  C     . VAL A 1 304 ? -39.77500 -21.98900 -54.52800 1.000 75.07000  ? 292 VAL A C     1 
ATOM   2329 O  O     . VAL A 1 304 ? -38.85400 -22.52400 -55.14300 1.000 67.70000  ? 292 VAL A O     1 
ATOM   2330 C  CB    . VAL A 1 304 ? -40.71000 -20.02900 -55.79900 1.000 71.10000  ? 292 VAL A CB    1 
ATOM   2331 C  CG1   . VAL A 1 304 ? -42.04800 -20.75400 -55.92700 1.000 62.83000  ? 292 VAL A CG1   1 
ATOM   2332 C  CG2   . VAL A 1 304 ? -40.92200 -18.53200 -55.73100 1.000 69.62000  ? 292 VAL A CG2   1 
ATOM   2333 N  N     . ILE A 1 305 ? -40.63900 -22.65700 -53.76800 1.000 81.93000  ? 293 ILE A N     1 
ATOM   2334 C  CA    . ILE A 1 305 ? -40.67700 -24.11100 -53.72600 1.000 73.80000  ? 293 ILE A CA    1 
ATOM   2335 C  C     . ILE A 1 305 ? -42.08000 -24.56200 -54.10000 1.000 80.63000  ? 293 ILE A C     1 
ATOM   2336 O  O     . ILE A 1 305 ? -43.07200 -23.92100 -53.73000 1.000 78.56000  ? 293 ILE A O     1 
ATOM   2337 C  CB    . ILE A 1 305 ? -40.28800 -24.67300 -52.33400 1.000 76.25000  ? 293 ILE A CB    1 
ATOM   2338 C  CG1   . ILE A 1 305 ? -38.81800 -24.40400 -52.03500 1.000 78.12000  ? 293 ILE A CG1   1 
ATOM   2339 C  CG2   . ILE A 1 305 ? -40.52800 -26.17600 -52.24800 1.000 79.60000  ? 293 ILE A CG2   1 
ATOM   2340 C  CD1   . ILE A 1 305 ? -38.57100 -23.07400 -51.40200 1.000 74.21000  ? 293 ILE A CD1   1 
ATOM   2341 N  N     . PRO A 1 306 ? -42.16000 -25.64400 -54.88500 1.000 84.46000  ? 294 PRO A N     1 
ATOM   2342 C  CA    . PRO A 1 306 ? -43.41900 -26.31600 -55.23200 1.000 81.47000  ? 294 PRO A CA    1 
ATOM   2343 C  C     . PRO A 1 306 ? -43.90600 -27.27600 -54.14100 1.000 75.95000  ? 294 PRO A C     1 
ATOM   2344 O  O     . PRO A 1 306 ? -43.20600 -28.22700 -53.78600 1.000 70.97000  ? 294 PRO A O     1 
ATOM   2345 C  CB    . PRO A 1 306 ? -43.06400 -27.08200 -56.52100 1.000 82.11000  ? 294 PRO A CB    1 
ATOM   2346 C  CG    . PRO A 1 306 ? -41.76800 -26.46500 -57.00700 1.000 78.64000  ? 294 PRO A CG    1 
ATOM   2347 C  CD    . PRO A 1 306 ? -41.05300 -26.06300 -55.76000 1.000 71.87000  ? 294 PRO A CD    1 
ATOM   2348 N  N     . LEU A 1 307 ? -45.09800 -27.02200 -53.61600 1.000 73.42000  ? 295 LEU A N     1 
ATOM   2349 C  CA    . LEU A 1 307 ? -45.67200 -27.90100 -52.61500 1.000 74.72000  ? 295 LEU A CA    1 
ATOM   2350 C  C     . LEU A 1 307 ? -45.72000 -29.31600 -53.14200 1.000 74.26000  ? 295 LEU A C     1 
ATOM   2351 O  O     . LEU A 1 307 ? -46.37400 -29.58400 -54.14400 1.000 83.01000  ? 295 LEU A O     1 
ATOM   2352 C  CB    . LEU A 1 307 ? -47.08000 -27.45700 -52.22000 1.000 72.45000  ? 295 LEU A CB    1 
ATOM   2353 C  CG    . LEU A 1 307 ? -47.21300 -26.14800 -51.44700 1.000 70.37000  ? 295 LEU A CG    1 
ATOM   2354 C  CD1   . LEU A 1 307 ? -48.56300 -26.06600 -50.75700 1.000 73.55000  ? 295 LEU A CD1   1 
ATOM   2355 C  CD2   . LEU A 1 307 ? -46.09700 -26.01700 -50.44700 1.000 72.95000  ? 295 LEU A CD2   1 
ATOM   2356 N  N     . THR A 1 308 ? -45.02100 -30.22200 -52.47100 1.000 76.98000  ? 296 THR A N     1 
ATOM   2357 C  CA    . THR A 1 308 ? -45.15300 -31.63400 -52.78800 1.000 74.50000  ? 296 THR A CA    1 
ATOM   2358 C  C     . THR A 1 308 ? -46.60600 -32.03100 -52.53000 1.000 78.11000  ? 296 THR A C     1 
ATOM   2359 O  O     . THR A 1 308 ? -47.35400 -31.29300 -51.88000 1.000 76.91000  ? 296 THR A O     1 
ATOM   2360 C  CB    . THR A 1 308 ? -44.16300 -32.51000 -51.97100 1.000 73.44000  ? 296 THR A CB    1 
ATOM   2361 O  OG1   . THR A 1 308 ? -44.43800 -32.40200 -50.57000 1.000 75.73000  ? 296 THR A OG1   1 
ATOM   2362 C  CG2   . THR A 1 308 ? -42.72100 -32.06400 -52.23000 1.000 61.46000  ? 296 THR A CG2   1 
ATOM   2363 N  N     . GLU A 1 309 ? -47.01300 -33.17500 -53.06600 1.000 82.94000  ? 297 GLU A N     1 
ATOM   2364 C  CA    . GLU A 1 309 ? -48.41100 -33.57600 -53.02800 1.000 76.78000  ? 297 GLU A CA    1 
ATOM   2365 C  C     . GLU A 1 309 ? -48.82100 -33.97800 -51.62500 1.000 77.15000  ? 297 GLU A C     1 
ATOM   2366 O  O     . GLU A 1 309 ? -49.99000 -33.89900 -51.25200 1.000 81.25000  ? 297 GLU A O     1 
ATOM   2367 C  CB    . GLU A 1 309 ? -48.65500 -34.72200 -54.00200 1.000 83.05000  ? 297 GLU A CB    1 
ATOM   2368 C  CG    . GLU A 1 309 ? -50.12100 -35.03200 -54.22600 1.000 95.47000  ? 297 GLU A CG    1 
ATOM   2369 C  CD    . GLU A 1 309 ? -50.45600 -35.20400 -55.69100 1.000 97.90000  ? 297 GLU A CD    1 
ATOM   2370 O  OE1   . GLU A 1 309 ? -50.44200 -34.18900 -56.42100 1.000 97.41000  ? 297 GLU A OE1   1 
ATOM   2371 O  OE2   . GLU A 1 309 ? -50.73200 -36.35000 -56.11500 1.000 96.82000  ? 297 GLU A OE2   1 
ATOM   2372 N  N     . GLU A 1 310 ? -47.83600 -34.41400 -50.85300 1.000 80.84000  ? 298 GLU A N     1 
ATOM   2373 C  CA    . GLU A 1 310 ? -48.02300 -34.76100 -49.45100 1.000 77.63000  ? 298 GLU A CA    1 
ATOM   2374 C  C     . GLU A 1 310 ? -48.02800 -33.48200 -48.60500 1.000 76.24000  ? 298 GLU A C     1 
ATOM   2375 O  O     . GLU A 1 310 ? -48.77900 -33.36700 -47.63200 1.000 71.30000  ? 298 GLU A O     1 
ATOM   2376 C  CB    . GLU A 1 310 ? -46.91800 -35.72200 -48.99100 1.000 76.82000  ? 298 GLU A CB    1 
ATOM   2377 C  CG    . GLU A 1 310 ? -46.71000 -36.93700 -49.90900 1.000 85.75000  ? 298 GLU A CG    1 
ATOM   2378 C  CD    . GLU A 1 310 ? -45.87500 -36.62900 -51.16700 1.000 96.64000  ? 298 GLU A CD    1 
ATOM   2379 O  OE1   . GLU A 1 310 ? -45.68900 -35.43400 -51.51200 1.000 88.60000  ? 298 GLU A OE1   1 
ATOM   2380 O  OE2   . GLU A 1 310 ? -45.40700 -37.59500 -51.81500 1.000 94.20000  ? 298 GLU A OE2   1 
ATOM   2381 N  N     . ALA A 1 311 ? -47.19100 -32.52200 -48.99400 1.000 70.09000  ? 299 ALA A N     1 
ATOM   2382 C  CA    . ALA A 1 311 ? -47.16500 -31.21300 -48.35400 1.000 69.18000  ? 299 ALA A CA    1 
ATOM   2383 C  C     . ALA A 1 311 ? -48.49100 -30.46900 -48.52100 1.000 71.73000  ? 299 ALA A C     1 
ATOM   2384 O  O     . ALA A 1 311 ? -49.06700 -29.99900 -47.53700 1.000 64.88000  ? 299 ALA A O     1 
ATOM   2385 C  CB    . ALA A 1 311 ? -46.01500 -30.37300 -48.90100 1.000 70.10000  ? 299 ALA A CB    1 
ATOM   2386 N  N     . GLU A 1 312 ? -48.97500 -30.35700 -49.75900 1.000 77.89000  ? 300 GLU A N     1 
ATOM   2387 C  CA    . GLU A 1 312 ? -50.22000 -29.63200 -50.01900 1.000 76.97000  ? 300 GLU A CA    1 
ATOM   2388 C  C     . GLU A 1 312 ? -51.39600 -30.34900 -49.35800 1.000 68.68000  ? 300 GLU A C     1 
ATOM   2389 O  O     . GLU A 1 312 ? -52.39700 -29.72200 -48.99700 1.000 61.77000  ? 300 GLU A O     1 
ATOM   2390 C  CB    . GLU A 1 312 ? -50.46200 -29.46700 -51.52800 1.000 82.76000  ? 300 GLU A CB    1 
ATOM   2391 C  CG    . GLU A 1 312 ? -50.82900 -30.75300 -52.27600 1.000 86.32000  ? 300 GLU A CG    1 
ATOM   2392 C  CD    . GLU A 1 312 ? -51.69800 -30.49900 -53.50900 1.000 95.99000  ? 300 GLU A CD    1 
ATOM   2393 O  OE1   . GLU A 1 312 ? -51.17400 -29.96700 -54.51300 1.000 98.05000  ? 300 GLU A OE1   1 
ATOM   2394 O  OE2   . GLU A 1 312 ? -52.90600 -30.82800 -53.47000 1.000 97.26000  ? 300 GLU A OE2   1 
ATOM   2395 N  N     . LEU A 1 313 ? -51.24500 -31.66400 -49.19500 1.000 68.79000  ? 301 LEU A N     1 
ATOM   2396 C  CA    . LEU A 1 313 ? -52.23700 -32.51100 -48.54300 1.000 63.55000  ? 301 LEU A CA    1 
ATOM   2397 C  C     . LEU A 1 313 ? -52.27500 -32.22700 -47.04700 1.000 64.84000  ? 301 LEU A C     1 
ATOM   2398 O  O     . LEU A 1 313 ? -53.34800 -32.02000 -46.46400 1.000 61.78000  ? 301 LEU A O     1 
ATOM   2399 C  CB    . LEU A 1 313 ? -51.92100 -33.98500 -48.79600 1.000 65.17000  ? 301 LEU A CB    1 
ATOM   2400 C  CG    . LEU A 1 313 ? -52.90600 -35.05300 -48.31300 1.000 73.08000  ? 301 LEU A CG    1 
ATOM   2401 C  CD1   . LEU A 1 313 ? -54.14000 -35.11200 -49.20200 1.000 70.24000  ? 301 LEU A CD1   1 
ATOM   2402 C  CD2   . LEU A 1 313 ? -52.22500 -36.40900 -48.26000 1.000 68.20000  ? 301 LEU A CD2   1 
ATOM   2403 N  N     . GLU A 1 314 ? -51.08600 -32.21800 -46.44500 1.000 67.04000  ? 302 GLU A N     1 
ATOM   2404 C  CA    . GLU A 1 314 ? -50.88800 -31.89200 -45.02500 1.000 68.11000  ? 302 GLU A CA    1 
ATOM   2405 C  C     . GLU A 1 314 ? -51.43300 -30.50900 -44.67400 1.000 57.64000  ? 302 GLU A C     1 
ATOM   2406 O  O     . GLU A 1 314 ? -52.17800 -30.34100 -43.70700 1.000 49.78000  ? 302 GLU A O     1 
ATOM   2407 C  CB    . GLU A 1 314 ? -49.39300 -31.97500 -44.67500 1.000 64.17000  ? 302 GLU A CB    1 
ATOM   2408 C  CG    . GLU A 1 314 ? -49.04700 -31.73700 -43.20500 1.000 57.81000  ? 302 GLU A CG    1 
ATOM   2409 C  CD    . GLU A 1 314 ? -47.56100 -31.89300 -42.92300 1.000 62.75000  ? 302 GLU A CD    1 
ATOM   2410 O  OE1   . GLU A 1 314 ? -46.79700 -30.95100 -43.24200 1.000 64.50000  ? 302 GLU A OE1   1 
ATOM   2411 O  OE2   . GLU A 1 314 ? -47.15800 -32.95900 -42.39500 1.000 65.42000  ? 302 GLU A OE2   1 
ATOM   2412 N  N     . LEU A 1 315 ? -51.04700 -29.53000 -45.48300 1.000 59.37000  ? 303 LEU A N     1 
ATOM   2413 C  CA    . LEU A 1 315 ? -51.53900 -28.16800 -45.36800 1.000 57.87000  ? 303 LEU A CA    1 
ATOM   2414 C  C     . LEU A 1 315 ? -53.05300 -28.11600 -45.26100 1.000 60.94000  ? 303 LEU A C     1 
ATOM   2415 O  O     . LEU A 1 315 ? -53.61500 -27.37200 -44.45000 1.000 60.20000  ? 303 LEU A O     1 
ATOM   2416 C  CB    . LEU A 1 315 ? -51.08700 -27.35500 -46.57100 1.000 58.05000  ? 303 LEU A CB    1 
ATOM   2417 C  CG    . LEU A 1 315 ? -51.74800 -25.99000 -46.67900 1.000 63.47000  ? 303 LEU A CG    1 
ATOM   2418 C  CD1   . LEU A 1 315 ? -50.84000 -24.95900 -46.06200 1.000 60.60000  ? 303 LEU A CD1   1 
ATOM   2419 C  CD2   . LEU A 1 315 ? -52.06900 -25.64800 -48.13200 1.000 75.03000  ? 303 LEU A CD2   1 
ATOM   2420 N  N     . ALA A 1 316 ? -53.70800 -28.92000 -46.09000 1.000 67.10000  ? 304 ALA A N     1 
ATOM   2421 C  CA    . ALA A 1 316 ? -55.15900 -28.95400 -46.14200 1.000 58.46000  ? 304 ALA A CA    1 
ATOM   2422 C  C     . ALA A 1 316 ? -55.75100 -29.49800 -44.84600 1.000 62.99000  ? 304 ALA A C     1 
ATOM   2423 O  O     . ALA A 1 316 ? -56.78700 -29.00400 -44.38500 1.000 64.90000  ? 304 ALA A O     1 
ATOM   2424 C  CB    . ALA A 1 316 ? -55.61800 -29.77900 -47.31400 1.000 55.56000  ? 304 ALA A CB    1 
ATOM   2425 N  N     . GLU A 1 317 ? -55.10500 -30.50800 -44.25600 1.000 61.01000  ? 305 GLU A N     1 
ATOM   2426 C  CA    . GLU A 1 317 ? -55.65400 -31.12600 -43.04200 1.000 64.12000  ? 305 GLU A CA    1 
ATOM   2427 C  C     . GLU A 1 317 ? -55.61400 -30.12600 -41.90100 1.000 57.62000  ? 305 GLU A C     1 
ATOM   2428 O  O     . GLU A 1 317 ? -56.61700 -29.92400 -41.21500 1.000 56.97000  ? 305 GLU A O     1 
ATOM   2429 C  CB    . GLU A 1 317 ? -54.89900 -32.40300 -42.65700 1.000 68.09000  ? 305 GLU A CB    1 
ATOM   2430 C  CG    . GLU A 1 317 ? -54.38800 -33.22900 -43.83900 1.000 73.86000  ? 305 GLU A CG    1 
ATOM   2431 C  CD    . GLU A 1 317 ? -53.64200 -34.49600 -43.40400 1.000 82.31000  ? 305 GLU A CD    1 
ATOM   2432 O  OE1   . GLU A 1 317 ? -53.56200 -34.76000 -42.18000 1.000 77.11000  ? 305 GLU A OE1   1 
ATOM   2433 O  OE2   . GLU A 1 317 ? -53.13200 -35.22400 -44.29000 1.000 82.18000  ? 305 GLU A OE2   1 
ATOM   2434 N  N     . ASN A 1 318 ? -54.44400 -29.50800 -41.72200 1.000 58.81000  ? 306 ASN A N     1 
ATOM   2435 C  CA    . ASN A 1 318 ? -54.25600 -28.38600 -40.79500 1.000 58.23000  ? 306 ASN A CA    1 
ATOM   2436 C  C     . ASN A 1 318 ? -55.31600 -27.29100 -40.98600 1.000 56.44000  ? 306 ASN A C     1 
ATOM   2437 O  O     . ASN A 1 318 ? -55.92200 -26.82200 -40.01200 1.000 50.88000  ? 306 ASN A O     1 
ATOM   2438 C  CB    . ASN A 1 318 ? -52.85300 -27.77500 -40.96200 1.000 52.42000  ? 306 ASN A CB    1 
ATOM   2439 C  CG    . ASN A 1 318 ? -51.75000 -28.70200 -40.50300 1.000 45.58000  ? 306 ASN A CG    1 
ATOM   2440 O  OD1   . ASN A 1 318 ? -51.86000 -29.34200 -39.46400 1.000 43.21000  ? 306 ASN A OD1   1 
ATOM   2441 N  ND2   . ASN A 1 318 ? -50.67300 -28.77500 -41.28100 1.000 45.11000  ? 306 ASN A ND2   1 
ATOM   2442 N  N     . ARG A 1 319 ? -55.52400 -26.88800 -42.24300 1.000 53.82000  ? 307 ARG A N     1 
ATOM   2443 C  CA    . ARG A 1 319 ? -56.57900 -25.93700 -42.58700 1.000 54.23000  ? 307 ARG A CA    1 
ATOM   2444 C  C     . ARG A 1 319 ? -57.93400 -26.36500 -42.04100 1.000 56.84000  ? 307 ARG A C     1 
ATOM   2445 O  O     . ARG A 1 319 ? -58.71200 -25.54100 -41.56500 1.000 53.80000  ? 307 ARG A O     1 
ATOM   2446 C  CB    . ARG A 1 319 ? -56.67800 -25.76800 -44.09400 1.000 55.01000  ? 307 ARG A CB    1 
ATOM   2447 C  CG    . ARG A 1 319 ? -55.56700 -24.97200 -44.68300 1.000 56.82000  ? 307 ARG A CG    1 
ATOM   2448 C  CD    . ARG A 1 319 ? -56.02400 -24.29400 -45.94400 1.000 60.45000  ? 307 ARG A CD    1 
ATOM   2449 N  NE    . ARG A 1 319 ? -55.71300 -22.87100 -45.89700 1.000 74.75000  ? 307 ARG A NE    1 
ATOM   2450 C  CZ    . ARG A 1 319 ? -54.64400 -22.32400 -46.46700 1.000 72.62000  ? 307 ARG A CZ    1 
ATOM   2451 N  NH1   . ARG A 1 319 ? -53.79000 -23.08200 -47.14600 1.000 59.31000  ? 307 ARG A NH1   1 
ATOM   2452 N  NH2   . ARG A 1 319 ? -54.43800 -21.01900 -46.36400 1.000 74.24000  ? 307 ARG A NH2   1 
ATOM   2453 N  N     . GLU A 1 320 ? -58.21600 -27.66100 -42.10800 1.000 60.36000  ? 308 GLU A N     1 
ATOM   2454 C  CA    . GLU A 1 320 ? -59.49300 -28.15200 -41.62700 1.000 57.77000  ? 308 GLU A CA    1 
ATOM   2455 C  C     . GLU A 1 320 ? -59.53800 -28.07400 -40.11700 1.000 57.82000  ? 308 GLU A C     1 
ATOM   2456 O  O     . GLU A 1 320 ? -60.53800 -27.63900 -39.54800 1.000 55.84000  ? 308 GLU A O     1 
ATOM   2457 C  CB    . GLU A 1 320 ? -59.75000 -29.57700 -42.10700 1.000 57.72000  ? 308 GLU A CB    1 
ATOM   2458 C  CG    . GLU A 1 320 ? -60.28600 -29.63800 -43.53300 1.000 68.86000  ? 308 GLU A CG    1 
ATOM   2459 C  CD    . GLU A 1 320 ? -61.24600 -28.48400 -43.85200 1.000 78.92000  ? 308 GLU A CD    1 
ATOM   2460 O  OE1   . GLU A 1 320 ? -62.28000 -28.34100 -43.15100 1.000 75.98000  ? 308 GLU A OE1   1 
ATOM   2461 O  OE2   . GLU A 1 320 ? -60.95400 -27.71100 -44.79900 1.000 74.63000  ? 308 GLU A OE2   1 
ATOM   2462 N  N     . ILE A 1 321 ? -58.43800 -28.47800 -39.48200 1.000 60.83000  ? 309 ILE A N     1 
ATOM   2463 C  CA    . ILE A 1 321 ? -58.28500 -28.41200 -38.03000 1.000 56.77000  ? 309 ILE A CA    1 
ATOM   2464 C  C     . ILE A 1 321 ? -58.54500 -27.00200 -37.49300 1.000 53.72000  ? 309 ILE A C     1 
ATOM   2465 O  O     . ILE A 1 321 ? -59.29800 -26.82500 -36.53900 1.000 54.01000  ? 309 ILE A O     1 
ATOM   2466 C  CB    . ILE A 1 321 ? -56.87400 -28.88100 -37.60500 1.000 53.07000  ? 309 ILE A CB    1 
ATOM   2467 C  CG1   . ILE A 1 321 ? -56.63600 -30.30800 -38.09300 1.000 44.46000  ? 309 ILE A CG1   1 
ATOM   2468 C  CG2   . ILE A 1 321 ? -56.69600 -28.80200 -36.09000 1.000 49.33000  ? 309 ILE A CG2   1 
ATOM   2469 C  CD1   . ILE A 1 321 ? -55.38000 -30.92900 -37.57000 1.000 42.16000  ? 309 ILE A CD1   1 
ATOM   2470 N  N     . LEU A 1 322 ? -57.95400 -25.99900 -38.12700 1.000 52.96000  ? 310 LEU A N     1 
ATOM   2471 C  CA    . LEU A 1 322 ? -58.09300 -24.62200 -37.65100 1.000 56.41000  ? 310 LEU A CA    1 
ATOM   2472 C  C     . LEU A 1 322 ? -59.50100 -24.02700 -37.80900 1.000 56.05000  ? 310 LEU A C     1 
ATOM   2473 O  O     . LEU A 1 322 ? -59.85500 -23.07600 -37.10000 1.000 56.23000  ? 310 LEU A O     1 
ATOM   2474 C  CB    . LEU A 1 322 ? -57.07000 -23.72600 -38.35900 1.000 57.46000  ? 310 LEU A CB    1 
ATOM   2475 C  CG    . LEU A 1 322 ? -55.61900 -23.85000 -37.86300 1.000 50.13000  ? 310 LEU A CG    1 
ATOM   2476 C  CD1   . LEU A 1 322 ? -54.74100 -22.79300 -38.47600 1.000 50.59000  ? 310 LEU A CD1   1 
ATOM   2477 C  CD2   . LEU A 1 322 ? -55.57400 -23.73100 -36.35200 1.000 48.74000  ? 310 LEU A CD2   1 
ATOM   2478 N  N     . LYS A 1 323 ? -60.30700 -24.58300 -38.71500 1.000 53.31000  ? 311 LYS A N     1 
ATOM   2479 C  CA    . LYS A 1 323 ? -61.68600 -24.11100 -38.88700 1.000 55.48000  ? 311 LYS A CA    1 
ATOM   2480 C  C     . LYS A 1 323 ? -62.57300 -24.38700 -37.66900 1.000 56.78000  ? 311 LYS A C     1 
ATOM   2481 O  O     . LYS A 1 323 ? -63.61600 -23.76900 -37.51200 1.000 55.44000  ? 311 LYS A O     1 
ATOM   2482 C  CB    . LYS A 1 323 ? -62.33900 -24.74800 -40.11600 1.000 56.14000  ? 311 LYS A CB    1 
ATOM   2483 C  CG    . LYS A 1 323 ? -61.77300 -24.31700 -41.45500 1.000 59.92000  ? 311 LYS A CG    1 
ATOM   2484 C  CD    . LYS A 1 323 ? -62.49800 -25.03700 -42.59400 1.000 69.69000  ? 311 LYS A CD    1 
ATOM   2485 C  CE    . LYS A 1 323 ? -61.94500 -24.64500 -43.96900 1.000 74.38000  ? 311 LYS A CE    1 
ATOM   2486 N  NZ    . LYS A 1 323 ? -62.47600 -25.51300 -45.07700 1.000 66.77000  ? 311 LYS A NZ    1 
ATOM   2487 N  N     . GLU A 1 324 ? -62.16900 -25.32900 -36.82200 1.000 61.01000  ? 312 GLU A N     1 
ATOM   2488 C  CA    . GLU A 1 324 ? -62.99700 -25.75300 -35.69500 1.000 57.90000  ? 312 GLU A CA    1 
ATOM   2489 C  C     . GLU A 1 324 ? -62.84800 -24.80800 -34.51200 1.000 61.10000  ? 312 GLU A C     1 
ATOM   2490 O  O     . GLU A 1 324 ? -61.86800 -24.06200 -34.42400 1.000 58.68000  ? 312 GLU A O     1 
ATOM   2491 C  CB    . GLU A 1 324 ? -62.63800 -27.18400 -35.28100 1.000 65.41000  ? 312 GLU A CB    1 
ATOM   2492 C  CG    . GLU A 1 324 ? -63.64400 -28.23900 -35.74900 1.000 70.36000  ? 312 GLU A CG    1 
ATOM   2493 C  CD    . GLU A 1 324 ? -63.62600 -28.47300 -37.25700 1.000 76.13000  ? 312 GLU A CD    1 
ATOM   2494 O  OE1   . GLU A 1 324 ? -62.73500 -27.92700 -37.94800 1.000 66.06000  ? 312 GLU A OE1   1 
ATOM   2495 O  OE2   . GLU A 1 324 ? -64.50400 -29.21700 -37.75200 1.000 84.24000  ? 312 GLU A OE2   1 
ATOM   2496 N  N     . PRO A 1 325 ? -63.83900 -24.81400 -33.60800 1.000 60.55000  ? 313 PRO A N     1 
ATOM   2497 C  CA    . PRO A 1 325 ? -63.81900 -23.94700 -32.42800 1.000 59.27000  ? 313 PRO A CA    1 
ATOM   2498 C  C     . PRO A 1 325 ? -63.19000 -24.61900 -31.21800 1.000 55.50000  ? 313 PRO A C     1 
ATOM   2499 O  O     . PRO A 1 325 ? -63.64500 -25.68000 -30.77300 1.000 53.94000  ? 313 PRO A O     1 
ATOM   2500 C  CB    . PRO A 1 325 ? -65.29900 -23.67100 -32.18000 1.000 54.84000  ? 313 PRO A CB    1 
ATOM   2501 C  CG    . PRO A 1 325 ? -65.95700 -24.93700 -32.59900 1.000 60.58000  ? 313 PRO A CG    1 
ATOM   2502 C  CD    . PRO A 1 325 ? -65.14900 -25.46400 -33.77500 1.000 59.42000  ? 313 PRO A CD    1 
ATOM   2503 N  N     . VAL A 1 326 ? -62.15800 -23.99200 -30.66900 1.000 51.78000  ? 314 VAL A N     1 
ATOM   2504 C  CA    . VAL A 1 326 ? -61.45500 -24.60900 -29.56500 1.000 43.34000  ? 314 VAL A CA    1 
ATOM   2505 C  C     . VAL A 1 326 ? -61.06800 -23.61400 -28.45000 1.000 39.64000  ? 314 VAL A C     1 
ATOM   2506 O  O     . VAL A 1 326 ? -60.80500 -22.43700 -28.68800 1.000 42.81000  ? 314 VAL A O     1 
ATOM   2507 C  CB    . VAL A 1 326 ? -60.22400 -25.35600 -30.10700 1.000 43.85000  ? 314 VAL A CB    1 
ATOM   2508 C  CG1   . VAL A 1 326 ? -59.15600 -24.38100 -30.61700 1.000 39.94000  ? 314 VAL A CG1   1 
ATOM   2509 C  CG2   . VAL A 1 326 ? -59.69200 -26.31300 -29.06100 1.000 49.27000  ? 314 VAL A CG2   1 
ATOM   2510 N  N     . HIS A 1 327 ? -61.09500 -24.08900 -27.21500 1.000 35.42000  ? 315 HIS A N     1 
ATOM   2511 C  CA    . HIS A 1 327 ? -60.68500 -23.28200 -26.09700 1.000 32.98000  ? 315 HIS A CA    1 
ATOM   2512 C  C     . HIS A 1 327 ? -59.84400 -24.14100 -25.17000 1.000 40.18000  ? 315 HIS A C     1 
ATOM   2513 O  O     . HIS A 1 327 ? -59.68600 -25.34000 -25.41600 1.000 36.84000  ? 315 HIS A O     1 
ATOM   2514 C  CB    . HIS A 1 327 ? -61.88800 -22.71400 -25.37400 1.000 33.43000  ? 315 HIS A CB    1 
ATOM   2515 C  CG    . HIS A 1 327 ? -62.77000 -23.75400 -24.74600 1.000 42.48000  ? 315 HIS A CG    1 
ATOM   2516 N  ND1   . HIS A 1 327 ? -62.61300 -24.17100 -23.44100 1.000 43.24000  ? 315 HIS A ND1   1 
ATOM   2517 C  CD2   . HIS A 1 327 ? -63.83500 -24.43400 -25.23500 1.000 40.05000  ? 315 HIS A CD2   1 
ATOM   2518 C  CE1   . HIS A 1 327 ? -63.54100 -25.07100 -23.15300 1.000 39.38000  ? 315 HIS A CE1   1 
ATOM   2519 N  NE2   . HIS A 1 327 ? -64.29400 -25.24600 -24.22300 1.000 38.79000  ? 315 HIS A NE2   1 
ATOM   2520 N  N     . GLY A 1 328 ? -59.28900 -23.53100 -24.12300 1.000 36.83000  ? 316 GLY A N     1 
ATOM   2521 C  CA    . GLY A 1 328 ? -58.52700 -24.27400 -23.12700 1.000 30.75000  ? 316 GLY A CA    1 
ATOM   2522 C  C     . GLY A 1 328 ? -59.04400 -23.86200 -21.77200 1.000 31.29000  ? 316 GLY A C     1 
ATOM   2523 O  O     . GLY A 1 328 ? -59.75600 -22.85900 -21.67900 1.000 36.36000  ? 316 GLY A O     1 
ATOM   2524 N  N     . VAL A 1 329 ? -58.70300 -24.60600 -20.72500 1.000 28.18000  ? 317 VAL A N     1 
ATOM   2525 C  CA    . VAL A 1 329 ? -59.17800 -24.24700 -19.38700 1.000 29.63000  ? 317 VAL A CA    1 
ATOM   2526 C  C     . VAL A 1 329 ? -58.03600 -23.80600 -18.46300 1.000 30.21000  ? 317 VAL A C     1 
ATOM   2527 O  O     . VAL A 1 329 ? -56.87700 -23.74500 -18.87100 1.000 32.58000  ? 317 VAL A O     1 
ATOM   2528 C  CB    . VAL A 1 329 ? -59.94600 -25.41900 -18.74400 1.000 29.58000  ? 317 VAL A CB    1 
ATOM   2529 C  CG1   . VAL A 1 329 ? -61.10900 -25.81600 -19.64700 1.000 25.81000  ? 317 VAL A CG1   1 
ATOM   2530 C  CG2   . VAL A 1 329 ? -59.02600 -26.58300 -18.51500 1.000 25.03000  ? 317 VAL A CG2   1 
ATOM   2531 N  N     . TYR A 1 330 ? -58.35800 -23.47600 -17.22100 1.000 30.29000  ? 318 TYR A N     1 
ATOM   2532 C  CA    . TYR A 1 330 ? -57.33000 -23.02300 -16.30000 1.000 25.63000  ? 318 TYR A CA    1 
ATOM   2533 C  C     . TYR A 1 330 ? -56.90800 -24.15800 -15.41000 1.000 30.43000  ? 318 TYR A C     1 
ATOM   2534 O  O     . TYR A 1 330 ? -57.46900 -25.23600 -15.48800 1.000 33.61000  ? 318 TYR A O     1 
ATOM   2535 C  CB    . TYR A 1 330 ? -57.82300 -21.84400 -15.48300 1.000 24.52000  ? 318 TYR A CB    1 
ATOM   2536 C  CG    . TYR A 1 330 ? -58.18100 -20.67100 -16.36600 1.000 33.70000  ? 318 TYR A CG    1 
ATOM   2537 C  CD1   . TYR A 1 330 ? -57.21200 -20.04900 -17.15900 1.000 34.55000  ? 318 TYR A CD1   1 
ATOM   2538 C  CD2   . TYR A 1 330 ? -59.47800 -20.18700 -16.42400 1.000 32.64000  ? 318 TYR A CD2   1 
ATOM   2539 C  CE1   . TYR A 1 330 ? -57.53600 -18.96700 -17.98400 1.000 36.00000  ? 318 TYR A CE1   1 
ATOM   2540 C  CE2   . TYR A 1 330 ? -59.81000 -19.10400 -17.24300 1.000 37.37000  ? 318 TYR A CE2   1 
ATOM   2541 C  CZ    . TYR A 1 330 ? -58.83800 -18.50200 -18.01700 1.000 42.05000  ? 318 TYR A CZ    1 
ATOM   2542 O  OH    . TYR A 1 330 ? -59.16900 -17.43400 -18.82300 1.000 45.62000  ? 318 TYR A OH    1 
ATOM   2543 N  N     . TYR A 1 331 ? -55.90700 -23.92100 -14.57300 1.000 33.15000  ? 319 TYR A N     1 
ATOM   2544 C  CA    . TYR A 1 331 ? -55.29000 -24.98900 -13.81200 1.000 26.44000  ? 319 TYR A CA    1 
ATOM   2545 C  C     . TYR A 1 331 ? -55.82300 -25.04000 -12.39700 1.000 31.67000  ? 319 TYR A C     1 
ATOM   2546 O  O     . TYR A 1 331 ? -55.91500 -24.02300 -11.71700 1.000 34.22000  ? 319 TYR A O     1 
ATOM   2547 C  CB    . TYR A 1 331 ? -53.78200 -24.80200 -13.81800 1.000 29.83000  ? 319 TYR A CB    1 
ATOM   2548 C  CG    . TYR A 1 331 ? -53.00900 -25.75200 -12.94900 1.000 27.55000  ? 319 TYR A CG    1 
ATOM   2549 C  CD1   . TYR A 1 331 ? -53.11800 -27.13300 -13.10500 1.000 27.85000  ? 319 TYR A CD1   1 
ATOM   2550 C  CD2   . TYR A 1 331 ? -52.14300 -25.26500 -11.98800 1.000 25.96000  ? 319 TYR A CD2   1 
ATOM   2551 C  CE1   . TYR A 1 331 ? -52.37700 -28.01700 -12.29200 1.000 29.22000  ? 319 TYR A CE1   1 
ATOM   2552 C  CE2   . TYR A 1 331 ? -51.41600 -26.11400 -11.18200 1.000 34.99000  ? 319 TYR A CE2   1 
ATOM   2553 C  CZ    . TYR A 1 331 ? -51.52600 -27.49000 -11.32600 1.000 35.20000  ? 319 TYR A CZ    1 
ATOM   2554 O  OH    . TYR A 1 331 ? -50.77000 -28.29000 -10.49000 1.000 29.16000  ? 319 TYR A OH    1 
ATOM   2555 N  N     . ASP A 1 332 ? -56.18300 -26.24900 -11.97800 1.000 37.61000  ? 320 ASP A N     1 
ATOM   2556 C  CA    . ASP A 1 332 ? -56.64000 -26.54900 -10.62300 1.000 33.96000  ? 320 ASP A CA    1 
ATOM   2557 C  C     . ASP A 1 332 ? -55.61400 -27.45000 -9.92600  1.000 37.21000  ? 320 ASP A C     1 
ATOM   2558 O  O     . ASP A 1 332 ? -55.46400 -28.62100 -10.29400 1.000 35.05000  ? 320 ASP A O     1 
ATOM   2559 C  CB    . ASP A 1 332 ? -58.01000 -27.22500 -10.68900 1.000 32.94000  ? 320 ASP A CB    1 
ATOM   2560 C  CG    . ASP A 1 332 ? -58.56600 -27.57400 -9.33500  1.000 41.28000  ? 320 ASP A CG    1 
ATOM   2561 O  OD1   . ASP A 1 332 ? -57.93600 -27.23900 -8.30700  1.000 42.12000  ? 320 ASP A OD1   1 
ATOM   2562 O  OD2   . ASP A 1 332 ? -59.65200 -28.19200 -9.30600  1.000 48.37000  ? 320 ASP A OD2   1 
ATOM   2563 N  N     . PRO A 1 333 ? -54.89500 -26.91000 -8.92600  1.000 34.04000  ? 321 PRO A N     1 
ATOM   2564 C  CA    . PRO A 1 333 ? -53.79000 -27.66500 -8.31900  1.000 36.96000  ? 321 PRO A CA    1 
ATOM   2565 C  C     . PRO A 1 333 ? -54.26700 -28.83400 -7.45900  1.000 43.46000  ? 321 PRO A C     1 
ATOM   2566 O  O     . PRO A 1 333 ? -53.46400 -29.68800 -7.09000  1.000 47.64000  ? 321 PRO A O     1 
ATOM   2567 C  CB    . PRO A 1 333 ? -53.07600 -26.62600 -7.44600  1.000 31.44000  ? 321 PRO A CB    1 
ATOM   2568 C  CG    . PRO A 1 333 ? -53.65600 -25.31100 -7.80000  1.000 31.89000  ? 321 PRO A CG    1 
ATOM   2569 C  CD    . PRO A 1 333 ? -55.03200 -25.57500 -8.33300  1.000 35.83000  ? 321 PRO A CD    1 
ATOM   2570 N  N     . SER A 1 334 ? -55.55500 -28.87000 -7.13500  1.000 42.66000  ? 322 SER A N     1 
ATOM   2571 C  CA    . SER A 1 334 ? -56.09300 -29.95300 -6.31700  1.000 42.27000  ? 322 SER A CA    1 
ATOM   2572 C  C     . SER A 1 334 ? -56.41100 -31.21400 -7.12800  1.000 43.74000  ? 322 SER A C     1 
ATOM   2573 O  O     . SER A 1 334 ? -56.83100 -32.22600 -6.56000  1.000 51.35000  ? 322 SER A O     1 
ATOM   2574 C  CB    . SER A 1 334 ? -57.35000 -29.47600 -5.59500  1.000 43.71000  ? 322 SER A CB    1 
ATOM   2575 O  OG    . SER A 1 334 ? -58.30800 -29.00700 -6.53500  1.000 45.47000  ? 322 SER A OG    1 
ATOM   2576 N  N     . LYS A 1 335 ? -56.22800 -31.14100 -8.45000  1.000 46.83000  ? 323 LYS A N     1 
ATOM   2577 C  CA    . LYS A 1 335 ? -56.46300 -32.27200 -9.36100  1.000 41.07000  ? 323 LYS A CA    1 
ATOM   2578 C  C     . LYS A 1 335 ? -55.14400 -32.75500 -9.94500  1.000 39.88000  ? 323 LYS A C     1 
ATOM   2579 O  O     . LYS A 1 335 ? -54.10100 -32.16000 -9.71500  1.000 48.53000  ? 323 LYS A O     1 
ATOM   2580 C  CB    . LYS A 1 335 ? -57.40700 -31.89000 -10.50300 1.000 34.87000  ? 323 LYS A CB    1 
ATOM   2581 C  CG    . LYS A 1 335 ? -58.64300 -31.14200 -10.07600 1.000 40.12000  ? 323 LYS A CG    1 
ATOM   2582 C  CD    . LYS A 1 335 ? -59.63400 -32.07400 -9.41100  1.000 52.05000  ? 323 LYS A CD    1 
ATOM   2583 C  CE    . LYS A 1 335 ? -60.89700 -31.32800 -8.96000  1.000 53.61000  ? 323 LYS A CE    1 
ATOM   2584 N  NZ    . LYS A 1 335 ? -60.79600 -30.90000 -7.52100  1.000 48.32000  ? 323 LYS A NZ    1 
ATOM   2585 N  N     . ASP A 1 336 ? -55.18900 -33.83000 -10.71500 1.000 42.14000  ? 324 ASP A N     1 
ATOM   2586 C  CA    . ASP A 1 336 ? -53.97500 -34.35700 -11.32000 1.000 44.07000  ? 324 ASP A CA    1 
ATOM   2587 C  C     . ASP A 1 336 ? -53.69400 -33.69800 -12.66700 1.000 43.11000  ? 324 ASP A C     1 
ATOM   2588 O  O     . ASP A 1 336 ? -54.60800 -33.23700 -13.35200 1.000 44.89000  ? 324 ASP A O     1 
ATOM   2589 C  CB    . ASP A 1 336 ? -54.09000 -35.87600 -11.49300 1.000 50.23000  ? 324 ASP A CB    1 
ATOM   2590 C  CG    . ASP A 1 336 ? -53.51100 -36.64900 -10.31400 1.000 54.13000  ? 324 ASP A CG    1 
ATOM   2591 O  OD1   . ASP A 1 336 ? -52.32700 -36.42200 -9.97600  1.000 57.78000  ? 324 ASP A OD1   1 
ATOM   2592 O  OD2   . ASP A 1 336 ? -54.23800 -37.47600 -9.72600  1.000 56.02000  ? 324 ASP A OD2   1 
ATOM   2593 N  N     . LEU A 1 337 ? -52.42900 -33.64200 -13.04700 1.000 43.44000  ? 325 LEU A N     1 
ATOM   2594 C  CA    . LEU A 1 337 ? -52.08900 -33.29700 -14.42000 1.000 37.33000  ? 325 LEU A CA    1 
ATOM   2595 C  C     . LEU A 1 337 ? -51.97400 -34.55200 -15.26300 1.000 34.24000  ? 325 LEU A C     1 
ATOM   2596 O  O     . LEU A 1 337 ? -51.12100 -35.39800 -15.02700 1.000 33.74000  ? 325 LEU A O     1 
ATOM   2597 C  CB    . LEU A 1 337 ? -50.77700 -32.53600 -14.48600 1.000 33.39000  ? 325 LEU A CB    1 
ATOM   2598 C  CG    . LEU A 1 337 ? -50.86800 -31.03900 -14.37700 1.000 35.08000  ? 325 LEU A CG    1 
ATOM   2599 C  CD1   . LEU A 1 337 ? -49.46000 -30.51700 -14.36800 1.000 37.52000  ? 325 LEU A CD1   1 
ATOM   2600 C  CD2   . LEU A 1 337 ? -51.63400 -30.51400 -15.56600 1.000 33.73000  ? 325 LEU A CD2   1 
ATOM   2601 N  N     . ILE A 1 338 ? -52.81900 -34.66000 -16.26700 1.000 34.45000  ? 326 ILE A N     1 
ATOM   2602 C  CA    . ILE A 1 338 ? -52.74400 -35.78800 -17.17200 1.000 36.74000  ? 326 ILE A CA    1 
ATOM   2603 C  C     . ILE A 1 338 ? -52.28100 -35.34100 -18.55200 1.000 36.65000  ? 326 ILE A C     1 
ATOM   2604 O  O     . ILE A 1 338 ? -52.81600 -34.38500 -19.12900 1.000 36.80000  ? 326 ILE A O     1 
ATOM   2605 C  CB    . ILE A 1 338 ? -54.10500 -36.48300 -17.29600 1.000 38.41000  ? 326 ILE A CB    1 
ATOM   2606 C  CG1   . ILE A 1 338 ? -54.61200 -36.92300 -15.92300 1.000 31.73000  ? 326 ILE A CG1   1 
ATOM   2607 C  CG2   . ILE A 1 338 ? -54.02500 -37.65300 -18.24800 1.000 36.01000  ? 326 ILE A CG2   1 
ATOM   2608 C  CD1   . ILE A 1 338 ? -56.08600 -37.16500 -15.93600 1.000 35.04000  ? 326 ILE A CD1   1 
ATOM   2609 N  N     . ALA A 1 339 ? -51.28200 -36.03500 -19.08000 1.000 33.72000  ? 327 ALA A N     1 
ATOM   2610 C  CA    . ALA A 1 339 ? -50.87100 -35.83500 -20.45900 1.000 30.72000  ? 327 ALA A CA    1 
ATOM   2611 C  C     . ALA A 1 339 ? -51.16400 -37.11000 -21.23400 1.000 33.84000  ? 327 ALA A C     1 
ATOM   2612 O  O     . ALA A 1 339 ? -50.86500 -38.19900 -20.74400 1.000 38.75000  ? 327 ALA A O     1 
ATOM   2613 C  CB    . ALA A 1 339 ? -49.40200 -35.48800 -20.52100 1.000 28.40000  ? 327 ALA A CB    1 
ATOM   2614 N  N     . GLU A 1 340 ? -51.77900 -37.00100 -22.41000 1.000 28.12000  ? 328 GLU A N     1 
ATOM   2615 C  CA    . GLU A 1 340 ? -51.88900 -38.17000 -23.27500 1.000 32.36000  ? 328 GLU A CA    1 
ATOM   2616 C  C     . GLU A 1 340 ? -51.31400 -37.88000 -24.65500 1.000 34.74000  ? 328 GLU A C     1 
ATOM   2617 O  O     . GLU A 1 340 ? -51.40000 -36.76800 -25.14900 1.000 36.37000  ? 328 GLU A O     1 
ATOM   2618 C  CB    . GLU A 1 340 ? -53.34300 -38.66400 -23.37200 1.000 39.29000  ? 328 GLU A CB    1 
ATOM   2619 C  CG    . GLU A 1 340 ? -54.25500 -37.90300 -24.30600 1.000 49.62000  ? 328 GLU A CG    1 
ATOM   2620 C  CD    . GLU A 1 340 ? -55.72800 -38.30200 -24.14500 1.000 65.93000  ? 328 GLU A CD    1 
ATOM   2621 O  OE1   . GLU A 1 340 ? -56.00900 -39.36200 -23.50400 1.000 53.55000  ? 328 GLU A OE1   1 
ATOM   2622 O  OE2   . GLU A 1 340 ? -56.59200 -37.53500 -24.65700 1.000 60.12000  ? 328 GLU A OE2   1 
ATOM   2623 N  N     . ILE A 1 341 ? -50.69800 -38.89100 -25.25500 1.000 34.40000  ? 329 ILE A N     1 
ATOM   2624 C  CA    . ILE A 1 341 ? -49.95400 -38.73700 -26.49400 1.000 33.26000  ? 329 ILE A CA    1 
ATOM   2625 C  C     . ILE A 1 341 ? -50.57900 -39.59600 -27.59700 1.000 37.98000  ? 329 ILE A C     1 
ATOM   2626 O  O     . ILE A 1 341 ? -51.06400 -40.70300 -27.33300 1.000 43.17000  ? 329 ILE A O     1 
ATOM   2627 C  CB    . ILE A 1 341 ? -48.47700 -39.13800 -26.27900 1.000 29.82000  ? 329 ILE A CB    1 
ATOM   2628 C  CG1   . ILE A 1 341 ? -47.89700 -38.36800 -25.10300 1.000 33.63000  ? 329 ILE A CG1   1 
ATOM   2629 C  CG2   . ILE A 1 341 ? -47.62700 -38.87000 -27.50100 1.000 27.95000  ? 329 ILE A CG2   1 
ATOM   2630 C  CD1   . ILE A 1 341 ? -46.39500 -38.57900 -24.91800 1.000 39.44000  ? 329 ILE A CD1   1 
ATOM   2631 N  N     . GLN A 1 342 ? -50.58000 -39.09000 -28.82500 1.000 33.30000  ? 330 GLN A N     1 
ATOM   2632 C  CA    . GLN A 1 342 ? -51.03200 -39.87400 -29.96600 1.000 36.52000  ? 330 GLN A CA    1 
ATOM   2633 C  C     . GLN A 1 342 ? -49.94900 -39.96500 -31.02500 1.000 34.63000  ? 330 GLN A C     1 
ATOM   2634 O  O     . GLN A 1 342 ? -49.29200 -38.97000 -31.31300 1.000 35.30000  ? 330 GLN A O     1 
ATOM   2635 C  CB    . GLN A 1 342 ? -52.30100 -39.26500 -30.56600 1.000 40.61000  ? 330 GLN A CB    1 
ATOM   2636 C  CG    . GLN A 1 342 ? -53.53600 -39.48400 -29.70800 1.000 47.45000  ? 330 GLN A CG    1 
ATOM   2637 C  CD    . GLN A 1 342 ? -53.89400 -38.27300 -28.84200 1.000 58.46000  ? 330 GLN A CD    1 
ATOM   2638 O  OE1   . GLN A 1 342 ? -53.45100 -37.14000 -29.09800 1.000 57.94000  ? 330 GLN A OE1   1 
ATOM   2639 N  NE2   . GLN A 1 342 ? -54.70700 -38.50900 -27.80900 1.000 57.26000  ? 330 GLN A NE2   1 
ATOM   2640 N  N     . LYS A 1 343 ? -49.76600 -41.15100 -31.60600 1.000 37.53000  ? 331 LYS A N     1 
ATOM   2641 C  CA    . LYS A 1 343 ? -48.80200 -41.31900 -32.69900 1.000 34.49000  ? 331 LYS A CA    1 
ATOM   2642 C  C     . LYS A 1 343 ? -49.40400 -40.79700 -33.98600 1.000 36.05000  ? 331 LYS A C     1 
ATOM   2643 O  O     . LYS A 1 343 ? -50.50000 -41.19200 -34.34500 1.000 44.49000  ? 331 LYS A O     1 
ATOM   2644 C  CB    . LYS A 1 343 ? -48.40100 -42.78400 -32.85800 1.000 38.59000  ? 331 LYS A CB    1 
ATOM   2645 C  CG    . LYS A 1 343 ? -47.43800 -43.06000 -34.02000 1.000 38.54000  ? 331 LYS A CG    1 
ATOM   2646 C  CD    . LYS A 1 343 ? -46.69900 -44.37200 -33.77200 1.000 37.03000  ? 331 LYS A CD    1 
ATOM   2647 C  CE    . LYS A 1 343 ? -46.46900 -45.17100 -35.04100 1.000 51.46000  ? 331 LYS A CE    1 
ATOM   2648 N  NZ    . LYS A 1 343 ? -45.67300 -44.46700 -36.09600 1.000 58.37000  ? 331 LYS A NZ    1 
ATOM   2649 N  N     . GLN A 1 344 ? -48.70100 -39.89300 -34.66300 1.000 40.63000  ? 332 GLN A N     1 
ATOM   2650 C  CA    . GLN A 1 344 ? -49.20500 -39.26300 -35.88700 1.000 42.47000  ? 332 GLN A CA    1 
ATOM   2651 C  C     . GLN A 1 344 ? -48.46200 -39.79800 -37.10800 1.000 47.98000  ? 332 GLN A C     1 
ATOM   2652 O  O     . GLN A 1 344 ? -48.66500 -39.33100 -38.22700 1.000 50.84000  ? 332 GLN A O     1 
ATOM   2653 C  CB    . GLN A 1 344 ? -49.04800 -37.73000 -35.83300 1.000 48.28000  ? 332 GLN A CB    1 
ATOM   2654 C  CG    . GLN A 1 344 ? -49.95800 -36.97900 -34.85700 1.000 42.93000  ? 332 GLN A CG    1 
ATOM   2655 C  CD    . GLN A 1 344 ? -51.40800 -36.94500 -35.31800 1.000 55.93000  ? 332 GLN A CD    1 
ATOM   2656 O  OE1   . GLN A 1 344 ? -51.70300 -37.13700 -36.50700 1.000 65.70000  ? 332 GLN A OE1   1 
ATOM   2657 N  NE2   . GLN A 1 344 ? -52.32500 -36.71200 -34.37900 1.000 46.33000  ? 332 GLN A NE2   1 
ATOM   2658 N  N     . GLY A 1 345 ? -47.56200 -40.74700 -36.88200 1.000 51.96000  ? 333 GLY A N     1 
ATOM   2659 C  CA    . GLY A 1 345 ? -46.76700 -41.30500 -37.95800 1.000 47.85000  ? 333 GLY A CA    1 
ATOM   2660 C  C     . GLY A 1 345 ? -45.63600 -40.41600 -38.44300 1.000 52.16000  ? 333 GLY A C     1 
ATOM   2661 O  O     . GLY A 1 345 ? -45.74300 -39.19400 -38.42100 1.000 54.91000  ? 333 GLY A O     1 
ATOM   2662 N  N     . GLN A 1 346 ? -44.54900 -41.05300 -38.88100 1.000 58.94000  ? 334 GLN A N     1 
ATOM   2663 C  CA    . GLN A 1 346 ? -43.38700 -40.37900 -39.46300 1.000 52.75000  ? 334 GLN A CA    1 
ATOM   2664 C  C     . GLN A 1 346 ? -42.61000 -39.53000 -38.45900 1.000 55.16000  ? 334 GLN A C     1 
ATOM   2665 O  O     . GLN A 1 346 ? -42.01600 -38.51900 -38.82300 1.000 58.83000  ? 334 GLN A O     1 
ATOM   2666 C  CB    . GLN A 1 346 ? -43.80000 -39.48900 -40.63500 1.000 60.28000  ? 334 GLN A CB    1 
ATOM   2667 C  CG    . GLN A 1 346 ? -44.75800 -40.11400 -41.62900 1.000 64.70000  ? 334 GLN A CG    1 
ATOM   2668 C  CD    . GLN A 1 346 ? -45.53900 -39.04600 -42.36600 1.000 71.64000  ? 334 GLN A CD    1 
ATOM   2669 O  OE1   . GLN A 1 346 ? -44.96000 -38.21700 -43.07900 1.000 75.36000  ? 334 GLN A OE1   1 
ATOM   2670 N  NE2   . GLN A 1 346 ? -46.85500 -39.02700 -42.16500 1.000 65.10000  ? 334 GLN A NE2   1 
ATOM   2671 N  N     . GLY A 1 347 ? -42.59900 -39.93400 -37.19800 1.000 53.62000  ? 335 GLY A N     1 
ATOM   2672 C  CA    . GLY A 1 347 ? -41.88800 -39.16300 -36.19500 1.000 48.65000  ? 335 GLY A CA    1 
ATOM   2673 C  C     . GLY A 1 347 ? -42.66800 -37.92200 -35.81500 1.000 45.49000  ? 335 GLY A C     1 
ATOM   2674 O  O     . GLY A 1 347 ? -42.08600 -36.90100 -35.45100 1.000 41.22000  ? 335 GLY A O     1 
ATOM   2675 N  N     . GLN A 1 348 ? -43.99100 -38.00900 -35.91500 1.000 43.17000  ? 336 GLN A N     1 
ATOM   2676 C  CA    . GLN A 1 348 ? -44.86400 -36.92100 -35.51000 1.000 36.66000  ? 336 GLN A CA    1 
ATOM   2677 C  C     . GLN A 1 348 ? -45.75100 -37.39300 -34.37600 1.000 38.99000  ? 336 GLN A C     1 
ATOM   2678 O  O     . GLN A 1 348 ? -46.22900 -38.53900 -34.39500 1.000 37.25000  ? 336 GLN A O     1 
ATOM   2679 C  CB    . GLN A 1 348 ? -45.70800 -36.43400 -36.68100 1.000 41.83000  ? 336 GLN A CB    1 
ATOM   2680 C  CG    . GLN A 1 348 ? -44.88400 -35.94300 -37.85000 1.000 47.42000  ? 336 GLN A CG    1 
ATOM   2681 C  CD    . GLN A 1 348 ? -45.71000 -35.16900 -38.84600 1.000 52.88000  ? 336 GLN A CD    1 
ATOM   2682 O  OE1   . GLN A 1 348 ? -45.70300 -33.93200 -38.85900 1.000 53.18000  ? 336 GLN A OE1   1 
ATOM   2683 N  NE2   . GLN A 1 348 ? -46.43400 -35.89000 -39.69300 1.000 59.15000  ? 336 GLN A NE2   1 
ATOM   2684 N  N     . TRP A 1 349 ? -45.94800 -36.51700 -33.38400 1.000 37.93000  ? 337 TRP A N     1 
ATOM   2685 C  CA    . TRP A 1 349 ? -46.73600 -36.81100 -32.17600 1.000 35.57000  ? 337 TRP A CA    1 
ATOM   2686 C  C     . TRP A 1 349 ? -47.57300 -35.61300 -31.73800 1.000 35.03000  ? 337 TRP A C     1 
ATOM   2687 O  O     . TRP A 1 349 ? -47.10800 -34.47800 -31.77400 1.000 35.34000  ? 337 TRP A O     1 
ATOM   2688 C  CB    . TRP A 1 349 ? -45.81100 -37.24100 -31.02700 1.000 33.22000  ? 337 TRP A CB    1 
ATOM   2689 C  CG    . TRP A 1 349 ? -44.87000 -38.32300 -31.43100 1.000 32.89000  ? 337 TRP A CG    1 
ATOM   2690 C  CD1   . TRP A 1 349 ? -43.73600 -38.18300 -32.16600 1.000 31.80000  ? 337 TRP A CD1   1 
ATOM   2691 C  CD2   . TRP A 1 349 ? -44.99800 -39.72100 -31.15500 1.000 28.16000  ? 337 TRP A CD2   1 
ATOM   2692 N  NE1   . TRP A 1 349 ? -43.15200 -39.40400 -32.37200 1.000 32.84000  ? 337 TRP A NE1   1 
ATOM   2693 C  CE2   . TRP A 1 349 ? -43.90200 -40.36200 -31.75500 1.000 31.83000  ? 337 TRP A CE2   1 
ATOM   2694 C  CE3   . TRP A 1 349 ? -45.93300 -40.48500 -30.45500 1.000 28.25000  ? 337 TRP A CE3   1 
ATOM   2695 C  CZ2   . TRP A 1 349 ? -43.71000 -41.73500 -31.67200 1.000 30.71000  ? 337 TRP A CZ2   1 
ATOM   2696 C  CZ3   . TRP A 1 349 ? -45.74100 -41.84600 -30.37200 1.000 28.56000  ? 337 TRP A CZ3   1 
ATOM   2697 C  CH2   . TRP A 1 349 ? -44.63900 -42.45900 -30.97400 1.000 33.12000  ? 337 TRP A CH2   1 
ATOM   2698 N  N     . THR A 1 350 ? -48.80800 -35.84100 -31.31700 1.000 33.04000  ? 338 THR A N     1 
ATOM   2699 C  CA    . THR A 1 350 ? -49.52200 -34.75600 -30.65600 1.000 34.43000  ? 338 THR A CA    1 
ATOM   2700 C  C     . THR A 1 350 ? -49.82400 -35.16300 -29.22600 1.000 40.58000  ? 338 THR A C     1 
ATOM   2701 O  O     . THR A 1 350 ? -49.84400 -36.35300 -28.88700 1.000 35.55000  ? 338 THR A O     1 
ATOM   2702 C  CB    . THR A 1 350 ? -50.82500 -34.37100 -31.35600 1.000 31.68000  ? 338 THR A CB    1 
ATOM   2703 O  OG1   . THR A 1 350 ? -51.56500 -35.55400 -31.63300 1.000 43.28000  ? 338 THR A OG1   1 
ATOM   2704 C  CG2   . THR A 1 350 ? -50.55500 -33.64500 -32.65200 1.000 39.00000  ? 338 THR A CG2   1 
ATOM   2705 N  N     . TYR A 1 351 ? -50.02300 -34.16900 -28.37100 1.000 40.53000  ? 339 TYR A N     1 
ATOM   2706 C  CA    . TYR A 1 351 ? -50.36400 -34.46500 -26.99300 1.000 35.15000  ? 339 TYR A CA    1 
ATOM   2707 C  C     . TYR A 1 351 ? -51.40400 -33.48600 -26.50000 1.000 34.24000  ? 339 TYR A C     1 
ATOM   2708 O  O     . TYR A 1 351 ? -51.56400 -32.39600 -27.04900 1.000 34.33000  ? 339 TYR A O     1 
ATOM   2709 C  CB    . TYR A 1 351 ? -49.12000 -34.45600 -26.08800 1.000 32.95000  ? 339 TYR A CB    1 
ATOM   2710 C  CG    . TYR A 1 351 ? -48.32600 -33.16600 -26.01500 1.000 30.54000  ? 339 TYR A CG    1 
ATOM   2711 C  CD1   . TYR A 1 351 ? -48.63900 -32.18200 -25.07300 1.000 33.16000  ? 339 TYR A CD1   1 
ATOM   2712 C  CD2   . TYR A 1 351 ? -47.22900 -32.94900 -26.85300 1.000 28.81000  ? 339 TYR A CD2   1 
ATOM   2713 C  CE1   . TYR A 1 351 ? -47.91000 -31.00200 -24.99100 1.000 23.88000  ? 339 TYR A CE1   1 
ATOM   2714 C  CE2   . TYR A 1 351 ? -46.48600 -31.77300 -26.77000 1.000 27.88000  ? 339 TYR A CE2   1 
ATOM   2715 C  CZ    . TYR A 1 351 ? -46.84000 -30.81100 -25.83300 1.000 27.96000  ? 339 TYR A CZ    1 
ATOM   2716 O  OH    . TYR A 1 351 ? -46.11500 -29.64700 -25.73400 1.000 38.57000  ? 339 TYR A OH    1 
ATOM   2717 N  N     . GLN A 1 352 ? -52.14200 -33.91600 -25.48800 1.000 30.71000  ? 340 GLN A N     1 
ATOM   2718 C  CA    . GLN A 1 352 ? -53.16800 -33.10600 -24.88000 1.000 33.01000  ? 340 GLN A CA    1 
ATOM   2719 C  C     . GLN A 1 352 ? -52.96800 -33.17200 -23.37200 1.000 36.88000  ? 340 GLN A C     1 
ATOM   2720 O  O     . GLN A 1 352 ? -52.86600 -34.25300 -22.79700 1.000 36.50000  ? 340 GLN A O     1 
ATOM   2721 C  CB    . GLN A 1 352 ? -54.54500 -33.60200 -25.29500 1.000 34.65000  ? 340 GLN A CB    1 
ATOM   2722 C  CG    . GLN A 1 352 ? -54.74200 -33.55200 -26.80300 1.000 42.73000  ? 340 GLN A CG    1 
ATOM   2723 C  CD    . GLN A 1 352 ? -55.63800 -34.65600 -27.32100 1.000 59.99000  ? 340 GLN A CD    1 
ATOM   2724 O  OE1   . GLN A 1 352 ? -55.65400 -35.77000 -26.78300 1.000 68.07000  ? 340 GLN A OE1   1 
ATOM   2725 N  NE2   . GLN A 1 352 ? -56.40600 -34.34900 -28.36500 1.000 60.36000  ? 340 GLN A NE2   1 
ATOM   2726 N  N     . ILE A 1 353 ? -52.86100 -32.01800 -22.72900 1.000 29.47000  ? 341 ILE A N     1 
ATOM   2727 C  CA    . ILE A 1 353 ? -52.70900 -32.01700 -21.28800 1.000 31.00000  ? 341 ILE A CA    1 
ATOM   2728 C  C     . ILE A 1 353 ? -54.01400 -31.55300 -20.66300 1.000 32.10000  ? 341 ILE A C     1 
ATOM   2729 O  O     . ILE A 1 353 ? -54.57500 -30.53100 -21.06600 1.000 35.48000  ? 341 ILE A O     1 
ATOM   2730 C  CB    . ILE A 1 353 ? -51.53900 -31.12400 -20.86500 1.000 31.01000  ? 341 ILE A CB    1 
ATOM   2731 C  CG1   . ILE A 1 353 ? -50.29800 -31.51700 -21.66100 1.000 27.09000  ? 341 ILE A CG1   1 
ATOM   2732 C  CG2   . ILE A 1 353 ? -51.28600 -31.24800 -19.39600 1.000 26.64000  ? 341 ILE A CG2   1 
ATOM   2733 C  CD1   . ILE A 1 353 ? -49.05100 -30.89800 -21.14300 1.000 30.51000  ? 341 ILE A CD1   1 
ATOM   2734 N  N     . TYR A 1 354 ? -54.51600 -32.31500 -19.70100 1.000 34.41000  ? 342 TYR A N     1 
ATOM   2735 C  CA    . TYR A 1 354 ? -55.81000 -32.01000 -19.09000 1.000 30.31000  ? 342 TYR A CA    1 
ATOM   2736 C  C     . TYR A 1 354 ? -55.86800 -32.49600 -17.66400 1.000 35.16000  ? 342 TYR A C     1 
ATOM   2737 O  O     . TYR A 1 354 ? -54.95800 -33.17800 -17.18600 1.000 34.62000  ? 342 TYR A O     1 
ATOM   2738 C  CB    . TYR A 1 354 ? -56.95000 -32.64500 -19.87200 1.000 35.31000  ? 342 TYR A CB    1 
ATOM   2739 C  CG    . TYR A 1 354 ? -56.87800 -34.16700 -20.00800 1.000 36.93000  ? 342 TYR A CG    1 
ATOM   2740 C  CD1   . TYR A 1 354 ? -57.40900 -35.01200 -19.03900 1.000 39.10000  ? 342 TYR A CD1   1 
ATOM   2741 C  CD2   . TYR A 1 354 ? -56.30800 -34.75400 -21.12900 1.000 39.38000  ? 342 TYR A CD2   1 
ATOM   2742 C  CE1   . TYR A 1 354 ? -57.34400 -36.41400 -19.18700 1.000 39.67000  ? 342 TYR A CE1   1 
ATOM   2743 C  CE2   . TYR A 1 354 ? -56.25200 -36.13200 -21.28500 1.000 35.70000  ? 342 TYR A CE2   1 
ATOM   2744 C  CZ    . TYR A 1 354 ? -56.76300 -36.95600 -20.31900 1.000 39.03000  ? 342 TYR A CZ    1 
ATOM   2745 O  OH    . TYR A 1 354 ? -56.67900 -38.32800 -20.49900 1.000 45.79000  ? 342 TYR A OH    1 
ATOM   2746 N  N     . GLN A 1 355 ? -56.95000 -32.16000 -16.98000 1.000 39.43000  ? 343 GLN A N     1 
ATOM   2747 C  CA    . GLN A 1 355 ? -57.13400 -32.65700 -15.62600 1.000 39.31000  ? 343 GLN A CA    1 
ATOM   2748 C  C     . GLN A 1 355 ? -58.44100 -33.40700 -15.53000 1.000 40.80000  ? 343 GLN A C     1 
ATOM   2749 O  O     . GLN A 1 355 ? -58.55700 -34.37100 -14.77700 1.000 44.48000  ? 343 GLN A O     1 
ATOM   2750 C  CB    . GLN A 1 355 ? -57.11300 -31.52000 -14.62200 1.000 36.61000  ? 343 GLN A CB    1 
ATOM   2751 C  CG    . GLN A 1 355 ? -55.95200 -30.57800 -14.77100 1.000 30.53000  ? 343 GLN A CG    1 
ATOM   2752 C  CD    . GLN A 1 355 ? -55.74300 -29.79800 -13.51100 1.000 32.62000  ? 343 GLN A CD    1 
ATOM   2753 O  OE1   . GLN A 1 355 ? -56.21500 -28.66100 -13.37800 1.000 29.43000  ? 343 GLN A OE1   1 
ATOM   2754 N  NE2   . GLN A 1 355 ? -55.06300 -30.41300 -12.54900 1.000 32.18000  ? 343 GLN A NE2   1 
ATOM   2755 N  N     . GLU A 1 356 ? -59.42100 -32.92600 -16.28600 1.000 41.96000  ? 344 GLU A N     1 
ATOM   2756 C  CA    . GLU A 1 356 ? -60.73800 -33.53300 -16.38400 1.000 41.75000  ? 344 GLU A CA    1 
ATOM   2757 C  C     . GLU A 1 356 ? -60.95700 -33.87400 -17.84600 1.000 43.29000  ? 344 GLU A C     1 
ATOM   2758 O  O     . GLU A 1 356 ? -60.55200 -33.09900 -18.71300 1.000 46.09000  ? 344 GLU A O     1 
ATOM   2759 C  CB    . GLU A 1 356 ? -61.82200 -32.58400 -15.86700 1.000 46.41000  ? 344 GLU A CB    1 
ATOM   2760 C  CG    . GLU A 1 356 ? -63.23500 -33.17200 -15.90600 1.000 63.01000  ? 344 GLU A CG    1 
ATOM   2761 C  CD    . GLU A 1 356 ? -64.30500 -32.25300 -15.33300 1.000 83.10000  ? 344 GLU A CD    1 
ATOM   2762 O  OE1   . GLU A 1 356 ? -63.99200 -31.08300 -14.97700 1.000 76.97000  ? 344 GLU A OE1   1 
ATOM   2763 O  OE2   . GLU A 1 356 ? -65.46700 -32.72000 -15.24200 1.000 83.81000  ? 344 GLU A OE2   1 
ATOM   2764 N  N     . PRO A 1 357 ? -61.57300 -35.03800 -18.13600 1.000 45.45000  ? 345 PRO A N     1 
ATOM   2765 C  CA    . PRO A 1 357 ? -61.65200 -35.49600 -19.52900 1.000 46.91000  ? 345 PRO A CA    1 
ATOM   2766 C  C     . PRO A 1 357 ? -62.27600 -34.48700 -20.50000 1.000 44.23000  ? 345 PRO A C     1 
ATOM   2767 O  O     . PRO A 1 357 ? -63.24200 -33.82600 -20.13500 1.000 45.29000  ? 345 PRO A O     1 
ATOM   2768 C  CB    . PRO A 1 357 ? -62.51600 -36.74600 -19.40900 1.000 45.02000  ? 345 PRO A CB    1 
ATOM   2769 C  CG    . PRO A 1 357 ? -62.13000 -37.28300 -18.07400 1.000 39.90000  ? 345 PRO A CG    1 
ATOM   2770 C  CD    . PRO A 1 357 ? -62.07700 -36.06800 -17.20800 1.000 37.09000  ? 345 PRO A CD    1 
ATOM   2771 N  N     . PHE A 1 358 ? -61.70300 -34.35300 -21.69600 1.000 43.23000  ? 346 PHE A N     1 
ATOM   2772 C  CA    . PHE A 1 358 ? -62.27400 -33.49800 -22.75100 1.000 47.86000  ? 346 PHE A CA    1 
ATOM   2773 C  C     . PHE A 1 358 ? -62.33600 -32.00900 -22.39500 1.000 47.74000  ? 346 PHE A C     1 
ATOM   2774 O  O     . PHE A 1 358 ? -63.10900 -31.23600 -22.99300 1.000 45.43000  ? 346 PHE A O     1 
ATOM   2775 C  CB    . PHE A 1 358 ? -63.67100 -34.00100 -23.13400 1.000 43.47000  ? 346 PHE A CB    1 
ATOM   2776 C  CG    . PHE A 1 358 ? -63.65800 -35.38200 -23.74800 1.000 47.57000  ? 346 PHE A CG    1 
ATOM   2777 C  CD1   . PHE A 1 358 ? -63.43000 -35.55000 -25.11000 1.000 45.23000  ? 346 PHE A CD1   1 
ATOM   2778 C  CD2   . PHE A 1 358 ? -63.84500 -36.50900 -22.96100 1.000 45.03000  ? 346 PHE A CD2   1 
ATOM   2779 C  CE1   . PHE A 1 358 ? -63.40500 -36.81200 -25.67600 1.000 45.63000  ? 346 PHE A CE1   1 
ATOM   2780 C  CE2   . PHE A 1 358 ? -63.82000 -37.78100 -23.52000 1.000 44.64000  ? 346 PHE A CE2   1 
ATOM   2781 C  CZ    . PHE A 1 358 ? -63.60000 -37.93000 -24.88100 1.000 44.82000  ? 346 PHE A CZ    1 
ATOM   2782 N  N     . LYS A 1 359 ? -61.50800 -31.62200 -21.42800 1.000 43.15000  ? 347 LYS A N     1 
ATOM   2783 C  CA    . LYS A 1 359 ? -61.26900 -30.23000 -21.08800 1.000 38.01000  ? 347 LYS A CA    1 
ATOM   2784 C  C     . LYS A 1 359 ? -59.75900 -29.98000 -21.06800 1.000 38.49000  ? 347 LYS A C     1 
ATOM   2785 O  O     . LYS A 1 359 ? -59.11400 -30.06300 -20.01400 1.000 37.05000  ? 347 LYS A O     1 
ATOM   2786 C  CB    . LYS A 1 359 ? -61.87700 -29.89400 -19.72800 1.000 38.13000  ? 347 LYS A CB    1 
ATOM   2787 C  CG    . LYS A 1 359 ? -63.37500 -29.89900 -19.67200 1.000 40.49000  ? 347 LYS A CG    1 
ATOM   2788 C  CD    . LYS A 1 359 ? -63.83700 -29.98600 -18.22800 1.000 53.29000  ? 347 LYS A CD    1 
ATOM   2789 C  CE    . LYS A 1 359 ? -65.28600 -29.54000 -18.05000 1.000 63.23000  ? 347 LYS A CE    1 
ATOM   2790 N  NZ    . LYS A 1 359 ? -65.73300 -29.68600 -16.63000 1.000 63.12000  ? 347 LYS A NZ    1 
ATOM   2791 N  N     . ASN A 1 360 ? -59.18500 -29.69500 -22.23000 1.000 36.16000  ? 348 ASN A N     1 
ATOM   2792 C  CA    . ASN A 1 360 ? -57.74800 -29.46800 -22.30100 1.000 30.92000  ? 348 ASN A CA    1 
ATOM   2793 C  C     . ASN A 1 360 ? -57.27100 -28.24200 -21.53400 1.000 32.89000  ? 348 ASN A C     1 
ATOM   2794 O  O     . ASN A 1 360 ? -57.87600 -27.16900 -21.60500 1.000 34.46000  ? 348 ASN A O     1 
ATOM   2795 C  CB    . ASN A 1 360 ? -57.30300 -29.32800 -23.74900 1.000 28.10000  ? 348 ASN A CB    1 
ATOM   2796 C  CG    . ASN A 1 360 ? -57.38800 -30.62100 -24.50500 1.000 26.25000  ? 348 ASN A CG    1 
ATOM   2797 O  OD1   . ASN A 1 360 ? -57.46900 -31.70200 -23.91900 1.000 30.15000  ? 348 ASN A OD1   1 
ATOM   2798 N  ND2   . ASN A 1 360 ? -57.36000 -30.52200 -25.81900 1.000 24.67000  ? 348 ASN A ND2   1 
ATOM   2799 N  N     . LEU A 1 361 ? -56.18800 -28.42700 -20.78900 1.000 29.69000  ? 349 LEU A N     1 
ATOM   2800 C  CA    . LEU A 1 361 ? -55.38300 -27.32100 -20.32300 1.000 26.87000  ? 349 LEU A CA    1 
ATOM   2801 C  C     . LEU A 1 361 ? -54.68900 -26.69700 -21.51900 1.000 30.05000  ? 349 LEU A C     1 
ATOM   2802 O  O     . LEU A 1 361 ? -54.77800 -25.49500 -21.75800 1.000 33.32000  ? 349 LEU A O     1 
ATOM   2803 C  CB    . LEU A 1 361 ? -54.35600 -27.79500 -19.30600 1.000 28.55000  ? 349 LEU A CB    1 
ATOM   2804 C  CG    . LEU A 1 361 ? -54.89900 -27.80900 -17.88500 1.000 32.21000  ? 349 LEU A CG    1 
ATOM   2805 C  CD1   . LEU A 1 361 ? -53.79100 -28.11600 -16.94100 1.000 30.64000  ? 349 LEU A CD1   1 
ATOM   2806 C  CD2   . LEU A 1 361 ? -55.46700 -26.45000 -17.57600 1.000 28.56000  ? 349 LEU A CD2   1 
ATOM   2807 N  N     . LYS A 1 362 ? -53.99200 -27.53300 -22.27700 1.000 29.26000  ? 350 LYS A N     1 
ATOM   2808 C  CA    . LYS A 1 362 ? -53.36600 -27.11100 -23.52400 1.000 29.96000  ? 350 LYS A CA    1 
ATOM   2809 C  C     . LYS A 1 362 ? -53.00200 -28.35300 -24.31400 1.000 31.52000  ? 350 LYS A C     1 
ATOM   2810 O  O     . LYS A 1 362 ? -53.08000 -29.47900 -23.80200 1.000 33.72000  ? 350 LYS A O     1 
ATOM   2811 C  CB    . LYS A 1 362 ? -52.11100 -26.24500 -23.27300 1.000 27.58000  ? 350 LYS A CB    1 
ATOM   2812 C  CG    . LYS A 1 362 ? -50.89600 -27.02200 -22.79300 1.000 23.10000  ? 350 LYS A CG    1 
ATOM   2813 C  CD    . LYS A 1 362 ? -49.73300 -26.11400 -22.43500 1.000 28.25000  ? 350 LYS A CD    1 
ATOM   2814 C  CE    . LYS A 1 362 ? -49.17000 -25.38800 -23.66000 1.000 26.01000  ? 350 LYS A CE    1 
ATOM   2815 N  NZ    . LYS A 1 362 ? -48.58400 -26.33200 -24.67600 1.000 33.23000  ? 350 LYS A NZ    1 
ATOM   2816 N  N     . THR A 1 363 ? -52.58300 -28.14400 -25.55500 1.000 31.42000  ? 351 THR A N     1 
ATOM   2817 C  CA    . THR A 1 363 ? -52.11700 -29.23100 -26.40400 1.000 28.96000  ? 351 THR A CA    1 
ATOM   2818 C  C     . THR A 1 363 ? -50.72200 -28.93500 -26.92700 1.000 30.67000  ? 351 THR A C     1 
ATOM   2819 O  O     . THR A 1 363 ? -50.13700 -27.90300 -26.59300 1.000 32.05000  ? 351 THR A O     1 
ATOM   2820 C  CB    . THR A 1 363 ? -53.06300 -29.44300 -27.58700 1.000 33.75000  ? 351 THR A CB    1 
ATOM   2821 O  OG1   . THR A 1 363 ? -53.00900 -28.29000 -28.43600 1.000 31.78000  ? 351 THR A OG1   1 
ATOM   2822 C  CG2   . THR A 1 363 ? -54.50900 -29.66400 -27.09300 1.000 24.05000  ? 351 THR A CG2   1 
ATOM   2823 N  N     . GLY A 1 364 ? -50.18600 -29.83100 -27.75100 1.000 31.48000  ? 352 GLY A N     1 
ATOM   2824 C  CA    . GLY A 1 364 ? -48.92800 -29.56900 -28.42900 1.000 26.74000  ? 352 GLY A CA    1 
ATOM   2825 C  C     . GLY A 1 364 ? -48.50700 -30.68700 -29.35900 1.000 30.40000  ? 352 GLY A C     1 
ATOM   2826 O  O     . GLY A 1 364 ? -49.17300 -31.72100 -29.44700 1.000 33.05000  ? 352 GLY A O     1 
ATOM   2827 N  N     . LYS A 1 365 ? -47.37900 -30.48200 -30.03300 1.000 33.41000  ? 353 LYS A N     1 
ATOM   2828 C  CA    . LYS A 1 365 ? -46.79300 -31.48100 -30.92500 1.000 34.06000  ? 353 LYS A CA    1 
ATOM   2829 C  C     . LYS A 1 365 ? -45.27700 -31.67400 -30.68100 1.000 41.17000  ? 353 LYS A C     1 
ATOM   2830 O  O     . LYS A 1 365 ? -44.56700 -30.76000 -30.25100 1.000 44.29000  ? 353 LYS A O     1 
ATOM   2831 C  CB    . LYS A 1 365 ? -47.03700 -31.08300 -32.39000 1.000 34.52000  ? 353 LYS A CB    1 
ATOM   2832 C  CG    . LYS A 1 365 ? -46.61500 -29.64300 -32.72000 1.000 44.81000  ? 353 LYS A CG    1 
ATOM   2833 C  CD    . LYS A 1 365 ? -46.65200 -29.32400 -34.22300 1.000 48.12000  ? 353 LYS A CD    1 
ATOM   2834 C  CE    . LYS A 1 365 ? -45.49400 -29.99900 -34.99500 1.000 55.16000  ? 353 LYS A CE    1 
ATOM   2835 N  NZ    . LYS A 1 365 ? -44.12700 -29.38500 -34.80900 1.000 50.65000  ? 353 LYS A NZ    1 
ATOM   2836 N  N     . TYR A 1 366 ? -44.79500 -32.88100 -30.95100 1.000 38.62000  ? 354 TYR A N     1 
ATOM   2837 C  CA    . TYR A 1 366 ? -43.36700 -33.17800 -31.00300 1.000 36.77000  ? 354 TYR A CA    1 
ATOM   2838 C  C     . TYR A 1 366 ? -43.02300 -33.80300 -32.36600 1.000 37.01000  ? 354 TYR A C     1 
ATOM   2839 O  O     . TYR A 1 366 ? -43.66300 -34.74400 -32.81700 1.000 40.56000  ? 354 TYR A O     1 
ATOM   2840 C  CB    . TYR A 1 366 ? -42.97000 -34.12800 -29.86700 1.000 33.73000  ? 354 TYR A CB    1 
ATOM   2841 C  CG    . TYR A 1 366 ? -41.50000 -34.48400 -29.86400 1.000 35.89000  ? 354 TYR A CG    1 
ATOM   2842 C  CD1   . TYR A 1 366 ? -40.54100 -33.53800 -29.49200 1.000 36.80000  ? 354 TYR A CD1   1 
ATOM   2843 C  CD2   . TYR A 1 366 ? -41.06000 -35.75800 -30.22000 1.000 34.86000  ? 354 TYR A CD2   1 
ATOM   2844 C  CE1   . TYR A 1 366 ? -39.18500 -33.83900 -29.48000 1.000 32.74000  ? 354 TYR A CE1   1 
ATOM   2845 C  CE2   . TYR A 1 366 ? -39.67800 -36.07600 -30.21100 1.000 34.63000  ? 354 TYR A CE2   1 
ATOM   2846 C  CZ    . TYR A 1 366 ? -38.75700 -35.09500 -29.83900 1.000 36.91000  ? 354 TYR A CZ    1 
ATOM   2847 O  OH    . TYR A 1 366 ? -37.39900 -35.34200 -29.80700 1.000 45.22000  ? 354 TYR A OH    1 
ATOM   2848 N  N     . ALA A 1 367 ? -42.02100 -33.29900 -33.04700 1.000 36.49000  ? 355 ALA A N     1 
ATOM   2849 C  CA    . ALA A 1 367 ? -41.73000 -33.89600 -34.33600 1.000 43.37000  ? 355 ALA A CA    1 
ATOM   2850 C  C     . ALA A 1 367 ? -40.24100 -33.91400 -34.65400 1.000 47.18000  ? 355 ALA A C     1 
ATOM   2851 O  O     . ALA A 1 367 ? -39.84900 -34.18800 -35.78500 1.000 51.37000  ? 355 ALA A O     1 
ATOM   2852 C  CB    . ALA A 1 367 ? -42.48700 -33.17000 -35.41600 1.000 46.28000  ? 355 ALA A CB    1 
ATOM   2853 N  N     . ARG A 1 368 ? -39.41300 -33.64100 -33.65400 1.000 46.66000  ? 356 ARG A N     1 
ATOM   2854 C  CA    . ARG A 1 368 ? -37.99700 -33.46100 -33.91400 1.000 52.40000  ? 356 ARG A CA    1 
ATOM   2855 C  C     . ARG A 1 368 ? -37.36900 -34.77800 -34.31600 1.000 49.80000  ? 356 ARG A C     1 
ATOM   2856 O  O     . ARG A 1 368 ? -37.57000 -35.79200 -33.65300 1.000 54.16000  ? 356 ARG A O     1 
ATOM   2857 C  CB    . ARG A 1 368 ? -37.28200 -32.87800 -32.69500 1.000 48.27000  ? 356 ARG A CB    1 
ATOM   2858 C  CG    . ARG A 1 368 ? -35.86300 -32.46800 -33.00000 1.000 54.86000  ? 356 ARG A CG    1 
ATOM   2859 C  CD    . ARG A 1 368 ? -35.15500 -31.91300 -31.79000 1.000 55.97000  ? 356 ARG A CD    1 
ATOM   2860 N  NE    . ARG A 1 368 ? -33.77000 -31.58400 -32.10900 1.000 58.53000  ? 356 ARG A NE    1 
ATOM   2861 C  CZ    . ARG A 1 368 ? -32.80000 -31.48900 -31.20800 1.000 62.04000  ? 356 ARG A CZ    1 
ATOM   2862 N  NH1   . ARG A 1 368 ? -33.06500 -31.70900 -29.92500 1.000 63.61000  ? 356 ARG A NH1   1 
ATOM   2863 N  NH2   . ARG A 1 368 ? -31.56800 -31.18600 -31.59000 1.000 62.48000  ? 356 ARG A NH2   1 
ATOM   2864 N  N     . MET A 1 369 ? -36.62200 -34.76600 -35.41600 1.000 50.66000  ? 357 MET A N     1 
ATOM   2865 C  CA    . MET A 1 369 ? -35.91500 -35.96600 -35.83900 1.000 52.65000  ? 357 MET A CA    1 
ATOM   2866 C  C     . MET A 1 369 ? -34.50900 -36.01500 -35.22200 1.000 56.44000  ? 357 MET A C     1 
ATOM   2867 O  O     . MET A 1 369 ? -33.59500 -35.30500 -35.65000 1.000 63.39000  ? 357 MET A O     1 
ATOM   2868 C  CB    . MET A 1 369 ? -35.85100 -36.05300 -37.37200 1.000 57.10000  ? 357 MET A CB    1 
ATOM   2869 C  CG    . MET A 1 369 ? -37.14100 -36.59200 -38.05700 1.000 68.26000  ? 357 MET A CG    1 
ATOM   2870 S  SD    . MET A 1 369 ? -37.80600 -38.16000 -37.40800 1.000 69.95000  ? 357 MET A SD    1 
ATOM   2871 C  CE    . MET A 1 369 ? -36.28800 -39.13700 -37.22000 1.000 54.74000  ? 357 MET A CE    1 
ATOM   2872 N  N     . ARG A 1 370 ? -34.36000 -36.84400 -34.19200 1.000 52.59000  ? 358 ARG A N     1 
ATOM   2873 C  CA    . ARG A 1 370 ? -33.08900 -37.00600 -33.49500 1.000 49.78000  ? 358 ARG A CA    1 
ATOM   2874 C  C     . ARG A 1 370 ? -32.43900 -38.34700 -33.83400 1.000 49.90000  ? 358 ARG A C     1 
ATOM   2875 O  O     . ARG A 1 370 ? -32.88000 -39.40300 -33.37900 1.000 48.19000  ? 358 ARG A O     1 
ATOM   2876 C  CB    . ARG A 1 370 ? -33.28400 -36.90300 -31.98100 1.000 50.08000  ? 358 ARG A CB    1 
ATOM   2877 C  CG    . ARG A 1 370 ? -33.89100 -35.60700 -31.50900 1.000 55.85000  ? 358 ARG A CG    1 
ATOM   2878 C  CD    . ARG A 1 370 ? -33.96500 -35.57800 -29.99000 1.000 64.03000  ? 358 ARG A CD    1 
ATOM   2879 N  NE    . ARG A 1 370 ? -32.87200 -34.81000 -29.40300 1.000 64.14000  ? 358 ARG A NE    1 
ATOM   2880 C  CZ    . ARG A 1 370 ? -31.67000 -35.30400 -29.14500 1.000 67.09000  ? 358 ARG A CZ    1 
ATOM   2881 N  NH1   . ARG A 1 370 ? -31.40200 -36.57200 -29.42700 1.000 71.28000  ? 358 ARG A NH1   1 
ATOM   2882 N  NH2   . ARG A 1 370 ? -30.73500 -34.52800 -28.61000 1.000 73.39000  ? 358 ARG A NH2   1 
ATOM   2883 N  N     . GLY A 1 371 ? -31.38400 -38.30400 -34.63200 1.000 49.73000  ? 359 GLY A N     1 
ATOM   2884 C  CA    . GLY A 1 371 ? -30.67300 -39.51200 -34.98000 1.000 40.27000  ? 359 GLY A CA    1 
ATOM   2885 C  C     . GLY A 1 371 ? -30.80900 -39.91700 -36.43400 1.000 40.79000  ? 359 GLY A C     1 
ATOM   2886 O  O     . GLY A 1 371 ? -31.88000 -39.82600 -37.04700 1.000 40.94000  ? 359 GLY A O     1 
ATOM   2887 N  N     . ALA A 1 372 ? -29.69100 -40.37100 -36.98300 1.000 41.40000  ? 360 ALA A N     1 
ATOM   2888 C  CA    . ALA A 1 372 ? -29.68900 -41.02000 -38.27900 1.000 44.59000  ? 360 ALA A CA    1 
ATOM   2889 C  C     . ALA A 1 372 ? -30.72100 -42.16300 -38.30400 1.000 43.03000  ? 360 ALA A C     1 
ATOM   2890 O  O     . ALA A 1 372 ? -31.50700 -42.28800 -39.24900 1.000 36.14000  ? 360 ALA A O     1 
ATOM   2891 C  CB    . ALA A 1 372 ? -28.29400 -41.54100 -38.59600 1.000 34.96000  ? 360 ALA A CB    1 
ATOM   2892 N  N     . HIS A 1 373 ? -30.71200 -42.97600 -37.25000 1.000 32.45000  ? 361 HIS A N     1 
ATOM   2893 C  CA    . HIS A 1 373 ? -31.58600 -44.13600 -37.14500 1.000 30.60000  ? 361 HIS A CA    1 
ATOM   2894 C  C     . HIS A 1 373 ? -32.23300 -44.17800 -35.78400 1.000 33.79000  ? 361 HIS A C     1 
ATOM   2895 O  O     . HIS A 1 373 ? -31.58200 -43.94500 -34.76000 1.000 37.64000  ? 361 HIS A O     1 
ATOM   2896 C  CB    . HIS A 1 373 ? -30.80600 -45.43300 -37.38200 1.000 28.71000  ? 361 HIS A CB    1 
ATOM   2897 C  CG    . HIS A 1 373 ? -29.64500 -45.26200 -38.29700 1.000 34.22000  ? 361 HIS A CG    1 
ATOM   2898 N  ND1   . HIS A 1 373 ? -29.79300 -45.12300 -39.66800 1.000 36.26000  ? 361 HIS A ND1   1 
ATOM   2899 C  CD2   . HIS A 1 373 ? -28.32000 -45.15600 -38.05400 1.000 36.01000  ? 361 HIS A CD2   1 
ATOM   2900 C  CE1   . HIS A 1 373 ? -28.60800 -44.96800 -40.22000 1.000 39.05000  ? 361 HIS A CE1   1 
ATOM   2901 N  NE2   . HIS A 1 373 ? -27.68800 -44.97900 -39.26000 1.000 37.03000  ? 361 HIS A NE2   1 
ATOM   2902 N  N     . THR A 1 374 ? -33.51800 -44.50800 -35.77500 1.000 35.37000  ? 362 THR A N     1 
ATOM   2903 C  CA    . THR A 1 374 ? -34.28700 -44.57300 -34.54700 1.000 30.52000  ? 362 THR A CA    1 
ATOM   2904 C  C     . THR A 1 374 ? -35.52500 -45.46200 -34.71700 1.000 34.39000  ? 362 THR A C     1 
ATOM   2905 O  O     . THR A 1 374 ? -35.71500 -46.09200 -35.76900 1.000 33.47000  ? 362 THR A O     1 
ATOM   2906 C  CB    . THR A 1 374 ? -34.71400 -43.17000 -34.11000 1.000 33.59000  ? 362 THR A CB    1 
ATOM   2907 O  OG1   . THR A 1 374 ? -35.32300 -43.23900 -32.81700 1.000 43.02000  ? 362 THR A OG1   1 
ATOM   2908 C  CG2   . THR A 1 374 ? -35.68600 -42.56600 -35.12400 1.000 28.87000  ? 362 THR A CG2   1 
ATOM   2909 N  N     . ASN A 1 375 ? -36.36200 -45.51000 -33.68300 1.000 34.32000  ? 363 ASN A N     1 
ATOM   2910 C  CA    . ASN A 1 375 ? -37.59300 -46.29700 -33.71500 1.000 34.62000  ? 363 ASN A CA    1 
ATOM   2911 C  C     . ASN A 1 375 ? -38.68300 -45.60300 -32.92000 1.000 35.15000  ? 363 ASN A C     1 
ATOM   2912 O  O     . ASN A 1 375 ? -38.41300 -44.60600 -32.27000 1.000 38.67000  ? 363 ASN A O     1 
ATOM   2913 C  CB    . ASN A 1 375 ? -37.34700 -47.71400 -33.18100 1.000 36.49000  ? 363 ASN A CB    1 
ATOM   2914 C  CG    . ASN A 1 375 ? -36.99100 -47.74500 -31.70100 1.000 35.50000  ? 363 ASN A CG    1 
ATOM   2915 O  OD1   . ASN A 1 375 ? -37.47100 -46.93000 -30.90200 1.000 36.19000  ? 363 ASN A OD1   1 
ATOM   2916 N  ND2   . ASN A 1 375 ? -36.15600 -48.70300 -31.32600 1.000 30.80000  ? 363 ASN A ND2   1 
ATOM   2917 N  N     . ASP A 1 376 ? -39.89900 -46.13600 -32.94600 1.000 39.35000  ? 364 ASP A N     1 
ATOM   2918 C  CA    . ASP A 1 376 ? -41.02600 -45.46100 -32.30600 1.000 37.85000  ? 364 ASP A CA    1 
ATOM   2919 C  C     . ASP A 1 376 ? -40.91400 -45.36400 -30.78300 1.000 38.97000  ? 364 ASP A C     1 
ATOM   2920 O  O     . ASP A 1 376 ? -41.32200 -44.35700 -30.21200 1.000 36.26000  ? 364 ASP A O     1 
ATOM   2921 C  CB    . ASP A 1 376 ? -42.33100 -46.14700 -32.67300 1.000 36.32000  ? 364 ASP A CB    1 
ATOM   2922 C  CG    . ASP A 1 376 ? -42.82600 -45.73300 -34.03800 1.000 55.79000  ? 364 ASP A CG    1 
ATOM   2923 O  OD1   . ASP A 1 376 ? -42.41800 -44.63300 -34.50800 1.000 56.60000  ? 364 ASP A OD1   1 
ATOM   2924 O  OD2   . ASP A 1 376 ? -43.62300 -46.50300 -34.63300 1.000 67.33000  ? 364 ASP A OD2   1 
ATOM   2925 N  N     . VAL A 1 377 ? -40.35100 -46.37700 -30.12100 1.000 32.13000  ? 365 VAL A N     1 
ATOM   2926 C  CA    . VAL A 1 377 ? -40.20300 -46.30500 -28.66700 1.000 31.36000  ? 365 VAL A CA    1 
ATOM   2927 C  C     . VAL A 1 377 ? -39.24400 -45.17300 -28.23200 1.000 36.34000  ? 365 VAL A C     1 
ATOM   2928 O  O     . VAL A 1 377 ? -39.53400 -44.43900 -27.28700 1.000 34.06000  ? 365 VAL A O     1 
ATOM   2929 C  CB    . VAL A 1 377 ? -39.72100 -47.63700 -28.07500 1.000 30.42000  ? 365 VAL A CB    1 
ATOM   2930 C  CG1   . VAL A 1 377 ? -39.73900 -47.55600 -26.56100 1.000 26.59000  ? 365 VAL A CG1   1 
ATOM   2931 C  CG2   . VAL A 1 377 ? -40.61500 -48.76300 -28.53400 1.000 24.60000  ? 365 VAL A CG2   1 
ATOM   2932 N  N     . LYS A 1 378 ? -38.11700 -45.01000 -28.92100 1.000 37.37000  ? 366 LYS A N     1 
ATOM   2933 C  CA    . LYS A 1 378 ? -37.22200 -43.89300 -28.62500 1.000 33.14000  ? 366 LYS A CA    1 
ATOM   2934 C  C     . LYS A 1 378 ? -37.94000 -42.57000 -28.81300 1.000 35.93000  ? 366 LYS A C     1 
ATOM   2935 O  O     . LYS A 1 378 ? -37.92500 -41.71700 -27.91400 1.000 39.74000  ? 366 LYS A O     1 
ATOM   2936 C  CB    . LYS A 1 378 ? -35.95500 -43.93400 -29.49800 1.000 34.19000  ? 366 LYS A CB    1 
ATOM   2937 C  CG    . LYS A 1 378 ? -35.13300 -45.17600 -29.26300 1.000 35.36000  ? 366 LYS A CG    1 
ATOM   2938 C  CD    . LYS A 1 378 ? -33.66000 -44.91800 -29.39600 1.000 38.18000  ? 366 LYS A CD    1 
ATOM   2939 C  CE    . LYS A 1 378 ? -33.20800 -44.99900 -30.82600 1.000 37.97000  ? 366 LYS A CE    1 
ATOM   2940 N  NZ    . LYS A 1 378 ? -31.78100 -45.44800 -30.88500 1.000 35.87000  ? 366 LYS A NZ    1 
ATOM   2941 N  N     . GLN A 1 379 ? -38.56300 -42.39100 -29.97600 1.000 34.22000  ? 367 GLN A N     1 
ATOM   2942 C  CA    . GLN A 1 379 ? -39.28700 -41.15500 -30.25800 1.000 32.51000  ? 367 GLN A CA    1 
ATOM   2943 C  C     . GLN A 1 379 ? -40.35400 -40.88600 -29.21000 1.000 34.29000  ? 367 GLN A C     1 
ATOM   2944 O  O     . GLN A 1 379 ? -40.59800 -39.73800 -28.85100 1.000 36.07000  ? 367 GLN A O     1 
ATOM   2945 C  CB    . GLN A 1 379 ? -39.94500 -41.20500 -31.63100 1.000 35.50000  ? 367 GLN A CB    1 
ATOM   2946 C  CG    . GLN A 1 379 ? -39.01600 -40.97000 -32.78700 1.000 38.95000  ? 367 GLN A CG    1 
ATOM   2947 C  CD    . GLN A 1 379 ? -39.66800 -41.31900 -34.09900 1.000 43.54000  ? 367 GLN A CD    1 
ATOM   2948 O  OE1   . GLN A 1 379 ? -40.83000 -41.73300 -34.13100 1.000 49.51000  ? 367 GLN A OE1   1 
ATOM   2949 N  NE2   . GLN A 1 379 ? -38.92700 -41.17600 -35.19000 1.000 48.58000  ? 367 GLN A NE2   1 
ATOM   2950 N  N     . LEU A 1 380 ? -41.00600 -41.94000 -28.72400 1.000 32.23000  ? 368 LEU A N     1 
ATOM   2951 C  CA    . LEU A 1 380 ? -42.04100 -41.74800 -27.71300 1.000 29.88000  ? 368 LEU A CA    1 
ATOM   2952 C  C     . LEU A 1 380 ? -41.38700 -41.20000 -26.43400 1.000 35.87000  ? 368 LEU A C     1 
ATOM   2953 O  O     . LEU A 1 380 ? -41.88100 -40.22700 -25.83200 1.000 36.19000  ? 368 LEU A O     1 
ATOM   2954 C  CB    . LEU A 1 380 ? -42.80400 -43.04800 -27.45700 1.000 25.73000  ? 368 LEU A CB    1 
ATOM   2955 C  CG    . LEU A 1 380 ? -43.91600 -42.98700 -26.40700 1.000 32.92000  ? 368 LEU A CG    1 
ATOM   2956 C  CD1   . LEU A 1 380 ? -44.90200 -41.88400 -26.72000 1.000 30.21000  ? 368 LEU A CD1   1 
ATOM   2957 C  CD2   . LEU A 1 380 ? -44.63800 -44.31400 -26.30900 1.000 29.98000  ? 368 LEU A CD2   1 
ATOM   2958 N  N     . THR A 1 381 ? -40.24400 -41.78800 -26.07100 1.000 31.23000  ? 369 THR A N     1 
ATOM   2959 C  CA    . THR A 1 381 ? -39.49100 -41.41000 -24.88200 1.000 30.45000  ? 369 THR A CA    1 
ATOM   2960 C  C     . THR A 1 381 ? -39.03700 -39.94500 -24.97100 1.000 36.19000  ? 369 THR A C     1 
ATOM   2961 O  O     . THR A 1 381 ? -38.98800 -39.22600 -23.96500 1.000 39.95000  ? 369 THR A O     1 
ATOM   2962 C  CB    . THR A 1 381 ? -38.26200 -42.35800 -24.67100 1.000 37.17000  ? 369 THR A CB    1 
ATOM   2963 O  OG1   . THR A 1 381 ? -38.71000 -43.71300 -24.44300 1.000 34.52000  ? 369 THR A OG1   1 
ATOM   2964 C  CG2   . THR A 1 381 ? -37.45800 -41.92600 -23.46800 1.000 39.39000  ? 369 THR A CG2   1 
ATOM   2965 N  N     . GLU A 1 382 ? -38.74600 -39.47400 -26.17500 1.000 31.76000  ? 370 GLU A N     1 
ATOM   2966 C  CA    . GLU A 1 382 ? -38.35600 -38.08200 -26.32100 1.000 31.65000  ? 370 GLU A CA    1 
ATOM   2967 C  C     . GLU A 1 382 ? -39.55100 -37.13700 -26.17100 1.000 32.43000  ? 370 GLU A C     1 
ATOM   2968 O  O     . GLU A 1 382 ? -39.42800 -36.03800 -25.61600 1.000 31.72000  ? 370 GLU A O     1 
ATOM   2969 C  CB    . GLU A 1 382 ? -37.67700 -37.87000 -27.66100 1.000 33.08000  ? 370 GLU A CB    1 
ATOM   2970 C  CG    . GLU A 1 382 ? -36.34700 -38.55600 -27.76600 1.000 32.76000  ? 370 GLU A CG    1 
ATOM   2971 C  CD    . GLU A 1 382 ? -35.94900 -38.78600 -29.20700 1.000 47.17000  ? 370 GLU A CD    1 
ATOM   2972 O  OE1   . GLU A 1 382 ? -35.13300 -39.70700 -29.44400 1.000 49.75000  ? 370 GLU A OE1   1 
ATOM   2973 O  OE2   . GLU A 1 382 ? -36.46500 -38.05800 -30.10000 1.000 44.82000  ? 370 GLU A OE2   1 
ATOM   2974 N  N     . ALA A 1 383 ? -40.70000 -37.57000 -26.67600 1.000 32.44000  ? 371 ALA A N     1 
ATOM   2975 C  CA    . ALA A 1 383 ? -41.92700 -36.80600 -26.56400 1.000 27.60000  ? 371 ALA A CA    1 
ATOM   2976 C  C     . ALA A 1 383 ? -42.28600 -36.64600 -25.10400 1.000 32.26000  ? 371 ALA A C     1 
ATOM   2977 O  O     . ALA A 1 383 ? -42.58700 -35.54300 -24.66800 1.000 30.64000  ? 371 ALA A O     1 
ATOM   2978 C  CB    . ALA A 1 383 ? -43.04600 -37.49000 -27.30900 1.000 32.20000  ? 371 ALA A CB    1 
ATOM   2979 N  N     . VAL A 1 384 ? -42.26400 -37.75800 -24.36200 1.000 34.41000  ? 372 VAL A N     1 
ATOM   2980 C  CA    . VAL A 1 384 ? -42.49700 -37.75400 -22.91200 1.000 29.67000  ? 372 VAL A CA    1 
ATOM   2981 C  C     . VAL A 1 384 ? -41.55000 -36.78000 -22.21100 1.000 34.98000  ? 372 VAL A C     1 
ATOM   2982 O  O     . VAL A 1 384 ? -41.95900 -36.02600 -21.32600 1.000 33.32000  ? 372 VAL A O     1 
ATOM   2983 C  CB    . VAL A 1 384 ? -42.32400 -39.17600 -22.29200 1.000 31.61000  ? 372 VAL A CB    1 
ATOM   2984 C  CG1   . VAL A 1 384 ? -42.37800 -39.12500 -20.77500 1.000 28.59000  ? 372 VAL A CG1   1 
ATOM   2985 C  CG2   . VAL A 1 384 ? -43.40000 -40.12600 -22.80600 1.000 30.08000  ? 372 VAL A CG2   1 
ATOM   2986 N  N     . GLN A 1 385 ? -40.27700 -36.78300 -22.60000 1.000 38.13000  ? 373 GLN A N     1 
ATOM   2987 C  CA    . GLN A 1 385 ? -39.31400 -35.90800 -21.93900 1.000 34.34000  ? 373 GLN A CA    1 
ATOM   2988 C  C     . GLN A 1 385 ? -39.56300 -34.43200 -22.26100 1.000 34.75000  ? 373 GLN A C     1 
ATOM   2989 O  O     . GLN A 1 385 ? -39.46400 -33.56400 -21.38600 1.000 35.27000  ? 373 GLN A O     1 
ATOM   2990 C  CB    . GLN A 1 385 ? -37.89300 -36.31200 -22.31300 1.000 38.41000  ? 373 GLN A CB    1 
ATOM   2991 C  CG    . GLN A 1 385 ? -37.27900 -37.23500 -21.26500 1.000 50.68000  ? 373 GLN A CG    1 
ATOM   2992 C  CD    . GLN A 1 385 ? -36.48700 -38.40400 -21.85000 1.000 50.53000  ? 373 GLN A CD    1 
ATOM   2993 O  OE1   . GLN A 1 385 ? -35.71800 -38.24100 -22.82000 1.000 41.07000  ? 373 GLN A OE1   1 
ATOM   2994 N  NE2   . GLN A 1 385 ? -36.66900 -39.59500 -21.25400 1.000 45.88000  ? 373 GLN A NE2   1 
ATOM   2995 N  N     . LYS A 1 386 ? -39.90300 -34.13700 -23.50800 1.000 33.72000  ? 374 LYS A N     1 
ATOM   2996 C  CA    . LYS A 1 386 ? -40.24800 -32.76800 -23.86200 1.000 28.28000  ? 374 LYS A CA    1 
ATOM   2997 C  C     . LYS A 1 386 ? -41.45600 -32.28100 -23.05500 1.000 33.88000  ? 374 LYS A C     1 
ATOM   2998 O  O     . LYS A 1 386 ? -41.40900 -31.19700 -22.47800 1.000 35.67000  ? 374 LYS A O     1 
ATOM   2999 C  CB    . LYS A 1 386 ? -40.51800 -32.66000 -25.35900 1.000 28.68000  ? 374 LYS A CB    1 
ATOM   3000 C  CG    . LYS A 1 386 ? -40.82400 -31.25500 -25.84500 1.000 37.39000  ? 374 LYS A CG    1 
ATOM   3001 C  CD    . LYS A 1 386 ? -41.92900 -31.31900 -26.90700 1.000 41.09000  ? 374 LYS A CD    1 
ATOM   3002 C  CE    . LYS A 1 386 ? -42.38200 -29.94600 -27.40200 1.000 49.07000  ? 374 LYS A CE    1 
ATOM   3003 N  NZ    . LYS A 1 386 ? -42.76000 -29.02600 -26.27900 1.000 49.63000  ? 374 LYS A NZ    1 
ATOM   3004 N  N     . ILE A 1 387 ? -42.52100 -33.08500 -22.98600 1.000 28.50000  ? 375 ILE A N     1 
ATOM   3005 C  CA    . ILE A 1 387 ? -43.72600 -32.73100 -22.22800 1.000 26.31000  ? 375 ILE A CA    1 
ATOM   3006 C  C     . ILE A 1 387 ? -43.48400 -32.52300 -20.72700 1.000 28.14000  ? 375 ILE A C     1 
ATOM   3007 O  O     . ILE A 1 387 ? -44.04500 -31.60900 -20.10300 1.000 28.70000  ? 375 ILE A O     1 
ATOM   3008 C  CB    . ILE A 1 387 ? -44.79900 -33.80700 -22.39000 1.000 33.26000  ? 375 ILE A CB    1 
ATOM   3009 C  CG1   . ILE A 1 387 ? -45.25600 -33.87600 -23.84600 1.000 27.42000  ? 375 ILE A CG1   1 
ATOM   3010 C  CG2   . ILE A 1 387 ? -45.98700 -33.55000 -21.45700 1.000 25.38000  ? 375 ILE A CG2   1 
ATOM   3011 C  CD1   . ILE A 1 387 ? -46.16800 -35.03000 -24.09600 1.000 27.80000  ? 375 ILE A CD1   1 
ATOM   3012 N  N     . THR A 1 388 ? -42.65600 -33.38200 -20.14800 1.000 28.16000  ? 376 THR A N     1 
ATOM   3013 C  CA    . THR A 1 388 ? -42.27900 -33.26800 -18.74100 1.000 27.71000  ? 376 THR A CA    1 
ATOM   3014 C  C     . THR A 1 388 ? -41.60400 -31.93300 -18.45100 1.000 29.73000  ? 376 THR A C     1 
ATOM   3015 O  O     . THR A 1 388 ? -41.93300 -31.25600 -17.48800 1.000 29.64000  ? 376 THR A O     1 
ATOM   3016 C  CB    . THR A 1 388 ? -41.34300 -34.42300 -18.32500 1.000 28.72000  ? 376 THR A CB    1 
ATOM   3017 O  OG1   . THR A 1 388 ? -42.07600 -35.65200 -18.35800 1.000 27.38000  ? 376 THR A OG1   1 
ATOM   3018 C  CG2   . THR A 1 388 ? -40.80200 -34.22100 -16.92600 1.000 22.61000  ? 376 THR A CG2   1 
ATOM   3019 N  N     . THR A 1 389 ? -40.66000 -31.54100 -19.29200 1.000 29.82000  ? 377 THR A N     1 
ATOM   3020 C  CA    . THR A 1 389 ? -39.94500 -30.30100 -19.04700 1.000 26.46000  ? 377 THR A CA    1 
ATOM   3021 C  C     . THR A 1 389 ? -40.89000 -29.13400 -19.19900 1.000 29.86000  ? 377 THR A C     1 
ATOM   3022 O  O     . THR A 1 389 ? -40.76600 -28.11700 -18.51600 1.000 32.53000  ? 377 THR A O     1 
ATOM   3023 C  CB    . THR A 1 389 ? -38.74500 -30.12900 -20.01600 1.000 33.30000  ? 377 THR A CB    1 
ATOM   3024 O  OG1   . THR A 1 389 ? -37.88700 -31.27600 -19.92600 1.000 42.61000  ? 377 THR A OG1   1 
ATOM   3025 C  CG2   . THR A 1 389 ? -37.94500 -28.89400 -19.66300 1.000 28.74000  ? 377 THR A CG2   1 
ATOM   3026 N  N     . GLU A 1 390 ? -41.84100 -29.28200 -20.10800 1.000 27.69000  ? 378 GLU A N     1 
ATOM   3027 C  CA    . GLU A 1 390 ? -42.74000 -28.19100 -20.40900 1.000 22.62000  ? 378 GLU A CA    1 
ATOM   3028 C  C     . GLU A 1 390 ? -43.77500 -28.05500 -19.30200 1.000 28.39000  ? 378 GLU A C     1 
ATOM   3029 O  O     . GLU A 1 390 ? -44.11900 -26.94200 -18.88700 1.000 28.96000  ? 378 GLU A O     1 
ATOM   3030 C  CB    . GLU A 1 390 ? -43.40100 -28.41800 -21.75600 1.000 26.82000  ? 378 GLU A CB    1 
ATOM   3031 C  CG    . GLU A 1 390 ? -44.57000 -27.48800 -22.03900 1.000 38.29000  ? 378 GLU A CG    1 
ATOM   3032 C  CD    . GLU A 1 390 ? -45.18300 -27.77700 -23.39800 1.000 49.02000  ? 378 GLU A CD    1 
ATOM   3033 O  OE1   . GLU A 1 390 ? -46.30700 -27.28500 -23.67500 1.000 44.93000  ? 378 GLU A OE1   1 
ATOM   3034 O  OE2   . GLU A 1 390 ? -44.52900 -28.51800 -24.18300 1.000 48.39000  ? 378 GLU A OE2   1 
ATOM   3035 N  N     . SER A 1 391 ? -44.26200 -29.19300 -18.81500 1.000 30.39000  ? 379 SER A N     1 
ATOM   3036 C  CA    . SER A 1 391 ? -45.15100 -29.19700 -17.66200 1.000 28.60000  ? 379 SER A CA    1 
ATOM   3037 C  C     . SER A 1 391 ? -44.49400 -28.54800 -16.45600 1.000 28.92000  ? 379 SER A C     1 
ATOM   3038 O  O     . SER A 1 391 ? -45.16600 -27.88900 -15.66200 1.000 31.45000  ? 379 SER A O     1 
ATOM   3039 C  CB    . SER A 1 391 ? -45.57700 -30.61900 -17.29100 1.000 24.54000  ? 379 SER A CB    1 
ATOM   3040 O  OG    . SER A 1 391 ? -46.18800 -31.26200 -18.39200 1.000 35.93000  ? 379 SER A OG    1 
ATOM   3041 N  N     . ILE A 1 392 ? -43.18700 -28.75300 -16.30500 1.000 28.06000  ? 380 ILE A N     1 
ATOM   3042 C  CA    . ILE A 1 392 ? -42.49000 -28.25700 -15.13200 1.000 26.58000  ? 380 ILE A CA    1 
ATOM   3043 C  C     . ILE A 1 392 ? -42.37000 -26.74300 -15.20900 1.000 32.04000  ? 380 ILE A C     1 
ATOM   3044 O  O     . ILE A 1 392 ? -42.51400 -26.05500 -14.19900 1.000 33.66000  ? 380 ILE A O     1 
ATOM   3045 C  CB    . ILE A 1 392 ? -41.12500 -28.91400 -14.98000 1.000 29.75000  ? 380 ILE A CB    1 
ATOM   3046 C  CG1   . ILE A 1 392 ? -41.31400 -30.34800 -14.46200 1.000 26.96000  ? 380 ILE A CG1   1 
ATOM   3047 C  CG2   . ILE A 1 392 ? -40.24300 -28.12100 -14.01000 1.000 29.13000  ? 380 ILE A CG2   1 
ATOM   3048 C  CD1   . ILE A 1 392 ? -40.03300 -31.13000 -14.32900 1.000 26.01000  ? 380 ILE A CD1   1 
ATOM   3049 N  N     . VAL A 1 393 ? -42.15500 -26.21200 -16.40900 1.000 31.63000  ? 381 VAL A N     1 
ATOM   3050 C  CA    . VAL A 1 393 ? -42.16600 -24.76400 -16.57900 1.000 24.86000  ? 381 VAL A CA    1 
ATOM   3051 C  C     . VAL A 1 393 ? -43.53400 -24.19400 -16.25100 1.000 25.87000  ? 381 VAL A C     1 
ATOM   3052 O  O     . VAL A 1 393 ? -43.66100 -23.25700 -15.46400 1.000 27.22000  ? 381 VAL A O     1 
ATOM   3053 C  CB    . VAL A 1 393 ? -41.77900 -24.35000 -18.00300 1.000 25.10000  ? 381 VAL A CB    1 
ATOM   3054 C  CG1   . VAL A 1 393 ? -42.03300 -22.87500 -18.20700 1.000 20.85000  ? 381 VAL A CG1   1 
ATOM   3055 C  CG2   . VAL A 1 393 ? -40.30100 -24.66100 -18.26300 1.000 26.24000  ? 381 VAL A CG2   1 
ATOM   3056 N  N     . ILE A 1 394 ? -44.57300 -24.76000 -16.84700 1.000 29.45000  ? 382 ILE A N     1 
ATOM   3057 C  CA    . ILE A 1 394 ? -45.90300 -24.17200 -16.72100 1.000 26.35000  ? 382 ILE A CA    1 
ATOM   3058 C  C     . ILE A 1 394 ? -46.57800 -24.44000 -15.36500 1.000 26.09000  ? 382 ILE A C     1 
ATOM   3059 O  O     . ILE A 1 394 ? -47.18100 -23.52900 -14.77100 1.000 26.95000  ? 382 ILE A O     1 
ATOM   3060 C  CB    . ILE A 1 394 ? -46.80200 -24.66400 -17.85000 1.000 27.13000  ? 382 ILE A CB    1 
ATOM   3061 C  CG1   . ILE A 1 394 ? -46.21800 -24.19900 -19.18300 1.000 21.26000  ? 382 ILE A CG1   1 
ATOM   3062 C  CG2   . ILE A 1 394 ? -48.23200 -24.15900 -17.67600 1.000 23.53000  ? 382 ILE A CG2   1 
ATOM   3063 C  CD1   . ILE A 1 394 ? -47.04400 -24.62000 -20.36900 1.000 24.09000  ? 382 ILE A CD1   1 
ATOM   3064 N  N     . TRP A 1 395 ? -46.46400 -25.65800 -14.85300 1.000 23.39000  ? 383 TRP A N     1 
ATOM   3065 C  CA    . TRP A 1 395 ? -47.17200 -25.99600 -13.61100 1.000 29.13000  ? 383 TRP A CA    1 
ATOM   3066 C  C     . TRP A 1 395 ? -46.25600 -26.32700 -12.44900 1.000 28.30000  ? 383 TRP A C     1 
ATOM   3067 O  O     . TRP A 1 395 ? -46.71500 -26.42300 -11.31200 1.000 32.38000  ? 383 TRP A O     1 
ATOM   3068 C  CB    . TRP A 1 395 ? -48.13400 -27.16900 -13.84700 1.000 28.91000  ? 383 TRP A CB    1 
ATOM   3069 C  CG    . TRP A 1 395 ? -49.13100 -26.84700 -14.90900 1.000 29.96000  ? 383 TRP A CG    1 
ATOM   3070 C  CD1   . TRP A 1 395 ? -50.18400 -25.98800 -14.80900 1.000 26.27000  ? 383 TRP A CD1   1 
ATOM   3071 C  CD2   . TRP A 1 395 ? -49.14300 -27.33900 -16.25300 1.000 26.82000  ? 383 TRP A CD2   1 
ATOM   3072 N  NE1   . TRP A 1 395 ? -50.86800 -25.94000 -16.00200 1.000 26.35000  ? 383 TRP A NE1   1 
ATOM   3073 C  CE2   . TRP A 1 395 ? -50.24200 -26.76100 -16.90100 1.000 23.73000  ? 383 TRP A CE2   1 
ATOM   3074 C  CE3   . TRP A 1 395 ? -48.33800 -28.23700 -16.95600 1.000 29.46000  ? 383 TRP A CE3   1 
ATOM   3075 C  CZ2   . TRP A 1 395 ? -50.55400 -27.03800 -18.22500 1.000 27.22000  ? 383 TRP A CZ2   1 
ATOM   3076 C  CZ3   . TRP A 1 395 ? -48.64700 -28.51100 -18.27500 1.000 27.20000  ? 383 TRP A CZ3   1 
ATOM   3077 C  CH2   . TRP A 1 395 ? -49.74700 -27.92000 -18.89300 1.000 29.54000  ? 383 TRP A CH2   1 
ATOM   3078 N  N     . GLY A 1 396 ? -44.97400 -26.53100 -12.73400 1.000 30.28000  ? 384 GLY A N     1 
ATOM   3079 C  CA    . GLY A 1 396 ? -44.00500 -26.81600 -11.69500 1.000 29.10000  ? 384 GLY A CA    1 
ATOM   3080 C  C     . GLY A 1 396 ? -44.09100 -28.23500 -11.19000 1.000 32.08000  ? 384 GLY A C     1 
ATOM   3081 O  O     . GLY A 1 396 ? -43.58000 -28.55200 -10.12300 1.000 36.25000  ? 384 GLY A O     1 
ATOM   3082 N  N     . LYS A 1 397 ? -44.74000 -29.09700 -11.95900 1.000 31.50000  ? 385 LYS A N     1 
ATOM   3083 C  CA    . LYS A 1 397 ? -44.74600 -30.50900 -11.64700 1.000 31.48000  ? 385 LYS A CA    1 
ATOM   3084 C  C     . LYS A 1 397 ? -44.85400 -31.31100 -12.92300 1.000 34.61000  ? 385 LYS A C     1 
ATOM   3085 O  O     . LYS A 1 397 ? -45.11300 -30.76700 -13.99900 1.000 36.81000  ? 385 LYS A O     1 
ATOM   3086 C  CB    . LYS A 1 397 ? -45.89500 -30.86200 -10.70600 1.000 31.11000  ? 385 LYS A CB    1 
ATOM   3087 C  CG    . LYS A 1 397 ? -47.25200 -30.60000 -11.28800 1.000 28.23000  ? 385 LYS A CG    1 
ATOM   3088 C  CD    . LYS A 1 397 ? -48.34200 -30.92500 -10.29000 1.000 34.38000  ? 385 LYS A CD    1 
ATOM   3089 C  CE    . LYS A 1 397 ? -48.87600 -32.34200 -10.49500 1.000 39.16000  ? 385 LYS A CE    1 
ATOM   3090 N  NZ    . LYS A 1 397 ? -50.26900 -32.43400 -9.94400  1.000 52.57000  ? 385 LYS A NZ    1 
ATOM   3091 N  N     . THR A 1 398 ? -44.65700 -32.61200 -12.78100 1.000 35.46000  ? 386 THR A N     1 
ATOM   3092 C  CA    . THR A 1 398 ? -44.70300 -33.56100 -13.87700 1.000 33.58000  ? 386 THR A CA    1 
ATOM   3093 C  C     . THR A 1 398 ? -46.12000 -34.10000 -14.02100 1.000 28.23000  ? 386 THR A C     1 
ATOM   3094 O  O     . THR A 1 398 ? -46.80000 -34.28200 -13.02500 1.000 34.17000  ? 386 THR A O     1 
ATOM   3095 C  CB    . THR A 1 398 ? -43.71200 -34.69500 -13.58700 1.000 34.84000  ? 386 THR A CB    1 
ATOM   3096 O  OG1   . THR A 1 398 ? -42.42700 -34.10900 -13.34200 1.000 32.90000  ? 386 THR A OG1   1 
ATOM   3097 C  CG2   . THR A 1 398 ? -43.61400 -35.67000 -14.73700 1.000 34.20000  ? 386 THR A CG2   1 
ATOM   3098 N  N     . PRO A 1 399 ? -46.58600 -34.34500 -15.24800 1.000 28.45000  ? 387 PRO A N     1 
ATOM   3099 C  CA    . PRO A 1 399 ? -47.93100 -34.91300 -15.33200 1.000 31.78000  ? 387 PRO A CA    1 
ATOM   3100 C  C     . PRO A 1 399 ? -47.89900 -36.43700 -15.31300 1.000 32.56000  ? 387 PRO A C     1 
ATOM   3101 O  O     . PRO A 1 399 ? -46.83000 -37.03100 -15.41600 1.000 32.03000  ? 387 PRO A O     1 
ATOM   3102 C  CB    . PRO A 1 399 ? -48.44500 -34.39300 -16.67200 1.000 34.77000  ? 387 PRO A CB    1 
ATOM   3103 C  CG    . PRO A 1 399 ? -47.20500 -34.30400 -17.51900 1.000 35.94000  ? 387 PRO A CG    1 
ATOM   3104 C  CD    . PRO A 1 399 ? -46.02400 -34.06800 -16.58000 1.000 34.26000  ? 387 PRO A CD    1 
ATOM   3105 N  N     . LYS A 1 400 ? -49.06300 -37.05300 -15.14000 1.000 34.91000  ? 388 LYS A N     1 
ATOM   3106 C  CA    . LYS A 1 400 ? -49.21700 -38.49300 -15.29600 1.000 36.81000  ? 388 LYS A CA    1 
ATOM   3107 C  C     . LYS A 1 400 ? -49.48500 -38.75600 -16.77400 1.000 32.36000  ? 388 LYS A C     1 
ATOM   3108 O  O     . LYS A 1 400 ? -50.15400 -37.95900 -17.43500 1.000 37.06000  ? 388 LYS A O     1 
ATOM   3109 C  CB    . LYS A 1 400 ? -50.34700 -39.02300 -14.40000 1.000 38.85000  ? 388 LYS A CB    1 
ATOM   3110 C  CG    . LYS A 1 400 ? -50.04200 -38.83400 -12.92200 1.000 45.54000  ? 388 LYS A CG    1 
ATOM   3111 C  CD    . LYS A 1 400 ? -51.11200 -39.39900 -12.01900 1.000 58.48000  ? 388 LYS A CD    1 
ATOM   3112 C  CE    . LYS A 1 400 ? -50.76100 -39.13700 -10.54600 1.000 62.71000  ? 388 LYS A CE    1 
ATOM   3113 N  NZ    . LYS A 1 400 ? -51.52400 -40.00900 -9.59400  1.000 55.80000  ? 388 LYS A NZ    1 
ATOM   3114 N  N     . PHE A 1 401 ? -48.95400 -39.84200 -17.31800 1.000 34.12000  ? 389 PHE A N     1 
ATOM   3115 C  CA    . PHE A 1 401 ? -49.10500 -40.05300 -18.75700 1.000 36.26000  ? 389 PHE A CA    1 
ATOM   3116 C  C     . PHE A 1 401 ? -50.09900 -41.15000 -19.14100 1.000 37.14000  ? 389 PHE A C     1 
ATOM   3117 O  O     . PHE A 1 401 ? -50.30200 -42.13200 -18.41100 1.000 31.73000  ? 389 PHE A O     1 
ATOM   3118 C  CB    . PHE A 1 401 ? -47.75200 -40.35700 -19.40000 1.000 28.04000  ? 389 PHE A CB    1 
ATOM   3119 C  CG    . PHE A 1 401 ? -46.85500 -39.18600 -19.44500 1.000 28.64000  ? 389 PHE A CG    1 
ATOM   3120 C  CD1   . PHE A 1 401 ? -46.02200 -38.89900 -18.37700 1.000 35.26000  ? 389 PHE A CD1   1 
ATOM   3121 C  CD2   . PHE A 1 401 ? -46.86300 -38.33800 -20.53600 1.000 30.95000  ? 389 PHE A CD2   1 
ATOM   3122 C  CE1   . PHE A 1 401 ? -45.18100 -37.79200 -18.40600 1.000 31.30000  ? 389 PHE A CE1   1 
ATOM   3123 C  CE2   . PHE A 1 401 ? -46.04000 -37.22900 -20.56700 1.000 28.84000  ? 389 PHE A CE2   1 
ATOM   3124 C  CZ    . PHE A 1 401 ? -45.19500 -36.95900 -19.50300 1.000 27.39000  ? 389 PHE A CZ    1 
ATOM   3125 N  N     . LYS A 1 402 ? -50.72100 -40.92900 -20.29800 1.000 32.68000  ? 390 LYS A N     1 
ATOM   3126 C  CA    . LYS A 1 402 ? -51.54100 -41.90400 -20.99200 1.000 31.72000  ? 390 LYS A CA    1 
ATOM   3127 C  C     . LYS A 1 402 ? -50.85500 -42.14300 -22.34100 1.000 33.46000  ? 390 LYS A C     1 
ATOM   3128 O  O     . LYS A 1 402 ? -50.81200 -41.23700 -23.16200 1.000 34.34000  ? 390 LYS A O     1 
ATOM   3129 C  CB    . LYS A 1 402 ? -52.96300 -41.36700 -21.17500 1.000 32.47000  ? 390 LYS A CB    1 
ATOM   3130 C  CG    . LYS A 1 402 ? -54.02000 -41.86700 -20.19000 1.000 37.73000  ? 390 LYS A CG    1 
ATOM   3131 C  CD    . LYS A 1 402 ? -53.72900 -41.52800 -18.74000 1.000 43.57000  ? 390 LYS A CD    1 
ATOM   3132 C  CE    . LYS A 1 402 ? -54.74100 -42.22500 -17.80800 1.000 55.44000  ? 390 LYS A CE    1 
ATOM   3133 N  NZ    . LYS A 1 402 ? -54.46100 -42.04800 -16.34000 1.000 58.02000  ? 390 LYS A NZ    1 
ATOM   3134 N  N     . LEU A 1 403 ? -50.30200 -43.33300 -22.57700 1.000 31.51000  ? 391 LEU A N     1 
ATOM   3135 C  CA    . LEU A 1 403 ? -49.51800 -43.57700 -23.79000 1.000 26.61000  ? 391 LEU A CA    1 
ATOM   3136 C  C     . LEU A 1 403 ? -49.99300 -44.79800 -24.59800 1.000 35.83000  ? 391 LEU A C     1 
ATOM   3137 O  O     . LEU A 1 403 ? -50.32600 -45.84200 -24.03500 1.000 34.69000  ? 391 LEU A O     1 
ATOM   3138 C  CB    . LEU A 1 403 ? -48.04300 -43.76200 -23.41400 1.000 32.48000  ? 391 LEU A CB    1 
ATOM   3139 C  CG    . LEU A 1 403 ? -47.41500 -42.76600 -22.42500 1.000 37.82000  ? 391 LEU A CG    1 
ATOM   3140 C  CD1   . LEU A 1 403 ? -45.98500 -43.16300 -21.97300 1.000 33.78000  ? 391 LEU A CD1   1 
ATOM   3141 C  CD2   . LEU A 1 403 ? -47.43700 -41.36500 -23.01800 1.000 26.49000  ? 391 LEU A CD2   1 
ATOM   3142 N  N     . PRO A 1 404 ? -50.00200 -44.68400 -25.92900 1.000 33.14000  ? 392 PRO A N     1 
ATOM   3143 C  CA    . PRO A 1 404 ? -50.38000 -45.80700 -26.79300 1.000 31.48000  ? 392 PRO A CA    1 
ATOM   3144 C  C     . PRO A 1 404 ? -49.27400 -46.84700 -26.93100 1.000 37.01000  ? 392 PRO A C     1 
ATOM   3145 O  O     . PRO A 1 404 ? -48.80300 -47.09900 -28.05400 1.000 33.83000  ? 392 PRO A O     1 
ATOM   3146 C  CB    . PRO A 1 404 ? -50.64200 -45.13400 -28.13800 1.000 34.14000  ? 392 PRO A CB    1 
ATOM   3147 C  CG    . PRO A 1 404 ? -49.76300 -43.94100 -28.12000 1.000 37.73000  ? 392 PRO A CG    1 
ATOM   3148 C  CD    . PRO A 1 404 ? -49.73000 -43.45900 -26.69500 1.000 32.74000  ? 392 PRO A CD    1 
ATOM   3149 N  N     . ILE A 1 405 ? -48.85500 -47.43000 -25.80900 1.000 34.86000  ? 393 ILE A N     1 
ATOM   3150 C  CA    . ILE A 1 405 ? -47.81100 -48.45300 -25.81600 1.000 33.94000  ? 393 ILE A CA    1 
ATOM   3151 C  C     . ILE A 1 405 ? -48.04600 -49.44000 -24.67900 1.000 33.92000  ? 393 ILE A C     1 
ATOM   3152 O  O     . ILE A 1 405 ? -48.13400 -49.04900 -23.52700 1.000 35.56000  ? 393 ILE A O     1 
ATOM   3153 C  CB    . ILE A 1 405 ? -46.38000 -47.82500 -25.70100 1.000 35.65000  ? 393 ILE A CB    1 
ATOM   3154 C  CG1   . ILE A 1 405 ? -45.29000 -48.90000 -25.72500 1.000 35.13000  ? 393 ILE A CG1   1 
ATOM   3155 C  CG2   . ILE A 1 405 ? -46.22600 -46.97400 -24.45600 1.000 26.42000  ? 393 ILE A CG2   1 
ATOM   3156 C  CD1   . ILE A 1 405 ? -43.88700 -48.34300 -25.49600 1.000 35.02000  ? 393 ILE A CD1   1 
ATOM   3157 N  N     . GLN A 1 406 ? -48.16800 -50.72000 -25.01100 1.000 37.76000  ? 394 GLN A N     1 
ATOM   3158 C  CA    . GLN A 1 406 ? -48.41800 -51.75000 -24.00800 1.000 36.80000  ? 394 GLN A CA    1 
ATOM   3159 C  C     . GLN A 1 406 ? -47.34300 -51.76600 -22.95300 1.000 36.01000  ? 394 GLN A C     1 
ATOM   3160 O  O     . GLN A 1 406 ? -46.19300 -51.46800 -23.24200 1.000 40.88000  ? 394 GLN A O     1 
ATOM   3161 C  CB    . GLN A 1 406 ? -48.47500 -53.11400 -24.65900 1.000 41.22000  ? 394 GLN A CB    1 
ATOM   3162 C  CG    . GLN A 1 406 ? -49.37900 -53.18100 -25.85000 1.000 45.96000  ? 394 GLN A CG    1 
ATOM   3163 C  CD    . GLN A 1 406 ? -50.73400 -53.68000 -25.46600 1.000 56.85000  ? 394 GLN A CD    1 
ATOM   3164 O  OE1   . GLN A 1 406 ? -51.10900 -53.63700 -24.28900 1.000 60.23000  ? 394 GLN A OE1   1 
ATOM   3165 N  NE2   . GLN A 1 406 ? -51.48100 -54.18100 -26.44800 1.000 57.07000  ? 394 GLN A NE2   1 
ATOM   3166 N  N     . LYS A 1 407 ? -47.69900 -52.13500 -21.73300 1.000 39.17000  ? 395 LYS A N     1 
ATOM   3167 C  CA    . LYS A 1 407 ? -46.69500 -52.28500 -20.69400 1.000 36.69000  ? 395 LYS A CA    1 
ATOM   3168 C  C     . LYS A 1 407 ? -45.56500 -53.22700 -21.12200 1.000 45.59000  ? 395 LYS A C     1 
ATOM   3169 O  O     . LYS A 1 407 ? -44.39900 -52.98800 -20.80200 1.000 52.30000  ? 395 LYS A O     1 
ATOM   3170 C  CB    . LYS A 1 407 ? -47.33900 -52.80400 -19.42000 1.000 41.70000  ? 395 LYS A CB    1 
ATOM   3171 C  CG    . LYS A 1 407 ? -47.21800 -51.86100 -18.26600 1.000 43.25000  ? 395 LYS A CG    1 
ATOM   3172 C  CD    . LYS A 1 407 ? -47.82400 -50.53600 -18.62100 1.000 35.07000  ? 395 LYS A CD    1 
ATOM   3173 C  CE    . LYS A 1 407 ? -47.87600 -49.59600 -17.41200 1.000 47.18000  ? 395 LYS A CE    1 
ATOM   3174 N  NZ    . LYS A 1 407 ? -46.61000 -48.85100 -17.07200 1.000 46.17000  ? 395 LYS A NZ    1 
ATOM   3175 N  N     . GLU A 1 408 ? -45.89700 -54.28600 -21.85600 1.000 42.66000  ? 396 GLU A N     1 
ATOM   3176 C  CA    . GLU A 1 408 ? -44.89500 -55.30100 -22.17200 1.000 47.71000  ? 396 GLU A CA    1 
ATOM   3177 C  C     . GLU A 1 408 ? -44.00600 -54.90500 -23.33400 1.000 42.70000  ? 396 GLU A C     1 
ATOM   3178 O  O     . GLU A 1 408 ? -42.86400 -55.34900 -23.41500 1.000 46.16000  ? 396 GLU A O     1 
ATOM   3179 C  CB    . GLU A 1 408 ? -45.53500 -56.65600 -22.47400 1.000 51.28000  ? 396 GLU A CB    1 
ATOM   3180 C  CG    . GLU A 1 408 ? -44.71000 -57.77600 -21.87700 1.000 65.66000  ? 396 GLU A CG    1 
ATOM   3181 C  CD    . GLU A 1 408 ? -44.96200 -59.11300 -22.53000 1.000 93.13000  ? 396 GLU A CD    1 
ATOM   3182 O  OE1   . GLU A 1 408 ? -46.06500 -59.29900 -23.08800 1.000 94.80000  ? 396 GLU A OE1   1 
ATOM   3183 O  OE2   . GLU A 1 408 ? -44.05000 -59.97300 -22.49000 1.000 105.29000 ? 396 GLU A OE2   1 
ATOM   3184 N  N     . THR A 1 409 ? -44.51900 -54.08300 -24.24100 1.000 42.24000  ? 397 THR A N     1 
ATOM   3185 C  CA    . THR A 1 409 ? -43.66000 -53.52500 -25.28200 1.000 40.99000  ? 397 THR A CA    1 
ATOM   3186 C  C     . THR A 1 409 ? -42.54900 -52.71900 -24.62200 1.000 44.92000  ? 397 THR A C     1 
ATOM   3187 O  O     . THR A 1 409 ? -41.37000 -52.87200 -24.94100 1.000 38.63000  ? 397 THR A O     1 
ATOM   3188 C  CB    . THR A 1 409 ? -44.41600 -52.60900 -26.24300 1.000 30.83000  ? 397 THR A CB    1 
ATOM   3189 O  OG1   . THR A 1 409 ? -45.53500 -53.30600 -26.78800 1.000 37.88000  ? 397 THR A OG1   1 
ATOM   3190 C  CG2   . THR A 1 409 ? -43.50300 -52.14800 -27.35900 1.000 27.21000  ? 397 THR A CG2   1 
ATOM   3191 N  N     . TRP A 1 410 ? -42.95000 -51.85400 -23.69800 1.000 44.20000  ? 398 TRP A N     1 
ATOM   3192 C  CA    . TRP A 1 410 ? -42.00300 -51.02500 -22.99800 1.000 40.10000  ? 398 TRP A CA    1 
ATOM   3193 C  C     . TRP A 1 410 ? -41.00400 -51.91300 -22.28200 1.000 41.18000  ? 398 TRP A C     1 
ATOM   3194 O  O     . TRP A 1 410 ? -39.80100 -51.73900 -22.41800 1.000 47.14000  ? 398 TRP A O     1 
ATOM   3195 C  CB    . TRP A 1 410 ? -42.70100 -50.10100 -22.00400 1.000 42.98000  ? 398 TRP A CB    1 
ATOM   3196 C  CG    . TRP A 1 410 ? -41.71300 -49.42400 -21.19100 1.000 43.07000  ? 398 TRP A CG    1 
ATOM   3197 C  CD1   . TRP A 1 410 ? -41.40100 -49.68000 -19.89100 1.000 50.69000  ? 398 TRP A CD1   1 
ATOM   3198 C  CD2   . TRP A 1 410 ? -40.81400 -48.41300 -21.63000 1.000 41.66000  ? 398 TRP A CD2   1 
ATOM   3199 N  NE1   . TRP A 1 410 ? -40.37400 -48.86300 -19.48200 1.000 49.46000  ? 398 TRP A NE1   1 
ATOM   3200 C  CE2   . TRP A 1 410 ? -39.99900 -48.07500 -20.53900 1.000 46.66000  ? 398 TRP A CE2   1 
ATOM   3201 C  CE3   . TRP A 1 410 ? -40.62800 -47.75000 -22.83900 1.000 41.26000  ? 398 TRP A CE3   1 
ATOM   3202 C  CZ2   . TRP A 1 410 ? -39.01200 -47.10300 -20.62500 1.000 45.17000  ? 398 TRP A CZ2   1 
ATOM   3203 C  CZ3   . TRP A 1 410 ? -39.65700 -46.78600 -22.91800 1.000 40.82000  ? 398 TRP A CZ3   1 
ATOM   3204 C  CH2   . TRP A 1 410 ? -38.85800 -46.47200 -21.82300 1.000 42.91000  ? 398 TRP A CH2   1 
ATOM   3205 N  N     . GLU A 1 411 ? -41.50800 -52.88600 -21.54300 1.000 44.95000  ? 399 GLU A N     1 
ATOM   3206 C  CA    . GLU A 1 411 ? -40.64600 -53.77200 -20.76200 1.000 46.20000  ? 399 GLU A CA    1 
ATOM   3207 C  C     . GLU A 1 411 ? -39.63000 -54.53500 -21.60600 1.000 45.68000  ? 399 GLU A C     1 
ATOM   3208 O  O     . GLU A 1 411 ? -38.49500 -54.74700 -21.17600 1.000 46.10000  ? 399 GLU A O     1 
ATOM   3209 C  CB    . GLU A 1 411 ? -41.50700 -54.74700 -19.97500 1.000 48.20000  ? 399 GLU A CB    1 
ATOM   3210 C  CG    . GLU A 1 411 ? -42.10300 -54.09900 -18.74500 1.000 58.03000  ? 399 GLU A CG    1 
ATOM   3211 C  CD    . GLU A 1 411 ? -41.28200 -54.40300 -17.51300 1.000 69.08000  ? 399 GLU A CD    1 
ATOM   3212 O  OE1   . GLU A 1 411 ? -40.32800 -55.21800 -17.64600 1.000 57.97000  ? 399 GLU A OE1   1 
ATOM   3213 O  OE2   . GLU A 1 411 ? -41.59600 -53.84600 -16.43000 1.000 69.60000  ? 399 GLU A OE2   1 
ATOM   3214 N  N     . THR A 1 412 ? -40.03500 -54.95100 -22.80400 1.000 42.58000  ? 400 THR A N     1 
ATOM   3215 C  CA    . THR A 1 412 ? -39.11400 -55.62200 -23.70400 1.000 38.19000  ? 400 THR A CA    1 
ATOM   3216 C  C     . THR A 1 412 ? -37.98100 -54.66400 -24.08300 1.000 49.32000  ? 400 THR A C     1 
ATOM   3217 O  O     . THR A 1 412 ? -36.80700 -55.03000 -24.02100 1.000 47.34000  ? 400 THR A O     1 
ATOM   3218 C  CB    . THR A 1 412 ? -39.81500 -56.11900 -24.97500 1.000 41.62000  ? 400 THR A CB    1 
ATOM   3219 O  OG1   . THR A 1 412 ? -40.96600 -56.89400 -24.62400 1.000 50.10000  ? 400 THR A OG1   1 
ATOM   3220 C  CG2   . THR A 1 412 ? -38.87400 -56.97400 -25.79300 1.000 42.96000  ? 400 THR A CG2   1 
ATOM   3221 N  N     . TRP A 1 413 ? -38.34500 -53.43600 -24.45500 1.000 42.10000  ? 401 TRP A N     1 
ATOM   3222 C  CA    . TRP A 1 413 ? -37.38900 -52.42900 -24.88700 1.000 38.53000  ? 401 TRP A CA    1 
ATOM   3223 C  C     . TRP A 1 413 ? -36.37100 -52.09600 -23.80600 1.000 42.94000  ? 401 TRP A C     1 
ATOM   3224 O  O     . TRP A 1 413 ? -35.16400 -52.08100 -24.05500 1.000 39.21000  ? 401 TRP A O     1 
ATOM   3225 C  CB    . TRP A 1 413 ? -38.12500 -51.16700 -25.29800 1.000 38.88000  ? 401 TRP A CB    1 
ATOM   3226 C  CG    . TRP A 1 413 ? -37.22100 -50.03500 -25.59000 1.000 38.27000  ? 401 TRP A CG    1 
ATOM   3227 C  CD1   . TRP A 1 413 ? -37.07500 -48.88800 -24.86300 1.000 38.14000  ? 401 TRP A CD1   1 
ATOM   3228 C  CD2   . TRP A 1 413 ? -36.31800 -49.93200 -26.69200 1.000 39.53000  ? 401 TRP A CD2   1 
ATOM   3229 N  NE1   . TRP A 1 413 ? -36.13700 -48.07300 -25.45100 1.000 35.97000  ? 401 TRP A NE1   1 
ATOM   3230 C  CE2   . TRP A 1 413 ? -35.65600 -48.69000 -26.57500 1.000 36.16000  ? 401 TRP A CE2   1 
ATOM   3231 C  CE3   . TRP A 1 413 ? -36.00200 -50.77000 -27.76800 1.000 40.61000  ? 401 TRP A CE3   1 
ATOM   3232 C  CZ2   . TRP A 1 413 ? -34.69800 -48.26800 -27.49300 1.000 36.92000  ? 401 TRP A CZ2   1 
ATOM   3233 C  CZ3   . TRP A 1 413 ? -35.04900 -50.34800 -28.68200 1.000 36.94000  ? 401 TRP A CZ3   1 
ATOM   3234 C  CH2   . TRP A 1 413 ? -34.40300 -49.11400 -28.53400 1.000 39.39000  ? 401 TRP A CH2   1 
ATOM   3235 N  N     . TRP A 1 414 ? -36.87200 -51.82600 -22.60600 1.000 39.50000  ? 402 TRP A N     1 
ATOM   3236 C  CA    . TRP A 1 414 ? -36.03100 -51.55500 -21.44500 1.000 41.00000  ? 402 TRP A CA    1 
ATOM   3237 C  C     . TRP A 1 414 ? -35.10200 -52.73100 -21.10400 1.000 53.85000  ? 402 TRP A C     1 
ATOM   3238 O  O     . TRP A 1 414 ? -34.06200 -52.55800 -20.47000 1.000 59.35000  ? 402 TRP A O     1 
ATOM   3239 C  CB    . TRP A 1 414 ? -36.91700 -51.21600 -20.24500 1.000 45.96000  ? 402 TRP A CB    1 
ATOM   3240 C  CG    . TRP A 1 414 ? -36.23400 -51.34800 -18.94300 1.000 52.01000  ? 402 TRP A CG    1 
ATOM   3241 C  CD1   . TRP A 1 414 ? -35.54100 -50.38000 -18.28400 1.000 51.63000  ? 402 TRP A CD1   1 
ATOM   3242 C  CD2   . TRP A 1 414 ? -36.15700 -52.52500 -18.13000 1.000 56.49000  ? 402 TRP A CD2   1 
ATOM   3243 N  NE1   . TRP A 1 414 ? -35.04200 -50.87400 -17.10500 1.000 54.17000  ? 402 TRP A NE1   1 
ATOM   3244 C  CE2   . TRP A 1 414 ? -35.40800 -52.18900 -16.98300 1.000 57.33000  ? 402 TRP A CE2   1 
ATOM   3245 C  CE3   . TRP A 1 414 ? -36.64600 -53.83300 -18.26300 1.000 51.51000  ? 402 TRP A CE3   1 
ATOM   3246 C  CZ2   . TRP A 1 414 ? -35.13400 -53.11000 -15.96900 1.000 62.34000  ? 402 TRP A CZ2   1 
ATOM   3247 C  CZ3   . TRP A 1 414 ? -36.37800 -54.74700 -17.25800 1.000 51.06000  ? 402 TRP A CZ3   1 
ATOM   3248 C  CH2   . TRP A 1 414 ? -35.62600 -54.38200 -16.12400 1.000 67.32000  ? 402 TRP A CH2   1 
ATOM   3249 N  N     . THR A 1 415 ? -35.48900 -53.93300 -21.51900 1.000 55.86000  ? 403 THR A N     1 
ATOM   3250 C  CA    . THR A 1 415 ? -34.70800 -55.13300 -21.24500 1.000 50.14000  ? 403 THR A CA    1 
ATOM   3251 C  C     . THR A 1 415 ? -33.59100 -55.35100 -22.27100 1.000 51.89000  ? 403 THR A C     1 
ATOM   3252 O  O     . THR A 1 415 ? -32.49900 -55.78000 -21.92100 1.000 65.20000  ? 403 THR A O     1 
ATOM   3253 C  CB    . THR A 1 415 ? -35.61500 -56.37900 -21.21600 1.000 49.56000  ? 403 THR A CB    1 
ATOM   3254 O  OG1   . THR A 1 415 ? -36.56000 -56.25500 -20.14700 1.000 46.32000  ? 403 THR A OG1   1 
ATOM   3255 C  CG2   . THR A 1 415 ? -34.78700 -57.63700 -21.00400 1.000 49.85000  ? 403 THR A CG2   1 
ATOM   3256 N  N     . GLU A 1 416 ? -33.86600 -55.03700 -23.53300 1.000 50.59000  ? 404 GLU A N     1 
ATOM   3257 C  CA    . GLU A 1 416 ? -32.92700 -55.28000 -24.62600 1.000 52.83000  ? 404 GLU A CA    1 
ATOM   3258 C  C     . GLU A 1 416 ? -32.09300 -54.04000 -25.06100 1.000 56.99000  ? 404 GLU A C     1 
ATOM   3259 O  O     . GLU A 1 416 ? -31.12300 -54.19000 -25.81900 1.000 53.00000  ? 404 GLU A O     1 
ATOM   3260 C  CB    . GLU A 1 416 ? -33.69400 -55.86100 -25.83200 1.000 49.74000  ? 404 GLU A CB    1 
ATOM   3261 C  CG    . GLU A 1 416 ? -34.57400 -54.86800 -26.59400 1.000 55.19000  ? 404 GLU A CG    1 
ATOM   3262 C  CD    . GLU A 1 416 ? -35.68500 -55.54000 -27.42400 1.000 62.90000  ? 404 GLU A CD    1 
ATOM   3263 O  OE1   . GLU A 1 416 ? -35.80900 -56.79100 -27.38800 1.000 65.88000  ? 404 GLU A OE1   1 
ATOM   3264 O  OE2   . GLU A 1 416 ? -36.45400 -54.81000 -28.10200 1.000 58.13000  ? 404 GLU A OE2   1 
ATOM   3265 N  N     . TYR A 1 417 ? -32.45300 -52.84100 -24.58100 1.000 52.40000  ? 405 TYR A N     1 
ATOM   3266 C  CA    . TYR A 1 417 ? -31.67200 -51.61500 -24.84600 1.000 47.36000  ? 405 TYR A CA    1 
ATOM   3267 C  C     . TYR A 1 417 ? -30.58300 -51.46600 -23.81400 1.000 44.19000  ? 405 TYR A C     1 
ATOM   3268 O  O     . TYR A 1 417 ? -30.85800 -51.51700 -22.61700 1.000 46.08000  ? 405 TYR A O     1 
ATOM   3269 C  CB    . TYR A 1 417 ? -32.55400 -50.35400 -24.82100 1.000 44.08000  ? 405 TYR A CB    1 
ATOM   3270 C  CG    . TYR A 1 417 ? -31.99500 -49.15200 -25.57700 1.000 43.45000  ? 405 TYR A CG    1 
ATOM   3271 C  CD1   . TYR A 1 417 ? -31.20500 -49.32100 -26.71100 1.000 46.20000  ? 405 TYR A CD1   1 
ATOM   3272 C  CD2   . TYR A 1 417 ? -32.27200 -47.84500 -25.15700 1.000 40.78000  ? 405 TYR A CD2   1 
ATOM   3273 C  CE1   . TYR A 1 417 ? -30.71000 -48.22900 -27.40800 1.000 42.88000  ? 405 TYR A CE1   1 
ATOM   3274 C  CE2   . TYR A 1 417 ? -31.78200 -46.74900 -25.84600 1.000 33.93000  ? 405 TYR A CE2   1 
ATOM   3275 C  CZ    . TYR A 1 417 ? -30.99900 -46.94600 -26.97200 1.000 42.83000  ? 405 TYR A CZ    1 
ATOM   3276 O  OH    . TYR A 1 417 ? -30.50400 -45.85500 -27.66700 1.000 56.42000  ? 405 TYR A OH    1 
ATOM   3277 N  N     . TRP A 1 418 ? -29.35900 -51.24500 -24.27800 1.000 48.86000  ? 406 TRP A N     1 
ATOM   3278 C  CA    . TRP A 1 418 ? -28.19600 -51.17900 -23.40200 1.000 47.33000  ? 406 TRP A CA    1 
ATOM   3279 C  C     . TRP A 1 418 ? -28.02900 -49.82400 -22.71100 1.000 48.97000  ? 406 TRP A C     1 
ATOM   3280 O  O     . TRP A 1 418 ? -27.05300 -49.61900 -21.99200 1.000 53.90000  ? 406 TRP A O     1 
ATOM   3281 C  CB    . TRP A 1 418 ? -26.93600 -51.49700 -24.20400 1.000 61.85000  ? 406 TRP A CB    1 
ATOM   3282 C  CG    . TRP A 1 418 ? -26.80200 -50.60700 -25.39100 1.000 64.13000  ? 406 TRP A CG    1 
ATOM   3283 C  CD1   . TRP A 1 418 ? -26.29800 -49.33000 -25.41700 1.000 67.48000  ? 406 TRP A CD1   1 
ATOM   3284 C  CD2   . TRP A 1 418 ? -27.21100 -50.90400 -26.72500 1.000 68.01000  ? 406 TRP A CD2   1 
ATOM   3285 N  NE1   . TRP A 1 418 ? -26.36500 -48.81900 -26.69300 1.000 69.70000  ? 406 TRP A NE1   1 
ATOM   3286 C  CE2   . TRP A 1 418 ? -26.92000 -49.76600 -27.51800 1.000 72.44000  ? 406 TRP A CE2   1 
ATOM   3287 C  CE3   . TRP A 1 418 ? -27.79600 -52.02300 -27.33200 1.000 68.96000  ? 406 TRP A CE3   1 
ATOM   3288 C  CZ2   . TRP A 1 418 ? -27.18900 -49.71800 -28.89100 1.000 69.62000  ? 406 TRP A CZ2   1 
ATOM   3289 C  CZ3   . TRP A 1 418 ? -28.06400 -51.97500 -28.69300 1.000 66.77000  ? 406 TRP A CZ3   1 
ATOM   3290 C  CH2   . TRP A 1 418 ? -27.75800 -50.82800 -29.45900 1.000 65.46000  ? 406 TRP A CH2   1 
ATOM   3291 N  N     . GLN A 1 419 ? -28.95600 -48.89800 -22.94800 1.000 46.13000  ? 407 GLN A N     1 
ATOM   3292 C  CA    . GLN A 1 419 ? -28.91500 -47.57700 -22.32700 1.000 40.03000  ? 407 GLN A CA    1 
ATOM   3293 C  C     . GLN A 1 419 ? -29.90700 -47.45100 -21.17000 1.000 42.46000  ? 407 GLN A C     1 
ATOM   3294 O  O     . GLN A 1 419 ? -30.89100 -48.18500 -21.08100 1.000 43.81000  ? 407 GLN A O     1 
ATOM   3295 C  CB    . GLN A 1 419 ? -29.20500 -46.48300 -23.35900 1.000 39.77000  ? 407 GLN A CB    1 
ATOM   3296 C  CG    . GLN A 1 419 ? -28.25000 -46.44100 -24.52700 1.000 44.46000  ? 407 GLN A CG    1 
ATOM   3297 C  CD    . GLN A 1 419 ? -27.12300 -45.44000 -24.32600 1.000 61.75000  ? 407 GLN A CD    1 
ATOM   3298 O  OE1   . GLN A 1 419 ? -25.95200 -45.81900 -24.14700 1.000 60.58000  ? 407 GLN A OE1   1 
ATOM   3299 N  NE2   . GLN A 1 419 ? -27.46800 -44.14800 -24.36800 1.000 48.93000  ? 407 GLN A NE2   1 
ATOM   3300 N  N     . ALA A 1 420 ? -29.64100 -46.51600 -20.27300 1.000 40.83000  ? 408 ALA A N     1 
ATOM   3301 C  CA    . ALA A 1 420 ? -30.59600 -46.21500 -19.23100 1.000 37.93000  ? 408 ALA A CA    1 
ATOM   3302 C  C     . ALA A 1 420 ? -31.74200 -45.45800 -19.87200 1.000 43.65000  ? 408 ALA A C     1 
ATOM   3303 O  O     . ALA A 1 420 ? -31.52300 -44.43400 -20.52900 1.000 43.40000  ? 408 ALA A O     1 
ATOM   3304 C  CB    . ALA A 1 420 ? -29.95600 -45.39300 -18.12100 1.000 40.04000  ? 408 ALA A CB    1 
ATOM   3305 N  N     . THR A 1 421 ? -32.95800 -45.96000 -19.71200 1.000 37.54000  ? 409 THR A N     1 
ATOM   3306 C  CA    . THR A 1 421 ? -34.10200 -45.22000 -20.19700 1.000 32.72000  ? 409 THR A CA    1 
ATOM   3307 C  C     . THR A 1 421 ? -35.26300 -45.41200 -19.24000 1.000 37.99000  ? 409 THR A C     1 
ATOM   3308 O  O     . THR A 1 421 ? -35.34700 -46.43200 -18.55400 1.000 41.50000  ? 409 THR A O     1 
ATOM   3309 C  CB    . THR A 1 421 ? -34.49300 -45.63600 -21.63300 1.000 33.90000  ? 409 THR A CB    1 
ATOM   3310 O  OG1   . THR A 1 421 ? -35.50400 -44.74500 -22.10700 1.000 40.40000  ? 409 THR A OG1   1 
ATOM   3311 C  CG2   . THR A 1 421 ? -34.99200 -47.08400 -21.71100 1.000 34.91000  ? 409 THR A CG2   1 
ATOM   3312 N  N     . TRP A 1 422 ? -36.14500 -44.42000 -19.17400 1.000 36.32000  ? 410 TRP A N     1 
ATOM   3313 C  CA    . TRP A 1 422 ? -37.22700 -44.44000 -18.20100 1.000 39.16000  ? 410 TRP A CA    1 
ATOM   3314 C  C     . TRP A 1 422 ? -38.31300 -43.43200 -18.52600 1.000 42.46000  ? 410 TRP A C     1 
ATOM   3315 O  O     . TRP A 1 422 ? -38.02900 -42.30200 -18.94600 1.000 53.15000  ? 410 TRP A O     1 
ATOM   3316 C  CB    . TRP A 1 422 ? -36.67700 -44.17500 -16.79600 1.000 48.48000  ? 410 TRP A CB    1 
ATOM   3317 C  CG    . TRP A 1 422 ? -37.70700 -44.22700 -15.69600 1.000 46.17000  ? 410 TRP A CG    1 
ATOM   3318 C  CD1   . TRP A 1 422 ? -38.27500 -45.35100 -15.13500 1.000 45.31000  ? 410 TRP A CD1   1 
ATOM   3319 C  CD2   . TRP A 1 422 ? -38.26200 -43.11300 -15.00000 1.000 39.30000  ? 410 TRP A CD2   1 
ATOM   3320 N  NE1   . TRP A 1 422 ? -39.16700 -44.98900 -14.15000 1.000 46.72000  ? 410 TRP A NE1   1 
ATOM   3321 C  CE2   . TRP A 1 422 ? -39.17700 -43.62200 -14.04900 1.000 39.75000  ? 410 TRP A CE2   1 
ATOM   3322 C  CE3   . TRP A 1 422 ? -38.08100 -41.73200 -15.09400 1.000 40.15000  ? 410 TRP A CE3   1 
ATOM   3323 C  CZ2   . TRP A 1 422 ? -39.89800 -42.80100 -13.20100 1.000 37.35000  ? 410 TRP A CZ2   1 
ATOM   3324 C  CZ3   . TRP A 1 422 ? -38.80600 -40.91300 -14.25400 1.000 40.63000  ? 410 TRP A CZ3   1 
ATOM   3325 C  CH2   . TRP A 1 422 ? -39.70300 -41.44600 -13.31900 1.000 41.35000  ? 410 TRP A CH2   1 
ATOM   3326 N  N     . ILE A 1 423 ? -39.55400 -43.86400 -18.31800 1.000 38.63000  ? 411 ILE A N     1 
ATOM   3327 C  CA    . ILE A 1 423 ? -40.75500 -43.05700 -18.50500 1.000 38.43000  ? 411 ILE A CA    1 
ATOM   3328 C  C     . ILE A 1 423 ? -41.49200 -42.91100 -17.16200 1.000 43.47000  ? 411 ILE A C     1 
ATOM   3329 O  O     . ILE A 1 423 ? -41.68100 -43.89600 -16.43200 1.000 37.81000  ? 411 ILE A O     1 
ATOM   3330 C  CB    . ILE A 1 423 ? -41.70000 -43.70000 -19.54300 1.000 42.50000  ? 411 ILE A CB    1 
ATOM   3331 C  CG1   . ILE A 1 423 ? -41.07600 -43.69900 -20.93300 1.000 44.55000  ? 411 ILE A CG1   1 
ATOM   3332 C  CG2   . ILE A 1 423 ? -43.04100 -42.98300 -19.59600 1.000 49.96000  ? 411 ILE A CG2   1 
ATOM   3333 C  CD1   . ILE A 1 423 ? -42.02300 -44.24500 -21.97700 1.000 39.26000  ? 411 ILE A CD1   1 
ATOM   3334 N  N     . PRO A 1 424 ? -41.91500 -41.68200 -16.82000 1.000 42.88000  ? 412 PRO A N     1 
ATOM   3335 C  CA    . PRO A 1 424 ? -42.55300 -41.49700 -15.51700 1.000 37.70000  ? 412 PRO A CA    1 
ATOM   3336 C  C     . PRO A 1 424 ? -43.85400 -42.26800 -15.42600 1.000 43.68000  ? 412 PRO A C     1 
ATOM   3337 O  O     . PRO A 1 424 ? -44.19100 -42.97600 -16.37800 1.000 44.81000  ? 412 PRO A O     1 
ATOM   3338 C  CB    . PRO A 1 424 ? -42.78200 -39.98200 -15.44100 1.000 45.93000  ? 412 PRO A CB    1 
ATOM   3339 C  CG    . PRO A 1 424 ? -42.63700 -39.47600 -16.84000 1.000 42.13000  ? 412 PRO A CG    1 
ATOM   3340 C  CD    . PRO A 1 424 ? -41.71600 -40.41000 -17.53400 1.000 44.01000  ? 412 PRO A CD    1 
ATOM   3341 N  N     . GLU A 1 425 ? -44.55400 -42.15600 -14.29500 1.000 55.13000  ? 413 GLU A N     1 
ATOM   3342 C  CA    . GLU A 1 425 ? -45.79600 -42.90200 -14.06100 1.000 49.70000  ? 413 GLU A CA    1 
ATOM   3343 C  C     . GLU A 1 425 ? -46.72700 -42.83900 -15.26100 1.000 46.04000  ? 413 GLU A C     1 
ATOM   3344 O  O     . GLU A 1 425 ? -47.10400 -41.74200 -15.70700 1.000 39.00000  ? 413 GLU A O     1 
ATOM   3345 C  CB    . GLU A 1 425 ? -46.52300 -42.37100 -12.82700 1.000 47.61000  ? 413 GLU A CB    1 
ATOM   3346 C  CG    . GLU A 1 425 ? -47.95100 -42.87600 -12.74600 1.000 58.16000  ? 413 GLU A CG    1 
ATOM   3347 C  CD    . GLU A 1 425 ? -48.74900 -42.21700 -11.64600 1.000 69.43000  ? 413 GLU A CD    1 
ATOM   3348 O  OE1   . GLU A 1 425 ? -49.85700 -42.71700 -11.33500 1.000 67.75000  ? 413 GLU A OE1   1 
ATOM   3349 O  OE2   . GLU A 1 425 ? -48.26400 -41.19900 -11.09800 1.000 79.55000  ? 413 GLU A OE2   1 
ATOM   3350 N  N     . TRP A 1 426 ? -47.08800 -44.00100 -15.80400 1.000 43.08000  ? 414 TRP A N     1 
ATOM   3351 C  CA    . TRP A 1 426 ? -47.94800 -43.99000 -16.99000 1.000 42.67000  ? 414 TRP A CA    1 
ATOM   3352 C  C     . TRP A 1 426 ? -48.89300 -45.17100 -17.08900 1.000 39.16000  ? 414 TRP A C     1 
ATOM   3353 O  O     . TRP A 1 426 ? -48.72100 -46.17200 -16.40200 1.000 48.07000  ? 414 TRP A O     1 
ATOM   3354 C  CB    . TRP A 1 426 ? -47.09700 -43.91500 -18.25600 1.000 39.32000  ? 414 TRP A CB    1 
ATOM   3355 C  CG    . TRP A 1 426 ? -46.28400 -45.11500 -18.47000 1.000 43.38000  ? 414 TRP A CG    1 
ATOM   3356 C  CD1   . TRP A 1 426 ? -45.14200 -45.47200 -17.80600 1.000 44.28000  ? 414 TRP A CD1   1 
ATOM   3357 C  CD2   . TRP A 1 426 ? -46.53800 -46.14400 -19.41700 1.000 39.60000  ? 414 TRP A CD2   1 
ATOM   3358 N  NE1   . TRP A 1 426 ? -44.67100 -46.67200 -18.29000 1.000 38.35000  ? 414 TRP A NE1   1 
ATOM   3359 C  CE2   . TRP A 1 426 ? -45.50900 -47.10100 -19.28200 1.000 38.19000  ? 414 TRP A CE2   1 
ATOM   3360 C  CE3   . TRP A 1 426 ? -47.53300 -46.34800 -20.36700 1.000 31.24000  ? 414 TRP A CE3   1 
ATOM   3361 C  CZ2   . TRP A 1 426 ? -45.45400 -48.24200 -20.06200 1.000 39.00000  ? 414 TRP A CZ2   1 
ATOM   3362 C  CZ3   . TRP A 1 426 ? -47.48100 -47.47800 -21.12800 1.000 35.28000  ? 414 TRP A CZ3   1 
ATOM   3363 C  CH2   . TRP A 1 426 ? -46.44600 -48.41000 -20.98300 1.000 40.64000  ? 414 TRP A CH2   1 
ATOM   3364 N  N     . GLU A 1 427 ? -49.89300 -45.02600 -17.95800 1.000 36.80000  ? 415 GLU A N     1 
ATOM   3365 C  CA    . GLU A 1 427 ? -50.94500 -46.01100 -18.14500 1.000 38.32000  ? 415 GLU A CA    1 
ATOM   3366 C  C     . GLU A 1 427 ? -51.22800 -46.15700 -19.62800 1.000 38.60000  ? 415 GLU A C     1 
ATOM   3367 O  O     . GLU A 1 427 ? -51.10900 -45.19300 -20.37300 1.000 41.74000  ? 415 GLU A O     1 
ATOM   3368 C  CB    . GLU A 1 427 ? -52.20800 -45.59200 -17.40300 1.000 39.61000  ? 415 GLU A CB    1 
ATOM   3369 C  CG    . GLU A 1 427 ? -53.03300 -46.75400 -16.91900 1.000 53.91000  ? 415 GLU A CG    1 
ATOM   3370 C  CD    . GLU A 1 427 ? -54.24600 -46.30900 -16.11200 1.000 72.42000  ? 415 GLU A CD    1 
ATOM   3371 O  OE1   . GLU A 1 427 ? -54.47500 -45.07700 -16.01400 1.000 70.73000  ? 415 GLU A OE1   1 
ATOM   3372 O  OE2   . GLU A 1 427 ? -54.96900 -47.19300 -15.58200 1.000 73.23000  ? 415 GLU A OE2   1 
ATOM   3373 N  N     . PHE A 1 428 ? -51.61200 -47.35200 -20.06100 1.000 36.07000  ? 416 PHE A N     1 
ATOM   3374 C  CA    . PHE A 1 428 ? -51.77300 -47.62600 -21.48600 1.000 34.32000  ? 416 PHE A CA    1 
ATOM   3375 C  C     . PHE A 1 428 ? -53.14200 -47.16300 -22.00700 1.000 40.87000  ? 416 PHE A C     1 
ATOM   3376 O  O     . PHE A 1 428 ? -54.16000 -47.38200 -21.35200 1.000 45.02000  ? 416 PHE A O     1 
ATOM   3377 C  CB    . PHE A 1 428 ? -51.56300 -49.12700 -21.73000 1.000 34.00000  ? 416 PHE A CB    1 
ATOM   3378 C  CG    . PHE A 1 428 ? -52.08700 -49.62300 -23.04900 1.000 38.07000  ? 416 PHE A CG    1 
ATOM   3379 C  CD1   . PHE A 1 428 ? -51.64000 -49.09300 -24.23900 1.000 40.59000  ? 416 PHE A CD1   1 
ATOM   3380 C  CD2   . PHE A 1 428 ? -53.00300 -50.65100 -23.09700 1.000 44.57000  ? 416 PHE A CD2   1 
ATOM   3381 C  CE1   . PHE A 1 428 ? -52.11600 -49.56300 -25.45400 1.000 43.34000  ? 416 PHE A CE1   1 
ATOM   3382 C  CE2   . PHE A 1 428 ? -53.48000 -51.12100 -24.30700 1.000 46.00000  ? 416 PHE A CE2   1 
ATOM   3383 C  CZ    . PHE A 1 428 ? -53.03200 -50.57700 -25.48400 1.000 47.28000  ? 416 PHE A CZ    1 
ATOM   3384 N  N     . VAL A 1 429 ? -53.17800 -46.50100 -23.16000 1.000 36.80000  ? 417 VAL A N     1 
ATOM   3385 C  CA    . VAL A 1 429 ? -54.46500 -46.22300 -23.79700 1.000 38.71000  ? 417 VAL A CA    1 
ATOM   3386 C  C     . VAL A 1 429 ? -54.54100 -46.82500 -25.17900 1.000 44.90000  ? 417 VAL A C     1 
ATOM   3387 O  O     . VAL A 1 429 ? -53.66600 -46.60200 -26.01300 1.000 43.11000  ? 417 VAL A O     1 
ATOM   3388 C  CB    . VAL A 1 429 ? -54.77200 -44.72000 -23.91200 1.000 41.50000  ? 417 VAL A CB    1 
ATOM   3389 C  CG1   . VAL A 1 429 ? -55.15300 -44.17300 -22.56000 1.000 45.40000  ? 417 VAL A CG1   1 
ATOM   3390 C  CG2   . VAL A 1 429 ? -53.60900 -43.94400 -24.52000 1.000 39.06000  ? 417 VAL A CG2   1 
ATOM   3391 N  N     . ASN A 1 430 ? -55.60300 -47.58100 -25.43200 1.000 46.47000  ? 418 ASN A N     1 
ATOM   3392 C  CA    . ASN A 1 430 ? -55.70500 -48.28600 -26.69900 1.000 53.05000  ? 418 ASN A CA    1 
ATOM   3393 C  C     . ASN A 1 430 ? -56.20800 -47.40400 -27.82900 1.000 49.87000  ? 418 ASN A C     1 
ATOM   3394 O  O     . ASN A 1 430 ? -57.27300 -47.63700 -28.38000 1.000 61.55000  ? 418 ASN A O     1 
ATOM   3395 C  CB    . ASN A 1 430 ? -56.60900 -49.50500 -26.56600 1.000 56.40000  ? 418 ASN A CB    1 
ATOM   3396 C  CG    . ASN A 1 430 ? -56.42200 -50.47700 -27.70800 1.000 67.23000  ? 418 ASN A CG    1 
ATOM   3397 O  OD1   . ASN A 1 430 ? -56.19000 -50.06400 -28.85800 1.000 62.57000  ? 418 ASN A OD1   1 
ATOM   3398 N  ND2   . ASN A 1 430 ? -56.48700 -51.78100 -27.40000 1.000 61.38000  ? 418 ASN A ND2   1 
ATOM   3399 N  N     . THR A 1 431 ? -55.42500 -46.40300 -28.18800 1.000 43.93000  ? 419 THR A N     1 
ATOM   3400 C  CA    . THR A 1 431 ? -55.81100 -45.52400 -29.26600 1.000 44.57000  ? 419 THR A CA    1 
ATOM   3401 C  C     . THR A 1 431 ? -54.74900 -45.60500 -30.35000 1.000 42.31000  ? 419 THR A C     1 
ATOM   3402 O  O     . THR A 1 431 ? -53.73700 -44.93900 -30.26300 1.000 49.59000  ? 419 THR A O     1 
ATOM   3403 C  CB    . THR A 1 431 ? -55.99700 -44.05400 -28.77600 1.000 49.56000  ? 419 THR A CB    1 
ATOM   3404 O  OG1   . THR A 1 431 ? -54.75500 -43.50700 -28.30600 1.000 49.35000  ? 419 THR A OG1   1 
ATOM   3405 C  CG2   . THR A 1 431 ? -57.00400 -43.99800 -27.64300 1.000 61.61000  ? 419 THR A CG2   1 
ATOM   3406 N  N     . PRO A 1 432 ? -54.98200 -46.43400 -31.37600 1.000 51.20000  ? 420 PRO A N     1 
ATOM   3407 C  CA    . PRO A 1 432 ? -54.07500 -46.63100 -32.51900 1.000 43.75000  ? 420 PRO A CA    1 
ATOM   3408 C  C     . PRO A 1 432 ? -53.68100 -45.34400 -33.23600 1.000 38.37000  ? 420 PRO A C     1 
ATOM   3409 O  O     . PRO A 1 432 ? -54.40500 -44.35000 -33.15900 1.000 43.76000  ? 420 PRO A O     1 
ATOM   3410 C  CB    . PRO A 1 432 ? -54.89100 -47.53400 -33.46700 1.000 45.51000  ? 420 PRO A CB    1 
ATOM   3411 C  CG    . PRO A 1 432 ? -56.30200 -47.39600 -33.00900 1.000 54.02000  ? 420 PRO A CG    1 
ATOM   3412 C  CD    . PRO A 1 432 ? -56.21100 -47.23200 -31.52000 1.000 53.58000  ? 420 PRO A CD    1 
ATOM   3413 N  N     . PRO A 1 433 ? -52.55400 -45.36300 -33.95500 1.000 33.85000  ? 421 PRO A N     1 
ATOM   3414 C  CA    . PRO A 1 433 ? -51.64200 -46.51000 -34.06300 1.000 41.80000  ? 421 PRO A CA    1 
ATOM   3415 C  C     . PRO A 1 433 ? -50.78400 -46.71400 -32.80900 1.000 36.42000  ? 421 PRO A C     1 
ATOM   3416 O  O     . PRO A 1 433 ? -50.09800 -45.79500 -32.39200 1.000 43.91000  ? 421 PRO A O     1 
ATOM   3417 C  CB    . PRO A 1 433 ? -50.77100 -46.16400 -35.28600 1.000 36.21000  ? 421 PRO A CB    1 
ATOM   3418 C  CG    . PRO A 1 433 ? -50.91700 -44.71500 -35.49000 1.000 38.06000  ? 421 PRO A CG    1 
ATOM   3419 C  CD    . PRO A 1 433 ? -52.26200 -44.31300 -34.94700 1.000 31.84000  ? 421 PRO A CD    1 
ATOM   3420 N  N     . LEU A 1 434 ? -50.84900 -47.90200 -32.21400 1.000 39.28000  ? 422 LEU A N     1 
ATOM   3421 C  CA    . LEU A 1 434 ? -50.02600 -48.22700 -31.05500 1.000 38.97000  ? 422 LEU A CA    1 
ATOM   3422 C  C     . LEU A 1 434 ? -48.52200 -48.23200 -31.37100 1.000 43.01000  ? 422 LEU A C     1 
ATOM   3423 O  O     . LEU A 1 434 ? -48.09700 -48.61700 -32.47300 1.000 41.30000  ? 422 LEU A O     1 
ATOM   3424 C  CB    . LEU A 1 434 ? -50.41600 -49.58900 -30.48900 1.000 35.32000  ? 422 LEU A CB    1 
ATOM   3425 C  CG    . LEU A 1 434 ? -51.82100 -49.83500 -29.93300 1.000 32.06000  ? 422 LEU A CG    1 
ATOM   3426 C  CD1   . LEU A 1 434 ? -51.76200 -51.12400 -29.15200 1.000 30.91000  ? 422 LEU A CD1   1 
ATOM   3427 C  CD2   . LEU A 1 434 ? -52.29200 -48.71200 -29.04400 1.000 34.70000  ? 422 LEU A CD2   1 
ATOM   3428 N  N     . VAL A 1 435 ? -47.71900 -47.79400 -30.40300 1.000 39.97000  ? 423 VAL A N     1 
ATOM   3429 C  CA    . VAL A 1 435 ? -46.27100 -47.80900 -30.55800 1.000 41.14000  ? 423 VAL A CA    1 
ATOM   3430 C  C     . VAL A 1 435 ? -45.79100 -49.22500 -30.35800 1.000 36.94000  ? 423 VAL A C     1 
ATOM   3431 O  O     . VAL A 1 435 ? -46.05400 -49.82200 -29.31900 1.000 37.97000  ? 423 VAL A O     1 
ATOM   3432 C  CB    . VAL A 1 435 ? -45.55800 -46.87900 -29.54200 1.000 40.06000  ? 423 VAL A CB    1 
ATOM   3433 C  CG1   . VAL A 1 435 ? -44.05200 -46.95800 -29.71300 1.000 36.51000  ? 423 VAL A CG1   1 
ATOM   3434 C  CG2   . VAL A 1 435 ? -46.03800 -45.44000 -29.68900 1.000 35.73000  ? 423 VAL A CG2   1 
ATOM   3435 N  N     . LYS A 1 436 ? -45.09000 -49.77600 -31.33800 1.000 37.12000  ? 424 LYS A N     1 
ATOM   3436 C  CA    . LYS A 1 436 ? -44.59400 -51.12800 -31.16200 1.000 37.63000  ? 424 LYS A CA    1 
ATOM   3437 C  C     . LYS A 1 436 ? -43.18400 -51.31900 -31.72700 1.000 41.95000  ? 424 LYS A C     1 
ATOM   3438 O  O     . LYS A 1 436 ? -42.70800 -50.53200 -32.54400 1.000 46.36000  ? 424 LYS A O     1 
ATOM   3439 C  CB    . LYS A 1 436 ? -45.56400 -52.13100 -31.80000 1.000 39.98000  ? 424 LYS A CB    1 
ATOM   3440 C  CG    . LYS A 1 436 ? -45.52900 -52.16500 -33.31800 1.000 51.04000  ? 424 LYS A CG    1 
ATOM   3441 C  CD    . LYS A 1 436 ? -46.80800 -52.77900 -33.89900 1.000 55.22000  ? 424 LYS A CD    1 
ATOM   3442 C  CE    . LYS A 1 436 ? -46.94000 -52.49500 -35.40700 1.000 56.97000  ? 424 LYS A CE    1 
ATOM   3443 N  NZ    . LYS A 1 436 ? -45.90100 -53.19600 -36.22200 1.000 57.77000  ? 424 LYS A NZ    1 
ATOM   3444 N  N     . LEU A 1 437 ? -42.51600 -52.36200 -31.24500 1.000 45.80000  ? 425 LEU A N     1 
ATOM   3445 C  CA    . LEU A 1 437 ? -41.26500 -52.83900 -31.81000 1.000 36.79000  ? 425 LEU A CA    1 
ATOM   3446 C  C     . LEU A 1 437 ? -41.58200 -53.74200 -32.99400 1.000 33.42000  ? 425 LEU A C     1 
ATOM   3447 O  O     . LEU A 1 437 ? -42.39800 -54.64900 -32.89600 1.000 38.38000  ? 425 LEU A O     1 
ATOM   3448 C  CB    . LEU A 1 437 ? -40.45700 -53.58600 -30.75100 1.000 41.60000  ? 425 LEU A CB    1 
ATOM   3449 C  CG    . LEU A 1 437 ? -40.00600 -52.71600 -29.58000 1.000 38.92000  ? 425 LEU A CG    1 
ATOM   3450 C  CD1   . LEU A 1 437 ? -39.49600 -53.57400 -28.43100 1.000 37.86000  ? 425 LEU A CD1   1 
ATOM   3451 C  CD2   . LEU A 1 437 ? -38.92300 -51.79100 -30.08600 1.000 28.96000  ? 425 LEU A CD2   1 
ATOM   3452 N  N     . TRP A 1 438 ? -40.94100 -53.48900 -34.12200 1.000 38.19000  ? 426 TRP A N     1 
ATOM   3453 C  CA    . TRP A 1 438 ? -41.36700 -54.10000 -35.36600 1.000 40.05000  ? 426 TRP A CA    1 
ATOM   3454 C  C     . TRP A 1 438 ? -40.66800 -55.42100 -35.65100 1.000 39.57000  ? 426 TRP A C     1 
ATOM   3455 O  O     . TRP A 1 438 ? -41.05300 -56.14700 -36.57400 1.000 39.77000  ? 426 TRP A O     1 
ATOM   3456 C  CB    . TRP A 1 438 ? -41.15800 -53.11100 -36.51100 1.000 35.14000  ? 426 TRP A CB    1 
ATOM   3457 C  CG    . TRP A 1 438 ? -42.17000 -52.00700 -36.49000 1.000 41.83000  ? 426 TRP A CG    1 
ATOM   3458 C  CD1   . TRP A 1 438 ? -42.20400 -50.94100 -35.63600 1.000 49.00000  ? 426 TRP A CD1   1 
ATOM   3459 C  CD2   . TRP A 1 438 ? -43.30800 -51.86600 -37.34500 1.000 55.41000  ? 426 TRP A CD2   1 
ATOM   3460 N  NE1   . TRP A 1 438 ? -43.28600 -50.13400 -35.91300 1.000 46.52000  ? 426 TRP A NE1   1 
ATOM   3461 C  CE2   . TRP A 1 438 ? -43.98100 -50.68200 -36.95900 1.000 56.02000  ? 426 TRP A CE2   1 
ATOM   3462 C  CE3   . TRP A 1 438 ? -43.82000 -52.61600 -38.41200 1.000 54.80000  ? 426 TRP A CE3   1 
ATOM   3463 C  CZ2   . TRP A 1 438 ? -45.13700 -50.23600 -37.59800 1.000 51.12000  ? 426 TRP A CZ2   1 
ATOM   3464 C  CZ3   . TRP A 1 438 ? -44.97200 -52.16500 -39.04800 1.000 58.75000  ? 426 TRP A CZ3   1 
ATOM   3465 C  CH2   . TRP A 1 438 ? -45.61400 -50.98900 -38.63700 1.000 56.93000  ? 426 TRP A CH2   1 
ATOM   3466 N  N     . TYR A 1 439 ? -39.65500 -55.73100 -34.85000 1.000 35.66000  ? 427 TYR A N     1 
ATOM   3467 C  CA    . TYR A 1 439 ? -38.94400 -56.99700 -34.95000 1.000 35.79000  ? 427 TYR A CA    1 
ATOM   3468 C  C     . TYR A 1 439 ? -38.05400 -57.15700 -33.75000 1.000 37.28000  ? 427 TYR A C     1 
ATOM   3469 O  O     . TYR A 1 439 ? -37.77100 -56.19800 -33.05600 1.000 44.44000  ? 427 TYR A O     1 
ATOM   3470 C  CB    . TYR A 1 439 ? -38.10000 -57.07900 -36.21900 1.000 35.77000  ? 427 TYR A CB    1 
ATOM   3471 C  CG    . TYR A 1 439 ? -37.07100 -55.97700 -36.33300 1.000 36.40000  ? 427 TYR A CG    1 
ATOM   3472 C  CD1   . TYR A 1 439 ? -35.80600 -56.11700 -35.78300 1.000 37.07000  ? 427 TYR A CD1   1 
ATOM   3473 C  CD2   . TYR A 1 439 ? -37.36600 -54.80000 -37.00300 1.000 32.98000  ? 427 TYR A CD2   1 
ATOM   3474 C  CE1   . TYR A 1 439 ? -34.86400 -55.11100 -35.88600 1.000 34.24000  ? 427 TYR A CE1   1 
ATOM   3475 C  CE2   . TYR A 1 439 ? -36.43500 -53.79000 -37.11200 1.000 32.65000  ? 427 TYR A CE2   1 
ATOM   3476 C  CZ    . TYR A 1 439 ? -35.18800 -53.95300 -36.54700 1.000 35.13000  ? 427 TYR A CZ    1 
ATOM   3477 O  OH    . TYR A 1 439 ? -34.26400 -52.94900 -36.65400 1.000 35.78000  ? 427 TYR A OH    1 
ATOM   3478 N  N     . GLN A 1 440 ? -37.58400 -58.37100 -33.52300 1.000 43.78000  ? 428 GLN A N     1 
ATOM   3479 C  CA    . GLN A 1 440 ? -36.82500 -58.63200 -32.32700 1.000 44.07000  ? 428 GLN A CA    1 
ATOM   3480 C  C     . GLN A 1 440 ? -35.70300 -59.61800 -32.60900 1.000 40.19000  ? 428 GLN A C     1 
ATOM   3481 O  O     . GLN A 1 440 ? -35.94000 -60.80700 -32.81500 1.000 54.06000  ? 428 GLN A O     1 
ATOM   3482 C  CB    . GLN A 1 440 ? -37.75100 -59.15600 -31.23400 1.000 52.68000  ? 428 GLN A CB    1 
ATOM   3483 C  CG    . GLN A 1 440 ? -37.32200 -58.80800 -29.81700 1.000 63.59000  ? 428 GLN A CG    1 
ATOM   3484 C  CD    . GLN A 1 440 ? -38.20900 -59.47900 -28.78400 1.000 77.36000  ? 428 GLN A CD    1 
ATOM   3485 O  OE1   . GLN A 1 440 ? -39.41200 -59.68100 -29.01700 1.000 80.23000  ? 428 GLN A OE1   1 
ATOM   3486 N  NE2   . GLN A 1 440 ? -37.62200 -59.84300 -27.64200 1.000 67.86000  ? 428 GLN A NE2   1 
ATOM   3487 N  N     . LEU A 1 441 ? -34.47800 -59.11200 -32.63600 1.000 36.28000  ? 429 LEU A N     1 
ATOM   3488 C  CA    . LEU A 1 441 ? -33.31200 -59.96300 -32.75700 1.000 35.85000  ? 429 LEU A CA    1 
ATOM   3489 C  C     . LEU A 1 441 ? -33.29500 -61.03100 -31.66300 1.000 35.69000  ? 429 LEU A C     1 
ATOM   3490 O  O     . LEU A 1 441 ? -33.64300 -60.78100 -30.51200 1.000 41.11000  ? 429 LEU A O     1 
ATOM   3491 C  CB    . LEU A 1 441 ? -32.03300 -59.12500 -32.69300 1.000 36.22000  ? 429 LEU A CB    1 
ATOM   3492 C  CG    . LEU A 1 441 ? -31.92700 -58.00500 -33.72700 1.000 34.34000  ? 429 LEU A CG    1 
ATOM   3493 C  CD1   . LEU A 1 441 ? -30.62100 -57.25500 -33.57500 1.000 30.42000  ? 429 LEU A CD1   1 
ATOM   3494 C  CD2   . LEU A 1 441 ? -32.04600 -58.57400 -35.11500 1.000 32.04000  ? 429 LEU A CD2   1 
ATOM   3495 N  N     . GLU A 1 442 ? -32.89500 -62.23000 -32.04500 1.000 35.00000  ? 430 GLU A N     1 
ATOM   3496 C  CA    . GLU A 1 442 ? -32.71800 -63.32900 -31.11100 1.000 42.16000  ? 430 GLU A CA    1 
ATOM   3497 C  C     . GLU A 1 442 ? -31.56800 -63.08900 -30.13900 1.000 39.78000  ? 430 GLU A C     1 
ATOM   3498 O  O     . GLU A 1 442 ? -30.54600 -62.49600 -30.50300 1.000 35.10000  ? 430 GLU A O     1 
ATOM   3499 C  CB    . GLU A 1 442 ? -32.46600 -64.62700 -31.89100 1.000 40.87000  ? 430 GLU A CB    1 
ATOM   3500 C  CG    . GLU A 1 442 ? -33.63200 -65.03200 -32.74900 1.000 34.87000  ? 430 GLU A CG    1 
ATOM   3501 C  CD    . GLU A 1 442 ? -34.85400 -65.31600 -31.90200 1.000 47.69000  ? 430 GLU A CD    1 
ATOM   3502 O  OE1   . GLU A 1 442 ? -35.97300 -65.02100 -32.36600 1.000 55.59000  ? 430 GLU A OE1   1 
ATOM   3503 O  OE2   . GLU A 1 442 ? -34.69300 -65.82900 -30.76500 1.000 55.70000  ? 430 GLU A OE2   1 
ATOM   3504 N  N     . LYS A 1 443 ? -31.72300 -63.58300 -28.91400 1.000 42.13000  ? 431 LYS A N     1 
ATOM   3505 C  CA    . LYS A 1 443 ? -30.64000 -63.55400 -27.93300 1.000 42.15000  ? 431 LYS A CA    1 
ATOM   3506 C  C     . LYS A 1 443 ? -29.66800 -64.73700 -28.09800 1.000 38.33000  ? 431 LYS A C     1 
ATOM   3507 O  O     . LYS A 1 443 ? -28.50900 -64.64600 -27.72400 1.000 41.12000  ? 431 LYS A O     1 
ATOM   3508 C  CB    . LYS A 1 443 ? -31.22100 -63.54000 -26.51700 1.000 47.53000  ? 431 LYS A CB    1 
ATOM   3509 C  CG    . LYS A 1 443 ? -32.25600 -62.43700 -26.27800 1.000 55.93000  ? 431 LYS A CG    1 
ATOM   3510 C  CD    . LYS A 1 443 ? -32.89000 -62.54900 -24.89200 1.000 67.74000  ? 431 LYS A CD    1 
ATOM   3511 C  CE    . LYS A 1 443 ? -33.93000 -61.46400 -24.65200 1.000 69.58000  ? 431 LYS A CE    1 
ATOM   3512 N  NZ    . LYS A 1 443 ? -34.56700 -61.60000 -23.30700 1.000 71.39000  ? 431 LYS A NZ    1 
ATOM   3513 N  N     . GLU A 1 444 ? -30.14100 -65.84100 -28.66200 1.000 38.68000  ? 432 GLU A N     1 
ATOM   3514 C  CA    . GLU A 1 444 ? -29.29600 -67.01500 -28.87600 1.000 37.58000  ? 432 GLU A CA    1 
ATOM   3515 C  C     . GLU A 1 444 ? -29.29900 -67.42600 -30.34300 1.000 35.89000  ? 432 GLU A C     1 
ATOM   3516 O  O     . GLU A 1 444 ? -30.28900 -67.21000 -31.03400 1.000 42.49000  ? 432 GLU A O     1 
ATOM   3517 C  CB    . GLU A 1 444 ? -29.78100 -68.17800 -28.00800 1.000 35.34000  ? 432 GLU A CB    1 
ATOM   3518 C  CG    . GLU A 1 444 ? -29.69800 -67.90900 -26.51900 1.000 48.22000  ? 432 GLU A CG    1 
ATOM   3519 C  CD    . GLU A 1 444 ? -28.27400 -67.60200 -26.06400 1.000 67.65000  ? 432 GLU A CD    1 
ATOM   3520 O  OE1   . GLU A 1 444 ? -27.32600 -68.27200 -26.55700 1.000 62.72000  ? 432 GLU A OE1   1 
ATOM   3521 O  OE2   . GLU A 1 444 ? -28.10200 -66.68300 -25.21900 1.000 72.68000  ? 432 GLU A OE2   1 
ATOM   3522 N  N     . PRO A 1 445 ? -28.20700 -68.04500 -30.82600 1.000 38.86000  ? 433 PRO A N     1 
ATOM   3523 C  CA    . PRO A 1 445 ? -28.16000 -68.46900 -32.23200 1.000 36.11000  ? 433 PRO A CA    1 
ATOM   3524 C  C     . PRO A 1 445 ? -29.27500 -69.45200 -32.55600 1.000 34.49000  ? 433 PRO A C     1 
ATOM   3525 O  O     . PRO A 1 445 ? -29.75300 -70.12700 -31.65600 1.000 36.99000  ? 433 PRO A O     1 
ATOM   3526 C  CB    . PRO A 1 445 ? -26.79200 -69.13600 -32.35100 1.000 33.83000  ? 433 PRO A CB    1 
ATOM   3527 C  CG    . PRO A 1 445 ? -26.49600 -69.60300 -30.98100 1.000 31.02000  ? 433 PRO A CG    1 
ATOM   3528 C  CD    . PRO A 1 445 ? -27.03400 -68.53200 -30.08400 1.000 37.17000  ? 433 PRO A CD    1 
ATOM   3529 N  N     . ILE A 1 446 ? -29.66800 -69.51900 -33.82300 1.000 35.36000  ? 434 ILE A N     1 
ATOM   3530 C  CA    . ILE A 1 446 ? -30.85000 -70.25800 -34.25000 1.000 30.00000  ? 434 ILE A CA    1 
ATOM   3531 C  C     . ILE A 1 446 ? -30.54200 -71.61400 -34.86600 1.000 33.52000  ? 434 ILE A C     1 
ATOM   3532 O  O     . ILE A 1 446 ? -29.86300 -71.68800 -35.90100 1.000 33.51000  ? 434 ILE A O     1 
ATOM   3533 C  CB    . ILE A 1 446 ? -31.63600 -69.46600 -35.31000 1.000 32.37000  ? 434 ILE A CB    1 
ATOM   3534 C  CG1   . ILE A 1 446 ? -31.91600 -68.03200 -34.85900 1.000 33.05000  ? 434 ILE A CG1   1 
ATOM   3535 C  CG2   . ILE A 1 446 ? -32.92000 -70.17400 -35.66600 1.000 32.99000  ? 434 ILE A CG2   1 
ATOM   3536 C  CD1   . ILE A 1 446 ? -32.36000 -67.15500 -35.99800 1.000 27.57000  ? 434 ILE A CD1   1 
ATOM   3537 N  N     . VAL A 1 447 ? -31.07300 -72.67700 -34.26600 1.000 33.93000  ? 435 VAL A N     1 
ATOM   3538 C  CA    . VAL A 1 447 ? -30.94800 -74.02000 -34.83400 1.000 36.97000  ? 435 VAL A CA    1 
ATOM   3539 C  C     . VAL A 1 447 ? -31.73000 -74.18800 -36.14600 1.000 40.93000  ? 435 VAL A C     1 
ATOM   3540 O  O     . VAL A 1 447 ? -32.93500 -73.87900 -36.21500 1.000 38.64000  ? 435 VAL A O     1 
ATOM   3541 C  CB    . VAL A 1 447 ? -31.43600 -75.10200 -33.85300 1.000 30.43000  ? 435 VAL A CB    1 
ATOM   3542 C  CG1   . VAL A 1 447 ? -31.37400 -76.47500 -34.51500 1.000 33.02000  ? 435 VAL A CG1   1 
ATOM   3543 C  CG2   . VAL A 1 447 ? -30.59800 -75.09300 -32.60000 1.000 31.20000  ? 435 VAL A CG2   1 
ATOM   3544 N  N     . GLY A 1 448 ? -31.04700 -74.68700 -37.17900 1.000 33.78000  ? 436 GLY A N     1 
ATOM   3545 C  CA    . GLY A 1 448 ? -31.69900 -74.98400 -38.44300 1.000 35.96000  ? 436 GLY A CA    1 
ATOM   3546 C  C     . GLY A 1 448 ? -31.81600 -73.73400 -39.27500 1.000 45.02000  ? 436 GLY A C     1 
ATOM   3547 O  O     . GLY A 1 448 ? -32.59600 -73.63900 -40.23300 1.000 46.07000  ? 436 GLY A O     1 
ATOM   3548 N  N     . ALA A 1 449 ? -31.03400 -72.74700 -38.87700 1.000 42.03000  ? 437 ALA A N     1 
ATOM   3549 C  CA    . ALA A 1 449 ? -30.91600 -71.52700 -39.63200 1.000 34.47000  ? 437 ALA A CA    1 
ATOM   3550 C  C     . ALA A 1 449 ? -29.52700 -71.48600 -40.28600 1.000 35.79000  ? 437 ALA A C     1 
ATOM   3551 O  O     . ALA A 1 449 ? -28.52300 -71.82000 -39.66400 1.000 38.12000  ? 437 ALA A O     1 
ATOM   3552 C  CB    . ALA A 1 449 ? -31.14200 -70.35000 -38.73000 1.000 35.18000  ? 437 ALA A CB    1 
ATOM   3553 N  N     . GLU A 1 450 ? -29.48600 -71.11200 -41.55500 1.000 29.72000  ? 438 GLU A N     1 
ATOM   3554 C  CA    . GLU A 1 450 ? -28.24900 -71.08300 -42.30000 1.000 27.01000  ? 438 GLU A CA    1 
ATOM   3555 C  C     . GLU A 1 450 ? -27.36400 -69.97600 -41.74700 1.000 36.37000  ? 438 GLU A C     1 
ATOM   3556 O  O     . GLU A 1 450 ? -27.83100 -68.85500 -41.53600 1.000 34.77000  ? 438 GLU A O     1 
ATOM   3557 C  CB    . GLU A 1 450 ? -28.54800 -70.85600 -43.77700 1.000 28.40000  ? 438 GLU A CB    1 
ATOM   3558 C  CG    . GLU A 1 450 ? -27.37500 -70.97200 -44.73600 1.000 30.13000  ? 438 GLU A CG    1 
ATOM   3559 C  CD    . GLU A 1 450 ? -27.82700 -70.67700 -46.16000 1.000 37.83000  ? 438 GLU A CD    1 
ATOM   3560 O  OE1   . GLU A 1 450 ? -29.02500 -70.33700 -46.33900 1.000 41.07000  ? 438 GLU A OE1   1 
ATOM   3561 O  OE2   . GLU A 1 450 ? -27.00400 -70.76700 -47.09700 1.000 41.89000  ? 438 GLU A OE2   1 
ATOM   3562 N  N     . THR A 1 451 ? -26.08800 -70.27800 -41.52100 1.000 33.01000  ? 439 THR A N     1 
ATOM   3563 C  CA    . THR A 1 451 ? -25.16600 -69.28700 -40.96600 1.000 31.22000  ? 439 THR A CA    1 
ATOM   3564 C  C     . THR A 1 451 ? -24.42200 -68.53500 -42.05600 1.000 29.17000  ? 439 THR A C     1 
ATOM   3565 O  O     . THR A 1 451 ? -23.62400 -69.12800 -42.77100 1.000 31.69000  ? 439 THR A O     1 
ATOM   3566 C  CB    . THR A 1 451 ? -24.13300 -69.94100 -40.00700 1.000 27.68000  ? 439 THR A CB    1 
ATOM   3567 O  OG1   . THR A 1 451 ? -24.82900 -70.66100 -38.97600 1.000 36.13000  ? 439 THR A OG1   1 
ATOM   3568 C  CG2   . THR A 1 451 ? -23.26800 -68.89400 -39.37000 1.000 25.54000  ? 439 THR A CG2   1 
ATOM   3569 N  N     . PHE A 1 452 ? -24.69500 -67.23300 -42.16400 1.000 27.50000  ? 440 PHE A N     1 
ATOM   3570 C  CA    . PHE A 1 452 ? -24.03100 -66.32900 -43.10500 1.000 25.38000  ? 440 PHE A CA    1 
ATOM   3571 C  C     . PHE A 1 452 ? -22.88500 -65.55100 -42.47600 1.000 31.66000  ? 440 PHE A C     1 
ATOM   3572 O  O     . PHE A 1 452 ? -23.11200 -64.71700 -41.59600 1.000 31.83000  ? 440 PHE A O     1 
ATOM   3573 C  CB    . PHE A 1 452 ? -25.01200 -65.29100 -43.65800 1.000 23.00000  ? 440 PHE A CB    1 
ATOM   3574 C  CG    . PHE A 1 452 ? -25.97300 -65.82300 -44.68100 1.000 29.14000  ? 440 PHE A CG    1 
ATOM   3575 C  CD1   . PHE A 1 452 ? -27.02200 -66.64300 -44.30700 1.000 27.76000  ? 440 PHE A CD1   1 
ATOM   3576 C  CD2   . PHE A 1 452 ? -25.85000 -65.46000 -46.01700 1.000 28.45000  ? 440 PHE A CD2   1 
ATOM   3577 C  CE1   . PHE A 1 452 ? -27.90100 -67.11900 -45.24800 1.000 28.39000  ? 440 PHE A CE1   1 
ATOM   3578 C  CE2   . PHE A 1 452 ? -26.72500 -65.93200 -46.96200 1.000 27.13000  ? 440 PHE A CE2   1 
ATOM   3579 C  CZ    . PHE A 1 452 ? -27.75500 -66.75700 -46.57700 1.000 27.94000  ? 440 PHE A CZ    1 
ATOM   3580 N  N     . TYR A 1 453 ? -21.67100 -65.76200 -42.96400 1.000 27.81000  ? 441 TYR A N     1 
ATOM   3581 C  CA    . TYR A 1 453 ? -20.55400 -64.92900 -42.57400 1.000 26.14000  ? 441 TYR A CA    1 
ATOM   3582 C  C     . TYR A 1 453 ? -20.40400 -63.79600 -43.58300 1.000 29.21000  ? 441 TYR A C     1 
ATOM   3583 O  O     . TYR A 1 453 ? -19.98400 -64.02900 -44.71500 1.000 36.01000  ? 441 TYR A O     1 
ATOM   3584 C  CB    . TYR A 1 453 ? -19.27800 -65.76900 -42.48700 1.000 27.62000  ? 441 TYR A CB    1 
ATOM   3585 C  CG    . TYR A 1 453 ? -19.33400 -66.80400 -41.39300 1.000 27.68000  ? 441 TYR A CG    1 
ATOM   3586 C  CD1   . TYR A 1 453 ? -19.83600 -68.07300 -41.63800 1.000 28.81000  ? 441 TYR A CD1   1 
ATOM   3587 C  CD2   . TYR A 1 453 ? -18.90300 -66.50500 -40.10500 1.000 30.80000  ? 441 TYR A CD2   1 
ATOM   3588 C  CE1   . TYR A 1 453 ? -19.90500 -69.01900 -40.62900 1.000 31.40000  ? 441 TYR A CE1   1 
ATOM   3589 C  CE2   . TYR A 1 453 ? -18.96400 -67.44200 -39.09200 1.000 31.75000  ? 441 TYR A CE2   1 
ATOM   3590 C  CZ    . TYR A 1 453 ? -19.47100 -68.69400 -39.36000 1.000 33.56000  ? 441 TYR A CZ    1 
ATOM   3591 O  OH    . TYR A 1 453 ? -19.53000 -69.62300 -38.35400 1.000 35.90000  ? 441 TYR A OH    1 
ATOM   3592 N  N     . VAL A 1 454 ? -20.74300 -62.57200 -43.18400 1.000 28.36000  ? 442 VAL A N     1 
ATOM   3593 C  CA    . VAL A 1 454 ? -20.75400 -61.44100 -44.11800 1.000 30.45000  ? 442 VAL A CA    1 
ATOM   3594 C  C     . VAL A 1 454 ? -19.54300 -60.56700 -43.94700 1.000 31.49000  ? 442 VAL A C     1 
ATOM   3595 O  O     . VAL A 1 454 ? -18.84200 -60.66300 -42.94500 1.000 39.00000  ? 442 VAL A O     1 
ATOM   3596 C  CB    . VAL A 1 454 ? -22.00500 -60.54300 -43.95800 1.000 33.00000  ? 442 VAL A CB    1 
ATOM   3597 C  CG1   . VAL A 1 454 ? -23.27200 -61.34100 -44.22700 1.000 24.66000  ? 442 VAL A CG1   1 
ATOM   3598 C  CG2   . VAL A 1 454 ? -22.02400 -59.87100 -42.57200 1.000 30.80000  ? 442 VAL A CG2   1 
ATOM   3599 N  N     . ASP A 1 455 ? -19.30400 -59.70800 -44.93200 1.000 31.97000  ? 443 ASP A N     1 
ATOM   3600 C  CA    . ASP A 1 455 ? -18.17600 -58.78600 -44.89500 1.000 36.13000  ? 443 ASP A CA    1 
ATOM   3601 C  C     . ASP A 1 455 ? -18.19200 -57.83800 -46.08000 1.000 35.21000  ? 443 ASP A C     1 
ATOM   3602 O  O     . ASP A 1 455 ? -18.86000 -58.07100 -47.08400 1.000 36.61000  ? 443 ASP A O     1 
ATOM   3603 C  CB    . ASP A 1 455 ? -16.83700 -59.53200 -44.87800 1.000 43.24000  ? 443 ASP A CB    1 
ATOM   3604 C  CG    . ASP A 1 455 ? -15.72200 -58.73000 -44.18800 1.000 44.00000  ? 443 ASP A CG    1 
ATOM   3605 O  OD1   . ASP A 1 455 ? -15.96100 -57.56400 -43.81200 1.000 43.35000  ? 443 ASP A OD1   1 
ATOM   3606 O  OD2   . ASP A 1 455 ? -14.60500 -59.26500 -44.01700 1.000 44.72000  ? 443 ASP A OD2   1 
ATOM   3607 N  N     . GLY A 1 456 ? -17.43900 -56.76100 -45.94800 1.000 33.47000  ? 444 GLY A N     1 
ATOM   3608 C  CA    . GLY A 1 456 ? -17.29500 -55.81000 -47.01800 1.000 36.78000  ? 444 GLY A CA    1 
ATOM   3609 C  C     . GLY A 1 456 ? -15.98300 -55.07600 -46.87300 1.000 36.62000  ? 444 GLY A C     1 
ATOM   3610 O  O     . GLY A 1 456 ? -15.51300 -54.84800 -45.75900 1.000 39.98000  ? 444 GLY A O     1 
ATOM   3611 N  N     . ALA A 1 457 ? -15.39700 -54.70800 -48.00700 1.000 37.49000  ? 445 ALA A N     1 
ATOM   3612 C  CA    . ALA A 1 457 ? -14.21400 -53.86600 -48.04400 1.000 34.52000  ? 445 ALA A CA    1 
ATOM   3613 C  C     . ALA A 1 457 ? -14.39700 -52.79400 -49.12300 1.000 39.93000  ? 445 ALA A C     1 
ATOM   3614 O  O     . ALA A 1 457 ? -15.11300 -53.00200 -50.09300 1.000 41.33000  ? 445 ALA A O     1 
ATOM   3615 C  CB    . ALA A 1 457 ? -12.99900 -54.69300 -48.30800 1.000 31.86000  ? 445 ALA A CB    1 
ATOM   3616 N  N     . ALA A 1 458 ? -13.78300 -51.63300 -48.94600 1.000 43.40000  ? 446 ALA A N     1 
ATOM   3617 C  CA    . ALA A 1 458 ? -13.76100 -50.64400 -50.01400 1.000 47.17000  ? 446 ALA A CA    1 
ATOM   3618 C  C     . ALA A 1 458 ? -12.41500 -49.93900 -50.06200 1.000 47.89000  ? 446 ALA A C     1 
ATOM   3619 O  O     . ALA A 1 458 ? -11.71400 -49.80700 -49.06200 1.000 47.07000  ? 446 ALA A O     1 
ATOM   3620 C  CB    . ALA A 1 458 ? -14.89900 -49.63000 -49.85100 1.000 41.91000  ? 446 ALA A CB    1 
ATOM   3621 N  N     . ASN A 1 459 ? -12.07500 -49.51000 -51.26600 1.000 51.91000  ? 447 ASN A N     1 
ATOM   3622 C  CA    . ASN A 1 459 ? -10.83300 -48.84700 -51.58800 1.000 50.82000  ? 447 ASN A CA    1 
ATOM   3623 C  C     . ASN A 1 459 ? -10.98400 -47.34800 -51.39000 1.000 51.93000  ? 447 ASN A C     1 
ATOM   3624 O  O     . ASN A 1 459 ? -11.68200 -46.70100 -52.15700 1.000 56.42000  ? 447 ASN A O     1 
ATOM   3625 C  CB    . ASN A 1 459 ? -10.48800 -49.18200 -53.03400 1.000 58.50000  ? 447 ASN A CB    1 
ATOM   3626 C  CG    . ASN A 1 459 ? -9.09400  -48.79700 -53.41300 1.000 63.31000  ? 447 ASN A CG    1 
ATOM   3627 O  OD1   . ASN A 1 459 ? -8.58800  -47.75600 -53.00400 1.000 66.84000  ? 447 ASN A OD1   1 
ATOM   3628 N  ND2   . ASN A 1 459 ? -8.45800  -49.63800 -54.22000 1.000 66.75000  ? 447 ASN A ND2   1 
ATOM   3629 N  N     . ARG A 1 460 ? -10.34300 -46.79100 -50.37100 1.000 59.42000  ? 448 ARG A N     1 
ATOM   3630 C  CA    . ARG A 1 460 ? -10.56800 -45.38600 -50.00200 1.000 61.06000  ? 448 ARG A CA    1 
ATOM   3631 C  C     . ARG A 1 460 ? -10.27200 -44.41200 -51.14300 1.000 64.97000  ? 448 ARG A C     1 
ATOM   3632 O  O     . ARG A 1 460 ? -10.88000 -43.33500 -51.25300 1.000 59.72000  ? 448 ARG A O     1 
ATOM   3633 C  CB    . ARG A 1 460 ? -9.72500  -45.02200 -48.77500 1.000 63.52000  ? 448 ARG A CB    1 
ATOM   3634 C  CG    . ARG A 1 460 ? -9.28700  -43.56300 -48.72800 1.000 73.68000  ? 448 ARG A CG    1 
ATOM   3635 C  CD    . ARG A 1 460 ? -8.35900  -43.26800 -47.55500 1.000 81.91000  ? 448 ARG A CD    1 
ATOM   3636 N  NE    . ARG A 1 460 ? -8.90000  -43.76100 -46.29100 1.000 80.34000  ? 448 ARG A NE    1 
ATOM   3637 C  CZ    . ARG A 1 460 ? -8.26200  -44.60400 -45.48300 1.000 86.99000  ? 448 ARG A CZ    1 
ATOM   3638 N  NH1   . ARG A 1 460 ? -7.04800  -45.05100 -45.80000 1.000 86.77000  ? 448 ARG A NH1   1 
ATOM   3639 N  NH2   . ARG A 1 460 ? -8.83700  -44.99900 -44.35400 1.000 82.00000  ? 448 ARG A NH2   1 
ATOM   3640 N  N     . GLU A 1 461 ? -9.35300  -44.79700 -52.01500 1.000 66.45000  ? 449 GLU A N     1 
ATOM   3641 C  CA    . GLU A 1 461 ? -8.97200  -43.90200 -53.09200 1.000 69.63000  ? 449 GLU A CA    1 
ATOM   3642 C  C     . GLU A 1 461 ? -9.90200  -44.03500 -54.30400 1.000 65.70000  ? 449 GLU A C     1 
ATOM   3643 O  O     . GLU A 1 461 ? -10.47900 -43.02800 -54.72400 1.000 61.87000  ? 449 GLU A O     1 
ATOM   3644 C  CB    . GLU A 1 461 ? -7.50700  -44.13800 -53.45100 1.000 68.68000  ? 449 GLU A CB    1 
ATOM   3645 C  CG    . GLU A 1 461 ? -6.62300  -44.04600 -52.20400 1.000 76.70000  ? 449 GLU A CG    1 
ATOM   3646 C  CD    . GLU A 1 461 ? -5.13100  -43.98200 -52.50500 1.000 100.61000 ? 449 GLU A CD    1 
ATOM   3647 O  OE1   . GLU A 1 461 ? -4.76600  -43.84000 -53.69500 1.000 103.78000 ? 449 GLU A OE1   1 
ATOM   3648 O  OE2   . GLU A 1 461 ? -4.32600  -44.07500 -51.54500 1.000 88.49000  ? 449 GLU A OE2   1 
ATOM   3649 N  N     . THR A 1 462 ? -10.08600 -45.25200 -54.83200 1.000 59.13000  ? 450 THR A N     1 
ATOM   3650 C  CA    . THR A 1 462 ? -10.95700 -45.45800 -56.00700 1.000 54.58000  ? 450 THR A CA    1 
ATOM   3651 C  C     . THR A 1 462 ? -12.45100 -45.33000 -55.68900 1.000 52.21000  ? 450 THR A C     1 
ATOM   3652 O  O     . THR A 1 462 ? -13.26100 -45.06200 -56.58100 1.000 50.40000  ? 450 THR A O     1 
ATOM   3653 C  CB    . THR A 1 462 ? -10.73800 -46.84800 -56.66300 1.000 56.58000  ? 450 THR A CB    1 
ATOM   3654 O  OG1   . THR A 1 462 ? -11.39000 -47.86200 -55.89200 1.000 54.40000  ? 450 THR A OG1   1 
ATOM   3655 C  CG2   . THR A 1 462 ? -9.25600  -47.18200 -56.78200 1.000 58.97000  ? 450 THR A CG2   1 
ATOM   3656 N  N     . LYS A 1 463 ? -12.79000 -45.52900 -54.41600 1.000 52.96000  ? 451 LYS A N     1 
ATOM   3657 C  CA    . LYS A 1 463 ? -14.16300 -45.55700 -53.91000 1.000 49.80000  ? 451 LYS A CA    1 
ATOM   3658 C  C     . LYS A 1 463 ? -14.91600 -46.80800 -54.35200 1.000 50.71000  ? 451 LYS A C     1 
ATOM   3659 O  O     . LYS A 1 463 ? -16.13600 -46.88000 -54.23500 1.000 53.59000  ? 451 LYS A O     1 
ATOM   3660 C  CB    . LYS A 1 463 ? -14.93900 -44.30600 -54.32900 1.000 50.64000  ? 451 LYS A CB    1 
ATOM   3661 C  CG    . LYS A 1 463 ? -15.14600 -43.31600 -53.19800 1.000 55.07000  ? 451 LYS A CG    1 
ATOM   3662 C  CD    . LYS A 1 463 ? -13.80600 -42.89200 -52.59800 1.000 61.77000  ? 451 LYS A CD    1 
ATOM   3663 C  CE    . LYS A 1 463 ? -13.98200 -41.82200 -51.51900 1.000 63.52000  ? 451 LYS A CE    1 
ATOM   3664 N  NZ    . LYS A 1 463 ? -12.69100 -41.42500 -50.87000 1.000 56.99000  ? 451 LYS A NZ    1 
ATOM   3665 N  N     . LEU A 1 464 ? -14.18100 -47.79600 -54.84400 1.000 48.68000  ? 452 LEU A N     1 
ATOM   3666 C  CA    . LEU A 1 464 ? -14.77100 -49.06500 -55.25400 1.000 49.53000  ? 452 LEU A CA    1 
ATOM   3667 C  C     . LEU A 1 464 ? -14.77700 -50.05600 -54.10400 1.000 49.45000  ? 452 LEU A C     1 
ATOM   3668 O  O     . LEU A 1 464 ? -13.86300 -50.07300 -53.28000 1.000 47.86000  ? 452 LEU A O     1 
ATOM   3669 C  CB    . LEU A 1 464 ? -14.00500 -49.67300 -56.42700 1.000 47.80000  ? 452 LEU A CB    1 
ATOM   3670 C  CG    . LEU A 1 464 ? -14.36400 -49.33600 -57.86400 1.000 43.53000  ? 452 LEU A CG    1 
ATOM   3671 C  CD1   . LEU A 1 464 ? -14.68200 -47.86500 -58.04700 1.000 54.33000  ? 452 LEU A CD1   1 
ATOM   3672 C  CD2   . LEU A 1 464 ? -13.17800 -49.74600 -58.70600 1.000 46.87000  ? 452 LEU A CD2   1 
ATOM   3673 N  N     . GLY A 1 465 ? -15.79400 -50.90600 -54.06800 1.000 48.29000  ? 453 GLY A N     1 
ATOM   3674 C  CA    . GLY A 1 465 ? -15.92700 -51.84100 -52.97300 1.000 46.31000  ? 453 GLY A CA    1 
ATOM   3675 C  C     . GLY A 1 465 ? -16.50700 -53.17900 -53.36700 1.000 40.49000  ? 453 GLY A C     1 
ATOM   3676 O  O     . GLY A 1 465 ? -16.91800 -53.39300 -54.49800 1.000 45.63000  ? 453 GLY A O     1 
ATOM   3677 N  N     . LYS A 1 466 ? -16.52300 -54.09400 -52.41400 1.000 33.48000  ? 454 LYS A N     1 
ATOM   3678 C  CA    . LYS A 1 466 ? -17.21600 -55.34600 -52.58000 1.000 40.15000  ? 454 LYS A CA    1 
ATOM   3679 C  C     . LYS A 1 466 ? -17.90600 -55.67600 -51.26400 1.000 41.67000  ? 454 LYS A C     1 
ATOM   3680 O  O     . LYS A 1 466 ? -17.36600 -55.40200 -50.19300 1.000 39.45000  ? 454 LYS A O     1 
ATOM   3681 C  CB    . LYS A 1 466 ? -16.25200 -56.45800 -52.99800 1.000 38.85000  ? 454 LYS A CB    1 
ATOM   3682 C  CG    . LYS A 1 466 ? -15.81700 -56.37800 -54.45100 1.000 37.35000  ? 454 LYS A CG    1 
ATOM   3683 C  CD    . LYS A 1 466 ? -14.84500 -57.49500 -54.76900 1.000 41.15000  ? 454 LYS A CD    1 
ATOM   3684 C  CE    . LYS A 1 466 ? -14.16800 -57.27700 -56.11100 1.000 50.56000  ? 454 LYS A CE    1 
ATOM   3685 N  NZ    . LYS A 1 466 ? -13.13100 -58.33200 -56.39700 1.000 51.92000  ? 454 LYS A NZ    1 
ATOM   3686 N  N     . ALA A 1 467 ? -19.11800 -56.21500 -51.35900 1.000 38.95000  ? 455 ALA A N     1 
ATOM   3687 C  CA    . ALA A 1 467 ? -19.84100 -56.76200 -50.22000 1.000 30.70000  ? 455 ALA A CA    1 
ATOM   3688 C  C     . ALA A 1 467 ? -20.19000 -58.19200 -50.57100 1.000 36.39000  ? 455 ALA A C     1 
ATOM   3689 O  O     . ALA A 1 467 ? -20.32300 -58.52000 -51.74500 1.000 37.97000  ? 455 ALA A O     1 
ATOM   3690 C  CB    . ALA A 1 467 ? -21.08600 -55.96100 -49.92800 1.000 31.54000  ? 455 ALA A CB    1 
ATOM   3691 N  N     . GLY A 1 468 ? -20.33600 -59.05600 -49.57900 1.000 36.64000  ? 456 GLY A N     1 
ATOM   3692 C  CA    . GLY A 1 468 ? -20.65400 -60.43700 -49.87900 1.000 30.25000  ? 456 GLY A CA    1 
ATOM   3693 C  C     . GLY A 1 468 ? -20.68300 -61.33300 -48.66300 1.000 31.07000  ? 456 GLY A C     1 
ATOM   3694 O  O     . GLY A 1 468 ? -20.32300 -60.91500 -47.57100 1.000 33.36000  ? 456 GLY A O     1 
ATOM   3695 N  N     . TYR A 1 469 ? -21.10600 -62.57800 -48.85600 1.000 34.75000  ? 457 TYR A N     1 
ATOM   3696 C  CA    . TYR A 1 469 ? -21.16900 -63.54200 -47.76700 1.000 32.40000  ? 457 TYR A CA    1 
ATOM   3697 C  C     . TYR A 1 469 ? -20.60200 -64.87500 -48.17500 1.000 34.58000  ? 457 TYR A C     1 
ATOM   3698 O  O     . TYR A 1 469 ? -20.31300 -65.12900 -49.33900 1.000 35.44000  ? 457 TYR A O     1 
ATOM   3699 C  CB    . TYR A 1 469 ? -22.60700 -63.75200 -47.28100 1.000 27.97000  ? 457 TYR A CB    1 
ATOM   3700 C  CG    . TYR A 1 469 ? -23.55000 -64.14300 -48.39500 1.000 34.36000  ? 457 TYR A CG    1 
ATOM   3701 C  CD1   . TYR A 1 469 ? -23.64600 -65.45800 -48.82500 1.000 33.49000  ? 457 TYR A CD1   1 
ATOM   3702 C  CD2   . TYR A 1 469 ? -24.32800 -63.18200 -49.04300 1.000 34.69000  ? 457 TYR A CD2   1 
ATOM   3703 C  CE1   . TYR A 1 469 ? -24.50000 -65.80600 -49.85400 1.000 35.63000  ? 457 TYR A CE1   1 
ATOM   3704 C  CE2   . TYR A 1 469 ? -25.17900 -63.52400 -50.06500 1.000 31.24000  ? 457 TYR A CE2   1 
ATOM   3705 C  CZ    . TYR A 1 469 ? -25.26000 -64.83100 -50.47100 1.000 35.43000  ? 457 TYR A CZ    1 
ATOM   3706 O  OH    . TYR A 1 469 ? -26.12100 -65.17400 -51.49200 1.000 39.93000  ? 457 TYR A OH    1 
ATOM   3707 N  N     . VAL A 1 470 ? -20.47000 -65.72100 -47.16900 1.000 38.15000  ? 458 VAL A N     1 
ATOM   3708 C  CA    . VAL A 1 470 ? -20.10900 -67.11400 -47.30500 1.000 32.67000  ? 458 VAL A CA    1 
ATOM   3709 C  C     . VAL A 1 470 ? -21.01900 -67.79500 -46.27700 1.000 33.41000  ? 458 VAL A C     1 
ATOM   3710 O  O     . VAL A 1 470 ? -21.20400 -67.25800 -45.18200 1.000 34.01000  ? 458 VAL A O     1 
ATOM   3711 C  CB    . VAL A 1 470 ? -18.59800 -67.33000 -47.02300 1.000 39.35000  ? 458 VAL A CB    1 
ATOM   3712 C  CG1   . VAL A 1 470 ? -18.38100 -68.37400 -45.97800 1.000 36.53000  ? 458 VAL A CG1   1 
ATOM   3713 C  CG2   . VAL A 1 470 ? -17.82300 -67.65300 -48.30100 1.000 39.19000  ? 458 VAL A CG2   1 
ATOM   3714 N  N     . THR A 1 471 ? -21.64400 -68.91800 -46.62600 1.000 31.04000  ? 459 THR A N     1 
ATOM   3715 C  CA    . THR A 1 471 ? -22.51600 -69.60400 -45.67200 1.000 29.45000  ? 459 THR A CA    1 
ATOM   3716 C  C     . THR A 1 471 ? -22.00100 -71.00900 -45.38300 1.000 34.20000  ? 459 THR A C     1 
ATOM   3717 O  O     . THR A 1 471 ? -21.21700 -71.57000 -46.14800 1.000 34.11000  ? 459 THR A O     1 
ATOM   3718 C  CB    . THR A 1 471 ? -23.96900 -69.69300 -46.16400 1.000 29.69000  ? 459 THR A CB    1 
ATOM   3719 O  OG1   . THR A 1 471 ? -24.14200 -70.89600 -46.92100 1.000 31.69000  ? 459 THR A OG1   1 
ATOM   3720 C  CG2   . THR A 1 471 ? -24.31400 -68.47500 -47.02300 1.000 27.29000  ? 459 THR A CG2   1 
ATOM   3721 N  N     . ASN A 1 472 ? -22.43500 -71.57200 -44.26200 1.000 34.45000  ? 460 ASN A N     1 
ATOM   3722 C  CA    . ASN A 1 472 ? -21.94600 -72.87100 -43.81800 1.000 31.62000  ? 460 ASN A CA    1 
ATOM   3723 C  C     . ASN A 1 472 ? -22.45800 -73.98900 -44.70400 1.000 35.53000  ? 460 ASN A C     1 
ATOM   3724 O  O     . ASN A 1 472 ? -22.04500 -75.14200 -44.56400 1.000 32.59000  ? 460 ASN A O     1 
ATOM   3725 C  CB    . ASN A 1 472 ? -22.38200 -73.14300 -42.38600 1.000 28.43000  ? 460 ASN A CB    1 
ATOM   3726 C  CG    . ASN A 1 472 ? -23.86600 -73.26500 -42.27800 1.000 31.43000  ? 460 ASN A CG    1 
ATOM   3727 O  OD1   . ASN A 1 472 ? -24.57600 -72.30400 -42.54000 1.000 38.95000  ? 460 ASN A OD1   1 
ATOM   3728 N  ND2   . ASN A 1 472 ? -24.35900 -74.44900 -41.92400 1.000 34.14000  ? 460 ASN A ND2   1 
ATOM   3729 N  N     . ARG A 1 473 ? -23.38600 -73.65600 -45.59000 1.000 33.28000  ? 461 ARG A N     1 
ATOM   3730 C  CA    . ARG A 1 473 ? -23.95000 -74.66000 -46.47500 1.000 34.03000  ? 461 ARG A CA    1 
ATOM   3731 C  C     . ARG A 1 473 ? -23.31100 -74.56000 -47.84300 1.000 37.62000  ? 461 ARG A C     1 
ATOM   3732 O  O     . ARG A 1 473 ? -23.82000 -75.11700 -48.80800 1.000 39.71000  ? 461 ARG A O     1 
ATOM   3733 C  CB    . ARG A 1 473 ? -25.45700 -74.50300 -46.58400 1.000 29.21000  ? 461 ARG A CB    1 
ATOM   3734 C  CG    . ARG A 1 473 ? -26.17000 -74.70100 -45.26800 1.000 32.89000  ? 461 ARG A CG    1 
ATOM   3735 C  CD    . ARG A 1 473 ? -27.64900 -74.48600 -45.43100 1.000 29.58000  ? 461 ARG A CD    1 
ATOM   3736 N  NE    . ARG A 1 473 ? -28.36900 -74.69900 -44.18300 1.000 37.52000  ? 461 ARG A NE    1 
ATOM   3737 C  CZ    . ARG A 1 473 ? -29.65000 -74.38200 -44.02400 1.000 38.32000  ? 461 ARG A CZ    1 
ATOM   3738 N  NH1   . ARG A 1 473 ? -30.31200 -73.85500 -45.04600 1.000 32.76000  ? 461 ARG A NH1   1 
ATOM   3739 N  NH2   . ARG A 1 473 ? -30.26800 -74.59000 -42.86100 1.000 35.05000  ? 461 ARG A NH2   1 
ATOM   3740 N  N     . GLY A 1 474 ? -22.21300 -73.81600 -47.93000 1.000 32.91000  ? 462 GLY A N     1 
ATOM   3741 C  CA    . GLY A 1 474 ? -21.43800 -73.77700 -49.15300 1.000 27.51000  ? 462 GLY A CA    1 
ATOM   3742 C  C     . GLY A 1 474 ? -21.78900 -72.70200 -50.14600 1.000 31.66000  ? 462 GLY A C     1 
ATOM   3743 O  O     . GLY A 1 474 ? -21.20700 -72.66600 -51.22200 1.000 40.23000  ? 462 GLY A O     1 
ATOM   3744 N  N     . ARG A 1 475 ? -22.72200 -71.81900 -49.80500 1.000 31.90000  ? 463 ARG A N     1 
ATOM   3745 C  CA    . ARG A 1 475 ? -23.03600 -70.71000 -50.69100 1.000 33.12000  ? 463 ARG A CA    1 
ATOM   3746 C  C     . ARG A 1 475 ? -22.08200 -69.55500 -50.50500 1.000 34.09000  ? 463 ARG A C     1 
ATOM   3747 O  O     . ARG A 1 475 ? -21.65600 -69.27500 -49.40000 1.000 36.27000  ? 463 ARG A O     1 
ATOM   3748 C  CB    . ARG A 1 475 ? -24.44100 -70.19500 -50.46000 1.000 31.66000  ? 463 ARG A CB    1 
ATOM   3749 C  CG    . ARG A 1 475 ? -25.46900 -71.25400 -50.44100 1.000 39.99000  ? 463 ARG A CG    1 
ATOM   3750 C  CD    . ARG A 1 475 ? -26.76500 -70.62900 -50.85300 1.000 43.19000  ? 463 ARG A CD    1 
ATOM   3751 N  NE    . ARG A 1 475 ? -27.58600 -70.24500 -49.71900 1.000 40.10000  ? 463 ARG A NE    1 
ATOM   3752 C  CZ    . ARG A 1 475 ? -28.35500 -69.16600 -49.70900 1.000 38.99000  ? 463 ARG A CZ    1 
ATOM   3753 N  NH1   . ARG A 1 475 ? -28.39800 -68.37200 -50.77100 1.000 34.34000  ? 463 ARG A NH1   1 
ATOM   3754 N  NH2   . ARG A 1 475 ? -29.11000 -68.89900 -48.65200 1.000 33.37000  ? 463 ARG A NH2   1 
ATOM   3755 N  N     . GLN A 1 476 ? -21.78100 -68.86500 -51.59500 1.000 34.98000  ? 464 GLN A N     1 
ATOM   3756 C  CA    . GLN A 1 476 ? -20.99400 -67.66200 -51.52700 1.000 32.75000  ? 464 GLN A CA    1 
ATOM   3757 C  C     . GLN A 1 476 ? -21.39900 -66.75400 -52.66000 1.000 36.05000  ? 464 GLN A C     1 
ATOM   3758 O  O     . GLN A 1 476 ? -21.86900 -67.21500 -53.69700 1.000 36.50000  ? 464 GLN A O     1 
ATOM   3759 C  CB    . GLN A 1 476 ? -19.51100 -67.97600 -51.58600 1.000 40.05000  ? 464 GLN A CB    1 
ATOM   3760 C  CG    . GLN A 1 476 ? -18.97400 -68.27500 -52.95700 1.000 45.38000  ? 464 GLN A CG    1 
ATOM   3761 C  CD    . GLN A 1 476 ? -17.49700 -68.59100 -52.90400 1.000 53.64000  ? 464 GLN A CD    1 
ATOM   3762 O  OE1   . GLN A 1 476 ? -17.05700 -69.39300 -52.07000 1.000 48.31000  ? 464 GLN A OE1   1 
ATOM   3763 N  NE2   . GLN A 1 476 ? -16.71600 -67.94400 -53.77300 1.000 47.02000  ? 464 GLN A NE2   1 
ATOM   3764 N  N     . LYS A 1 477 ? -21.23800 -65.45400 -52.43200 1.000 37.08000  ? 465 LYS A N     1 
ATOM   3765 C  CA    . LYS A 1 477 ? -21.68800 -64.42700 -53.35700 1.000 37.79000  ? 465 LYS A CA    1 
ATOM   3766 C  C     . LYS A 1 477 ? -20.93800 -63.14700 -53.07400 1.000 32.64000  ? 465 LYS A C     1 
ATOM   3767 O  O     . LYS A 1 477 ? -20.79200 -62.77900 -51.92100 1.000 34.08000  ? 465 LYS A O     1 
ATOM   3768 C  CB    . LYS A 1 477 ? -23.19300 -64.18100 -53.22600 1.000 36.81000  ? 465 LYS A CB    1 
ATOM   3769 C  CG    . LYS A 1 477 ? -23.73000 -63.20400 -54.27000 1.000 33.43000  ? 465 LYS A CG    1 
ATOM   3770 C  CD    . LYS A 1 477 ? -25.13600 -62.71200 -53.96200 1.000 39.28000  ? 465 LYS A CD    1 
ATOM   3771 C  CE    . LYS A 1 477 ? -26.20400 -63.49300 -54.73400 1.000 45.93000  ? 465 LYS A CE    1 
ATOM   3772 N  NZ    . LYS A 1 477 ? -27.55500 -62.83300 -54.62000 1.000 48.85000  ? 465 LYS A NZ    1 
ATOM   3773 N  N     . VAL A 1 478 ? -20.46500 -62.47500 -54.11600 1.000 32.53000  ? 466 VAL A N     1 
ATOM   3774 C  CA    . VAL A 1 478 ? -19.80000 -61.18700 -53.95500 1.000 29.10000  ? 466 VAL A CA    1 
ATOM   3775 C  C     . VAL A 1 478 ? -20.49300 -60.16400 -54.83400 1.000 33.82000  ? 466 VAL A C     1 
ATOM   3776 O  O     . VAL A 1 478 ? -20.74500 -60.41400 -56.01100 1.000 43.41000  ? 466 VAL A O     1 
ATOM   3777 C  CB    . VAL A 1 478 ? -18.27800 -61.25900 -54.30800 1.000 30.69000  ? 466 VAL A CB    1 
ATOM   3778 C  CG1   . VAL A 1 478 ? -17.75800 -59.93300 -54.80600 1.000 40.87000  ? 466 VAL A CG1   1 
ATOM   3779 C  CG2   . VAL A 1 478 ? -17.45800 -61.68700 -53.10200 1.000 40.10000  ? 466 VAL A CG2   1 
ATOM   3780 N  N     . VAL A 1 479 ? -20.81800 -59.01300 -54.26200 1.000 35.88000  ? 467 VAL A N     1 
ATOM   3781 C  CA    . VAL A 1 479 ? -21.36900 -57.91100 -55.03300 1.000 32.91000  ? 467 VAL A CA    1 
ATOM   3782 C  C     . VAL A 1 479 ? -20.39300 -56.73500 -55.07000 1.000 40.43000  ? 467 VAL A C     1 
ATOM   3783 O  O     . VAL A 1 479 ? -20.05000 -56.17800 -54.02500 1.000 41.24000  ? 467 VAL A O     1 
ATOM   3784 C  CB    . VAL A 1 479 ? -22.71200 -57.45700 -54.45000 1.000 30.25000  ? 467 VAL A CB    1 
ATOM   3785 C  CG1   . VAL A 1 479 ? -23.09600 -56.09800 -54.96900 1.000 27.72000  ? 467 VAL A CG1   1 
ATOM   3786 C  CG2   . VAL A 1 479 ? -23.78500 -58.47700 -54.76700 1.000 26.84000  ? 467 VAL A CG2   1 
ATOM   3787 N  N     . THR A 1 480 ? -19.95100 -56.35600 -56.27100 1.000 45.01000  ? 468 THR A N     1 
ATOM   3788 C  CA    . THR A 1 480 ? -19.10400 -55.16600 -56.44900 1.000 44.16000  ? 468 THR A CA    1 
ATOM   3789 C  C     . THR A 1 480 ? -19.90700 -53.86200 -56.38700 1.000 41.93000  ? 468 THR A C     1 
ATOM   3790 O  O     . THR A 1 480 ? -20.99900 -53.75900 -56.94200 1.000 41.96000  ? 468 THR A O     1 
ATOM   3791 C  CB    . THR A 1 480 ? -18.35800 -55.18300 -57.79400 1.000 41.53000  ? 468 THR A CB    1 
ATOM   3792 O  OG1   . THR A 1 480 ? -19.30600 -54.99800 -58.85400 1.000 45.43000  ? 468 THR A OG1   1 
ATOM   3793 C  CG2   . THR A 1 480 ? -17.59900 -56.49300 -57.99000 1.000 35.92000  ? 468 THR A CG2   1 
ATOM   3794 N  N     . LEU A 1 481 ? -19.35000 -52.86100 -55.72100 1.000 39.67000  ? 469 LEU A N     1 
ATOM   3795 C  CA    . LEU A 1 481 ? -20.04300 -51.59400 -55.57200 1.000 45.38000  ? 469 LEU A CA    1 
ATOM   3796 C  C     . LEU A 1 481 ? -19.14000 -50.45500 -56.03900 1.000 52.50000  ? 469 LEU A C     1 
ATOM   3797 O  O     . LEU A 1 481 ? -17.91200 -50.59400 -56.10600 1.000 48.19000  ? 469 LEU A O     1 
ATOM   3798 C  CB    . LEU A 1 481 ? -20.49100 -51.37100 -54.11700 1.000 42.29000  ? 469 LEU A CB    1 
ATOM   3799 C  CG    . LEU A 1 481 ? -21.38400 -52.44400 -53.48300 1.000 44.76000  ? 469 LEU A CG    1 
ATOM   3800 C  CD1   . LEU A 1 481 ? -20.55700 -53.37000 -52.63000 1.000 41.46000  ? 469 LEU A CD1   1 
ATOM   3801 C  CD2   . LEU A 1 481 ? -22.47200 -51.82000 -52.65700 1.000 43.93000  ? 469 LEU A CD2   1 
ATOM   3802 N  N     . THR A 1 482 ? -19.76600 -49.33700 -56.38900 1.000 50.46000  ? 470 THR A N     1 
ATOM   3803 C  CA    . THR A 1 482 ? -19.04100 -48.17100 -56.84300 1.000 48.48000  ? 470 THR A CA    1 
ATOM   3804 C  C     . THR A 1 482 ? -19.40300 -46.96800 -56.00000 1.000 54.11000  ? 470 THR A C     1 
ATOM   3805 O  O     . THR A 1 482 ? -20.56900 -46.79800 -55.59300 1.000 51.31000  ? 470 THR A O     1 
ATOM   3806 C  CB    . THR A 1 482 ? -19.34500 -47.83000 -58.29700 1.000 47.44000  ? 470 THR A CB    1 
ATOM   3807 O  OG1   . THR A 1 482 ? -20.60900 -47.15500 -58.35800 1.000 59.81000  ? 470 THR A OG1   1 
ATOM   3808 C  CG2   . THR A 1 482 ? -19.38700 -49.08300 -59.15100 1.000 53.65000  ? 470 THR A CG2   1 
ATOM   3809 N  N     . ASP A 1 483 ? -18.40000 -46.12500 -55.76800 1.000 55.99000  ? 471 ASP A N     1 
ATOM   3810 C  CA    . ASP A 1 483 ? -18.59100 -44.89100 -55.02600 1.000 57.57000  ? 471 ASP A CA    1 
ATOM   3811 C  C     . ASP A 1 483 ? -19.16500 -45.23000 -53.65200 1.000 50.58000  ? 471 ASP A C     1 
ATOM   3812 O  O     . ASP A 1 483 ? -20.22900 -44.75200 -53.25800 1.000 43.79000  ? 471 ASP A O     1 
ATOM   3813 C  CB    . ASP A 1 483 ? -19.50300 -43.93800 -55.80700 1.000 58.79000  ? 471 ASP A CB    1 
ATOM   3814 C  CG    . ASP A 1 483 ? -19.65100 -42.59900 -55.13400 1.000 70.25000  ? 471 ASP A CG    1 
ATOM   3815 O  OD1   . ASP A 1 483 ? -18.67400 -42.12900 -54.50300 1.000 75.11000  ? 471 ASP A OD1   1 
ATOM   3816 O  OD2   . ASP A 1 483 ? -20.75500 -42.02500 -55.22400 1.000 78.86000  ? 471 ASP A OD2   1 
ATOM   3817 N  N     . THR A 1 484 ? -18.45600 -46.09100 -52.93600 1.000 46.86000  ? 472 THR A N     1 
ATOM   3818 C  CA    . THR A 1 484 ? -18.96100 -46.58300 -51.67400 1.000 43.41000  ? 472 THR A CA    1 
ATOM   3819 C  C     . THR A 1 484 ? -17.96500 -46.28900 -50.57300 1.000 41.16000  ? 472 THR A C     1 
ATOM   3820 O  O     . THR A 1 484 ? -16.94800 -45.66400 -50.80300 1.000 44.56000  ? 472 THR A O     1 
ATOM   3821 C  CB    . THR A 1 484 ? -19.26100 -48.09200 -51.72900 1.000 40.95000  ? 472 THR A CB    1 
ATOM   3822 O  OG1   . THR A 1 484 ? -19.75400 -48.51200 -50.46100 1.000 40.02000  ? 472 THR A OG1   1 
ATOM   3823 C  CG2   . THR A 1 484 ? -18.01500 -48.88800 -52.05000 1.000 42.28000  ? 472 THR A CG2   1 
ATOM   3824 N  N     . THR A 1 485 ? -18.29000 -46.71700 -49.36400 1.000 40.94000  ? 473 THR A N     1 
ATOM   3825 C  CA    . THR A 1 485 ? -17.46900 -46.47000 -48.19500 1.000 36.96000  ? 473 THR A CA    1 
ATOM   3826 C  C     . THR A 1 485 ? -17.40300 -47.76300 -47.42500 1.000 40.29000  ? 473 THR A C     1 
ATOM   3827 O  O     . THR A 1 485 ? -18.28200 -48.60700 -47.59000 1.000 42.90000  ? 473 THR A O     1 
ATOM   3828 C  CB    . THR A 1 485 ? -18.06100 -45.41300 -47.29200 1.000 37.60000  ? 473 THR A CB    1 
ATOM   3829 O  OG1   . THR A 1 485 ? -19.15300 -45.99500 -46.57100 1.000 37.51000  ? 473 THR A OG1   1 
ATOM   3830 C  CG2   . THR A 1 485 ? -18.55700 -44.25000 -48.09700 1.000 37.97000  ? 473 THR A CG2   1 
ATOM   3831 N  N     . ASN A 1 486 ? -16.40900 -47.93100 -46.55800 1.000 40.42000  ? 474 ASN A N     1 
ATOM   3832 C  CA    . ASN A 1 486 ? -16.28800 -49.22200 -45.90700 1.000 45.97000  ? 474 ASN A CA    1 
ATOM   3833 C  C     . ASN A 1 486 ? -17.52000 -49.54800 -45.07200 1.000 42.73000  ? 474 ASN A C     1 
ATOM   3834 O  O     . ASN A 1 486 ? -18.04700 -50.66000 -45.18500 1.000 44.48000  ? 474 ASN A O     1 
ATOM   3835 C  CB    . ASN A 1 486 ? -14.99600 -49.31700 -45.09100 1.000 45.05000  ? 474 ASN A CB    1 
ATOM   3836 C  CG    . ASN A 1 486 ? -13.93800 -50.13600 -45.82500 1.000 55.81000  ? 474 ASN A CG    1 
ATOM   3837 O  OD1   . ASN A 1 486 ? -13.97100 -50.23400 -47.04800 1.000 65.51000  ? 474 ASN A OD1   1 
ATOM   3838 N  ND2   . ASN A 1 486 ? -13.04600 -50.76100 -45.09500 1.000 58.46000  ? 474 ASN A ND2   1 
ATOM   3839 N  N     . GLN A 1 487 ? -18.01200 -48.58200 -44.29800 1.000 40.61000  ? 475 GLN A N     1 
ATOM   3840 C  CA    . GLN A 1 487 ? -19.24000 -48.78000 -43.52800 1.000 33.44000  ? 475 GLN A CA    1 
ATOM   3841 C  C     . GLN A 1 487 ? -20.38400 -49.24100 -44.42300 1.000 34.53000  ? 475 GLN A C     1 
ATOM   3842 O  O     . GLN A 1 487 ? -21.08700 -50.19300 -44.09800 1.000 34.90000  ? 475 GLN A O     1 
ATOM   3843 C  CB    . GLN A 1 487 ? -19.64400 -47.49800 -42.80100 1.000 40.55000  ? 475 GLN A CB    1 
ATOM   3844 C  CG    . GLN A 1 487 ? -18.63200 -46.98300 -41.75600 1.000 40.78000  ? 475 GLN A CG    1 
ATOM   3845 C  CD    . GLN A 1 487 ? -17.39000 -46.32100 -42.37900 1.000 52.80000  ? 475 GLN A CD    1 
ATOM   3846 O  OE1   . GLN A 1 487 ? -17.19900 -46.33400 -43.60800 1.000 44.80000  ? 475 GLN A OE1   1 
ATOM   3847 N  NE2   . GLN A 1 487 ? -16.53400 -45.75000 -41.52400 1.000 58.16000  ? 475 GLN A NE2   1 
ATOM   3848 N  N     . LYS A 1 488 ? -20.55200 -48.57700 -45.56200 1.000 39.52000  ? 476 LYS A N     1 
ATOM   3849 C  CA    . LYS A 1 488 ? -21.60800 -48.93400 -46.51500 1.000 36.83000  ? 476 LYS A CA    1 
ATOM   3850 C  C     . LYS A 1 488 ? -21.48100 -50.36700 -47.00500 1.000 36.05000  ? 476 LYS A C     1 
ATOM   3851 O  O     . LYS A 1 488 ? -22.47600 -51.08800 -47.06700 1.000 36.52000  ? 476 LYS A O     1 
ATOM   3852 C  CB    . LYS A 1 488 ? -21.60400 -47.98200 -47.71300 1.000 34.17000  ? 476 LYS A CB    1 
ATOM   3853 C  CG    . LYS A 1 488 ? -22.49900 -46.79200 -47.52300 1.000 34.47000  ? 476 LYS A CG    1 
ATOM   3854 C  CD    . LYS A 1 488 ? -21.97700 -45.58300 -48.23400 1.000 36.89000  ? 476 LYS A CD    1 
ATOM   3855 C  CE    . LYS A 1 488 ? -22.80700 -44.37200 -47.87200 1.000 39.64000  ? 476 LYS A CE    1 
ATOM   3856 N  NZ    . LYS A 1 488 ? -23.18900 -43.60800 -49.09700 1.000 45.49000  ? 476 LYS A NZ    1 
ATOM   3857 N  N     . THR A 1 489 ? -20.27000 -50.78700 -47.34800 1.000 28.57000  ? 477 THR A N     1 
ATOM   3858 C  CA    . THR A 1 489 ? -20.11200 -52.12300 -47.88200 1.000 34.21000  ? 477 THR A CA    1 
ATOM   3859 C  C     . THR A 1 489 ? -20.48000 -53.12200 -46.80500 1.000 32.67000  ? 477 THR A C     1 
ATOM   3860 O  O     . THR A 1 489 ? -20.95900 -54.21400 -47.08200 1.000 33.44000  ? 477 THR A O     1 
ATOM   3861 C  CB    . THR A 1 489 ? -18.68000 -52.40200 -48.37800 1.000 36.31000  ? 477 THR A CB    1 
ATOM   3862 O  OG1   . THR A 1 489 ? -17.80600 -52.58800 -47.26000 1.000 35.68000  ? 477 THR A OG1   1 
ATOM   3863 C  CG2   . THR A 1 489 ? -18.17300 -51.26600 -49.24500 1.000 34.31000  ? 477 THR A CG2   1 
ATOM   3864 N  N     . GLU A 1 490 ? -20.28700 -52.72400 -45.56100 1.000 34.33000  ? 478 GLU A N     1 
ATOM   3865 C  CA    . GLU A 1 490 ? -20.51000 -53.62300 -44.43800 1.000 36.75000  ? 478 GLU A CA    1 
ATOM   3866 C  C     . GLU A 1 490 ? -22.02600 -53.76800 -44.17100 1.000 36.17000  ? 478 GLU A C     1 
ATOM   3867 O  O     . GLU A 1 490 ? -22.52800 -54.84800 -43.84300 1.000 33.07000  ? 478 GLU A O     1 
ATOM   3868 C  CB    . GLU A 1 490 ? -19.73400 -53.09000 -43.22800 1.000 36.16000  ? 478 GLU A CB    1 
ATOM   3869 C  CG    . GLU A 1 490 ? -19.16000 -54.13900 -42.30400 1.000 39.21000  ? 478 GLU A CG    1 
ATOM   3870 C  CD    . GLU A 1 490 ? -18.00500 -54.95900 -42.85300 1.000 42.02000  ? 478 GLU A CD    1 
ATOM   3871 O  OE1   . GLU A 1 490 ? -18.13500 -56.20600 -42.84700 1.000 42.25000  ? 478 GLU A OE1   1 
ATOM   3872 O  OE2   . GLU A 1 490 ? -16.96800 -54.37600 -43.24300 1.000 39.86000  ? 478 GLU A OE2   1 
ATOM   3873 N  N     . LEU A 1 491 ? -22.75200 -52.66900 -44.36200 1.000 40.06000  ? 479 LEU A N     1 
ATOM   3874 C  CA    . LEU A 1 491 ? -24.21100 -52.66700 -44.31900 1.000 30.75000  ? 479 LEU A CA    1 
ATOM   3875 C  C     . LEU A 1 491 ? -24.81400 -53.40500 -45.50500 1.000 38.22000  ? 479 LEU A C     1 
ATOM   3876 O  O     . LEU A 1 491 ? -25.86600 -54.04100 -45.38000 1.000 37.02000  ? 479 LEU A O     1 
ATOM   3877 C  CB    . LEU A 1 491 ? -24.74000 -51.24200 -44.31600 1.000 29.89000  ? 479 LEU A CB    1 
ATOM   3878 C  CG    . LEU A 1 491 ? -24.88400 -50.53800 -42.98000 1.000 30.68000  ? 479 LEU A CG    1 
ATOM   3879 C  CD1   . LEU A 1 491 ? -25.60000 -49.25200 -43.25100 1.000 27.69000  ? 479 LEU A CD1   1 
ATOM   3880 C  CD2   . LEU A 1 491 ? -25.68700 -51.40900 -42.05000 1.000 30.89000  ? 479 LEU A CD2   1 
ATOM   3881 N  N     . GLN A 1 492 ? -24.16900 -53.27700 -46.66500 1.000 35.23000  ? 480 GLN A N     1 
ATOM   3882 C  CA    . GLN A 1 492 ? -24.61600 -53.95900 -47.87700 1.000 32.97000  ? 480 GLN A CA    1 
ATOM   3883 C  C     . GLN A 1 492 ? -24.50800 -55.48400 -47.76300 1.000 37.76000  ? 480 GLN A C     1 
ATOM   3884 O  O     . GLN A 1 492 ? -25.39000 -56.21100 -48.24900 1.000 36.61000  ? 480 GLN A O     1 
ATOM   3885 C  CB    . GLN A 1 492 ? -23.81400 -53.47700 -49.08000 1.000 35.09000  ? 480 GLN A CB    1 
ATOM   3886 C  CG    . GLN A 1 492 ? -24.10400 -52.05800 -49.48100 1.000 35.25000  ? 480 GLN A CG    1 
ATOM   3887 C  CD    . GLN A 1 492 ? -25.19200 -51.94900 -50.52400 1.000 41.07000  ? 480 GLN A CD    1 
ATOM   3888 O  OE1   . GLN A 1 492 ? -25.91700 -52.91100 -50.80200 1.000 40.27000  ? 480 GLN A OE1   1 
ATOM   3889 N  NE2   . GLN A 1 492 ? -25.30200 -50.76900 -51.12500 1.000 45.32000  ? 480 GLN A NE2   1 
ATOM   3890 N  N     . ALA A 1 493 ? -23.43000 -55.96300 -47.13600 1.000 36.14000  ? 481 ALA A N     1 
ATOM   3891 C  CA    . ALA A 1 493 ? -23.24300 -57.39500 -46.93000 1.000 30.99000  ? 481 ALA A CA    1 
ATOM   3892 C  C     . ALA A 1 493 ? -24.36900 -57.93800 -46.07400 1.000 33.16000  ? 481 ALA A C     1 
ATOM   3893 O  O     . ALA A 1 493 ? -24.90100 -59.01100 -46.34200 1.000 38.43000  ? 481 ALA A O     1 
ATOM   3894 C  CB    . ALA A 1 493 ? -21.89100 -57.68800 -46.28300 1.000 29.85000  ? 481 ALA A CB    1 
ATOM   3895 N  N     . ILE A 1 494 ? -24.74000 -57.20300 -45.03500 1.000 35.84000  ? 482 ILE A N     1 
ATOM   3896 C  CA    . ILE A 1 494 ? -25.83100 -57.65700 -44.18500 1.000 33.25000  ? 482 ILE A CA    1 
ATOM   3897 C  C     . ILE A 1 494 ? -27.14200 -57.67900 -44.97800 1.000 33.68000  ? 482 ILE A C     1 
ATOM   3898 O  O     . ILE A 1 494 ? -27.95100 -58.59300 -44.81700 1.000 35.34000  ? 482 ILE A O     1 
ATOM   3899 C  CB    . ILE A 1 494 ? -25.96200 -56.77900 -42.92800 1.000 33.55000  ? 482 ILE A CB    1 
ATOM   3900 C  CG1   . ILE A 1 494 ? -24.71900 -56.96500 -42.06000 1.000 27.16000  ? 482 ILE A CG1   1 
ATOM   3901 C  CG2   . ILE A 1 494 ? -27.23600 -57.12400 -42.13500 1.000 28.83000  ? 482 ILE A CG2   1 
ATOM   3902 C  CD1   . ILE A 1 494 ? -24.76400 -56.18900 -40.76900 1.000 29.16000  ? 482 ILE A CD1   1 
ATOM   3903 N  N     . TYR A 1 495 ? -27.33000 -56.70400 -45.86600 1.000 32.00000  ? 483 TYR A N     1 
ATOM   3904 C  CA    . TYR A 1 495 ? -28.54800 -56.61800 -46.67700 1.000 31.32000  ? 483 TYR A CA    1 
ATOM   3905 C  C     . TYR A 1 495 ? -28.63000 -57.80900 -47.63500 1.000 34.45000  ? 483 TYR A C     1 
ATOM   3906 O  O     . TYR A 1 495 ? -29.71100 -58.30000 -47.97400 1.000 33.85000  ? 483 TYR A O     1 
ATOM   3907 C  CB    . TYR A 1 495 ? -28.57400 -55.29600 -47.44600 1.000 27.97000  ? 483 TYR A CB    1 
ATOM   3908 C  CG    . TYR A 1 495 ? -29.79900 -55.09500 -48.29400 1.000 32.83000  ? 483 TYR A CG    1 
ATOM   3909 C  CD1   . TYR A 1 495 ? -31.07700 -55.34700 -47.79600 1.000 36.10000  ? 483 TYR A CD1   1 
ATOM   3910 C  CD2   . TYR A 1 495 ? -29.68700 -54.61100 -49.58700 1.000 38.69000  ? 483 TYR A CD2   1 
ATOM   3911 C  CE1   . TYR A 1 495 ? -32.21000 -55.14300 -48.59400 1.000 40.31000  ? 483 TYR A CE1   1 
ATOM   3912 C  CE2   . TYR A 1 495 ? -30.80600 -54.40000 -50.39000 1.000 36.48000  ? 483 TYR A CE2   1 
ATOM   3913 C  CZ    . TYR A 1 495 ? -32.05800 -54.67000 -49.90100 1.000 42.46000  ? 483 TYR A CZ    1 
ATOM   3914 O  OH    . TYR A 1 495 ? -33.14600 -54.45400 -50.73300 1.000 47.47000  ? 483 TYR A OH    1 
ATOM   3915 N  N     . LEU A 1 496 ? -27.46700 -58.28200 -48.05400 1.000 34.39000  ? 484 LEU A N     1 
ATOM   3916 C  CA    . LEU A 1 496 ? -27.36500 -59.38200 -48.99500 1.000 29.55000  ? 484 LEU A CA    1 
ATOM   3917 C  C     . LEU A 1 496 ? -27.71500 -60.69900 -48.31200 1.000 36.97000  ? 484 LEU A C     1 
ATOM   3918 O  O     . LEU A 1 496 ? -28.48000 -61.52400 -48.84300 1.000 36.20000  ? 484 LEU A O     1 
ATOM   3919 C  CB    . LEU A 1 496 ? -25.95500 -59.43600 -49.56300 1.000 35.17000  ? 484 LEU A CB    1 
ATOM   3920 C  CG    . LEU A 1 496 ? -25.85400 -59.97200 -50.97500 1.000 44.01000  ? 484 LEU A CG    1 
ATOM   3921 C  CD1   . LEU A 1 496 ? -26.88800 -59.25900 -51.80200 1.000 41.39000  ? 484 LEU A CD1   1 
ATOM   3922 C  CD2   . LEU A 1 496 ? -24.45000 -59.72800 -51.50400 1.000 40.66000  ? 484 LEU A CD2   1 
ATOM   3923 N  N     . ALA A 1 497 ? -27.15200 -60.90300 -47.12800 1.000 33.50000  ? 485 ALA A N     1 
ATOM   3924 C  CA    . ALA A 1 497 ? -27.47600 -62.09100 -46.36500 1.000 28.42000  ? 485 ALA A CA    1 
ATOM   3925 C  C     . ALA A 1 497 ? -28.97500 -62.11900 -46.07200 1.000 27.96000  ? 485 ALA A C     1 
ATOM   3926 O  O     . ALA A 1 497 ? -29.60100 -63.16100 -46.13100 1.000 32.05000  ? 485 ALA A O     1 
ATOM   3927 C  CB    . ALA A 1 497 ? -26.67000 -62.13000 -45.08800 1.000 26.73000  ? 485 ALA A CB    1 
ATOM   3928 N  N     . LEU A 1 498 ? -29.55900 -60.97000 -45.77200 1.000 25.85000  ? 486 LEU A N     1 
ATOM   3929 C  CA    . LEU A 1 498 ? -30.98500 -60.92900 -45.50300 1.000 27.10000  ? 486 LEU A CA    1 
ATOM   3930 C  C     . LEU A 1 498 ? -31.78700 -61.24700 -46.75100 1.000 29.57000  ? 486 LEU A C     1 
ATOM   3931 O  O     . LEU A 1 498 ? -32.78200 -61.95900 -46.68700 1.000 28.67000  ? 486 LEU A O     1 
ATOM   3932 C  CB    . LEU A 1 498 ? -31.39700 -59.56400 -44.97100 1.000 31.72000  ? 486 LEU A CB    1 
ATOM   3933 C  CG    . LEU A 1 498 ? -30.96200 -59.29100 -43.54200 1.000 27.35000  ? 486 LEU A CG    1 
ATOM   3934 C  CD1   . LEU A 1 498 ? -31.22300 -57.82900 -43.27300 1.000 28.73000  ? 486 LEU A CD1   1 
ATOM   3935 C  CD2   . LEU A 1 498 ? -31.71400 -60.20200 -42.57300 1.000 18.54000  ? 486 LEU A CD2   1 
ATOM   3936 N  N     . GLN A 1 499 ? -31.34600 -60.72500 -47.88900 1.000 31.77000  ? 487 GLN A N     1 
ATOM   3937 C  CA    . GLN A 1 499 ? -32.06300 -60.94500 -49.13600 1.000 26.82000  ? 487 GLN A CA    1 
ATOM   3938 C  C     . GLN A 1 499 ? -32.01100 -62.38500 -49.59200 1.000 32.86000  ? 487 GLN A C     1 
ATOM   3939 O  O     . GLN A 1 499 ? -32.97500 -62.88900 -50.16300 1.000 35.67000  ? 487 GLN A O     1 
ATOM   3940 C  CB    . GLN A 1 499 ? -31.51000 -60.04400 -50.22900 1.000 26.57000  ? 487 GLN A CB    1 
ATOM   3941 C  CG    . GLN A 1 499 ? -32.24900 -58.73300 -50.32400 1.000 40.74000  ? 487 GLN A CG    1 
ATOM   3942 C  CD    . GLN A 1 499 ? -31.69900 -57.83200 -51.40600 1.000 40.87000  ? 487 GLN A CD    1 
ATOM   3943 O  OE1   . GLN A 1 499 ? -32.39000 -56.94400 -51.89700 1.000 47.53000  ? 487 GLN A OE1   1 
ATOM   3944 N  NE2   . GLN A 1 499 ? -30.44800 -58.04900 -51.77600 1.000 39.31000  ? 487 GLN A NE2   1 
ATOM   3945 N  N     . ASP A 1 500 ? -30.89100 -63.05100 -49.33700 1.000 32.82000  ? 488 ASP A N     1 
ATOM   3946 C  CA    . ASP A 1 500 ? -30.66400 -64.37200 -49.89900 1.000 26.73000  ? 488 ASP A CA    1 
ATOM   3947 C  C     . ASP A 1 500 ? -30.92200 -65.49500 -48.91900 1.000 30.45000  ? 488 ASP A C     1 
ATOM   3948 O  O     . ASP A 1 500 ? -30.60700 -66.64500 -49.20000 1.000 42.28000  ? 488 ASP A O     1 
ATOM   3949 C  CB    . ASP A 1 500 ? -29.23600 -64.47000 -50.42800 1.000 30.46000  ? 488 ASP A CB    1 
ATOM   3950 C  CG    . ASP A 1 500 ? -29.02300 -63.59900 -51.64600 1.000 37.33000  ? 488 ASP A CG    1 
ATOM   3951 O  OD1   . ASP A 1 500 ? -30.03800 -63.06300 -52.14300 1.000 31.26000  ? 488 ASP A OD1   1 
ATOM   3952 O  OD2   . ASP A 1 500 ? -27.86900 -63.46300 -52.11300 1.000 35.96000  ? 488 ASP A OD2   1 
ATOM   3953 N  N     . SER A 1 501 ? -31.49700 -65.17900 -47.77100 1.000 30.40000  ? 489 SER A N     1 
ATOM   3954 C  CA    . SER A 1 501 ? -31.68800 -66.19600 -46.74700 1.000 28.28000  ? 489 SER A CA    1 
ATOM   3955 C  C     . SER A 1 501 ? -33.15500 -66.51200 -46.54000 1.000 30.02000  ? 489 SER A C     1 
ATOM   3956 O  O     . SER A 1 501 ? -34.03200 -65.86000 -47.11200 1.000 34.24000  ? 489 SER A O     1 
ATOM   3957 C  CB    . SER A 1 501 ? -31.07300 -65.74800 -45.43100 1.000 30.66000  ? 489 SER A CB    1 
ATOM   3958 O  OG    . SER A 1 501 ? -31.54300 -64.45300 -45.08500 1.000 32.70000  ? 489 SER A OG    1 
ATOM   3959 N  N     . GLY A 1 502 ? -33.41700 -67.51600 -45.70900 1.000 35.18000  ? 490 GLY A N     1 
ATOM   3960 C  CA    . GLY A 1 502 ? -34.76900 -67.99200 -45.48300 1.000 19.93000  ? 490 GLY A CA    1 
ATOM   3961 C  C     . GLY A 1 502 ? -35.41500 -67.11300 -44.45500 1.000 26.58000  ? 490 GLY A C     1 
ATOM   3962 O  O     . GLY A 1 502 ? -34.94500 -66.01800 -44.19600 1.000 32.02000  ? 490 GLY A O     1 
ATOM   3963 N  N     . LEU A 1 503 ? -36.49500 -67.58400 -43.85700 1.000 29.57000  ? 491 LEU A N     1 
ATOM   3964 C  CA    . LEU A 1 503 ? -37.19500 -66.78500 -42.87500 1.000 28.56000  ? 491 LEU A CA    1 
ATOM   3965 C  C     . LEU A 1 503 ? -36.40600 -66.75200 -41.57700 1.000 33.99000  ? 491 LEU A C     1 
ATOM   3966 O  O     . LEU A 1 503 ? -36.67100 -65.91800 -40.69800 1.000 36.68000  ? 491 LEU A O     1 
ATOM   3967 C  CB    . LEU A 1 503 ? -38.58900 -67.34000 -42.62700 1.000 32.66000  ? 491 LEU A CB    1 
ATOM   3968 C  CG    . LEU A 1 503 ? -39.57600 -67.16800 -43.77000 1.000 32.45000  ? 491 LEU A CG    1 
ATOM   3969 C  CD1   . LEU A 1 503 ? -40.90200 -67.78600 -43.36200 1.000 23.43000  ? 491 LEU A CD1   1 
ATOM   3970 C  CD2   . LEU A 1 503 ? -39.72700 -65.68900 -44.08300 1.000 26.19000  ? 491 LEU A CD2   1 
ATOM   3971 N  N     . GLU A 1 504 ? -35.44800 -67.67100 -41.45500 1.000 26.00000  ? 492 GLU A N     1 
ATOM   3972 C  CA    . GLU A 1 504 ? -34.59700 -67.74800 -40.27700 1.000 30.26000  ? 492 GLU A CA    1 
ATOM   3973 C  C     . GLU A 1 504 ? -33.14200 -67.71900 -40.70600 1.000 32.71000  ? 492 GLU A C     1 
ATOM   3974 O  O     . GLU A 1 504 ? -32.73200 -68.51900 -41.55800 1.000 34.72000  ? 492 GLU A O     1 
ATOM   3975 C  CB    . GLU A 1 504 ? -34.90200 -69.01000 -39.47300 1.000 30.16000  ? 492 GLU A CB    1 
ATOM   3976 C  CG    . GLU A 1 504 ? -36.39600 -69.18100 -39.22500 1.000 35.20000  ? 492 GLU A CG    1 
ATOM   3977 C  CD    . GLU A 1 504 ? -36.72300 -70.02600 -37.98800 1.000 52.38000  ? 492 GLU A CD    1 
ATOM   3978 O  OE1   . GLU A 1 504 ? -37.92400 -70.36300 -37.79400 1.000 55.79000  ? 492 GLU A OE1   1 
ATOM   3979 O  OE2   . GLU A 1 504 ? -35.79400 -70.33600 -37.20200 1.000 48.04000  ? 492 GLU A OE2   1 
ATOM   3980 N  N     . VAL A 1 505 ? -32.35800 -66.80200 -40.13200 1.000 29.74000  ? 493 VAL A N     1 
ATOM   3981 C  CA    . VAL A 1 505 ? -30.97400 -66.64200 -40.56700 1.000 27.25000  ? 493 VAL A CA    1 
ATOM   3982 C  C     . VAL A 1 505 ? -30.07000 -66.23900 -39.41400 1.000 30.44000  ? 493 VAL A C     1 
ATOM   3983 O  O     . VAL A 1 505 ? -30.45200 -65.42000 -38.57100 1.000 31.48000  ? 493 VAL A O     1 
ATOM   3984 C  CB    . VAL A 1 505 ? -30.88000 -65.60000 -41.71100 1.000 26.69000  ? 493 VAL A CB    1 
ATOM   3985 C  CG1   . VAL A 1 505 ? -31.42300 -64.26000 -41.27500 1.000 24.22000  ? 493 VAL A CG1   1 
ATOM   3986 C  CG2   . VAL A 1 505 ? -29.47200 -65.47500 -42.22200 1.000 27.50000  ? 493 VAL A CG2   1 
ATOM   3987 N  N     . ASN A 1 506 ? -28.89300 -66.86600 -39.35700 1.000 29.31000  ? 494 ASN A N     1 
ATOM   3988 C  CA    . ASN A 1 506 ? -27.79600 -66.46200 -38.47900 1.000 23.28000  ? 494 ASN A CA    1 
ATOM   3989 C  C     . ASN A 1 506 ? -26.79700 -65.62600 -39.28400 1.000 26.48000  ? 494 ASN A C     1 
ATOM   3990 O  O     . ASN A 1 506 ? -26.29400 -66.07400 -40.31200 1.000 28.68000  ? 494 ASN A O     1 
ATOM   3991 C  CB    . ASN A 1 506 ? -27.09000 -67.68200 -37.87600 1.000 24.69000  ? 494 ASN A CB    1 
ATOM   3992 C  CG    . ASN A 1 506 ? -27.97200 -68.46100 -36.91300 1.000 30.20000  ? 494 ASN A CG    1 
ATOM   3993 O  OD1   . ASN A 1 506 ? -28.52100 -67.89300 -35.97000 1.000 31.58000  ? 494 ASN A OD1   1 
ATOM   3994 N  ND2   . ASN A 1 506 ? -28.11300 -69.77200 -37.14600 1.000 27.12000  ? 494 ASN A ND2   1 
ATOM   3995 N  N     . ILE A 1 507 ? -26.51400 -64.40800 -38.84100 1.000 23.72000  ? 495 ILE A N     1 
ATOM   3996 C  CA    . ILE A 1 507 ? -25.53400 -63.57800 -39.53100 1.000 23.85000  ? 495 ILE A CA    1 
ATOM   3997 C  C     . ILE A 1 507 ? -24.36100 -63.21500 -38.61700 1.000 29.73000  ? 495 ILE A C     1 
ATOM   3998 O  O     . ILE A 1 507 ? -24.56100 -62.70300 -37.51600 1.000 34.00000  ? 495 ILE A O     1 
ATOM   3999 C  CB    . ILE A 1 507 ? -26.16000 -62.28400 -40.05900 1.000 25.35000  ? 495 ILE A CB    1 
ATOM   4000 C  CG1   . ILE A 1 507 ? -27.38400 -62.60300 -40.91500 1.000 25.27000  ? 495 ILE A CG1   1 
ATOM   4001 C  CG2   . ILE A 1 507 ? -25.12500 -61.47000 -40.84300 1.000 22.62000  ? 495 ILE A CG2   1 
ATOM   4002 C  CD1   . ILE A 1 507 ? -27.98900 -61.40500 -41.52300 1.000 21.17000  ? 495 ILE A CD1   1 
ATOM   4003 N  N     . VAL A 1 508 ? -23.14300 -63.48000 -39.08100 1.000 29.59000  ? 496 VAL A N     1 
ATOM   4004 C  CA    . VAL A 1 508 ? -21.93600 -63.07100 -38.37600 1.000 25.42000  ? 496 VAL A CA    1 
ATOM   4005 C  C     . VAL A 1 508 ? -21.22100 -61.95000 -39.13800 1.000 29.11000  ? 496 VAL A C     1 
ATOM   4006 O  O     . VAL A 1 508 ? -20.84700 -62.09600 -40.29900 1.000 29.93000  ? 496 VAL A O     1 
ATOM   4007 C  CB    . VAL A 1 508 ? -20.98400 -64.24000 -38.17500 1.000 24.16000  ? 496 VAL A CB    1 
ATOM   4008 C  CG1   . VAL A 1 508 ? -19.82700 -63.77200 -37.38900 1.000 25.61000  ? 496 VAL A CG1   1 
ATOM   4009 C  CG2   . VAL A 1 508 ? -21.69500 -65.37200 -37.42300 1.000 26.24000  ? 496 VAL A CG2   1 
ATOM   4010 N  N     . THR A 1 509 ? -21.05200 -60.82400 -38.45800 1.000 30.08000  ? 497 THR A N     1 
ATOM   4011 C  CA    . THR A 1 509 ? -20.41500 -59.63100 -38.99300 1.000 32.40000  ? 497 THR A CA    1 
ATOM   4012 C  C     . THR A 1 509 ? -19.17600 -59.26100 -38.13700 1.000 35.43000  ? 497 THR A C     1 
ATOM   4013 O  O     . THR A 1 509 ? -19.04000 -59.73200 -36.99700 1.000 33.42000  ? 497 THR A O     1 
ATOM   4014 C  CB    . THR A 1 509 ? -21.42400 -58.47200 -39.02100 1.000 28.05000  ? 497 THR A CB    1 
ATOM   4015 O  OG1   . THR A 1 509 ? -20.82100 -57.30800 -39.58100 1.000 32.69000  ? 497 THR A OG1   1 
ATOM   4016 C  CG2   . THR A 1 509 ? -21.85700 -58.13700 -37.63900 1.000 31.44000  ? 497 THR A CG2   1 
ATOM   4017 N  N     . ASP A 1 510 ? -18.25900 -58.45700 -38.67500 1.000 33.64000  ? 498 ASP A N     1 
ATOM   4018 C  CA    . ASP A 1 510 ? -17.13100 -57.97900 -37.85800 1.000 35.50000  ? 498 ASP A CA    1 
ATOM   4019 C  C     . ASP A 1 510 ? -17.17400 -56.47000 -37.65900 1.000 36.54000  ? 498 ASP A C     1 
ATOM   4020 O  O     . ASP A 1 510 ? -16.18100 -55.84300 -37.29200 1.000 45.29000  ? 498 ASP A O     1 
ATOM   4021 C  CB    . ASP A 1 510 ? -15.78100 -58.38300 -38.46000 1.000 32.10000  ? 498 ASP A CB    1 
ATOM   4022 C  CG    . ASP A 1 510 ? -15.53200 -57.79300 -39.84200 1.000 39.85000  ? 498 ASP A CG    1 
ATOM   4023 O  OD1   . ASP A 1 510 ? -15.99100 -56.66800 -40.14500 1.000 41.97000  ? 498 ASP A OD1   1 
ATOM   4024 O  OD2   . ASP A 1 510 ? -14.84300 -58.47100 -40.64000 1.000 47.90000  ? 498 ASP A OD2   1 
ATOM   4025 N  N     . SER A 1 511 ? -18.34500 -55.90400 -37.89700 1.000 34.06000  ? 499 SER A N     1 
ATOM   4026 C  CA    . SER A 1 511 ? -18.53700 -54.46700 -37.94100 1.000 33.55000  ? 499 SER A CA    1 
ATOM   4027 C  C     . SER A 1 511 ? -19.28100 -53.92100 -36.74400 1.000 34.22000  ? 499 SER A C     1 
ATOM   4028 O  O     . SER A 1 511 ? -20.49000 -54.13300 -36.63100 1.000 35.29000  ? 499 SER A O     1 
ATOM   4029 C  CB    . SER A 1 511 ? -19.32100 -54.10800 -39.18200 1.000 31.99000  ? 499 SER A CB    1 
ATOM   4030 O  OG    . SER A 1 511 ? -19.73400 -52.75300 -39.17500 1.000 35.62000  ? 499 SER A OG    1 
ATOM   4031 N  N     . GLN A 1 512 ? -18.58800 -53.19700 -35.87100 1.000 37.86000  ? 500 GLN A N     1 
ATOM   4032 C  CA    . GLN A 1 512 ? -19.25600 -52.61500 -34.71200 1.000 39.10000  ? 500 GLN A CA    1 
ATOM   4033 C  C     . GLN A 1 512 ? -20.25600 -51.59700 -35.20100 1.000 37.52000  ? 500 GLN A C     1 
ATOM   4034 O  O     . GLN A 1 512 ? -21.34600 -51.45200 -34.63300 1.000 37.22000  ? 500 GLN A O     1 
ATOM   4035 C  CB    . GLN A 1 512 ? -18.26200 -51.96000 -33.77700 1.000 52.70000  ? 500 GLN A CB    1 
ATOM   4036 C  CG    . GLN A 1 512 ? -16.97200 -52.70900 -33.63700 1.000 53.20000  ? 500 GLN A CG    1 
ATOM   4037 C  CD    . GLN A 1 512 ? -16.14300 -52.13000 -32.53500 1.000 60.50000  ? 500 GLN A CD    1 
ATOM   4038 O  OE1   . GLN A 1 512 ? -16.65900 -51.39800 -31.68200 1.000 62.93000  ? 500 GLN A OE1   1 
ATOM   4039 N  NE2   . GLN A 1 512 ? -14.85000 -52.43800 -32.54000 1.000 64.59000  ? 500 GLN A NE2   1 
ATOM   4040 N  N     . TYR A 1 513 ? -19.87100 -50.90800 -36.27600 1.000 31.71000  ? 501 TYR A N     1 
ATOM   4041 C  CA    . TYR A 1 513 ? -20.75600 -49.97400 -36.94800 1.000 32.34000  ? 501 TYR A CA    1 
ATOM   4042 C  C     . TYR A 1 513 ? -22.11700 -50.59300 -37.24100 1.000 35.76000  ? 501 TYR A C     1 
ATOM   4043 O  O     . TYR A 1 513 ? -23.13300 -50.16900 -36.67600 1.000 35.67000  ? 501 TYR A O     1 
ATOM   4044 C  CB    . TYR A 1 513 ? -20.12900 -49.47400 -38.24800 1.000 31.19000  ? 501 TYR A CB    1 
ATOM   4045 C  CG    . TYR A 1 513 ? -21.06800 -48.56200 -39.00500 1.000 30.89000  ? 501 TYR A CG    1 
ATOM   4046 C  CD1   . TYR A 1 513 ? -21.29400 -47.25900 -38.58100 1.000 30.08000  ? 501 TYR A CD1   1 
ATOM   4047 C  CD2   . TYR A 1 513 ? -21.74900 -49.01100 -40.12400 1.000 30.09000  ? 501 TYR A CD2   1 
ATOM   4048 C  CE1   . TYR A 1 513 ? -22.16400 -46.42100 -39.27200 1.000 37.28000  ? 501 TYR A CE1   1 
ATOM   4049 C  CE2   . TYR A 1 513 ? -22.62500 -48.19200 -40.80900 1.000 31.10000  ? 501 TYR A CE2   1 
ATOM   4050 C  CZ    . TYR A 1 513 ? -22.83000 -46.89900 -40.38300 1.000 35.73000  ? 501 TYR A CZ    1 
ATOM   4051 O  OH    . TYR A 1 513 ? -23.70300 -46.07800 -41.06900 1.000 30.92000  ? 501 TYR A OH    1 
ATOM   4052 N  N     . ALA A 1 514 ? -22.12700 -51.60500 -38.11200 1.000 38.39000  ? 502 ALA A N     1 
ATOM   4053 C  CA    . ALA A 1 514 ? -23.36800 -52.26600 -38.54000 1.000 31.25000  ? 502 ALA A CA    1 
ATOM   4054 C  C     . ALA A 1 514 ? -24.10600 -52.87400 -37.37300 1.000 27.90000  ? 502 ALA A C     1 
ATOM   4055 O  O     . ALA A 1 514 ? -25.31100 -52.68100 -37.21500 1.000 31.42000  ? 502 ALA A O     1 
ATOM   4056 C  CB    . ALA A 1 514 ? -23.07100 -53.31800 -39.55100 1.000 33.63000  ? 502 ALA A CB    1 
ATOM   4057 N  N     . LEU A 1 515 ? -23.36700 -53.60700 -36.55000 1.000 36.00000  ? 503 LEU A N     1 
ATOM   4058 C  CA    . LEU A 1 515 ? -23.91800 -54.23500 -35.35300 1.000 35.68000  ? 503 LEU A CA    1 
ATOM   4059 C  C     . LEU A 1 515 ? -24.57700 -53.22200 -34.42700 1.000 37.53000  ? 503 LEU A C     1 
ATOM   4060 O  O     . LEU A 1 515 ? -25.64800 -53.48500 -33.88700 1.000 38.49000  ? 503 LEU A O     1 
ATOM   4061 C  CB    . LEU A 1 515 ? -22.82600 -54.97900 -34.60100 1.000 37.91000  ? 503 LEU A CB    1 
ATOM   4062 C  CG    . LEU A 1 515 ? -23.33400 -55.53300 -33.28500 1.000 40.05000  ? 503 LEU A CG    1 
ATOM   4063 C  CD1   . LEU A 1 515 ? -23.90600 -56.91000 -33.53900 1.000 33.11000  ? 503 LEU A CD1   1 
ATOM   4064 C  CD2   . LEU A 1 515 ? -22.20500 -55.53200 -32.25600 1.000 37.93000  ? 503 LEU A CD2   1 
ATOM   4065 N  N     . GLY A 1 516 ? -23.94600 -52.06000 -34.25300 1.000 34.30000  ? 504 GLY A N     1 
ATOM   4066 C  CA    . GLY A 1 516 ? -24.53700 -51.00100 -33.45100 1.000 32.74000  ? 504 GLY A CA    1 
ATOM   4067 C  C     . GLY A 1 516 ? -25.87400 -50.43700 -33.94800 1.000 33.65000  ? 504 GLY A C     1 
ATOM   4068 O  O     . GLY A 1 516 ? -26.80200 -50.22700 -33.16100 1.000 37.40000  ? 504 GLY A O     1 
ATOM   4069 N  N     . ILE A 1 517 ? -25.98400 -50.17500 -35.24500 1.000 28.34000  ? 505 ILE A N     1 
ATOM   4070 C  CA    . ILE A 1 517 ? -27.26000 -49.72800 -35.81400 1.000 39.14000  ? 505 ILE A CA    1 
ATOM   4071 C  C     . ILE A 1 517 ? -28.36700 -50.78200 -35.69000 1.000 37.39000  ? 505 ILE A C     1 
ATOM   4072 O  O     . ILE A 1 517 ? -29.43400 -50.51400 -35.14200 1.000 32.85000  ? 505 ILE A O     1 
ATOM   4073 C  CB    . ILE A 1 517 ? -27.10400 -49.33600 -37.30300 1.000 34.68000  ? 505 ILE A CB    1 
ATOM   4074 C  CG1   . ILE A 1 517 ? -26.33300 -48.02300 -37.39400 1.000 27.83000  ? 505 ILE A CG1   1 
ATOM   4075 C  CG2   . ILE A 1 517 ? -28.47700 -49.21000 -37.99600 1.000 26.42000  ? 505 ILE A CG2   1 
ATOM   4076 C  CD1   . ILE A 1 517 ? -25.59700 -47.83300 -38.69100 1.000 32.69000  ? 505 ILE A CD1   1 
ATOM   4077 N  N     . ILE A 1 518 ? -28.10200 -51.98400 -36.18900 1.000 33.75000  ? 506 ILE A N     1 
ATOM   4078 C  CA    . ILE A 1 518 ? -29.13900 -53.00600 -36.25900 1.000 32.73000  ? 506 ILE A CA    1 
ATOM   4079 C  C     . ILE A 1 518 ? -29.57700 -53.47000 -34.87200 1.000 37.16000  ? 506 ILE A C     1 
ATOM   4080 O  O     . ILE A 1 518 ? -30.74800 -53.76500 -34.65400 1.000 41.33000  ? 506 ILE A O     1 
ATOM   4081 C  CB    . ILE A 1 518 ? -28.66500 -54.19900 -37.09100 1.000 33.95000  ? 506 ILE A CB    1 
ATOM   4082 C  CG1   . ILE A 1 518 ? -28.59300 -53.79800 -38.56200 1.000 24.37000  ? 506 ILE A CG1   1 
ATOM   4083 C  CG2   . ILE A 1 518 ? -29.61300 -55.36300 -36.94800 1.000 33.85000  ? 506 ILE A CG2   1 
ATOM   4084 C  CD1   . ILE A 1 518 ? -27.75000 -54.70900 -39.37500 1.000 29.83000  ? 506 ILE A CD1   1 
ATOM   4085 N  N     . GLN A 1 519 ? -28.65500 -53.50500 -33.92000 1.000 37.25000  ? 507 GLN A N     1 
ATOM   4086 C  CA    . GLN A 1 519 ? -28.99500 -53.96900 -32.58000 1.000 39.68000  ? 507 GLN A CA    1 
ATOM   4087 C  C     . GLN A 1 519 ? -29.88900 -52.99900 -31.77800 1.000 46.25000  ? 507 GLN A C     1 
ATOM   4088 O  O     . GLN A 1 519 ? -30.56300 -53.41000 -30.82500 1.000 42.78000  ? 507 GLN A O     1 
ATOM   4089 C  CB    . GLN A 1 519 ? -27.72200 -54.25200 -31.81000 1.000 40.51000  ? 507 GLN A CB    1 
ATOM   4090 C  CG    . GLN A 1 519 ? -27.95000 -54.86000 -30.45200 1.000 60.15000  ? 507 GLN A CG    1 
ATOM   4091 C  CD    . GLN A 1 519 ? -26.69700 -55.49700 -29.92300 1.000 70.14000  ? 507 GLN A CD    1 
ATOM   4092 O  OE1   . GLN A 1 519 ? -25.79300 -55.84900 -30.70000 1.000 68.09000  ? 507 GLN A OE1   1 
ATOM   4093 N  NE2   . GLN A 1 519 ? -26.61400 -55.63900 -28.59600 1.000 73.30000  ? 507 GLN A NE2   1 
ATOM   4094 N  N     . ALA A 1 520 ? -29.90800 -51.72100 -32.15900 1.000 42.91000  ? 508 ALA A N     1 
ATOM   4095 C  CA    . ALA A 1 520 ? -30.77900 -50.75600 -31.48700 1.000 41.50000  ? 508 ALA A CA    1 
ATOM   4096 C  C     . ALA A 1 520 ? -32.18100 -50.76600 -32.08800 1.000 42.76000  ? 508 ALA A C     1 
ATOM   4097 O  O     . ALA A 1 520 ? -33.02700 -49.92900 -31.74800 1.000 45.65000  ? 508 ALA A O     1 
ATOM   4098 C  CB    . ALA A 1 520 ? -30.18900 -49.35800 -31.55100 1.000 41.64000  ? 508 ALA A CB    1 
ATOM   4099 N  N     . GLN A 1 521 ? -32.41400 -51.70300 -32.99800 1.000 41.56000  ? 509 GLN A N     1 
ATOM   4100 C  CA    . GLN A 1 521 ? -33.75100 -51.94800 -33.53500 1.000 39.19000  ? 509 GLN A CA    1 
ATOM   4101 C  C     . GLN A 1 521 ? -34.45700 -50.75600 -34.16500 1.000 34.88000  ? 509 GLN A C     1 
ATOM   4102 O  O     . GLN A 1 521 ? -35.58400 -50.44300 -33.79100 1.000 33.15000  ? 509 GLN A O     1 
ATOM   4103 C  CB    . GLN A 1 521 ? -34.63900 -52.49600 -32.43100 1.000 37.82000  ? 509 GLN A CB    1 
ATOM   4104 C  CG    . GLN A 1 521 ? -34.22500 -53.88600 -31.99200 1.000 49.14000  ? 509 GLN A CG    1 
ATOM   4105 C  CD    . GLN A 1 521 ? -34.89600 -54.29200 -30.71200 1.000 51.41000  ? 509 GLN A CD    1 
ATOM   4106 O  OE1   . GLN A 1 521 ? -35.56900 -55.30900 -30.65400 1.000 60.98000  ? 509 GLN A OE1   1 
ATOM   4107 N  NE2   . GLN A 1 521 ? -34.71600 -53.49400 -29.67100 1.000 55.10000  ? 509 GLN A NE2   1 
ATOM   4108 N  N     . PRO A 1 522 ? -33.82400 -50.11400 -35.15100 1.000 30.58000  ? 510 PRO A N     1 
ATOM   4109 C  CA    . PRO A 1 522 ? -34.53200 -49.00100 -35.77600 1.000 32.04000  ? 510 PRO A CA    1 
ATOM   4110 C  C     . PRO A 1 522 ? -35.65800 -49.47600 -36.66300 1.000 33.34000  ? 510 PRO A C     1 
ATOM   4111 O  O     . PRO A 1 522 ? -35.54300 -50.55900 -37.24800 1.000 31.93000  ? 510 PRO A O     1 
ATOM   4112 C  CB    . PRO A 1 522 ? -33.45000 -48.33400 -36.62800 1.000 29.88000  ? 510 PRO A CB    1 
ATOM   4113 C  CG    . PRO A 1 522 ? -32.57000 -49.47000 -37.02700 1.000 29.55000  ? 510 PRO A CG    1 
ATOM   4114 C  CD    . PRO A 1 522 ? -32.54800 -50.40100 -35.82700 1.000 30.95000  ? 510 PRO A CD    1 
ATOM   4115 N  N     . ASP A 1 523 ? -36.70500 -48.66100 -36.77900 1.000 30.91000  ? 511 ASP A N     1 
ATOM   4116 C  CA    . ASP A 1 523 ? -37.71400 -48.85300 -37.80100 1.000 30.98000  ? 511 ASP A CA    1 
ATOM   4117 C  C     . ASP A 1 523 ? -37.75100 -47.64900 -38.75800 1.000 36.22000  ? 511 ASP A C     1 
ATOM   4118 O  O     . ASP A 1 523 ? -38.51800 -47.64900 -39.72200 1.000 40.73000  ? 511 ASP A O     1 
ATOM   4119 C  CB    . ASP A 1 523 ? -39.09200 -49.10900 -37.16500 1.000 32.71000  ? 511 ASP A CB    1 
ATOM   4120 C  CG    . ASP A 1 523 ? -39.53600 -47.99200 -36.23600 1.000 38.69000  ? 511 ASP A CG    1 
ATOM   4121 O  OD1   . ASP A 1 523 ? -39.28900 -46.82400 -36.57100 1.000 43.24000  ? 511 ASP A OD1   1 
ATOM   4122 O  OD2   . ASP A 1 523 ? -40.14100 -48.27500 -35.16800 1.000 42.19000  ? 511 ASP A OD2   1 
ATOM   4123 N  N     . GLN A 1 524 ? -36.92900 -46.63000 -38.49500 1.000 31.89000  ? 512 GLN A N     1 
ATOM   4124 C  CA    . GLN A 1 524 ? -36.79200 -45.48100 -39.41200 1.000 34.39000  ? 512 GLN A CA    1 
ATOM   4125 C  C     . GLN A 1 524 ? -35.36100 -45.04700 -39.54600 1.000 30.84000  ? 512 GLN A C     1 
ATOM   4126 O  O     . GLN A 1 524 ? -34.61800 -45.08100 -38.56900 1.000 31.60000  ? 512 GLN A O     1 
ATOM   4127 C  CB    . GLN A 1 524 ? -37.56600 -44.26400 -38.94000 1.000 28.84000  ? 512 GLN A CB    1 
ATOM   4128 C  CG    . GLN A 1 524 ? -38.90200 -44.54700 -38.40000 1.000 35.97000  ? 512 GLN A CG    1 
ATOM   4129 C  CD    . GLN A 1 524 ? -39.32300 -43.45600 -37.47600 1.000 46.54000  ? 512 GLN A CD    1 
ATOM   4130 O  OE1   . GLN A 1 524 ? -39.16100 -42.26900 -37.79600 1.000 46.85000  ? 512 GLN A OE1   1 
ATOM   4131 N  NE2   . GLN A 1 524 ? -39.83200 -43.83200 -36.30000 1.000 45.04000  ? 512 GLN A NE2   1 
ATOM   4132 N  N     . SER A 1 525 ? -34.99100 -44.58000 -40.73500 1.000 27.71000  ? 513 SER A N     1 
ATOM   4133 C  CA    . SER A 1 525 ? -33.62200 -44.15500 -40.97200 1.000 30.05000  ? 513 SER A CA    1 
ATOM   4134 C  C     . SER A 1 525 ? -33.52600 -43.14100 -42.10500 1.000 36.07000  ? 513 SER A C     1 
ATOM   4135 O  O     . SER A 1 525 ? -34.33300 -43.15500 -43.03500 1.000 39.32000  ? 513 SER A O     1 
ATOM   4136 C  CB    . SER A 1 525 ? -32.74000 -45.37600 -41.27400 1.000 33.67000  ? 513 SER A CB    1 
ATOM   4137 O  OG    . SER A 1 525 ? -31.47000 -45.00400 -41.79800 1.000 36.69000  ? 513 SER A OG    1 
ATOM   4138 N  N     . GLU A 1 526 ? -32.53300 -42.26000 -42.01500 1.000 43.20000  ? 514 GLU A N     1 
ATOM   4139 C  CA    . GLU A 1 526 ? -32.21800 -41.32900 -43.09500 1.000 39.93000  ? 514 GLU A CA    1 
ATOM   4140 C  C     . GLU A 1 526 ? -31.67100 -42.10500 -44.26400 1.000 40.97000  ? 514 GLU A C     1 
ATOM   4141 O  O     . GLU A 1 526 ? -31.76700 -41.67600 -45.41100 1.000 46.00000  ? 514 GLU A O     1 
ATOM   4142 C  CB    . GLU A 1 526 ? -31.18400 -40.29300 -42.66400 1.000 36.64000  ? 514 GLU A CB    1 
ATOM   4143 C  CG    . GLU A 1 526 ? -31.65600 -39.30100 -41.62600 1.000 49.65000  ? 514 GLU A CG    1 
ATOM   4144 C  CD    . GLU A 1 526 ? -30.49500 -38.64300 -40.85400 1.000 65.31000  ? 514 GLU A CD    1 
ATOM   4145 O  OE1   . GLU A 1 526 ? -29.30500 -38.84700 -41.22800 1.000 55.84000  ? 514 GLU A OE1   1 
ATOM   4146 O  OE2   . GLU A 1 526 ? -30.78400 -37.92800 -39.86100 1.000 62.98000  ? 514 GLU A OE2   1 
ATOM   4147 N  N     . SER A 1 527 ? -31.07900 -43.25300 -43.95500 1.000 37.82000  ? 515 SER A N     1 
ATOM   4148 C  CA    . SER A 1 527 ? -30.38000 -44.05000 -44.95000 1.000 33.97000  ? 515 SER A CA    1 
ATOM   4149 C  C     . SER A 1 527 ? -31.30700 -45.00200 -45.69000 1.000 39.98000  ? 515 SER A C     1 
ATOM   4150 O  O     . SER A 1 527 ? -31.98100 -45.84500 -45.08200 1.000 41.94000  ? 515 SER A O     1 
ATOM   4151 C  CB    . SER A 1 527 ? -29.25700 -44.84100 -44.28800 1.000 37.61000  ? 515 SER A CB    1 
ATOM   4152 O  OG    . SER A 1 527 ? -28.76100 -45.83800 -45.16500 1.000 40.88000  ? 515 SER A OG    1 
ATOM   4153 N  N     . GLU A 1 528 ? -31.33300 -44.88000 -47.00900 1.000 40.12000  ? 516 GLU A N     1 
ATOM   4154 C  CA    . GLU A 1 528 ? -32.16400 -45.76400 -47.80100 1.000 43.61000  ? 516 GLU A CA    1 
ATOM   4155 C  C     . GLU A 1 528 ? -31.71300 -47.19900 -47.59600 1.000 41.33000  ? 516 GLU A C     1 
ATOM   4156 O  O     . GLU A 1 528 ? -32.53600 -48.09900 -47.45400 1.000 46.67000  ? 516 GLU A O     1 
ATOM   4157 C  CB    . GLU A 1 528 ? -32.11600 -45.39700 -49.28300 1.000 47.34000  ? 516 GLU A CB    1 
ATOM   4158 C  CG    . GLU A 1 528 ? -33.20600 -46.07100 -50.10300 1.000 59.98000  ? 516 GLU A CG    1 
ATOM   4159 C  CD    . GLU A 1 528 ? -32.95600 -45.95500 -51.59300 1.000 81.94000  ? 516 GLU A CD    1 
ATOM   4160 O  OE1   . GLU A 1 528 ? -31.76800 -45.94400 -51.99700 1.000 83.33000  ? 516 GLU A OE1   1 
ATOM   4161 O  OE2   . GLU A 1 528 ? -33.94500 -45.86300 -52.35800 1.000 96.06000  ? 516 GLU A OE2   1 
ATOM   4162 N  N     . LEU A 1 529 ? -30.40600 -47.41700 -47.56100 1.000 35.13000  ? 517 LEU A N     1 
ATOM   4163 C  CA    . LEU A 1 529 ? -29.89500 -48.77200 -47.38500 1.000 35.03000  ? 517 LEU A CA    1 
ATOM   4164 C  C     . LEU A 1 529 ? -30.33400 -49.35500 -46.04300 1.000 34.64000  ? 517 LEU A C     1 
ATOM   4165 O  O     . LEU A 1 529 ? -30.69500 -50.52900 -45.95500 1.000 31.26000  ? 517 LEU A O     1 
ATOM   4166 C  CB    . LEU A 1 529 ? -28.37900 -48.77800 -47.49800 1.000 27.47000  ? 517 LEU A CB    1 
ATOM   4167 C  CG    . LEU A 1 529 ? -27.60100 -50.06900 -47.29400 1.000 34.77000  ? 517 LEU A CG    1 
ATOM   4168 C  CD1   . LEU A 1 529 ? -28.01600 -51.14300 -48.30000 1.000 34.85000  ? 517 LEU A CD1   1 
ATOM   4169 C  CD2   . LEU A 1 529 ? -26.12200 -49.74200 -47.42100 1.000 33.55000  ? 517 LEU A CD2   1 
ATOM   4170 N  N     . VAL A 1 530 ? -30.32200 -48.53200 -44.99300 1.000 35.75000  ? 518 VAL A N     1 
ATOM   4171 C  CA    . VAL A 1 530 ? -30.73100 -49.02700 -43.68400 1.000 32.23000  ? 518 VAL A CA    1 
ATOM   4172 C  C     . VAL A 1 530 ? -32.21500 -49.31800 -43.70700 1.000 36.61000  ? 518 VAL A C     1 
ATOM   4173 O  O     . VAL A 1 530 ? -32.65700 -50.30600 -43.12600 1.000 41.27000  ? 518 VAL A O     1 
ATOM   4174 C  CB    . VAL A 1 530 ? -30.40700 -48.05400 -42.54300 1.000 32.67000  ? 518 VAL A CB    1 
ATOM   4175 C  CG1   . VAL A 1 530 ? -31.07000 -48.51100 -41.25600 1.000 27.50000  ? 518 VAL A CG1   1 
ATOM   4176 C  CG2   . VAL A 1 530 ? -28.90500 -47.97500 -42.33700 1.000 32.82000  ? 518 VAL A CG2   1 
ATOM   4177 N  N     . ASN A 1 531 ? -32.98600 -48.47800 -44.39200 1.000 36.32000  ? 519 ASN A N     1 
ATOM   4178 C  CA    . ASN A 1 531 ? -34.41300 -48.73800 -44.55200 1.000 31.59000  ? 519 ASN A CA    1 
ATOM   4179 C  C     . ASN A 1 531 ? -34.66200 -50.09700 -45.22800 1.000 32.90000  ? 519 ASN A C     1 
ATOM   4180 O  O     . ASN A 1 531 ? -35.44300 -50.90100 -44.72400 1.000 34.77000  ? 519 ASN A O     1 
ATOM   4181 C  CB    . ASN A 1 531 ? -35.08500 -47.61400 -45.35000 1.000 38.26000  ? 519 ASN A CB    1 
ATOM   4182 C  CG    . ASN A 1 531 ? -35.45200 -46.39800 -44.48200 1.000 38.93000  ? 519 ASN A CG    1 
ATOM   4183 O  OD1   . ASN A 1 531 ? -35.71700 -46.52000 -43.28600 1.000 34.34000  ? 519 ASN A OD1   1 
ATOM   4184 N  ND2   . ASN A 1 531 ? -35.47400 -45.21900 -45.10100 1.000 44.63000  ? 519 ASN A ND2   1 
ATOM   4185 N  N     . GLN A 1 532 ? -33.97800 -50.37400 -46.33900 1.000 36.16000  ? 520 GLN A N     1 
ATOM   4186 C  CA    . GLN A 1 532 ? -34.11200 -51.67000 -47.01400 1.000 34.12000  ? 520 GLN A CA    1 
ATOM   4187 C  C     . GLN A 1 532 ? -33.81700 -52.80900 -46.05300 1.000 32.18000  ? 520 GLN A C     1 
ATOM   4188 O  O     . GLN A 1 532 ? -34.58600 -53.76300 -45.97100 1.000 34.55000  ? 520 GLN A O     1 
ATOM   4189 C  CB    . GLN A 1 532 ? -33.19500 -51.75600 -48.23700 1.000 30.91000  ? 520 GLN A CB    1 
ATOM   4190 C  CG    . GLN A 1 532 ? -33.83300 -51.20900 -49.49900 1.000 43.95000  ? 520 GLN A CG    1 
ATOM   4191 C  CD    . GLN A 1 532 ? -32.82700 -50.59100 -50.46500 1.000 52.76000  ? 520 GLN A CD    1 
ATOM   4192 O  OE1   . GLN A 1 532 ? -31.68600 -51.04200 -50.56300 1.000 52.48000  ? 520 GLN A OE1   1 
ATOM   4193 N  NE2   . GLN A 1 532 ? -33.25000 -49.54600 -51.18200 1.000 61.30000  ? 520 GLN A NE2   1 
ATOM   4194 N  N     . ILE A 1 533 ? -32.71200 -52.69600 -45.31800 1.000 31.76000  ? 521 ILE A N     1 
ATOM   4195 C  CA    . ILE A 1 533 ? -32.37700 -53.66800 -44.27700 1.000 31.65000  ? 521 ILE A CA    1 
ATOM   4196 C  C     . ILE A 1 533 ? -33.53000 -53.86200 -43.29000 1.000 27.89000  ? 521 ILE A C     1 
ATOM   4197 O  O     . ILE A 1 533 ? -33.91100 -54.99300 -43.00000 1.000 28.88000  ? 521 ILE A O     1 
ATOM   4198 C  CB    . ILE A 1 533 ? -31.11000 -53.24900 -43.50500 1.000 28.18000  ? 521 ILE A CB    1 
ATOM   4199 C  CG1   . ILE A 1 533 ? -29.88700 -53.40400 -44.39900 1.000 25.43000  ? 521 ILE A CG1   1 
ATOM   4200 C  CG2   . ILE A 1 533 ? -30.93400 -54.10000 -42.24900 1.000 19.72000  ? 521 ILE A CG2   1 
ATOM   4201 C  CD1   . ILE A 1 533 ? -28.61300 -53.05900 -43.70800 1.000 29.78000  ? 521 ILE A CD1   1 
ATOM   4202 N  N     . ILE A 1 534 ? -34.09000 -52.76200 -42.79200 1.000 26.92000  ? 522 ILE A N     1 
ATOM   4203 C  CA    . ILE A 1 534 ? -35.21400 -52.81200 -41.85300 1.000 28.32000  ? 522 ILE A CA    1 
ATOM   4204 C  C     . ILE A 1 534 ? -36.41800 -53.56800 -42.42600 1.000 30.13000  ? 522 ILE A C     1 
ATOM   4205 O  O     . ILE A 1 534 ? -37.02000 -54.42000 -41.75700 1.000 29.37000  ? 522 ILE A O     1 
ATOM   4206 C  CB    . ILE A 1 534 ? -35.66700 -51.40300 -41.45200 1.000 27.84000  ? 522 ILE A CB    1 
ATOM   4207 C  CG1   . ILE A 1 534 ? -34.68100 -50.77900 -40.46500 1.000 26.44000  ? 522 ILE A CG1   1 
ATOM   4208 C  CG2   . ILE A 1 534 ? -37.05400 -51.44800 -40.83200 1.000 25.18000  ? 522 ILE A CG2   1 
ATOM   4209 C  CD1   . ILE A 1 534 ? -34.93300 -49.29800 -40.23500 1.000 25.87000  ? 522 ILE A CD1   1 
ATOM   4210 N  N     . GLU A 1 535 ? -36.76500 -53.25100 -43.66600 1.000 30.66000  ? 523 GLU A N     1 
ATOM   4211 C  CA    . GLU A 1 535 ? -37.85200 -53.93700 -44.33800 1.000 34.41000  ? 523 GLU A CA    1 
ATOM   4212 C  C     . GLU A 1 535 ? -37.62900 -55.45100 -44.29000 1.000 36.01000  ? 523 GLU A C     1 
ATOM   4213 O  O     . GLU A 1 535 ? -38.52700 -56.20000 -43.93300 1.000 36.33000  ? 523 GLU A O     1 
ATOM   4214 C  CB    . GLU A 1 535 ? -37.97700 -53.44500 -45.77800 1.000 44.06000  ? 523 GLU A CB    1 
ATOM   4215 C  CG    . GLU A 1 535 ? -39.12800 -54.09000 -46.54800 1.000 62.42000  ? 523 GLU A CG    1 
ATOM   4216 C  CD    . GLU A 1 535 ? -39.42000 -53.37700 -47.85600 1.000 71.30000  ? 523 GLU A CD    1 
ATOM   4217 O  OE1   . GLU A 1 535 ? -40.40100 -52.59700 -47.89600 1.000 77.02000  ? 523 GLU A OE1   1 
ATOM   4218 O  OE2   . GLU A 1 535 ? -38.66600 -53.59200 -48.83400 1.000 72.26000  ? 523 GLU A OE2   1 
ATOM   4219 N  N     . GLN A 1 536 ? -36.41900 -55.89300 -44.62700 1.000 36.48000  ? 524 GLN A N     1 
ATOM   4220 C  CA    . GLN A 1 536 ? -36.05300 -57.30100 -44.51700 1.000 29.60000  ? 524 GLN A CA    1 
ATOM   4221 C  C     . GLN A 1 536 ? -36.18700 -57.82800 -43.10500 1.000 30.99000  ? 524 GLN A C     1 
ATOM   4222 O  O     . GLN A 1 536 ? -36.76100 -58.89700 -42.91400 1.000 39.47000  ? 524 GLN A O     1 
ATOM   4223 C  CB    . GLN A 1 536 ? -34.61900 -57.52300 -44.97600 1.000 33.03000  ? 524 GLN A CB    1 
ATOM   4224 C  CG    . GLN A 1 536 ? -34.39800 -57.21400 -46.42600 1.000 38.02000  ? 524 GLN A CG    1 
ATOM   4225 C  CD    . GLN A 1 536 ? -35.11100 -58.19000 -47.30700 1.000 36.76000  ? 524 GLN A CD    1 
ATOM   4226 O  OE1   . GLN A 1 536 ? -35.19300 -59.37800 -46.99300 1.000 33.17000  ? 524 GLN A OE1   1 
ATOM   4227 N  NE2   . GLN A 1 536 ? -35.65300 -57.69900 -48.41100 1.000 47.83000  ? 524 GLN A NE2   1 
ATOM   4228 N  N     . LEU A 1 537 ? -35.63400 -57.11600 -42.11500 1.000 30.09000  ? 525 LEU A N     1 
ATOM   4229 C  CA    . LEU A 1 537 ? -35.69200 -57.59200 -40.72000 1.000 26.93000  ? 525 LEU A CA    1 
ATOM   4230 C  C     . LEU A 1 537 ? -37.14200 -57.79300 -40.27100 1.000 31.90000  ? 525 LEU A C     1 
ATOM   4231 O  O     . LEU A 1 537 ? -37.43400 -58.68800 -39.48400 1.000 32.29000  ? 525 LEU A O     1 
ATOM   4232 C  CB    . LEU A 1 537 ? -34.97600 -56.62800 -39.76800 1.000 25.00000  ? 525 LEU A CB    1 
ATOM   4233 C  CG    . LEU A 1 537 ? -33.45400 -56.51000 -39.87600 1.000 29.42000  ? 525 LEU A CG    1 
ATOM   4234 C  CD1   . LEU A 1 537 ? -32.98100 -55.21600 -39.25900 1.000 28.33000  ? 525 LEU A CD1   1 
ATOM   4235 C  CD2   . LEU A 1 537 ? -32.77300 -57.67000 -39.20700 1.000 26.53000  ? 525 LEU A CD2   1 
ATOM   4236 N  N     . ILE A 1 538 ? -38.05500 -56.97100 -40.78400 1.000 32.71000  ? 526 ILE A N     1 
ATOM   4237 C  CA    . ILE A 1 538 ? -39.46400 -57.11500 -40.43500 1.000 35.25000  ? 526 ILE A CA    1 
ATOM   4238 C  C     . ILE A 1 538 ? -40.09200 -58.37400 -41.04800 1.000 31.48000  ? 526 ILE A C     1 
ATOM   4239 O  O     . ILE A 1 538 ? -40.85000 -59.06200 -40.37500 1.000 33.07000  ? 526 ILE A O     1 
ATOM   4240 C  CB    . ILE A 1 538 ? -40.25900 -55.86400 -40.84500 1.000 35.89000  ? 526 ILE A CB    1 
ATOM   4241 C  CG1   . ILE A 1 538 ? -39.89800 -54.70400 -39.92000 1.000 29.38000  ? 526 ILE A CG1   1 
ATOM   4242 C  CG2   . ILE A 1 538 ? -41.73400 -56.09700 -40.71300 1.000 27.59000  ? 526 ILE A CG2   1 
ATOM   4243 C  CD1   . ILE A 1 538 ? -40.43900 -53.40600 -40.36300 1.000 31.79000  ? 526 ILE A CD1   1 
ATOM   4244 N  N     . LYS A 1 539 ? -39.75900 -58.69100 -42.30000 1.000 30.54000  ? 527 LYS A N     1 
ATOM   4245 C  CA    . LYS A 1 539 ? -40.25400 -59.91400 -42.95600 1.000 30.67000  ? 527 LYS A CA    1 
ATOM   4246 C  C     . LYS A 1 539 ? -39.80700 -61.23700 -42.30200 1.000 35.17000  ? 527 LYS A C     1 
ATOM   4247 O  O     . LYS A 1 539 ? -40.52800 -62.23500 -42.38300 1.000 32.04000  ? 527 LYS A O     1 
ATOM   4248 C  CB    . LYS A 1 539 ? -39.82800 -59.94100 -44.43500 1.000 28.51000  ? 527 LYS A CB    1 
ATOM   4249 C  CG    . LYS A 1 539 ? -40.56300 -58.93200 -45.29500 1.000 41.49000  ? 527 LYS A CG    1 
ATOM   4250 C  CD    . LYS A 1 539 ? -40.02600 -58.84100 -46.71400 1.000 46.26000  ? 527 LYS A CD    1 
ATOM   4251 C  CE    . LYS A 1 539 ? -40.83000 -57.80900 -47.51200 1.000 59.02000  ? 527 LYS A CE    1 
ATOM   4252 N  NZ    . LYS A 1 539 ? -40.24900 -57.47800 -48.85100 1.000 61.85000  ? 527 LYS A NZ    1 
ATOM   4253 N  N     . LYS A 1 540 ? -38.62600 -61.25400 -41.68100 1.000 31.40000  ? 528 LYS A N     1 
ATOM   4254 C  CA    . LYS A 1 540 ? -38.05300 -62.48800 -41.14900 1.000 26.04000  ? 528 LYS A CA    1 
ATOM   4255 C  C     . LYS A 1 540 ? -38.80700 -62.97800 -39.92800 1.000 33.23000  ? 528 LYS A C     1 
ATOM   4256 O  O     . LYS A 1 540 ? -39.41600 -62.18300 -39.21100 1.000 33.04000  ? 528 LYS A O     1 
ATOM   4257 C  CB    . LYS A 1 540 ? -36.58300 -62.28300 -40.77500 1.000 29.19000  ? 528 LYS A CB    1 
ATOM   4258 C  CG    . LYS A 1 540 ? -35.68100 -61.92400 -41.91400 1.000 25.29000  ? 528 LYS A CG    1 
ATOM   4259 C  CD    . LYS A 1 540 ? -35.47700 -63.11400 -42.80700 1.000 26.08000  ? 528 LYS A CD    1 
ATOM   4260 C  CE    . LYS A 1 540 ? -34.74100 -62.67100 -44.03600 1.000 30.23000  ? 528 LYS A CE    1 
ATOM   4261 N  NZ    . LYS A 1 540 ? -34.42400 -63.78600 -44.94500 1.000 31.67000  ? 528 LYS A NZ    1 
ATOM   4262 N  N     . GLU A 1 541 ? -38.76200 -64.29200 -39.70500 1.000 36.18000  ? 529 GLU A N     1 
ATOM   4263 C  CA    . GLU A 1 541 ? -39.27000 -64.91000 -38.48100 1.000 38.38000  ? 529 GLU A CA    1 
ATOM   4264 C  C     . GLU A 1 541 ? -38.25400 -64.76900 -37.36200 1.000 32.66000  ? 529 GLU A C     1 
ATOM   4265 O  O     . GLU A 1 541 ? -38.58200 -64.40300 -36.24800 1.000 37.41000  ? 529 GLU A O     1 
ATOM   4266 C  CB    . GLU A 1 541 ? -39.58100 -66.40400 -38.69400 1.000 41.98000  ? 529 GLU A CB    1 
ATOM   4267 C  CG    . GLU A 1 541 ? -40.99900 -66.73900 -39.19000 1.000 48.07000  ? 529 GLU A CG    1 
ATOM   4268 C  CD    . GLU A 1 541 ? -42.11800 -66.16200 -38.29100 1.000 67.68000  ? 529 GLU A CD    1 
ATOM   4269 O  OE1   . GLU A 1 541 ? -42.26100 -66.60700 -37.11900 1.000 65.34000  ? 529 GLU A OE1   1 
ATOM   4270 O  OE2   . GLU A 1 541 ? -42.85700 -65.26000 -38.76500 1.000 68.93000  ? 529 GLU A OE2   1 
ATOM   4271 N  N     . LYS A 1 542 ? -37.01000 -65.08900 -37.66400 1.000 34.70000  ? 530 LYS A N     1 
ATOM   4272 C  CA    . LYS A 1 542 ? -35.95600 -65.05200 -36.66400 1.000 34.24000  ? 530 LYS A CA    1 
ATOM   4273 C  C     . LYS A 1 542 ? -34.66200 -64.59200 -37.28900 1.000 33.17000  ? 530 LYS A C     1 
ATOM   4274 O  O     . LYS A 1 542 ? -34.26800 -65.12100 -38.32900 1.000 34.85000  ? 530 LYS A O     1 
ATOM   4275 C  CB    . LYS A 1 542 ? -35.75500 -66.42500 -36.03900 1.000 36.39000  ? 530 LYS A CB    1 
ATOM   4276 C  CG    . LYS A 1 542 ? -36.71000 -66.77000 -34.95400 1.000 37.06000  ? 530 LYS A CG    1 
ATOM   4277 C  CD    . LYS A 1 542 ? -36.53800 -68.21500 -34.58100 1.000 36.18000  ? 530 LYS A CD    1 
ATOM   4278 C  CE    . LYS A 1 542 ? -37.32400 -68.54700 -33.33800 1.000 45.16000  ? 530 LYS A CE    1 
ATOM   4279 N  NZ    . LYS A 1 542 ? -36.82900 -69.82500 -32.77500 1.000 56.74000  ? 530 LYS A NZ    1 
ATOM   4280 N  N     . VAL A 1 543 ? -34.01600 -63.61000 -36.66200 1.000 32.65000  ? 531 VAL A N     1 
ATOM   4281 C  CA    . VAL A 1 543 ? -32.67300 -63.18600 -37.04700 1.000 26.85000  ? 531 VAL A CA    1 
ATOM   4282 C  C     . VAL A 1 543 ? -31.78700 -63.20700 -35.82700 1.000 28.01000  ? 531 VAL A C     1 
ATOM   4283 O  O     . VAL A 1 543 ? -32.19100 -62.73000 -34.77300 1.000 32.60000  ? 531 VAL A O     1 
ATOM   4284 C  CB    . VAL A 1 543 ? -32.64700 -61.76400 -37.61900 1.000 32.10000  ? 531 VAL A CB    1 
ATOM   4285 C  CG1   . VAL A 1 543 ? -31.22200 -61.36900 -38.00200 1.000 22.95000  ? 531 VAL A CG1   1 
ATOM   4286 C  CG2   . VAL A 1 543 ? -33.57500 -61.64800 -38.79800 1.000 31.86000  ? 531 VAL A CG2   1 
ATOM   4287 N  N     . TYR A 1 544 ? -30.58800 -63.75900 -35.95600 1.000 30.54000  ? 532 TYR A N     1 
ATOM   4288 C  CA    . TYR A 1 544 ? -29.58900 -63.64600 -34.90600 1.000 27.17000  ? 532 TYR A CA    1 
ATOM   4289 C  C     . TYR A 1 544 ? -28.33200 -63.03800 -35.49900 1.000 30.94000  ? 532 TYR A C     1 
ATOM   4290 O  O     . TYR A 1 544 ? -27.75200 -63.58300 -36.44900 1.000 28.29000  ? 532 TYR A O     1 
ATOM   4291 C  CB    . TYR A 1 544 ? -29.29000 -65.00400 -34.28100 1.000 32.55000  ? 532 TYR A CB    1 
ATOM   4292 C  CG    . TYR A 1 544 ? -28.17800 -64.97800 -33.25600 1.000 34.74000  ? 532 TYR A CG    1 
ATOM   4293 C  CD1   . TYR A 1 544 ? -28.40700 -64.50900 -31.97100 1.000 37.47000  ? 532 TYR A CD1   1 
ATOM   4294 C  CD2   . TYR A 1 544 ? -26.89800 -65.43000 -33.57000 1.000 30.18000  ? 532 TYR A CD2   1 
ATOM   4295 C  CE1   . TYR A 1 544 ? -27.38500 -64.49000 -31.01400 1.000 36.72000  ? 532 TYR A CE1   1 
ATOM   4296 C  CE2   . TYR A 1 544 ? -25.86600 -65.40400 -32.62400 1.000 32.90000  ? 532 TYR A CE2   1 
ATOM   4297 C  CZ    . TYR A 1 544 ? -26.12100 -64.93300 -31.35100 1.000 35.45000  ? 532 TYR A CZ    1 
ATOM   4298 O  OH    . TYR A 1 544 ? -25.12400 -64.90700 -30.40400 1.000 42.16000  ? 532 TYR A OH    1 
ATOM   4299 N  N     . LEU A 1 545 ? -27.92000 -61.90100 -34.94300 1.000 32.16000  ? 533 LEU A N     1 
ATOM   4300 C  CA    . LEU A 1 545 ? -26.76000 -61.17900 -35.44300 1.000 32.94000  ? 533 LEU A CA    1 
ATOM   4301 C  C     . LEU A 1 545 ? -25.62700 -61.21400 -34.41500 1.000 33.73000  ? 533 LEU A C     1 
ATOM   4302 O  O     . LEU A 1 545 ? -25.78600 -60.75100 -33.28800 1.000 38.50000  ? 533 LEU A O     1 
ATOM   4303 C  CB    . LEU A 1 545 ? -27.14300 -59.73900 -35.78000 1.000 32.51000  ? 533 LEU A CB    1 
ATOM   4304 C  CG    . LEU A 1 545 ? -26.03100 -58.93700 -36.44700 1.000 34.36000  ? 533 LEU A CG    1 
ATOM   4305 C  CD1   . LEU A 1 545 ? -25.97600 -59.28700 -37.91000 1.000 38.74000  ? 533 LEU A CD1   1 
ATOM   4306 C  CD2   . LEU A 1 545 ? -26.23300 -57.45100 -36.25300 1.000 40.41000  ? 533 LEU A CD2   1 
ATOM   4307 N  N     . ALA A 1 546 ? -24.49200 -61.78200 -34.80400 1.000 30.08000  ? 534 ALA A N     1 
ATOM   4308 C  CA    . ALA A 1 546 ? -23.35600 -61.96500 -33.90000 1.000 31.18000  ? 534 ALA A CA    1 
ATOM   4309 C  C     . ALA A 1 546 ? -22.13600 -61.22000 -34.41300 1.000 31.21000  ? 534 ALA A C     1 
ATOM   4310 O  O     . ALA A 1 546 ? -22.04000 -60.94000 -35.59900 1.000 33.25000  ? 534 ALA A O     1 
ATOM   4311 C  CB    . ALA A 1 546 ? -23.03600 -63.42800 -33.74600 1.000 31.57000  ? 534 ALA A CB    1 
ATOM   4312 N  N     . TRP A 1 547 ? -21.19700 -60.90100 -33.53100 1.000 30.48000  ? 535 TRP A N     1 
ATOM   4313 C  CA    . TRP A 1 547 ? -20.02000 -60.16100 -33.96100 1.000 30.69000  ? 535 TRP A CA    1 
ATOM   4314 C  C     . TRP A 1 547 ? -18.74800 -60.99900 -33.76900 1.000 31.91000  ? 535 TRP A C     1 
ATOM   4315 O  O     . TRP A 1 547 ? -18.72800 -61.90200 -32.93800 1.000 33.90000  ? 535 TRP A O     1 
ATOM   4316 C  CB    . TRP A 1 547 ? -19.94300 -58.85100 -33.19300 1.000 33.86000  ? 535 TRP A CB    1 
ATOM   4317 C  CG    . TRP A 1 547 ? -18.75500 -58.03000 -33.50600 1.000 36.95000  ? 535 TRP A CG    1 
ATOM   4318 C  CD1   . TRP A 1 547 ? -18.62300 -57.13100 -34.52900 1.000 34.07000  ? 535 TRP A CD1   1 
ATOM   4319 C  CD2   . TRP A 1 547 ? -17.51900 -58.00500 -32.78000 1.000 37.45000  ? 535 TRP A CD2   1 
ATOM   4320 N  NE1   . TRP A 1 547 ? -17.37200 -56.56100 -34.49300 1.000 35.21000  ? 535 TRP A NE1   1 
ATOM   4321 C  CE2   . TRP A 1 547 ? -16.67400 -57.08200 -33.42900 1.000 39.19000  ? 535 TRP A CE2   1 
ATOM   4322 C  CE3   . TRP A 1 547 ? -17.04200 -58.68800 -31.64800 1.000 35.30000  ? 535 TRP A CE3   1 
ATOM   4323 C  CZ2   . TRP A 1 547 ? -15.36900 -56.81600 -32.97800 1.000 34.16000  ? 535 TRP A CZ2   1 
ATOM   4324 C  CZ3   . TRP A 1 547 ? -15.75000 -58.43500 -31.21100 1.000 33.10000  ? 535 TRP A CZ3   1 
ATOM   4325 C  CH2   . TRP A 1 547 ? -14.92800 -57.50100 -31.87600 1.000 35.13000  ? 535 TRP A CH2   1 
ATOM   4326 N  N     . VAL A 1 548 ? -17.71200 -60.73900 -34.56300 1.000 28.54000  ? 536 VAL A N     1 
ATOM   4327 C  CA    . VAL A 1 548 ? -16.39700 -61.33700 -34.33000 1.000 31.41000  ? 536 VAL A CA    1 
ATOM   4328 C  C     . VAL A 1 548 ? -15.33600 -60.29800 -34.67200 1.000 33.90000  ? 536 VAL A C     1 
ATOM   4329 O  O     . VAL A 1 548 ? -15.57500 -59.44700 -35.51800 1.000 34.40000  ? 536 VAL A O     1 
ATOM   4330 C  CB    . VAL A 1 548 ? -16.14500 -62.62700 -35.18000 1.000 27.97000  ? 536 VAL A CB    1 
ATOM   4331 C  CG1   . VAL A 1 548 ? -17.02100 -63.77300 -34.73500 1.000 23.45000  ? 536 VAL A CG1   1 
ATOM   4332 C  CG2   . VAL A 1 548 ? -16.32000 -62.34600 -36.65800 1.000 31.38000  ? 536 VAL A CG2   1 
ATOM   4333 N  N     . PRO A 1 549 ? -14.16100 -60.35500 -34.01900 1.000 37.60000  ? 537 PRO A N     1 
ATOM   4334 C  CA    . PRO A 1 549 ? -13.07200 -59.43100 -34.37600 1.000 35.60000  ? 537 PRO A CA    1 
ATOM   4335 C  C     . PRO A 1 549 ? -12.60500 -59.67900 -35.79900 1.000 35.21000  ? 537 PRO A C     1 
ATOM   4336 O  O     . PRO A 1 549 ? -12.42100 -60.84700 -36.14400 1.000 39.04000  ? 537 PRO A O     1 
ATOM   4337 C  CB    . PRO A 1 549 ? -11.95100 -59.78600 -33.38700 1.000 36.42000  ? 537 PRO A CB    1 
ATOM   4338 C  CG    . PRO A 1 549 ? -12.57200 -60.69900 -32.36200 1.000 40.83000  ? 537 PRO A CG    1 
ATOM   4339 C  CD    . PRO A 1 549 ? -13.74300 -61.34900 -33.01700 1.000 35.99000  ? 537 PRO A CD    1 
ATOM   4340 N  N     . ALA A 1 550 ? -12.40800 -58.62500 -36.59000 1.000 37.29000  ? 538 ALA A N     1 
ATOM   4341 C  CA    . ALA A 1 550 ? -11.91300 -58.74800 -37.97100 1.000 42.49000  ? 538 ALA A CA    1 
ATOM   4342 C  C     . ALA A 1 550 ? -10.42000 -59.09800 -38.07800 1.000 53.55000  ? 538 ALA A C     1 
ATOM   4343 O  O     . ALA A 1 550 ? -9.63300  -58.79100 -37.17900 1.000 58.22000  ? 538 ALA A O     1 
ATOM   4344 C  CB    . ALA A 1 550 ? -12.17300 -57.47400 -38.72500 1.000 39.70000  ? 538 ALA A CB    1 
ATOM   4345 N  N     . HIS A 1 551 ? -10.04300 -59.72400 -39.19300 1.000 50.85000  ? 539 HIS A N     1 
ATOM   4346 C  CA    . HIS A 1 551 ? -8.64800  -60.05300 -39.48000 1.000 51.82000  ? 539 HIS A CA    1 
ATOM   4347 C  C     . HIS A 1 551 ? -7.97700  -60.84600 -38.37000 1.000 52.60000  ? 539 HIS A C     1 
ATOM   4348 O  O     . HIS A 1 551 ? -6.82900  -60.57900 -38.04700 1.000 54.82000  ? 539 HIS A O     1 
ATOM   4349 C  CB    . HIS A 1 551 ? -7.81100  -58.78900 -39.72100 1.000 44.85000  ? 539 HIS A CB    1 
ATOM   4350 C  CG    . HIS A 1 551 ? -8.51400  -57.72500 -40.49200 1.000 49.81000  ? 539 HIS A CG    1 
ATOM   4351 N  ND1   . HIS A 1 551 ? -8.87500  -57.88000 -41.81600 1.000 58.24000  ? 539 HIS A ND1   1 
ATOM   4352 C  CD2   . HIS A 1 551 ? -8.92000  -56.48000 -40.13500 1.000 51.49000  ? 539 HIS A CD2   1 
ATOM   4353 C  CE1   . HIS A 1 551 ? -9.48300  -56.78200 -42.23500 1.000 62.95000  ? 539 HIS A CE1   1 
ATOM   4354 N  NE2   . HIS A 1 551 ? -9.52300  -55.91800 -41.23600 1.000 60.80000  ? 539 HIS A NE2   1 
ATOM   4355 N  N     . LYS A 1 552 ? -8.66400  -61.80400 -37.76600 1.000 52.22000  ? 540 LYS A N     1 
ATOM   4356 C  CA    . LYS A 1 552 ? -7.97200  -62.66700 -36.81500 1.000 52.87000  ? 540 LYS A CA    1 
ATOM   4357 C  C     . LYS A 1 552 ? -8.16900  -64.14200 -37.14600 1.000 55.67000  ? 540 LYS A C     1 
ATOM   4358 O  O     . LYS A 1 552 ? -8.15600  -65.00100 -36.24800 1.000 55.80000  ? 540 LYS A O     1 
ATOM   4359 C  CB    . LYS A 1 552 ? -8.42500  -62.38000 -35.39100 1.000 49.88000  ? 540 LYS A CB    1 
ATOM   4360 C  CG    . LYS A 1 552 ? -8.59600  -60.92000 -35.10000 1.000 48.02000  ? 540 LYS A CG    1 
ATOM   4361 C  CD    . LYS A 1 552 ? -8.25300  -60.61900 -33.65500 1.000 54.55000  ? 540 LYS A CD    1 
ATOM   4362 C  CE    . LYS A 1 552 ? -6.73500  -60.59900 -33.43100 1.000 63.27000  ? 540 LYS A CE    1 
ATOM   4363 N  NZ    . LYS A 1 552 ? -6.07800  -59.32000 -33.90700 1.000 62.96000  ? 540 LYS A NZ    1 
ATOM   4364 N  N     . GLY A 1 553 ? -8.34200  -64.42600 -38.43800 1.000 50.96000  ? 541 GLY A N     1 
ATOM   4365 C  CA    . GLY A 1 553 ? -8.36600  -65.79200 -38.93000 1.000 51.48000  ? 541 GLY A CA    1 
ATOM   4366 C  C     . GLY A 1 553 ? -9.53900  -66.62600 -38.44300 1.000 56.28000  ? 541 GLY A C     1 
ATOM   4367 O  O     . GLY A 1 553 ? -9.53500  -67.85100 -38.58300 1.000 59.50000  ? 541 GLY A O     1 
ATOM   4368 N  N     . ILE A 1 554 ? -10.54600 -65.97100 -37.87100 1.000 51.08000  ? 542 ILE A N     1 
ATOM   4369 C  CA    . ILE A 1 554 ? -11.74400 -66.66800 -37.43000 1.000 50.76000  ? 542 ILE A CA    1 
ATOM   4370 C  C     . ILE A 1 554 ? -12.51400 -67.17500 -38.65200 1.000 50.78000  ? 542 ILE A C     1 
ATOM   4371 O  O     . ILE A 1 554 ? -13.00400 -66.38600 -39.45800 1.000 54.58000  ? 542 ILE A O     1 
ATOM   4372 C  CB    . ILE A 1 554 ? -12.66200 -65.75200 -36.59100 1.000 52.80000  ? 542 ILE A CB    1 
ATOM   4373 C  CG1   . ILE A 1 554 ? -11.86600 -65.01800 -35.51500 1.000 49.89000  ? 542 ILE A CG1   1 
ATOM   4374 C  CG2   . ILE A 1 554 ? -13.78600 -66.55100 -35.96900 1.000 50.92000  ? 542 ILE A CG2   1 
ATOM   4375 C  CD1   . ILE A 1 554 ? -11.55100 -65.86000 -34.33600 1.000 50.80000  ? 542 ILE A CD1   1 
ATOM   4376 N  N     . GLY A 1 555 ? -12.61000 -68.48700 -38.81600 1.000 54.33000  ? 543 GLY A N     1 
ATOM   4377 C  CA    . GLY A 1 555 ? -13.39300 -69.02900 -39.91500 1.000 47.93000  ? 543 GLY A CA    1 
ATOM   4378 C  C     . GLY A 1 555 ? -14.87300 -68.92000 -39.57900 1.000 53.98000  ? 543 GLY A C     1 
ATOM   4379 O  O     . GLY A 1 555 ? -15.30000 -69.20100 -38.44500 1.000 64.52000  ? 543 GLY A O     1 
ATOM   4380 N  N     . GLY A 1 556 ? -15.67800 -68.51400 -40.55100 1.000 43.77000  ? 544 GLY A N     1 
ATOM   4381 C  CA    . GLY A 1 556 ? -15.21600 -68.26400 -41.88600 1.000 37.80000  ? 544 GLY A CA    1 
ATOM   4382 C  C     . GLY A 1 556 ? -15.50200 -66.81800 -42.14400 1.000 39.03000  ? 544 GLY A C     1 
ATOM   4383 O  O     . GLY A 1 556 ? -15.84400 -66.41400 -43.25700 1.000 42.84000  ? 544 GLY A O     1 
ATOM   4384 N  N     . ASN A 1 557 ? -15.37000 -66.02000 -41.09500 1.000 39.50000  ? 545 ASN A N     1 
ATOM   4385 C  CA    . ASN A 1 557 ? -15.14800 -64.61000 -41.32100 1.000 40.41000  ? 545 ASN A CA    1 
ATOM   4386 C  C     . ASN A 1 557 ? -13.88400 -64.45900 -42.17700 1.000 44.17000  ? 545 ASN A C     1 
ATOM   4387 O  O     . ASN A 1 557 ? -13.76200 -63.53900 -42.99300 1.000 45.76000  ? 545 ASN A O     1 
ATOM   4388 C  CB    . ASN A 1 557 ? -15.00300 -63.84900 -40.01000 1.000 35.99000  ? 545 ASN A CB    1 
ATOM   4389 C  CG    . ASN A 1 557 ? -14.54500 -62.42600 -40.22800 1.000 38.03000  ? 545 ASN A CG    1 
ATOM   4390 O  OD1   . ASN A 1 557 ? -13.42200 -62.05400 -39.87100 1.000 41.57000  ? 545 ASN A OD1   1 
ATOM   4391 N  ND2   . ASN A 1 557 ? -15.39600 -61.62700 -40.86200 1.000 40.34000  ? 545 ASN A ND2   1 
ATOM   4392 N  N     . GLU A 1 558 ? -12.94600 -65.38000 -41.99800 1.000 39.29000  ? 546 GLU A N     1 
ATOM   4393 C  CA    . GLU A 1 558 ? -11.70100 -65.31300 -42.73300 1.000 48.18000  ? 546 GLU A CA    1 
ATOM   4394 C  C     . GLU A 1 558 ? -11.93200 -65.55700 -44.21400 1.000 48.18000  ? 546 GLU A C     1 
ATOM   4395 O  O     . GLU A 1 558 ? -11.34600 -64.87400 -45.06300 1.000 45.61000  ? 546 GLU A O     1 
ATOM   4396 C  CB    . GLU A 1 558 ? -10.70100 -66.32600 -42.18400 1.000 55.13000  ? 546 GLU A CB    1 
ATOM   4397 C  CG    . GLU A 1 558 ? -9.43800  -66.43100 -42.99800 1.000 58.14000  ? 546 GLU A CG    1 
ATOM   4398 C  CD    . GLU A 1 558 ? -8.62100  -67.62600 -42.60700 1.000 67.08000  ? 546 GLU A CD    1 
ATOM   4399 O  OE1   . GLU A 1 558 ? -9.15800  -68.50400 -41.88500 1.000 68.38000  ? 546 GLU A OE1   1 
ATOM   4400 O  OE2   . GLU A 1 558 ? -7.44400  -67.68400 -43.02000 1.000 72.06000  ? 546 GLU A OE2   1 
ATOM   4401 N  N     . GLN A 1 559 ? -12.79200 -66.52600 -44.52200 1.000 47.47000  ? 547 GLN A N     1 
ATOM   4402 C  CA    . GLN A 1 559 ? -13.04800 -66.90300 -45.91100 1.000 48.68000  ? 547 GLN A CA    1 
ATOM   4403 C  C     . GLN A 1 559 ? -13.72200 -65.79500 -46.71800 1.000 47.90000  ? 547 GLN A C     1 
ATOM   4404 O  O     . GLN A 1 559 ? -13.32300 -65.52600 -47.85600 1.000 51.30000  ? 547 GLN A O     1 
ATOM   4405 C  CB    . GLN A 1 559 ? -13.88800 -68.18100 -45.97100 1.000 47.52000  ? 547 GLN A CB    1 
ATOM   4406 C  CG    . GLN A 1 559 ? -13.04500 -69.45500 -46.05900 1.000 53.03000  ? 547 GLN A CG    1 
ATOM   4407 C  CD    . GLN A 1 559 ? -12.65000 -70.00400 -44.69700 1.000 54.83000  ? 547 GLN A CD    1 
ATOM   4408 O  OE1   . GLN A 1 559 ? -12.43400 -69.25800 -43.74400 1.000 60.15000  ? 547 GLN A OE1   1 
ATOM   4409 N  NE2   . GLN A 1 559 ? -12.57200 -71.32300 -44.59900 1.000 65.79000  ? 547 GLN A NE2   1 
ATOM   4410 N  N     . VAL A 1 560 ? -14.72500 -65.14300 -46.13200 1.000 41.91000  ? 548 VAL A N     1 
ATOM   4411 C  CA    . VAL A 1 560 ? -15.44500 -64.08700 -46.84300 1.000 42.93000  ? 548 VAL A CA    1 
ATOM   4412 C  C     . VAL A 1 560 ? -14.60300 -62.81600 -46.92700 1.000 42.92000  ? 548 VAL A C     1 
ATOM   4413 O  O     . VAL A 1 560 ? -14.75000 -62.02300 -47.86300 1.000 42.79000  ? 548 VAL A O     1 
ATOM   4414 C  CB    . VAL A 1 560 ? -16.80600 -63.78100 -46.17300 1.000 42.29000  ? 548 VAL A CB    1 
ATOM   4415 C  CG1   . VAL A 1 560 ? -16.61900 -63.42800 -44.69900 1.000 43.45000  ? 548 VAL A CG1   1 
ATOM   4416 C  CG2   . VAL A 1 560 ? -17.53400 -62.67700 -46.91200 1.000 35.10000  ? 548 VAL A CG2   1 
ATOM   4417 N  N     . ASP A 1 561 ? -13.70800 -62.63500 -45.95500 1.000 44.21000  ? 549 ASP A N     1 
ATOM   4418 C  CA    . ASP A 1 561 ? -12.77500 -61.51400 -45.96800 1.000 41.11000  ? 549 ASP A CA    1 
ATOM   4419 C  C     . ASP A 1 561 ? -11.87600 -61.55900 -47.19800 1.000 41.95000  ? 549 ASP A C     1 
ATOM   4420 O  O     . ASP A 1 561 ? -11.63100 -60.52200 -47.81200 1.000 43.51000  ? 549 ASP A O     1 
ATOM   4421 C  CB    . ASP A 1 561 ? -11.92300 -61.50000 -44.70100 1.000 46.02000  ? 549 ASP A CB    1 
ATOM   4422 C  CG    . ASP A 1 561 ? -11.27500 -60.14500 -44.44800 1.000 52.51000  ? 549 ASP A CG    1 
ATOM   4423 O  OD1   . ASP A 1 561 ? -11.89300 -59.28700 -43.76600 1.000 60.41000  ? 549 ASP A OD1   1 
ATOM   4424 O  OD2   . ASP A 1 561 ? -10.14600 -59.93500 -44.93300 1.000 55.05000  ? 549 ASP A OD2   1 
ATOM   4425 N  N     . LYS A 1 562 ? -11.39700 -62.75000 -47.56800 1.000 38.95000  ? 550 LYS A N     1 
ATOM   4426 C  CA    . LYS A 1 562 ? -10.60200 -62.91200 -48.79500 1.000 41.35000  ? 550 LYS A CA    1 
ATOM   4427 C  C     . LYS A 1 562 ? -11.41600 -62.57400 -50.04900 1.000 52.39000  ? 550 LYS A C     1 
ATOM   4428 O  O     . LYS A 1 562 ? -10.91800 -61.85700 -50.93400 1.000 53.35000  ? 550 LYS A O     1 
ATOM   4429 C  CB    . LYS A 1 562 ? -10.04400 -64.33200 -48.92000 1.000 42.18000  ? 550 LYS A CB    1 
ATOM   4430 C  CG    . LYS A 1 562 ? -9.33800  -64.82500 -47.68000 1.000 55.96000  ? 550 LYS A CG    1 
ATOM   4431 C  CD    . LYS A 1 562 ? -8.57600  -66.11300 -47.93200 1.000 65.14000  ? 550 LYS A CD    1 
ATOM   4432 C  CE    . LYS A 1 562 ? -7.11900  -65.98200 -47.48300 1.000 73.23000  ? 550 LYS A CE    1 
ATOM   4433 N  NZ    . LYS A 1 562 ? -6.98300  -65.52500 -46.06200 1.000 66.64000  ? 550 LYS A NZ    1 
ATOM   4434 N  N     . LEU A 1 563 ? -12.65700 -63.07700 -50.11700 1.000 47.75000  ? 551 LEU A N     1 
ATOM   4435 C  CA    . LEU A 1 563 ? -13.55400 -62.82500 -51.25700 1.000 40.88000  ? 551 LEU A CA    1 
ATOM   4436 C  C     . LEU A 1 563 ? -13.76800 -61.33400 -51.52800 1.000 45.28000  ? 551 LEU A C     1 
ATOM   4437 O  O     . LEU A 1 563 ? -13.65500 -60.88300 -52.67300 1.000 48.96000  ? 551 LEU A O     1 
ATOM   4438 C  CB    . LEU A 1 563 ? -14.91200 -63.50300 -51.03800 1.000 40.29000  ? 551 LEU A CB    1 
ATOM   4439 C  CG    . LEU A 1 563 ? -15.20400 -64.81600 -51.77800 1.000 45.89000  ? 551 LEU A CG    1 
ATOM   4440 C  CD1   . LEU A 1 563 ? -14.09400 -65.82400 -51.59700 1.000 45.34000  ? 551 LEU A CD1   1 
ATOM   4441 C  CD2   . LEU A 1 563 ? -16.51400 -65.42100 -51.29500 1.000 50.01000  ? 551 LEU A CD2   1 
ATOM   4442 N  N     . VAL A 1 564 ? -14.07400 -60.56100 -50.48800 1.000 44.83000  ? 552 VAL A N     1 
ATOM   4443 C  CA    . VAL A 1 564 ? -14.37700 -59.14300 -50.69100 1.000 43.51000  ? 552 VAL A CA    1 
ATOM   4444 C  C     . VAL A 1 564 ? -13.11900 -58.26900 -50.69300 1.000 48.99000  ? 552 VAL A C     1 
ATOM   4445 O  O     . VAL A 1 564 ? -13.15500 -57.14000 -51.20500 1.000 52.80000  ? 552 VAL A O     1 
ATOM   4446 C  CB    . VAL A 1 564 ? -15.37700 -58.60900 -49.62600 1.000 39.97000  ? 552 VAL A CB    1 
ATOM   4447 C  CG1   . VAL A 1 564 ? -16.58500 -59.53100 -49.52900 1.000 38.66000  ? 552 VAL A CG1   1 
ATOM   4448 C  CG2   . VAL A 1 564 ? -14.71700 -58.46900 -48.26700 1.000 39.34000  ? 552 VAL A CG2   1 
ATOM   4449 N  N     . SER A 1 565 ? -12.00800 -58.77500 -50.14300 1.000 48.52000  ? 553 SER A N     1 
ATOM   4450 C  CA    . SER A 1 565 ? -10.75800 -58.00100 -50.13100 1.000 50.43000  ? 553 SER A CA    1 
ATOM   4451 C  C     . SER A 1 565 ? -10.10000 -58.04000 -51.49300 1.000 53.23000  ? 553 SER A C     1 
ATOM   4452 O  O     . SER A 1 565 ? -9.43300  -57.08100 -51.90500 1.000 60.87000  ? 553 SER A O     1 
ATOM   4453 C  CB    . SER A 1 565 ? -9.77800  -58.52100 -49.08000 1.000 46.14000  ? 553 SER A CB    1 
ATOM   4454 O  OG    . SER A 1 565 ? -9.96500  -57.86500 -47.83800 1.000 55.73000  ? 553 SER A OG    1 
ATOM   4455 N  N     . ALA A 1 566 ? -10.30200 -59.16200 -52.17900 1.000 51.85000  ? 554 ALA A N     1 
ATOM   4456 C  CA    . ALA A 1 566 ? -9.72500  -59.42100 -53.49400 1.000 53.59000  ? 554 ALA A CA    1 
ATOM   4457 C  C     . ALA A 1 566 ? -9.98800  -58.29000 -54.48300 1.000 52.88000  ? 554 ALA A C     1 
ATOM   4458 O  O     . ALA A 1 566 ? -11.13100 -58.01200 -54.84000 1.000 58.91000  ? 554 ALA A O     1 
ATOM   4459 C  CB    . ALA A 1 566 ? -10.26500 -60.74000 -54.05000 1.000 48.66000  ? 554 ALA A CB    1 
ATOM   4460 N  N     . GLY A 1 567 ? -8.92300  -57.63200 -54.91600 1.000 50.87000  ? 555 GLY A N     1 
ATOM   4461 C  CA    . GLY A 1 567 ? -9.03700  -56.58600 -55.91300 1.000 55.02000  ? 555 GLY A CA    1 
ATOM   4462 C  C     . GLY A 1 567 ? -9.26500  -55.18100 -55.37400 1.000 58.79000  ? 555 GLY A C     1 
ATOM   4463 O  O     . GLY A 1 567 ? -9.50900  -54.25100 -56.15900 1.000 57.49000  ? 555 GLY A O     1 
ATOM   4464 N  N     . ILE A 1 568 ? -9.17100  -55.01200 -54.05200 1.000 57.28000  ? 556 ILE A N     1 
ATOM   4465 C  CA    . ILE A 1 568 ? -9.47400  -53.71900 -53.43000 1.000 60.10000  ? 556 ILE A CA    1 
ATOM   4466 C  C     . ILE A 1 568 ? -8.40500  -53.20600 -52.47400 1.000 52.24000  ? 556 ILE A C     1 
ATOM   4467 O  O     . ILE A 1 568 ? -8.19400  -53.78300 -51.40600 1.000 53.03000  ? 556 ILE A O     1 
ATOM   4468 C  CB    . ILE A 1 568 ? -10.78600 -53.79700 -52.66800 1.000 59.71000  ? 556 ILE A CB    1 
ATOM   4469 C  CG1   . ILE A 1 568 ? -11.92300 -54.08700 -53.64200 1.000 48.46000  ? 556 ILE A CG1   1 
ATOM   4470 C  CG2   . ILE A 1 568 ? -11.02900 -52.50700 -51.91800 1.000 61.13000  ? 556 ILE A CG2   1 
ATOM   4471 C  CD1   . ILE A 1 568 ? -13.21200 -54.13300 -52.97900 1.000 53.25000  ? 556 ILE A CD1   1 
ATOM   4472 N  N     . GLU B 2 6   ? -10.69900 -9.52500  6.92500   1.000 83.90000  ? 6   GLU B N     1 
ATOM   4473 C  CA    . GLU B 2 6   ? -10.07900 -9.14200  5.66500   1.000 85.10000  ? 6   GLU B CA    1 
ATOM   4474 C  C     . GLU B 2 6   ? -9.98200  -10.32500 4.71400   1.000 80.79000  ? 6   GLU B C     1 
ATOM   4475 O  O     . GLU B 2 6   ? -9.68500  -11.45200 5.10600   1.000 71.67000  ? 6   GLU B O     1 
ATOM   4476 C  CB    . GLU B 2 6   ? -8.68100  -8.53900  5.88100   1.000 90.32000  ? 6   GLU B CB    1 
ATOM   4477 C  CG    . GLU B 2 6   ? -7.87400  -8.36500  4.58500   1.000 89.85000  ? 6   GLU B CG    1 
ATOM   4478 C  CD    . GLU B 2 6   ? -7.33400  -6.96200  4.38300   1.000 101.57000 ? 6   GLU B CD    1 
ATOM   4479 O  OE1   . GLU B 2 6   ? -7.84600  -6.01800  5.02800   1.000 102.64000 ? 6   GLU B OE1   1 
ATOM   4480 O  OE2   . GLU B 2 6   ? -6.39600  -6.80900  3.56900   1.000 98.97000  ? 6   GLU B OE2   1 
ATOM   4481 N  N     . THR B 2 7   ? -10.18300 -10.00500 3.44400   1.000 82.23000  ? 7   THR B N     1 
ATOM   4482 C  CA    . THR B 2 7   ? -10.48100 -10.94000 2.37800   1.000 70.54000  ? 7   THR B CA    1 
ATOM   4483 C  C     . THR B 2 7   ? -9.26000  -11.47000 1.62700   1.000 64.79000  ? 7   THR B C     1 
ATOM   4484 O  O     . THR B 2 7   ? -8.32100  -10.71900 1.35400   1.000 62.13000  ? 7   THR B O     1 
ATOM   4485 C  CB    . THR B 2 7   ? -11.42700 -10.24300 1.38500   1.000 64.24000  ? 7   THR B CB    1 
ATOM   4486 O  OG1   . THR B 2 7   ? -12.77900 -10.61500 1.67300   1.000 64.64000  ? 7   THR B OG1   1 
ATOM   4487 C  CG2   . THR B 2 7   ? -11.07700 -10.58800 -0.02800  1.000 62.12000  ? 7   THR B CG2   1 
ATOM   4488 N  N     . VAL B 2 8   ? -9.28700  -12.76600 1.30100   1.000 60.30000  ? 8   VAL B N     1 
ATOM   4489 C  CA    . VAL B 2 8   ? -8.26400  -13.39400 0.45500   1.000 62.91000  ? 8   VAL B CA    1 
ATOM   4490 C  C     . VAL B 2 8   ? -8.54500  -13.15000 -1.02800  1.000 58.58000  ? 8   VAL B C     1 
ATOM   4491 O  O     . VAL B 2 8   ? -9.53500  -13.64900 -1.54300  1.000 63.12000  ? 8   VAL B O     1 
ATOM   4492 C  CB    . VAL B 2 8   ? -8.18200  -14.93300 0.68800   1.000 57.02000  ? 8   VAL B CB    1 
ATOM   4493 C  CG1   . VAL B 2 8   ? -7.25500  -15.57400 -0.33400  1.000 55.98000  ? 8   VAL B CG1   1 
ATOM   4494 C  CG2   . VAL B 2 8   ? -7.72500  -15.26100 2.10400   1.000 54.42000  ? 8   VAL B CG2   1 
ATOM   4495 N  N     . PRO B 2 9   ? -7.69100  -12.36700 -1.71300  1.000 59.95000  ? 9   PRO B N     1 
ATOM   4496 C  CA    . PRO B 2 9   ? -7.86700  -12.17900 -3.16100  1.000 59.52000  ? 9   PRO B CA    1 
ATOM   4497 C  C     . PRO B 2 9   ? -7.95200  -13.50900 -3.91000  1.000 56.76000  ? 9   PRO B C     1 
ATOM   4498 O  O     . PRO B 2 9   ? -7.20600  -14.43400 -3.59400  1.000 60.18000  ? 9   PRO B O     1 
ATOM   4499 C  CB    . PRO B 2 9   ? -6.61000  -11.40800 -3.58200  1.000 54.64000  ? 9   PRO B CB    1 
ATOM   4500 C  CG    . PRO B 2 9   ? -6.01300  -10.85900 -2.32900  1.000 60.65000  ? 9   PRO B CG    1 
ATOM   4501 C  CD    . PRO B 2 9   ? -6.75000  -11.39400 -1.13800  1.000 60.61000  ? 9   PRO B CD    1 
ATOM   4502 N  N     . VAL B 2 10  ? -8.87300  -13.60900 -4.86300  1.000 52.29000  ? 10  VAL B N     1 
ATOM   4503 C  CA    . VAL B 2 10  ? -9.00600  -14.80500 -5.68300  1.000 52.72000  ? 10  VAL B CA    1 
ATOM   4504 C  C     . VAL B 2 10  ? -9.18100  -14.38900 -7.12700  1.000 51.97000  ? 10  VAL B C     1 
ATOM   4505 O  O     . VAL B 2 10  ? -9.78600  -13.35700 -7.39900  1.000 54.87000  ? 10  VAL B O     1 
ATOM   4506 C  CB    . VAL B 2 10  ? -10.20400 -15.68600 -5.28100  1.000 50.51000  ? 10  VAL B CB    1 
ATOM   4507 C  CG1   . VAL B 2 10  ? -9.89200  -17.13700 -5.59900  1.000 55.13000  ? 10  VAL B CG1   1 
ATOM   4508 C  CG2   . VAL B 2 10  ? -10.55800 -15.53000 -3.81400  1.000 45.75000  ? 10  VAL B CG2   1 
ATOM   4509 N  N     . LYS B 2 11  ? -8.66800  -15.19200 -8.05100  1.000 52.88000  ? 11  LYS B N     1 
ATOM   4510 C  CA    . LYS B 2 11  ? -8.68200  -14.80400 -9.45700  1.000 58.88000  ? 11  LYS B CA    1 
ATOM   4511 C  C     . LYS B 2 11  ? -9.13800  -15.95500 -10.33600 1.000 61.71000  ? 11  LYS B C     1 
ATOM   4512 O  O     . LYS B 2 11  ? -9.27800  -17.08000 -9.86900  1.000 63.52000  ? 11  LYS B O     1 
ATOM   4513 C  CB    . LYS B 2 11  ? -7.29400  -14.31500 -9.89400  1.000 67.69000  ? 11  LYS B CB    1 
ATOM   4514 C  CG    . LYS B 2 11  ? -7.33500  -13.18200 -10.92100 1.000 75.04000  ? 11  LYS B CG    1 
ATOM   4515 C  CD    . LYS B 2 11  ? -8.42900  -12.16600 -10.57700 1.000 84.59000  ? 11  LYS B CD    1 
ATOM   4516 C  CE    . LYS B 2 11  ? -8.83400  -11.31300 -11.78100 1.000 84.53000  ? 11  LYS B CE    1 
ATOM   4517 N  NZ    . LYS B 2 11  ? -9.65000  -12.07200 -12.79500 1.000 72.59000  ? 11  LYS B NZ    1 
ATOM   4518 N  N     . LEU B 2 12  ? -9.40500  -15.66500 -11.60300 1.000 61.02000  ? 12  LEU B N     1 
ATOM   4519 C  CA    . LEU B 2 12  ? -9.71700  -16.71400 -12.55800 1.000 53.13000  ? 12  LEU B CA    1 
ATOM   4520 C  C     . LEU B 2 12  ? -8.43000  -17.14900 -13.21500 1.000 57.12000  ? 12  LEU B C     1 
ATOM   4521 O  O     . LEU B 2 12  ? -7.46400  -16.38800 -13.24600 1.000 62.75000  ? 12  LEU B O     1 
ATOM   4522 C  CB    . LEU B 2 12  ? -10.71300 -16.22800 -13.61100 1.000 53.23000  ? 12  LEU B CB    1 
ATOM   4523 C  CG    . LEU B 2 12  ? -12.15600 -15.95800 -13.17300 1.000 54.21000  ? 12  LEU B CG    1 
ATOM   4524 C  CD1   . LEU B 2 12  ? -12.86700 -15.15000 -14.23400 1.000 50.74000  ? 12  LEU B CD1   1 
ATOM   4525 C  CD2   . LEU B 2 12  ? -12.91200 -17.24700 -12.91200 1.000 49.86000  ? 12  LEU B CD2   1 
ATOM   4526 N  N     . LYS B 2 13  ? -8.41300  -18.37300 -13.73400 1.000 58.61000  ? 13  LYS B N     1 
ATOM   4527 C  CA    . LYS B 2 13  ? -7.32400  -18.82900 -14.59400 1.000 63.01000  ? 13  LYS B CA    1 
ATOM   4528 C  C     . LYS B 2 13  ? -7.11700  -17.83000 -15.74400 1.000 68.14000  ? 13  LYS B C     1 
ATOM   4529 O  O     . LYS B 2 13  ? -8.03700  -17.08800 -16.11400 1.000 62.90000  ? 13  LYS B O     1 
ATOM   4530 C  CB    . LYS B 2 13  ? -7.60900  -20.23900 -15.12900 1.000 57.20000  ? 13  LYS B CB    1 
ATOM   4531 C  CG    . LYS B 2 13  ? -7.80000  -21.26000 -14.02300 1.000 53.83000  ? 13  LYS B CG    1 
ATOM   4532 C  CD    . LYS B 2 13  ? -7.60700  -22.68700 -14.50700 1.000 46.77000  ? 13  LYS B CD    1 
ATOM   4533 C  CE    . LYS B 2 13  ? -7.90700  -23.65400 -13.36600 1.000 59.38000  ? 13  LYS B CE    1 
ATOM   4534 N  NZ    . LYS B 2 13  ? -7.44600  -25.04500 -13.60700 1.000 72.08000  ? 13  LYS B NZ    1 
ATOM   4535 N  N     . PRO B 2 14  ? -5.89800  -17.78600 -16.30100 1.000 76.46000  ? 14  PRO B N     1 
ATOM   4536 C  CA    . PRO B 2 14  ? -5.61100  -16.75600 -17.30800 1.000 72.79000  ? 14  PRO B CA    1 
ATOM   4537 C  C     . PRO B 2 14  ? -6.34900  -16.96600 -18.63900 1.000 64.20000  ? 14  PRO B C     1 
ATOM   4538 O  O     . PRO B 2 14  ? -6.25200  -18.02300 -19.26500 1.000 63.45000  ? 14  PRO B O     1 
ATOM   4539 C  CB    . PRO B 2 14  ? -4.09100  -16.87100 -17.49400 1.000 71.24000  ? 14  PRO B CB    1 
ATOM   4540 C  CG    . PRO B 2 14  ? -3.76800  -18.27800 -17.12100 1.000 71.42000  ? 14  PRO B CG    1 
ATOM   4541 C  CD    . PRO B 2 14  ? -4.72200  -18.62900 -16.01200 1.000 73.18000  ? 14  PRO B CD    1 
ATOM   4542 N  N     . GLY B 2 15  ? -7.08700  -15.95200 -19.06600 1.000 62.58000  ? 15  GLY B N     1 
ATOM   4543 C  CA    . GLY B 2 15  ? -7.75100  -16.01500 -20.35100 1.000 64.21000  ? 15  GLY B CA    1 
ATOM   4544 C  C     . GLY B 2 15  ? -9.08000  -16.72600 -20.25600 1.000 63.91000  ? 15  GLY B C     1 
ATOM   4545 O  O     . GLY B 2 15  ? -9.55300  -17.32800 -21.22100 1.000 61.54000  ? 15  GLY B O     1 
ATOM   4546 N  N     . MET B 2 16  ? -9.69000  -16.65100 -19.08100 1.000 61.72000  ? 16  MET B N     1 
ATOM   4547 C  CA    . MET B 2 16  ? -11.00900 -17.22300 -18.90200 1.000 56.58000  ? 16  MET B CA    1 
ATOM   4548 C  C     . MET B 2 16  ? -11.99500 -16.23600 -18.28800 1.000 55.82000  ? 16  MET B C     1 
ATOM   4549 O  O     . MET B 2 16  ? -11.70500 -15.59600 -17.27600 1.000 56.45000  ? 16  MET B O     1 
ATOM   4550 C  CB    . MET B 2 16  ? -10.91500 -18.47700 -18.04700 1.000 51.65000  ? 16  MET B CB    1 
ATOM   4551 C  CG    . MET B 2 16  ? -10.45400 -19.67400 -18.83900 1.000 54.82000  ? 16  MET B CG    1 
ATOM   4552 S  SD    . MET B 2 16  ? -10.16000 -21.09500 -17.78100 1.000 69.58000  ? 16  MET B SD    1 
ATOM   4553 C  CE    . MET B 2 16  ? -10.62500 -22.44500 -18.88200 1.000 58.73000  ? 16  MET B CE    1 
ATOM   4554 N  N     . ASP B 2 17  ? -13.16100 -16.11700 -18.91900 1.000 52.95000  ? 17  ASP B N     1 
ATOM   4555 C  CA    . ASP B 2 17  ? -14.24800 -15.31800 -18.38400 1.000 47.42000  ? 17  ASP B CA    1 
ATOM   4556 C  C     . ASP B 2 17  ? -15.12100 -16.17600 -17.48000 1.000 46.10000  ? 17  ASP B C     1 
ATOM   4557 O  O     . ASP B 2 17  ? -15.07900 -17.40000 -17.56100 1.000 43.94000  ? 17  ASP B O     1 
ATOM   4558 C  CB    . ASP B 2 17  ? -15.08400 -14.71800 -19.50900 1.000 42.22000  ? 17  ASP B CB    1 
ATOM   4559 C  CG    . ASP B 2 17  ? -15.76500 -13.43900 -19.09200 1.000 53.73000  ? 17  ASP B CG    1 
ATOM   4560 O  OD1   . ASP B 2 17  ? -15.59500 -13.04300 -17.90600 1.000 51.24000  ? 17  ASP B OD1   1 
ATOM   4561 O  OD2   . ASP B 2 17  ? -16.46400 -12.83400 -19.94300 1.000 59.36000  ? 17  ASP B OD2   1 
ATOM   4562 N  N     . GLY B 2 18  ? -15.92400 -15.53600 -16.63700 1.000 45.39000  ? 18  GLY B N     1 
ATOM   4563 C  CA    . GLY B 2 18  ? -16.77700 -16.25000 -15.70100 1.000 42.70000  ? 18  GLY B CA    1 
ATOM   4564 C  C     . GLY B 2 18  ? -17.84800 -17.13200 -16.33200 1.000 37.18000  ? 18  GLY B C     1 
ATOM   4565 O  O     . GLY B 2 18  ? -18.07300 -17.09600 -17.53800 1.000 39.09000  ? 18  GLY B O     1 
ATOM   4566 N  N     . PRO B 2 19  ? -18.51400 -17.95100 -15.51400 1.000 34.01000  ? 19  PRO B N     1 
ATOM   4567 C  CA    . PRO B 2 19  ? -19.55000 -18.82500 -16.06600 1.000 31.14000  ? 19  PRO B CA    1 
ATOM   4568 C  C     . PRO B 2 19  ? -20.74700 -18.04700 -16.60300 1.000 32.98000  ? 19  PRO B C     1 
ATOM   4569 O  O     . PRO B 2 19  ? -21.15700 -17.01200 -16.06300 1.000 32.54000  ? 19  PRO B O     1 
ATOM   4570 C  CB    . PRO B 2 19  ? -19.95400 -19.69000 -14.86400 1.000 35.22000  ? 19  PRO B CB    1 
ATOM   4571 C  CG    . PRO B 2 19  ? -19.61800 -18.84200 -13.65000 1.000 35.43000  ? 19  PRO B CG    1 
ATOM   4572 C  CD    . PRO B 2 19  ? -18.34800 -18.12500 -14.05500 1.000 38.31000  ? 19  PRO B CD    1 
ATOM   4573 N  N     . LYS B 2 20  ? -21.30100 -18.56100 -17.69300 1.000 33.45000  ? 20  LYS B N     1 
ATOM   4574 C  CA    . LYS B 2 20  ? -22.52900 -18.02700 -18.26400 1.000 30.63000  ? 20  LYS B CA    1 
ATOM   4575 C  C     . LYS B 2 20  ? -23.47200 -19.18600 -18.64000 1.000 33.93000  ? 20  LYS B C     1 
ATOM   4576 O  O     . LYS B 2 20  ? -23.77800 -19.38300 -19.81900 1.000 31.05000  ? 20  LYS B O     1 
ATOM   4577 C  CB    . LYS B 2 20  ? -22.20500 -17.14900 -19.47600 1.000 31.57000  ? 20  LYS B CB    1 
ATOM   4578 C  CG    . LYS B 2 20  ? -21.38200 -15.90200 -19.12600 1.000 30.82000  ? 20  LYS B CG    1 
ATOM   4579 C  CD    . LYS B 2 20  ? -21.07300 -15.04300 -20.35200 1.000 28.37000  ? 20  LYS B CD    1 
ATOM   4580 C  CE    . LYS B 2 20  ? -20.35800 -13.75200 -19.94100 1.000 30.78000  ? 20  LYS B CE    1 
ATOM   4581 N  NZ    . LYS B 2 20  ? -20.17800 -12.80000 -21.08000 1.000 36.20000  ? 20  LYS B NZ    1 
ATOM   4582 N  N     . VAL B 2 21  ? -23.90300 -19.94700 -17.62400 1.000 29.72000  ? 21  VAL B N     1 
ATOM   4583 C  CA    . VAL B 2 21  ? -24.76400 -21.11800 -17.78000 1.000 29.45000  ? 21  VAL B CA    1 
ATOM   4584 C  C     . VAL B 2 21  ? -26.23100 -20.81600 -17.50400 1.000 34.73000  ? 21  VAL B C     1 
ATOM   4585 O  O     . VAL B 2 21  ? -26.55500 -20.26000 -16.46000 1.000 33.33000  ? 21  VAL B O     1 
ATOM   4586 C  CB    . VAL B 2 21  ? -24.36400 -22.24400 -16.83100 1.000 30.94000  ? 21  VAL B CB    1 
ATOM   4587 C  CG1   . VAL B 2 21  ? -25.16800 -23.49300 -17.14300 1.000 29.03000  ? 21  VAL B CG1   1 
ATOM   4588 C  CG2   . VAL B 2 21  ? -22.86000 -22.51500 -16.90100 1.000 30.65000  ? 21  VAL B CG2   1 
ATOM   4589 N  N     . LYS B 2 22  ? -27.12300 -21.20400 -18.41500 1.000 36.68000  ? 22  LYS B N     1 
ATOM   4590 C  CA    . LYS B 2 22  ? -28.54600 -20.88000 -18.25500 1.000 37.74000  ? 22  LYS B CA    1 
ATOM   4591 C  C     . LYS B 2 22  ? -29.21500 -21.71200 -17.16300 1.000 32.09000  ? 22  LYS B C     1 
ATOM   4592 O  O     . LYS B 2 22  ? -29.02400 -22.92700 -17.06700 1.000 43.43000  ? 22  LYS B O     1 
ATOM   4593 C  CB    . LYS B 2 22  ? -29.29900 -21.04600 -19.59000 1.000 32.10000  ? 22  LYS B CB    1 
ATOM   4594 C  CG    . LYS B 2 22  ? -29.34300 -19.74800 -20.40000 1.000 41.88000  ? 22  LYS B CG    1 
ATOM   4595 C  CD    . LYS B 2 22  ? -29.50900 -19.99300 -21.88500 1.000 50.62000  ? 22  LYS B CD    1 
ATOM   4596 C  CE    . LYS B 2 22  ? -30.95400 -19.79000 -22.34300 1.000 52.93000  ? 22  LYS B CE    1 
ATOM   4597 N  NZ    . LYS B 2 22  ? -31.08200 -19.95200 -23.82800 1.000 51.42000  ? 22  LYS B NZ    1 
ATOM   4598 N  N     . GLN B 2 23  ? -29.99800 -21.04500 -16.33000 1.000 29.36000  ? 23  GLN B N     1 
ATOM   4599 C  CA    . GLN B 2 23  ? -30.76900 -21.72400 -15.29900 1.000 31.98000  ? 23  GLN B CA    1 
ATOM   4600 C  C     . GLN B 2 23  ? -31.80700 -22.66100 -15.92900 1.000 31.80000  ? 23  GLN B C     1 
ATOM   4601 O  O     . GLN B 2 23  ? -32.51000 -22.28800 -16.87100 1.000 31.14000  ? 23  GLN B O     1 
ATOM   4602 C  CB    . GLN B 2 23  ? -31.44500 -20.69000 -14.39900 1.000 26.83000  ? 23  GLN B CB    1 
ATOM   4603 C  CG    . GLN B 2 23  ? -32.44000 -21.26900 -13.43200 1.000 27.33000  ? 23  GLN B CG    1 
ATOM   4604 C  CD    . GLN B 2 23  ? -31.78100 -22.10900 -12.37800 1.000 29.44000  ? 23  GLN B CD    1 
ATOM   4605 O  OE1   . GLN B 2 23  ? -30.79900 -21.68800 -11.74300 1.000 29.11000  ? 23  GLN B OE1   1 
ATOM   4606 N  NE2   . GLN B 2 23  ? -32.31700 -23.30400 -12.16800 1.000 31.25000  ? 23  GLN B NE2   1 
ATOM   4607 N  N     . TRP B 2 24  ? -31.90300 -23.87700 -15.41500 1.000 29.73000  ? 24  TRP B N     1 
ATOM   4608 C  CA    . TRP B 2 24  ? -32.86800 -24.83400 -15.94900 1.000 30.91000  ? 24  TRP B CA    1 
ATOM   4609 C  C     . TRP B 2 24  ? -34.19300 -24.83200 -15.16300 1.000 33.56000  ? 24  TRP B C     1 
ATOM   4610 O  O     . TRP B 2 24  ? -34.27900 -24.30100 -14.04500 1.000 34.91000  ? 24  TRP B O     1 
ATOM   4611 C  CB    . TRP B 2 24  ? -32.24500 -26.23300 -15.98000 1.000 37.50000  ? 24  TRP B CB    1 
ATOM   4612 C  CG    . TRP B 2 24  ? -31.74900 -26.77200 -14.69000 1.000 35.31000  ? 24  TRP B CG    1 
ATOM   4613 C  CD1   . TRP B 2 24  ? -32.50700 -27.17400 -13.61800 1.000 43.16000  ? 24  TRP B CD1   1 
ATOM   4614 C  CD2   . TRP B 2 24  ? -30.38400 -27.05900 -14.34800 1.000 33.84000  ? 24  TRP B CD2   1 
ATOM   4615 N  NE1   . TRP B 2 24  ? -31.69200 -27.67300 -12.61700 1.000 46.37000  ? 24  TRP B NE1   1 
ATOM   4616 C  CE2   . TRP B 2 24  ? -30.38500 -27.61000 -13.03400 1.000 40.84000  ? 24  TRP B CE2   1 
ATOM   4617 C  CE3   . TRP B 2 24  ? -29.16800 -26.90000 -15.01300 1.000 23.81000  ? 24  TRP B CE3   1 
ATOM   4618 C  CZ2   . TRP B 2 24  ? -29.20700 -27.98900 -12.36700 1.000 30.53000  ? 24  TRP B CZ2   1 
ATOM   4619 C  CZ3   . TRP B 2 24  ? -28.00600 -27.28900 -14.36000 1.000 33.91000  ? 24  TRP B CZ3   1 
ATOM   4620 C  CH2   . TRP B 2 24  ? -28.03400 -27.82900 -13.04200 1.000 29.96000  ? 24  TRP B CH2   1 
ATOM   4621 N  N     . PRO B 2 25  ? -35.25600 -25.39100 -15.74900 1.000 34.00000  ? 25  PRO B N     1 
ATOM   4622 C  CA    . PRO B 2 25  ? -36.52000 -25.19700 -15.02100 1.000 33.50000  ? 25  PRO B CA    1 
ATOM   4623 C  C     . PRO B 2 25  ? -36.61100 -26.03900 -13.73800 1.000 35.79000  ? 25  PRO B C     1 
ATOM   4624 O  O     . PRO B 2 25  ? -36.10500 -27.17700 -13.68900 1.000 37.29000  ? 25  PRO B O     1 
ATOM   4625 C  CB    . PRO B 2 25  ? -37.56700 -25.62500 -16.04300 1.000 30.00000  ? 25  PRO B CB    1 
ATOM   4626 C  CG    . PRO B 2 25  ? -36.85100 -26.63700 -16.90600 1.000 32.77000  ? 25  PRO B CG    1 
ATOM   4627 C  CD    . PRO B 2 25  ? -35.42600 -26.17200 -16.98800 1.000 30.82000  ? 25  PRO B CD    1 
ATOM   4628 N  N     . LEU B 2 26  ? -37.23800 -25.47200 -12.70900 1.000 32.18000  ? 26  LEU B N     1 
ATOM   4629 C  CA    . LEU B 2 26  ? -37.33700 -26.10700 -11.39300 1.000 32.03000  ? 26  LEU B CA    1 
ATOM   4630 C  C     . LEU B 2 26  ? -38.77800 -26.44300 -11.04600 1.000 36.82000  ? 26  LEU B C     1 
ATOM   4631 O  O     . LEU B 2 26  ? -39.68400 -25.73300 -11.49000 1.000 33.73000  ? 26  LEU B O     1 
ATOM   4632 C  CB    . LEU B 2 26  ? -36.77000 -25.19300 -10.30900 1.000 28.20000  ? 26  LEU B CB    1 
ATOM   4633 C  CG    . LEU B 2 26  ? -35.26100 -24.94000 -10.35500 1.000 30.42000  ? 26  LEU B CG    1 
ATOM   4634 C  CD1   . LEU B 2 26  ? -34.82600 -23.97500 -9.24800  1.000 28.13000  ? 26  LEU B CD1   1 
ATOM   4635 C  CD2   . LEU B 2 26  ? -34.50100 -26.25500 -10.28400 1.000 31.75000  ? 26  LEU B CD2   1 
ATOM   4636 N  N     . THR B 2 27  ? -38.99400 -27.50100 -10.25100 1.000 33.29000  ? 27  THR B N     1 
ATOM   4637 C  CA    . THR B 2 27  ? -40.33700 -27.79400 -9.74100  1.000 32.16000  ? 27  THR B CA    1 
ATOM   4638 C  C     . THR B 2 27  ? -40.78700 -26.76300 -8.71100  1.000 32.13000  ? 27  THR B C     1 
ATOM   4639 O  O     . THR B 2 27  ? -39.97300 -26.04400 -8.13100  1.000 35.24000  ? 27  THR B O     1 
ATOM   4640 C  CB    . THR B 2 27  ? -40.43700 -29.17400 -9.07800  1.000 33.80000  ? 27  THR B CB    1 
ATOM   4641 O  OG1   . THR B 2 27  ? -39.48200 -29.25400 -8.01500  1.000 42.61000  ? 27  THR B OG1   1 
ATOM   4642 C  CG2   . THR B 2 27  ? -40.20400 -30.30400 -10.08200 1.000 31.52000  ? 27  THR B CG2   1 
ATOM   4643 N  N     . GLU B 2 28  ? -42.09200 -26.71300 -8.47300  1.000 35.34000  ? 28  GLU B N     1 
ATOM   4644 C  CA    . GLU B 2 28  ? -42.66100 -25.73700 -7.56200  1.000 33.37000  ? 28  GLU B CA    1 
ATOM   4645 C  C     . GLU B 2 28  ? -42.07400 -25.88300 -6.18500  1.000 29.49000  ? 28  GLU B C     1 
ATOM   4646 O  O     . GLU B 2 28  ? -41.71100 -24.90400 -5.55100  1.000 34.77000  ? 28  GLU B O     1 
ATOM   4647 C  CB    . GLU B 2 28  ? -44.16900 -25.89200 -7.49500  1.000 34.56000  ? 28  GLU B CB    1 
ATOM   4648 C  CG    . GLU B 2 28  ? -44.81600 -24.90000 -6.56600  1.000 43.35000  ? 28  GLU B CG    1 
ATOM   4649 C  CD    . GLU B 2 28  ? -46.30400 -24.82400 -6.77600  1.000 48.87000  ? 28  GLU B CD    1 
ATOM   4650 O  OE1   . GLU B 2 28  ? -46.91600 -23.81100 -6.36300  1.000 60.06000  ? 28  GLU B OE1   1 
ATOM   4651 O  OE2   . GLU B 2 28  ? -46.85400 -25.78100 -7.36100  1.000 45.30000  ? 28  GLU B OE2   1 
ATOM   4652 N  N     . GLU B 2 29  ? -41.99500 -27.12400 -5.73600  1.000 29.88000  ? 29  GLU B N     1 
ATOM   4653 C  CA    . GLU B 2 29  ? -41.36100 -27.47300 -4.47900  1.000 34.49000  ? 29  GLU B CA    1 
ATOM   4654 C  C     . GLU B 2 29  ? -39.97100 -26.84300 -4.32100  1.000 35.08000  ? 29  GLU B C     1 
ATOM   4655 O  O     . GLU B 2 29  ? -39.68900 -26.16800 -3.32900  1.000 36.61000  ? 29  GLU B O     1 
ATOM   4656 C  CB    . GLU B 2 29  ? -41.25400 -28.98900 -4.37400  1.000 38.99000  ? 29  GLU B CB    1 
ATOM   4657 C  CG    . GLU B 2 29  ? -41.84700 -29.56800 -3.12200  1.000 47.53000  ? 29  GLU B CG    1 
ATOM   4658 C  CD    . GLU B 2 29  ? -41.73100 -31.08200 -3.10800  1.000 71.49000  ? 29  GLU B CD    1 
ATOM   4659 O  OE1   . GLU B 2 29  ? -41.10100 -31.63600 -4.04700  1.000 67.36000  ? 29  GLU B OE1   1 
ATOM   4660 O  OE2   . GLU B 2 29  ? -42.26400 -31.71400 -2.16600  1.000 81.27000  ? 29  GLU B OE2   1 
ATOM   4661 N  N     . LYS B 2 30  ? -39.10400 -27.06700 -5.30300  1.000 35.05000  ? 30  LYS B N     1 
ATOM   4662 C  CA    . LYS B 2 30  ? -37.73000 -26.57600 -5.24100  1.000 34.68000  ? 30  LYS B CA    1 
ATOM   4663 C  C     . LYS B 2 30  ? -37.63300 -25.06400 -5.27100  1.000 31.97000  ? 30  LYS B C     1 
ATOM   4664 O  O     . LYS B 2 30  ? -36.76900 -24.48700 -4.61900  1.000 33.65000  ? 30  LYS B O     1 
ATOM   4665 C  CB    . LYS B 2 30  ? -36.90100 -27.14400 -6.39100  1.000 34.39000  ? 30  LYS B CB    1 
ATOM   4666 C  CG    . LYS B 2 30  ? -36.67800 -28.64200 -6.30200  1.000 37.75000  ? 30  LYS B CG    1 
ATOM   4667 C  CD    . LYS B 2 30  ? -35.45700 -29.05800 -7.10900  1.000 37.10000  ? 30  LYS B CD    1 
ATOM   4668 C  CE    . LYS B 2 30  ? -35.44300 -30.56600 -7.34700  1.000 46.98000  ? 30  LYS B CE    1 
ATOM   4669 N  NZ    . LYS B 2 30  ? -36.20200 -30.86100 -8.59400  1.000 51.25000  ? 30  LYS B NZ    1 
ATOM   4670 N  N     . ILE B 2 31  ? -38.49100 -24.41500 -6.04500  1.000 31.35000  ? 31  ILE B N     1 
ATOM   4671 C  CA    . ILE B 2 31  ? -38.47100 -22.95700 -6.08300  1.000 34.09000  ? 31  ILE B CA    1 
ATOM   4672 C  C     . ILE B 2 31  ? -38.90300 -22.36600 -4.75000  1.000 33.42000  ? 31  ILE B C     1 
ATOM   4673 O  O     . ILE B 2 31  ? -38.30600 -21.39300 -4.28400  1.000 34.01000  ? 31  ILE B O     1 
ATOM   4674 C  CB    . ILE B 2 31  ? -39.36800 -22.40600 -7.18400  1.000 33.92000  ? 31  ILE B CB    1 
ATOM   4675 C  CG1   . ILE B 2 31  ? -38.74700 -22.71500 -8.54700  1.000 29.83000  ? 31  ILE B CG1   1 
ATOM   4676 C  CG2   . ILE B 2 31  ? -39.58800 -20.90600 -7.00000  1.000 21.36000  ? 31  ILE B CG2   1 
ATOM   4677 C  CD1   . ILE B 2 31  ? -39.70600 -22.48500 -9.68600  1.000 28.84000  ? 31  ILE B CD1   1 
ATOM   4678 N  N     . LYS B 2 32  ? -39.92900 -22.96100 -4.13600  1.000 32.29000  ? 32  LYS B N     1 
ATOM   4679 C  CA    . LYS B 2 32  ? -40.39700 -22.52300 -2.81900  1.000 30.43000  ? 32  LYS B CA    1 
ATOM   4680 C  C     . LYS B 2 32  ? -39.30200 -22.63800 -1.75400  1.000 36.47000  ? 32  LYS B C     1 
ATOM   4681 O  O     . LYS B 2 32  ? -39.05100 -21.68900 -0.99500  1.000 35.76000  ? 32  LYS B O     1 
ATOM   4682 C  CB    . LYS B 2 32  ? -41.63600 -23.31400 -2.41000  1.000 28.19000  ? 32  LYS B CB    1 
ATOM   4683 C  CG    . LYS B 2 32  ? -42.91700 -22.56600 -2.73100  1.000 39.44000  ? 32  LYS B CG    1 
ATOM   4684 C  CD    . LYS B 2 32  ? -44.14800 -23.44900 -2.63900  1.000 50.10000  ? 32  LYS B CD    1 
ATOM   4685 C  CE    . LYS B 2 32  ? -45.37100 -22.71100 -3.18100  1.000 49.27000  ? 32  LYS B CE    1 
ATOM   4686 N  NZ    . LYS B 2 32  ? -46.42900 -23.65100 -3.68600  1.000 57.95000  ? 32  LYS B NZ    1 
ATOM   4687 N  N     . ALA B 2 33  ? -38.64400 -23.79400 -1.71500  1.000 33.13000  ? 33  ALA B N     1 
ATOM   4688 C  CA    . ALA B 2 33  ? -37.47000 -23.98200 -0.87100  1.000 37.34000  ? 33  ALA B CA    1 
ATOM   4689 C  C     . ALA B 2 33  ? -36.38000 -22.93500 -1.15800  1.000 35.89000  ? 33  ALA B C     1 
ATOM   4690 O  O     . ALA B 2 33  ? -35.82500 -22.32200 -0.24100  1.000 37.01000  ? 33  ALA B O     1 
ATOM   4691 C  CB    . ALA B 2 33  ? -36.91700 -25.39400 -1.05700  1.000 41.37000  ? 33  ALA B CB    1 
ATOM   4692 N  N     . LEU B 2 34  ? -36.08400 -22.71500 -2.43400  1.000 38.42000  ? 34  LEU B N     1 
ATOM   4693 C  CA    . LEU B 2 34  ? -35.02200 -21.78300 -2.79300  1.000 31.98000  ? 34  LEU B CA    1 
ATOM   4694 C  C     . LEU B 2 34  ? -35.34400 -20.38400 -2.39200  1.000 29.98000  ? 34  LEU B C     1 
ATOM   4695 O  O     . LEU B 2 34  ? -34.47300 -19.67900 -1.93600  1.000 35.54000  ? 34  LEU B O     1 
ATOM   4696 C  CB    . LEU B 2 34  ? -34.74300 -21.82000 -4.28600  1.000 31.99000  ? 34  LEU B CB    1 
ATOM   4697 C  CG    . LEU B 2 34  ? -33.90700 -23.01900 -4.71500  1.000 33.47000  ? 34  LEU B CG    1 
ATOM   4698 C  CD1   . LEU B 2 34  ? -33.46400 -22.82200 -6.15100  1.000 34.94000  ? 34  LEU B CD1   1 
ATOM   4699 C  CD2   . LEU B 2 34  ? -32.71100 -23.19400 -3.78400  1.000 33.62000  ? 34  LEU B CD2   1 
ATOM   4700 N  N     . VAL B 2 35  ? -36.59500 -19.97500 -2.58100  1.000 33.67000  ? 35  VAL B N     1 
ATOM   4701 C  CA    . VAL B 2 35  ? -36.99700 -18.60900 -2.27100  1.000 32.83000  ? 35  VAL B CA    1 
ATOM   4702 C  C     . VAL B 2 35  ? -36.99300 -18.39700 -0.76000  1.000 34.60000  ? 35  VAL B C     1 
ATOM   4703 O  O     . VAL B 2 35  ? -36.59700 -17.35000 -0.26100  1.000 41.20000  ? 35  VAL B O     1 
ATOM   4704 C  CB    . VAL B 2 35  ? -38.38600 -18.27000 -2.85400  1.000 29.56000  ? 35  VAL B CB    1 
ATOM   4705 C  CG1   . VAL B 2 35  ? -38.89400 -16.95100 -2.29700  1.000 24.78000  ? 35  VAL B CG1   1 
ATOM   4706 C  CG2   . VAL B 2 35  ? -38.30700 -18.18800 -4.36100  1.000 25.87000  ? 35  VAL B CG2   1 
ATOM   4707 N  N     . GLU B 2 36  ? -37.41700 -19.41700 -0.03700  1.000 38.60000  ? 36  GLU B N     1 
ATOM   4708 C  CA    . GLU B 2 36  ? -37.42400 -19.37800 1.41400   1.000 39.80000  ? 36  GLU B CA    1 
ATOM   4709 C  C     . GLU B 2 36  ? -35.98500 -19.26200 1.93400   1.000 45.05000  ? 36  GLU B C     1 
ATOM   4710 O  O     . GLU B 2 36  ? -35.67100 -18.35900 2.71700   1.000 43.90000  ? 36  GLU B O     1 
ATOM   4711 C  CB    . GLU B 2 36  ? -38.12200 -20.63100 1.94200   1.000 45.41000  ? 36  GLU B CB    1 
ATOM   4712 C  CG    . GLU B 2 36  ? -38.24400 -20.75000 3.43700   1.000 50.33000  ? 36  GLU B CG    1 
ATOM   4713 C  CD    . GLU B 2 36  ? -38.82300 -22.09500 3.81900   1.000 68.92000  ? 36  GLU B CD    1 
ATOM   4714 O  OE1   . GLU B 2 36  ? -38.28100 -22.72800 4.75300   1.000 79.13000  ? 36  GLU B OE1   1 
ATOM   4715 O  OE2   . GLU B 2 36  ? -39.80700 -22.52600 3.16800   1.000 62.97000  ? 36  GLU B OE2   1 
ATOM   4716 N  N     . ILE B 2 37  ? -35.11200 -20.15700 1.46700   1.000 39.08000  ? 37  ILE B N     1 
ATOM   4717 C  CA    . ILE B 2 37  ? -33.69300 -20.13700 1.82200   1.000 30.64000  ? 37  ILE B CA    1 
ATOM   4718 C  C     . ILE B 2 37  ? -32.98800 -18.82200 1.45000   1.000 37.80000  ? 37  ILE B C     1 
ATOM   4719 O  O     . ILE B 2 37  ? -32.24800 -18.24300 2.25500   1.000 40.44000  ? 37  ILE B O     1 
ATOM   4720 C  CB    . ILE B 2 37  ? -32.96200 -21.31500 1.14900   1.000 33.25000  ? 37  ILE B CB    1 
ATOM   4721 C  CG1   . ILE B 2 37  ? -33.44300 -22.65400 1.72800   1.000 31.19000  ? 37  ILE B CG1   1 
ATOM   4722 C  CG2   . ILE B 2 37  ? -31.45500 -21.19800 1.29900   1.000 31.31000  ? 37  ILE B CG2   1 
ATOM   4723 C  CD1   . ILE B 2 37  ? -32.96700 -23.85000 0.93200   1.000 35.19000  ? 37  ILE B CD1   1 
ATOM   4724 N  N     . CYS B 2 38  ? -33.21500 -18.33400 0.23900   1.000 35.96000  ? 38  CYS B N     1 
ATOM   4725 C  CA    . CYS B 2 38  ? -32.49700 -17.15100 -0.21200  1.000 37.44000  ? 38  CYS B CA    1 
ATOM   4726 C  C     . CYS B 2 38  ? -32.89300 -15.86100 0.49500   1.000 42.51000  ? 38  CYS B C     1 
ATOM   4727 O  O     . CYS B 2 38  ? -32.02600 -15.02500 0.79000   1.000 39.14000  ? 38  CYS B O     1 
ATOM   4728 C  CB    . CYS B 2 38  ? -32.66800 -16.98300 -1.71400  1.000 38.82000  ? 38  CYS B CB    1 
ATOM   4729 S  SG    . CYS B 2 38  ? -31.67500 -18.18900 -2.62100  1.000 43.69000  ? 38  CYS B SG    1 
ATOM   4730 N  N     . THR B 2 39  ? -34.18400 -15.68800 0.77600   1.000 42.59000  ? 39  THR B N     1 
ATOM   4731 C  CA    . THR B 2 39  ? -34.61300 -14.46500 1.43400   1.000 45.97000  ? 39  THR B CA    1 
ATOM   4732 C  C     . THR B 2 39  ? -33.97000 -14.35200 2.82100   1.000 44.91000  ? 39  THR B C     1 
ATOM   4733 O  O     . THR B 2 39  ? -33.61700 -13.25800 3.26200   1.000 50.57000  ? 39  THR B O     1 
ATOM   4734 C  CB    . THR B 2 39  ? -36.15400 -14.36300 1.56300   1.000 49.01000  ? 39  THR B CB    1 
ATOM   4735 O  OG1   . THR B 2 39  ? -36.63800 -15.43700 2.36000   1.000 52.87000  ? 39  THR B OG1   1 
ATOM   4736 C  CG2   . THR B 2 39  ? -36.83300 -14.39600 0.20400   1.000 44.86000  ? 39  THR B CG2   1 
ATOM   4737 N  N     . GLU B 2 40  ? -33.79400 -15.47500 3.50200   1.000 41.77000  ? 40  GLU B N     1 
ATOM   4738 C  CA    . GLU B 2 40  ? -33.15600 -15.44000 4.80900   1.000 49.90000  ? 40  GLU B CA    1 
ATOM   4739 C  C     . GLU B 2 40  ? -31.63400 -15.29600 4.69400   1.000 49.73000  ? 40  GLU B C     1 
ATOM   4740 O  O     . GLU B 2 40  ? -31.02900 -14.51400 5.43300   1.000 57.21000  ? 40  GLU B O     1 
ATOM   4741 C  CB    . GLU B 2 40  ? -33.51200 -16.67600 5.62800   1.000 45.32000  ? 40  GLU B CB    1 
ATOM   4742 C  CG    . GLU B 2 40  ? -32.46500 -16.99500 6.66300   1.000 56.12000  ? 40  GLU B CG    1 
ATOM   4743 C  CD    . GLU B 2 40  ? -32.99100 -17.83900 7.81700   1.000 81.82000  ? 40  GLU B CD    1 
ATOM   4744 O  OE1   . GLU B 2 40  ? -33.86900 -18.70300 7.58500   1.000 91.21000  ? 40  GLU B OE1   1 
ATOM   4745 O  OE2   . GLU B 2 40  ? -32.52000 -17.64400 8.96200   1.000 87.78000  ? 40  GLU B OE2   1 
ATOM   4746 N  N     . MET B 2 41  ? -31.00400 -16.02600 3.78000   1.000 43.61000  ? 41  MET B N     1 
ATOM   4747 C  CA    . MET B 2 41  ? -29.60300 -15.73100 3.45900   1.000 41.22000  ? 41  MET B CA    1 
ATOM   4748 C  C     . MET B 2 41  ? -29.40300 -14.26500 3.09800   1.000 41.80000  ? 41  MET B C     1 
ATOM   4749 O  O     . MET B 2 41  ? -28.37800 -13.66400 3.40700   1.000 42.54000  ? 41  MET B O     1 
ATOM   4750 C  CB    . MET B 2 41  ? -29.11100 -16.58400 2.30200   1.000 41.51000  ? 41  MET B CB    1 
ATOM   4751 C  CG    . MET B 2 41  ? -28.86200 -18.03300 2.65000   1.000 40.92000  ? 41  MET B CG    1 
ATOM   4752 S  SD    . MET B 2 41  ? -28.22300 -18.89800 1.21300   1.000 43.25000  ? 41  MET B SD    1 
ATOM   4753 C  CE    . MET B 2 41  ? -26.51400 -18.33700 1.20500   1.000 41.33000  ? 41  MET B CE    1 
ATOM   4754 N  N     . GLU B 2 42  ? -30.37500 -13.68200 2.41900   1.000 43.82000  ? 42  GLU B N     1 
ATOM   4755 C  CA    . GLU B 2 42  ? -30.24800 -12.28200 2.09000   1.000 43.53000  ? 42  GLU B CA    1 
ATOM   4756 C  C     . GLU B 2 42  ? -30.37500 -11.44900 3.36500   1.000 48.42000  ? 42  GLU B C     1 
ATOM   4757 O  O     . GLU B 2 42  ? -29.71100 -10.41400 3.50700   1.000 48.71000  ? 42  GLU B O     1 
ATOM   4758 C  CB    . GLU B 2 42  ? -31.29200 -11.86500 1.06500   1.000 44.58000  ? 42  GLU B CB    1 
ATOM   4759 C  CG    . GLU B 2 42  ? -31.13200 -10.43700 0.59100   1.000 48.82000  ? 42  GLU B CG    1 
ATOM   4760 C  CD    . GLU B 2 42  ? -32.39200 -9.89200  -0.05100  1.000 51.06000  ? 42  GLU B CD    1 
ATOM   4761 O  OE1   . GLU B 2 42  ? -32.36000 -8.73300  -0.52700  1.000 54.86000  ? 42  GLU B OE1   1 
ATOM   4762 O  OE2   . GLU B 2 42  ? -33.41100 -10.62300 -0.08300  1.000 54.17000  ? 42  GLU B OE2   1 
ATOM   4763 N  N     . LYS B 2 43  ? -31.21400 -11.90100 4.29600   1.000 42.60000  ? 43  LYS B N     1 
ATOM   4764 C  CA    . LYS B 2 43  ? -31.37300 -11.18900 5.56500   1.000 44.82000  ? 43  LYS B CA    1 
ATOM   4765 C  C     . LYS B 2 43  ? -30.17300 -11.36700 6.49700   1.000 48.59000  ? 43  LYS B C     1 
ATOM   4766 O  O     . LYS B 2 43  ? -30.00600 -10.59500 7.42600   1.000 54.84000  ? 43  LYS B O     1 
ATOM   4767 C  CB    . LYS B 2 43  ? -32.65600 -11.62900 6.28600   1.000 50.13000  ? 43  LYS B CB    1 
ATOM   4768 C  CG    . LYS B 2 43  ? -33.92800 -11.00700 5.69200   1.000 57.31000  ? 43  LYS B CG    1 
ATOM   4769 C  CD    . LYS B 2 43  ? -35.13200 -11.09100 6.63700   1.000 49.57000  ? 43  LYS B CD    1 
ATOM   4770 C  CE    . LYS B 2 43  ? -35.58000 -12.51700 6.88700   1.000 47.57000  ? 43  LYS B CE    1 
ATOM   4771 N  NZ    . LYS B 2 43  ? -36.86600 -12.53700 7.64700   1.000 51.15000  ? 43  LYS B NZ    1 
ATOM   4772 N  N     . GLU B 2 44  ? -29.34700 -12.38300 6.26000   1.000 47.23000  ? 44  GLU B N     1 
ATOM   4773 C  CA    . GLU B 2 44  ? -28.12400 -12.56600 7.03800   1.000 39.55000  ? 44  GLU B CA    1 
ATOM   4774 C  C     . GLU B 2 44  ? -26.90100 -11.93800 6.37500   1.000 44.83000  ? 44  GLU B C     1 
ATOM   4775 O  O     . GLU B 2 44  ? -25.80000 -12.02600 6.90800   1.000 52.22000  ? 44  GLU B O     1 
ATOM   4776 C  CB    . GLU B 2 44  ? -27.85900 -14.04600 7.27500   1.000 41.88000  ? 44  GLU B CB    1 
ATOM   4777 C  CG    . GLU B 2 44  ? -28.71700 -14.62600 8.35500   1.000 46.85000  ? 44  GLU B CG    1 
ATOM   4778 C  CD    . GLU B 2 44  ? -29.34200 -15.94600 7.97100   1.000 56.07000  ? 44  GLU B CD    1 
ATOM   4779 O  OE1   . GLU B 2 44  ? -28.95300 -16.53400 6.93200   1.000 60.36000  ? 44  GLU B OE1   1 
ATOM   4780 O  OE2   . GLU B 2 44  ? -30.23000 -16.39900 8.72200   1.000 56.09000  ? 44  GLU B OE2   1 
ATOM   4781 N  N     . GLY B 2 45  ? -27.09000 -11.32500 5.21000   1.000 41.31000  ? 45  GLY B N     1 
ATOM   4782 C  CA    . GLY B 2 45  ? -26.00500 -10.68200 4.49000   1.000 34.90000  ? 45  GLY B CA    1 
ATOM   4783 C  C     . GLY B 2 45  ? -25.12400 -11.54700 3.60100   1.000 42.55000  ? 45  GLY B C     1 
ATOM   4784 O  O     . GLY B 2 45  ? -24.14300 -11.05300 3.01900   1.000 41.63000  ? 45  GLY B O     1 
ATOM   4785 N  N     . LYS B 2 46  ? -25.46400 -12.82700 3.46200   1.000 44.92000  ? 46  LYS B N     1 
ATOM   4786 C  CA    . LYS B 2 46  ? -24.58600 -13.76700 2.74800   1.000 45.67000  ? 46  LYS B CA    1 
ATOM   4787 C  C     . LYS B 2 46  ? -24.72800 -13.70800 1.23000   1.000 40.66000  ? 46  LYS B C     1 
ATOM   4788 O  O     . LYS B 2 46  ? -23.78100 -13.99500 0.49800   1.000 40.62000  ? 46  LYS B O     1 
ATOM   4789 C  CB    . LYS B 2 46  ? -24.85000 -15.17700 3.23900   1.000 40.45000  ? 46  LYS B CB    1 
ATOM   4790 C  CG    . LYS B 2 46  ? -25.14800 -15.18600 4.70800   1.000 44.81000  ? 46  LYS B CG    1 
ATOM   4791 C  CD    . LYS B 2 46  ? -25.29800 -16.56500 5.21800   1.000 49.44000  ? 46  LYS B CD    1 
ATOM   4792 C  CE    . LYS B 2 46  ? -25.27800 -16.56300 6.72300   1.000 62.54000  ? 46  LYS B CE    1 
ATOM   4793 N  NZ    . LYS B 2 46  ? -25.95700 -17.80700 7.23800   1.000 75.46000  ? 46  LYS B NZ    1 
ATOM   4794 N  N     . ILE B 2 47  ? -25.90900 -13.32700 0.76000   1.000 39.61000  ? 47  ILE B N     1 
ATOM   4795 C  CA    . ILE B 2 47  ? -26.12300 -13.09700 -0.66600  1.000 41.65000  ? 47  ILE B CA    1 
ATOM   4796 C  C     . ILE B 2 47  ? -26.73100 -11.71100 -0.88800  1.000 41.42000  ? 47  ILE B C     1 
ATOM   4797 O  O     . ILE B 2 47  ? -27.41000 -11.18700 -0.00500  1.000 43.45000  ? 47  ILE B O     1 
ATOM   4798 C  CB    . ILE B 2 47  ? -27.05200 -14.17400 -1.28300  1.000 41.48000  ? 47  ILE B CB    1 
ATOM   4799 C  CG1   . ILE B 2 47  ? -28.46100 -14.07200 -0.66400  1.000 41.56000  ? 47  ILE B CG1   1 
ATOM   4800 C  CG2   . ILE B 2 47  ? -26.41500 -15.56800 -1.14000  1.000 35.76000  ? 47  ILE B CG2   1 
ATOM   4801 C  CD1   . ILE B 2 47  ? -29.46900 -15.09400 -1.15700  1.000 36.43000  ? 47  ILE B CD1   1 
ATOM   4802 N  N     . SER B 2 48  ? -26.49300 -11.11900 -2.05800  1.000 44.05000  ? 48  SER B N     1 
ATOM   4803 C  CA    . SER B 2 48  ? -27.09300 -9.82300  -2.40200  1.000 42.18000  ? 48  SER B CA    1 
ATOM   4804 C  C     . SER B 2 48  ? -27.83800 -9.83600  -3.73600  1.000 37.99000  ? 48  SER B C     1 
ATOM   4805 O  O     . SER B 2 48  ? -27.33600 -10.37400 -4.71800  1.000 42.70000  ? 48  SER B O     1 
ATOM   4806 C  CB    . SER B 2 48  ? -26.02000 -8.74000  -2.45000  1.000 34.70000  ? 48  SER B CB    1 
ATOM   4807 O  OG    . SER B 2 48  ? -25.69200 -8.31800  -1.14200  1.000 45.20000  ? 48  SER B OG    1 
ATOM   4808 N  N     . LYS B 2 49  ? -29.02100 -9.22700  -3.78400  1.000 40.68000  ? 49  LYS B N     1 
ATOM   4809 C  CA    . LYS B 2 49  ? -29.71900 -9.05900  -5.06100  1.000 37.90000  ? 49  LYS B CA    1 
ATOM   4810 C  C     . LYS B 2 49  ? -28.85100 -8.27100  -6.02900  1.000 31.30000  ? 49  LYS B C     1 
ATOM   4811 O  O     . LYS B 2 49  ? -28.16600 -7.32700  -5.63700  1.000 32.14000  ? 49  LYS B O     1 
ATOM   4812 C  CB    . LYS B 2 49  ? -31.07200 -8.36100  -4.88100  1.000 34.86000  ? 49  LYS B CB    1 
ATOM   4813 C  CG    . LYS B 2 49  ? -32.12000 -9.21500  -4.19800  1.000 44.77000  ? 49  LYS B CG    1 
ATOM   4814 C  CD    . LYS B 2 49  ? -33.51400 -8.88000  -4.69700  1.000 40.94000  ? 49  LYS B CD    1 
ATOM   4815 C  CE    . LYS B 2 49  ? -34.57500 -9.66900  -3.93800  1.000 43.23000  ? 49  LYS B CE    1 
ATOM   4816 N  NZ    . LYS B 2 49  ? -34.60900 -9.28200  -2.49400  1.000 51.60000  ? 49  LYS B NZ    1 
ATOM   4817 N  N     . ILE B 2 50  ? -28.86900 -8.67900  -7.29100  1.000 33.28000  ? 50  ILE B N     1 
ATOM   4818 C  CA    . ILE B 2 50  ? -28.12200 -7.98700  -8.34700  1.000 38.73000  ? 50  ILE B CA    1 
ATOM   4819 C  C     . ILE B 2 50  ? -28.97100 -7.84600  -9.60000  1.000 32.06000  ? 50  ILE B C     1 
ATOM   4820 O  O     . ILE B 2 50  ? -30.05200 -8.41900  -9.71300  1.000 36.49000  ? 50  ILE B O     1 
ATOM   4821 C  CB    . ILE B 2 50  ? -26.80600 -8.71600  -8.72600  1.000 32.75000  ? 50  ILE B CB    1 
ATOM   4822 C  CG1   . ILE B 2 50  ? -27.09700 -10.13600 -9.19200  1.000 33.50000  ? 50  ILE B CG1   1 
ATOM   4823 C  CG2   . ILE B 2 50  ? -25.84600 -8.73400  -7.55500  1.000 30.52000  ? 50  ILE B CG2   1 
ATOM   4824 C  CD1   . ILE B 2 50  ? -25.85200 -10.96000 -9.34300  1.000 34.28000  ? 50  ILE B CD1   1 
ATOM   4825 N  N     . GLY B 2 51  ? -28.48100 -7.07400  -10.54800 1.000 25.93000  ? 51  GLY B N     1 
ATOM   4826 C  CA    . GLY B 2 51  ? -29.26900 -6.80100  -11.72000 1.000 25.79000  ? 51  GLY B CA    1 
ATOM   4827 C  C     . GLY B 2 51  ? -28.79100 -7.65500  -12.85300 1.000 31.34000  ? 51  GLY B C     1 
ATOM   4828 O  O     . GLY B 2 51  ? -28.09100 -8.65000  -12.63400 1.000 33.66000  ? 51  GLY B O     1 
ATOM   4829 N  N     . PRO B 2 52  ? -29.16900 -7.27000  -14.07400 1.000 31.41000  ? 52  PRO B N     1 
ATOM   4830 C  CA    . PRO B 2 52  ? -28.71200 -7.91800  -15.30300 1.000 27.48000  ? 52  PRO B CA    1 
ATOM   4831 C  C     . PRO B 2 52  ? -27.40100 -7.35800  -15.87700 1.000 35.82000  ? 52  PRO B C     1 
ATOM   4832 O  O     . PRO B 2 52  ? -26.90100 -7.94300  -16.84400 1.000 36.66000  ? 52  PRO B O     1 
ATOM   4833 C  CB    . PRO B 2 52  ? -29.86700 -7.66500  -16.27100 1.000 32.90000  ? 52  PRO B CB    1 
ATOM   4834 C  CG    . PRO B 2 52  ? -30.50200 -6.40800  -15.80600 1.000 27.92000  ? 52  PRO B CG    1 
ATOM   4835 C  CD    . PRO B 2 52  ? -30.26400 -6.30900  -14.31500 1.000 29.66000  ? 52  PRO B CD    1 
ATOM   4836 N  N     . GLU B 2 53  ? -26.85100 -6.27300  -15.32500 1.000 35.14000  ? 53  GLU B N     1 
ATOM   4837 C  CA    . GLU B 2 53  ? -25.56200 -5.77000  -15.82900 1.000 39.56000  ? 53  GLU B CA    1 
ATOM   4838 C  C     . GLU B 2 53  ? -24.38900 -6.70300  -15.41500 1.000 36.61000  ? 53  GLU B C     1 
ATOM   4839 O  O     . GLU B 2 53  ? -23.33000 -6.68700  -16.03600 1.000 41.93000  ? 53  GLU B O     1 
ATOM   4840 C  CB    . GLU B 2 53  ? -25.31900 -4.32300  -15.36200 1.000 34.07000  ? 53  GLU B CB    1 
ATOM   4841 C  CG    . GLU B 2 53  ? -24.84700 -4.16400  -13.92100 1.000 33.69000  ? 53  GLU B CG    1 
ATOM   4842 C  CD    . GLU B 2 53  ? -25.96000 -4.34400  -12.90600 1.000 39.19000  ? 53  GLU B CD    1 
ATOM   4843 O  OE1   . GLU B 2 53  ? -27.05500 -4.81100  -13.30400 1.000 35.72000  ? 53  GLU B OE1   1 
ATOM   4844 O  OE2   . GLU B 2 53  ? -25.73600 -4.01500  -11.71100 1.000 42.41000  ? 53  GLU B OE2   1 
ATOM   4845 N  N     . ASN B 2 54  ? -24.58600 -7.50200  -14.36900 1.000 31.51000  ? 54  ASN B N     1 
ATOM   4846 C  CA    . ASN B 2 54  ? -23.74400 -8.66200  -14.08200 1.000 29.31000  ? 54  ASN B CA    1 
ATOM   4847 C  C     . ASN B 2 54  ? -24.04200 -9.69500  -15.13500 1.000 36.63000  ? 54  ASN B C     1 
ATOM   4848 O  O     . ASN B 2 54  ? -25.13100 -10.26800 -15.12000 1.000 36.51000  ? 54  ASN B O     1 
ATOM   4849 C  CB    . ASN B 2 54  ? -24.05400 -9.22400  -12.69000 1.000 28.91000  ? 54  ASN B CB    1 
ATOM   4850 C  CG    . ASN B 2 54  ? -23.16800 -10.41000 -12.29100 1.000 32.75000  ? 54  ASN B CG    1 
ATOM   4851 O  OD1   . ASN B 2 54  ? -22.76100 -11.22600 -13.12200 1.000 35.06000  ? 54  ASN B OD1   1 
ATOM   4852 N  ND2   . ASN B 2 54  ? -22.88300 -10.51400 -10.98900 1.000 32.11000  ? 54  ASN B ND2   1 
ATOM   4853 N  N     . PRO B 2 55  ? -23.08300 -9.95900  -16.04200 1.000 39.64000  ? 55  PRO B N     1 
ATOM   4854 C  CA    . PRO B 2 55  ? -23.28900 -10.91000 -17.15000 1.000 35.43000  ? 55  PRO B CA    1 
ATOM   4855 C  C     . PRO B 2 55  ? -23.10400 -12.38600 -16.79600 1.000 30.77000  ? 55  PRO B C     1 
ATOM   4856 O  O     . PRO B 2 55  ? -23.20000 -13.21100 -17.70600 1.000 34.81000  ? 55  PRO B O     1 
ATOM   4857 C  CB    . PRO B 2 55  ? -22.21400 -10.50500 -18.15200 1.000 34.88000  ? 55  PRO B CB    1 
ATOM   4858 C  CG    . PRO B 2 55  ? -21.07300 -10.07700 -17.24900 1.000 34.15000  ? 55  PRO B CG    1 
ATOM   4859 C  CD    . PRO B 2 55  ? -21.73900 -9.35500  -16.08600 1.000 35.53000  ? 55  PRO B CD    1 
ATOM   4860 N  N     . TYR B 2 56  ? -22.84400 -12.72700 -15.53600 1.000 31.05000  ? 56  TYR B N     1 
ATOM   4861 C  CA    . TYR B 2 56  ? -22.49900 -14.11900 -15.20000 1.000 36.13000  ? 56  TYR B CA    1 
ATOM   4862 C  C     . TYR B 2 56  ? -23.67300 -14.90800 -14.60800 1.000 33.45000  ? 56  TYR B C     1 
ATOM   4863 O  O     . TYR B 2 56  ? -24.59700 -14.33000 -14.00600 1.000 32.69000  ? 56  TYR B O     1 
ATOM   4864 C  CB    . TYR B 2 56  ? -21.29500 -14.14500 -14.22900 1.000 35.45000  ? 56  TYR B CB    1 
ATOM   4865 C  CG    . TYR B 2 56  ? -20.13400 -13.35600 -14.77000 1.000 36.12000  ? 56  TYR B CG    1 
ATOM   4866 C  CD1   . TYR B 2 56  ? -19.32700 -13.87300 -15.78100 1.000 36.33000  ? 56  TYR B CD1   1 
ATOM   4867 C  CD2   . TYR B 2 56  ? -19.87600 -12.07100 -14.31500 1.000 37.87000  ? 56  TYR B CD2   1 
ATOM   4868 C  CE1   . TYR B 2 56  ? -18.27300 -13.13300 -16.31300 1.000 36.82000  ? 56  TYR B CE1   1 
ATOM   4869 C  CE2   . TYR B 2 56  ? -18.82400 -11.32700 -14.83300 1.000 41.27000  ? 56  TYR B CE2   1 
ATOM   4870 C  CZ    . TYR B 2 56  ? -18.02800 -11.85800 -15.83100 1.000 42.49000  ? 56  TYR B CZ    1 
ATOM   4871 O  OH    . TYR B 2 56  ? -17.00200 -11.09700 -16.34200 1.000 41.52000  ? 56  TYR B OH    1 
ATOM   4872 N  N     . ASN B 2 57  ? -23.64100 -16.23100 -14.76800 1.000 29.39000  ? 57  ASN B N     1 
ATOM   4873 C  CA    . ASN B 2 57  ? -24.68100 -17.04300 -14.15700 1.000 29.30000  ? 57  ASN B CA    1 
ATOM   4874 C  C     . ASN B 2 57  ? -24.32800 -18.50800 -13.96800 1.000 30.59000  ? 57  ASN B C     1 
ATOM   4875 O  O     . ASN B 2 57  ? -23.53200 -19.08900 -14.69900 1.000 30.59000  ? 57  ASN B O     1 
ATOM   4876 C  CB    . ASN B 2 57  ? -25.96500 -16.93800 -14.96800 1.000 29.45000  ? 57  ASN B CB    1 
ATOM   4877 C  CG    . ASN B 2 57  ? -27.18000 -17.39100 -14.19100 1.000 28.67000  ? 57  ASN B CG    1 
ATOM   4878 O  OD1   . ASN B 2 57  ? -27.62100 -16.71800 -13.26300 1.000 28.96000  ? 57  ASN B OD1   1 
ATOM   4879 N  ND2   . ASN B 2 57  ? -27.72900 -18.54300 -14.56100 1.000 27.00000  ? 57  ASN B ND2   1 
ATOM   4880 N  N     . THR B 2 58  ? -24.97100 -19.09100 -12.96700 1.000 30.45000  ? 58  THR B N     1 
ATOM   4881 C  CA    . THR B 2 58  ? -24.72200 -20.44200 -12.53400 1.000 30.88000  ? 58  THR B CA    1 
ATOM   4882 C  C     . THR B 2 58  ? -26.04600 -21.03800 -12.06600 1.000 30.05000  ? 58  THR B C     1 
ATOM   4883 O  O     . THR B 2 58  ? -26.77600 -20.39000 -11.32500 1.000 31.36000  ? 58  THR B O     1 
ATOM   4884 C  CB    . THR B 2 58  ? -23.67000 -20.44300 -11.40300 1.000 37.28000  ? 58  THR B CB    1 
ATOM   4885 O  OG1   . THR B 2 58  ? -22.39500 -20.03500 -11.93600 1.000 41.49000  ? 58  THR B OG1   1 
ATOM   4886 C  CG2   . THR B 2 58  ? -23.53800 -21.80300 -10.78200 1.000 34.61000  ? 58  THR B CG2   1 
ATOM   4887 N  N     . PRO B 2 59  ? -26.37000 -22.26600 -12.49600 1.000 24.38000  ? 59  PRO B N     1 
ATOM   4888 C  CA    . PRO B 2 59  ? -27.65600 -22.86700 -12.13900 1.000 27.76000  ? 59  PRO B CA    1 
ATOM   4889 C  C     . PRO B 2 59  ? -27.81500 -23.11100 -10.64100 1.000 30.09000  ? 59  PRO B C     1 
ATOM   4890 O  O     . PRO B 2 59  ? -26.81700 -23.34700 -9.97300  1.000 29.08000  ? 59  PRO B O     1 
ATOM   4891 C  CB    . PRO B 2 59  ? -27.64100 -24.21300 -12.87900 1.000 30.00000  ? 59  PRO B CB    1 
ATOM   4892 C  CG    . PRO B 2 59  ? -26.49300 -24.18200 -13.77500 1.000 27.60000  ? 59  PRO B CG    1 
ATOM   4893 C  CD    . PRO B 2 59  ? -25.51500 -23.21300 -13.21700 1.000 30.56000  ? 59  PRO B CD    1 
ATOM   4894 N  N     . VAL B 2 60  ? -29.04400 -23.08100 -10.13100 1.000 28.45000  ? 60  VAL B N     1 
ATOM   4895 C  CA    . VAL B 2 60  ? -29.30400 -23.51300 -8.76000  1.000 27.47000  ? 60  VAL B CA    1 
ATOM   4896 C  C     . VAL B 2 60  ? -30.45300 -24.47900 -8.69300  1.000 30.57000  ? 60  VAL B C     1 
ATOM   4897 O  O     . VAL B 2 60  ? -31.39100 -24.43800 -9.50600  1.000 29.10000  ? 60  VAL B O     1 
ATOM   4898 C  CB    . VAL B 2 60  ? -29.68200 -22.36600 -7.83000  1.000 27.61000  ? 60  VAL B CB    1 
ATOM   4899 C  CG1   . VAL B 2 60  ? -28.51900 -21.49300 -7.54100  1.000 36.97000  ? 60  VAL B CG1   1 
ATOM   4900 C  CG2   . VAL B 2 60  ? -30.81000 -21.56700 -8.45900  1.000 35.15000  ? 60  VAL B CG2   1 
ATOM   4901 N  N     . PHE B 2 61  ? -30.41500 -25.31500 -7.67400  1.000 32.61000  ? 61  PHE B N     1 
ATOM   4902 C  CA    . PHE B 2 61  ? -31.58800 -26.09100 -7.35100  1.000 33.03000  ? 61  PHE B CA    1 
ATOM   4903 C  C     . PHE B 2 61  ? -31.56400 -26.45800 -5.88100  1.000 35.80000  ? 61  PHE B C     1 
ATOM   4904 O  O     . PHE B 2 61  ? -30.96100 -25.75300 -5.06500  1.000 35.54000  ? 61  PHE B O     1 
ATOM   4905 C  CB    . PHE B 2 61  ? -31.69900 -27.32300 -8.24900  1.000 30.19000  ? 61  PHE B CB    1 
ATOM   4906 C  CG    . PHE B 2 61  ? -30.53900 -28.26200 -8.17200  1.000 34.14000  ? 61  PHE B CG    1 
ATOM   4907 C  CD1   . PHE B 2 61  ? -29.27400 -27.87100 -8.56000  1.000 35.08000  ? 61  PHE B CD1   1 
ATOM   4908 C  CD2   . PHE B 2 61  ? -30.73400 -29.57500 -7.78100  1.000 36.57000  ? 61  PHE B CD2   1 
ATOM   4909 C  CE1   . PHE B 2 61  ? -28.21300 -28.76000 -8.51000  1.000 38.61000  ? 61  PHE B CE1   1 
ATOM   4910 C  CE2   . PHE B 2 61  ? -29.67400 -30.47100 -7.74100  1.000 34.74000  ? 61  PHE B CE2   1 
ATOM   4911 C  CZ    . PHE B 2 61  ? -28.41400 -30.05800 -8.10300  1.000 32.62000  ? 61  PHE B CZ    1 
ATOM   4912 N  N     . ALA B 2 62  ? -32.24100 -27.53800 -5.53400  1.000 32.35000  ? 62  ALA B N     1 
ATOM   4913 C  CA    . ALA B 2 62  ? -32.39500 -27.86800 -4.14100  1.000 31.57000  ? 62  ALA B CA    1 
ATOM   4914 C  C     . ALA B 2 62  ? -32.74400 -29.33200 -3.99800  1.000 42.95000  ? 62  ALA B C     1 
ATOM   4915 O  O     . ALA B 2 62  ? -33.54100 -29.88800 -4.77200  1.000 41.85000  ? 62  ALA B O     1 
ATOM   4916 C  CB    . ALA B 2 62  ? -33.45200 -27.00000 -3.50700  1.000 29.41000  ? 62  ALA B CB    1 
ATOM   4917 N  N     . ILE B 2 63  ? -32.12800 -29.96300 -3.00800  1.000 43.19000  ? 63  ILE B N     1 
ATOM   4918 C  CA    . ILE B 2 63  ? -32.46600 -31.33400 -2.67300  1.000 48.00000  ? 63  ILE B CA    1 
ATOM   4919 C  C     . ILE B 2 63  ? -32.99700 -31.36700 -1.25000  1.000 48.84000  ? 63  ILE B C     1 
ATOM   4920 O  O     . ILE B 2 63  ? -32.54600 -30.59900 -0.39300  1.000 50.61000  ? 63  ILE B O     1 
ATOM   4921 C  CB    . ILE B 2 63  ? -31.26500 -32.25600 -2.82400  1.000 37.17000  ? 63  ILE B CB    1 
ATOM   4922 C  CG1   . ILE B 2 63  ? -30.15700 -31.80100 -1.87500  1.000 42.47000  ? 63  ILE B CG1   1 
ATOM   4923 C  CG2   . ILE B 2 63  ? -30.81200 -32.23900 -4.26400  1.000 32.92000  ? 63  ILE B CG2   1 
ATOM   4924 C  CD1   . ILE B 2 63  ? -28.86400 -32.52500 -2.04900  1.000 39.74000  ? 63  ILE B CD1   1 
ATOM   4925 N  N     . LYS B 2 64  ? -33.99400 -32.21300 -1.02200  1.000 54.90000  ? 64  LYS B N     1 
ATOM   4926 C  CA    . LYS B 2 64  ? -34.50600 -32.41300 0.31500   1.000 61.94000  ? 64  LYS B CA    1 
ATOM   4927 C  C     . LYS B 2 64  ? -34.09200 -33.79500 0.74600   1.000 60.87000  ? 64  LYS B C     1 
ATOM   4928 O  O     . LYS B 2 64  ? -34.19000 -34.78200 0.03500   1.000 55.98000  ? 64  LYS B O     1 
ATOM   4929 C  CB    . LYS B 2 64  ? -36.02500 -32.23400 0.39600   1.000 59.87000  ? 64  LYS B CB    1 
ATOM   4930 C  CG    . LYS B 2 64  ? -36.83700 -33.51300 0.34900   1.000 54.29000  ? 64  LYS B CG    1 
ATOM   4931 C  CD    . LYS B 2 64  ? -38.24800 -33.24700 0.80600   1.000 55.59000  ? 64  LYS B CD    1 
ATOM   4932 C  CE    . LYS B 2 64  ? -38.24000 -32.32000 2.01200   1.000 65.86000  ? 64  LYS B CE    1 
ATOM   4933 N  NZ    . LYS B 2 64  ? -39.56100 -32.29000 2.69000   1.000 75.91000  ? 64  LYS B NZ    1 
ATOM   4934 N  N     . LYS B 2 65  ? -33.67200 -33.85600 1.98000   1.000 69.54000  ? 65  LYS B N     1 
ATOM   4935 C  CA    . LYS B 2 65  ? -32.94300 -34.99800 2.43400   1.000 79.98000  ? 65  LYS B CA    1 
ATOM   4936 C  C     . LYS B 2 65  ? -33.82400 -35.99600 3.11000   1.000 90.85000  ? 65  LYS B C     1 
ATOM   4937 O  O     . LYS B 2 65  ? -34.82300 -35.64700 3.77300   1.000 92.26000  ? 65  LYS B O     1 
ATOM   4938 C  CB    . LYS B 2 65  ? -31.82000 -34.54500 3.35500   1.000 84.76000  ? 65  LYS B CB    1 
ATOM   4939 C  CG    . LYS B 2 65  ? -30.94500 -33.53000 2.67800   1.000 75.52000  ? 65  LYS B CG    1 
ATOM   4940 C  CD    . LYS B 2 65  ? -29.52200 -33.80000 2.97700   1.000 85.32000  ? 65  LYS B CD    1 
ATOM   4941 C  CE    . LYS B 2 65  ? -28.68600 -33.55000 1.77000   1.000 77.81000  ? 65  LYS B CE    1 
ATOM   4942 N  NZ    . LYS B 2 65  ? -27.99800 -34.81600 1.45600   1.000 74.25000  ? 65  LYS B NZ    1 
ATOM   4943 N  N     . LYS B 2 66  ? -33.45700 -37.24800 2.83000   1.000 92.87000  ? 66  LYS B N     1 
ATOM   4944 C  CA    . LYS B 2 66  ? -33.92900 -38.44400 3.52600   1.000 101.18000 ? 66  LYS B CA    1 
ATOM   4945 C  C     . LYS B 2 66  ? -35.42800 -38.45300 3.77500   1.000 101.63000 ? 66  LYS B C     1 
ATOM   4946 O  O     . LYS B 2 66  ? -36.25800 -38.32300 2.84100   1.000 98.37000  ? 66  LYS B O     1 
ATOM   4947 C  CB    . LYS B 2 66  ? -33.19200 -38.58500 4.88100   1.000 102.88000 ? 66  LYS B CB    1 
ATOM   4948 C  CG    . LYS B 2 66  ? -32.96200 -40.02900 5.39300   1.000 110.71000 ? 66  LYS B CG    1 
ATOM   4949 C  CD    . LYS B 2 66  ? -32.58600 -40.04500 6.87700   1.000 102.81000 ? 66  LYS B CD    1 
ATOM   4950 C  CE    . LYS B 2 66  ? -31.86800 -41.32200 7.29600   1.000 95.56000  ? 66  LYS B CE    1 
ATOM   4951 N  NZ    . LYS B 2 66  ? -30.87200 -41.06300 8.38300   1.000 98.84000  ? 66  LYS B NZ    1 
ATOM   4952 N  N     . ASP B 2 67  ? -35.70100 -38.59200 5.07900   1.000 101.41000 ? 67  ASP B N     1 
ATOM   4953 C  CA    . ASP B 2 67  ? -36.93300 -38.26800 5.77100   1.000 97.17000  ? 67  ASP B CA    1 
ATOM   4954 C  C     . ASP B 2 67  ? -36.67400 -36.89700 6.40700   1.000 104.11000 ? 67  ASP B C     1 
ATOM   4955 O  O     . ASP B 2 67  ? -36.17100 -36.83500 7.48600   1.000 112.25000 ? 67  ASP B O     1 
ATOM   4956 C  CB    . ASP B 2 67  ? -37.21700 -39.28800 6.88000   1.000 102.13000 ? 67  ASP B CB    1 
ATOM   4957 C  CG    . ASP B 2 67  ? -38.46700 -40.13500 6.63800   1.000 102.19000 ? 67  ASP B CG    1 
ATOM   4958 O  OD1   . ASP B 2 67  ? -39.28700 -39.83300 5.74600   1.000 104.36000 ? 67  ASP B OD1   1 
ATOM   4959 O  OD2   . ASP B 2 67  ? -38.65200 -41.11300 7.39900   1.000 100.50000 ? 67  ASP B OD2   1 
ATOM   4960 N  N     . SER B 2 68  ? -36.81900 -35.78000 5.73000   1.000 98.57000  ? 68  SER B N     1 
ATOM   4961 C  CA    . SER B 2 68  ? -36.79400 -34.52500 6.47500   1.000 83.60000  ? 68  SER B CA    1 
ATOM   4962 C  C     . SER B 2 68  ? -37.81800 -33.61200 5.86200   1.000 79.18000  ? 68  SER B C     1 
ATOM   4963 O  O     . SER B 2 68  ? -38.54200 -33.98700 4.94100   1.000 77.30000  ? 68  SER B O     1 
ATOM   4964 C  CB    . SER B 2 68  ? -35.42300 -33.87200 6.45200   1.000 80.37000  ? 68  SER B CB    1 
ATOM   4965 O  OG    . SER B 2 68  ? -35.33100 -32.88400 7.45200   1.000 75.65000  ? 68  SER B OG    1 
ATOM   4966 N  N     . THR B 2 69  ? -37.90900 -32.41600 6.40500   1.000 83.64000  ? 69  THR B N     1 
ATOM   4967 C  CA    . THR B 2 69  ? -38.66600 -31.38200 5.75000   1.000 78.26000  ? 69  THR B CA    1 
ATOM   4968 C  C     . THR B 2 69  ? -37.73900 -30.19300 5.62500   1.000 79.63000  ? 69  THR B C     1 
ATOM   4969 O  O     . THR B 2 69  ? -38.18000 -29.04500 5.64000   1.000 77.07000  ? 69  THR B O     1 
ATOM   4970 C  CB    . THR B 2 69  ? -39.94700 -31.01900 6.51700   1.000 79.29000  ? 69  THR B CB    1 
ATOM   4971 O  OG1   . THR B 2 69  ? -39.69000 -31.06600 7.93100   1.000 70.73000  ? 69  THR B OG1   1 
ATOM   4972 C  CG2   . THR B 2 69  ? -41.08900 -31.99200 6.14400   1.000 69.10000  ? 69  THR B CG2   1 
ATOM   4973 N  N     . LYS B 2 70  ? -36.44200 -30.47200 5.50800   1.000 81.10000  ? 70  LYS B N     1 
ATOM   4974 C  CA    . LYS B 2 70  ? -35.50300 -29.40100 5.22300   1.000 74.81000  ? 70  LYS B CA    1 
ATOM   4975 C  C     . LYS B 2 70  ? -34.70800 -29.67600 3.95200   1.000 64.19000  ? 70  LYS B C     1 
ATOM   4976 O  O     . LYS B 2 70  ? -34.13300 -30.75600 3.76300   1.000 62.99000  ? 70  LYS B O     1 
ATOM   4977 C  CB    . LYS B 2 70  ? -34.56300 -29.14500 6.40200   1.000 66.84000  ? 70  LYS B CB    1 
ATOM   4978 C  CG    . LYS B 2 70  ? -34.51300 -27.65500 6.79400   1.000 73.77000  ? 70  LYS B CG    1 
ATOM   4979 C  CD    . LYS B 2 70  ? -35.71200 -27.24600 7.66900   1.000 78.96000  ? 70  LYS B CD    1 
ATOM   4980 C  CE    . LYS B 2 70  ? -35.73200 -25.74300 7.99900   1.000 80.60000  ? 70  LYS B CE    1 
ATOM   4981 N  NZ    . LYS B 2 70  ? -36.22800 -24.88300 6.87700   1.000 75.60000  ? 70  LYS B NZ    1 
ATOM   4982 N  N     . TRP B 2 71  ? -34.72400 -28.65300 3.09700   1.000 56.27000  ? 71  TRP B N     1 
ATOM   4983 C  CA    . TRP B 2 71  ? -34.06800 -28.60700 1.80000   1.000 48.71000  ? 71  TRP B CA    1 
ATOM   4984 C  C     . TRP B 2 71  ? -32.67800 -28.05200 1.92000   1.000 45.97000  ? 71  TRP B C     1 
ATOM   4985 O  O     . TRP B 2 71  ? -32.36800 -27.30500 2.85300   1.000 49.31000  ? 71  TRP B O     1 
ATOM   4986 C  CB    . TRP B 2 71  ? -34.87100 -27.72900 0.83600   1.000 49.87000  ? 71  TRP B CB    1 
ATOM   4987 C  CG    . TRP B 2 71  ? -36.18600 -28.29600 0.55900   1.000 46.49000  ? 71  TRP B CG    1 
ATOM   4988 C  CD1   . TRP B 2 71  ? -37.28200 -28.24900 1.35900   1.000 43.61000  ? 71  TRP B CD1   1 
ATOM   4989 C  CD2   . TRP B 2 71  ? -36.55400 -29.04800 -0.59500  1.000 47.93000  ? 71  TRP B CD2   1 
ATOM   4990 N  NE1   . TRP B 2 71  ? -38.32100 -28.92600 0.77000   1.000 45.11000  ? 71  TRP B NE1   1 
ATOM   4991 C  CE2   . TRP B 2 71  ? -37.90000 -29.42300 -0.43400  1.000 43.58000  ? 71  TRP B CE2   1 
ATOM   4992 C  CE3   . TRP B 2 71  ? -35.87600 -29.44100 -1.75000  1.000 45.32000  ? 71  TRP B CE3   1 
ATOM   4993 C  CZ2   . TRP B 2 71  ? -38.58200 -30.16900 -1.38800  1.000 44.06000  ? 71  TRP B CZ2   1 
ATOM   4994 C  CZ3   . TRP B 2 71  ? -36.55100 -30.18600 -2.69300  1.000 46.89000  ? 71  TRP B CZ3   1 
ATOM   4995 C  CH2   . TRP B 2 71  ? -37.88900 -30.54500 -2.50700  1.000 46.07000  ? 71  TRP B CH2   1 
ATOM   4996 N  N     . ARG B 2 72  ? -31.84100 -28.39500 0.95700   1.000 43.20000  ? 72  ARG B N     1 
ATOM   4997 C  CA    . ARG B 2 72  ? -30.52500 -27.79200 0.89700   1.000 40.75000  ? 72  ARG B CA    1 
ATOM   4998 C  C     . ARG B 2 72  ? -30.34700 -27.16300 -0.46200  1.000 42.10000  ? 72  ARG B C     1 
ATOM   4999 O  O     . ARG B 2 72  ? -30.57800 -27.80500 -1.48200  1.000 47.38000  ? 72  ARG B O     1 
ATOM   5000 C  CB    . ARG B 2 72  ? -29.41800 -28.81600 1.15500   1.000 41.26000  ? 72  ARG B CB    1 
ATOM   5001 C  CG    . ARG B 2 72  ? -28.05200 -28.17300 1.39100   1.000 39.38000  ? 72  ARG B CG    1 
ATOM   5002 C  CD    . ARG B 2 72  ? -27.02300 -29.23800 1.64400   1.000 50.97000  ? 72  ARG B CD    1 
ATOM   5003 N  NE    . ARG B 2 72  ? -25.65200 -28.75000 1.82500   1.000 55.11000  ? 72  ARG B NE    1 
ATOM   5004 C  CZ    . ARG B 2 72  ? -24.90000 -28.18700 0.87800   1.000 55.08000  ? 72  ARG B CZ    1 
ATOM   5005 N  NH1   . ARG B 2 72  ? -25.38200 -27.97800 -0.34500  1.000 49.48000  ? 72  ARG B NH1   1 
ATOM   5006 N  NH2   . ARG B 2 72  ? -23.65200 -27.82200 1.16300   1.000 48.77000  ? 72  ARG B NH2   1 
ATOM   5007 N  N     . LYS B 2 73  ? -29.95800 -25.89900 -0.48800  1.000 42.63000  ? 73  LYS B N     1 
ATOM   5008 C  CA    . LYS B 2 73  ? -29.64300 -25.29600 -1.75800  1.000 37.76000  ? 73  LYS B CA    1 
ATOM   5009 C  C     . LYS B 2 73  ? -28.38700 -25.96400 -2.25100  1.000 36.33000  ? 73  LYS B C     1 
ATOM   5010 O  O     . LYS B 2 73  ? -27.57000 -26.42400 -1.46000  1.000 40.39000  ? 73  LYS B O     1 
ATOM   5011 C  CB    . LYS B 2 73  ? -29.45200 -23.79100 -1.64600  1.000 33.88000  ? 73  LYS B CB    1 
ATOM   5012 C  CG    . LYS B 2 73  ? -29.08400 -23.15800 -2.94800  1.000 32.09000  ? 73  LYS B CG    1 
ATOM   5013 C  CD    . LYS B 2 73  ? -28.91800 -21.67200 -2.81900  1.000 41.70000  ? 73  LYS B CD    1 
ATOM   5014 C  CE    . LYS B 2 73  ? -27.69500 -21.37000 -2.00500  1.000 44.79000  ? 73  LYS B CE    1 
ATOM   5015 N  NZ    . LYS B 2 73  ? -27.50600 -19.88800 -1.93100  1.000 60.22000  ? 73  LYS B NZ    1 
ATOM   5016 N  N     . LEU B 2 74  ? -28.25600 -26.01800 -3.56900  1.000 44.92000  ? 74  LEU B N     1 
ATOM   5017 C  CA    . LEU B 2 74  ? -27.12000 -26.60500 -4.25700  1.000 38.88000  ? 74  LEU B CA    1 
ATOM   5018 C  C     . LEU B 2 74  ? -26.81900 -25.75300 -5.48100  1.000 33.75000  ? 74  LEU B C     1 
ATOM   5019 O  O     . LEU B 2 74  ? -27.56000 -25.78500 -6.45700  1.000 34.74000  ? 74  LEU B O     1 
ATOM   5020 C  CB    . LEU B 2 74  ? -27.44200 -28.03600 -4.67000  1.000 40.00000  ? 74  LEU B CB    1 
ATOM   5021 C  CG    . LEU B 2 74  ? -26.66200 -29.19000 -4.08100  1.000 45.07000  ? 74  LEU B CG    1 
ATOM   5022 C  CD1   . LEU B 2 74  ? -27.40400 -30.46100 -4.42900  1.000 43.60000  ? 74  LEU B CD1   1 
ATOM   5023 C  CD2   . LEU B 2 74  ? -25.27800 -29.19200 -4.68300  1.000 45.04000  ? 74  LEU B CD2   1 
ATOM   5024 N  N     . VAL B 2 75  ? -25.76000 -24.96700 -5.42900  1.000 32.82000  ? 75  VAL B N     1 
ATOM   5025 C  CA    . VAL B 2 75  ? -25.35400 -24.25000 -6.61400  1.000 30.16000  ? 75  VAL B CA    1 
ATOM   5026 C  C     . VAL B 2 75  ? -24.42400 -25.13000 -7.45100  1.000 37.23000  ? 75  VAL B C     1 
ATOM   5027 O  O     . VAL B 2 75  ? -23.40300 -25.60600 -6.96800  1.000 40.36000  ? 75  VAL B O     1 
ATOM   5028 C  CB    . VAL B 2 75  ? -24.67300 -22.94800 -6.25000  1.000 31.87000  ? 75  VAL B CB    1 
ATOM   5029 C  CG1   . VAL B 2 75  ? -24.38200 -22.14900 -7.48900  1.000 28.68000  ? 75  VAL B CG1   1 
ATOM   5030 C  CG2   . VAL B 2 75  ? -25.56500 -22.15700 -5.31200  1.000 31.81000  ? 75  VAL B CG2   1 
ATOM   5031 N  N     . ASP B 2 76  ? -24.80300 -25.37700 -8.69800  1.000 35.31000  ? 76  ASP B N     1 
ATOM   5032 C  CA    . ASP B 2 76  ? -23.96300 -26.14200 -9.60200  1.000 32.04000  ? 76  ASP B CA    1 
ATOM   5033 C  C     . ASP B 2 76  ? -22.78400 -25.28200 -10.05900 1.000 32.83000  ? 76  ASP B C     1 
ATOM   5034 O  O     . ASP B 2 76  ? -22.81700 -24.67700 -11.12700 1.000 30.39000  ? 76  ASP B O     1 
ATOM   5035 C  CB    . ASP B 2 76  ? -24.78600 -26.65100 -10.80000 1.000 34.46000  ? 76  ASP B CB    1 
ATOM   5036 C  CG    . ASP B 2 76  ? -23.93400 -27.35300 -11.86200 1.000 38.41000  ? 76  ASP B CG    1 
ATOM   5037 O  OD1   . ASP B 2 76  ? -22.75800 -27.70600 -11.57900 1.000 37.25000  ? 76  ASP B OD1   1 
ATOM   5038 O  OD2   . ASP B 2 76  ? -24.45200 -27.53600 -12.99000 1.000 32.28000  ? 76  ASP B OD2   1 
ATOM   5039 N  N     . PHE B 2 77  ? -21.73600 -25.25400 -9.24400  1.000 32.73000  ? 77  PHE B N     1 
ATOM   5040 C  CA    . PHE B 2 77  ? -20.55900 -24.42900 -9.51500  1.000 35.35000  ? 77  PHE B CA    1 
ATOM   5041 C  C     . PHE B 2 77  ? -19.48800 -25.10800 -10.38900 1.000 34.52000  ? 77  PHE B C     1 
ATOM   5042 O  O     . PHE B 2 77  ? -18.32600 -24.73000 -10.32000 1.000 33.78000  ? 77  PHE B O     1 
ATOM   5043 C  CB    . PHE B 2 77  ? -19.91600 -24.00400 -8.18900  1.000 29.99000  ? 77  PHE B CB    1 
ATOM   5044 C  CG    . PHE B 2 77  ? -20.48100 -22.73800 -7.60800  1.000 32.05000  ? 77  PHE B CG    1 
ATOM   5045 C  CD1   . PHE B 2 77  ? -20.62500 -21.60100 -8.39200  1.000 27.96000  ? 77  PHE B CD1   1 
ATOM   5046 C  CD2   . PHE B 2 77  ? -20.86600 -22.68700 -6.26700  1.000 32.67000  ? 77  PHE B CD2   1 
ATOM   5047 C  CE1   . PHE B 2 77  ? -21.14200 -20.45000 -7.85600  1.000 31.54000  ? 77  PHE B CE1   1 
ATOM   5048 C  CE2   . PHE B 2 77  ? -21.38500 -21.53200 -5.72300  1.000 28.15000  ? 77  PHE B CE2   1 
ATOM   5049 C  CZ    . PHE B 2 77  ? -21.52000 -20.41200 -6.51300  1.000 29.78000  ? 77  PHE B CZ    1 
ATOM   5050 N  N     . ARG B 2 78  ? -19.86200 -26.09500 -11.20100 1.000 31.91000  ? 78  ARG B N     1 
ATOM   5051 C  CA    . ARG B 2 78  ? -18.85600 -26.87700 -11.92600 1.000 34.17000  ? 78  ARG B CA    1 
ATOM   5052 C  C     . ARG B 2 78  ? -18.06400 -26.04000 -12.90100 1.000 35.70000  ? 78  ARG B C     1 
ATOM   5053 O  O     . ARG B 2 78  ? -16.83600 -26.13000 -12.96600 1.000 38.60000  ? 78  ARG B O     1 
ATOM   5054 C  CB    . ARG B 2 78  ? -19.50200 -28.04600 -12.66500 1.000 32.24000  ? 78  ARG B CB    1 
ATOM   5055 C  CG    . ARG B 2 78  ? -19.71800 -29.25900 -11.77100 1.000 31.69000  ? 78  ARG B CG    1 
ATOM   5056 C  CD    . ARG B 2 78  ? -20.43900 -30.35800 -12.50800 1.000 36.33000  ? 78  ARG B CD    1 
ATOM   5057 N  NE    . ARG B 2 78  ? -21.78100 -29.93700 -12.88100 1.000 35.09000  ? 78  ARG B NE    1 
ATOM   5058 C  CZ    . ARG B 2 78  ? -22.58700 -30.66500 -13.63000 1.000 31.48000  ? 78  ARG B CZ    1 
ATOM   5059 N  NH1   . ARG B 2 78  ? -22.17200 -31.83900 -14.07600 1.000 35.01000  ? 78  ARG B NH1   1 
ATOM   5060 N  NH2   . ARG B 2 78  ? -23.79300 -30.22600 -13.93300 1.000 29.76000  ? 78  ARG B NH2   1 
ATOM   5061 N  N     . GLU B 2 79  ? -18.76700 -25.21200 -13.65400 1.000 38.92000  ? 79  GLU B N     1 
ATOM   5062 C  CA    . GLU B 2 79  ? -18.10100 -24.31600 -14.58000 1.000 42.39000  ? 79  GLU B CA    1 
ATOM   5063 C  C     . GLU B 2 79  ? -17.19500 -23.32100 -13.84400 1.000 41.86000  ? 79  GLU B C     1 
ATOM   5064 O  O     . GLU B 2 79  ? -16.01500 -23.21100 -14.16600 1.000 45.61000  ? 79  GLU B O     1 
ATOM   5065 C  CB    . GLU B 2 79  ? -19.12100 -23.57700 -15.43300 1.000 36.00000  ? 79  GLU B CB    1 
ATOM   5066 C  CG    . GLU B 2 79  ? -18.55000 -23.12000 -16.74400 1.000 41.30000  ? 79  GLU B CG    1 
ATOM   5067 C  CD    . GLU B 2 79  ? -18.20200 -24.28700 -17.64000 1.000 59.01000  ? 79  GLU B CD    1 
ATOM   5068 O  OE1   . GLU B 2 79  ? -17.29300 -24.13300 -18.48800 1.000 65.08000  ? 79  GLU B OE1   1 
ATOM   5069 O  OE2   . GLU B 2 79  ? -18.84000 -25.36100 -17.49600 1.000 61.00000  ? 79  GLU B OE2   1 
ATOM   5070 N  N     . LEU B 2 80  ? -17.72200 -22.61800 -12.84800 1.000 31.42000  ? 80  LEU B N     1 
ATOM   5071 C  CA    . LEU B 2 80  ? -16.89400 -21.65400 -12.12300 1.000 36.96000  ? 80  LEU B CA    1 
ATOM   5072 C  C     . LEU B 2 80  ? -15.64900 -22.30500 -11.54800 1.000 37.62000  ? 80  LEU B C     1 
ATOM   5073 O  O     . LEU B 2 80  ? -14.56900 -21.73300 -11.59600 1.000 41.76000  ? 80  LEU B O     1 
ATOM   5074 C  CB    . LEU B 2 80  ? -17.68100 -20.97800 -10.99900 1.000 34.81000  ? 80  LEU B CB    1 
ATOM   5075 C  CG    . LEU B 2 80  ? -16.82200 -20.06600 -10.12800 1.000 30.54000  ? 80  LEU B CG    1 
ATOM   5076 C  CD1   . LEU B 2 80  ? -16.23200 -18.91800 -10.93900 1.000 29.98000  ? 80  LEU B CD1   1 
ATOM   5077 C  CD2   . LEU B 2 80  ? -17.64900 -19.57300 -8.95700  1.000 34.50000  ? 80  LEU B CD2   1 
ATOM   5078 N  N     . ASN B 2 81  ? -15.81200 -23.50800 -11.00900 1.000 40.54000  ? 81  ASN B N     1 
ATOM   5079 C  CA    . ASN B 2 81  ? -14.69000 -24.28900 -10.48700 1.000 44.10000  ? 81  ASN B CA    1 
ATOM   5080 C  C     . ASN B 2 81  ? -13.64200 -24.66400 -11.55000 1.000 45.99000  ? 81  ASN B C     1 
ATOM   5081 O  O     . ASN B 2 81  ? -12.44000 -24.63700 -11.27500 1.000 51.32000  ? 81  ASN B O     1 
ATOM   5082 C  CB    . ASN B 2 81  ? -15.21300 -25.55300 -9.80100  1.000 36.17000  ? 81  ASN B CB    1 
ATOM   5083 C  CG    . ASN B 2 81  ? -15.94100 -25.24400 -8.51500  1.000 36.20000  ? 81  ASN B CG    1 
ATOM   5084 O  OD1   . ASN B 2 81  ? -15.76700 -24.16500 -7.94500  1.000 45.30000  ? 81  ASN B OD1   1 
ATOM   5085 N  ND2   . ASN B 2 81  ? -16.75700 -26.18100 -8.04500  1.000 33.87000  ? 81  ASN B ND2   1 
ATOM   5086 N  N     . LYS B 2 82  ? -14.09400 -25.00800 -12.75600 1.000 44.19000  ? 82  LYS B N     1 
ATOM   5087 C  CA    . LYS B 2 82  ? -13.18300 -25.23700 -13.87500 1.000 42.31000  ? 82  LYS B CA    1 
ATOM   5088 C  C     . LYS B 2 82  ? -12.35200 -23.99200 -14.17500 1.000 40.81000  ? 82  LYS B C     1 
ATOM   5089 O  O     . LYS B 2 82  ? -11.23300 -24.09500 -14.65600 1.000 49.77000  ? 82  LYS B O     1 
ATOM   5090 C  CB    . LYS B 2 82  ? -13.95100 -25.65300 -15.13400 1.000 42.89000  ? 82  LYS B CB    1 
ATOM   5091 C  CG    . LYS B 2 82  ? -14.05700 -27.14200 -15.35600 1.000 48.01000  ? 82  LYS B CG    1 
ATOM   5092 C  CD    . LYS B 2 82  ? -14.84500 -27.45600 -16.62700 1.000 53.36000  ? 82  LYS B CD    1 
ATOM   5093 C  CE    . LYS B 2 82  ? -16.34700 -27.55200 -16.35500 1.000 53.90000  ? 82  LYS B CE    1 
ATOM   5094 N  NZ    . LYS B 2 82  ? -17.12600 -28.03900 -17.53700 1.000 55.19000  ? 82  LYS B NZ    1 
ATOM   5095 N  N     . ARG B 2 83  ? -12.89900 -22.81900 -13.88100 1.000 41.82000  ? 83  ARG B N     1 
ATOM   5096 C  CA    . ARG B 2 83  ? -12.26100 -21.55900 -14.26900 1.000 46.65000  ? 83  ARG B CA    1 
ATOM   5097 C  C     . ARG B 2 83  ? -11.62000 -20.80000 -13.11700 1.000 47.52000  ? 83  ARG B C     1 
ATOM   5098 O  O     . ARG B 2 83  ? -11.03600 -19.74000 -13.31800 1.000 47.27000  ? 83  ARG B O     1 
ATOM   5099 C  CB    . ARG B 2 83  ? -13.28000 -20.64200 -14.94000 1.000 40.36000  ? 83  ARG B CB    1 
ATOM   5100 C  CG    . ARG B 2 83  ? -13.89300 -21.21700 -16.18200 1.000 40.20000  ? 83  ARG B CG    1 
ATOM   5101 C  CD    . ARG B 2 83  ? -15.26100 -20.62900 -16.36600 1.000 45.32000  ? 83  ARG B CD    1 
ATOM   5102 N  NE    . ARG B 2 83  ? -16.01400 -21.32000 -17.39800 1.000 45.80000  ? 83  ARG B NE    1 
ATOM   5103 C  CZ    . ARG B 2 83  ? -16.27600 -20.79100 -18.58200 1.000 43.92000  ? 83  ARG B CZ    1 
ATOM   5104 N  NH1   . ARG B 2 83  ? -15.84500 -19.56900 -18.85700 1.000 51.03000  ? 83  ARG B NH1   1 
ATOM   5105 N  NH2   . ARG B 2 83  ? -16.96900 -21.47200 -19.48100 1.000 44.64000  ? 83  ARG B NH2   1 
ATOM   5106 N  N     . THR B 2 84  ? -11.76200 -21.32300 -11.90800 1.000 53.51000  ? 84  THR B N     1 
ATOM   5107 C  CA    . THR B 2 84  ? -11.16000 -20.69400 -10.74300 1.000 51.17000  ? 84  THR B CA    1 
ATOM   5108 C  C     . THR B 2 84  ? -9.68000  -21.02700 -10.72300 1.000 57.59000  ? 84  THR B C     1 
ATOM   5109 O  O     . THR B 2 84  ? -9.28300  -22.16500 -11.00800 1.000 51.66000  ? 84  THR B O     1 
ATOM   5110 C  CB    . THR B 2 84  ? -11.82900 -21.15700 -9.43600  1.000 46.82000  ? 84  THR B CB    1 
ATOM   5111 O  OG1   . THR B 2 84  ? -13.20000 -20.75300 -9.44600  1.000 48.83000  ? 84  THR B OG1   1 
ATOM   5112 C  CG2   . THR B 2 84  ? -11.16300 -20.53200 -8.23200  1.000 47.77000  ? 84  THR B CG2   1 
ATOM   5113 N  N     . GLN B 2 85  ? -8.87400  -20.01500 -10.41600 1.000 65.50000  ? 85  GLN B N     1 
ATOM   5114 C  CA    . GLN B 2 85  ? -7.42800  -20.15600 -10.28400 1.000 66.81000  ? 85  GLN B CA    1 
ATOM   5115 C  C     . GLN B 2 85  ? -7.08800  -21.36300 -9.39600  1.000 67.27000  ? 85  GLN B C     1 
ATOM   5116 O  O     . GLN B 2 85  ? -7.83600  -21.72100 -8.49000  1.000 65.92000  ? 85  GLN B O     1 
ATOM   5117 C  CB    . GLN B 2 85  ? -6.83300  -18.84000 -9.74200  1.000 64.79000  ? 85  GLN B CB    1 
ATOM   5118 C  CG    . GLN B 2 85  ? -5.40100  -18.88300 -9.25800  1.000 78.71000  ? 85  GLN B CG    1 
ATOM   5119 C  CD    . GLN B 2 85  ? -5.31800  -19.35600 -7.82400  1.000 90.22000  ? 85  GLN B CD    1 
ATOM   5120 O  OE1   . GLN B 2 85  ? -6.19900  -19.04200 -7.00900  1.000 90.19000  ? 85  GLN B OE1   1 
ATOM   5121 N  NE2   . GLN B 2 85  ? -4.28100  -20.14200 -7.51000  1.000 77.99000  ? 85  GLN B NE2   1 
ATOM   5122 N  N     . ASP B 2 86  ? -5.97100  -22.00500 -9.70000  1.000 72.43000  ? 86  ASP B N     1 
ATOM   5123 C  CA    . ASP B 2 86  ? -5.52600  -23.20600 -9.00600  1.000 70.02000  ? 86  ASP B CA    1 
ATOM   5124 C  C     . ASP B 2 86  ? -5.56100  -23.07800 -7.48400  1.000 62.95000  ? 86  ASP B C     1 
ATOM   5125 O  O     . ASP B 2 86  ? -4.66900  -22.48500 -6.88100  1.000 59.40000  ? 86  ASP B O     1 
ATOM   5126 C  CB    . ASP B 2 86  ? -4.11000  -23.54300 -9.47600  1.000 84.96000  ? 86  ASP B CB    1 
ATOM   5127 C  CG    . ASP B 2 86  ? -3.88500  -23.17600 -10.93900 1.000 92.04000  ? 86  ASP B CG    1 
ATOM   5128 O  OD1   . ASP B 2 86  ? -4.31300  -23.96700 -11.81400 1.000 88.67000  ? 86  ASP B OD1   1 
ATOM   5129 O  OD2   . ASP B 2 86  ? -3.29500  -22.09700 -11.20900 1.000 85.13000  ? 86  ASP B OD2   1 
ATOM   5130 N  N     . HIS B 2 96  ? -3.81500  -35.85800 0.65000   1.000 76.65000  ? 96  HIS B N     1 
ATOM   5131 C  CA    . HIS B 2 96  ? -4.88200  -36.85600 0.70000   1.000 70.26000  ? 96  HIS B CA    1 
ATOM   5132 C  C     . HIS B 2 96  ? -4.43200  -38.09700 1.48200   1.000 69.53000  ? 96  HIS B C     1 
ATOM   5133 O  O     . HIS B 2 96  ? -3.51400  -38.81500 1.05100   1.000 71.14000  ? 96  HIS B O     1 
ATOM   5134 C  CB    . HIS B 2 96  ? -5.32200  -37.26900 -0.71700  1.000 66.89000  ? 96  HIS B CB    1 
ATOM   5135 C  CG    . HIS B 2 96  ? -6.31300  -38.40200 -0.73800  1.000 51.68000  ? 96  HIS B CG    1 
ATOM   5136 N  ND1   . HIS B 2 96  ? -7.62500  -38.22900 -0.34800  1.000 52.19000  ? 96  HIS B ND1   1 
ATOM   5137 C  CD2   . HIS B 2 96  ? -6.17900  -39.70000 -1.05100  1.000 56.47000  ? 96  HIS B CD2   1 
ATOM   5138 C  CE1   . HIS B 2 96  ? -8.25800  -39.38700 -0.43100  1.000 51.84000  ? 96  HIS B CE1   1 
ATOM   5139 N  NE2   . HIS B 2 96  ? -7.40200  -40.30400 -0.85900  1.000 49.00000  ? 96  HIS B NE2   1 
ATOM   5140 N  N     . PRO B 2 97  ? -5.08700  -38.36000 2.62700   1.000 66.81000  ? 97  PRO B N     1 
ATOM   5141 C  CA    . PRO B 2 97  ? -4.79600  -39.46100 3.55600   1.000 62.81000  ? 97  PRO B CA    1 
ATOM   5142 C  C     . PRO B 2 97  ? -5.09000  -40.85500 2.99400   1.000 60.91000  ? 97  PRO B C     1 
ATOM   5143 O  O     . PRO B 2 97  ? -6.25200  -41.23000 2.79600   1.000 59.10000  ? 97  PRO B O     1 
ATOM   5144 C  CB    . PRO B 2 97  ? -5.71000  -39.15700 4.74700   1.000 63.15000  ? 97  PRO B CB    1 
ATOM   5145 C  CG    . PRO B 2 97  ? -6.82700  -38.37900 4.17200   1.000 56.72000  ? 97  PRO B CG    1 
ATOM   5146 C  CD    . PRO B 2 97  ? -6.18300  -37.51100 3.12600   1.000 61.38000  ? 97  PRO B CD    1 
ATOM   5147 N  N     . ALA B 2 98  ? -4.02500  -41.62000 2.76500   1.000 63.24000  ? 98  ALA B N     1 
ATOM   5148 C  CA    . ALA B 2 98  ? -4.14100  -42.96700 2.22100   1.000 57.04000  ? 98  ALA B CA    1 
ATOM   5149 C  C     . ALA B 2 98  ? -4.81900  -43.91200 3.19200   1.000 57.80000  ? 98  ALA B C     1 
ATOM   5150 O  O     . ALA B 2 98  ? -5.28700  -44.97700 2.79700   1.000 62.41000  ? 98  ALA B O     1 
ATOM   5151 C  CB    . ALA B 2 98  ? -2.78400  -43.50100 1.85200   1.000 49.51000  ? 98  ALA B CB    1 
ATOM   5152 N  N     . GLY B 2 99  ? -4.87400  -43.52700 4.46300   1.000 57.53000  ? 99  GLY B N     1 
ATOM   5153 C  CA    . GLY B 2 99  ? -5.40200  -44.40600 5.49300   1.000 57.96000  ? 99  GLY B CA    1 
ATOM   5154 C  C     . GLY B 2 99  ? -6.90700  -44.33800 5.59300   1.000 61.37000  ? 99  GLY B C     1 
ATOM   5155 O  O     . GLY B 2 99  ? -7.54200  -45.14400 6.28100   1.000 66.96000  ? 99  GLY B O     1 
ATOM   5156 N  N     . LEU B 2 100 ? -7.48300  -43.36900 4.89500   1.000 61.16000  ? 100 LEU B N     1 
ATOM   5157 C  CA    . LEU B 2 100 ? -8.92300  -43.19500 4.91300   1.000 58.13000  ? 100 LEU B CA    1 
ATOM   5158 C  C     . LEU B 2 100 ? -9.64600  -44.37900 4.26300   1.000 60.44000  ? 100 LEU B C     1 
ATOM   5159 O  O     . LEU B 2 100 ? -10.75200 -44.74300 4.68400   1.000 56.97000  ? 100 LEU B O     1 
ATOM   5160 C  CB    . LEU B 2 100 ? -9.29800  -41.88600 4.22000   1.000 54.56000  ? 100 LEU B CB    1 
ATOM   5161 C  CG    . LEU B 2 100 ? -10.79500 -41.61800 4.15900   1.000 45.23000  ? 100 LEU B CG    1 
ATOM   5162 C  CD1   . LEU B 2 100 ? -11.35200 -41.43500 5.56400   1.000 52.08000  ? 100 LEU B CD1   1 
ATOM   5163 C  CD2   . LEU B 2 100 ? -11.07300 -40.41900 3.28500   1.000 50.89000  ? 100 LEU B CD2   1 
ATOM   5164 N  N     . LYS B 2 101 ? -9.02400  -44.98800 3.25100   1.000 63.87000  ? 101 LYS B N     1 
ATOM   5165 C  CA    . LYS B 2 101 ? -9.67600  -46.07700 2.51300   1.000 65.03000  ? 101 LYS B CA    1 
ATOM   5166 C  C     . LYS B 2 101 ? -9.62900  -47.42700 3.22900   1.000 69.95000  ? 101 LYS B C     1 
ATOM   5167 O  O     . LYS B 2 101 ? -10.12200 -48.42100 2.68700   1.000 77.64000  ? 101 LYS B O     1 
ATOM   5168 C  CB    . LYS B 2 101 ? -9.06200  -46.23300 1.11700   1.000 53.95000  ? 101 LYS B CB    1 
ATOM   5169 C  CG    . LYS B 2 101 ? -7.56500  -46.06200 1.08200   1.000 57.67000  ? 101 LYS B CG    1 
ATOM   5170 C  CD    . LYS B 2 101 ? -6.96000  -46.70800 -0.15600  1.000 49.69000  ? 101 LYS B CD    1 
ATOM   5171 C  CE    . LYS B 2 101 ? -5.49800  -46.34100 -0.31400  1.000 43.33000  ? 101 LYS B CE    1 
ATOM   5172 N  NZ    . LYS B 2 101 ? -5.35400  -44.89300 -0.64700  1.000 51.75000  ? 101 LYS B NZ    1 
ATOM   5173 N  N     . LYS B 2 102 ? -9.04800  -47.46800 4.43200   1.000 71.55000  ? 102 LYS B N     1 
ATOM   5174 C  CA    . LYS B 2 102 ? -8.96000  -48.71200 5.21400   1.000 69.10000  ? 102 LYS B CA    1 
ATOM   5175 C  C     . LYS B 2 102 ? -10.02100 -48.82100 6.31500   1.000 70.31000  ? 102 LYS B C     1 
ATOM   5176 O  O     . LYS B 2 102 ? -10.41700 -49.92000 6.69000   1.000 74.31000  ? 102 LYS B O     1 
ATOM   5177 C  CB    . LYS B 2 102 ? -7.58500  -48.84800 5.86400   1.000 56.27000  ? 102 LYS B CB    1 
ATOM   5178 C  CG    . LYS B 2 102 ? -6.42900  -48.29000 5.06000   1.000 60.00000  ? 102 LYS B CG    1 
ATOM   5179 C  CD    . LYS B 2 102 ? -6.17600  -49.09500 3.79800   1.000 67.55000  ? 102 LYS B CD    1 
ATOM   5180 C  CE    . LYS B 2 102 ? -4.69300  -49.07800 3.43400   1.000 60.71000  ? 102 LYS B CE    1 
ATOM   5181 N  NZ    . LYS B 2 102 ? -4.04000  -47.79600 3.81400   1.000 53.18000  ? 102 LYS B NZ    1 
ATOM   5182 N  N     . LYS B 2 103 ? -10.46400 -47.68100 6.83500   1.000 66.55000  ? 103 LYS B N     1 
ATOM   5183 C  CA    . LYS B 2 103 ? -11.28800 -47.63900 8.04300   1.000 61.01000  ? 103 LYS B CA    1 
ATOM   5184 C  C     . LYS B 2 103 ? -12.54400 -48.50000 7.95500   1.000 61.63000  ? 103 LYS B C     1 
ATOM   5185 O  O     . LYS B 2 103 ? -13.15500 -48.60300 6.89900   1.000 64.77000  ? 103 LYS B O     1 
ATOM   5186 C  CB    . LYS B 2 103 ? -11.65800 -46.19100 8.35400   1.000 60.60000  ? 103 LYS B CB    1 
ATOM   5187 C  CG    . LYS B 2 103 ? -10.43700 -45.28700 8.51900   1.000 61.47000  ? 103 LYS B CG    1 
ATOM   5188 C  CD    . LYS B 2 103 ? -9.67400  -45.59800 9.79900   1.000 64.32000  ? 103 LYS B CD    1 
ATOM   5189 C  CE    . LYS B 2 103 ? -8.20600  -45.23300 9.66800   1.000 62.35000  ? 103 LYS B CE    1 
ATOM   5190 N  NZ    . LYS B 2 103 ? -7.56300  -45.10700 11.00300  1.000 58.86000  ? 103 LYS B NZ    1 
ATOM   5191 N  N     . LYS B 2 104 ? -12.91100 -49.13800 9.06300   1.000 62.70000  ? 104 LYS B N     1 
ATOM   5192 C  CA    . LYS B 2 104 ? -14.05300 -50.04400 9.05800   1.000 70.60000  ? 104 LYS B CA    1 
ATOM   5193 C  C     . LYS B 2 104 ? -15.33800 -49.26000 8.83400   1.000 72.73000  ? 104 LYS B C     1 
ATOM   5194 O  O     . LYS B 2 104 ? -16.25100 -49.71400 8.13200   1.000 72.46000  ? 104 LYS B O     1 
ATOM   5195 C  CB    . LYS B 2 104 ? -14.14100 -50.84000 10.36400  1.000 71.61000  ? 104 LYS B CB    1 
ATOM   5196 C  CG    . LYS B 2 104 ? -15.12800 -52.02300 10.29700  1.000 80.08000  ? 104 LYS B CG    1 
ATOM   5197 C  CD    . LYS B 2 104 ? -15.53500 -52.52100 11.68400  1.000 80.76000  ? 104 LYS B CD    1 
ATOM   5198 C  CE    . LYS B 2 104 ? -14.46500 -52.19900 12.73000  1.000 85.23000  ? 104 LYS B CE    1 
ATOM   5199 N  NZ    . LYS B 2 104 ? -14.89900 -52.54300 14.11900  1.000 80.60000  ? 104 LYS B NZ    1 
ATOM   5200 N  N     . SER B 2 105 ? -15.40800 -48.08300 9.44500   1.000 65.37000  ? 105 SER B N     1 
ATOM   5201 C  CA    . SER B 2 105 ? -16.52700 -47.18200 9.22400   1.000 63.83000  ? 105 SER B CA    1 
ATOM   5202 C  C     . SER B 2 105 ? -15.99000 -45.83200 8.75300   1.000 62.46000  ? 105 SER B C     1 
ATOM   5203 O  O     . SER B 2 105 ? -14.95000 -45.37300 9.23400   1.000 61.90000  ? 105 SER B O     1 
ATOM   5204 C  CB    . SER B 2 105 ? -17.37200 -47.02200 10.49900  1.000 63.74000  ? 105 SER B CB    1 
ATOM   5205 O  OG    . SER B 2 105 ? -18.14500 -48.18000 10.78000  1.000 61.80000  ? 105 SER B OG    1 
ATOM   5206 N  N     . VAL B 2 106 ? -16.66500 -45.22000 7.78300   1.000 53.18000  ? 106 VAL B N     1 
ATOM   5207 C  CA    . VAL B 2 106 ? -16.40700 -43.82200 7.48300   1.000 51.60000  ? 106 VAL B CA    1 
ATOM   5208 C  C     . VAL B 2 106 ? -17.73500 -43.09400 7.47900   1.000 53.77000  ? 106 VAL B C     1 
ATOM   5209 O  O     . VAL B 2 106 ? -18.74100 -43.57700 6.95300   1.000 55.20000  ? 106 VAL B O     1 
ATOM   5210 C  CB    . VAL B 2 106 ? -15.66200 -43.60500 6.14900   1.000 49.62000  ? 106 VAL B CB    1 
ATOM   5211 C  CG1   . VAL B 2 106 ? -15.42200 -42.12700 5.91600   1.000 47.25000  ? 106 VAL B CG1   1 
ATOM   5212 C  CG2   . VAL B 2 106 ? -14.33300 -44.28400 6.18100   1.000 54.58000  ? 106 VAL B CG2   1 
ATOM   5213 N  N     . THR B 2 107 ? -17.72100 -41.92600 8.10000   1.000 54.27000  ? 107 THR B N     1 
ATOM   5214 C  CA    . THR B 2 107 ? -18.91100 -41.12700 8.30000   1.000 52.31000  ? 107 THR B CA    1 
ATOM   5215 C  C     . THR B 2 107 ? -18.74700 -39.83700 7.50200   1.000 48.06000  ? 107 THR B C     1 
ATOM   5216 O  O     . THR B 2 107 ? -17.63900 -39.33300 7.38200   1.000 48.86000  ? 107 THR B O     1 
ATOM   5217 C  CB    . THR B 2 107 ? -19.10800 -40.86300 9.80700   1.000 54.35000  ? 107 THR B CB    1 
ATOM   5218 O  OG1   . THR B 2 107 ? -19.92300 -41.89000 10.37700  1.000 55.39000  ? 107 THR B OG1   1 
ATOM   5219 C  CG2   . THR B 2 107 ? -19.73200 -39.52400 10.06200  1.000 58.23000  ? 107 THR B CG2   1 
ATOM   5220 N  N     . VAL B 2 108 ? -19.82300 -39.32300 6.91800   1.000 51.92000  ? 108 VAL B N     1 
ATOM   5221 C  CA    . VAL B 2 108 ? -19.71000 -38.12200 6.09400   1.000 46.67000  ? 108 VAL B CA    1 
ATOM   5222 C  C     . VAL B 2 108 ? -20.61700 -36.99700 6.54500   1.000 45.88000  ? 108 VAL B C     1 
ATOM   5223 O  O     . VAL B 2 108 ? -21.82500 -37.11500 6.46400   1.000 44.58000  ? 108 VAL B O     1 
ATOM   5224 C  CB    . VAL B 2 108 ? -20.03700 -38.41600 4.63300   1.000 42.81000  ? 108 VAL B CB    1 
ATOM   5225 C  CG1   . VAL B 2 108 ? -19.65900 -37.23700 3.77700   1.000 43.68000  ? 108 VAL B CG1   1 
ATOM   5226 C  CG2   . VAL B 2 108 ? -19.32900 -39.66300 4.17900   1.000 42.49000  ? 108 VAL B CG2   1 
ATOM   5227 N  N     . LEU B 2 109 ? -20.02000 -35.89400 6.99000   1.000 45.23000  ? 109 LEU B N     1 
ATOM   5228 C  CA    . LEU B 2 109 ? -20.77100 -34.74400 7.48600   1.000 40.58000  ? 109 LEU B CA    1 
ATOM   5229 C  C     . LEU B 2 109 ? -20.70600 -33.54400 6.57400   1.000 49.76000  ? 109 LEU B C     1 
ATOM   5230 O  O     . LEU B 2 109 ? -19.72400 -33.31600 5.87000   1.000 52.88000  ? 109 LEU B O     1 
ATOM   5231 C  CB    . LEU B 2 109 ? -20.26800 -34.29400 8.84100   1.000 45.81000  ? 109 LEU B CB    1 
ATOM   5232 C  CG    . LEU B 2 109 ? -19.87100 -35.34100 9.84500   1.000 46.10000  ? 109 LEU B CG    1 
ATOM   5233 C  CD1   . LEU B 2 109 ? -18.82300 -34.71600 10.69800  1.000 47.99000  ? 109 LEU B CD1   1 
ATOM   5234 C  CD2   . LEU B 2 109 ? -21.06500 -35.70900 10.63800  1.000 48.90000  ? 109 LEU B CD2   1 
ATOM   5235 N  N     . ASP B 2 110 ? -21.76500 -32.75600 6.62700   1.000 49.09000  ? 110 ASP B N     1 
ATOM   5236 C  CA    . ASP B 2 110 ? -21.91200 -31.59700 5.77200   1.000 46.86000  ? 110 ASP B CA    1 
ATOM   5237 C  C     . ASP B 2 110 ? -21.48000 -30.35800 6.53700   1.000 50.93000  ? 110 ASP B C     1 
ATOM   5238 O  O     . ASP B 2 110 ? -22.21100 -29.84600 7.36900   1.000 53.79000  ? 110 ASP B O     1 
ATOM   5239 C  CB    . ASP B 2 110 ? -23.36500 -31.49400 5.29600   1.000 42.81000  ? 110 ASP B CB    1 
ATOM   5240 C  CG    . ASP B 2 110 ? -23.60900 -30.31600 4.38500   1.000 50.23000  ? 110 ASP B CG    1 
ATOM   5241 O  OD1   . ASP B 2 110 ? -22.63500 -29.72700 3.89800   1.000 54.87000  ? 110 ASP B OD1   1 
ATOM   5242 O  OD2   . ASP B 2 110 ? -24.78400 -29.97100 4.15200   1.000 47.55000  ? 110 ASP B OD2   1 
ATOM   5243 N  N     . VAL B 2 111 ? -20.27700 -29.87500 6.25800   1.000 47.22000  ? 111 VAL B N     1 
ATOM   5244 C  CA    . VAL B 2 111 ? -19.75800 -28.71800 6.97700   1.000 42.78000  ? 111 VAL B CA    1 
ATOM   5245 C  C     . VAL B 2 111 ? -19.83400 -27.44100 6.14000   1.000 41.32000  ? 111 VAL B C     1 
ATOM   5246 O  O     . VAL B 2 111 ? -19.08900 -26.50000 6.37100   1.000 47.29000  ? 111 VAL B O     1 
ATOM   5247 C  CB    . VAL B 2 111 ? -18.29000 -28.95500 7.45200   1.000 42.55000  ? 111 VAL B CB    1 
ATOM   5248 C  CG1   . VAL B 2 111 ? -18.22600 -30.18300 8.33000   1.000 46.73000  ? 111 VAL B CG1   1 
ATOM   5249 C  CG2   . VAL B 2 111 ? -17.35900 -29.11900 6.29800   1.000 39.47000  ? 111 VAL B CG2   1 
ATOM   5250 N  N     . GLY B 2 112 ? -20.75900 -27.40600 5.18900   1.000 45.47000  ? 112 GLY B N     1 
ATOM   5251 C  CA    . GLY B 2 112 ? -20.94400 -26.25100 4.32700   1.000 47.91000  ? 112 GLY B CA    1 
ATOM   5252 C  C     . GLY B 2 112 ? -21.28400 -24.94300 5.04300   1.000 53.39000  ? 112 GLY B C     1 
ATOM   5253 O  O     . GLY B 2 112 ? -20.82100 -23.87400 4.63600   1.000 52.85000  ? 112 GLY B O     1 
ATOM   5254 N  N     . ASP B 2 113 ? -22.09000 -25.01800 6.10300   1.000 54.23000  ? 113 ASP B N     1 
ATOM   5255 C  CA    . ASP B 2 113 ? -22.48300 -23.82700 6.86900   1.000 61.21000  ? 113 ASP B CA    1 
ATOM   5256 C  C     . ASP B 2 113 ? -21.28400 -23.01700 7.36900   1.000 60.79000  ? 113 ASP B C     1 
ATOM   5257 O  O     . ASP B 2 113 ? -21.35800 -21.79100 7.50000   1.000 57.02000  ? 113 ASP B O     1 
ATOM   5258 C  CB    . ASP B 2 113 ? -23.35500 -24.21500 8.06800   1.000 57.20000  ? 113 ASP B CB    1 
ATOM   5259 C  CG    . ASP B 2 113 ? -24.76400 -24.56600 7.66900   1.000 67.86000  ? 113 ASP B CG    1 
ATOM   5260 O  OD1   . ASP B 2 113 ? -25.12800 -24.29900 6.50200   1.000 69.71000  ? 113 ASP B OD1   1 
ATOM   5261 O  OD2   . ASP B 2 113 ? -25.51200 -25.09600 8.52100   1.000 76.42000  ? 113 ASP B OD2   1 
ATOM   5262 N  N     . ALA B 2 114 ? -20.18700 -23.71500 7.64600   1.000 57.50000  ? 114 ALA B N     1 
ATOM   5263 C  CA    . ALA B 2 114 ? -18.97300 -23.09100 8.14900   1.000 52.47000  ? 114 ALA B CA    1 
ATOM   5264 C  C     . ALA B 2 114 ? -18.49000 -21.97100 7.24200   1.000 48.13000  ? 114 ALA B C     1 
ATOM   5265 O  O     . ALA B 2 114 ? -17.94300 -20.98100 7.71200   1.000 54.49000  ? 114 ALA B O     1 
ATOM   5266 C  CB    . ALA B 2 114 ? -17.87700 -24.14100 8.31800   1.000 49.42000  ? 114 ALA B CB    1 
ATOM   5267 N  N     . TYR B 2 115 ? -18.69100 -22.13000 5.94100   1.000 49.83000  ? 115 TYR B N     1 
ATOM   5268 C  CA    . TYR B 2 115 ? -18.12300 -21.20300 4.96100   1.000 53.46000  ? 115 TYR B CA    1 
ATOM   5269 C  C     . TYR B 2 115 ? -18.70900 -19.78600 5.00400   1.000 52.25000  ? 115 TYR B C     1 
ATOM   5270 O  O     . TYR B 2 115 ? -18.05000 -18.81700 4.62400   1.000 48.37000  ? 115 TYR B O     1 
ATOM   5271 C  CB    . TYR B 2 115 ? -18.29500 -21.78700 3.56400   1.000 48.85000  ? 115 TYR B CB    1 
ATOM   5272 C  CG    . TYR B 2 115 ? -17.50800 -23.05400 3.37200   1.000 49.16000  ? 115 TYR B CG    1 
ATOM   5273 C  CD1   . TYR B 2 115 ? -16.34200 -23.27600 4.07800   1.000 44.36000  ? 115 TYR B CD1   1 
ATOM   5274 C  CD2   . TYR B 2 115 ? -17.93400 -24.03300 2.49200   1.000 53.91000  ? 115 TYR B CD2   1 
ATOM   5275 C  CE1   . TYR B 2 115 ? -15.61400 -24.42800 3.90400   1.000 49.24000  ? 115 TYR B CE1   1 
ATOM   5276 C  CE2   . TYR B 2 115 ? -17.21300 -25.20400 2.32000   1.000 50.95000  ? 115 TYR B CE2   1 
ATOM   5277 C  CZ    . TYR B 2 115 ? -16.05300 -25.39400 3.02500   1.000 49.61000  ? 115 TYR B CZ    1 
ATOM   5278 O  OH    . TYR B 2 115 ? -15.32600 -26.55400 2.85300   1.000 50.67000  ? 115 TYR B OH    1 
ATOM   5279 N  N     . PHE B 2 116 ? -19.94500 -19.67000 5.47400   1.000 55.49000  ? 116 PHE B N     1 
ATOM   5280 C  CA    . PHE B 2 116 ? -20.64900 -18.39000 5.48300   1.000 55.31000  ? 116 PHE B CA    1 
ATOM   5281 C  C     . PHE B 2 116 ? -20.12200 -17.45600 6.57200   1.000 54.44000  ? 116 PHE B C     1 
ATOM   5282 O  O     . PHE B 2 116 ? -20.68600 -16.38900 6.80800   1.000 54.90000  ? 116 PHE B O     1 
ATOM   5283 C  CB    . PHE B 2 116 ? -22.16000 -18.60700 5.66600   1.000 57.81000  ? 116 PHE B CB    1 
ATOM   5284 C  CG    . PHE B 2 116 ? -22.79800 -19.44300 4.58100   1.000 59.56000  ? 116 PHE B CG    1 
ATOM   5285 C  CD1   . PHE B 2 116 ? -22.18500 -19.59000 3.33900   1.000 59.43000  ? 116 PHE B CD1   1 
ATOM   5286 C  CD2   . PHE B 2 116 ? -24.01300 -20.07400 4.80500   1.000 59.30000  ? 116 PHE B CD2   1 
ATOM   5287 C  CE1   . PHE B 2 116 ? -22.76600 -20.36000 2.34200   1.000 57.28000  ? 116 PHE B CE1   1 
ATOM   5288 C  CE2   . PHE B 2 116 ? -24.60100 -20.84100 3.81800   1.000 64.23000  ? 116 PHE B CE2   1 
ATOM   5289 C  CZ    . PHE B 2 116 ? -23.97500 -20.98700 2.58000   1.000 63.71000  ? 116 PHE B CZ    1 
ATOM   5290 N  N     . SER B 2 117 ? -19.03800 -17.86200 7.22900   1.000 58.39000  ? 117 SER B N     1 
ATOM   5291 C  CA    . SER B 2 117 ? -18.43100 -17.06300 8.28900   1.000 53.40000  ? 117 SER B CA    1 
ATOM   5292 C  C     . SER B 2 117 ? -17.28200 -16.23900 7.73400   1.000 52.57000  ? 117 SER B C     1 
ATOM   5293 O  O     . SER B 2 117 ? -16.80000 -15.31700 8.37800   1.000 61.15000  ? 117 SER B O     1 
ATOM   5294 C  CB    . SER B 2 117 ? -17.94600 -17.96300 9.43500   1.000 55.59000  ? 117 SER B CB    1 
ATOM   5295 O  OG    . SER B 2 117 ? -16.84900 -18.78700 9.05300   1.000 55.99000  ? 117 SER B OG    1 
ATOM   5296 N  N     . VAL B 2 118 ? -16.85100 -16.58800 6.53000   1.000 48.12000  ? 118 VAL B N     1 
ATOM   5297 C  CA    . VAL B 2 118 ? -15.73700 -15.92800 5.87400   1.000 44.27000  ? 118 VAL B CA    1 
ATOM   5298 C  C     . VAL B 2 118 ? -16.26500 -15.13400 4.70500   1.000 49.63000  ? 118 VAL B C     1 
ATOM   5299 O  O     . VAL B 2 118 ? -16.90600 -15.69700 3.83300   1.000 58.60000  ? 118 VAL B O     1 
ATOM   5300 C  CB    . VAL B 2 118 ? -14.71200 -16.93800 5.34800   1.000 45.98000  ? 118 VAL B CB    1 
ATOM   5301 C  CG1   . VAL B 2 118 ? -13.54200 -16.21700 4.69800   1.000 42.92000  ? 118 VAL B CG1   1 
ATOM   5302 C  CG2   . VAL B 2 118 ? -14.25800 -17.86600 6.45700   1.000 46.81000  ? 118 VAL B CG2   1 
ATOM   5303 N  N     . PRO B 2 119 ? -16.01400 -13.82600 4.67200   1.000 48.72000  ? 119 PRO B N     1 
ATOM   5304 C  CA    . PRO B 2 119 ? -16.45600 -13.03100 3.52300   1.000 49.28000  ? 119 PRO B CA    1 
ATOM   5305 C  C     . PRO B 2 119 ? -15.67800 -13.35400 2.24900   1.000 46.16000  ? 119 PRO B C     1 
ATOM   5306 O  O     . PRO B 2 119 ? -14.58800 -13.91200 2.32500   1.000 46.96000  ? 119 PRO B O     1 
ATOM   5307 C  CB    . PRO B 2 119 ? -16.19200 -11.59200 3.97700   1.000 49.23000  ? 119 PRO B CB    1 
ATOM   5308 C  CG    . PRO B 2 119 ? -15.12200 -11.72300 4.97500   1.000 42.98000  ? 119 PRO B CG    1 
ATOM   5309 C  CD    . PRO B 2 119 ? -15.41200 -12.98500 5.71200   1.000 47.70000  ? 119 PRO B CD    1 
ATOM   5310 N  N     . LEU B 2 120 ? -16.24100 -12.98700 1.10100   1.000 51.26000  ? 120 LEU B N     1 
ATOM   5311 C  CA    . LEU B 2 120 ? -15.68500 -13.34300 -0.19900  1.000 49.13000  ? 120 LEU B CA    1 
ATOM   5312 C  C     . LEU B 2 120 ? -15.13000 -12.12600 -0.90900  1.000 48.75000  ? 120 LEU B C     1 
ATOM   5313 O  O     . LEU B 2 120 ? -15.73700 -11.05900 -0.88500  1.000 52.10000  ? 120 LEU B O     1 
ATOM   5314 C  CB    . LEU B 2 120 ? -16.75000 -14.02100 -1.08600  1.000 49.69000  ? 120 LEU B CB    1 
ATOM   5315 C  CG    . LEU B 2 120 ? -16.32800 -14.31900 -2.54000  1.000 49.95000  ? 120 LEU B CG    1 
ATOM   5316 C  CD1   . LEU B 2 120 ? -15.13100 -15.27100 -2.58000  1.000 40.18000  ? 120 LEU B CD1   1 
ATOM   5317 C  CD2   . LEU B 2 120 ? -17.47100 -14.86100 -3.40700  1.000 41.50000  ? 120 LEU B CD2   1 
ATOM   5318 N  N     . ASP B 2 121 ? -13.98300 -12.30300 -1.55400  1.000 50.63000  ? 121 ASP B N     1 
ATOM   5319 C  CA    . ASP B 2 121 ? -13.34800 -11.23000 -2.30000  1.000 48.59000  ? 121 ASP B CA    1 
ATOM   5320 C  C     . ASP B 2 121 ? -14.30400 -10.46600 -3.19700  1.000 51.76000  ? 121 ASP B C     1 
ATOM   5321 O  O     . ASP B 2 121 ? -14.91000 -11.02600 -4.11400  1.000 55.21000  ? 121 ASP B O     1 
ATOM   5322 C  CB    . ASP B 2 121 ? -12.19000 -11.78600 -3.12800  1.000 57.44000  ? 121 ASP B CB    1 
ATOM   5323 C  CG    . ASP B 2 121 ? -11.50800 -10.71800 -3.97000  1.000 63.18000  ? 121 ASP B CG    1 
ATOM   5324 O  OD1   . ASP B 2 121 ? -11.62000 -9.51900  -3.62000  1.000 65.29000  ? 121 ASP B OD1   1 
ATOM   5325 O  OD2   . ASP B 2 121 ? -10.86000 -11.08000 -4.98500  1.000 66.70000  ? 121 ASP B OD2   1 
ATOM   5326 N  N     . GLU B 2 122 ? -14.40000 -9.17100  -2.91600  1.000 53.51000  ? 122 GLU B N     1 
ATOM   5327 C  CA    . GLU B 2 122 ? -15.27600 -8.24300  -3.62000  1.000 55.57000  ? 122 GLU B CA    1 
ATOM   5328 C  C     . GLU B 2 122 ? -15.26000 -8.38500  -5.13800  1.000 53.56000  ? 122 GLU B C     1 
ATOM   5329 O  O     . GLU B 2 122 ? -16.31000 -8.40200  -5.78000  1.000 53.60000  ? 122 GLU B O     1 
ATOM   5330 C  CB    . GLU B 2 122 ? -14.90000 -6.80800  -3.24600  1.000 54.17000  ? 122 GLU B CB    1 
ATOM   5331 C  CG    . GLU B 2 122 ? -16.01200 -6.04800  -2.55300  1.000 67.80000  ? 122 GLU B CG    1 
ATOM   5332 C  CD    . GLU B 2 122 ? -17.19600 -5.77500  -3.48200  1.000 79.30000  ? 122 GLU B CD    1 
ATOM   5333 O  OE1   . GLU B 2 122 ? -17.02900 -4.99600  -4.45500  1.000 80.57000  ? 122 GLU B OE1   1 
ATOM   5334 O  OE2   . GLU B 2 122 ? -18.29000 -6.34300  -3.24100  1.000 66.96000  ? 122 GLU B OE2   1 
ATOM   5335 N  N     . ASP B 2 123 ? -14.07300 -8.49000  -5.72000  1.000 54.58000  ? 123 ASP B N     1 
ATOM   5336 C  CA    . ASP B 2 123 ? -13.98900 -8.46600  -7.17200  1.000 55.36000  ? 123 ASP B CA    1 
ATOM   5337 C  C     . ASP B 2 123 ? -14.31900 -9.82200  -7.76000  1.000 52.41000  ? 123 ASP B C     1 
ATOM   5338 O  O     . ASP B 2 123 ? -14.36000 -9.98000  -8.97800  1.000 51.79000  ? 123 ASP B O     1 
ATOM   5339 C  CB    . ASP B 2 123 ? -12.60800 -7.99500  -7.62500  1.000 53.04000  ? 123 ASP B CB    1 
ATOM   5340 C  CG    . ASP B 2 123 ? -12.45300 -6.48900  -7.51100  1.000 69.39000  ? 123 ASP B CG    1 
ATOM   5341 O  OD1   . ASP B 2 123 ? -13.27200 -5.87700  -6.78800  1.000 67.70000  ? 123 ASP B OD1   1 
ATOM   5342 O  OD2   . ASP B 2 123 ? -11.53200 -5.91300  -8.13700  1.000 78.66000  ? 123 ASP B OD2   1 
ATOM   5343 N  N     . PHE B 2 124 ? -14.57600 -10.79200 -6.89100  1.000 46.23000  ? 124 PHE B N     1 
ATOM   5344 C  CA    . PHE B 2 124 ? -14.87300 -12.14000 -7.34000  1.000 45.76000  ? 124 PHE B CA    1 
ATOM   5345 C  C     . PHE B 2 124 ? -16.35200 -12.45200 -7.20100  1.000 46.88000  ? 124 PHE B C     1 
ATOM   5346 O  O     . PHE B 2 124 ? -16.86500 -13.32300 -7.89800  1.000 41.57000  ? 124 PHE B O     1 
ATOM   5347 C  CB    . PHE B 2 124 ? -14.06000 -13.16600 -6.56000  1.000 43.19000  ? 124 PHE B CB    1 
ATOM   5348 C  CG    . PHE B 2 124 ? -14.00000 -14.52000 -7.21800  1.000 42.52000  ? 124 PHE B CG    1 
ATOM   5349 C  CD1   . PHE B 2 124 ? -13.10500 -14.77000 -8.24600  1.000 37.48000  ? 124 PHE B CD1   1 
ATOM   5350 C  CD2   . PHE B 2 124 ? -14.83400 -15.54100 -6.80700  1.000 40.15000  ? 124 PHE B CD2   1 
ATOM   5351 C  CE1   . PHE B 2 124 ? -13.04500 -16.00500 -8.84900  1.000 37.99000  ? 124 PHE B CE1   1 
ATOM   5352 C  CE2   . PHE B 2 124 ? -14.77200 -16.77600 -7.40800  1.000 36.86000  ? 124 PHE B CE2   1 
ATOM   5353 C  CZ    . PHE B 2 124 ? -13.86900 -17.01000 -8.42700  1.000 34.78000  ? 124 PHE B CZ    1 
ATOM   5354 N  N     . ARG B 2 125 ? -17.03200 -11.73000 -6.31500  1.000 44.50000  ? 125 ARG B N     1 
ATOM   5355 C  CA    . ARG B 2 125 ? -18.44100 -11.98000 -6.03200  1.000 41.57000  ? 125 ARG B CA    1 
ATOM   5356 C  C     . ARG B 2 125 ? -19.31200 -12.09800 -7.28000  1.000 41.79000  ? 125 ARG B C     1 
ATOM   5357 O  O     . ARG B 2 125 ? -20.24700 -12.91200 -7.31300  1.000 41.07000  ? 125 ARG B O     1 
ATOM   5358 C  CB    . ARG B 2 125 ? -18.98500 -10.88000 -5.13300  1.000 38.96000  ? 125 ARG B CB    1 
ATOM   5359 C  CG    . ARG B 2 125 ? -18.37900 -10.94500 -3.76100  1.000 43.95000  ? 125 ARG B CG    1 
ATOM   5360 C  CD    . ARG B 2 125 ? -18.75300 -9.77100  -2.90900  1.000 45.15000  ? 125 ARG B CD    1 
ATOM   5361 N  NE    . ARG B 2 125 ? -18.27200 -9.96200  -1.54800  1.000 49.63000  ? 125 ARG B NE    1 
ATOM   5362 C  CZ    . ARG B 2 125 ? -18.50700 -9.12000  -0.54900  1.000 52.53000  ? 125 ARG B CZ    1 
ATOM   5363 N  NH1   . ARG B 2 125 ? -19.21700 -8.01900  -0.76600  1.000 52.52000  ? 125 ARG B NH1   1 
ATOM   5364 N  NH2   . ARG B 2 125 ? -18.03800 -9.38200  0.66600   1.000 50.69000  ? 125 ARG B NH2   1 
ATOM   5365 N  N     . LYS B 2 126 ? -18.98300 -11.32700 -8.31400  1.000 36.25000  ? 126 LYS B N     1 
ATOM   5366 C  CA    . LYS B 2 126 ? -19.85200 -11.25800 -9.47700  1.000 36.73000  ? 126 LYS B CA    1 
ATOM   5367 C  C     . LYS B 2 126 ? -19.88800 -12.56800 -10.26400 1.000 39.20000  ? 126 LYS B C     1 
ATOM   5368 O  O     . LYS B 2 126 ? -20.84400 -12.85000 -10.99400 1.000 41.19000  ? 126 LYS B O     1 
ATOM   5369 C  CB    . LYS B 2 126 ? -19.43100 -10.11400 -10.38100 1.000 32.83000  ? 126 LYS B CB    1 
ATOM   5370 C  CG    . LYS B 2 126 ? -17.97500 -10.07100 -10.70700 1.000 35.68000  ? 126 LYS B CG    1 
ATOM   5371 C  CD    . LYS B 2 126 ? -17.75600 -9.01600  -11.78600 1.000 36.11000  ? 126 LYS B CD    1 
ATOM   5372 C  CE    . LYS B 2 126 ? -16.38400 -9.13400  -12.42800 1.000 46.51000  ? 126 LYS B CE    1 
ATOM   5373 N  NZ    . LYS B 2 126 ? -15.32500 -8.54200  -11.54300 1.000 54.49000  ? 126 LYS B NZ    1 
ATOM   5374 N  N     . TYR B 2 127 ? -18.85500 -13.37800 -10.10100 1.000 40.18000  ? 127 TYR B N     1 
ATOM   5375 C  CA    . TYR B 2 127 ? -18.79600 -14.66200 -10.78000 1.000 35.34000  ? 127 TYR B CA    1 
ATOM   5376 C  C     . TYR B 2 127 ? -19.67900 -15.69600 -10.11200 1.000 34.11000  ? 127 TYR B C     1 
ATOM   5377 O  O     . TYR B 2 127 ? -19.89000 -16.77400 -10.66600 1.000 31.76000  ? 127 TYR B O     1 
ATOM   5378 C  CB    . TYR B 2 127 ? -17.35800 -15.18000 -10.82500 1.000 37.55000  ? 127 TYR B CB    1 
ATOM   5379 C  CG    . TYR B 2 127 ? -16.37000 -14.21600 -11.44000 1.000 41.76000  ? 127 TYR B CG    1 
ATOM   5380 C  CD1   . TYR B 2 127 ? -16.50900 -13.80100 -12.76600 1.000 39.66000  ? 127 TYR B CD1   1 
ATOM   5381 C  CD2   . TYR B 2 127 ? -15.29200 -13.72300 -10.70000 1.000 42.44000  ? 127 TYR B CD2   1 
ATOM   5382 C  CE1   . TYR B 2 127 ? -15.61200 -12.91900 -13.33100 1.000 42.61000  ? 127 TYR B CE1   1 
ATOM   5383 C  CE2   . TYR B 2 127 ? -14.38800 -12.84200 -11.26400 1.000 37.97000  ? 127 TYR B CE2   1 
ATOM   5384 C  CZ    . TYR B 2 127 ? -14.55300 -12.44800 -12.57400 1.000 39.92000  ? 127 TYR B CZ    1 
ATOM   5385 O  OH    . TYR B 2 127 ? -13.65300 -11.59100 -13.14700 1.000 52.94000  ? 127 TYR B OH    1 
ATOM   5386 N  N     . THR B 2 128 ? -20.18700 -15.38400 -8.92300  1.000 31.10000  ? 128 THR B N     1 
ATOM   5387 C  CA    . THR B 2 128 ? -21.02500 -16.34300 -8.21000  1.000 34.69000  ? 128 THR B CA    1 
ATOM   5388 C  C     . THR B 2 128 ? -22.53000 -16.11700 -8.43600  1.000 34.51000  ? 128 THR B C     1 
ATOM   5389 O  O     . THR B 2 128 ? -23.36400 -16.71100 -7.75800  1.000 33.76000  ? 128 THR B O     1 
ATOM   5390 C  CB    . THR B 2 128 ? -20.76900 -16.28700 -6.71900  1.000 34.96000  ? 128 THR B CB    1 
ATOM   5391 O  OG1   . THR B 2 128 ? -21.23800 -15.02400 -6.23900  1.000 40.73000  ? 128 THR B OG1   1 
ATOM   5392 C  CG2   . THR B 2 128 ? -19.28600 -16.42300 -6.42400  1.000 28.83000  ? 128 THR B CG2   1 
ATOM   5393 N  N     . ALA B 2 129 ? -22.87000 -15.26000 -9.38900  1.000 34.02000  ? 129 ALA B N     1 
ATOM   5394 C  CA    . ALA B 2 129 ? -24.25900 -14.93600 -9.69000  1.000 31.31000  ? 129 ALA B CA    1 
ATOM   5395 C  C     . ALA B 2 129 ? -25.12200 -16.16300 -10.01900 1.000 33.84000  ? 129 ALA B C     1 
ATOM   5396 O  O     . ALA B 2 129 ? -24.69000 -17.06100 -10.73200 1.000 30.10000  ? 129 ALA B O     1 
ATOM   5397 C  CB    . ALA B 2 129 ? -24.30500 -13.95800 -10.83500 1.000 29.60000  ? 129 ALA B CB    1 
ATOM   5398 N  N     . PHE B 2 130 ? -26.34400 -16.19700 -9.49200  1.000 30.03000  ? 130 PHE B N     1 
ATOM   5399 C  CA    . PHE B 2 130 ? -27.28700 -17.24200 -9.85600  1.000 31.89000  ? 130 PHE B CA    1 
ATOM   5400 C  C     . PHE B 2 130 ? -28.67700 -16.62000 -9.97600  1.000 32.65000  ? 130 PHE B C     1 
ATOM   5401 O  O     . PHE B 2 130 ? -28.86500 -15.47600 -9.57800  1.000 30.59000  ? 130 PHE B O     1 
ATOM   5402 C  CB    . PHE B 2 130 ? -27.26000 -18.40500 -8.84500  1.000 29.30000  ? 130 PHE B CB    1 
ATOM   5403 C  CG    . PHE B 2 130 ? -27.61200 -18.01400 -7.42600  1.000 34.90000  ? 130 PHE B CG    1 
ATOM   5404 C  CD1   . PHE B 2 130 ? -26.63500 -17.58100 -6.54500  1.000 34.23000  ? 130 PHE B CD1   1 
ATOM   5405 C  CD2   . PHE B 2 130 ? -28.91800 -18.09900 -6.96400  1.000 38.40000  ? 130 PHE B CD2   1 
ATOM   5406 C  CE1   . PHE B 2 130 ? -26.96200 -17.22200 -5.23700  1.000 36.37000  ? 130 PHE B CE1   1 
ATOM   5407 C  CE2   . PHE B 2 130 ? -29.24800 -17.73500 -5.64800  1.000 33.67000  ? 130 PHE B CE2   1 
ATOM   5408 C  CZ    . PHE B 2 130 ? -28.27200 -17.30400 -4.79200  1.000 33.43000  ? 130 PHE B CZ    1 
ATOM   5409 N  N     . THR B 2 131 ? -29.63700 -17.36500 -10.53100 1.000 31.29000  ? 131 THR B N     1 
ATOM   5410 C  CA    . THR B 2 131 ? -30.96900 -16.81600 -10.85900 1.000 31.14000  ? 131 THR B CA    1 
ATOM   5411 C  C     . THR B 2 131 ? -32.11900 -17.71400 -10.41800 1.000 34.08000  ? 131 THR B C     1 
ATOM   5412 O  O     . THR B 2 131 ? -32.15300 -18.90300 -10.75800 1.000 29.68000  ? 131 THR B O     1 
ATOM   5413 C  CB    . THR B 2 131 ? -31.14000 -16.60100 -12.37700 1.000 27.96000  ? 131 THR B CB    1 
ATOM   5414 O  OG1   . THR B 2 131 ? -29.96300 -15.99000 -12.91700 1.000 35.45000  ? 131 THR B OG1   1 
ATOM   5415 C  CG2   . THR B 2 131 ? -32.36500 -15.73500 -12.67700 1.000 27.73000  ? 131 THR B CG2   1 
ATOM   5416 N  N     . ILE B 2 132 ? -33.08700 -17.15900 -9.69800  1.000 30.51000  ? 132 ILE B N     1 
ATOM   5417 C  CA    . ILE B 2 132 ? -34.22700 -17.98100 -9.32800  1.000 32.95000  ? 132 ILE B CA    1 
ATOM   5418 C  C     . ILE B 2 132 ? -35.41100 -17.78600 -10.28100 1.000 31.59000  ? 132 ILE B C     1 
ATOM   5419 O  O     . ILE B 2 132 ? -35.93100 -16.67400 -10.40500 1.000 37.26000  ? 132 ILE B O     1 
ATOM   5420 C  CB    . ILE B 2 132 ? -34.66900 -17.70100 -7.89500  1.000 29.96000  ? 132 ILE B CB    1 
ATOM   5421 C  CG1   . ILE B 2 132 ? -33.48300 -17.89400 -6.94900  1.000 34.58000  ? 132 ILE B CG1   1 
ATOM   5422 C  CG2   . ILE B 2 132 ? -35.80000 -18.65300 -7.50900  1.000 26.86000  ? 132 ILE B CG2   1 
ATOM   5423 C  CD1   . ILE B 2 132 ? -33.84600 -17.77600 -5.47800  1.000 37.92000  ? 132 ILE B CD1   1 
ATOM   5424 N  N     . PRO B 2 133 ? -35.83200 -18.87100 -10.95700 1.000 27.43000  ? 133 PRO B N     1 
ATOM   5425 C  CA    . PRO B 2 133 ? -36.97700 -18.90500 -11.88500 1.000 28.51000  ? 133 PRO B CA    1 
ATOM   5426 C  C     . PRO B 2 133 ? -38.30500 -18.81000 -11.17500 1.000 30.27000  ? 133 PRO B C     1 
ATOM   5427 O  O     . PRO B 2 133 ? -38.35000 -19.06100 -9.96900  1.000 32.52000  ? 133 PRO B O     1 
ATOM   5428 C  CB    . PRO B 2 133 ? -36.85800 -20.27700 -12.55600 1.000 29.33000  ? 133 PRO B CB    1 
ATOM   5429 C  CG    . PRO B 2 133 ? -36.11000 -21.13400 -11.55200 1.000 24.66000  ? 133 PRO B CG    1 
ATOM   5430 C  CD    . PRO B 2 133 ? -35.15500 -20.18100 -10.85800 1.000 30.71000  ? 133 PRO B CD    1 
ATOM   5431 N  N     . SER B 2 134 ? -39.37100 -18.47800 -11.90000 1.000 28.08000  ? 134 SER B N     1 
ATOM   5432 C  CA    . SER B 2 134 ? -40.70100 -18.52000 -11.30500 1.000 26.45000  ? 134 SER B CA    1 
ATOM   5433 C  C     . SER B 2 134 ? -41.58300 -19.52200 -12.03100 1.000 30.75000  ? 134 SER B C     1 
ATOM   5434 O  O     . SER B 2 134 ? -41.35700 -19.84500 -13.20400 1.000 31.40000  ? 134 SER B O     1 
ATOM   5435 C  CB    . SER B 2 134 ? -41.35300 -17.14600 -11.32200 1.000 30.61000  ? 134 SER B CB    1 
ATOM   5436 O  OG    . SER B 2 134 ? -41.48900 -16.67500 -12.64400 1.000 32.15000  ? 134 SER B OG    1 
ATOM   5437 N  N     . ILE B 2 135 ? -42.58500 -20.03900 -11.33900 1.000 24.73000  ? 135 ILE B N     1 
ATOM   5438 C  CA    . ILE B 2 135 ? -43.46600 -20.97600 -12.00100 1.000 25.19000  ? 135 ILE B CA    1 
ATOM   5439 C  C     . ILE B 2 135 ? -44.24100 -20.26800 -13.10600 1.000 25.77000  ? 135 ILE B C     1 
ATOM   5440 O  O     . ILE B 2 135 ? -44.86900 -19.24900 -12.85600 1.000 24.20000  ? 135 ILE B O     1 
ATOM   5441 C  CB    . ILE B 2 135 ? -44.44500 -21.62600 -11.01600 1.000 28.53000  ? 135 ILE B CB    1 
ATOM   5442 C  CG1   . ILE B 2 135 ? -43.72300 -22.66900 -10.17100 1.000 32.31000  ? 135 ILE B CG1   1 
ATOM   5443 C  CG2   . ILE B 2 135 ? -45.59000 -22.28800 -11.76200 1.000 30.34000  ? 135 ILE B CG2   1 
ATOM   5444 C  CD1   . ILE B 2 135 ? -43.44800 -22.20700 -8.76400  1.000 39.49000  ? 135 ILE B CD1   1 
ATOM   5445 N  N     . ASN B 2 136 ? -44.18800 -20.81400 -14.32200 1.000 27.22000  ? 136 ASN B N     1 
ATOM   5446 C  CA    . ASN B 2 136 ? -44.95800 -20.28600 -15.45500 1.000 23.90000  ? 136 ASN B CA    1 
ATOM   5447 C  C     . ASN B 2 136 ? -44.51300 -18.87200 -15.74200 1.000 25.08000  ? 136 ASN B C     1 
ATOM   5448 O  O     . ASN B 2 136 ? -45.30000 -18.04900 -16.23300 1.000 29.37000  ? 136 ASN B O     1 
ATOM   5449 C  CB    . ASN B 2 136 ? -46.47300 -20.33300 -15.17800 1.000 20.68000  ? 136 ASN B CB    1 
ATOM   5450 C  CG    . ASN B 2 136 ? -47.31300 -20.08900 -16.42500 1.000 22.47000  ? 136 ASN B CG    1 
ATOM   5451 O  OD1   . ASN B 2 136 ? -46.92000 -20.44200 -17.53700 1.000 23.28000  ? 136 ASN B OD1   1 
ATOM   5452 N  ND2   . ASN B 2 136 ? -48.46900 -19.45200 -16.24600 1.000 23.86000  ? 136 ASN B ND2   1 
ATOM   5453 N  N     . ASN B 2 137 ? -43.25700 -18.57700 -15.40700 1.000 23.87000  ? 137 ASN B N     1 
ATOM   5454 C  CA    . ASN B 2 137 ? -42.65500 -17.28500 -15.72700 1.000 23.37000  ? 137 ASN B CA    1 
ATOM   5455 C  C     . ASN B 2 137 ? -43.53400 -16.11400 -15.35000 1.000 24.49000  ? 137 ASN B C     1 
ATOM   5456 O  O     . ASN B 2 137 ? -43.70000 -15.17100 -16.10800 1.000 28.43000  ? 137 ASN B O     1 
ATOM   5457 C  CB    . ASN B 2 137 ? -42.31500 -17.22900 -17.20700 1.000 22.65000  ? 137 ASN B CB    1 
ATOM   5458 C  CG    . ASN B 2 137 ? -41.20300 -18.18100 -17.55700 1.000 26.87000  ? 137 ASN B CG    1 
ATOM   5459 O  OD1   . ASN B 2 137 ? -40.03500 -17.86600 -17.35500 1.000 28.21000  ? 137 ASN B OD1   1 
ATOM   5460 N  ND2   . ASN B 2 137 ? -41.55600 -19.37000 -18.04400 1.000 23.33000  ? 137 ASN B ND2   1 
ATOM   5461 N  N     . GLU B 2 138 ? -44.13000 -16.20600 -14.17300 1.000 26.85000  ? 138 GLU B N     1 
ATOM   5462 C  CA    . GLU B 2 138 ? -44.95600 -15.14800 -13.65300 1.000 22.35000  ? 138 GLU B CA    1 
ATOM   5463 C  C     . GLU B 2 138 ? -44.10700 -13.88600 -13.51400 1.000 25.96000  ? 138 GLU B C     1 
ATOM   5464 O  O     . GLU B 2 138 ? -44.60500 -12.78800 -13.69400 1.000 27.54000  ? 138 GLU B O     1 
ATOM   5465 C  CB    . GLU B 2 138 ? -45.56100 -15.58300 -12.32000 1.000 24.76000  ? 138 GLU B CB    1 
ATOM   5466 C  CG    . GLU B 2 138 ? -46.27900 -14.50600 -11.52400 1.000 26.51000  ? 138 GLU B CG    1 
ATOM   5467 C  CD    . GLU B 2 138 ? -46.55300 -14.93300 -10.08100 1.000 39.07000  ? 138 GLU B CD    1 
ATOM   5468 O  OE1   . GLU B 2 138 ? -46.43100 -14.07300 -9.17800  1.000 46.05000  ? 138 GLU B OE1   1 
ATOM   5469 O  OE2   . GLU B 2 138 ? -46.89600 -16.12300 -9.84600  1.000 39.30000  ? 138 GLU B OE2   1 
ATOM   5470 N  N     . THR B 2 139 ? -42.82100 -14.04400 -13.19400 1.000 28.73000  ? 139 THR B N     1 
ATOM   5471 C  CA    . THR B 2 139 ? -41.91600 -12.89900 -13.08900 1.000 25.62000  ? 139 THR B CA    1 
ATOM   5472 C  C     . THR B 2 139 ? -40.62000 -13.16900 -13.83600 1.000 28.70000  ? 139 THR B C     1 
ATOM   5473 O  O     . THR B 2 139 ? -40.28000 -14.32500 -14.11300 1.000 26.02000  ? 139 THR B O     1 
ATOM   5474 C  CB    . THR B 2 139 ? -41.53800 -12.54300 -11.60200 1.000 27.31000  ? 139 THR B CB    1 
ATOM   5475 O  OG1   . THR B 2 139 ? -40.49700 -13.40900 -11.13100 1.000 23.32000  ? 139 THR B OG1   1 
ATOM   5476 C  CG2   . THR B 2 139 ? -42.73600 -12.61200 -10.65400 1.000 22.12000  ? 139 THR B CG2   1 
ATOM   5477 N  N     . PRO B 2 140 ? -39.88000 -12.10100 -14.17200 1.000 29.93000  ? 140 PRO B N     1 
ATOM   5478 C  CA    . PRO B 2 140 ? -38.48300 -12.33700 -14.55400 1.000 29.58000  ? 140 PRO B CA    1 
ATOM   5479 C  C     . PRO B 2 140 ? -37.70900 -13.04400 -13.43400 1.000 27.84000  ? 140 PRO B C     1 
ATOM   5480 O  O     . PRO B 2 140 ? -38.15700 -13.01600 -12.27600 1.000 27.20000  ? 140 PRO B O     1 
ATOM   5481 C  CB    . PRO B 2 140 ? -37.92400 -10.92400 -14.79300 1.000 25.32000  ? 140 PRO B CB    1 
ATOM   5482 C  CG    . PRO B 2 140 ? -39.07100 -9.97000  -14.62500 1.000 26.57000  ? 140 PRO B CG    1 
ATOM   5483 C  CD    . PRO B 2 140 ? -40.34700 -10.76400 -14.56400 1.000 28.18000  ? 140 PRO B CD    1 
ATOM   5484 N  N     . GLY B 2 141 ? -36.58200 -13.67300 -13.76900 1.000 25.11000  ? 141 GLY B N     1 
ATOM   5485 C  CA    . GLY B 2 141 ? -35.72100 -14.27100 -12.75900 1.000 29.26000  ? 141 GLY B CA    1 
ATOM   5486 C  C     . GLY B 2 141 ? -35.23300 -13.28200 -11.70100 1.000 30.88000  ? 141 GLY B C     1 
ATOM   5487 O  O     . GLY B 2 141 ? -35.04100 -12.09800 -11.98500 1.000 33.84000  ? 141 GLY B O     1 
ATOM   5488 N  N     . ILE B 2 142 ? -35.03600 -13.77200 -10.47800 1.000 30.23000  ? 142 ILE B N     1 
ATOM   5489 C  CA    . ILE B 2 142 ? -34.46200 -12.98300 -9.38600  1.000 29.65000  ? 142 ILE B CA    1 
ATOM   5490 C  C     . ILE B 2 142 ? -32.97200 -13.32600 -9.20900  1.000 29.42000  ? 142 ILE B C     1 
ATOM   5491 O  O     . ILE B 2 142 ? -32.62700 -14.46600 -8.91900  1.000 29.33000  ? 142 ILE B O     1 
ATOM   5492 C  CB    . ILE B 2 142 ? -35.19700 -13.24100 -8.06200  1.000 32.54000  ? 142 ILE B CB    1 
ATOM   5493 C  CG1   . ILE B 2 142 ? -36.70900 -13.20800 -8.28300  1.000 29.75000  ? 142 ILE B CG1   1 
ATOM   5494 C  CG2   . ILE B 2 142 ? -34.78000 -12.22000 -7.02100  1.000 36.34000  ? 142 ILE B CG2   1 
ATOM   5495 C  CD1   . ILE B 2 142 ? -37.18000 -11.89000 -8.82200  1.000 26.88000  ? 142 ILE B CD1   1 
ATOM   5496 N  N     . ARG B 2 143 ? -32.08900 -12.34700 -9.38300  1.000 32.80000  ? 143 ARG B N     1 
ATOM   5497 C  CA    . ARG B 2 143 ? -30.65700 -12.63800 -9.39400  1.000 33.01000  ? 143 ARG B CA    1 
ATOM   5498 C  C     . ARG B 2 143 ? -29.93300 -12.26600 -8.09900  1.000 34.68000  ? 143 ARG B C     1 
ATOM   5499 O  O     . ARG B 2 143 ? -30.16700 -11.20400 -7.52400  1.000 33.18000  ? 143 ARG B O     1 
ATOM   5500 C  CB    . ARG B 2 143 ? -30.00100 -11.92900 -10.57500 1.000 33.39000  ? 143 ARG B CB    1 
ATOM   5501 C  CG    . ARG B 2 143 ? -30.28200 -12.62000 -11.88500 1.000 29.48000  ? 143 ARG B CG    1 
ATOM   5502 C  CD    . ARG B 2 143 ? -29.87800 -11.75900 -13.05600 1.000 31.19000  ? 143 ARG B CD    1 
ATOM   5503 N  NE    . ARG B 2 143 ? -28.44500 -11.50100 -13.11100 1.000 31.99000  ? 143 ARG B NE    1 
ATOM   5504 C  CZ    . ARG B 2 143 ? -27.52100 -12.44200 -13.25300 1.000 28.24000  ? 143 ARG B CZ    1 
ATOM   5505 N  NH1   . ARG B 2 143 ? -27.86600 -13.71500 -13.32000 1.000 27.56000  ? 143 ARG B NH1   1 
ATOM   5506 N  NH2   . ARG B 2 143 ? -26.24500 -12.10500 -13.31800 1.000 31.50000  ? 143 ARG B NH2   1 
ATOM   5507 N  N     . TYR B 2 144 ? -29.05000 -13.16200 -7.65900  1.000 32.09000  ? 144 TYR B N     1 
ATOM   5508 C  CA    . TYR B 2 144 ? -28.27000 -12.97700 -6.44600  1.000 30.55000  ? 144 TYR B CA    1 
ATOM   5509 C  C     . TYR B 2 144 ? -26.81000 -13.14700 -6.75600  1.000 33.78000  ? 144 TYR B C     1 
ATOM   5510 O  O     . TYR B 2 144 ? -26.45700 -13.70800 -7.78800  1.000 32.33000  ? 144 TYR B O     1 
ATOM   5511 C  CB    . TYR B 2 144 ? -28.67200 -13.98100 -5.36200  1.000 28.25000  ? 144 TYR B CB    1 
ATOM   5512 C  CG    . TYR B 2 144 ? -30.04900 -13.74900 -4.77800  1.000 36.06000  ? 144 TYR B CG    1 
ATOM   5513 C  CD1   . TYR B 2 144 ? -31.17700 -14.34700 -5.33400  1.000 34.18000  ? 144 TYR B CD1   1 
ATOM   5514 C  CD2   . TYR B 2 144 ? -30.22600 -12.92000 -3.67200  1.000 41.82000  ? 144 TYR B CD2   1 
ATOM   5515 C  CE1   . TYR B 2 144 ? -32.44200 -14.13400 -4.79700  1.000 37.85000  ? 144 TYR B CE1   1 
ATOM   5516 C  CE2   . TYR B 2 144 ? -31.48100 -12.69700 -3.13300  1.000 41.24000  ? 144 TYR B CE2   1 
ATOM   5517 C  CZ    . TYR B 2 144 ? -32.58700 -13.30700 -3.69100  1.000 43.71000  ? 144 TYR B CZ    1 
ATOM   5518 O  OH    . TYR B 2 144 ? -33.83300 -13.07800 -3.13200  1.000 45.31000  ? 144 TYR B OH    1 
ATOM   5519 N  N     . GLN B 2 145 ? -25.96200 -12.64900 -5.86300  1.000 36.43000  ? 145 GLN B N     1 
ATOM   5520 C  CA    . GLN B 2 145 ? -24.55400 -13.02400 -5.85700  1.000 35.30000  ? 145 GLN B CA    1 
ATOM   5521 C  C     . GLN B 2 145 ? -24.10700 -13.20800 -4.40800  1.000 37.47000  ? 145 GLN B C     1 
ATOM   5522 O  O     . GLN B 2 145 ? -24.77400 -12.74600 -3.47500  1.000 36.24000  ? 145 GLN B O     1 
ATOM   5523 C  CB    . GLN B 2 145 ? -23.70000 -11.99000 -6.56600  1.000 31.40000  ? 145 GLN B CB    1 
ATOM   5524 C  CG    . GLN B 2 145 ? -23.33900 -10.82900 -5.69100  1.000 40.99000  ? 145 GLN B CG    1 
ATOM   5525 C  CD    . GLN B 2 145 ? -22.55500 -9.78200  -6.43200  1.000 38.35000  ? 145 GLN B CD    1 
ATOM   5526 O  OE1   . GLN B 2 145 ? -22.52800 -9.75700  -7.67400  1.000 36.49000  ? 145 GLN B OE1   1 
ATOM   5527 N  NE2   . GLN B 2 145 ? -21.91000 -8.89700  -5.67700  1.000 40.47000  ? 145 GLN B NE2   1 
ATOM   5528 N  N     . TYR B 2 146 ? -22.99500 -13.91000 -4.22300  1.000 40.27000  ? 146 TYR B N     1 
ATOM   5529 C  CA    . TYR B 2 146 ? -22.51000 -14.24500 -2.88900  1.000 40.77000  ? 146 TYR B CA    1 
ATOM   5530 C  C     . TYR B 2 146 ? -21.65400 -13.14600 -2.26500  1.000 43.98000  ? 146 TYR B C     1 
ATOM   5531 O  O     . TYR B 2 146 ? -20.96000 -12.40900 -2.96200  1.000 42.77000  ? 146 TYR B O     1 
ATOM   5532 C  CB    . TYR B 2 146 ? -21.71500 -15.53800 -2.94000  1.000 34.92000  ? 146 TYR B CB    1 
ATOM   5533 C  CG    . TYR B 2 146 ? -22.58900 -16.74600 -2.76700  1.000 39.69000  ? 146 TYR B CG    1 
ATOM   5534 C  CD1   . TYR B 2 146 ? -23.18600 -17.35700 -3.85600  1.000 35.56000  ? 146 TYR B CD1   1 
ATOM   5535 C  CD2   . TYR B 2 146 ? -22.83700 -17.26500 -1.50700  1.000 44.41000  ? 146 TYR B CD2   1 
ATOM   5536 C  CE1   . TYR B 2 146 ? -23.99900 -18.45100 -3.69300  1.000 31.40000  ? 146 TYR B CE1   1 
ATOM   5537 C  CE2   . TYR B 2 146 ? -23.64300 -18.35500 -1.33500  1.000 42.74000  ? 146 TYR B CE2   1 
ATOM   5538 C  CZ    . TYR B 2 146 ? -24.22200 -18.94300 -2.43200  1.000 40.12000  ? 146 TYR B CZ    1 
ATOM   5539 O  OH    . TYR B 2 146 ? -25.02900 -20.03700 -2.26000  1.000 43.38000  ? 146 TYR B OH    1 
ATOM   5540 N  N     . ASN B 2 147 ? -21.72300 -13.03600 -0.94400  1.000 43.06000  ? 147 ASN B N     1 
ATOM   5541 C  CA    . ASN B 2 147 ? -20.87500 -12.10700 -0.20500  1.000 45.92000  ? 147 ASN B CA    1 
ATOM   5542 C  C     . ASN B 2 147 ? -19.89900 -12.87200 0.68700   1.000 49.41000  ? 147 ASN B C     1 
ATOM   5543 O  O     . ASN B 2 147 ? -18.97500 -12.29100 1.27200   1.000 47.99000  ? 147 ASN B O     1 
ATOM   5544 C  CB    . ASN B 2 147 ? -21.72200 -11.15700 0.64600   1.000 43.95000  ? 147 ASN B CB    1 
ATOM   5545 C  CG    . ASN B 2 147 ? -22.59900 -10.25000 -0.18400  1.000 41.23000  ? 147 ASN B CG    1 
ATOM   5546 O  OD1   . ASN B 2 147 ? -22.19000 -9.72400  -1.23800  1.000 41.98000  ? 147 ASN B OD1   1 
ATOM   5547 N  ND2   . ASN B 2 147 ? -23.82200 -10.05200 0.28800   1.000 35.35000  ? 147 ASN B ND2   1 
ATOM   5548 N  N     . VAL B 2 148 ? -20.13300 -14.17800 0.79300   1.000 43.52000  ? 148 VAL B N     1 
ATOM   5549 C  CA    . VAL B 2 148 ? -19.33500 -15.05600 1.62400   1.000 43.75000  ? 148 VAL B CA    1 
ATOM   5550 C  C     . VAL B 2 148 ? -18.95500 -16.29300 0.82800   1.000 49.36000  ? 148 VAL B C     1 
ATOM   5551 O  O     . VAL B 2 148 ? -19.38000 -16.43500 -0.32100  1.000 54.36000  ? 148 VAL B O     1 
ATOM   5552 C  CB    . VAL B 2 148 ? -20.09000 -15.47600 2.87400   1.000 44.42000  ? 148 VAL B CB    1 
ATOM   5553 C  CG1   . VAL B 2 148 ? -20.55300 -14.24000 3.64600   1.000 40.54000  ? 148 VAL B CG1   1 
ATOM   5554 C  CG2   . VAL B 2 148 ? -21.25500 -16.34700 2.48900   1.000 40.70000  ? 148 VAL B CG2   1 
ATOM   5555 N  N     . LEU B 2 149 ? -18.15900 -17.18400 1.42400   1.000 47.20000  ? 149 LEU B N     1 
ATOM   5556 C  CA    . LEU B 2 149 ? -17.66500 -18.35100 0.69800   1.000 43.32000  ? 149 LEU B CA    1 
ATOM   5557 C  C     . LEU B 2 149 ? -18.84100 -19.22500 0.36100   1.000 41.28000  ? 149 LEU B C     1 
ATOM   5558 O  O     . LEU B 2 149 ? -19.53300 -19.70300 1.25400   1.000 44.96000  ? 149 LEU B O     1 
ATOM   5559 C  CB    . LEU B 2 149 ? -16.64400 -19.14700 1.50800   1.000 44.89000  ? 149 LEU B CB    1 
ATOM   5560 C  CG    . LEU B 2 149 ? -15.32600 -18.48700 1.90500   1.000 42.81000  ? 149 LEU B CG    1 
ATOM   5561 C  CD1   . LEU B 2 149 ? -14.51400 -19.47400 2.72200   1.000 41.68000  ? 149 LEU B CD1   1 
ATOM   5562 C  CD2   . LEU B 2 149 ? -14.55900 -18.00100 0.68500   1.000 36.44000  ? 149 LEU B CD2   1 
ATOM   5563 N  N     . PRO B 2 150 ? -19.08200 -19.42800 -0.93400  1.000 41.89000  ? 150 PRO B N     1 
ATOM   5564 C  CA    . PRO B 2 150 ? -20.25100 -20.22100 -1.33600  1.000 39.97000  ? 150 PRO B CA    1 
ATOM   5565 C  C     . PRO B 2 150 ? -20.01700 -21.72900 -1.19400  1.000 35.69000  ? 150 PRO B C     1 
ATOM   5566 O  O     . PRO B 2 150 ? -18.94800 -22.22300 -1.51700  1.000 38.99000  ? 150 PRO B O     1 
ATOM   5567 C  CB    . PRO B 2 150 ? -20.47100 -19.81100 -2.80000  1.000 41.32000  ? 150 PRO B CB    1 
ATOM   5568 C  CG    . PRO B 2 150 ? -19.17100 -19.09100 -3.24900  1.000 41.59000  ? 150 PRO B CG    1 
ATOM   5569 C  CD    . PRO B 2 150 ? -18.25000 -18.98800 -2.07100  1.000 39.70000  ? 150 PRO B CD    1 
ATOM   5570 N  N     . GLN B 2 151 ? -21.00100 -22.44100 -0.65800  1.000 40.43000  ? 151 GLN B N     1 
ATOM   5571 C  CA    . GLN B 2 151 ? -20.99100 -23.89900 -0.66600  1.000 41.02000  ? 151 GLN B CA    1 
ATOM   5572 C  C     . GLN B 2 151 ? -20.90000 -24.39900 -2.11000  1.000 39.63000  ? 151 GLN B C     1 
ATOM   5573 O  O     . GLN B 2 151 ? -21.61600 -23.90200 -2.99300  1.000 35.81000  ? 151 GLN B O     1 
ATOM   5574 C  CB    . GLN B 2 151 ? -22.24600 -24.45900 0.01200   1.000 35.37000  ? 151 GLN B CB    1 
ATOM   5575 C  CG    . GLN B 2 151 ? -22.54900 -23.81200 1.34400   1.000 47.62000  ? 151 GLN B CG    1 
ATOM   5576 C  CD    . GLN B 2 151 ? -23.71800 -24.45200 2.06800   1.000 51.91000  ? 151 GLN B CD    1 
ATOM   5577 O  OE1   . GLN B 2 151 ? -23.54500 -25.41300 2.81100   1.000 55.10000  ? 151 GLN B OE1   1 
ATOM   5578 N  NE2   . GLN B 2 151 ? -24.91400 -23.91700 1.85800   1.000 53.12000  ? 151 GLN B NE2   1 
ATOM   5579 N  N     . GLY B 2 152 ? -20.01200 -25.36600 -2.34600  1.000 34.25000  ? 152 GLY B N     1 
ATOM   5580 C  CA    . GLY B 2 152 ? -19.81600 -25.93900 -3.67000  1.000 31.24000  ? 152 GLY B CA    1 
ATOM   5581 C  C     . GLY B 2 152 ? -18.77900 -25.26300 -4.55900  1.000 31.67000  ? 152 GLY B C     1 
ATOM   5582 O  O     . GLY B 2 152 ? -18.50400 -25.75400 -5.64900  1.000 36.90000  ? 152 GLY B O     1 
ATOM   5583 N  N     . TRP B 2 153 ? -18.20900 -24.14200 -4.11900  1.000 30.31000  ? 153 TRP B N     1 
ATOM   5584 C  CA    . TRP B 2 153 ? -17.09400 -23.51900 -4.84400  1.000 35.32000  ? 153 TRP B CA    1 
ATOM   5585 C  C     . TRP B 2 153 ? -15.78600 -24.11500 -4.36400  1.000 40.77000  ? 153 TRP B C     1 
ATOM   5586 O  O     . TRP B 2 153 ? -15.63300 -24.37500 -3.17200  1.000 40.72000  ? 153 TRP B O     1 
ATOM   5587 C  CB    . TRP B 2 153 ? -17.07800 -22.01100 -4.64300  1.000 36.20000  ? 153 TRP B CB    1 
ATOM   5588 C  CG    . TRP B 2 153 ? -15.94400 -21.30400 -5.31700  1.000 39.98000  ? 153 TRP B CG    1 
ATOM   5589 C  CD1   . TRP B 2 153 ? -15.57200 -21.41700 -6.62300  1.000 37.34000  ? 153 TRP B CD1   1 
ATOM   5590 C  CD2   . TRP B 2 153 ? -15.06300 -20.32900 -4.72700  1.000 39.89000  ? 153 TRP B CD2   1 
ATOM   5591 N  NE1   . TRP B 2 153 ? -14.50700 -20.57900 -6.88400  1.000 40.64000  ? 153 TRP B NE1   1 
ATOM   5592 C  CE2   . TRP B 2 153 ? -14.17400 -19.90400 -5.73900  1.000 40.72000  ? 153 TRP B CE2   1 
ATOM   5593 C  CE3   . TRP B 2 153 ? -14.94400 -19.77500 -3.44300  1.000 35.98000  ? 153 TRP B CE3   1 
ATOM   5594 C  CZ2   . TRP B 2 153 ? -13.17000 -18.95600 -5.50800  1.000 40.66000  ? 153 TRP B CZ2   1 
ATOM   5595 C  CZ3   . TRP B 2 153 ? -13.94800 -18.84100 -3.21500  1.000 40.87000  ? 153 TRP B CZ3   1 
ATOM   5596 C  CH2   . TRP B 2 153 ? -13.07300 -18.43600 -4.24600  1.000 39.03000  ? 153 TRP B CH2   1 
ATOM   5597 N  N     . LYS B 2 154 ? -14.84300 -24.33000 -5.28000  1.000 40.74000  ? 154 LYS B N     1 
ATOM   5598 C  CA    . LYS B 2 154 ? -13.60700 -25.02800 -4.92700  1.000 45.92000  ? 154 LYS B CA    1 
ATOM   5599 C  C     . LYS B 2 154 ? -12.69500 -24.10500 -4.10000  1.000 49.42000  ? 154 LYS B C     1 
ATOM   5600 O  O     . LYS B 2 154 ? -11.84000 -24.56400 -3.34400  1.000 53.89000  ? 154 LYS B O     1 
ATOM   5601 C  CB    . LYS B 2 154 ? -12.88600 -25.53800 -6.18700  1.000 47.99000  ? 154 LYS B CB    1 
ATOM   5602 C  CG    . LYS B 2 154 ? -11.70600 -24.68100 -6.67300  1.000 44.12000  ? 154 LYS B CG    1 
ATOM   5603 C  CD    . LYS B 2 154 ? -10.98200 -25.33700 -7.85000  1.000 38.51000  ? 154 LYS B CD    1 
ATOM   5604 C  CE    . LYS B 2 154 ? -9.85400  -24.45400 -8.38100  1.000 50.36000  ? 154 LYS B CE    1 
ATOM   5605 N  NZ    . LYS B 2 154 ? -9.46400  -24.73900 -9.80200  1.000 51.77000  ? 154 LYS B NZ    1 
ATOM   5606 N  N     . GLY B 2 155 ? -12.89400 -22.80300 -4.23000  1.000 42.59000  ? 155 GLY B N     1 
ATOM   5607 C  CA    . GLY B 2 155 ? -12.14100 -21.86000 -3.43500  1.000 43.36000  ? 155 GLY B CA    1 
ATOM   5608 C  C     . GLY B 2 155 ? -12.51200 -21.92700 -1.97000  1.000 43.40000  ? 155 GLY B C     1 
ATOM   5609 O  O     . GLY B 2 155 ? -11.69300 -21.62800 -1.11100  1.000 48.59000  ? 155 GLY B O     1 
ATOM   5610 N  N     . SER B 2 156 ? -13.74100 -22.33300 -1.68100  1.000 40.61000  ? 156 SER B N     1 
ATOM   5611 C  CA    . SER B 2 156 ? -14.24300 -22.31300 -0.30900  1.000 41.84000  ? 156 SER B CA    1 
ATOM   5612 C  C     . SER B 2 156 ? -13.46500 -23.19900 0.67400   1.000 48.76000  ? 156 SER B C     1 
ATOM   5613 O  O     . SER B 2 156 ? -13.07600 -22.71800 1.73700   1.000 51.54000  ? 156 SER B O     1 
ATOM   5614 C  CB    . SER B 2 156 ? -15.72000 -22.70600 -0.27700  1.000 43.60000  ? 156 SER B CB    1 
ATOM   5615 O  OG    . SER B 2 156 ? -16.52900 -21.69800 -0.85000  1.000 48.52000  ? 156 SER B OG    1 
ATOM   5616 N  N     . PRO B 2 157 ? -13.24300 -24.49000 0.34800   1.000 49.21000  ? 157 PRO B N     1 
ATOM   5617 C  CA    . PRO B 2 157 ? -12.44400 -25.25600 1.31200   1.000 52.38000  ? 157 PRO B CA    1 
ATOM   5618 C  C     . PRO B 2 157 ? -10.98900 -24.75800 1.40100   1.000 52.49000  ? 157 PRO B C     1 
ATOM   5619 O  O     . PRO B 2 157 ? -10.38300 -24.86600 2.46900   1.000 57.20000  ? 157 PRO B O     1 
ATOM   5620 C  CB    . PRO B 2 157 ? -12.50800 -26.68400 0.75800   1.000 47.73000  ? 157 PRO B CB    1 
ATOM   5621 C  CG    . PRO B 2 157 ? -12.67600 -26.49300 -0.70100  1.000 43.53000  ? 157 PRO B CG    1 
ATOM   5622 C  CD    . PRO B 2 157 ? -13.57600 -25.30300 -0.83700  1.000 44.16000  ? 157 PRO B CD    1 
ATOM   5623 N  N     . ALA B 2 158 ? -10.45400 -24.21200 0.30800   1.000 46.37000  ? 158 ALA B N     1 
ATOM   5624 C  CA    . ALA B 2 158 ? -9.09500  -23.69200 0.29100   1.000 41.56000  ? 158 ALA B CA    1 
ATOM   5625 C  C     . ALA B 2 158 ? -8.94100  -22.50200 1.22700   1.000 46.21000  ? 158 ALA B C     1 
ATOM   5626 O  O     . ALA B 2 158 ? -8.15200  -22.55600 2.15100   1.000 52.06000  ? 158 ALA B O     1 
ATOM   5627 C  CB    . ALA B 2 158 ? -8.70200  -23.30900 -1.11000  1.000 42.43000  ? 158 ALA B CB    1 
ATOM   5628 N  N     . ILE B 2 159 ? -9.68700  -21.42800 0.98300   1.000 46.79000  ? 159 ILE B N     1 
ATOM   5629 C  CA    . ILE B 2 159 ? -9.65000  -20.24400 1.84800   1.000 46.68000  ? 159 ILE B CA    1 
ATOM   5630 C  C     . ILE B 2 159 ? -9.89700  -20.59000 3.32900   1.000 48.38000  ? 159 ILE B C     1 
ATOM   5631 O  O     . ILE B 2 159 ? -9.31500  -19.98800 4.23100   1.000 55.91000  ? 159 ILE B O     1 
ATOM   5632 C  CB    . ILE B 2 159 ? -10.71000 -19.16900 1.41000   1.000 52.30000  ? 159 ILE B CB    1 
ATOM   5633 C  CG1   . ILE B 2 159 ? -10.59700 -18.82200 -0.08200  1.000 43.72000  ? 159 ILE B CG1   1 
ATOM   5634 C  CG2   . ILE B 2 159 ? -10.63300 -17.90300 2.28100   1.000 43.82000  ? 159 ILE B CG2   1 
ATOM   5635 C  CD1   . ILE B 2 159 ? -9.24400  -18.40200 -0.52400  1.000 41.17000  ? 159 ILE B CD1   1 
ATOM   5636 N  N     . PHE B 2 160 ? -10.75100 -21.56800 3.58500   1.000 46.53000  ? 160 PHE B N     1 
ATOM   5637 C  CA    . PHE B 2 160 ? -11.18100 -21.84900 4.96000   1.000 49.56000  ? 160 PHE B CA    1 
ATOM   5638 C  C     . PHE B 2 160 ? -10.34000 -22.92900 5.63600   1.000 51.20000  ? 160 PHE B C     1 
ATOM   5639 O  O     . PHE B 2 160 ? -10.55500 -23.24500 6.80300   1.000 50.32000  ? 160 PHE B O     1 
ATOM   5640 C  CB    . PHE B 2 160 ? -12.65000 -22.25900 4.94700   1.000 43.31000  ? 160 PHE B CB    1 
ATOM   5641 C  CG    . PHE B 2 160 ? -13.27000 -22.41800 6.29800   1.000 39.45000  ? 160 PHE B CG    1 
ATOM   5642 C  CD1   . PHE B 2 160 ? -13.79600 -21.33000 6.96100   1.000 45.96000  ? 160 PHE B CD1   1 
ATOM   5643 C  CD2   . PHE B 2 160 ? -13.40600 -23.67400 6.87000   1.000 47.69000  ? 160 PHE B CD2   1 
ATOM   5644 C  CE1   . PHE B 2 160 ? -14.41400 -21.48700 8.19000   1.000 50.71000  ? 160 PHE B CE1   1 
ATOM   5645 C  CE2   . PHE B 2 160 ? -14.00800 -23.83600 8.10500   1.000 43.04000  ? 160 PHE B CE2   1 
ATOM   5646 C  CZ    . PHE B 2 160 ? -14.51700 -22.74600 8.76300   1.000 44.36000  ? 160 PHE B CZ    1 
ATOM   5647 N  N     . GLN B 2 161 ? -9.37000  -23.47300 4.90600   1.000 50.84000  ? 161 GLN B N     1 
ATOM   5648 C  CA    . GLN B 2 161 ? -8.56900  -24.59300 5.40100   1.000 55.19000  ? 161 GLN B CA    1 
ATOM   5649 C  C     . GLN B 2 161 ? -7.86100  -24.29100 6.71300   1.000 56.35000  ? 161 GLN B C     1 
ATOM   5650 O  O     . GLN B 2 161 ? -7.86000  -25.12400 7.62500   1.000 56.59000  ? 161 GLN B O     1 
ATOM   5651 C  CB    . GLN B 2 161 ? -7.52800  -25.02100 4.36500   1.000 47.79000  ? 161 GLN B CB    1 
ATOM   5652 C  CG    . GLN B 2 161 ? -6.76600  -26.27600 4.75900   1.000 54.87000  ? 161 GLN B CG    1 
ATOM   5653 C  CD    . GLN B 2 161 ? -5.63000  -26.56000 3.81000   1.000 69.49000  ? 161 GLN B CD    1 
ATOM   5654 O  OE1   . GLN B 2 161 ? -5.72500  -26.28200 2.61600   1.000 73.70000  ? 161 GLN B OE1   1 
ATOM   5655 N  NE2   . GLN B 2 161 ? -4.53700  -27.09700 4.33500   1.000 78.21000  ? 161 GLN B NE2   1 
ATOM   5656 N  N     . SER B 2 162 ? -7.25900  -23.10500 6.79900   1.000 56.38000  ? 162 SER B N     1 
ATOM   5657 C  CA    . SER B 2 162 ? -6.48000  -22.71600 7.97600   1.000 57.49000  ? 162 SER B CA    1 
ATOM   5658 C  C     . SER B 2 162 ? -7.37500  -22.70900 9.21500   1.000 56.71000  ? 162 SER B C     1 
ATOM   5659 O  O     . SER B 2 162 ? -7.05000  -23.31500 10.24500  1.000 59.09000  ? 162 SER B O     1 
ATOM   5660 C  CB    . SER B 2 162 ? -5.82700  -21.35000 7.76400   1.000 45.54000  ? 162 SER B CB    1 
ATOM   5661 O  OG    . SER B 2 162 ? -6.81000  -20.36700 7.46700   1.000 65.25000  ? 162 SER B OG    1 
ATOM   5662 N  N     . SER B 2 163 ? -8.51800  -22.04500 9.09800   1.000 52.06000  ? 163 SER B N     1 
ATOM   5663 C  CA    . SER B 2 163 ? -9.52900  -22.08600 10.14700  1.000 55.06000  ? 163 SER B CA    1 
ATOM   5664 C  C     . SER B 2 163 ? -10.03300 -23.50900 10.40900  1.000 56.20000  ? 163 SER B C     1 
ATOM   5665 O  O     . SER B 2 163 ? -10.36100 -23.84200 11.53600  1.000 56.27000  ? 163 SER B O     1 
ATOM   5666 C  CB    . SER B 2 163 ? -10.70700 -21.17800 9.79200   1.000 52.93000  ? 163 SER B CB    1 
ATOM   5667 O  OG    . SER B 2 163 ? -10.25600 -19.87900 9.44200   1.000 58.81000  ? 163 SER B OG    1 
ATOM   5668 N  N     . MET B 2 164 ? -10.09200 -24.35400 9.38200   1.000 58.30000  ? 164 MET B N     1 
ATOM   5669 C  CA    . MET B 2 164 ? -10.54500 -25.73700 9.58400   1.000 60.87000  ? 164 MET B CA    1 
ATOM   5670 C  C     . MET B 2 164 ? -9.55300  -26.55900 10.39800  1.000 62.45000  ? 164 MET B C     1 
ATOM   5671 O  O     . MET B 2 164 ? -9.96200  -27.33200 11.26600  1.000 60.11000  ? 164 MET B O     1 
ATOM   5672 C  CB    . MET B 2 164 ? -10.81000 -26.44300 8.24800   1.000 54.05000  ? 164 MET B CB    1 
ATOM   5673 C  CG    . MET B 2 164 ? -12.28600 -26.71700 7.97800   1.000 59.28000  ? 164 MET B CG    1 
ATOM   5674 S  SD    . MET B 2 164 ? -12.99400 -27.90900 9.13200   1.000 54.93000  ? 164 MET B SD    1 
ATOM   5675 C  CE    . MET B 2 164 ? -11.79700 -29.18000 8.79800   1.000 64.75000  ? 164 MET B CE    1 
ATOM   5676 N  N     . THR B 2 165 ? -8.26000  -26.39700 10.11400  1.000 61.30000  ? 165 THR B N     1 
ATOM   5677 C  CA    . THR B 2 165 ? -7.23300  -27.14800 10.82500  1.000 60.98000  ? 165 THR B CA    1 
ATOM   5678 C  C     . THR B 2 165 ? -7.29400  -26.82500 12.30700  1.000 66.11000  ? 165 THR B C     1 
ATOM   5679 O  O     . THR B 2 165 ? -7.16200  -27.71200 13.16100  1.000 66.75000  ? 165 THR B O     1 
ATOM   5680 C  CB    . THR B 2 165 ? -5.81600  -26.84100 10.32300  1.000 60.22000  ? 165 THR B CB    1 
ATOM   5681 O  OG1   . THR B 2 165 ? -5.76600  -26.92300 8.89300   1.000 58.54000  ? 165 THR B OG1   1 
ATOM   5682 C  CG2   . THR B 2 165 ? -4.85000  -27.85000 10.91400  1.000 67.07000  ? 165 THR B CG2   1 
ATOM   5683 N  N     . LYS B 2 166 ? -7.51700  -25.54500 12.60100  1.000 68.47000  ? 166 LYS B N     1 
ATOM   5684 C  CA    . LYS B 2 166 ? -7.54100  -25.06600 13.97500  1.000 65.97000  ? 166 LYS B CA    1 
ATOM   5685 C  C     . LYS B 2 166 ? -8.74600  -25.58600 14.75400  1.000 70.23000  ? 166 LYS B C     1 
ATOM   5686 O  O     . LYS B 2 166 ? -8.66700  -25.74500 15.97100  1.000 72.30000  ? 166 LYS B O     1 
ATOM   5687 C  CB    . LYS B 2 166 ? -7.49700  -23.53600 14.00200  1.000 60.61000  ? 166 LYS B CB    1 
ATOM   5688 C  CG    . LYS B 2 166 ? -6.07300  -22.97600 14.02600  1.000 73.86000  ? 166 LYS B CG    1 
ATOM   5689 C  CD    . LYS B 2 166 ? -5.99200  -21.54400 13.48100  1.000 73.89000  ? 166 LYS B CD    1 
ATOM   5690 C  CE    . LYS B 2 166 ? -5.18500  -20.63300 14.41200  1.000 84.15000  ? 166 LYS B CE    1 
ATOM   5691 N  NZ    . LYS B 2 166 ? -4.76700  -19.35100 13.76900  1.000 79.77000  ? 166 LYS B NZ    1 
ATOM   5692 N  N     . ILE B 2 167 ? -9.85200  -25.87500 14.07100  1.000 69.93000  ? 167 ILE B N     1 
ATOM   5693 C  CA    . ILE B 2 167 ? -11.01500 -26.40700 14.78000  1.000 71.45000  ? 167 ILE B CA    1 
ATOM   5694 C  C     . ILE B 2 167 ? -10.86700 -27.90100 15.06100  1.000 69.57000  ? 167 ILE B C     1 
ATOM   5695 O  O     . ILE B 2 167 ? -11.24400 -28.38000 16.13000  1.000 70.47000  ? 167 ILE B O     1 
ATOM   5696 C  CB    . ILE B 2 167 ? -12.32700 -26.16200 14.01200  1.000 75.06000  ? 167 ILE B CB    1 
ATOM   5697 C  CG1   . ILE B 2 167 ? -12.33800 -24.74200 13.45700  1.000 73.14000  ? 167 ILE B CG1   1 
ATOM   5698 C  CG2   . ILE B 2 167 ? -13.52900 -26.36100 14.93000  1.000 75.25000  ? 167 ILE B CG2   1 
ATOM   5699 C  CD1   . ILE B 2 167 ? -13.64600 -24.31100 12.87700  1.000 65.14000  ? 167 ILE B CD1   1 
ATOM   5700 N  N     . LEU B 2 168 ? -10.30400 -28.64000 14.11800  1.000 66.35000  ? 168 LEU B N     1 
ATOM   5701 C  CA    . LEU B 2 168 ? -10.17300 -30.07400 14.31600  1.000 69.57000  ? 168 LEU B CA    1 
ATOM   5702 C  C     . LEU B 2 168 ? -9.01100  -30.40900 15.23800  1.000 69.69000  ? 168 LEU B C     1 
ATOM   5703 O  O     . LEU B 2 168 ? -9.04400  -31.43200 15.91600  1.000 66.42000  ? 168 LEU B O     1 
ATOM   5704 C  CB    . LEU B 2 168 ? -10.00600 -30.78900 12.97400  1.000 69.02000  ? 168 LEU B CB    1 
ATOM   5705 C  CG    . LEU B 2 168 ? -11.18000 -30.64700 12.00500  1.000 58.76000  ? 168 LEU B CG    1 
ATOM   5706 C  CD1   . LEU B 2 168 ? -11.03300 -31.68300 10.91400  1.000 58.49000  ? 168 LEU B CD1   1 
ATOM   5707 C  CD2   . LEU B 2 168 ? -12.51400 -30.79100 12.72600  1.000 49.98000  ? 168 LEU B CD2   1 
ATOM   5708 N  N     . GLU B 2 169 ? -8.00700  -29.53300 15.27100  1.000 73.53000  ? 169 GLU B N     1 
ATOM   5709 C  CA    . GLU B 2 169 ? -6.74700  -29.79000 15.98100  1.000 74.96000  ? 169 GLU B CA    1 
ATOM   5710 C  C     . GLU B 2 169 ? -6.89600  -30.49400 17.35800  1.000 73.92000  ? 169 GLU B C     1 
ATOM   5711 O  O     . GLU B 2 169 ? -6.29100  -31.55300 17.55900  1.000 71.28000  ? 169 GLU B O     1 
ATOM   5712 C  CB    . GLU B 2 169 ? -5.96100  -28.47400 16.12100  1.000 73.68000  ? 169 GLU B CB    1 
ATOM   5713 C  CG    . GLU B 2 169 ? -4.51700  -28.63400 16.58500  1.000 80.64000  ? 169 GLU B CG    1 
ATOM   5714 C  CD    . GLU B 2 169 ? -4.40900  -28.80000 18.09300  1.000 88.20000  ? 169 GLU B CD    1 
ATOM   5715 O  OE1   . GLU B 2 169 ? -3.47100  -29.48900 18.55700  1.000 91.55000  ? 169 GLU B OE1   1 
ATOM   5716 O  OE2   . GLU B 2 169 ? -5.27100  -28.24500 18.81200  1.000 82.86000  ? 169 GLU B OE2   1 
ATOM   5717 N  N     . PRO B 2 170 ? -7.70500  -29.93700 18.29500  1.000 73.63000  ? 170 PRO B N     1 
ATOM   5718 C  CA    . PRO B 2 170 ? -7.87000  -30.62200 19.58900  1.000 72.14000  ? 170 PRO B CA    1 
ATOM   5719 C  C     . PRO B 2 170 ? -8.46500  -32.02800 19.47300  1.000 75.61000  ? 170 PRO B C     1 
ATOM   5720 O  O     . PRO B 2 170 ? -8.01300  -32.95200 20.16100  1.000 72.24000  ? 170 PRO B O     1 
ATOM   5721 C  CB    . PRO B 2 170 ? -8.84200  -29.71100 20.35300  1.000 71.53000  ? 170 PRO B CB    1 
ATOM   5722 C  CG    . PRO B 2 170 ? -8.72200  -28.39700 19.70900  1.000 76.25000  ? 170 PRO B CG    1 
ATOM   5723 C  CD    . PRO B 2 170 ? -8.49000  -28.68900 18.25800  1.000 78.13000  ? 170 PRO B CD    1 
ATOM   5724 N  N     . PHE B 2 171 ? -9.48100  -32.16800 18.62200  1.000 76.37000  ? 171 PHE B N     1 
ATOM   5725 C  CA    . PHE B 2 171 ? -10.15900 -33.44500 18.41100  1.000 67.98000  ? 171 PHE B CA    1 
ATOM   5726 C  C     . PHE B 2 171 ? -9.21200  -34.48300 17.83000  1.000 62.84000  ? 171 PHE B C     1 
ATOM   5727 O  O     . PHE B 2 171 ? -9.17900  -35.62900 18.27700  1.000 65.28000  ? 171 PHE B O     1 
ATOM   5728 C  CB    . PHE B 2 171 ? -11.37400 -33.27000 17.48800  1.000 64.01000  ? 171 PHE B CB    1 
ATOM   5729 C  CG    . PHE B 2 171 ? -12.18200 -34.52200 17.31400  1.000 60.85000  ? 171 PHE B CG    1 
ATOM   5730 C  CD1   . PHE B 2 171 ? -13.15500 -34.87000 18.24300  1.000 60.90000  ? 171 PHE B CD1   1 
ATOM   5731 C  CD2   . PHE B 2 171 ? -11.96200 -35.35700 16.23500  1.000 54.96000  ? 171 PHE B CD2   1 
ATOM   5732 C  CE1   . PHE B 2 171 ? -13.89000 -36.01900 18.10300  1.000 54.38000  ? 171 PHE B CE1   1 
ATOM   5733 C  CE2   . PHE B 2 171 ? -12.69700 -36.50800 16.08500  1.000 56.43000  ? 171 PHE B CE2   1 
ATOM   5734 C  CZ    . PHE B 2 171 ? -13.66600 -36.84200 17.02300  1.000 58.72000  ? 171 PHE B CZ    1 
ATOM   5735 N  N     . ARG B 2 172 ? -8.44800  -34.06900 16.82700  1.000 58.52000  ? 172 ARG B N     1 
ATOM   5736 C  CA    . ARG B 2 172 ? -7.46400  -34.93400 16.20300  1.000 63.25000  ? 172 ARG B CA    1 
ATOM   5737 C  C     . ARG B 2 172 ? -6.38200  -35.39400 17.17900  1.000 63.64000  ? 172 ARG B C     1 
ATOM   5738 O  O     . ARG B 2 172 ? -6.06800  -36.58400 17.24900  1.000 64.92000  ? 172 ARG B O     1 
ATOM   5739 C  CB    . ARG B 2 172 ? -6.82500  -34.21700 15.02400  1.000 67.43000  ? 172 ARG B CB    1 
ATOM   5740 C  CG    . ARG B 2 172 ? -7.70000  -34.15800 13.80100  1.000 60.35000  ? 172 ARG B CG    1 
ATOM   5741 C  CD    . ARG B 2 172 ? -7.15100  -33.15200 12.82700  1.000 59.86000  ? 172 ARG B CD    1 
ATOM   5742 N  NE    . ARG B 2 172 ? -7.70400  -33.36600 11.50100  1.000 65.40000  ? 172 ARG B NE    1 
ATOM   5743 C  CZ    . ARG B 2 172 ? -7.66900  -32.47100 10.52100  1.000 63.38000  ? 172 ARG B CZ    1 
ATOM   5744 N  NH1   . ARG B 2 172 ? -7.11500  -31.27700 10.71800  1.000 58.22000  ? 172 ARG B NH1   1 
ATOM   5745 N  NH2   . ARG B 2 172 ? -8.20000  -32.77500 9.34200   1.000 58.96000  ? 172 ARG B NH2   1 
ATOM   5746 N  N     . LYS B 2 173 ? -5.80900  -34.44700 17.91900  1.000 65.10000  ? 173 LYS B N     1 
ATOM   5747 C  CA    . LYS B 2 173 ? -4.80800  -34.76600 18.93500  1.000 69.41000  ? 173 LYS B CA    1 
ATOM   5748 C  C     . LYS B 2 173 ? -5.33900  -35.81100 19.91500  1.000 65.89000  ? 173 LYS B C     1 
ATOM   5749 O  O     . LYS B 2 173 ? -4.70500  -36.85100 20.12300  1.000 58.08000  ? 173 LYS B O     1 
ATOM   5750 C  CB    . LYS B 2 173 ? -4.38300  -33.50100 19.69100  1.000 68.99000  ? 173 LYS B CB    1 
ATOM   5751 C  CG    . LYS B 2 173 ? -2.96500  -33.02100 19.39300  1.000 74.18000  ? 173 LYS B CG    1 
ATOM   5752 C  CD    . LYS B 2 173 ? -1.91800  -33.84800 20.14900  1.000 76.62000  ? 173 LYS B CD    1 
ATOM   5753 C  CE    . LYS B 2 173 ? -0.50700  -33.33300 19.89100  1.000 68.28000  ? 173 LYS B CE    1 
ATOM   5754 N  NZ    . LYS B 2 173 ? 0.52400   -34.39300 20.06400  1.000 70.61000  ? 173 LYS B NZ    1 
ATOM   5755 N  N     . GLN B 2 174 ? -6.51500  -35.53600 20.48200  1.000 60.35000  ? 174 GLN B N     1 
ATOM   5756 C  CA    . GLN B 2 174 ? -7.11800  -36.40700 21.48200  1.000 62.37000  ? 174 GLN B CA    1 
ATOM   5757 C  C     . GLN B 2 174 ? -7.67100  -37.69900 20.86700  1.000 62.93000  ? 174 GLN B C     1 
ATOM   5758 O  O     . GLN B 2 174 ? -7.89600  -38.69000 21.56200  1.000 59.24000  ? 174 GLN B O     1 
ATOM   5759 C  CB    . GLN B 2 174 ? -8.21700  -35.65900 22.24800  1.000 62.24000  ? 174 GLN B CB    1 
ATOM   5760 C  CG    . GLN B 2 174 ? -8.89700  -36.51400 23.32100  1.000 76.80000  ? 174 GLN B CG    1 
ATOM   5761 C  CD    . GLN B 2 174 ? -9.81600  -35.72700 24.23300  1.000 91.61000  ? 174 GLN B CD    1 
ATOM   5762 O  OE1   . GLN B 2 174 ? -9.79500  -34.49300 24.24300  1.000 99.19000  ? 174 GLN B OE1   1 
ATOM   5763 N  NE2   . GLN B 2 174 ? -10.63600 -36.43900 25.00700  1.000 88.87000  ? 174 GLN B NE2   1 
ATOM   5764 N  N     . ASN B 2 175 ? -7.87100  -37.70200 19.55700  1.000 63.80000  ? 175 ASN B N     1 
ATOM   5765 C  CA    . ASN B 2 175 ? -8.30000  -38.92100 18.88200  1.000 64.32000  ? 175 ASN B CA    1 
ATOM   5766 C  C     . ASN B 2 175 ? -7.42000  -39.29500 17.69000  1.000 67.48000  ? 175 ASN B C     1 
ATOM   5767 O  O     . ASN B 2 175 ? -7.87600  -39.24700 16.54500  1.000 63.26000  ? 175 ASN B O     1 
ATOM   5768 C  CB    . ASN B 2 175 ? -9.74700  -38.77600 18.42600  1.000 62.70000  ? 175 ASN B CB    1 
ATOM   5769 C  CG    . ASN B 2 175 ? -10.72600 -39.03100 19.53700  1.000 58.55000  ? 175 ASN B CG    1 
ATOM   5770 O  OD1   . ASN B 2 175 ? -10.97900 -40.18100 19.88700  1.000 64.59000  ? 175 ASN B OD1   1 
ATOM   5771 N  ND2   . ASN B 2 175 ? -11.28000 -37.96700 20.10600  1.000 59.67000  ? 175 ASN B ND2   1 
ATOM   5772 N  N     . PRO B 2 176 ? -6.16200  -39.69400 17.96200  1.000 72.79000  ? 176 PRO B N     1 
ATOM   5773 C  CA    . PRO B 2 176 ? -5.10800  -39.92400 16.95700  1.000 69.30000  ? 176 PRO B CA    1 
ATOM   5774 C  C     . PRO B 2 176 ? -5.46800  -40.97700 15.91400  1.000 71.20000  ? 176 PRO B C     1 
ATOM   5775 O  O     . PRO B 2 176 ? -4.99700  -40.88200 14.77800  1.000 69.79000  ? 176 PRO B O     1 
ATOM   5776 C  CB    . PRO B 2 176 ? -3.91800  -40.40300 17.79400  1.000 64.31000  ? 176 PRO B CB    1 
ATOM   5777 C  CG    . PRO B 2 176 ? -4.21500  -39.94400 19.17500  1.000 74.29000  ? 176 PRO B CG    1 
ATOM   5778 C  CD    . PRO B 2 176 ? -5.69700  -40.03400 19.31500  1.000 68.08000  ? 176 PRO B CD    1 
ATOM   5779 N  N     . ASP B 2 177 ? -6.28700  -41.95800 16.28900  1.000 71.09000  ? 177 ASP B N     1 
ATOM   5780 C  CA    . ASP B 2 177 ? -6.65400  -43.03400 15.36600  1.000 74.00000  ? 177 ASP B CA    1 
ATOM   5781 C  C     . ASP B 2 177 ? -7.99200  -42.79900 14.64900  1.000 73.24000  ? 177 ASP B C     1 
ATOM   5782 O  O     . ASP B 2 177 ? -8.60900  -43.73300 14.12100  1.000 71.64000  ? 177 ASP B O     1 
ATOM   5783 C  CB    . ASP B 2 177 ? -6.67300  -44.37200 16.10500  1.000 74.52000  ? 177 ASP B CB    1 
ATOM   5784 C  CG    . ASP B 2 177 ? -5.28900  -44.98100 16.21500  1.000 79.37000  ? 177 ASP B CG    1 
ATOM   5785 O  OD1   . ASP B 2 177 ? -4.79900  -45.53000 15.20200  1.000 76.02000  ? 177 ASP B OD1   1 
ATOM   5786 O  OD2   . ASP B 2 177 ? -4.68100  -44.89000 17.30200  1.000 78.54000  ? 177 ASP B OD2   1 
ATOM   5787 N  N     . ILE B 2 178 ? -8.42900  -41.54500 14.62700  1.000 67.35000  ? 178 ILE B N     1 
ATOM   5788 C  CA    . ILE B 2 178 ? -9.54700  -41.13600 13.79200  1.000 62.59000  ? 178 ILE B CA    1 
ATOM   5789 C  C     . ILE B 2 178 ? -9.00600  -40.29000 12.63200  1.000 61.18000  ? 178 ILE B C     1 
ATOM   5790 O  O     . ILE B 2 178 ? -8.27500  -39.31900 12.85000  1.000 64.33000  ? 178 ILE B O     1 
ATOM   5791 C  CB    . ILE B 2 178 ? -10.60300 -40.35000 14.60500  1.000 59.60000  ? 178 ILE B CB    1 
ATOM   5792 C  CG1   . ILE B 2 178 ? -11.43200 -41.30300 15.47400  1.000 60.55000  ? 178 ILE B CG1   1 
ATOM   5793 C  CG2   . ILE B 2 178 ? -11.51900 -39.58500 13.69300  1.000 54.61000  ? 178 ILE B CG2   1 
ATOM   5794 C  CD1   . ILE B 2 178 ? -12.63500 -40.63500 16.14000  1.000 55.59000  ? 178 ILE B CD1   1 
ATOM   5795 N  N     . VAL B 2 179 ? -9.33000  -40.68000 11.40200  1.000 57.17000  ? 179 VAL B N     1 
ATOM   5796 C  CA    . VAL B 2 179 ? -8.91600  -39.91100 10.22800  1.000 54.34000  ? 179 VAL B CA    1 
ATOM   5797 C  C     . VAL B 2 179 ? -10.02300 -38.98900 9.73700   1.000 55.70000  ? 179 VAL B C     1 
ATOM   5798 O  O     . VAL B 2 179 ? -11.10700 -39.44600 9.36700   1.000 55.35000  ? 179 VAL B O     1 
ATOM   5799 C  CB    . VAL B 2 179 ? -8.51700  -40.80900 9.05800   1.000 57.86000  ? 179 VAL B CB    1 
ATOM   5800 C  CG1   . VAL B 2 179 ? -8.01200  -39.95000 7.91000   1.000 52.48000  ? 179 VAL B CG1   1 
ATOM   5801 C  CG2   . VAL B 2 179 ? -7.47800  -41.83300 9.48900   1.000 55.57000  ? 179 VAL B CG2   1 
ATOM   5802 N  N     . ILE B 2 180 ? -9.74700  -37.69300 9.72900   1.000 51.27000  ? 180 ILE B N     1 
ATOM   5803 C  CA    . ILE B 2 180 ? -10.71800 -36.72900 9.24900   1.000 51.05000  ? 180 ILE B CA    1 
ATOM   5804 C  C     . ILE B 2 180 ? -10.24600 -36.09000 7.95300   1.000 52.94000  ? 180 ILE B C     1 
ATOM   5805 O  O     . ILE B 2 180 ? -9.17300  -35.48600 7.90600   1.000 48.50000  ? 180 ILE B O     1 
ATOM   5806 C  CB    . ILE B 2 180 ? -10.98200 -35.62400 10.27800  1.000 57.52000  ? 180 ILE B CB    1 
ATOM   5807 C  CG1   . ILE B 2 180 ? -11.22900 -36.22500 11.65900  1.000 56.33000  ? 180 ILE B CG1   1 
ATOM   5808 C  CG2   . ILE B 2 180 ? -12.18900 -34.81000 9.86400   1.000 60.31000  ? 180 ILE B CG2   1 
ATOM   5809 C  CD1   . ILE B 2 180 ? -11.62600 -35.20800 12.67800  1.000 54.79000  ? 180 ILE B CD1   1 
ATOM   5810 N  N     . TYR B 2 181 ? -11.05500 -36.22800 6.90500   1.000 54.85000  ? 181 TYR B N     1 
ATOM   5811 C  CA    . TYR B 2 181 ? -10.74200 -35.66300 5.58600   1.000 51.54000  ? 181 TYR B CA    1 
ATOM   5812 C  C     . TYR B 2 181 ? -11.80200 -34.67800 5.10600   1.000 51.19000  ? 181 TYR B C     1 
ATOM   5813 O  O     . TYR B 2 181 ? -13.00100 -34.88600 5.29900   1.000 54.24000  ? 181 TYR B O     1 
ATOM   5814 C  CB    . TYR B 2 181 ? -10.59400 -36.77300 4.55300   1.000 52.44000  ? 181 TYR B CB    1 
ATOM   5815 C  CG    . TYR B 2 181 ? -10.29700 -36.27800 3.16700   1.000 51.06000  ? 181 TYR B CG    1 
ATOM   5816 C  CD1   . TYR B 2 181 ? -9.27700  -35.36800 2.94500   1.000 47.03000  ? 181 TYR B CD1   1 
ATOM   5817 C  CD2   . TYR B 2 181 ? -11.02500 -36.73400 2.07400   1.000 50.51000  ? 181 TYR B CD2   1 
ATOM   5818 C  CE1   . TYR B 2 181 ? -8.98400  -34.91800 1.67500   1.000 47.14000  ? 181 TYR B CE1   1 
ATOM   5819 C  CE2   . TYR B 2 181 ? -10.74100 -36.28400 0.78800   1.000 49.98000  ? 181 TYR B CE2   1 
ATOM   5820 C  CZ    . TYR B 2 181 ? -9.71200  -35.37900 0.59800   1.000 51.77000  ? 181 TYR B CZ    1 
ATOM   5821 O  OH    . TYR B 2 181 ? -9.41100  -34.92300 -0.66800  1.000 61.41000  ? 181 TYR B OH    1 
ATOM   5822 N  N     . GLN B 2 182 ? -11.36300 -33.60400 4.46800   1.000 50.24000  ? 182 GLN B N     1 
ATOM   5823 C  CA    . GLN B 2 182 ? -12.30500 -32.62800 3.95200   1.000 45.07000  ? 182 GLN B CA    1 
ATOM   5824 C  C     . GLN B 2 182 ? -12.25400 -32.60000 2.42300   1.000 50.40000  ? 182 GLN B C     1 
ATOM   5825 O  O     . GLN B 2 182 ? -11.17700 -32.60100 1.82500   1.000 46.90000  ? 182 GLN B O     1 
ATOM   5826 C  CB    . GLN B 2 182 ? -12.01500 -31.24200 4.52700   1.000 38.64000  ? 182 GLN B CB    1 
ATOM   5827 C  CG    . GLN B 2 182 ? -12.95100 -30.19900 4.00200   1.000 48.99000  ? 182 GLN B CG    1 
ATOM   5828 C  CD    . GLN B 2 182 ? -12.75000 -28.84500 4.63000   1.000 55.12000  ? 182 GLN B CD    1 
ATOM   5829 O  OE1   . GLN B 2 182 ? -11.63100 -28.45600 4.95900   1.000 63.09000  ? 182 GLN B OE1   1 
ATOM   5830 N  NE2   . GLN B 2 182 ? -13.84300 -28.10700 4.79300   1.000 52.78000  ? 182 GLN B NE2   1 
ATOM   5831 N  N     . TYR B 2 183 ? -13.42200 -32.60300 1.79100   1.000 53.68000  ? 183 TYR B N     1 
ATOM   5832 C  CA    . TYR B 2 183 ? -13.51200 -32.41900 0.34300   1.000 45.68000  ? 183 TYR B CA    1 
ATOM   5833 C  C     . TYR B 2 183 ? -14.72900 -31.54400 0.06300   1.000 39.58000  ? 183 TYR B C     1 
ATOM   5834 O  O     . TYR B 2 183 ? -15.86200 -31.95600 0.30700   1.000 44.94000  ? 183 TYR B O     1 
ATOM   5835 C  CB    . TYR B 2 183 ? -13.60700 -33.76500 -0.40300  1.000 44.38000  ? 183 TYR B CB    1 
ATOM   5836 C  CG    . TYR B 2 183 ? -13.70200 -33.58400 -1.89800  1.000 44.15000  ? 183 TYR B CG    1 
ATOM   5837 C  CD1   . TYR B 2 183 ? -12.56700 -33.50300 -2.67300  1.000 37.93000  ? 183 TYR B CD1   1 
ATOM   5838 C  CD2   . TYR B 2 183 ? -14.93400 -33.44700 -2.52700  1.000 47.28000  ? 183 TYR B CD2   1 
ATOM   5839 C  CE1   . TYR B 2 183 ? -12.64700 -33.30100 -4.03400  1.000 45.23000  ? 183 TYR B CE1   1 
ATOM   5840 C  CE2   . TYR B 2 183 ? -15.02500 -33.24400 -3.88900  1.000 43.26000  ? 183 TYR B CE2   1 
ATOM   5841 C  CZ    . TYR B 2 183 ? -13.87700 -33.16800 -4.63900  1.000 47.48000  ? 183 TYR B CZ    1 
ATOM   5842 O  OH    . TYR B 2 183 ? -13.94900 -32.97000 -6.00700  1.000 50.42000  ? 183 TYR B OH    1 
ATOM   5843 N  N     . MET B 2 184 ? -14.49100 -30.33800 -0.43300  1.000 38.44000  ? 184 MET B N     1 
ATOM   5844 C  CA    . MET B 2 184 ? -15.56300 -29.38300 -0.67400  1.000 40.48000  ? 184 MET B CA    1 
ATOM   5845 C  C     . MET B 2 184 ? -16.39500 -29.15000 0.59400   1.000 42.36000  ? 184 MET B C     1 
ATOM   5846 O  O     . MET B 2 184 ? -15.86300 -28.79700 1.64000   1.000 44.85000  ? 184 MET B O     1 
ATOM   5847 C  CB    . MET B 2 184 ? -16.44900 -29.86300 -1.82900  1.000 42.67000  ? 184 MET B CB    1 
ATOM   5848 C  CG    . MET B 2 184 ? -15.68300 -30.10700 -3.10800  1.000 37.99000  ? 184 MET B CG    1 
ATOM   5849 S  SD    . MET B 2 184 ? -15.14600 -28.58300 -3.89100  1.000 61.79000  ? 184 MET B SD    1 
ATOM   5850 C  CE    . MET B 2 184 ? -16.60400 -28.22200 -4.88200  1.000 52.00000  ? 184 MET B CE    1 
ATOM   5851 N  N     . ASP B 2 185 ? -17.70300 -29.35300 0.50200   1.000 44.23000  ? 185 ASP B N     1 
ATOM   5852 C  CA    . ASP B 2 185 ? -18.58200 -29.14600 1.65000   1.000 40.36000  ? 185 ASP B CA    1 
ATOM   5853 C  C     . ASP B 2 185 ? -18.56100 -30.33200 2.61900   1.000 44.75000  ? 185 ASP B C     1 
ATOM   5854 O  O     . ASP B 2 185 ? -19.30300 -30.34600 3.60700   1.000 43.28000  ? 185 ASP B O     1 
ATOM   5855 C  CB    . ASP B 2 185 ? -20.02200 -28.91200 1.18500   1.000 44.64000  ? 185 ASP B CB    1 
ATOM   5856 C  CG    . ASP B 2 185 ? -20.16700 -27.71200 0.26100   1.000 46.58000  ? 185 ASP B CG    1 
ATOM   5857 O  OD1   . ASP B 2 185 ? -19.15100 -27.07100 -0.07400  1.000 49.35000  ? 185 ASP B OD1   1 
ATOM   5858 O  OD2   . ASP B 2 185 ? -21.31300 -27.42100 -0.15000  1.000 55.55000  ? 185 ASP B OD2   1 
ATOM   5859 N  N     . ASP B 2 186 ? -17.73600 -31.33700 2.32700   1.000 42.32000  ? 186 ASP B N     1 
ATOM   5860 C  CA    . ASP B 2 186 ? -17.81300 -32.60000 3.05400   1.000 43.84000  ? 186 ASP B CA    1 
ATOM   5861 C  C     . ASP B 2 186 ? -16.63600 -32.82800 3.98800   1.000 45.00000  ? 186 ASP B C     1 
ATOM   5862 O  O     . ASP B 2 186 ? -15.49600 -32.43300 3.71100   1.000 42.11000  ? 186 ASP B O     1 
ATOM   5863 C  CB    . ASP B 2 186 ? -17.89300 -33.79200 2.08500   1.000 50.64000  ? 186 ASP B CB    1 
ATOM   5864 C  CG    . ASP B 2 186 ? -19.21300 -33.87200 1.33300   1.000 47.79000  ? 186 ASP B CG    1 
ATOM   5865 O  OD1   . ASP B 2 186 ? -20.18100 -33.17200 1.71600   1.000 50.25000  ? 186 ASP B OD1   1 
ATOM   5866 O  OD2   . ASP B 2 186 ? -19.27900 -34.66600 0.36300   1.000 50.14000  ? 186 ASP B OD2   1 
ATOM   5867 N  N     . LEU B 2 187 ? -16.93500 -33.50700 5.08800   1.000 47.24000  ? 187 LEU B N     1 
ATOM   5868 C  CA    . LEU B 2 187 ? -15.92800 -33.95900 6.02700   1.000 46.36000  ? 187 LEU B CA    1 
ATOM   5869 C  C     . LEU B 2 187 ? -16.08600 -35.45500 6.13500   1.000 46.97000  ? 187 LEU B C     1 
ATOM   5870 O  O     . LEU B 2 187 ? -17.12500 -35.94100 6.58700   1.000 47.73000  ? 187 LEU B O     1 
ATOM   5871 C  CB    . LEU B 2 187 ? -16.11000 -33.29600 7.39300   1.000 53.64000  ? 187 LEU B CB    1 
ATOM   5872 C  CG    . LEU B 2 187 ? -14.91600 -32.87700 8.25200   1.000 52.42000  ? 187 LEU B CG    1 
ATOM   5873 C  CD1   . LEU B 2 187 ? -14.02700 -31.86600 7.53700   1.000 46.11000  ? 187 LEU B CD1   1 
ATOM   5874 C  CD2   . LEU B 2 187 ? -15.45100 -32.30100 9.55400   1.000 50.40000  ? 187 LEU B CD2   1 
ATOM   5875 N  N     . TYR B 2 188 ? -15.07900 -36.18600 5.68000   1.000 47.57000  ? 188 TYR B N     1 
ATOM   5876 C  CA    . TYR B 2 188 ? -15.06800 -37.63200 5.81500   1.000 49.23000  ? 188 TYR B CA    1 
ATOM   5877 C  C     . TYR B 2 188 ? -14.34100 -38.00000 7.09000   1.000 52.25000  ? 188 TYR B C     1 
ATOM   5878 O  O     . TYR B 2 188 ? -13.20800 -37.55800 7.32200   1.000 55.35000  ? 188 TYR B O     1 
ATOM   5879 C  CB    . TYR B 2 188 ? -14.40700 -38.28400 4.60600   1.000 49.26000  ? 188 TYR B CB    1 
ATOM   5880 C  CG    . TYR B 2 188 ? -15.19100 -38.06100 3.34600   1.000 48.34000  ? 188 TYR B CG    1 
ATOM   5881 C  CD1   . TYR B 2 188 ? -15.03900 -36.88800 2.60800   1.000 49.97000  ? 188 TYR B CD1   1 
ATOM   5882 C  CD2   . TYR B 2 188 ? -16.10100 -39.01400 2.90100   1.000 46.54000  ? 188 TYR B CD2   1 
ATOM   5883 C  CE1   . TYR B 2 188 ? -15.77100 -36.67400 1.45000   1.000 51.08000  ? 188 TYR B CE1   1 
ATOM   5884 C  CE2   . TYR B 2 188 ? -16.83200 -38.82200 1.74900   1.000 50.39000  ? 188 TYR B CE2   1 
ATOM   5885 C  CZ    . TYR B 2 188 ? -16.67100 -37.64800 1.02600   1.000 54.23000  ? 188 TYR B CZ    1 
ATOM   5886 O  OH    . TYR B 2 188 ? -17.41400 -37.45000 -0.11800  1.000 53.27000  ? 188 TYR B OH    1 
ATOM   5887 N  N     . VAL B 2 189 ? -14.99700 -38.79300 7.92600   1.000 47.29000  ? 189 VAL B N     1 
ATOM   5888 C  CA    . VAL B 2 189 ? -14.44000 -39.15100 9.22500   1.000 55.50000  ? 189 VAL B CA    1 
ATOM   5889 C  C     . VAL B 2 189 ? -14.39900 -40.66800 9.37300   1.000 51.97000  ? 189 VAL B C     1 
ATOM   5890 O  O     . VAL B 2 189 ? -15.44000 -41.32000 9.43600   1.000 53.53000  ? 189 VAL B O     1 
ATOM   5891 C  CB    . VAL B 2 189 ? -15.25600 -38.52000 10.39200  1.000 49.81000  ? 189 VAL B CB    1 
ATOM   5892 C  CG1   . VAL B 2 189 ? -14.58000 -38.78000 11.72000  1.000 49.35000  ? 189 VAL B CG1   1 
ATOM   5893 C  CG2   . VAL B 2 189 ? -15.41500 -37.03500 10.17600  1.000 45.39000  ? 189 VAL B CG2   1 
ATOM   5894 N  N     . GLY B 2 190 ? -13.19200 -41.22700 9.42100   1.000 57.17000  ? 190 GLY B N     1 
ATOM   5895 C  CA    . GLY B 2 190 ? -13.03000 -42.66900 9.51400   1.000 55.93000  ? 190 GLY B CA    1 
ATOM   5896 C  C     . GLY B 2 190 ? -12.43700 -43.17200 10.81900  1.000 58.53000  ? 190 GLY B C     1 
ATOM   5897 O  O     . GLY B 2 190 ? -11.56300 -42.53400 11.41700  1.000 59.20000  ? 190 GLY B O     1 
ATOM   5898 N  N     . SER B 2 191 ? -12.90900 -44.33600 11.25100  1.000 60.58000  ? 191 SER B N     1 
ATOM   5899 C  CA    . SER B 2 191 ? -12.38600 -44.99200 12.44100  1.000 58.88000  ? 191 SER B CA    1 
ATOM   5900 C  C     . SER B 2 191 ? -12.50000 -46.51400 12.34400  1.000 64.53000  ? 191 SER B C     1 
ATOM   5901 O  O     . SER B 2 191 ? -13.27300 -47.05000 11.53300  1.000 62.44000  ? 191 SER B O     1 
ATOM   5902 C  CB    . SER B 2 191 ? -13.13200 -44.51200 13.68100  1.000 55.95000  ? 191 SER B CB    1 
ATOM   5903 O  OG    . SER B 2 191 ? -14.36600 -45.20500 13.81600  1.000 56.72000  ? 191 SER B OG    1 
ATOM   5904 N  N     . ASP B 2 192 ? -11.74300 -47.20400 13.19600  1.000 67.35000  ? 192 ASP B N     1 
ATOM   5905 C  CA    . ASP B 2 192 ? -11.85800 -48.65600 13.34900  1.000 70.12000  ? 192 ASP B CA    1 
ATOM   5906 C  C     . ASP B 2 192 ? -12.72100 -49.01800 14.57300  1.000 67.91000  ? 192 ASP B C     1 
ATOM   5907 O  O     . ASP B 2 192 ? -12.81600 -50.18100 14.96800  1.000 75.47000  ? 192 ASP B O     1 
ATOM   5908 C  CB    . ASP B 2 192 ? -10.46100 -49.28600 13.45300  1.000 66.09000  ? 192 ASP B CB    1 
ATOM   5909 C  CG    . ASP B 2 192 ? -9.68700  -49.20800 12.13700  1.000 68.47000  ? 192 ASP B CG    1 
ATOM   5910 O  OD1   . ASP B 2 192 ? -10.26600 -49.63000 11.11100  1.000 68.83000  ? 192 ASP B OD1   1 
ATOM   5911 O  OD2   . ASP B 2 192 ? -8.52400  -48.72000 12.11700  1.000 56.80000  ? 192 ASP B OD2   1 
ATOM   5912 N  N     . LEU B 2 193 ? -13.35400 -48.01200 15.16800  1.000 64.05000  ? 193 LEU B N     1 
ATOM   5913 C  CA    . LEU B 2 193 ? -14.23200 -48.24000 16.30800  1.000 66.40000  ? 193 LEU B CA    1 
ATOM   5914 C  C     . LEU B 2 193 ? -15.44100 -49.08500 15.93100  1.000 69.99000  ? 193 LEU B C     1 
ATOM   5915 O  O     . LEU B 2 193 ? -15.90900 -49.06700 14.78900  1.000 68.87000  ? 193 LEU B O     1 
ATOM   5916 C  CB    . LEU B 2 193 ? -14.72000 -46.92000 16.90800  1.000 55.13000  ? 193 LEU B CB    1 
ATOM   5917 C  CG    . LEU B 2 193 ? -13.70000 -45.89400 17.37700  1.000 54.43000  ? 193 LEU B CG    1 
ATOM   5918 C  CD1   . LEU B 2 193 ? -14.43200 -44.84600 18.16500  1.000 49.14000  ? 193 LEU B CD1   1 
ATOM   5919 C  CD2   . LEU B 2 193 ? -12.59800 -46.53000 18.21100  1.000 49.90000  ? 193 LEU B CD2   1 
ATOM   5920 N  N     . GLU B 2 194 ? -15.92600 -49.82600 16.91900  1.000 69.68000  ? 194 GLU B N     1 
ATOM   5921 C  CA    . GLU B 2 194 ? -17.18200 -50.54100 16.83100  1.000 68.69000  ? 194 GLU B CA    1 
ATOM   5922 C  C     . GLU B 2 194 ? -18.27800 -49.53800 16.56700  1.000 67.60000  ? 194 GLU B C     1 
ATOM   5923 O  O     . GLU B 2 194 ? -18.23700 -48.44000 17.10900  1.000 73.93000  ? 194 GLU B O     1 
ATOM   5924 C  CB    . GLU B 2 194 ? -17.44200 -51.29900 18.12900  1.000 71.70000  ? 194 GLU B CB    1 
ATOM   5925 C  CG    . GLU B 2 194 ? -18.89100 -51.31500 18.55900  1.000 78.90000  ? 194 GLU B CG    1 
ATOM   5926 C  CD    . GLU B 2 194 ? -19.05300 -51.44800 20.06100  1.000 92.63000  ? 194 GLU B CD    1 
ATOM   5927 O  OE1   . GLU B 2 194 ? -18.23600 -52.17100 20.68700  1.000 90.63000  ? 194 GLU B OE1   1 
ATOM   5928 O  OE2   . GLU B 2 194 ? -19.99600 -50.82300 20.61100  1.000 88.93000  ? 194 GLU B OE2   1 
ATOM   5929 N  N     . ILE B 2 195 ? -19.24900 -49.88900 15.73400  1.000 69.74000  ? 195 ILE B N     1 
ATOM   5930 C  CA    . ILE B 2 195 ? -20.34700 -48.96700 15.48600  1.000 75.66000  ? 195 ILE B CA    1 
ATOM   5931 C  C     . ILE B 2 195 ? -21.06000 -48.73900 16.82100  1.000 80.20000  ? 195 ILE B C     1 
ATOM   5932 O  O     . ILE B 2 195 ? -21.29300 -49.67900 17.59200  1.000 87.56000  ? 195 ILE B O     1 
ATOM   5933 C  CB    . ILE B 2 195 ? -21.30300 -49.48600 14.38400  1.000 71.48000  ? 195 ILE B CB    1 
ATOM   5934 C  CG1   . ILE B 2 195 ? -21.58200 -48.38100 13.38000  1.000 71.65000  ? 195 ILE B CG1   1 
ATOM   5935 C  CG2   . ILE B 2 195 ? -22.62500 -49.97500 14.94200  1.000 70.61000  ? 195 ILE B CG2   1 
ATOM   5936 C  CD1   . ILE B 2 195 ? -22.39300 -48.86500 12.24000  1.000 78.61000  ? 195 ILE B CD1   1 
ATOM   5937 N  N     . GLY B 2 196 ? -21.35100 -47.48100 17.12500  1.000 67.79000  ? 196 GLY B N     1 
ATOM   5938 C  CA    . GLY B 2 196 ? -21.81200 -47.14400 18.45600  1.000 68.75000  ? 196 GLY B CA    1 
ATOM   5939 C  C     . GLY B 2 196 ? -20.73800 -46.34500 19.16500  1.000 67.14000  ? 196 GLY B C     1 
ATOM   5940 O  O     . GLY B 2 196 ? -20.98600 -45.22600 19.59500  1.000 69.83000  ? 196 GLY B O     1 
ATOM   5941 N  N     . GLN B 2 197 ? -19.54300 -46.91500 19.28600  1.000 65.87000  ? 197 GLN B N     1 
ATOM   5942 C  CA    . GLN B 2 197 ? -18.39000 -46.14200 19.73100  1.000 70.08000  ? 197 GLN B CA    1 
ATOM   5943 C  C     . GLN B 2 197 ? -17.96100 -45.15600 18.63500  1.000 64.78000  ? 197 GLN B C     1 
ATOM   5944 O  O     . GLN B 2 197 ? -17.64200 -43.99700 18.92700  1.000 61.51000  ? 197 GLN B O     1 
ATOM   5945 C  CB    . GLN B 2 197 ? -17.24300 -47.06500 20.13400  1.000 65.65000  ? 197 GLN B CB    1 
ATOM   5946 C  CG    . GLN B 2 197 ? -17.12000 -47.17700 21.64300  1.000 75.88000  ? 197 GLN B CG    1 
ATOM   5947 C  CD    . GLN B 2 197 ? -16.37500 -48.41200 22.08900  1.000 84.49000  ? 197 GLN B CD    1 
ATOM   5948 O  OE1   . GLN B 2 197 ? -16.94800 -49.28500 22.75100  1.000 81.39000  ? 197 GLN B OE1   1 
ATOM   5949 N  NE2   . GLN B 2 197 ? -15.08900 -48.49300 21.74300  1.000 71.16000  ? 197 GLN B NE2   1 
ATOM   5950 N  N     . HIS B 2 198 ? -17.98900 -45.61900 17.38200  1.000 62.28000  ? 198 HIS B N     1 
ATOM   5951 C  CA    . HIS B 2 198 ? -17.81400 -44.77000 16.19700  1.000 60.54000  ? 198 HIS B CA    1 
ATOM   5952 C  C     . HIS B 2 198 ? -18.83000 -43.63700 16.16600  1.000 61.23000  ? 198 HIS B C     1 
ATOM   5953 O  O     . HIS B 2 198 ? -18.46300 -42.46100 16.11700  1.000 59.96000  ? 198 HIS B O     1 
ATOM   5954 C  CB    . HIS B 2 198 ? -17.93600 -45.60400 14.91400  1.000 65.21000  ? 198 HIS B CB    1 
ATOM   5955 C  CG    . HIS B 2 198 ? -17.85700 -44.80100 13.64600  1.000 62.00000  ? 198 HIS B CG    1 
ATOM   5956 N  ND1   . HIS B 2 198 ? -16.67200 -44.56800 12.98000  1.000 55.07000  ? 198 HIS B ND1   1 
ATOM   5957 C  CD2   . HIS B 2 198 ? -18.82400 -44.19800 12.91000  1.000 57.87000  ? 198 HIS B CD2   1 
ATOM   5958 C  CE1   . HIS B 2 198 ? -16.90600 -43.84100 11.90300  1.000 50.17000  ? 198 HIS B CE1   1 
ATOM   5959 N  NE2   . HIS B 2 198 ? -18.20400 -43.60300 11.83600  1.000 56.10000  ? 198 HIS B NE2   1 
ATOM   5960 N  N     . ARG B 2 199 ? -20.10900 -43.99900 16.19900  1.000 59.93000  ? 199 ARG B N     1 
ATOM   5961 C  CA    . ARG B 2 199 ? -21.18600 -43.01400 16.21400  1.000 60.88000  ? 199 ARG B CA    1 
ATOM   5962 C  C     . ARG B 2 199 ? -21.11200 -42.04200 17.40100  1.000 65.50000  ? 199 ARG B C     1 
ATOM   5963 O  O     . ARG B 2 199 ? -21.36900 -40.83800 17.25300  1.000 67.94000  ? 199 ARG B O     1 
ATOM   5964 C  CB    . ARG B 2 199 ? -22.53200 -43.72200 16.21800  1.000 63.71000  ? 199 ARG B CB    1 
ATOM   5965 C  CG    . ARG B 2 199 ? -22.71500 -44.68900 15.06600  1.000 73.96000  ? 199 ARG B CG    1 
ATOM   5966 C  CD    . ARG B 2 199 ? -24.11900 -44.54200 14.52800  1.000 79.02000  ? 199 ARG B CD    1 
ATOM   5967 N  NE    . ARG B 2 199 ? -24.38300 -45.34200 13.34000  1.000 79.49000  ? 199 ARG B NE    1 
ATOM   5968 C  CZ    . ARG B 2 199 ? -24.78000 -46.60600 13.37100  1.000 82.80000  ? 199 ARG B CZ    1 
ATOM   5969 N  NH1   . ARG B 2 199 ? -24.93000 -47.22900 14.53700  1.000 77.60000  ? 199 ARG B NH1   1 
ATOM   5970 N  NH2   . ARG B 2 199 ? -25.01500 -47.24600 12.23300  1.000 80.77000  ? 199 ARG B NH2   1 
ATOM   5971 N  N     . THR B 2 200 ? -20.76900 -42.56000 18.57700  1.000 63.92000  ? 200 THR B N     1 
ATOM   5972 C  CA    . THR B 2 200 ? -20.60900 -41.71300 19.75100  1.000 61.23000  ? 200 THR B CA    1 
ATOM   5973 C  C     . THR B 2 200 ? -19.46500 -40.72700 19.51300  1.000 58.67000  ? 200 THR B C     1 
ATOM   5974 O  O     . THR B 2 200 ? -19.52000 -39.57700 19.95700  1.000 57.29000  ? 200 THR B O     1 
ATOM   5975 C  CB    . THR B 2 200 ? -20.35400 -42.54800 21.02500  1.000 62.75000  ? 200 THR B CB    1 
ATOM   5976 O  OG1   . THR B 2 200 ? -21.46200 -43.43400 21.24500  1.000 59.14000  ? 200 THR B OG1   1 
ATOM   5977 C  CG2   . THR B 2 200 ? -20.19300 -41.65200 22.24200  1.000 61.19000  ? 200 THR B CG2   1 
ATOM   5978 N  N     . LYS B 2 201 ? -18.44800 -41.17500 18.77900  1.000 58.17000  ? 201 LYS B N     1 
ATOM   5979 C  CA    . LYS B 2 201 ? -17.34300 -40.30500 18.38300  1.000 58.10000  ? 201 LYS B CA    1 
ATOM   5980 C  C     . LYS B 2 201 ? -17.74700 -39.23000 17.37800  1.000 63.24000  ? 201 LYS B C     1 
ATOM   5981 O  O     . LYS B 2 201 ? -17.33800 -38.06300 17.50400  1.000 62.93000  ? 201 LYS B O     1 
ATOM   5982 C  CB    . LYS B 2 201 ? -16.21000 -41.13000 17.79800  1.000 49.43000  ? 201 LYS B CB    1 
ATOM   5983 C  CG    . LYS B 2 201 ? -15.25000 -41.59100 18.83200  1.000 50.94000  ? 201 LYS B CG    1 
ATOM   5984 C  CD    . LYS B 2 201 ? -14.41000 -40.45500 19.36500  1.000 55.50000  ? 201 LYS B CD    1 
ATOM   5985 C  CE    . LYS B 2 201 ? -13.70600 -40.89100 20.64700  1.000 61.05000  ? 201 LYS B CE    1 
ATOM   5986 N  NZ    . LYS B 2 201 ? -14.23800 -40.23300 21.87300  1.000 62.44000  ? 201 LYS B NZ    1 
ATOM   5987 N  N     . ILE B 2 202 ? -18.52600 -39.62300 16.37000  1.000 59.31000  ? 202 ILE B N     1 
ATOM   5988 C  CA    . ILE B 2 202 ? -19.01000 -38.66600 15.37500  1.000 61.61000  ? 202 ILE B CA    1 
ATOM   5989 C  C     . ILE B 2 202 ? -19.79900 -37.55500 16.05500  1.000 64.52000  ? 202 ILE B C     1 
ATOM   5990 O  O     . ILE B 2 202 ? -19.60800 -36.35900 15.75100  1.000 59.52000  ? 202 ILE B O     1 
ATOM   5991 C  CB    . ILE B 2 202 ? -19.88000 -39.34800 14.29700  1.000 56.13000  ? 202 ILE B CB    1 
ATOM   5992 C  CG1   . ILE B 2 202 ? -18.99400 -40.22500 13.41700  1.000 53.37000  ? 202 ILE B CG1   1 
ATOM   5993 C  CG2   . ILE B 2 202 ? -20.61400 -38.31900 13.44600  1.000 48.69000  ? 202 ILE B CG2   1 
ATOM   5994 C  CD1   . ILE B 2 202 ? -17.72000 -39.53900 13.00400  1.000 48.43000  ? 202 ILE B CD1   1 
ATOM   5995 N  N     . GLU B 2 203 ? -20.66200 -37.94600 16.99500  1.000 64.40000  ? 203 GLU B N     1 
ATOM   5996 C  CA    . GLU B 2 203 ? -21.47300 -36.96900 17.71000  1.000 61.46000  ? 203 GLU B CA    1 
ATOM   5997 C  C     . GLU B 2 203 ? -20.58600 -36.13000 18.63100  1.000 65.47000  ? 203 GLU B C     1 
ATOM   5998 O  O     . GLU B 2 203 ? -20.89200 -34.96200 18.89400  1.000 62.82000  ? 203 GLU B O     1 
ATOM   5999 C  CB    . GLU B 2 203 ? -22.59800 -37.65300 18.48700  1.000 53.95000  ? 203 GLU B CB    1 
ATOM   6000 C  CG    . GLU B 2 203 ? -23.55200 -36.68700 19.19500  1.000 63.46000  ? 203 GLU B CG    1 
ATOM   6001 C  CD    . GLU B 2 203 ? -24.19400 -35.64800 18.26600  1.000 68.09000  ? 203 GLU B CD    1 
ATOM   6002 O  OE1   . GLU B 2 203 ? -24.53500 -34.54700 18.76900  1.000 63.40000  ? 203 GLU B OE1   1 
ATOM   6003 O  OE2   . GLU B 2 203 ? -24.37500 -35.93000 17.05200  1.000 68.88000  ? 203 GLU B OE2   1 
ATOM   6004 N  N     . GLU B 2 204 ? -19.47400 -36.70600 19.09400  1.000 65.61000  ? 204 GLU B N     1 
ATOM   6005 C  CA    . GLU B 2 204 ? -18.48200 -35.91200 19.81100  1.000 60.23000  ? 204 GLU B CA    1 
ATOM   6006 C  C     . GLU B 2 204 ? -17.95700 -34.77400 18.93000  1.000 65.86000  ? 204 GLU B C     1 
ATOM   6007 O  O     . GLU B 2 204 ? -17.88500 -33.62600 19.38200  1.000 72.23000  ? 204 GLU B O     1 
ATOM   6008 C  CB    . GLU B 2 204 ? -17.31900 -36.76400 20.29300  1.000 56.68000  ? 204 GLU B CB    1 
ATOM   6009 C  CG    . GLU B 2 204 ? -16.13800 -35.91700 20.75200  1.000 68.87000  ? 204 GLU B CG    1 
ATOM   6010 C  CD    . GLU B 2 204 ? -15.15800 -36.68500 21.62100  1.000 78.83000  ? 204 GLU B CD    1 
ATOM   6011 O  OE1   . GLU B 2 204 ? -15.49800 -37.82100 22.03700  1.000 70.38000  ? 204 GLU B OE1   1 
ATOM   6012 O  OE2   . GLU B 2 204 ? -14.05200 -36.14700 21.88600  1.000 80.39000  ? 204 GLU B OE2   1 
ATOM   6013 N  N     . LEU B 2 205 ? -17.61500 -35.08100 17.67600  1.000 59.75000  ? 205 LEU B N     1 
ATOM   6014 C  CA    . LEU B 2 205 ? -17.12800 -34.05700 16.74700  1.000 59.51000  ? 205 LEU B CA    1 
ATOM   6015 C  C     . LEU B 2 205 ? -18.19300 -33.00500 16.37500  1.000 59.54000  ? 205 LEU B C     1 
ATOM   6016 O  O     . LEU B 2 205 ? -17.87700 -31.82300 16.26700  1.000 59.96000  ? 205 LEU B O     1 
ATOM   6017 C  CB    . LEU B 2 205 ? -16.58100 -34.71100 15.48100  1.000 54.08000  ? 205 LEU B CB    1 
ATOM   6018 C  CG    . LEU B 2 205 ? -15.36800 -34.05700 14.79900  1.000 56.38000  ? 205 LEU B CG    1 
ATOM   6019 C  CD1   . LEU B 2 205 ? -14.94100 -34.87500 13.60900  1.000 53.43000  ? 205 LEU B CD1   1 
ATOM   6020 C  CD2   . LEU B 2 205 ? -15.62300 -32.64800 14.34700  1.000 55.74000  ? 205 LEU B CD2   1 
ATOM   6021 N  N     . ARG B 2 206 ? -19.44200 -33.41600 16.17100  1.000 60.94000  ? 206 ARG B N     1 
ATOM   6022 C  CA    . ARG B 2 206 ? -20.48600 -32.44500 15.82300  1.000 65.18000  ? 206 ARG B CA    1 
ATOM   6023 C  C     . ARG B 2 206 ? -20.67900 -31.45500 16.96700  1.000 66.10000  ? 206 ARG B C     1 
ATOM   6024 O  O     . ARG B 2 206 ? -20.83300 -30.25100 16.73500  1.000 68.75000  ? 206 ARG B O     1 
ATOM   6025 C  CB    . ARG B 2 206 ? -21.82200 -33.13400 15.48300  1.000 69.55000  ? 206 ARG B CB    1 
ATOM   6026 C  CG    . ARG B 2 206 ? -21.82200 -33.96900 14.19300  1.000 74.67000  ? 206 ARG B CG    1 
ATOM   6027 C  CD    . ARG B 2 206 ? -21.69900 -33.08400 12.93800  1.000 90.67000  ? 206 ARG B CD    1 
ATOM   6028 N  NE    . ARG B 2 206 ? -22.96000 -32.43700 12.54700  1.000 95.72000  ? 206 ARG B NE    1 
ATOM   6029 C  CZ    . ARG B 2 206 ? -23.08900 -31.56800 11.53800  1.000 83.98000  ? 206 ARG B CZ    1 
ATOM   6030 N  NH1   . ARG B 2 206 ? -22.03600 -31.22200 10.80800  1.000 83.17000  ? 206 ARG B NH1   1 
ATOM   6031 N  NH2   . ARG B 2 206 ? -24.27300 -31.04200 11.25300  1.000 70.22000  ? 206 ARG B NH2   1 
ATOM   6032 N  N     . GLN B 2 207 ? -20.67100 -31.96500 18.19800  1.000 67.15000  ? 207 GLN B N     1 
ATOM   6033 C  CA    . GLN B 2 207 ? -20.69500 -31.11400 19.38500  1.000 68.99000  ? 207 GLN B CA    1 
ATOM   6034 C  C     . GLN B 2 207 ? -19.51000 -30.15400 19.33300  1.000 72.09000  ? 207 GLN B C     1 
ATOM   6035 O  O     . GLN B 2 207 ? -19.63200 -28.94600 19.56500  1.000 74.19000  ? 207 GLN B O     1 
ATOM   6036 C  CB    . GLN B 2 207 ? -20.63900 -31.95200 20.66800  1.000 69.86000  ? 207 GLN B CB    1 
ATOM   6037 C  CG    . GLN B 2 207 ? -21.88900 -32.77200 20.97800  1.000 74.40000  ? 207 GLN B CG    1 
ATOM   6038 C  CD    . GLN B 2 207 ? -21.71900 -33.67600 22.21400  1.000 87.19000  ? 207 GLN B CD    1 
ATOM   6039 O  OE1   . GLN B 2 207 ? -20.59500 -33.97600 22.63700  1.000 80.55000  ? 207 GLN B OE1   1 
ATOM   6040 N  NE2   . GLN B 2 207 ? -22.84300 -34.11200 22.79000  1.000 82.77000  ? 207 GLN B NE2   1 
ATOM   6041 N  N     . HIS B 2 208 ? -18.35600 -30.71500 19.01000  1.000 69.77000  ? 208 HIS B N     1 
ATOM   6042 C  CA    . HIS B 2 208 ? -17.12400 -29.95300 18.91200  1.000 74.51000  ? 208 HIS B CA    1 
ATOM   6043 C  C     . HIS B 2 208 ? -17.24300 -28.83500 17.87400  1.000 69.76000  ? 208 HIS B C     1 
ATOM   6044 O  O     . HIS B 2 208 ? -16.77500 -27.71400 18.09600  1.000 70.73000  ? 208 HIS B O     1 
ATOM   6045 C  CB    . HIS B 2 208 ? -15.97000 -30.90100 18.56500  1.000 73.71000  ? 208 HIS B CB    1 
ATOM   6046 C  CG    . HIS B 2 208 ? -14.61500 -30.30400 18.74900  1.000 78.29000  ? 208 HIS B CG    1 
ATOM   6047 N  ND1   . HIS B 2 208 ? -13.84800 -30.53100 19.87200  1.000 85.32000  ? 208 HIS B ND1   1 
ATOM   6048 C  CD2   . HIS B 2 208 ? -13.88600 -29.49000 17.94800  1.000 78.79000  ? 208 HIS B CD2   1 
ATOM   6049 C  CE1   . HIS B 2 208 ? -12.70600 -29.88000 19.75700  1.000 89.43000  ? 208 HIS B CE1   1 
ATOM   6050 N  NE2   . HIS B 2 208 ? -12.70200 -29.23900 18.60200  1.000 90.15000  ? 208 HIS B NE2   1 
ATOM   6051 N  N     . LEU B 2 209 ? -17.87800 -29.14900 16.74600  1.000 68.00000  ? 209 LEU B N     1 
ATOM   6052 C  CA    . LEU B 2 209 ? -18.03500 -28.18700 15.65300  1.000 72.85000  ? 209 LEU B CA    1 
ATOM   6053 C  C     . LEU B 2 209 ? -19.17000 -27.22000 15.94600  1.000 76.57000  ? 209 LEU B C     1 
ATOM   6054 O  O     . LEU B 2 209 ? -19.10500 -26.03600 15.61200  1.000 78.74000  ? 209 LEU B O     1 
ATOM   6055 C  CB    . LEU B 2 209 ? -18.29400 -28.90400 14.31800  1.000 63.63000  ? 209 LEU B CB    1 
ATOM   6056 C  CG    . LEU B 2 209 ? -17.08200 -29.57500 13.66300  1.000 61.54000  ? 209 LEU B CG    1 
ATOM   6057 C  CD1   . LEU B 2 209 ? -17.47500 -30.21800 12.34600  1.000 57.43000  ? 209 LEU B CD1   1 
ATOM   6058 C  CD2   . LEU B 2 209 ? -15.90800 -28.60800 13.47800  1.000 65.33000  ? 209 LEU B CD2   1 
ATOM   6059 N  N     . LEU B 2 210 ? -20.22800 -27.75000 16.55000  1.000 74.56000  ? 210 LEU B N     1 
ATOM   6060 C  CA    . LEU B 2 210 ? -21.34400 -26.91400 16.97200  1.000 67.80000  ? 210 LEU B CA    1 
ATOM   6061 C  C     . LEU B 2 210 ? -20.86100 -25.78100 17.84500  1.000 75.65000  ? 210 LEU B C     1 
ATOM   6062 O  O     . LEU B 2 210 ? -21.41300 -24.66100 17.83600  1.000 77.71000  ? 210 LEU B O     1 
ATOM   6063 C  CB    . LEU B 2 210 ? -22.36200 -27.73800 17.71100  1.000 63.39000  ? 210 LEU B CB    1 
ATOM   6064 C  CG    . LEU B 2 210 ? -23.78100 -27.40400 17.35200  1.000 65.96000  ? 210 LEU B CG    1 
ATOM   6065 C  CD1   . LEU B 2 210 ? -24.05800 -28.06000 16.02800  1.000 78.47000  ? 210 LEU B CD1   1 
ATOM   6066 C  CD2   . LEU B 2 210 ? -24.64100 -27.98900 18.44200  1.000 75.86000  ? 210 LEU B CD2   1 
ATOM   6067 N  N     . ARG B 2 211 ? -19.82700 -26.10600 18.60400  1.000 78.46000  ? 211 ARG B N     1 
ATOM   6068 C  CA    . ARG B 2 211 ? -19.29100 -25.21800 19.60600  1.000 75.78000  ? 211 ARG B CA    1 
ATOM   6069 C  C     . ARG B 2 211 ? -18.50500 -24.06100 19.00900  1.000 84.48000  ? 211 ARG B C     1 
ATOM   6070 O  O     . ARG B 2 211 ? -18.24900 -23.07200 19.68900  1.000 90.32000  ? 211 ARG B O     1 
ATOM   6071 C  CB    . ARG B 2 211 ? -18.39900 -25.98900 20.55100  1.000 76.20000  ? 211 ARG B CB    1 
ATOM   6072 C  CG    . ARG B 2 211 ? -18.72400 -25.67700 21.97900  1.000 79.44000  ? 211 ARG B CG    1 
ATOM   6073 C  CD    . ARG B 2 211 ? -18.24200 -26.78200 22.87700  1.000 83.20000  ? 211 ARG B CD    1 
ATOM   6074 N  NE    . ARG B 2 211 ? -16.81900 -26.62300 23.15300  1.000 100.86000 ? 211 ARG B NE    1 
ATOM   6075 C  CZ    . ARG B 2 211 ? -15.91300 -27.58800 23.01600  1.000 104.79000 ? 211 ARG B CZ    1 
ATOM   6076 N  NH1   . ARG B 2 211 ? -16.28500 -28.80000 22.61000  1.000 91.52000  ? 211 ARG B NH1   1 
ATOM   6077 N  NH2   . ARG B 2 211 ? -14.63600 -27.34300 23.29900  1.000 102.29000 ? 211 ARG B NH2   1 
ATOM   6078 N  N     . TRP B 2 212 ? -18.08900 -24.19000 17.75300  1.000 83.44000  ? 212 TRP B N     1 
ATOM   6079 C  CA    . TRP B 2 212 ? -17.35100 -23.10800 17.11200  1.000 78.19000  ? 212 TRP B CA    1 
ATOM   6080 C  C     . TRP B 2 212 ? -18.25700 -22.19700 16.32100  1.000 76.80000  ? 212 TRP B C     1 
ATOM   6081 O  O     . TRP B 2 212 ? -18.64500 -22.55900 15.21400  1.000 81.29000  ? 212 TRP B O     1 
ATOM   6082 C  CB    . TRP B 2 212 ? -16.27400 -23.67300 16.20400  1.000 80.13000  ? 212 TRP B CB    1 
ATOM   6083 C  CG    . TRP B 2 212 ? -14.97500 -23.80100 16.84700  1.000 91.58000  ? 212 TRP B CG    1 
ATOM   6084 C  CD1   . TRP B 2 212 ? -14.62000 -24.67500 17.84700  1.000 94.04000  ? 212 TRP B CD1   1 
ATOM   6085 C  CD2   . TRP B 2 212 ? -13.80000 -23.05400 16.51900  1.000 103.40000 ? 212 TRP B CD2   1 
ATOM   6086 N  NE1   . TRP B 2 212 ? -13.28800 -24.50200 18.16700  1.000 99.22000  ? 212 TRP B NE1   1 
ATOM   6087 C  CE2   . TRP B 2 212 ? -12.76100 -23.51500 17.36700  1.000 103.71000 ? 212 TRP B CE2   1 
ATOM   6088 C  CE3   . TRP B 2 212 ? -13.52100 -22.03500 15.58800  1.000 101.77000 ? 212 TRP B CE3   1 
ATOM   6089 C  CZ2   . TRP B 2 212 ? -11.46100 -22.99000 17.31100  1.000 97.42000  ? 212 TRP B CZ2   1 
ATOM   6090 C  CZ3   . TRP B 2 212 ? -12.22900 -21.51400 15.53400  1.000 95.63000  ? 212 TRP B CZ3   1 
ATOM   6091 C  CH2   . TRP B 2 212 ? -11.21700 -21.99400 16.39400  1.000 91.94000  ? 212 TRP B CH2   1 
ATOM   6092 N  N     . GLU B 2 233 ? -23.79500 -44.42300 6.16600   1.000 73.45000  ? 233 GLU B N     1 
ATOM   6093 C  CA    . GLU B 2 233 ? -22.47700 -44.73800 6.70100   1.000 64.53000  ? 233 GLU B CA    1 
ATOM   6094 C  C     . GLU B 2 233 ? -21.60400 -45.44500 5.70000   1.000 74.03000  ? 233 GLU B C     1 
ATOM   6095 O  O     . GLU B 2 233 ? -22.07800 -46.33300 5.02200   1.000 77.40000  ? 233 GLU B O     1 
ATOM   6096 C  CB    . GLU B 2 233 ? -22.58600 -45.63100 7.90700   1.000 65.71000  ? 233 GLU B CB    1 
ATOM   6097 C  CG    . GLU B 2 233 ? -23.51900 -45.18800 8.97400   1.000 86.92000  ? 233 GLU B CG    1 
ATOM   6098 C  CD    . GLU B 2 233 ? -22.93600 -45.45700 10.32800  1.000 87.62000  ? 233 GLU B CD    1 
ATOM   6099 O  OE1   . GLU B 2 233 ? -22.04500 -46.32200 10.40900  1.000 84.62000  ? 233 GLU B OE1   1 
ATOM   6100 O  OE2   . GLU B 2 233 ? -23.34200 -44.79100 11.29600  1.000 84.78000  ? 233 GLU B OE2   1 
ATOM   6101 N  N     . LEU B 2 234 ? -20.32800 -45.08600 5.60500   1.000 66.41000  ? 234 LEU B N     1 
ATOM   6102 C  CA    . LEU B 2 234 ? -19.45300 -45.75400 4.63600   1.000 52.06000  ? 234 LEU B CA    1 
ATOM   6103 C  C     . LEU B 2 234 ? -18.63300 -46.86100 5.26000   1.000 58.67000  ? 234 LEU B C     1 
ATOM   6104 O  O     . LEU B 2 234 ? -18.35400 -46.83300 6.45100   1.000 65.19000  ? 234 LEU B O     1 
ATOM   6105 C  CB    . LEU B 2 234 ? -18.50200 -44.76000 3.98500   1.000 55.71000  ? 234 LEU B CB    1 
ATOM   6106 C  CG    . LEU B 2 234 ? -18.81800 -44.26800 2.58400   1.000 55.37000  ? 234 LEU B CG    1 
ATOM   6107 C  CD1   . LEU B 2 234 ? -20.18600 -43.64400 2.54900   1.000 51.15000  ? 234 LEU B CD1   1 
ATOM   6108 C  CD2   . LEU B 2 234 ? -17.75200 -43.26500 2.19200   1.000 51.63000  ? 234 LEU B CD2   1 
ATOM   6109 N  N     . HIS B 2 235 ? -18.22400 -47.82000 4.43400   1.000 62.72000  ? 235 HIS B N     1 
ATOM   6110 C  CA    . HIS B 2 235 ? -17.33200 -48.90400 4.84200   1.000 60.11000  ? 235 HIS B CA    1 
ATOM   6111 C  C     . HIS B 2 235 ? -16.36300 -49.24100 3.72300   1.000 60.03000  ? 235 HIS B C     1 
ATOM   6112 O  O     . HIS B 2 235 ? -16.59100 -50.18200 2.97700   1.000 65.76000  ? 235 HIS B O     1 
ATOM   6113 C  CB    . HIS B 2 235 ? -18.12100 -50.17000 5.21900   1.000 63.52000  ? 235 HIS B CB    1 
ATOM   6114 C  CG    . HIS B 2 235 ? -19.14600 -49.95100 6.28400   1.000 66.52000  ? 235 HIS B CG    1 
ATOM   6115 N  ND1   . HIS B 2 235 ? -18.81500 -49.74600 7.60800   1.000 67.92000  ? 235 HIS B ND1   1 
ATOM   6116 C  CD2   . HIS B 2 235 ? -20.49900 -49.89300 6.22200   1.000 62.98000  ? 235 HIS B CD2   1 
ATOM   6117 C  CE1   . HIS B 2 235 ? -19.91700 -49.56800 8.31300   1.000 71.96000  ? 235 HIS B CE1   1 
ATOM   6118 N  NE2   . HIS B 2 235 ? -20.95400 -49.65100 7.49700   1.000 68.75000  ? 235 HIS B NE2   1 
ATOM   6119 N  N     . PRO B 2 236 ? -15.26400 -48.48900 3.60500   1.000 62.34000  ? 236 PRO B N     1 
ATOM   6120 C  CA    . PRO B 2 236 ? -14.31900 -48.71900 2.49800   1.000 65.93000  ? 236 PRO B CA    1 
ATOM   6121 C  C     . PRO B 2 236 ? -13.55500 -50.05100 2.57000   1.000 67.67000  ? 236 PRO B C     1 
ATOM   6122 O  O     . PRO B 2 236 ? -12.61200 -50.25300 1.80300   1.000 77.08000  ? 236 PRO B O     1 
ATOM   6123 C  CB    . PRO B 2 236 ? -13.35400 -47.52500 2.59700   1.000 58.81000  ? 236 PRO B CB    1 
ATOM   6124 C  CG    . PRO B 2 236 ? -13.51700 -47.00100 3.97100   1.000 62.19000  ? 236 PRO B CG    1 
ATOM   6125 C  CD    . PRO B 2 236 ? -14.92100 -47.30300 4.40300   1.000 56.73000  ? 236 PRO B CD    1 
ATOM   6126 N  N     . ASP B 2 237 ? -13.95900 -50.94300 3.46800   1.000 73.22000  ? 237 ASP B N     1 
ATOM   6127 C  CA    . ASP B 2 237 ? -13.44400 -52.31500 3.49300   1.000 78.77000  ? 237 ASP B CA    1 
ATOM   6128 C  C     . ASP B 2 237 ? -14.20700 -53.17800 2.51400   1.000 77.22000  ? 237 ASP B C     1 
ATOM   6129 O  O     . ASP B 2 237 ? -13.62700 -53.95800 1.76100   1.000 81.24000  ? 237 ASP B O     1 
ATOM   6130 C  CB    . ASP B 2 237 ? -13.56900 -52.92600 4.88800   1.000 79.43000  ? 237 ASP B CB    1 
ATOM   6131 C  CG    . ASP B 2 237 ? -12.54600 -52.39000 5.84300   1.000 88.02000  ? 237 ASP B CG    1 
ATOM   6132 O  OD1   . ASP B 2 237 ? -11.47700 -51.95100 5.36000   1.000 87.90000  ? 237 ASP B OD1   1 
ATOM   6133 O  OD2   . ASP B 2 237 ? -12.80800 -52.41500 7.06800   1.000 87.56000  ? 237 ASP B OD2   1 
ATOM   6134 N  N     . LYS B 2 238 ? -15.52500 -53.02000 2.55900   1.000 78.41000  ? 238 LYS B N     1 
ATOM   6135 C  CA    . LYS B 2 238 ? -16.46700 -53.78000 1.75000   1.000 80.06000  ? 238 LYS B CA    1 
ATOM   6136 C  C     . LYS B 2 238 ? -16.21800 -53.62500 0.25200   1.000 82.03000  ? 238 LYS B C     1 
ATOM   6137 O  O     . LYS B 2 238 ? -16.48300 -54.55000 -0.51600  1.000 85.17000  ? 238 LYS B O     1 
ATOM   6138 C  CB    . LYS B 2 238 ? -17.90600 -53.35400 2.09400   1.000 81.87000  ? 238 LYS B CB    1 
ATOM   6139 C  CG    . LYS B 2 238 ? -19.00700 -54.03300 1.27200   1.000 85.07000  ? 238 LYS B CG    1 
ATOM   6140 C  CD    . LYS B 2 238 ? -18.84300 -55.54900 1.26200   1.000 85.17000  ? 238 LYS B CD    1 
ATOM   6141 C  CE    . LYS B 2 238 ? -20.06200 -56.25900 1.82700   1.000 85.14000  ? 238 LYS B CE    1 
ATOM   6142 N  NZ    . LYS B 2 238 ? -19.82300 -57.72900 1.90800   1.000 84.73000  ? 238 LYS B NZ    1 
ATOM   6143 N  N     . TRP B 2 239 ? -15.70800 -52.46300 -0.15900  1.000 79.24000  ? 239 TRP B N     1 
ATOM   6144 C  CA    . TRP B 2 239 ? -15.51400 -52.16900 -1.58000  1.000 76.23000  ? 239 TRP B CA    1 
ATOM   6145 C  C     . TRP B 2 239 ? -14.62300 -53.22600 -2.21200  1.000 80.03000  ? 239 TRP B C     1 
ATOM   6146 O  O     . TRP B 2 239 ? -13.52900 -53.50300 -1.70500  1.000 76.79000  ? 239 TRP B O     1 
ATOM   6147 C  CB    . TRP B 2 239 ? -14.89700 -50.78300 -1.78100  1.000 70.58000  ? 239 TRP B CB    1 
ATOM   6148 C  CG    . TRP B 2 239 ? -15.67700 -49.66300 -1.17400  1.000 61.15000  ? 239 TRP B CG    1 
ATOM   6149 C  CD1   . TRP B 2 239 ? -16.92400 -49.73000 -0.62600  1.000 59.91000  ? 239 TRP B CD1   1 
ATOM   6150 C  CD2   . TRP B 2 239 ? -15.25600 -48.30100 -1.04400  1.000 56.13000  ? 239 TRP B CD2   1 
ATOM   6151 N  NE1   . TRP B 2 239 ? -17.30700 -48.49600 -0.16600  1.000 56.80000  ? 239 TRP B NE1   1 
ATOM   6152 C  CE2   . TRP B 2 239 ? -16.30000 -47.60000 -0.41300  1.000 59.29000  ? 239 TRP B CE2   1 
ATOM   6153 C  CE3   . TRP B 2 239 ? -14.09400 -47.60900 -1.40500  1.000 55.29000  ? 239 TRP B CE3   1 
ATOM   6154 C  CZ2   . TRP B 2 239 ? -16.22200 -46.23200 -0.13300  1.000 55.44000  ? 239 TRP B CZ2   1 
ATOM   6155 C  CZ3   . TRP B 2 239 ? -14.01400 -46.25400 -1.12800  1.000 53.58000  ? 239 TRP B CZ3   1 
ATOM   6156 C  CH2   . TRP B 2 239 ? -15.07500 -45.57900 -0.50100  1.000 52.65000  ? 239 TRP B CH2   1 
ATOM   6157 N  N     . THR B 2 240 ? -15.10600 -53.83900 -3.29400  1.000 73.31000  ? 240 THR B N     1 
ATOM   6158 C  CA    . THR B 2 240 ? -14.32300 -54.85600 -3.99600  1.000 74.72000  ? 240 THR B CA    1 
ATOM   6159 C  C     . THR B 2 240 ? -14.37300 -54.68600 -5.50000  1.000 71.66000  ? 240 THR B C     1 
ATOM   6160 O  O     . THR B 2 240 ? -15.38000 -54.25100 -6.07300  1.000 67.86000  ? 240 THR B O     1 
ATOM   6161 C  CB    . THR B 2 240 ? -14.77500 -56.31300 -3.67400  1.000 71.55000  ? 240 THR B CB    1 
ATOM   6162 O  OG1   . THR B 2 240 ? -16.14700 -56.50300 -4.04800  1.000 69.73000  ? 240 THR B OG1   1 
ATOM   6163 C  CG2   . THR B 2 240 ? -14.57100 -56.64900 -2.19500  1.000 72.45000  ? 240 THR B CG2   1 
ATOM   6164 N  N     . VAL B 2 241 ? -13.25300 -55.04800 -6.11700  1.000 71.11000  ? 241 VAL B N     1 
ATOM   6165 C  CA    . VAL B 2 241 ? -13.10100 -55.05700 -7.55700  1.000 64.50000  ? 241 VAL B CA    1 
ATOM   6166 C  C     . VAL B 2 241 ? -13.94500 -56.17600 -8.19400  1.000 68.50000  ? 241 VAL B C     1 
ATOM   6167 O  O     . VAL B 2 241 ? -14.14500 -57.24600 -7.59600  1.000 64.03000  ? 241 VAL B O     1 
ATOM   6168 C  CB    . VAL B 2 241 ? -11.60400 -55.19900 -7.92600  1.000 60.56000  ? 241 VAL B CB    1 
ATOM   6169 C  CG1   . VAL B 2 241 ? -11.40600 -56.03600 -9.18300  1.000 64.26000  ? 241 VAL B CG1   1 
ATOM   6170 C  CG2   . VAL B 2 241 ? -10.97400 -53.82100 -8.07400  1.000 59.67000  ? 241 VAL B CG2   1 
ATOM   6171 N  N     . GLN B 2 242 ? -14.47400 -55.89000 -9.38700  1.000 62.74000  ? 242 GLN B N     1 
ATOM   6172 C  CA    . GLN B 2 242 ? -15.20100 -56.86300 -10.18900 1.000 57.01000  ? 242 GLN B CA    1 
ATOM   6173 C  C     . GLN B 2 242 ? -14.32000 -57.36700 -11.33300 1.000 60.83000  ? 242 GLN B C     1 
ATOM   6174 O  O     . GLN B 2 242 ? -14.19500 -56.69100 -12.35100 1.000 59.67000  ? 242 GLN B O     1 
ATOM   6175 C  CB    . GLN B 2 242 ? -16.48700 -56.24400 -10.73400 1.000 50.17000  ? 242 GLN B CB    1 
ATOM   6176 C  CG    . GLN B 2 242 ? -17.30100 -57.18600 -11.58700 1.000 61.70000  ? 242 GLN B CG    1 
ATOM   6177 C  CD    . GLN B 2 242 ? -17.57600 -58.51200 -10.89500 1.000 65.34000  ? 242 GLN B CD    1 
ATOM   6178 O  OE1   . GLN B 2 242 ? -18.30500 -58.56600 -9.89700  1.000 71.55000  ? 242 GLN B OE1   1 
ATOM   6179 N  NE2   . GLN B 2 242 ? -16.99500 -59.59500 -11.42600 1.000 63.83000  ? 242 GLN B NE2   1 
ATOM   6180 N  N     . PRO B 2 243 ? -13.69600 -58.55300 -11.16200 1.000 61.00000  ? 243 PRO B N     1 
ATOM   6181 C  CA    . PRO B 2 243 ? -12.82900 -59.12400 -12.19300 1.000 58.69000  ? 243 PRO B CA    1 
ATOM   6182 C  C     . PRO B 2 243 ? -13.59800 -59.49800 -13.44600 1.000 58.57000  ? 243 PRO B C     1 
ATOM   6183 O  O     . PRO B 2 243 ? -14.80200 -59.77000 -13.36900 1.000 53.45000  ? 243 PRO B O     1 
ATOM   6184 C  CB    . PRO B 2 243 ? -12.27000 -60.38400 -11.52200 1.000 55.33000  ? 243 PRO B CB    1 
ATOM   6185 C  CG    . PRO B 2 243 ? -13.31900 -60.78200 -10.56100 1.000 49.70000  ? 243 PRO B CG    1 
ATOM   6186 C  CD    . PRO B 2 243 ? -13.85500 -59.48200 -10.02800 1.000 62.59000  ? 243 PRO B CD    1 
ATOM   6187 N  N     . ILE B 2 244 ? -12.90500 -59.50700 -14.58100 1.000 60.03000  ? 244 ILE B N     1 
ATOM   6188 C  CA    . ILE B 2 244 ? -13.45500 -60.04900 -15.81600 1.000 58.50000  ? 244 ILE B CA    1 
ATOM   6189 C  C     . ILE B 2 244 ? -13.61300 -61.56700 -15.68200 1.000 59.92000  ? 244 ILE B C     1 
ATOM   6190 O  O     . ILE B 2 244 ? -12.76800 -62.26000 -15.10300 1.000 49.40000  ? 244 ILE B O     1 
ATOM   6191 C  CB    . ILE B 2 244 ? -12.57800 -59.69900 -17.02900 1.000 57.36000  ? 244 ILE B CB    1 
ATOM   6192 C  CG1   . ILE B 2 244 ? -12.48800 -58.17900 -17.17800 1.000 58.78000  ? 244 ILE B CG1   1 
ATOM   6193 C  CG2   . ILE B 2 244 ? -13.12700 -60.32100 -18.30600 1.000 54.94000  ? 244 ILE B CG2   1 
ATOM   6194 C  CD1   . ILE B 2 244 ? -11.65200 -57.73200 -18.34900 1.000 54.93000  ? 244 ILE B CD1   1 
ATOM   6195 N  N     . VAL B 2 245 ? -14.72500 -62.05900 -16.21500 1.000 65.76000  ? 245 VAL B N     1 
ATOM   6196 C  CA    . VAL B 2 245 ? -15.18700 -63.42300 -16.00000 1.000 66.47000  ? 245 VAL B CA    1 
ATOM   6197 C  C     . VAL B 2 245 ? -15.11000 -64.22000 -17.30900 1.000 63.03000  ? 245 VAL B C     1 
ATOM   6198 O  O     . VAL B 2 245 ? -15.24600 -63.64600 -18.39100 1.000 64.80000  ? 245 VAL B O     1 
ATOM   6199 C  CB    . VAL B 2 245 ? -16.63900 -63.40900 -15.46000 1.000 75.70000  ? 245 VAL B CB    1 
ATOM   6200 C  CG1   . VAL B 2 245 ? -16.84900 -62.20100 -14.52500 1.000 61.10000  ? 245 VAL B CG1   1 
ATOM   6201 C  CG2   . VAL B 2 245 ? -17.65900 -63.34500 -16.61100 1.000 71.16000  ? 245 VAL B CG2   1 
ATOM   6202 N  N     . LEU B 2 246 ? -14.87100 -65.52700 -17.23000 1.000 61.47000  ? 246 LEU B N     1 
ATOM   6203 C  CA    . LEU B 2 246 ? -14.92100 -66.35600 -18.43400 1.000 58.86000  ? 246 LEU B CA    1 
ATOM   6204 C  C     . LEU B 2 246 ? -15.91700 -67.49000 -18.24400 1.000 64.54000  ? 246 LEU B C     1 
ATOM   6205 O  O     . LEU B 2 246 ? -15.92500 -68.14100 -17.19900 1.000 64.48000  ? 246 LEU B O     1 
ATOM   6206 C  CB    . LEU B 2 246 ? -13.54500 -66.91700 -18.79500 1.000 51.72000  ? 246 LEU B CB    1 
ATOM   6207 C  CG    . LEU B 2 246 ? -12.49700 -65.93000 -19.31100 1.000 50.38000  ? 246 LEU B CG    1 
ATOM   6208 C  CD1   . LEU B 2 246 ? -11.30600 -66.68500 -19.86700 1.000 49.79000  ? 246 LEU B CD1   1 
ATOM   6209 C  CD2   . LEU B 2 246 ? -13.06400 -64.98900 -20.35600 1.000 44.22000  ? 246 LEU B CD2   1 
ATOM   6210 N  N     . PRO B 2 247 ? -16.76200 -67.72800 -19.26200 1.000 65.94000  ? 247 PRO B N     1 
ATOM   6211 C  CA    . PRO B 2 247 ? -17.78500 -68.76800 -19.13700 1.000 62.85000  ? 247 PRO B CA    1 
ATOM   6212 C  C     . PRO B 2 247 ? -17.12300 -70.09100 -18.80400 1.000 64.16000  ? 247 PRO B C     1 
ATOM   6213 O  O     . PRO B 2 247 ? -16.00100 -70.30600 -19.26300 1.000 62.36000  ? 247 PRO B O     1 
ATOM   6214 C  CB    . PRO B 2 247 ? -18.43200 -68.81400 -20.53500 1.000 60.03000  ? 247 PRO B CB    1 
ATOM   6215 C  CG    . PRO B 2 247 ? -18.00300 -67.56700 -21.23400 1.000 61.53000  ? 247 PRO B CG    1 
ATOM   6216 C  CD    . PRO B 2 247 ? -16.68500 -67.17800 -20.63000 1.000 63.67000  ? 247 PRO B CD    1 
ATOM   6217 N  N     . GLU B 2 248 ? -17.75800 -70.93700 -18.00100 1.000 60.72000  ? 248 GLU B N     1 
ATOM   6218 C  CA    . GLU B 2 248 ? -17.30300 -72.31400 -17.92500 1.000 63.68000  ? 248 GLU B CA    1 
ATOM   6219 C  C     . GLU B 2 248 ? -18.47300 -73.24100 -18.15700 1.000 64.84000  ? 248 GLU B C     1 
ATOM   6220 O  O     . GLU B 2 248 ? -19.54200 -73.06300 -17.57600 1.000 65.75000  ? 248 GLU B O     1 
ATOM   6221 C  CB    . GLU B 2 248 ? -16.62800 -72.63400 -16.59600 1.000 71.12000  ? 248 GLU B CB    1 
ATOM   6222 C  CG    . GLU B 2 248 ? -15.83800 -73.94600 -16.68200 1.000 75.55000  ? 248 GLU B CG    1 
ATOM   6223 C  CD    . GLU B 2 248 ? -14.94900 -74.20900 -15.48500 1.000 89.60000  ? 248 GLU B CD    1 
ATOM   6224 O  OE1   . GLU B 2 248 ? -15.39200 -73.94100 -14.34800 1.000 102.35000 ? 248 GLU B OE1   1 
ATOM   6225 O  OE2   . GLU B 2 248 ? -13.80600 -74.68600 -15.68300 1.000 88.84000  ? 248 GLU B OE2   1 
ATOM   6226 N  N     . LYS B 2 249 ? -18.25800 -74.23100 -19.01700 1.000 61.78000  ? 249 LYS B N     1 
ATOM   6227 C  CA    . LYS B 2 249 ? -19.33200 -75.09800 -19.44900 1.000 59.16000  ? 249 LYS B CA    1 
ATOM   6228 C  C     . LYS B 2 249 ? -18.80100 -76.38800 -20.09000 1.000 66.93000  ? 249 LYS B C     1 
ATOM   6229 O  O     . LYS B 2 249 ? -17.61600 -76.49200 -20.43300 1.000 59.97000  ? 249 LYS B O     1 
ATOM   6230 C  CB    . LYS B 2 249 ? -20.24100 -74.33900 -20.41500 1.000 59.27000  ? 249 LYS B CB    1 
ATOM   6231 C  CG    . LYS B 2 249 ? -19.55900 -73.85200 -21.67300 1.000 51.00000  ? 249 LYS B CG    1 
ATOM   6232 C  CD    . LYS B 2 249 ? -20.51300 -73.06000 -22.54400 1.000 47.23000  ? 249 LYS B CD    1 
ATOM   6233 C  CE    . LYS B 2 249 ? -20.90100 -71.77000 -21.86300 1.000 52.68000  ? 249 LYS B CE    1 
ATOM   6234 N  NZ    . LYS B 2 249 ? -21.62200 -70.84100 -22.77400 1.000 53.55000  ? 249 LYS B NZ    1 
ATOM   6235 N  N     . ASP B 2 250 ? -19.68700 -77.36900 -20.25300 1.000 70.90000  ? 250 ASP B N     1 
ATOM   6236 C  CA    . ASP B 2 250 ? -19.26300 -78.70900 -20.63900 1.000 62.27000  ? 250 ASP B CA    1 
ATOM   6237 C  C     . ASP B 2 250 ? -19.31900 -78.96000 -22.13000 1.000 62.35000  ? 250 ASP B C     1 
ATOM   6238 O  O     . ASP B 2 250 ? -18.54600 -79.76200 -22.64700 1.000 72.78000  ? 250 ASP B O     1 
ATOM   6239 C  CB    . ASP B 2 250 ? -20.09700 -79.74600 -19.90800 1.000 69.26000  ? 250 ASP B CB    1 
ATOM   6240 C  CG    . ASP B 2 250 ? -19.89400 -79.68500 -18.41400 1.000 81.03000  ? 250 ASP B CG    1 
ATOM   6241 O  OD1   . ASP B 2 250 ? -18.77400 -79.32600 -17.98700 1.000 72.42000  ? 250 ASP B OD1   1 
ATOM   6242 O  OD2   . ASP B 2 250 ? -20.85300 -79.98400 -17.66800 1.000 99.16000  ? 250 ASP B OD2   1 
ATOM   6243 N  N     . SER B 2 251 ? -20.22300 -78.30300 -22.84000 1.000 58.22000  ? 251 SER B N     1 
ATOM   6244 C  CA    . SER B 2 251 ? -20.09200 -78.30900 -24.29500 1.000 59.17000  ? 251 SER B CA    1 
ATOM   6245 C  C     . SER B 2 251 ? -20.11100 -76.87800 -24.81700 1.000 52.44000  ? 251 SER B C     1 
ATOM   6246 O  O     . SER B 2 251 ? -20.84500 -76.01700 -24.33700 1.000 52.79000  ? 251 SER B O     1 
ATOM   6247 C  CB    . SER B 2 251 ? -21.17600 -79.16400 -24.97100 1.000 56.23000  ? 251 SER B CB    1 
ATOM   6248 O  OG    . SER B 2 251 ? -22.48000 -78.68400 -24.70200 1.000 59.44000  ? 251 SER B OG    1 
ATOM   6249 N  N     . TRP B 2 252 ? -19.25000 -76.62200 -25.78300 1.000 51.92000  ? 252 TRP B N     1 
ATOM   6250 C  CA    . TRP B 2 252 ? -19.17400 -75.30900 -26.38500 1.000 47.77000  ? 252 TRP B CA    1 
ATOM   6251 C  C     . TRP B 2 252 ? -19.66600 -75.42900 -27.81900 1.000 43.54000  ? 252 TRP B C     1 
ATOM   6252 O  O     . TRP B 2 252 ? -19.30200 -76.37600 -28.52600 1.000 41.49000  ? 252 TRP B O     1 
ATOM   6253 C  CB    . TRP B 2 252 ? -17.73400 -74.76100 -26.33500 1.000 47.39000  ? 252 TRP B CB    1 
ATOM   6254 C  CG    . TRP B 2 252 ? -17.17900 -74.60600 -24.93600 1.000 52.36000  ? 252 TRP B CG    1 
ATOM   6255 C  CD1   . TRP B 2 252 ? -16.79000 -75.60800 -24.08600 1.000 55.00000  ? 252 TRP B CD1   1 
ATOM   6256 C  CD2   . TRP B 2 252 ? -16.94300 -73.37800 -24.23600 1.000 49.00000  ? 252 TRP B CD2   1 
ATOM   6257 N  NE1   . TRP B 2 252 ? -16.33800 -75.07700 -22.89600 1.000 53.15000  ? 252 TRP B NE1   1 
ATOM   6258 C  CE2   . TRP B 2 252 ? -16.42400 -73.71100 -22.96400 1.000 51.68000  ? 252 TRP B CE2   1 
ATOM   6259 C  CE3   . TRP B 2 252 ? -17.12000 -72.03000 -24.55700 1.000 47.51000  ? 252 TRP B CE3   1 
ATOM   6260 C  CZ2   . TRP B 2 252 ? -16.09200 -72.74700 -22.01900 1.000 54.19000  ? 252 TRP B CZ2   1 
ATOM   6261 C  CZ3   . TRP B 2 252 ? -16.78900 -71.07200 -23.61300 1.000 47.92000  ? 252 TRP B CZ3   1 
ATOM   6262 C  CH2   . TRP B 2 252 ? -16.28000 -71.43600 -22.36300 1.000 54.59000  ? 252 TRP B CH2   1 
ATOM   6263 N  N     . THR B 2 253 ? -20.50000 -74.48800 -28.25000 1.000 36.22000  ? 253 THR B N     1 
ATOM   6264 C  CA    . THR B 2 253 ? -20.81400 -74.38000 -29.66700 1.000 33.50000  ? 253 THR B CA    1 
ATOM   6265 C  C     . THR B 2 253 ? -19.86900 -73.40600 -30.33500 1.000 33.36000  ? 253 THR B C     1 
ATOM   6266 O  O     . THR B 2 253 ? -19.18400 -72.64300 -29.66100 1.000 35.54000  ? 253 THR B O     1 
ATOM   6267 C  CB    . THR B 2 253 ? -22.21500 -73.89700 -29.89400 1.000 33.33000  ? 253 THR B CB    1 
ATOM   6268 O  OG1   . THR B 2 253 ? -22.29600 -72.52000 -29.48500 1.000 35.85000  ? 253 THR B OG1   1 
ATOM   6269 C  CG2   . THR B 2 253 ? -23.14400 -74.72900 -29.08200 1.000 30.98000  ? 253 THR B CG2   1 
ATOM   6270 N  N     . VAL B 2 254 ? -19.82700 -73.43800 -31.66000 1.000 31.50000  ? 254 VAL B N     1 
ATOM   6271 C  CA    . VAL B 2 254 ? -19.11100 -72.43400 -32.42600 1.000 30.10000  ? 254 VAL B CA    1 
ATOM   6272 C  C     . VAL B 2 254 ? -19.47500 -71.03300 -31.94500 1.000 35.21000  ? 254 VAL B C     1 
ATOM   6273 O  O     . VAL B 2 254 ? -18.62500 -70.15600 -31.81400 1.000 37.20000  ? 254 VAL B O     1 
ATOM   6274 C  CB    . VAL B 2 254 ? -19.43500 -72.54400 -33.91300 1.000 32.16000  ? 254 VAL B CB    1 
ATOM   6275 C  CG1   . VAL B 2 254 ? -18.83700 -71.36700 -34.69000 1.000 27.42000  ? 254 VAL B CG1   1 
ATOM   6276 C  CG2   . VAL B 2 254 ? -18.96000 -73.88200 -34.45500 1.000 30.85000  ? 254 VAL B CG2   1 
ATOM   6277 N  N     . ASN B 2 255 ? -20.74800 -70.80900 -31.66900 1.000 35.35000  ? 255 ASN B N     1 
ATOM   6278 C  CA    . ASN B 2 255 ? -21.14000 -69.49200 -31.19400 1.000 36.82000  ? 255 ASN B CA    1 
ATOM   6279 C  C     . ASN B 2 255 ? -20.51600 -69.15700 -29.84100 1.000 38.03000  ? 255 ASN B C     1 
ATOM   6280 O  O     . ASN B 2 255 ? -19.97500 -68.07900 -29.68100 1.000 39.61000  ? 255 ASN B O     1 
ATOM   6281 C  CB    . ASN B 2 255 ? -22.66000 -69.38400 -31.11700 1.000 32.94000  ? 255 ASN B CB    1 
ATOM   6282 C  CG    . ASN B 2 255 ? -23.11100 -68.01100 -30.72600 1.000 37.29000  ? 255 ASN B CG    1 
ATOM   6283 O  OD1   . ASN B 2 255 ? -23.06100 -67.08200 -31.52100 1.000 39.70000  ? 255 ASN B OD1   1 
ATOM   6284 N  ND2   . ASN B 2 255 ? -23.53700 -67.86400 -29.49000 1.000 39.29000  ? 255 ASN B ND2   1 
ATOM   6285 N  N     . ASP B 2 256 ? -20.59800 -70.07600 -28.87500 1.000 41.43000  ? 256 ASP B N     1 
ATOM   6286 C  CA    . ASP B 2 256 ? -19.93600 -69.90400 -27.58000 1.000 37.93000  ? 256 ASP B CA    1 
ATOM   6287 C  C     . ASP B 2 256 ? -18.47600 -69.49400 -27.79100 1.000 35.98000  ? 256 ASP B C     1 
ATOM   6288 O  O     . ASP B 2 256 ? -18.03400 -68.46600 -27.28200 1.000 37.91000  ? 256 ASP B O     1 
ATOM   6289 C  CB    . ASP B 2 256 ? -20.00200 -71.19100 -26.74300 1.000 36.15000  ? 256 ASP B CB    1 
ATOM   6290 C  CG    . ASP B 2 256 ? -21.40500 -71.51200 -26.24800 1.000 46.02000  ? 256 ASP B CG    1 
ATOM   6291 O  OD1   . ASP B 2 256 ? -22.15800 -70.56900 -25.90100 1.000 50.60000  ? 256 ASP B OD1   1 
ATOM   6292 O  OD2   . ASP B 2 256 ? -21.75200 -72.72100 -26.19500 1.000 48.55000  ? 256 ASP B OD2   1 
ATOM   6293 N  N     . ILE B 2 257 ? -17.74800 -70.27600 -28.57700 1.000 33.25000  ? 257 ILE B N     1 
ATOM   6294 C  CA    . ILE B 2 257 ? -16.33000 -70.03300 -28.77700 1.000 34.85000  ? 257 ILE B CA    1 
ATOM   6295 C  C     . ILE B 2 257 ? -16.07000 -68.72100 -29.49500 1.000 35.77000  ? 257 ILE B C     1 
ATOM   6296 O  O     . ILE B 2 257 ? -15.11000 -68.02400 -29.16100 1.000 41.19000  ? 257 ILE B O     1 
ATOM   6297 C  CB    . ILE B 2 257 ? -15.67400 -71.17600 -29.55500 1.000 36.27000  ? 257 ILE B CB    1 
ATOM   6298 C  CG1   . ILE B 2 257 ? -15.87500 -72.49100 -28.81400 1.000 34.92000  ? 257 ILE B CG1   1 
ATOM   6299 C  CG2   . ILE B 2 257 ? -14.20200 -70.91900 -29.74300 1.000 33.81000  ? 257 ILE B CG2   1 
ATOM   6300 C  CD1   . ILE B 2 257 ? -15.26200 -73.65900 -29.52300 1.000 40.99000  ? 257 ILE B CD1   1 
ATOM   6301 N  N     . GLN B 2 258 ? -16.91900 -68.36000 -30.45700 1.000 37.79000  ? 258 GLN B N     1 
ATOM   6302 C  CA    . GLN B 2 258 ? -16.76600 -67.06000 -31.13900 1.000 37.30000  ? 258 GLN B CA    1 
ATOM   6303 C  C     . GLN B 2 258 ? -16.93800 -65.89800 -30.15000 1.000 33.17000  ? 258 GLN B C     1 
ATOM   6304 O  O     . GLN B 2 258 ? -16.18700 -64.92300 -30.18300 1.000 33.33000  ? 258 GLN B O     1 
ATOM   6305 C  CB    . GLN B 2 258 ? -17.74700 -66.93100 -32.31900 1.000 36.55000  ? 258 GLN B CB    1 
ATOM   6306 C  CG    . GLN B 2 258 ? -17.31500 -67.75000 -33.56400 1.000 34.89000  ? 258 GLN B CG    1 
ATOM   6307 C  CD    . GLN B 2 258 ? -18.24400 -67.59600 -34.76100 1.000 31.83000  ? 258 GLN B CD    1 
ATOM   6308 O  OE1   . GLN B 2 258 ? -19.31800 -67.00000 -34.65700 1.000 28.67000  ? 258 GLN B OE1   1 
ATOM   6309 N  NE2   . GLN B 2 258 ? -17.83400 -68.14900 -35.90600 1.000 38.67000  ? 258 GLN B NE2   1 
ATOM   6310 N  N     . LYS B 2 259 ? -17.89900 -66.02100 -29.24300 1.000 31.58000  ? 259 LYS B N     1 
ATOM   6311 C  CA    . LYS B 2 259 ? -18.11500 -64.99400 -28.22700 1.000 35.17000  ? 259 LYS B CA    1 
ATOM   6312 C  C     . LYS B 2 259 ? -16.87700 -64.86300 -27.35500 1.000 37.61000  ? 259 LYS B C     1 
ATOM   6313 O  O     . LYS B 2 259 ? -16.38100 -63.76000 -27.10700 1.000 40.32000  ? 259 LYS B O     1 
ATOM   6314 C  CB    . LYS B 2 259 ? -19.33600 -65.33000 -27.37200 1.000 31.00000  ? 259 LYS B CB    1 
ATOM   6315 C  CG    . LYS B 2 259 ? -20.60600 -64.56900 -27.75200 1.000 38.95000  ? 259 LYS B CG    1 
ATOM   6316 C  CD    . LYS B 2 259 ? -21.82700 -65.16500 -27.04900 1.000 44.28000  ? 259 LYS B CD    1 
ATOM   6317 C  CE    . LYS B 2 259 ? -23.06400 -64.27900 -27.17100 1.000 57.82000  ? 259 LYS B CE    1 
ATOM   6318 N  NZ    . LYS B 2 259 ? -24.28200 -64.98200 -26.64100 1.000 60.02000  ? 259 LYS B NZ    1 
ATOM   6319 N  N     . LEU B 2 260 ? -16.38600 -66.01700 -26.91000 1.000 39.52000  ? 260 LEU B N     1 
ATOM   6320 C  CA    . LEU B 2 260 ? -15.19300 -66.13600 -26.08100 1.000 34.83000  ? 260 LEU B CA    1 
ATOM   6321 C  C     . LEU B 2 260 ? -13.95800 -65.50900 -26.71500 1.000 40.47000  ? 260 LEU B C     1 
ATOM   6322 O  O     . LEU B 2 260 ? -13.29700 -64.68400 -26.09500 1.000 39.82000  ? 260 LEU B O     1 
ATOM   6323 C  CB    . LEU B 2 260 ? -14.92300 -67.60200 -25.79700 1.000 38.29000  ? 260 LEU B CB    1 
ATOM   6324 C  CG    . LEU B 2 260 ? -13.77300 -67.90100 -24.85800 1.000 40.46000  ? 260 LEU B CG    1 
ATOM   6325 C  CD1   . LEU B 2 260 ? -14.09300 -67.29200 -23.51500 1.000 42.14000  ? 260 LEU B CD1   1 
ATOM   6326 C  CD2   . LEU B 2 260 ? -13.58300 -69.40400 -24.75900 1.000 42.39000  ? 260 LEU B CD2   1 
ATOM   6327 N  N     . VAL B 2 261 ? -13.64600 -65.89800 -27.95000 1.000 41.27000  ? 261 VAL B N     1 
ATOM   6328 C  CA    . VAL B 2 261 ? -12.48000 -65.35200 -28.63300 1.000 39.94000  ? 261 VAL B CA    1 
ATOM   6329 C  C     . VAL B 2 261 ? -12.57600 -63.83400 -28.80400 1.000 45.07000  ? 261 VAL B C     1 
ATOM   6330 O  O     . VAL B 2 261 ? -11.56800 -63.11800 -28.69100 1.000 46.71000  ? 261 VAL B O     1 
ATOM   6331 C  CB    . VAL B 2 261 ? -12.27600 -66.00900 -29.99900 1.000 38.89000  ? 261 VAL B CB    1 
ATOM   6332 C  CG1   . VAL B 2 261 ? -11.22100 -65.27300 -30.79600 1.000 34.55000  ? 261 VAL B CG1   1 
ATOM   6333 C  CG2   . VAL B 2 261 ? -11.85800 -67.45100 -29.80600 1.000 41.98000  ? 261 VAL B CG2   1 
ATOM   6334 N  N     . GLY B 2 262 ? -13.78200 -63.33200 -29.04800 1.000 42.19000  ? 262 GLY B N     1 
ATOM   6335 C  CA    . GLY B 2 262 ? -13.96100 -61.89600 -29.19800 1.000 40.85000  ? 262 GLY B CA    1 
ATOM   6336 C  C     . GLY B 2 262 ? -13.75400 -61.15400 -27.88800 1.000 45.49000  ? 262 GLY B C     1 
ATOM   6337 O  O     . GLY B 2 262 ? -13.06800 -60.11500 -27.84500 1.000 38.40000  ? 262 GLY B O     1 
ATOM   6338 N  N     . LYS B 2 263 ? -14.35600 -61.69000 -26.82500 1.000 41.13000  ? 263 LYS B N     1 
ATOM   6339 C  CA    . LYS B 2 263 ? -14.12700 -61.19000 -25.47900 1.000 39.13000  ? 263 LYS B CA    1 
ATOM   6340 C  C     . LYS B 2 263 ? -12.63700 -61.19300 -25.12100 1.000 46.29000  ? 263 LYS B C     1 
ATOM   6341 O  O     . LYS B 2 263 ? -12.09400 -60.14400 -24.79600 1.000 50.68000  ? 263 LYS B O     1 
ATOM   6342 C  CB    . LYS B 2 263 ? -14.91600 -62.00500 -24.46100 1.000 36.94000  ? 263 LYS B CB    1 
ATOM   6343 C  CG    . LYS B 2 263 ? -14.89600 -61.37400 -23.09000 1.000 43.23000  ? 263 LYS B CG    1 
ATOM   6344 C  CD    . LYS B 2 263 ? -15.75100 -62.15900 -22.10800 1.000 49.79000  ? 263 LYS B CD    1 
ATOM   6345 C  CE    . LYS B 2 263 ? -15.77500 -61.48400 -20.73800 1.000 50.78000  ? 263 LYS B CE    1 
ATOM   6346 N  NZ    . LYS B 2 263 ? -16.87700 -61.98500 -19.86600 1.000 53.84000  ? 263 LYS B NZ    1 
ATOM   6347 N  N     . LEU B 2 264 ? -11.97900 -62.35300 -25.19400 1.000 42.17000  ? 264 LEU B N     1 
ATOM   6348 C  CA    . LEU B 2 264 ? -10.54600 -62.45900 -24.88600 1.000 42.84000  ? 264 LEU B CA    1 
ATOM   6349 C  C     . LEU B 2 264 ? -9.67500  -61.51500 -25.71000 1.000 41.42000  ? 264 LEU B C     1 
ATOM   6350 O  O     . LEU B 2 264 ? -8.73400  -60.92100 -25.19200 1.000 47.03000  ? 264 LEU B O     1 
ATOM   6351 C  CB    . LEU B 2 264 ? -10.04200 -63.88000 -25.10000 1.000 40.67000  ? 264 LEU B CB    1 
ATOM   6352 C  CG    . LEU B 2 264 ? -10.57800 -64.98900 -24.20200 1.000 39.12000  ? 264 LEU B CG    1 
ATOM   6353 C  CD1   . LEU B 2 264 ? -9.96100  -66.28600 -24.65400 1.000 43.38000  ? 264 LEU B CD1   1 
ATOM   6354 C  CD2   . LEU B 2 264 ? -10.30800 -64.73300 -22.72700 1.000 37.44000  ? 264 LEU B CD2   1 
ATOM   6355 N  N     . ASN B 2 265 ? -9.97200  -61.38700 -26.99400 1.000 40.30000  ? 265 ASN B N     1 
ATOM   6356 C  CA    . ASN B 2 265 ? -9.23300  -60.45500 -27.83900 1.000 40.36000  ? 265 ASN B CA    1 
ATOM   6357 C  C     . ASN B 2 265 ? -9.29000  -59.03400 -27.29600 1.000 41.10000  ? 265 ASN B C     1 
ATOM   6358 O  O     . ASN B 2 265 ? -8.29200  -58.33900 -27.25400 1.000 44.55000  ? 265 ASN B O     1 
ATOM   6359 C  CB    . ASN B 2 265 ? -9.77700  -60.49000 -29.25900 1.000 43.72000  ? 265 ASN B CB    1 
ATOM   6360 C  CG    . ASN B 2 265 ? -8.93300  -59.70300 -30.22600 1.000 42.66000  ? 265 ASN B CG    1 
ATOM   6361 O  OD1   . ASN B 2 265 ? -7.75600  -60.00900 -30.43400 1.000 49.52000  ? 265 ASN B OD1   1 
ATOM   6362 N  ND2   . ASN B 2 265 ? -9.53700  -58.69800 -30.85400 1.000 42.31000  ? 265 ASN B ND2   1 
ATOM   6363 N  N     . TRP B 2 266 ? -10.46900 -58.61400 -26.86200 1.000 49.84000  ? 266 TRP B N     1 
ATOM   6364 C  CA    . TRP B 2 266 ? -10.62400 -57.29000 -26.27200 1.000 50.45000  ? 266 TRP B CA    1 
ATOM   6365 C  C     . TRP B 2 266 ? -9.83700  -57.20000 -24.97800 1.000 49.08000  ? 266 TRP B C     1 
ATOM   6366 O  O     . TRP B 2 266 ? -9.10700  -56.24200 -24.75300 1.000 55.57000  ? 266 TRP B O     1 
ATOM   6367 C  CB    . TRP B 2 266 ? -12.09900 -56.97400 -26.01700 1.000 48.10000  ? 266 TRP B CB    1 
ATOM   6368 C  CG    . TRP B 2 266 ? -12.32000 -55.87700 -25.01400 1.000 56.74000  ? 266 TRP B CG    1 
ATOM   6369 C  CD1   . TRP B 2 266 ? -12.36100 -54.52900 -25.26100 1.000 57.77000  ? 266 TRP B CD1   1 
ATOM   6370 C  CD2   . TRP B 2 266 ? -12.54200 -56.02900 -23.59600 1.000 57.81000  ? 266 TRP B CD2   1 
ATOM   6371 N  NE1   . TRP B 2 266 ? -12.59700 -53.83700 -24.08800 1.000 60.53000  ? 266 TRP B NE1   1 
ATOM   6372 C  CE2   . TRP B 2 266 ? -12.71000 -54.73300 -23.05500 1.000 59.17000  ? 266 TRP B CE2   1 
ATOM   6373 C  CE3   . TRP B 2 266 ? -12.62500 -57.13800 -22.73700 1.000 58.25000  ? 266 TRP B CE3   1 
ATOM   6374 C  CZ2   . TRP B 2 266 ? -12.94800 -54.51500 -21.68800 1.000 59.53000  ? 266 TRP B CZ2   1 
ATOM   6375 C  CZ3   . TRP B 2 266 ? -12.86100 -56.92000 -21.37300 1.000 57.42000  ? 266 TRP B CZ3   1 
ATOM   6376 C  CH2   . TRP B 2 266 ? -13.01600 -55.62000 -20.86600 1.000 57.95000  ? 266 TRP B CH2   1 
ATOM   6377 N  N     . ALA B 2 267 ? -9.97500  -58.21600 -24.14100 1.000 46.24000  ? 267 ALA B N     1 
ATOM   6378 C  CA    . ALA B 2 267 ? -9.38200  -58.20200 -22.81800 1.000 43.45000  ? 267 ALA B CA    1 
ATOM   6379 C  C     . ALA B 2 267 ? -7.87200  -58.17000 -22.89100 1.000 49.25000  ? 267 ALA B C     1 
ATOM   6380 O  O     . ALA B 2 267 ? -7.21900  -57.70600 -21.96100 1.000 53.88000  ? 267 ALA B O     1 
ATOM   6381 C  CB    . ALA B 2 267 ? -9.85000  -59.40000 -22.01700 1.000 45.07000  ? 267 ALA B CB    1 
ATOM   6382 N  N     . SER B 2 268 ? -7.31400  -58.64200 -24.00200 1.000 50.22000  ? 268 SER B N     1 
ATOM   6383 C  CA    . SER B 2 268 ? -5.86000  -58.66100 -24.15300 1.000 54.65000  ? 268 SER B CA    1 
ATOM   6384 C  C     . SER B 2 268 ? -5.27100  -57.23100 -24.24300 1.000 55.28000  ? 268 SER B C     1 
ATOM   6385 O  O     . SER B 2 268 ? -4.05400  -57.04600 -24.15200 1.000 50.65000  ? 268 SER B O     1 
ATOM   6386 C  CB    . SER B 2 268 ? -5.46600  -59.49700 -25.37700 1.000 44.20000  ? 268 SER B CB    1 
ATOM   6387 O  OG    . SER B 2 268 ? -5.83700  -58.84900 -26.58200 1.000 43.72000  ? 268 SER B OG    1 
ATOM   6388 N  N     . GLN B 2 269 ? -6.14100  -56.23200 -24.40800 1.000 46.92000  ? 269 GLN B N     1 
ATOM   6389 C  CA    . GLN B 2 269 ? -5.72400  -54.83700 -24.39100 1.000 51.77000  ? 269 GLN B CA    1 
ATOM   6390 C  C     . GLN B 2 269 ? -5.50100  -54.37200 -22.96200 1.000 49.56000  ? 269 GLN B C     1 
ATOM   6391 O  O     . GLN B 2 269 ? -4.79400  -53.40400 -22.71000 1.000 55.11000  ? 269 GLN B O     1 
ATOM   6392 C  CB    . GLN B 2 269 ? -6.76200  -53.94200 -25.06400 1.000 51.05000  ? 269 GLN B CB    1 
ATOM   6393 C  CG    . GLN B 2 269 ? -6.92300  -54.16000 -26.55100 1.000 50.00000  ? 269 GLN B CG    1 
ATOM   6394 C  CD    . GLN B 2 269 ? -8.18800  -53.50500 -27.08400 1.000 62.78000  ? 269 GLN B CD    1 
ATOM   6395 O  OE1   . GLN B 2 269 ? -9.29700  -53.78900 -26.60900 1.000 59.12000  ? 269 GLN B OE1   1 
ATOM   6396 N  NE2   . GLN B 2 269 ? -8.03100  -52.61200 -28.06300 1.000 62.20000  ? 269 GLN B NE2   1 
ATOM   6397 N  N     . ILE B 2 270 ? -6.13200  -55.06000 -22.02700 1.000 45.23000  ? 270 ILE B N     1 
ATOM   6398 C  CA    . ILE B 2 270 ? -5.97000  -54.75400 -20.62200 1.000 46.04000  ? 270 ILE B CA    1 
ATOM   6399 C  C     . ILE B 2 270 ? -4.87700  -55.65000 -20.06000 1.000 52.99000  ? 270 ILE B C     1 
ATOM   6400 O  O     . ILE B 2 270 ? -3.90300  -55.16700 -19.47700 1.000 49.30000  ? 270 ILE B O     1 
ATOM   6401 C  CB    . ILE B 2 270 ? -7.28700  -54.95800 -19.85100 1.000 52.15000  ? 270 ILE B CB    1 
ATOM   6402 C  CG1   . ILE B 2 270 ? -8.33000  -53.93400 -20.30100 1.000 45.33000  ? 270 ILE B CG1   1 
ATOM   6403 C  CG2   . ILE B 2 270 ? -7.07000  -54.86200 -18.36300 1.000 54.15000  ? 270 ILE B CG2   1 
ATOM   6404 C  CD1   . ILE B 2 270 ? -9.70300  -54.22200 -19.76400 1.000 46.29000  ? 270 ILE B CD1   1 
ATOM   6405 N  N     . TYR B 2 271 ? -5.05400  -56.95800 -20.26000 1.000 58.90000  ? 271 TYR B N     1 
ATOM   6406 C  CA    . TYR B 2 271 ? -4.09100  -57.98700 -19.86100 1.000 54.17000  ? 271 TYR B CA    1 
ATOM   6407 C  C     . TYR B 2 271 ? -3.38300  -58.56200 -21.07800 1.000 57.84000  ? 271 TYR B C     1 
ATOM   6408 O  O     . TYR B 2 271 ? -3.91800  -59.45200 -21.74600 1.000 58.63000  ? 271 TYR B O     1 
ATOM   6409 C  CB    . TYR B 2 271 ? -4.78100  -59.12100 -19.10700 1.000 55.41000  ? 271 TYR B CB    1 
ATOM   6410 C  CG    . TYR B 2 271 ? -5.61300  -58.66900 -17.93900 1.000 62.84000  ? 271 TYR B CG    1 
ATOM   6411 C  CD1   . TYR B 2 271 ? -5.04700  -58.53100 -16.67900 1.000 65.09000  ? 271 TYR B CD1   1 
ATOM   6412 C  CD2   . TYR B 2 271 ? -6.96700  -58.37900 -18.09000 1.000 60.04000  ? 271 TYR B CD2   1 
ATOM   6413 C  CE1   . TYR B 2 271 ? -5.80100  -58.12100 -15.59800 1.000 71.67000  ? 271 TYR B CE1   1 
ATOM   6414 C  CE2   . TYR B 2 271 ? -7.73200  -57.96400 -17.01200 1.000 60.58000  ? 271 TYR B CE2   1 
ATOM   6415 C  CZ    . TYR B 2 271 ? -7.14200  -57.83800 -15.76800 1.000 70.41000  ? 271 TYR B CZ    1 
ATOM   6416 O  OH    . TYR B 2 271 ? -7.87900  -57.43000 -14.68000 1.000 77.95000  ? 271 TYR B OH    1 
ATOM   6417 N  N     . PRO B 2 272 ? -2.16400  -58.08200 -21.35600 1.000 59.21000  ? 272 PRO B N     1 
ATOM   6418 C  CA    . PRO B 2 272 ? -1.42200  -58.48200 -22.55500 1.000 57.86000  ? 272 PRO B CA    1 
ATOM   6419 C  C     . PRO B 2 272 ? -1.05500  -59.95900 -22.52500 1.000 54.27000  ? 272 PRO B C     1 
ATOM   6420 O  O     . PRO B 2 272 ? -0.68700  -60.54000 -23.55400 1.000 48.48000  ? 272 PRO B O     1 
ATOM   6421 C  CB    . PRO B 2 272 ? -0.17600  -57.59700 -22.50000 1.000 65.86000  ? 272 PRO B CB    1 
ATOM   6422 C  CG    . PRO B 2 272 ? -0.55000  -56.46300 -21.58200 1.000 58.96000  ? 272 PRO B CG    1 
ATOM   6423 C  CD    . PRO B 2 272 ? -1.40800  -57.10900 -20.55500 1.000 55.78000  ? 272 PRO B CD    1 
ATOM   6424 N  N     . GLY B 2 273 ? -1.17300  -60.55800 -21.34700 1.000 50.88000  ? 273 GLY B N     1 
ATOM   6425 C  CA    . GLY B 2 273 ? -0.97400  -61.98400 -21.21000 1.000 56.93000  ? 273 GLY B CA    1 
ATOM   6426 C  C     . GLY B 2 273 ? -2.15100  -62.87100 -21.59800 1.000 66.14000  ? 273 GLY B C     1 
ATOM   6427 O  O     . GLY B 2 273 ? -2.10600  -64.06900 -21.36300 1.000 64.27000  ? 273 GLY B O     1 
ATOM   6428 N  N     . ILE B 2 274 ? -3.17900  -62.32700 -22.24200 1.000 61.94000  ? 274 ILE B N     1 
ATOM   6429 C  CA    . ILE B 2 274 ? -4.26000  -63.18200 -22.71300 1.000 57.84000  ? 274 ILE B CA    1 
ATOM   6430 C  C     . ILE B 2 274 ? -3.92000  -63.65600 -24.12500 1.000 55.33000  ? 274 ILE B C     1 
ATOM   6431 O  O     . ILE B 2 274 ? -3.34100  -62.92400 -24.91800 1.000 53.92000  ? 274 ILE B O     1 
ATOM   6432 C  CB    . ILE B 2 274 ? -5.62300  -62.45500 -22.65600 1.000 54.10000  ? 274 ILE B CB    1 
ATOM   6433 C  CG1   . ILE B 2 274 ? -6.18000  -62.55600 -21.24200 1.000 54.56000  ? 274 ILE B CG1   1 
ATOM   6434 C  CG2   . ILE B 2 274 ? -6.62500  -63.09200 -23.57800 1.000 51.87000  ? 274 ILE B CG2   1 
ATOM   6435 C  CD1   . ILE B 2 274 ? -7.22200  -61.55100 -20.94200 1.000 59.92000  ? 274 ILE B CD1   1 
ATOM   6436 N  N     . LYS B 2 275 ? -4.24700  -64.90500 -24.42200 1.000 60.82000  ? 275 LYS B N     1 
ATOM   6437 C  CA    . LYS B 2 275 ? -3.96400  -65.47300 -25.73500 1.000 63.72000  ? 275 LYS B CA    1 
ATOM   6438 C  C     . LYS B 2 275 ? -5.17700  -66.19600 -26.32600 1.000 62.26000  ? 275 LYS B C     1 
ATOM   6439 O  O     . LYS B 2 275 ? -6.04200  -66.67100 -25.59500 1.000 60.87000  ? 275 LYS B O     1 
ATOM   6440 C  CB    . LYS B 2 275 ? -2.77800  -66.42800 -25.64300 1.000 70.10000  ? 275 LYS B CB    1 
ATOM   6441 C  CG    . LYS B 2 275 ? -1.61700  -66.04600 -26.54500 1.000 86.96000  ? 275 LYS B CG    1 
ATOM   6442 C  CD    . LYS B 2 275 ? -2.02300  -66.04800 -28.02800 1.000 90.61000  ? 275 LYS B CD    1 
ATOM   6443 C  CE    . LYS B 2 275 ? -0.90100  -65.51800 -28.93000 1.000 83.61000  ? 275 LYS B CE    1 
ATOM   6444 N  NZ    . LYS B 2 275 ? -0.21700  -66.58100 -29.73100 1.000 74.84000  ? 275 LYS B NZ    1 
ATOM   6445 N  N     . VAL B 2 276 ? -5.24300  -66.28800 -27.65000 1.000 63.49000  ? 276 VAL B N     1 
ATOM   6446 C  CA    . VAL B 2 276 ? -6.44500  -66.82900 -28.27000 1.000 58.46000  ? 276 VAL B CA    1 
ATOM   6447 C  C     . VAL B 2 276 ? -6.18700  -67.69500 -29.53200 1.000 59.45000  ? 276 VAL B C     1 
ATOM   6448 O  O     . VAL B 2 276 ? -7.10600  -68.05800 -30.25000 1.000 53.60000  ? 276 VAL B O     1 
ATOM   6449 C  CB    . VAL B 2 276 ? -7.41900  -65.63700 -28.55600 1.000 49.42000  ? 276 VAL B CB    1 
ATOM   6450 C  CG1   . VAL B 2 276 ? -7.35100  -65.14200 -29.98700 1.000 38.03000  ? 276 VAL B CG1   1 
ATOM   6451 C  CG2   . VAL B 2 276 ? -8.82300  -65.97900 -28.11400 1.000 52.84000  ? 276 VAL B CG2   1 
ATOM   6452 N  N     . ARG B 2 277 ? -4.93300  -68.07600 -29.76200 1.000 63.95000  ? 277 ARG B N     1 
ATOM   6453 C  CA    . ARG B 2 277 ? -4.56800  -68.84500 -30.96000 1.000 62.96000  ? 277 ARG B CA    1 
ATOM   6454 C  C     . ARG B 2 277 ? -5.19400  -70.24100 -30.98700 1.000 59.90000  ? 277 ARG B C     1 
ATOM   6455 O  O     . ARG B 2 277 ? -5.83500  -70.61100 -31.96800 1.000 60.18000  ? 277 ARG B O     1 
ATOM   6456 C  CB    . ARG B 2 277 ? -3.04000  -68.97700 -31.09400 1.000 65.67000  ? 277 ARG B CB    1 
ATOM   6457 C  CG    . ARG B 2 277 ? -2.60100  -69.55600 -32.44700 1.000 72.48000  ? 277 ARG B CG    1 
ATOM   6458 C  CD    . ARG B 2 277 ? -1.08400  -69.44300 -32.67300 1.000 81.61000  ? 277 ARG B CD    1 
ATOM   6459 N  NE    . ARG B 2 277 ? -0.70900  -69.28800 -34.08800 1.000 91.50000  ? 277 ARG B NE    1 
ATOM   6460 C  CZ    . ARG B 2 277 ? -0.01000  -68.25700 -34.57000 1.000 85.15000  ? 277 ARG B CZ    1 
ATOM   6461 N  NH1   . ARG B 2 277 ? 0.38000   -67.29700 -33.75400 1.000 80.36000  ? 277 ARG B NH1   1 
ATOM   6462 N  NH2   . ARG B 2 277 ? 0.29700   -68.17300 -35.86000 1.000 84.04000  ? 277 ARG B NH2   1 
ATOM   6463 N  N     . GLN B 2 278 ? -5.01200  -71.01300 -29.92100 1.000 56.70000  ? 278 GLN B N     1 
ATOM   6464 C  CA    . GLN B 2 278 ? -5.57300  -72.36200 -29.86700 1.000 58.50000  ? 278 GLN B CA    1 
ATOM   6465 C  C     . GLN B 2 278 ? -7.11100  -72.36000 -29.92800 1.000 63.47000  ? 278 GLN B C     1 
ATOM   6466 O  O     . GLN B 2 278 ? -7.70900  -73.20600 -30.60700 1.000 61.64000  ? 278 GLN B O     1 
ATOM   6467 C  CB    . GLN B 2 278 ? -5.11000  -73.10600 -28.60000 1.000 61.50000  ? 278 GLN B CB    1 
ATOM   6468 C  CG    . GLN B 2 278 ? -3.60100  -73.36900 -28.49600 1.000 67.14000  ? 278 GLN B CG    1 
ATOM   6469 C  CD    . GLN B 2 278 ? -2.99000  -73.97900 -29.76300 1.000 73.96000  ? 278 GLN B CD    1 
ATOM   6470 O  OE1   . GLN B 2 278 ? -3.37400  -75.06900 -30.19700 1.000 69.87000  ? 278 GLN B OE1   1 
ATOM   6471 N  NE2   . GLN B 2 278 ? -2.03000  -73.26700 -30.36100 1.000 76.78000  ? 278 GLN B NE2   1 
ATOM   6472 N  N     . LEU B 2 279 ? -7.75000  -71.42900 -29.21300 1.000 63.21000  ? 279 LEU B N     1 
ATOM   6473 C  CA    . LEU B 2 279 ? -9.21200  -71.36100 -29.18400 1.000 50.74000  ? 279 LEU B CA    1 
ATOM   6474 C  C     . LEU B 2 279 ? -9.73900  -70.99100 -30.55000 1.000 48.91000  ? 279 LEU B C     1 
ATOM   6475 O  O     . LEU B 2 279 ? -10.77900 -71.47300 -30.96700 1.000 51.72000  ? 279 LEU B O     1 
ATOM   6476 C  CB    . LEU B 2 279 ? -9.69800  -70.35300 -28.15100 1.000 44.28000  ? 279 LEU B CB    1 
ATOM   6477 C  CG    . LEU B 2 279 ? -9.74800  -70.87100 -26.72200 1.000 43.11000  ? 279 LEU B CG    1 
ATOM   6478 C  CD1   . LEU B 2 279 ? -9.93100  -69.72400 -25.77800 1.000 49.61000  ? 279 LEU B CD1   1 
ATOM   6479 C  CD2   . LEU B 2 279 ? -10.87100 -71.85100 -26.56000 1.000 41.96000  ? 279 LEU B CD2   1 
ATOM   6480 N  N     . SER B 2 280 ? -8.99400  -70.14900 -31.25100 1.000 53.12000  ? 280 SER B N     1 
ATOM   6481 C  CA    . SER B 2 280 ? -9.39500  -69.68400 -32.56900 1.000 54.04000  ? 280 SER B CA    1 
ATOM   6482 C  C     . SER B 2 280 ? -9.16100  -70.70100 -33.68900 1.000 53.83000  ? 280 SER B C     1 
ATOM   6483 O  O     . SER B 2 280 ? -9.76000  -70.58700 -34.75400 1.000 62.34000  ? 280 SER B O     1 
ATOM   6484 C  CB    . SER B 2 280 ? -8.66600  -68.38600 -32.90800 1.000 55.19000  ? 280 SER B CB    1 
ATOM   6485 O  OG    . SER B 2 280 ? -8.84500  -68.05400 -34.27700 1.000 66.62000  ? 280 SER B OG    1 
ATOM   6486 N  N     . LYS B 2 281 ? -8.29900  -71.68800 -33.46900 1.000 56.16000  ? 281 LYS B N     1 
ATOM   6487 C  CA    . LYS B 2 281 ? -8.06000  -72.69100 -34.50700 1.000 57.99000  ? 281 LYS B CA    1 
ATOM   6488 C  C     . LYS B 2 281 ? -9.13200  -73.77600 -34.44700 1.000 53.87000  ? 281 LYS B C     1 
ATOM   6489 O  O     . LYS B 2 281 ? -9.25800  -74.58200 -35.36400 1.000 58.09000  ? 281 LYS B O     1 
ATOM   6490 C  CB    . LYS B 2 281 ? -6.65000  -73.29700 -34.38800 1.000 59.41000  ? 281 LYS B CB    1 
ATOM   6491 C  CG    . LYS B 2 281 ? -6.46800  -74.25800 -33.24100 1.000 64.02000  ? 281 LYS B CG    1 
ATOM   6492 C  CD    . LYS B 2 281 ? -4.99500  -74.52900 -32.95100 1.000 68.50000  ? 281 LYS B CD    1 
ATOM   6493 C  CE    . LYS B 2 281 ? -4.32700  -75.32100 -34.06900 1.000 78.98000  ? 281 LYS B CE    1 
ATOM   6494 N  NZ    . LYS B 2 281 ? -3.02700  -75.90400 -33.61900 1.000 75.49000  ? 281 LYS B NZ    1 
ATOM   6495 N  N     . LEU B 2 282 ? -9.91400  -73.78900 -33.37300 1.000 49.97000  ? 282 LEU B N     1 
ATOM   6496 C  CA    . LEU B 2 282 ? -11.09000 -74.64400 -33.31200 1.000 48.21000  ? 282 LEU B CA    1 
ATOM   6497 C  C     . LEU B 2 282 ? -12.17300 -74.14700 -34.27700 1.000 55.58000  ? 282 LEU B C     1 
ATOM   6498 O  O     . LEU B 2 282 ? -13.07300 -74.89600 -34.67200 1.000 58.96000  ? 282 LEU B O     1 
ATOM   6499 C  CB    . LEU B 2 282 ? -11.65600 -74.68600 -31.89900 1.000 49.75000  ? 282 LEU B CB    1 
ATOM   6500 C  CG    . LEU B 2 282 ? -10.81200 -75.13700 -30.71400 1.000 52.42000  ? 282 LEU B CG    1 
ATOM   6501 C  CD1   . LEU B 2 282 ? -11.62800 -74.90700 -29.45800 1.000 49.23000  ? 282 LEU B CD1   1 
ATOM   6502 C  CD2   . LEU B 2 282 ? -10.42000 -76.60400 -30.82500 1.000 48.08000  ? 282 LEU B CD2   1 
ATOM   6503 N  N     . LEU B 2 283 ? -12.08800 -72.87300 -34.64400 1.000 55.01000  ? 283 LEU B N     1 
ATOM   6504 C  CA    . LEU B 2 283 ? -13.07800 -72.25400 -35.51500 1.000 53.07000  ? 283 LEU B CA    1 
ATOM   6505 C  C     . LEU B 2 283 ? -12.67300 -72.27100 -36.97700 1.000 59.03000  ? 283 LEU B C     1 
ATOM   6506 O  O     . LEU B 2 283 ? -13.18900 -71.48300 -37.76800 1.000 67.11000  ? 283 LEU B O     1 
ATOM   6507 C  CB    . LEU B 2 283 ? -13.32300 -70.80600 -35.08900 1.000 50.95000  ? 283 LEU B CB    1 
ATOM   6508 C  CG    . LEU B 2 283 ? -13.89400 -70.71700 -33.68200 1.000 48.64000  ? 283 LEU B CG    1 
ATOM   6509 C  CD1   . LEU B 2 283 ? -13.95500 -69.27400 -33.21000 1.000 40.23000  ? 283 LEU B CD1   1 
ATOM   6510 C  CD2   . LEU B 2 283 ? -15.26000 -71.39500 -33.68000 1.000 41.27000  ? 283 LEU B CD2   1 
ATOM   6511 N  N     . ARG B 2 284 ? -11.73900 -73.13400 -37.35200 1.000 52.27000  ? 284 ARG B N     1 
ATOM   6512 C  CA    . ARG B 2 284 ? -11.34200 -73.18000 -38.74900 1.000 52.06000  ? 284 ARG B CA    1 
ATOM   6513 C  C     . ARG B 2 284 ? -12.49400 -73.75900 -39.56600 1.000 52.40000  ? 284 ARG B C     1 
ATOM   6514 O  O     . ARG B 2 284 ? -13.21000 -74.65500 -39.11500 1.000 52.65000  ? 284 ARG B O     1 
ATOM   6515 C  CB    . ARG B 2 284 ? -10.05700 -73.99000 -38.94100 1.000 48.97000  ? 284 ARG B CB    1 
ATOM   6516 C  CG    . ARG B 2 284 ? -8.77600  -73.19400 -38.71000 1.000 53.37000  ? 284 ARG B CG    1 
ATOM   6517 C  CD    . ARG B 2 284 ? -7.53500  -74.01200 -39.07800 1.000 61.23000  ? 284 ARG B CD    1 
ATOM   6518 N  NE    . ARG B 2 284 ? -6.29800  -73.23800 -38.94200 1.000 74.64000  ? 284 ARG B NE    1 
ATOM   6519 C  CZ    . ARG B 2 284 ? -5.35200  -73.47000 -38.03000 1.000 78.15000  ? 284 ARG B CZ    1 
ATOM   6520 N  NH1   . ARG B 2 284 ? -5.48800  -74.47000 -37.16300 1.000 77.83000  ? 284 ARG B NH1   1 
ATOM   6521 N  NH2   . ARG B 2 284 ? -4.26300  -72.70300 -37.98500 1.000 68.19000  ? 284 ARG B NH2   1 
ATOM   6522 N  N     . GLY B 2 285 ? -12.69100 -73.21800 -40.76200 1.000 48.51000  ? 285 GLY B N     1 
ATOM   6523 C  CA    . GLY B 2 285 ? -13.77500 -73.66400 -41.61000 1.000 42.80000  ? 285 GLY B CA    1 
ATOM   6524 C  C     . GLY B 2 285 ? -14.87800 -72.62400 -41.64500 1.000 52.06000  ? 285 GLY B C     1 
ATOM   6525 O  O     . GLY B 2 285 ? -14.66700 -71.47500 -41.26300 1.000 52.56000  ? 285 GLY B O     1 
ATOM   6526 N  N     . THR B 2 286 ? -16.05200 -73.02400 -42.11900 1.000 48.18000  ? 286 THR B N     1 
ATOM   6527 C  CA    . THR B 2 286 ? -17.21100 -72.15100 -42.14300 1.000 36.12000  ? 286 THR B CA    1 
ATOM   6528 C  C     . THR B 2 286 ? -18.36700 -72.89100 -41.50000 1.000 36.45000  ? 286 THR B C     1 
ATOM   6529 O  O     . THR B 2 286 ? -19.19400 -73.46100 -42.19100 1.000 40.01000  ? 286 THR B O     1 
ATOM   6530 C  CB    . THR B 2 286 ? -17.58600 -71.73400 -43.56900 1.000 34.21000  ? 286 THR B CB    1 
ATOM   6531 O  OG1   . THR B 2 286 ? -16.47700 -71.06400 -44.19200 1.000 44.75000  ? 286 THR B OG1   1 
ATOM   6532 C  CG2   . THR B 2 286 ? -18.75700 -70.80100 -43.53900 1.000 33.99000  ? 286 THR B CG2   1 
ATOM   6533 N  N     . LYS B 2 287 ? -18.41900 -72.88600 -40.17200 1.000 36.78000  ? 287 LYS B N     1 
ATOM   6534 C  CA    . LYS B 2 287 ? -19.34100 -73.75300 -39.44400 1.000 33.52000  ? 287 LYS B CA    1 
ATOM   6535 C  C     . LYS B 2 287 ? -20.66600 -73.09800 -39.01500 1.000 35.15000  ? 287 LYS B C     1 
ATOM   6536 O  O     . LYS B 2 287 ? -20.77600 -71.87900 -38.86000 1.000 35.99000  ? 287 LYS B O     1 
ATOM   6537 C  CB    . LYS B 2 287 ? -18.62400 -74.31800 -38.21300 1.000 34.67000  ? 287 LYS B CB    1 
ATOM   6538 C  CG    . LYS B 2 287 ? -17.45400 -75.23900 -38.56800 1.000 39.98000  ? 287 LYS B CG    1 
ATOM   6539 C  CD    . LYS B 2 287 ? -16.60400 -75.62900 -37.36800 1.000 45.43000  ? 287 LYS B CD    1 
ATOM   6540 C  CE    . LYS B 2 287 ? -15.52000 -76.61500 -37.77700 1.000 46.22000  ? 287 LYS B CE    1 
ATOM   6541 N  NZ    . LYS B 2 287 ? -16.10900 -77.94800 -38.09000 1.000 48.62000  ? 287 LYS B NZ    1 
ATOM   6542 N  N     . ALA B 2 288 ? -21.67400 -73.92900 -38.82200 1.000 32.81000  ? 288 ALA B N     1 
ATOM   6543 C  CA    . ALA B 2 288 ? -22.94400 -73.47800 -38.27300 1.000 35.12000  ? 288 ALA B CA    1 
ATOM   6544 C  C     . ALA B 2 288 ? -22.73600 -72.92800 -36.86600 1.000 31.35000  ? 288 ALA B C     1 
ATOM   6545 O  O     . ALA B 2 288 ? -21.93300 -73.47100 -36.11600 1.000 36.99000  ? 288 ALA B O     1 
ATOM   6546 C  CB    . ALA B 2 288 ? -23.94200 -74.63100 -38.25400 1.000 28.14000  ? 288 ALA B CB    1 
ATOM   6547 N  N     . LEU B 2 289 ? -23.44500 -71.86600 -36.49300 1.000 29.77000  ? 289 LEU B N     1 
ATOM   6548 C  CA    . LEU B 2 289 ? -23.24000 -71.28800 -35.16900 1.000 26.59000  ? 289 LEU B CA    1 
ATOM   6549 C  C     . LEU B 2 289 ? -23.55100 -72.27300 -34.05700 1.000 29.94000  ? 289 LEU B C     1 
ATOM   6550 O  O     . LEU B 2 289 ? -22.99700 -72.14000 -32.97700 1.000 34.53000  ? 289 LEU B O     1 
ATOM   6551 C  CB    . LEU B 2 289 ? -24.08500 -70.04200 -34.96100 1.000 27.75000  ? 289 LEU B CB    1 
ATOM   6552 C  CG    . LEU B 2 289 ? -23.61700 -68.77900 -35.66300 1.000 27.22000  ? 289 LEU B CG    1 
ATOM   6553 C  CD1   . LEU B 2 289 ? -24.35300 -67.59100 -35.08200 1.000 25.56000  ? 289 LEU B CD1   1 
ATOM   6554 C  CD2   . LEU B 2 289 ? -22.17300 -68.63500 -35.46000 1.000 26.03000  ? 289 LEU B CD2   1 
ATOM   6555 N  N     . THR B 2 290 ? -24.41700 -73.25300 -34.30700 1.000 29.41000  ? 290 THR B N     1 
ATOM   6556 C  CA    . THR B 2 290 ? -24.88400 -74.12800 -33.22800 1.000 30.19000  ? 290 THR B CA    1 
ATOM   6557 C  C     . THR B 2 290 ? -24.22300 -75.48000 -33.25700 1.000 30.48000  ? 290 THR B C     1 
ATOM   6558 O  O     . THR B 2 290 ? -24.54500 -76.35300 -32.45600 1.000 30.67000  ? 290 THR B O     1 
ATOM   6559 C  CB    . THR B 2 290 ? -26.40300 -74.35700 -33.26900 1.000 32.99000  ? 290 THR B CB    1 
ATOM   6560 O  OG1   . THR B 2 290 ? -26.80000 -74.73300 -34.59700 1.000 38.55000  ? 290 THR B OG1   1 
ATOM   6561 C  CG2   . THR B 2 290 ? -27.15400 -73.10600 -32.82600 1.000 31.42000  ? 290 THR B CG2   1 
ATOM   6562 N  N     . GLU B 2 291 ? -23.31100 -75.66400 -34.19500 1.000 29.48000  ? 291 GLU B N     1 
ATOM   6563 C  CA    . GLU B 2 291 ? -22.46100 -76.84400 -34.17500 1.000 40.32000  ? 291 GLU B CA    1 
ATOM   6564 C  C     . GLU B 2 291 ? -21.66500 -76.92100 -32.86300 1.000 39.82000  ? 291 GLU B C     1 
ATOM   6565 O  O     . GLU B 2 291 ? -21.12900 -75.91900 -32.38800 1.000 41.15000  ? 291 GLU B O     1 
ATOM   6566 C  CB    . GLU B 2 291 ? -21.51300 -76.83300 -35.37200 1.000 36.14000  ? 291 GLU B CB    1 
ATOM   6567 C  CG    . GLU B 2 291 ? -20.40900 -77.84100 -35.28800 1.000 38.81000  ? 291 GLU B CG    1 
ATOM   6568 C  CD    . GLU B 2 291 ? -19.89900 -78.21300 -36.66400 1.000 56.14000  ? 291 GLU B CD    1 
ATOM   6569 O  OE1   . GLU B 2 291 ? -18.72500 -78.64200 -36.78300 1.000 62.76000  ? 291 GLU B OE1   1 
ATOM   6570 O  OE2   . GLU B 2 291 ? -20.68500 -78.07100 -37.63300 1.000 61.01000  ? 291 GLU B OE2   1 
ATOM   6571 N  N     . VAL B 2 292 ? -21.59600 -78.10700 -32.27800 1.000 38.66000  ? 292 VAL B N     1 
ATOM   6572 C  CA    . VAL B 2 292 ? -20.85000 -78.28900 -31.04500 1.000 39.66000  ? 292 VAL B CA    1 
ATOM   6573 C  C     . VAL B 2 292 ? -19.37900 -78.62400 -31.30700 1.000 42.09000  ? 292 VAL B C     1 
ATOM   6574 O  O     . VAL B 2 292 ? -19.05600 -79.57700 -32.00700 1.000 38.82000  ? 292 VAL B O     1 
ATOM   6575 C  CB    . VAL B 2 292 ? -21.48800 -79.38000 -30.18100 1.000 37.29000  ? 292 VAL B CB    1 
ATOM   6576 C  CG1   . VAL B 2 292 ? -20.53500 -79.79400 -29.08300 1.000 39.26000  ? 292 VAL B CG1   1 
ATOM   6577 C  CG2   . VAL B 2 292 ? -22.79000 -78.86400 -29.59400 1.000 38.69000  ? 292 VAL B CG2   1 
ATOM   6578 N  N     . ILE B 2 293 ? -18.49500 -77.80800 -30.74300 1.000 45.68000  ? 293 ILE B N     1 
ATOM   6579 C  CA    . ILE B 2 293 ? -17.06200 -77.99000 -30.89700 1.000 42.88000  ? 293 ILE B CA    1 
ATOM   6580 C  C     . ILE B 2 293 ? -16.44100 -78.51100 -29.61800 1.000 46.72000  ? 293 ILE B C     1 
ATOM   6581 O  O     . ILE B 2 293 ? -16.44200 -77.81400 -28.61100 1.000 48.96000  ? 293 ILE B O     1 
ATOM   6582 C  CB    . ILE B 2 293 ? -16.36900 -76.69100 -31.25200 1.000 46.54000  ? 293 ILE B CB    1 
ATOM   6583 C  CG1   . ILE B 2 293 ? -17.00500 -76.06700 -32.49500 1.000 44.02000  ? 293 ILE B CG1   1 
ATOM   6584 C  CG2   . ILE B 2 293 ? -14.88900 -76.93800 -31.45400 1.000 49.24000  ? 293 ILE B CG2   1 
ATOM   6585 C  CD1   . ILE B 2 293 ? -16.60400 -76.73200 -33.79700 1.000 48.37000  ? 293 ILE B CD1   1 
ATOM   6586 N  N     . PRO B 2 294 ? -15.91700 -79.74600 -29.65200 1.000 54.03000  ? 294 PRO B N     1 
ATOM   6587 C  CA    . PRO B 2 294 ? -15.19100 -80.30600 -28.50600 1.000 54.08000  ? 294 PRO B CA    1 
ATOM   6588 C  C     . PRO B 2 294 ? -13.85100 -79.61000 -28.33300 1.000 51.02000  ? 294 PRO B C     1 
ATOM   6589 O  O     . PRO B 2 294 ? -13.12700 -79.43600 -29.32700 1.000 48.19000  ? 294 PRO B O     1 
ATOM   6590 C  CB    . PRO B 2 294 ? -15.00300 -81.77100 -28.89400 1.000 45.71000  ? 294 PRO B CB    1 
ATOM   6591 C  CG    . PRO B 2 294 ? -14.95700 -81.73700 -30.38300 1.000 48.28000  ? 294 PRO B CG    1 
ATOM   6592 C  CD    . PRO B 2 294 ? -15.95400 -80.68600 -30.78500 1.000 47.66000  ? 294 PRO B CD    1 
ATOM   6593 N  N     . LEU B 2 295 ? -13.54000 -79.20000 -27.10300 1.000 50.38000  ? 295 LEU B N     1 
ATOM   6594 C  CA    . LEU B 2 295 ? -12.31800 -78.44100 -26.84500 1.000 54.02000  ? 295 LEU B CA    1 
ATOM   6595 C  C     . LEU B 2 295 ? -11.08700 -79.34300 -26.78500 1.000 59.10000  ? 295 LEU B C     1 
ATOM   6596 O  O     . LEU B 2 295 ? -11.00500 -80.23400 -25.92900 1.000 58.88000  ? 295 LEU B O     1 
ATOM   6597 C  CB    . LEU B 2 295 ? -12.43600 -77.65600 -25.53800 1.000 56.45000  ? 295 LEU B CB    1 
ATOM   6598 C  CG    . LEU B 2 295 ? -13.37900 -76.46100 -25.42400 1.000 49.38000  ? 295 LEU B CG    1 
ATOM   6599 C  CD1   . LEU B 2 295 ? -13.39000 -75.99000 -23.99600 1.000 52.88000  ? 295 LEU B CD1   1 
ATOM   6600 C  CD2   . LEU B 2 295 ? -12.93100 -75.33700 -26.31700 1.000 49.42000  ? 295 LEU B CD2   1 
ATOM   6601 N  N     . THR B 2 296 ? -10.13300 -79.10100 -27.68600 1.000 57.47000  ? 296 THR B N     1 
ATOM   6602 C  CA    . THR B 2 296 ? -8.85000  -79.80000 -27.66300 1.000 55.35000  ? 296 THR B CA    1 
ATOM   6603 C  C     . THR B 2 296 ? -8.06400  -79.47800 -26.38500 1.000 62.99000  ? 296 THR B C     1 
ATOM   6604 O  O     . THR B 2 296 ? -8.34800  -78.49100 -25.69700 1.000 62.73000  ? 296 THR B O     1 
ATOM   6605 C  CB    . THR B 2 296 ? -7.98500  -79.44500 -28.88900 1.000 54.43000  ? 296 THR B CB    1 
ATOM   6606 O  OG1   . THR B 2 296 ? -7.62700  -78.05900 -28.84200 1.000 58.15000  ? 296 THR B OG1   1 
ATOM   6607 C  CG2   . THR B 2 296 ? -8.73400  -79.71700 -30.17800 1.000 44.24000  ? 296 THR B CG2   1 
ATOM   6608 N  N     . GLU B 2 297 ? -7.07500  -80.32500 -26.09400 1.000 75.06000  ? 297 GLU B N     1 
ATOM   6609 C  CA    . GLU B 2 297 ? -6.23300  -80.26600 -24.88800 1.000 73.55000  ? 297 GLU B CA    1 
ATOM   6610 C  C     . GLU B 2 297 ? -5.58300  -78.89700 -24.63800 1.000 67.15000  ? 297 GLU B C     1 
ATOM   6611 O  O     . GLU B 2 297 ? -5.62000  -78.34700 -23.53000 1.000 65.48000  ? 297 GLU B O     1 
ATOM   6612 C  CB    . GLU B 2 297 ? -5.14100  -81.34000 -25.00300 1.000 79.51000  ? 297 GLU B CB    1 
ATOM   6613 C  CG    . GLU B 2 297 ? -4.29400  -81.56300 -23.76400 1.000 87.72000  ? 297 GLU B CG    1 
ATOM   6614 C  CD    . GLU B 2 297 ? -3.09300  -82.45600 -24.03800 1.000 95.50000  ? 297 GLU B CD    1 
ATOM   6615 O  OE1   . GLU B 2 297 ? -2.80400  -82.72300 -25.23200 1.000 85.87000  ? 297 GLU B OE1   1 
ATOM   6616 O  OE2   . GLU B 2 297 ? -2.44500  -82.88900 -23.05500 1.000 101.45000 ? 297 GLU B OE2   1 
ATOM   6617 N  N     . GLU B 2 298 ? -4.99100  -78.35400 -25.69000 1.000 60.91000  ? 298 GLU B N     1 
ATOM   6618 C  CA    . GLU B 2 298 ? -4.26600  -77.10200 -25.60900 1.000 64.90000  ? 298 GLU B CA    1 
ATOM   6619 C  C     . GLU B 2 298 ? -5.22300  -75.91600 -25.53200 1.000 72.28000  ? 298 GLU B C     1 
ATOM   6620 O  O     . GLU B 2 298 ? -4.93100  -74.91200 -24.86500 1.000 71.58000  ? 298 GLU B O     1 
ATOM   6621 C  CB    . GLU B 2 298 ? -3.32100  -76.96700 -26.80800 1.000 66.12000  ? 298 GLU B CB    1 
ATOM   6622 C  CG    . GLU B 2 298 ? -3.93900  -77.34100 -28.15000 1.000 70.62000  ? 298 GLU B CG    1 
ATOM   6623 C  CD    . GLU B 2 298 ? -4.00000  -78.85600 -28.41500 1.000 74.58000  ? 298 GLU B CD    1 
ATOM   6624 O  OE1   . GLU B 2 298 ? -4.46800  -79.62100 -27.53500 1.000 67.81000  ? 298 GLU B OE1   1 
ATOM   6625 O  OE2   . GLU B 2 298 ? -3.59300  -79.27800 -29.52200 1.000 80.15000  ? 298 GLU B OE2   1 
ATOM   6626 N  N     . ALA B 2 299 ? -6.36400  -76.03700 -26.21300 1.000 68.90000  ? 299 ALA B N     1 
ATOM   6627 C  CA    . ALA B 2 299 ? -7.39700  -75.01100 -26.15900 1.000 58.22000  ? 299 ALA B CA    1 
ATOM   6628 C  C     . ALA B 2 299 ? -8.03400  -75.03200 -24.77900 1.000 59.35000  ? 299 ALA B C     1 
ATOM   6629 O  O     . ALA B 2 299 ? -8.41000  -73.99400 -24.23900 1.000 60.87000  ? 299 ALA B O     1 
ATOM   6630 C  CB    . ALA B 2 299 ? -8.42800  -75.22500 -27.23500 1.000 53.65000  ? 299 ALA B CB    1 
ATOM   6631 N  N     . GLU B 2 300 ? -8.13000  -76.22000 -24.19700 1.000 61.54000  ? 300 GLU B N     1 
ATOM   6632 C  CA    . GLU B 2 300 ? -8.56400  -76.34600 -22.81300 1.000 61.17000  ? 300 GLU B CA    1 
ATOM   6633 C  C     . GLU B 2 300 ? -7.54300  -75.66300 -21.90000 1.000 65.78000  ? 300 GLU B C     1 
ATOM   6634 O  O     . GLU B 2 300 ? -7.90200  -74.97100 -20.94300 1.000 60.55000  ? 300 GLU B O     1 
ATOM   6635 C  CB    . GLU B 2 300 ? -8.72800  -77.81800 -22.43400 1.000 58.31000  ? 300 GLU B CB    1 
ATOM   6636 C  CG    . GLU B 2 300 ? -9.53700  -78.03500 -21.17900 1.000 64.52000  ? 300 GLU B CG    1 
ATOM   6637 C  CD    . GLU B 2 300 ? -10.98700 -77.61500 -21.34800 1.000 73.08000  ? 300 GLU B CD    1 
ATOM   6638 O  OE1   . GLU B 2 300 ? -11.65700 -78.16800 -22.24800 1.000 70.69000  ? 300 GLU B OE1   1 
ATOM   6639 O  OE2   . GLU B 2 300 ? -11.45500 -76.73300 -20.58800 1.000 77.21000  ? 300 GLU B OE2   1 
ATOM   6640 N  N     . LEU B 2 301 ? -6.26700  -75.85400 -22.23100 1.000 66.15000  ? 301 LEU B N     1 
ATOM   6641 C  CA    . LEU B 2 301 ? -5.15000  -75.31900 -21.45300 1.000 68.65000  ? 301 LEU B CA    1 
ATOM   6642 C  C     . LEU B 2 301 ? -5.07900  -73.80000 -21.51100 1.000 67.53000  ? 301 LEU B C     1 
ATOM   6643 O  O     . LEU B 2 301 ? -5.01700  -73.12300 -20.48100 1.000 63.49000  ? 301 LEU B O     1 
ATOM   6644 C  CB    . LEU B 2 301 ? -3.82600  -75.91400 -21.95600 1.000 76.81000  ? 301 LEU B CB    1 
ATOM   6645 C  CG    . LEU B 2 301 ? -2.50800  -75.41000 -21.34700 1.000 74.04000  ? 301 LEU B CG    1 
ATOM   6646 C  CD1   . LEU B 2 301 ? -2.41500  -75.79200 -19.86900 1.000 68.82000  ? 301 LEU B CD1   1 
ATOM   6647 C  CD2   . LEU B 2 301 ? -1.30500  -75.93200 -22.13300 1.000 66.11000  ? 301 LEU B CD2   1 
ATOM   6648 N  N     . GLU B 2 302 ? -5.06400  -73.27800 -22.73100 1.000 64.61000  ? 302 GLU B N     1 
ATOM   6649 C  CA    . GLU B 2 302 ? -5.00000  -71.84600 -22.97100 1.000 57.34000  ? 302 GLU B CA    1 
ATOM   6650 C  C     . GLU B 2 302 ? -6.15100  -71.10400 -22.29300 1.000 56.45000  ? 302 GLU B C     1 
ATOM   6651 O  O     . GLU B 2 302 ? -5.98400  -69.99600 -21.78200 1.000 54.26000  ? 302 GLU B O     1 
ATOM   6652 C  CB    . GLU B 2 302 ? -5.00400  -71.60200 -24.46600 1.000 53.22000  ? 302 GLU B CB    1 
ATOM   6653 C  CG    . GLU B 2 302 ? -5.32700  -70.20900 -24.88000 1.000 53.24000  ? 302 GLU B CG    1 
ATOM   6654 C  CD    . GLU B 2 302 ? -5.54100  -70.14300 -26.36600 1.000 63.25000  ? 302 GLU B CD    1 
ATOM   6655 O  OE1   . GLU B 2 302 ? -6.71700  -70.17600 -26.79100 1.000 64.21000  ? 302 GLU B OE1   1 
ATOM   6656 O  OE2   . GLU B 2 302 ? -4.53700  -70.09200 -27.11500 1.000 65.80000  ? 302 GLU B OE2   1 
ATOM   6657 N  N     . LEU B 2 303 ? -7.31800  -71.73700 -22.28500 1.000 56.17000  ? 303 LEU B N     1 
ATOM   6658 C  CA    . LEU B 2 303 ? -8.47700  -71.23600 -21.55700 1.000 58.66000  ? 303 LEU B CA    1 
ATOM   6659 C  C     . LEU B 2 303 ? -8.23500  -71.27100 -20.03900 1.000 63.90000  ? 303 LEU B C     1 
ATOM   6660 O  O     . LEU B 2 303 ? -8.76600  -70.44700 -19.27500 1.000 61.67000  ? 303 LEU B O     1 
ATOM   6661 C  CB    . LEU B 2 303 ? -9.72200  -72.05800 -21.92400 1.000 57.93000  ? 303 LEU B CB    1 
ATOM   6662 C  CG    . LEU B 2 303 ? -11.01400 -71.75400 -21.16100 1.000 54.19000  ? 303 LEU B CG    1 
ATOM   6663 C  CD1   . LEU B 2 303 ? -11.40100 -70.29500 -21.30200 1.000 49.65000  ? 303 LEU B CD1   1 
ATOM   6664 C  CD2   . LEU B 2 303 ? -12.13000 -72.65000 -21.62700 1.000 55.67000  ? 303 LEU B CD2   1 
ATOM   6665 N  N     . ALA B 2 304 ? -7.43100  -72.23000 -19.59900 1.000 65.05000  ? 304 ALA B N     1 
ATOM   6666 C  CA    . ALA B 2 304 ? -7.08500  -72.31200 -18.18900 1.000 64.27000  ? 304 ALA B CA    1 
ATOM   6667 C  C     . ALA B 2 304 ? -6.15200  -71.15000 -17.77300 1.000 68.49000  ? 304 ALA B C     1 
ATOM   6668 O  O     . ALA B 2 304 ? -6.38000  -70.50500 -16.73600 1.000 62.02000  ? 304 ALA B O     1 
ATOM   6669 C  CB    . ALA B 2 304 ? -6.45500  -73.65400 -17.89100 1.000 62.03000  ? 304 ALA B CB    1 
ATOM   6670 N  N     . GLU B 2 305 ? -5.12000  -70.88000 -18.58100 1.000 64.63000  ? 305 GLU B N     1 
ATOM   6671 C  CA    . GLU B 2 305 ? -4.19100  -69.77700 -18.29800 1.000 65.06000  ? 305 GLU B CA    1 
ATOM   6672 C  C     . GLU B 2 305 ? -4.95500  -68.48700 -18.17500 1.000 66.50000  ? 305 GLU B C     1 
ATOM   6673 O  O     . GLU B 2 305 ? -4.92800  -67.84400 -17.12800 1.000 68.94000  ? 305 GLU B O     1 
ATOM   6674 C  CB    . GLU B 2 305 ? -3.13400  -69.58800 -19.39200 1.000 69.59000  ? 305 GLU B CB    1 
ATOM   6675 C  CG    . GLU B 2 305 ? -2.34900  -70.80200 -19.85200 1.000 73.19000  ? 305 GLU B CG    1 
ATOM   6676 C  CD    . GLU B 2 305 ? -1.44000  -70.45200 -21.03100 1.000 81.49000  ? 305 GLU B CD    1 
ATOM   6677 O  OE1   . GLU B 2 305 ? -1.13800  -69.24500 -21.21900 1.000 80.80000  ? 305 GLU B OE1   1 
ATOM   6678 O  OE2   . GLU B 2 305 ? -1.04400  -71.37700 -21.77600 1.000 85.08000  ? 305 GLU B OE2   1 
ATOM   6679 N  N     . ASN B 2 306 ? -5.61100  -68.12000 -19.27900 1.000 66.36000  ? 306 ASN B N     1 
ATOM   6680 C  CA    . ASN B 2 306 ? -6.42700  -66.91100 -19.38400 1.000 56.38000  ? 306 ASN B CA    1 
ATOM   6681 C  C     . ASN B 2 306 ? -7.27800  -66.66600 -18.14300 1.000 59.24000  ? 306 ASN B C     1 
ATOM   6682 O  O     . ASN B 2 306 ? -7.40300  -65.54200 -17.66500 1.000 59.99000  ? 306 ASN B O     1 
ATOM   6683 C  CB    . ASN B 2 306 ? -7.34100  -66.99400 -20.60300 1.000 51.68000  ? 306 ASN B CB    1 
ATOM   6684 C  CG    . ASN B 2 306 ? -6.59900  -66.85100 -21.91500 1.000 52.58000  ? 306 ASN B CG    1 
ATOM   6685 O  OD1   . ASN B 2 306 ? -5.61400  -66.11100 -22.02200 1.000 54.04000  ? 306 ASN B OD1   1 
ATOM   6686 N  ND2   . ASN B 2 306 ? -7.08400  -67.55100 -22.93700 1.000 48.55000  ? 306 ASN B ND2   1 
ATOM   6687 N  N     . ARG B 2 307 ? -7.86000  -67.73200 -17.61300 1.000 61.84000  ? 307 ARG B N     1 
ATOM   6688 C  CA    . ARG B 2 307 ? -8.71300  -67.60100 -16.44900 1.000 65.50000  ? 307 ARG B CA    1 
ATOM   6689 C  C     . ARG B 2 307 ? -7.90500  -67.08700 -15.26700 1.000 74.26000  ? 307 ARG B C     1 
ATOM   6690 O  O     . ARG B 2 307 ? -8.42900  -66.38300 -14.39500 1.000 73.20000  ? 307 ARG B O     1 
ATOM   6691 C  CB    . ARG B 2 307 ? -9.36600  -68.93500 -16.12600 1.000 66.36000  ? 307 ARG B CB    1 
ATOM   6692 C  CG    . ARG B 2 307 ? -10.86600 -68.86100 -16.07600 1.000 69.23000  ? 307 ARG B CG    1 
ATOM   6693 C  CD    . ARG B 2 307 ? -11.45500 -70.24400 -16.02800 1.000 68.41000  ? 307 ARG B CD    1 
ATOM   6694 N  NE    . ARG B 2 307 ? -12.72500 -70.29400 -16.73500 1.000 71.61000  ? 307 ARG B NE    1 
ATOM   6695 C  CZ    . ARG B 2 307 ? -13.02800 -71.22100 -17.63500 1.000 73.02000  ? 307 ARG B CZ    1 
ATOM   6696 N  NH1   . ARG B 2 307 ? -12.15500 -72.17800 -17.92700 1.000 65.74000  ? 307 ARG B NH1   1 
ATOM   6697 N  NH2   . ARG B 2 307 ? -14.20800 -71.19400 -18.23500 1.000 70.96000  ? 307 ARG B NH2   1 
ATOM   6698 N  N     . GLU B 2 308 ? -6.61800  -67.43100 -15.26900 1.000 77.57000  ? 308 GLU B N     1 
ATOM   6699 C  CA    . GLU B 2 308 ? -5.69200  -67.04200 -14.20500 1.000 81.52000  ? 308 GLU B CA    1 
ATOM   6700 C  C     . GLU B 2 308 ? -5.01200  -65.70200 -14.48500 1.000 75.99000  ? 308 GLU B C     1 
ATOM   6701 O  O     . GLU B 2 308 ? -4.82300  -64.90100 -13.57300 1.000 83.14000  ? 308 GLU B O     1 
ATOM   6702 C  CB    . GLU B 2 308 ? -4.64000  -68.13900 -13.99400 1.000 79.13000  ? 308 GLU B CB    1 
ATOM   6703 C  CG    . GLU B 2 308 ? -5.23200  -69.44000 -13.45400 1.000 87.58000  ? 308 GLU B CG    1 
ATOM   6704 C  CD    . GLU B 2 308 ? -6.04100  -69.24000 -12.16500 1.000 98.08000  ? 308 GLU B CD    1 
ATOM   6705 O  OE1   . GLU B 2 308 ? -5.55600  -68.53800 -11.24200 1.000 99.29000  ? 308 GLU B OE1   1 
ATOM   6706 O  OE2   . GLU B 2 308 ? -7.16800  -69.78100 -12.08500 1.000 97.93000  ? 308 GLU B OE2   1 
ATOM   6707 N  N     . ILE B 2 309 ? -4.64900  -65.45800 -15.74000 1.000 69.22000  ? 309 ILE B N     1 
ATOM   6708 C  CA    . ILE B 2 309 ? -4.09600  -64.16700 -16.13400 1.000 61.79000  ? 309 ILE B CA    1 
ATOM   6709 C  C     . ILE B 2 309 ? -5.08600  -63.06300 -15.79000 1.000 69.04000  ? 309 ILE B C     1 
ATOM   6710 O  O     . ILE B 2 309 ? -4.69900  -61.91700 -15.56000 1.000 76.10000  ? 309 ILE B O     1 
ATOM   6711 C  CB    . ILE B 2 309 ? -3.75700  -64.13200 -17.64100 1.000 63.26000  ? 309 ILE B CB    1 
ATOM   6712 C  CG1   . ILE B 2 309 ? -2.59300  -65.06800 -17.93600 1.000 62.45000  ? 309 ILE B CG1   1 
ATOM   6713 C  CG2   . ILE B 2 309 ? -3.38800  -62.73300 -18.10500 1.000 57.51000  ? 309 ILE B CG2   1 
ATOM   6714 C  CD1   . ILE B 2 309 ? -2.81700  -65.95700 -19.13200 1.000 69.10000  ? 309 ILE B CD1   1 
ATOM   6715 N  N     . LEU B 2 310 ? -6.36700  -63.41500 -15.72400 1.000 69.82000  ? 310 LEU B N     1 
ATOM   6716 C  CA    . LEU B 2 310 ? -7.40200  -62.44300 -15.39500 1.000 69.87000  ? 310 LEU B CA    1 
ATOM   6717 C  C     . LEU B 2 310 ? -7.44300  -62.13900 -13.89900 1.000 77.99000  ? 310 LEU B C     1 
ATOM   6718 O  O     . LEU B 2 310 ? -7.92500  -61.07300 -13.49300 1.000 65.77000  ? 310 LEU B O     1 
ATOM   6719 C  CB    . LEU B 2 310 ? -8.75800  -62.94700 -15.88400 1.000 68.17000  ? 310 LEU B CB    1 
ATOM   6720 C  CG    . LEU B 2 310 ? -8.91600  -62.80200 -17.40100 1.000 62.79000  ? 310 LEU B CG    1 
ATOM   6721 C  CD1   . LEU B 2 310 ? -10.20800 -63.42800 -17.88500 1.000 54.18000  ? 310 LEU B CD1   1 
ATOM   6722 C  CD2   . LEU B 2 310 ? -8.86100  -61.33900 -17.77100 1.000 61.91000  ? 310 LEU B CD2   1 
ATOM   6723 N  N     . LYS B 2 311 ? -6.95200  -63.08400 -13.09100 1.000 85.51000  ? 311 LYS B N     1 
ATOM   6724 C  CA    . LYS B 2 311 ? -6.88300  -62.92000 -11.63500 1.000 90.07000  ? 311 LYS B CA    1 
ATOM   6725 C  C     . LYS B 2 311 ? -5.52400  -62.35300 -11.17800 1.000 92.19000  ? 311 LYS B C     1 
ATOM   6726 O  O     . LYS B 2 311 ? -4.89600  -62.84400 -10.23500 1.000 97.49000  ? 311 LYS B O     1 
ATOM   6727 C  CB    . LYS B 2 311 ? -7.15900  -64.25400 -10.93900 1.000 88.86000  ? 311 LYS B CB    1 
ATOM   6728 C  CG    . LYS B 2 311 ? -7.74200  -64.10400 -9.53400  1.000 99.97000  ? 311 LYS B CG    1 
ATOM   6729 C  CD    . LYS B 2 311 ? -7.33000  -65.26600 -8.63700  1.000 95.35000  ? 311 LYS B CD    1 
ATOM   6730 C  CE    . LYS B 2 311 ? -7.99600  -65.16000 -7.27200  1.000 83.21000  ? 311 LYS B CE    1 
ATOM   6731 N  NZ    . LYS B 2 311 ? -7.04100  -65.44600 -6.16900  1.000 88.41000  ? 311 LYS B NZ    1 
ATOM   6732 N  N     . GLU B 2 312 ? -5.07400  -61.32500 -11.88400 1.000 88.66000  ? 312 GLU B N     1 
ATOM   6733 C  CA    . GLU B 2 312 ? -3.84300  -60.61000 -11.58200 1.000 78.32000  ? 312 GLU B CA    1 
ATOM   6734 C  C     . GLU B 2 312 ? -4.25200  -59.15600 -11.47400 1.000 91.15000  ? 312 GLU B C     1 
ATOM   6735 O  O     . GLU B 2 312 ? -5.34600  -58.78900 -11.91800 1.000 93.63000  ? 312 GLU B O     1 
ATOM   6736 C  CB    . GLU B 2 312 ? -2.79300  -60.81400 -12.68500 1.000 75.15000  ? 312 GLU B CB    1 
ATOM   6737 C  CG    . GLU B 2 312 ? -2.24200  -62.23300 -12.78400 1.000 80.27000  ? 312 GLU B CG    1 
ATOM   6738 C  CD    . GLU B 2 312 ? -1.30600  -62.44800 -13.98200 1.000 87.95000  ? 312 GLU B CD    1 
ATOM   6739 O  OE1   . GLU B 2 312 ? -1.13700  -61.51800 -14.81400 1.000 82.20000  ? 312 GLU B OE1   1 
ATOM   6740 O  OE2   . GLU B 2 312 ? -0.73700  -63.56300 -14.08200 1.000 89.64000  ? 312 GLU B OE2   1 
ATOM   6741 N  N     . PRO B 2 313 ? -3.41600  -58.32100 -10.85600 1.000 91.53000  ? 313 PRO B N     1 
ATOM   6742 C  CA    . PRO B 2 313 ? -3.79500  -56.91400 -10.99500 1.000 84.41000  ? 313 PRO B CA    1 
ATOM   6743 C  C     . PRO B 2 313 ? -3.25600  -56.35600 -12.31300 1.000 77.56000  ? 313 PRO B C     1 
ATOM   6744 O  O     . PRO B 2 313 ? -2.18400  -56.79000 -12.76400 1.000 77.20000  ? 313 PRO B O     1 
ATOM   6745 C  CB    . PRO B 2 313 ? -3.14300  -56.24900 -9.77200  1.000 86.99000  ? 313 PRO B CB    1 
ATOM   6746 C  CG    . PRO B 2 313 ? -2.83200  -57.39600 -8.82700  1.000 89.46000  ? 313 PRO B CG    1 
ATOM   6747 C  CD    . PRO B 2 313 ? -2.50500  -58.54800 -9.72500  1.000 82.99000  ? 313 PRO B CD    1 
ATOM   6748 N  N     . VAL B 2 314 ? -3.99700  -55.43100 -12.92100 1.000 71.72000  ? 314 VAL B N     1 
ATOM   6749 C  CA    . VAL B 2 314 ? -3.50000  -54.70300 -14.07500 1.000 74.71000  ? 314 VAL B CA    1 
ATOM   6750 C  C     . VAL B 2 314 ? -2.14800  -54.10800 -13.71700 1.000 79.68000  ? 314 VAL B C     1 
ATOM   6751 O  O     . VAL B 2 314 ? -2.00700  -53.36000 -12.75700 1.000 78.91000  ? 314 VAL B O     1 
ATOM   6752 C  CB    . VAL B 2 314 ? -4.43800  -53.56700 -14.52100 1.000 71.76000  ? 314 VAL B CB    1 
ATOM   6753 C  CG1   . VAL B 2 314 ? -4.14000  -53.18300 -15.97500 1.000 61.25000  ? 314 VAL B CG1   1 
ATOM   6754 C  CG2   . VAL B 2 314 ? -5.89000  -53.96300 -14.35700 1.000 71.71000  ? 314 VAL B CG2   1 
ATOM   6755 N  N     . HIS B 2 315 ? -1.14500  -54.45300 -14.49400 1.000 77.67000  ? 315 HIS B N     1 
ATOM   6756 C  CA    . HIS B 2 315 ? 0.19000   -54.00700 -14.20100 1.000 73.10000  ? 315 HIS B CA    1 
ATOM   6757 C  C     . HIS B 2 315 ? 0.40800   -52.59500 -14.74000 1.000 72.13000  ? 315 HIS B C     1 
ATOM   6758 O  O     . HIS B 2 315 ? -0.10300  -52.24800 -15.79200 1.000 67.74000  ? 315 HIS B O     1 
ATOM   6759 C  CB    . HIS B 2 315 ? 1.18900   -55.01400 -14.78600 1.000 74.46000  ? 315 HIS B CB    1 
ATOM   6760 C  CG    . HIS B 2 315 ? 2.55400   -54.45500 -15.00200 1.000 82.75000  ? 315 HIS B CG    1 
ATOM   6761 N  ND1   . HIS B 2 315 ? 3.49000   -54.35900 -13.99300 1.000 83.77000  ? 315 HIS B ND1   1 
ATOM   6762 C  CD2   . HIS B 2 315 ? 3.13400   -53.92700 -16.10700 1.000 80.33000  ? 315 HIS B CD2   1 
ATOM   6763 C  CE1   . HIS B 2 315 ? 4.59200   -53.80700 -14.47400 1.000 88.53000  ? 315 HIS B CE1   1 
ATOM   6764 N  NE2   . HIS B 2 315 ? 4.40000   -53.53500 -15.75200 1.000 83.30000  ? 315 HIS B NE2   1 
ATOM   6765 N  N     . GLY B 2 316 ? 1.15500   -51.78100 -13.99900 1.000 69.58000  ? 316 GLY B N     1 
ATOM   6766 C  CA    . GLY B 2 316 ? 1.63900   -50.50400 -14.48800 1.000 61.84000  ? 316 GLY B CA    1 
ATOM   6767 C  C     . GLY B 2 316 ? 0.65000   -49.36100 -14.56900 1.000 60.05000  ? 316 GLY B C     1 
ATOM   6768 O  O     . GLY B 2 316 ? 0.67300   -48.57600 -15.50800 1.000 56.59000  ? 316 GLY B O     1 
ATOM   6769 N  N     . VAL B 2 317 ? -0.22700  -49.26500 -13.58200 1.000 59.07000  ? 317 VAL B N     1 
ATOM   6770 C  CA    . VAL B 2 317 ? -1.20500  -48.18300 -13.54700 1.000 58.29000  ? 317 VAL B CA    1 
ATOM   6771 C  C     . VAL B 2 317 ? -0.92700  -47.23300 -12.39800 1.000 52.35000  ? 317 VAL B C     1 
ATOM   6772 O  O     . VAL B 2 317 ? -1.12900  -47.56200 -11.24000 1.000 52.21000  ? 317 VAL B O     1 
ATOM   6773 C  CB    . VAL B 2 317 ? -2.64300  -48.71500 -13.41400 1.000 59.15000  ? 317 VAL B CB    1 
ATOM   6774 C  CG1   . VAL B 2 317 ? -3.13600  -49.21000 -14.72300 1.000 60.99000  ? 317 VAL B CG1   1 
ATOM   6775 C  CG2   . VAL B 2 317 ? -2.69900  -49.82400 -12.42600 1.000 64.87000  ? 317 VAL B CG2   1 
ATOM   6776 N  N     . TYR B 2 318 ? -0.45700  -46.04200 -12.72700 1.000 47.67000  ? 318 TYR B N     1 
ATOM   6777 C  CA    . TYR B 2 318 ? -0.08500  -45.09500 -11.69700 1.000 45.41000  ? 318 TYR B CA    1 
ATOM   6778 C  C     . TYR B 2 318 ? -0.97000  -43.90100 -11.71300 1.000 44.03000  ? 318 TYR B C     1 
ATOM   6779 O  O     . TYR B 2 318 ? -0.99800  -43.15900 -12.68400 1.000 46.79000  ? 318 TYR B O     1 
ATOM   6780 C  CB    . TYR B 2 318 ? 1.37100   -44.66700 -11.85800 1.000 45.70000  ? 318 TYR B CB    1 
ATOM   6781 C  CG    . TYR B 2 318 ? 2.29300   -45.84400 -11.73800 1.000 51.28000  ? 318 TYR B CG    1 
ATOM   6782 C  CD1   . TYR B 2 318 ? 2.65100   -46.35500 -10.49600 1.000 53.67000  ? 318 TYR B CD1   1 
ATOM   6783 C  CD2   . TYR B 2 318 ? 2.75900   -46.47900 -12.86500 1.000 53.82000  ? 318 TYR B CD2   1 
ATOM   6784 C  CE1   . TYR B 2 318 ? 3.47200   -47.44600 -10.39100 1.000 54.53000  ? 318 TYR B CE1   1 
ATOM   6785 C  CE2   . TYR B 2 318 ? 3.57100   -47.57200 -12.77500 1.000 53.87000  ? 318 TYR B CE2   1 
ATOM   6786 C  CZ    . TYR B 2 318 ? 3.92600   -48.05400 -11.54000 1.000 57.69000  ? 318 TYR B CZ    1 
ATOM   6787 O  OH    . TYR B 2 318 ? 4.73500   -49.15800 -11.47600 1.000 61.92000  ? 318 TYR B OH    1 
ATOM   6788 N  N     . TYR B 2 319 ? -1.68900  -43.71600 -10.61500 1.000 40.21000  ? 319 TYR B N     1 
ATOM   6789 C  CA    . TYR B 2 319 ? -2.57500  -42.57300 -10.47400 1.000 39.44000  ? 319 TYR B CA    1 
ATOM   6790 C  C     . TYR B 2 319 ? -1.81400  -41.26900 -10.65300 1.000 42.46000  ? 319 TYR B C     1 
ATOM   6791 O  O     . TYR B 2 319 ? -0.81800  -41.03800 -9.99700  1.000 48.63000  ? 319 TYR B O     1 
ATOM   6792 C  CB    . TYR B 2 319 ? -3.28500  -42.60200 -9.11600  1.000 47.42000  ? 319 TYR B CB    1 
ATOM   6793 C  CG    . TYR B 2 319 ? -4.03800  -41.32600 -8.80800  1.000 50.91000  ? 319 TYR B CG    1 
ATOM   6794 C  CD1   . TYR B 2 319 ? -5.03500  -40.86300 -9.65800  1.000 49.49000  ? 319 TYR B CD1   1 
ATOM   6795 C  CD2   . TYR B 2 319 ? -3.74000  -40.57600 -7.67300  1.000 46.59000  ? 319 TYR B CD2   1 
ATOM   6796 C  CE1   . TYR B 2 319 ? -5.71500  -39.68300 -9.39300  1.000 52.43000  ? 319 TYR B CE1   1 
ATOM   6797 C  CE2   . TYR B 2 319 ? -4.41700  -39.40000 -7.39100  1.000 54.54000  ? 319 TYR B CE2   1 
ATOM   6798 C  CZ    . TYR B 2 319 ? -5.41000  -38.95500 -8.25700  1.000 58.35000  ? 319 TYR B CZ    1 
ATOM   6799 O  OH    . TYR B 2 319 ? -6.09600  -37.78000 -7.99800  1.000 52.83000  ? 319 TYR B OH    1 
ATOM   6800 N  N     . ASP B 2 320 ? -2.29200  -40.43300 -11.56600 1.000 44.94000  ? 320 ASP B N     1 
ATOM   6801 C  CA    . ASP B 2 320 ? -1.71400  -39.12300 -11.83000 1.000 52.31000  ? 320 ASP B CA    1 
ATOM   6802 C  C     . ASP B 2 320 ? -2.75100  -38.01700 -11.57400 1.000 59.25000  ? 320 ASP B C     1 
ATOM   6803 O  O     . ASP B 2 320 ? -3.73900  -37.91400 -12.29600 1.000 59.64000  ? 320 ASP B O     1 
ATOM   6804 C  CB    . ASP B 2 320 ? -1.19700  -39.07200 -13.27700 1.000 53.54000  ? 320 ASP B CB    1 
ATOM   6805 C  CG    . ASP B 2 320 ? -0.83900  -37.65600 -13.75100 1.000 61.89000  ? 320 ASP B CG    1 
ATOM   6806 O  OD1   . ASP B 2 320 ? -0.84100  -36.68700 -12.95100 1.000 60.78000  ? 320 ASP B OD1   1 
ATOM   6807 O  OD2   . ASP B 2 320 ? -0.53100  -37.52000 -14.95600 1.000 64.99000  ? 320 ASP B OD2   1 
ATOM   6808 N  N     . PRO B 2 321 ? -2.51100  -37.16800 -10.55800 1.000 60.09000  ? 321 PRO B N     1 
ATOM   6809 C  CA    . PRO B 2 321 ? -3.42600  -36.07400 -10.19700 1.000 52.62000  ? 321 PRO B CA    1 
ATOM   6810 C  C     . PRO B 2 321 ? -3.51700  -34.96300 -11.23500 1.000 56.28000  ? 321 PRO B C     1 
ATOM   6811 O  O     . PRO B 2 321 ? -4.49100  -34.22000 -11.20700 1.000 60.46000  ? 321 PRO B O     1 
ATOM   6812 C  CB    . PRO B 2 321 ? -2.83300  -35.53400 -8.90500  1.000 43.72000  ? 321 PRO B CB    1 
ATOM   6813 C  CG    . PRO B 2 321 ? -2.04200  -36.67900 -8.35300  1.000 55.36000  ? 321 PRO B CG    1 
ATOM   6814 C  CD    . PRO B 2 321 ? -1.45400  -37.35000 -9.55200  1.000 54.52000  ? 321 PRO B CD    1 
ATOM   6815 N  N     . SER B 2 322 ? -2.54700  -34.84700 -12.13500 1.000 55.18000  ? 322 SER B N     1 
ATOM   6816 C  CA    . SER B 2 322 ? -2.62500  -33.83000 -13.18700 1.000 59.59000  ? 322 SER B CA    1 
ATOM   6817 C  C     . SER B 2 322 ? -3.63300  -34.18600 -14.29900 1.000 58.63000  ? 322 SER B C     1 
ATOM   6818 O  O     . SER B 2 322 ? -3.81500  -33.42500 -15.25400 1.000 61.23000  ? 322 SER B O     1 
ATOM   6819 C  CB    . SER B 2 322 ? -1.23800  -33.59300 -13.80900 1.000 64.79000  ? 322 SER B CB    1 
ATOM   6820 O  OG    . SER B 2 322 ? -0.85200  -34.65400 -14.67400 1.000 67.39000  ? 322 SER B OG    1 
ATOM   6821 N  N     . LYS B 2 323 ? -4.27300  -35.34600 -14.18300 1.000 58.05000  ? 323 LYS B N     1 
ATOM   6822 C  CA    . LYS B 2 323 ? -5.22500  -35.80800 -15.19700 1.000 58.38000  ? 323 LYS B CA    1 
ATOM   6823 C  C     . LYS B 2 323 ? -6.54100  -36.20600 -14.54800 1.000 57.84000  ? 323 LYS B C     1 
ATOM   6824 O  O     . LYS B 2 323 ? -6.57500  -36.56900 -13.37100 1.000 56.16000  ? 323 LYS B O     1 
ATOM   6825 C  CB    . LYS B 2 323 ? -4.64100  -36.97800 -15.99000 1.000 58.82000  ? 323 LYS B CB    1 
ATOM   6826 C  CG    . LYS B 2 323 ? -3.30200  -36.63800 -16.63600 1.000 66.72000  ? 323 LYS B CG    1 
ATOM   6827 C  CD    . LYS B 2 323 ? -2.93500  -37.59700 -17.75200 1.000 74.78000  ? 323 LYS B CD    1 
ATOM   6828 C  CE    . LYS B 2 323 ? -2.55900  -38.95900 -17.20900 1.000 75.38000  ? 323 LYS B CE    1 
ATOM   6829 N  NZ    . LYS B 2 323 ? -2.18900  -39.86700 -18.32700 1.000 81.68000  ? 323 LYS B NZ    1 
ATOM   6830 N  N     . ASP B 2 324 ? -7.63100  -36.12600 -15.29700 1.000 55.72000  ? 324 ASP B N     1 
ATOM   6831 C  CA    . ASP B 2 324 ? -8.92100  -36.42300 -14.70000 1.000 53.36000  ? 324 ASP B CA    1 
ATOM   6832 C  C     . ASP B 2 324 ? -9.05300  -37.90000 -14.50200 1.000 45.60000  ? 324 ASP B C     1 
ATOM   6833 O  O     . ASP B 2 324 ? -8.56600  -38.67800 -15.31400 1.000 46.98000  ? 324 ASP B O     1 
ATOM   6834 C  CB    . ASP B 2 324 ? -10.06900 -35.92600 -15.56900 1.000 59.55000  ? 324 ASP B CB    1 
ATOM   6835 C  CG    . ASP B 2 324 ? -9.96100  -34.45000 -15.88300 1.000 69.65000  ? 324 ASP B CG    1 
ATOM   6836 O  OD1   . ASP B 2 324 ? -9.69000  -33.65400 -14.94500 1.000 69.97000  ? 324 ASP B OD1   1 
ATOM   6837 O  OD2   . ASP B 2 324 ? -10.13800 -34.09400 -17.07100 1.000 72.05000  ? 324 ASP B OD2   1 
ATOM   6838 N  N     . LEU B 2 325 ? -9.68400  -38.28700 -13.40400 1.000 38.69000  ? 325 LEU B N     1 
ATOM   6839 C  CA    . LEU B 2 325 ? -10.24600 -39.61500 -13.32800 1.000 46.26000  ? 325 LEU B CA    1 
ATOM   6840 C  C     . LEU B 2 325 ? -11.41300 -39.66800 -14.31500 1.000 47.11000  ? 325 LEU B C     1 
ATOM   6841 O  O     . LEU B 2 325 ? -12.20000 -38.72700 -14.40200 1.000 49.62000  ? 325 LEU B O     1 
ATOM   6842 C  CB    . LEU B 2 325 ? -10.73600 -39.94100 -11.91600 1.000 49.55000  ? 325 LEU B CB    1 
ATOM   6843 C  CG    . LEU B 2 325 ? -9.74600  -40.06200 -10.76800 1.000 49.11000  ? 325 LEU B CG    1 
ATOM   6844 C  CD1   . LEU B 2 325 ? -10.52500 -40.09200 -9.46300  1.000 49.17000  ? 325 LEU B CD1   1 
ATOM   6845 C  CD2   . LEU B 2 325 ? -8.92500  -41.33300 -10.94100 1.000 45.67000  ? 325 LEU B CD2   1 
ATOM   6846 N  N     . ILE B 2 326 ? -11.52500 -40.76800 -15.04800 1.000 41.24000  ? 326 ILE B N     1 
ATOM   6847 C  CA    . ILE B 2 326 ? -12.61600 -40.97600 -15.98400 1.000 35.34000  ? 326 ILE B CA    1 
ATOM   6848 C  C     . ILE B 2 326 ? -13.41600 -42.19300 -15.56900 1.000 40.02000  ? 326 ILE B C     1 
ATOM   6849 O  O     . ILE B 2 326 ? -12.84200 -43.24100 -15.28800 1.000 42.23000  ? 326 ILE B O     1 
ATOM   6850 C  CB    . ILE B 2 326 ? -12.07400 -41.18000 -17.38900 1.000 39.85000  ? 326 ILE B CB    1 
ATOM   6851 C  CG1   . ILE B 2 326 ? -11.46600 -39.88000 -17.89200 1.000 32.06000  ? 326 ILE B CG1   1 
ATOM   6852 C  CG2   . ILE B 2 326 ? -13.15100 -41.69700 -18.31200 1.000 36.43000  ? 326 ILE B CG2   1 
ATOM   6853 C  CD1   . ILE B 2 326 ? -10.79400 -40.03700 -19.17600 1.000 35.23000  ? 326 ILE B CD1   1 
ATOM   6854 N  N     . ALA B 2 327 ? -14.73500 -42.08400 -15.51000 1.000 34.65000  ? 327 ALA B N     1 
ATOM   6855 C  CA    . ALA B 2 327 ? -15.52100 -43.25900 -15.15300 1.000 36.78000  ? 327 ALA B CA    1 
ATOM   6856 C  C     . ALA B 2 327 ? -16.44300 -43.69500 -16.29300 1.000 35.58000  ? 327 ALA B C     1 
ATOM   6857 O  O     . ALA B 2 327 ? -17.18700 -42.89700 -16.84800 1.000 42.58000  ? 327 ALA B O     1 
ATOM   6858 C  CB    . ALA B 2 327 ? -16.32700 -42.99400 -13.87200 1.000 29.73000  ? 327 ALA B CB    1 
ATOM   6859 N  N     . GLU B 2 328 ? -16.39000 -44.96100 -16.66400 1.000 32.92000  ? 328 GLU B N     1 
ATOM   6860 C  CA    . GLU B 2 328 ? -17.40600 -45.46600 -17.56700 1.000 38.82000  ? 328 GLU B CA    1 
ATOM   6861 C  C     . GLU B 2 328 ? -18.40400 -46.32600 -16.80500 1.000 38.15000  ? 328 GLU B C     1 
ATOM   6862 O  O     . GLU B 2 328 ? -18.02700 -47.06000 -15.89300 1.000 35.72000  ? 328 GLU B O     1 
ATOM   6863 C  CB    . GLU B 2 328 ? -16.79000 -46.27300 -18.68900 1.000 40.58000  ? 328 GLU B CB    1 
ATOM   6864 C  CG    . GLU B 2 328 ? -15.86700 -45.50100 -19.57500 1.000 44.12000  ? 328 GLU B CG    1 
ATOM   6865 C  CD    . GLU B 2 328 ? -15.70800 -46.21000 -20.89300 1.000 54.98000  ? 328 GLU B CD    1 
ATOM   6866 O  OE1   . GLU B 2 328 ? -14.72300 -45.92800 -21.60700 1.000 55.38000  ? 328 GLU B OE1   1 
ATOM   6867 O  OE2   . GLU B 2 328 ? -16.58800 -47.05500 -21.20500 1.000 55.50000  ? 328 GLU B OE2   1 
ATOM   6868 N  N     . ILE B 2 329 ? -19.67500 -46.22300 -17.17600 1.000 35.08000  ? 329 ILE B N     1 
ATOM   6869 C  CA    . ILE B 2 329 ? -20.71200 -47.07500 -16.61200 1.000 35.36000  ? 329 ILE B CA    1 
ATOM   6870 C  C     . ILE B 2 329 ? -21.43900 -47.81500 -17.73600 1.000 37.89000  ? 329 ILE B C     1 
ATOM   6871 O  O     . ILE B 2 329 ? -21.79600 -47.21300 -18.75000 1.000 43.26000  ? 329 ILE B O     1 
ATOM   6872 C  CB    . ILE B 2 329 ? -21.71600 -46.25700 -15.80300 1.000 33.79000  ? 329 ILE B CB    1 
ATOM   6873 C  CG1   . ILE B 2 329 ? -21.00200 -45.41700 -14.75400 1.000 30.87000  ? 329 ILE B CG1   1 
ATOM   6874 C  CG2   . ILE B 2 329 ? -22.72600 -47.14600 -15.14700 1.000 31.01000  ? 329 ILE B CG2   1 
ATOM   6875 C  CD1   . ILE B 2 329 ? -21.96500 -44.59000 -13.95700 1.000 34.13000  ? 329 ILE B CD1   1 
ATOM   6876 N  N     . GLN B 2 330 ? -21.64100 -49.11800 -17.57500 1.000 38.22000  ? 330 GLN B N     1 
ATOM   6877 C  CA    . GLN B 2 330 ? -22.44100 -49.88200 -18.53400 1.000 40.46000  ? 330 GLN B CA    1 
ATOM   6878 C  C     . GLN B 2 330 ? -23.60500 -50.51700 -17.83200 1.000 40.36000  ? 330 GLN B C     1 
ATOM   6879 O  O     . GLN B 2 330 ? -23.43400 -51.10000 -16.76400 1.000 43.66000  ? 330 GLN B O     1 
ATOM   6880 C  CB    . GLN B 2 330 ? -21.63000 -50.97300 -19.22600 1.000 43.00000  ? 330 GLN B CB    1 
ATOM   6881 C  CG    . GLN B 2 330 ? -20.33000 -50.49600 -19.81200 1.000 45.52000  ? 330 GLN B CG    1 
ATOM   6882 C  CD    . GLN B 2 330 ? -19.20900 -50.59900 -18.81300 1.000 39.82000  ? 330 GLN B CD    1 
ATOM   6883 O  OE1   . GLN B 2 330 ? -19.27300 -51.39400 -17.86600 1.000 36.81000  ? 330 GLN B OE1   1 
ATOM   6884 N  NE2   . GLN B 2 330 ? -18.17700 -49.78800 -19.00200 1.000 36.04000  ? 330 GLN B NE2   1 
ATOM   6885 N  N     . LYS B 2 331 ? -24.78900 -50.39600 -18.42400 1.000 44.56000  ? 331 LYS B N     1 
ATOM   6886 C  CA    . LYS B 2 331 ? -25.97900 -51.03600 -17.88300 1.000 43.82000  ? 331 LYS B CA    1 
ATOM   6887 C  C     . LYS B 2 331 ? -25.96600 -52.52200 -18.22900 1.000 45.85000  ? 331 LYS B C     1 
ATOM   6888 O  O     . LYS B 2 331 ? -25.93900 -52.87900 -19.41200 1.000 51.98000  ? 331 LYS B O     1 
ATOM   6889 C  CB    . LYS B 2 331 ? -27.23400 -50.36200 -18.43100 1.000 42.64000  ? 331 LYS B CB    1 
ATOM   6890 C  CG    . LYS B 2 331 ? -28.50200 -51.17500 -18.30900 1.000 39.02000  ? 331 LYS B CG    1 
ATOM   6891 C  CD    . LYS B 2 331 ? -29.63100 -50.40800 -18.92700 1.000 38.62000  ? 331 LYS B CD    1 
ATOM   6892 C  CE    . LYS B 2 331 ? -30.92100 -51.20100 -18.92600 1.000 41.67000  ? 331 LYS B CE    1 
ATOM   6893 N  NZ    . LYS B 2 331 ? -32.00200 -50.38400 -19.54000 1.000 45.30000  ? 331 LYS B NZ    1 
ATOM   6894 N  N     . GLN B 2 332 ? -25.96000 -53.38600 -17.21200 1.000 41.22000  ? 332 GLN B N     1 
ATOM   6895 C  CA    . GLN B 2 332 ? -25.97900 -54.83100 -17.46000 1.000 47.89000  ? 332 GLN B CA    1 
ATOM   6896 C  C     . GLN B 2 332 ? -27.36400 -55.45400 -17.34300 1.000 53.28000  ? 332 GLN B C     1 
ATOM   6897 O  O     . GLN B 2 332 ? -27.51300 -56.66400 -17.48000 1.000 59.29000  ? 332 GLN B O     1 
ATOM   6898 C  CB    . GLN B 2 332 ? -25.04100 -55.57000 -16.51000 1.000 49.98000  ? 332 GLN B CB    1 
ATOM   6899 C  CG    . GLN B 2 332 ? -23.59900 -55.11500 -16.52700 1.000 49.73000  ? 332 GLN B CG    1 
ATOM   6900 C  CD    . GLN B 2 332 ? -22.87000 -55.35700 -17.84300 1.000 57.56000  ? 332 GLN B CD    1 
ATOM   6901 O  OE1   . GLN B 2 332 ? -23.48200 -55.57600 -18.89300 1.000 62.20000  ? 332 GLN B OE1   1 
ATOM   6902 N  NE2   . GLN B 2 332 ? -21.54200 -55.28500 -17.79200 1.000 59.19000  ? 332 GLN B NE2   1 
ATOM   6903 N  N     . GLY B 2 333 ? -28.37200 -54.63100 -17.08600 1.000 53.50000  ? 333 GLY B N     1 
ATOM   6904 C  CA    . GLY B 2 333 ? -29.72100 -55.12500 -16.92100 1.000 42.16000  ? 333 GLY B CA    1 
ATOM   6905 C  C     . GLY B 2 333 ? -29.95000 -55.69200 -15.53600 1.000 53.73000  ? 333 GLY B C     1 
ATOM   6906 O  O     . GLY B 2 333 ? -29.00000 -55.93600 -14.79200 1.000 53.53000  ? 333 GLY B O     1 
ATOM   6907 N  N     . GLN B 2 334 ? -31.22100 -55.88200 -15.19100 1.000 61.09000  ? 334 GLN B N     1 
ATOM   6908 C  CA    . GLN B 2 334 ? -31.61000 -56.55300 -13.96100 1.000 56.53000  ? 334 GLN B CA    1 
ATOM   6909 C  C     . GLN B 2 334 ? -31.12700 -55.81800 -12.72600 1.000 61.48000  ? 334 GLN B C     1 
ATOM   6910 O  O     . GLN B 2 334 ? -30.83900 -56.44400 -11.69800 1.000 61.29000  ? 334 GLN B O     1 
ATOM   6911 C  CB    . GLN B 2 334 ? -31.07200 -57.98000 -13.94600 1.000 69.43000  ? 334 GLN B CB    1 
ATOM   6912 C  CG    . GLN B 2 334 ? -31.55800 -58.85000 -15.08700 1.000 78.85000  ? 334 GLN B CG    1 
ATOM   6913 C  CD    . GLN B 2 334 ? -31.54800 -60.31200 -14.70300 1.000 92.03000  ? 334 GLN B CD    1 
ATOM   6914 O  OE1   . GLN B 2 334 ? -31.98400 -60.68200 -13.60100 1.000 87.51000  ? 334 GLN B OE1   1 
ATOM   6915 N  NE2   . GLN B 2 334 ? -31.04100 -61.15700 -15.60000 1.000 103.63000 ? 334 GLN B NE2   1 
ATOM   6916 N  N     . GLY B 2 335 ? -31.02900 -54.49600 -12.82800 1.000 55.48000  ? 335 GLY B N     1 
ATOM   6917 C  CA    . GLY B 2 335 ? -30.54400 -53.68500 -11.72600 1.000 55.37000  ? 335 GLY B CA    1 
ATOM   6918 C  C     . GLY B 2 335 ? -29.04000 -53.79000 -11.51600 1.000 55.98000  ? 335 GLY B C     1 
ATOM   6919 O  O     . GLY B 2 335 ? -28.52700 -53.37700 -10.47800 1.000 56.09000  ? 335 GLY B O     1 
ATOM   6920 N  N     . GLN B 2 336 ? -28.33400 -54.33200 -12.50500 1.000 50.87000  ? 336 GLN B N     1 
ATOM   6921 C  CA    . GLN B 2 336 ? -26.89000 -54.52500 -12.41200 1.000 53.83000  ? 336 GLN B CA    1 
ATOM   6922 C  C     . GLN B 2 336 ? -26.13100 -53.50400 -13.25100 1.000 46.16000  ? 336 GLN B C     1 
ATOM   6923 O  O     . GLN B 2 336 ? -26.42100 -53.32400 -14.42700 1.000 49.84000  ? 336 GLN B O     1 
ATOM   6924 C  CB    . GLN B 2 336 ? -26.51400 -55.94300 -12.85600 1.000 63.33000  ? 336 GLN B CB    1 
ATOM   6925 C  CG    . GLN B 2 336 ? -27.09000 -57.05900 -11.98500 1.000 63.55000  ? 336 GLN B CG    1 
ATOM   6926 C  CD    . GLN B 2 336 ? -26.42900 -57.14600 -10.62000 1.000 70.41000  ? 336 GLN B CD    1 
ATOM   6927 O  OE1   . GLN B 2 336 ? -25.25300 -56.79700 -10.45300 1.000 73.31000  ? 336 GLN B OE1   1 
ATOM   6928 N  NE2   . GLN B 2 336 ? -27.18600 -57.61400 -9.63200  1.000 73.42000  ? 336 GLN B NE2   1 
ATOM   6929 N  N     . TRP B 2 337 ? -25.14600 -52.85500 -12.64800 1.000 44.30000  ? 337 TRP B N     1 
ATOM   6930 C  CA    . TRP B 2 337 ? -24.36800 -51.82000 -13.33000 1.000 46.68000  ? 337 TRP B CA    1 
ATOM   6931 C  C     . TRP B 2 337 ? -22.87800 -52.03800 -13.13200 1.000 44.67000  ? 337 TRP B C     1 
ATOM   6932 O  O     . TRP B 2 337 ? -22.42500 -52.22100 -12.00600 1.000 49.15000  ? 337 TRP B O     1 
ATOM   6933 C  CB    . TRP B 2 337 ? -24.75400 -50.42600 -12.82000 1.000 43.33000  ? 337 TRP B CB    1 
ATOM   6934 C  CG    . TRP B 2 337 ? -26.21200 -50.12800 -12.93700 1.000 45.90000  ? 337 TRP B CG    1 
ATOM   6935 C  CD1   . TRP B 2 337 ? -27.21100 -50.54900 -12.10100 1.000 45.93000  ? 337 TRP B CD1   1 
ATOM   6936 C  CD2   . TRP B 2 337 ? -26.84500 -49.34800 -13.95300 1.000 40.72000  ? 337 TRP B CD2   1 
ATOM   6937 N  NE1   . TRP B 2 337 ? -28.42600 -50.07200 -12.53600 1.000 41.61000  ? 337 TRP B NE1   1 
ATOM   6938 C  CE2   . TRP B 2 337 ? -28.22400 -49.33000 -13.67300 1.000 41.50000  ? 337 TRP B CE2   1 
ATOM   6939 C  CE3   . TRP B 2 337 ? -26.37400 -48.65800 -15.07200 1.000 37.81000  ? 337 TRP B CE3   1 
ATOM   6940 C  CZ2   . TRP B 2 337 ? -29.13600 -48.65900 -14.47300 1.000 38.95000  ? 337 TRP B CZ2   1 
ATOM   6941 C  CZ3   . TRP B 2 337 ? -27.27800 -47.98800 -15.85500 1.000 38.10000  ? 337 TRP B CZ3   1 
ATOM   6942 C  CH2   . TRP B 2 337 ? -28.64200 -47.99400 -15.55700 1.000 38.73000  ? 337 TRP B CH2   1 
ATOM   6943 N  N     . THR B 2 338 ? -22.11200 -52.01200 -14.21500 1.000 37.59000  ? 338 THR B N     1 
ATOM   6944 C  CA    . THR B 2 338 ? -20.67100 -52.19500 -14.10700 1.000 38.75000  ? 338 THR B CA    1 
ATOM   6945 C  C     . THR B 2 338 ? -19.94300 -50.89200 -14.41700 1.000 42.21000  ? 338 THR B C     1 
ATOM   6946 O  O     . THR B 2 338 ? -20.37000 -50.11900 -15.28500 1.000 39.57000  ? 338 THR B O     1 
ATOM   6947 C  CB    . THR B 2 338 ? -20.16800 -53.29000 -15.05000 1.000 36.84000  ? 338 THR B CB    1 
ATOM   6948 O  OG1   . THR B 2 338 ? -20.60500 -53.00500 -16.38100 1.000 41.63000  ? 338 THR B OG1   1 
ATOM   6949 C  CG2   . THR B 2 338 ? -20.70500 -54.63800 -14.62900 1.000 38.52000  ? 338 THR B CG2   1 
ATOM   6950 N  N     . TYR B 2 339 ? -18.84900 -50.64200 -13.70700 1.000 35.88000  ? 339 TYR B N     1 
ATOM   6951 C  CA    . TYR B 2 339 ? -18.10600 -49.42100 -13.92800 1.000 35.14000  ? 339 TYR B CA    1 
ATOM   6952 C  C     . TYR B 2 339 ? -16.60200 -49.65200 -13.89000 1.000 41.50000  ? 339 TYR B C     1 
ATOM   6953 O  O     . TYR B 2 339 ? -16.12100 -50.57400 -13.23300 1.000 38.93000  ? 339 TYR B O     1 
ATOM   6954 C  CB    . TYR B 2 339 ? -18.50900 -48.36100 -12.89700 1.000 36.34000  ? 339 TYR B CB    1 
ATOM   6955 C  CG    . TYR B 2 339 ? -18.09600 -48.66400 -11.47200 1.000 37.13000  ? 339 TYR B CG    1 
ATOM   6956 C  CD1   . TYR B 2 339 ? -16.85700 -48.25200 -10.99000 1.000 38.25000  ? 339 TYR B CD1   1 
ATOM   6957 C  CD2   . TYR B 2 339 ? -18.95000 -49.33300 -10.60300 1.000 36.89000  ? 339 TYR B CD2   1 
ATOM   6958 C  CE1   . TYR B 2 339 ? -16.46500 -48.51400 -9.69600  1.000 39.65000  ? 339 TYR B CE1   1 
ATOM   6959 C  CE2   . TYR B 2 339 ? -18.56800 -49.60500 -9.29500  1.000 41.88000  ? 339 TYR B CE2   1 
ATOM   6960 C  CZ    . TYR B 2 339 ? -17.31700 -49.18600 -8.85100  1.000 47.31000  ? 339 TYR B CZ    1 
ATOM   6961 O  OH    . TYR B 2 339 ? -16.89100 -49.43700 -7.56500  1.000 54.89000  ? 339 TYR B OH    1 
ATOM   6962 N  N     . GLN B 2 340 ? -15.86600 -48.81000 -14.60900 1.000 41.20000  ? 340 GLN B N     1 
ATOM   6963 C  CA    . GLN B 2 340 ? -14.41400 -48.82400 -14.54800 1.000 40.33000  ? 340 GLN B CA    1 
ATOM   6964 C  C     . GLN B 2 340 ? -13.92600 -47.40200 -14.41200 1.000 40.79000  ? 340 GLN B C     1 
ATOM   6965 O  O     . GLN B 2 340 ? -14.49200 -46.50000 -15.02700 1.000 45.85000  ? 340 GLN B O     1 
ATOM   6966 C  CB    . GLN B 2 340 ? -13.80000 -49.47500 -15.78300 1.000 41.41000  ? 340 GLN B CB    1 
ATOM   6967 C  CG    . GLN B 2 340 ? -14.46800 -50.76900 -16.17700 1.000 39.23000  ? 340 GLN B CG    1 
ATOM   6968 C  CD    . GLN B 2 340 ? -15.68900 -50.51000 -16.99200 1.000 37.11000  ? 340 GLN B CD    1 
ATOM   6969 O  OE1   . GLN B 2 340 ? -15.64500 -49.75200 -17.96000 1.000 41.10000  ? 340 GLN B OE1   1 
ATOM   6970 N  NE2   . GLN B 2 340 ? -16.80000 -51.09100 -16.58900 1.000 36.98000  ? 340 GLN B NE2   1 
ATOM   6971 N  N     . ILE B 2 341 ? -12.89700 -47.21200 -13.58700 1.000 39.52000  ? 341 ILE B N     1 
ATOM   6972 C  CA    . ILE B 2 341 ? -12.25500 -45.91700 -13.37200 1.000 38.75000  ? 341 ILE B CA    1 
ATOM   6973 C  C     . ILE B 2 341 ? -10.84100 -45.99700 -13.92300 1.000 36.41000  ? 341 ILE B C     1 
ATOM   6974 O  O     . ILE B 2 341 ? -10.10000 -46.92000 -13.61600 1.000 41.71000  ? 341 ILE B O     1 
ATOM   6975 C  CB    . ILE B 2 341 ? -12.20500 -45.52500 -11.86700 1.000 39.39000  ? 341 ILE B CB    1 
ATOM   6976 C  CG1   . ILE B 2 341 ? -13.60900 -45.42700 -11.27400 1.000 36.61000  ? 341 ILE B CG1   1 
ATOM   6977 C  CG2   . ILE B 2 341 ? -11.43400 -44.22600 -11.65500 1.000 38.79000  ? 341 ILE B CG2   1 
ATOM   6978 C  CD1   . ILE B 2 341 ? -13.61800 -44.98300 -9.82400  1.000 39.33000  ? 341 ILE B CD1   1 
ATOM   6979 N  N     . TYR B 2 342 ? -10.46800 -45.03800 -14.74500 1.000 33.80000  ? 342 TYR B N     1 
ATOM   6980 C  CA    . TYR B 2 342 ? -9.17400  -45.07000 -15.38700 1.000 39.40000  ? 342 TYR B CA    1 
ATOM   6981 C  C     . TYR B 2 342 ? -8.79100  -43.64100 -15.74300 1.000 44.21000  ? 342 TYR B C     1 
ATOM   6982 O  O     . TYR B 2 342 ? -9.60500  -42.72800 -15.59900 1.000 46.44000  ? 342 TYR B O     1 
ATOM   6983 C  CB    . TYR B 2 342 ? -9.20400  -45.96800 -16.62900 1.000 40.93000  ? 342 TYR B CB    1 
ATOM   6984 C  CG    . TYR B 2 342 ? -10.09000 -45.44800 -17.74700 1.000 39.91000  ? 342 TYR B CG    1 
ATOM   6985 C  CD1   . TYR B 2 342 ? -11.43900 -45.78000 -17.81500 1.000 44.19000  ? 342 TYR B CD1   1 
ATOM   6986 C  CD2   . TYR B 2 342 ? -9.57800  -44.62500 -18.73100 1.000 44.54000  ? 342 TYR B CD2   1 
ATOM   6987 C  CE1   . TYR B 2 342 ? -12.25100 -45.29700 -18.84300 1.000 40.67000  ? 342 TYR B CE1   1 
ATOM   6988 C  CE2   . TYR B 2 342 ? -10.37000 -44.14200 -19.75100 1.000 45.13000  ? 342 TYR B CE2   1 
ATOM   6989 C  CZ    . TYR B 2 342 ? -11.70000 -44.48100 -19.80900 1.000 44.83000  ? 342 TYR B CZ    1 
ATOM   6990 O  OH    . TYR B 2 342 ? -12.46700 -43.97300 -20.83900 1.000 50.98000  ? 342 TYR B OH    1 
ATOM   6991 N  N     . GLN B 2 343 ? -7.55200  -43.44300 -16.18600 1.000 45.67000  ? 343 GLN B N     1 
ATOM   6992 C  CA    . GLN B 2 343 ? -7.10200  -42.13900 -16.64600 1.000 40.38000  ? 343 GLN B CA    1 
ATOM   6993 C  C     . GLN B 2 343 ? -6.60700  -42.24100 -18.06600 1.000 43.65000  ? 343 GLN B C     1 
ATOM   6994 O  O     . GLN B 2 343 ? -6.58400  -41.26100 -18.79000 1.000 47.01000  ? 343 GLN B O     1 
ATOM   6995 C  CB    . GLN B 2 343 ? -5.99300  -41.60200 -15.76500 1.000 43.36000  ? 343 GLN B CB    1 
ATOM   6996 C  CG    . GLN B 2 343 ? -6.37300  -41.40200 -14.34000 1.000 46.40000  ? 343 GLN B CG    1 
ATOM   6997 C  CD    . GLN B 2 343 ? -5.31400  -40.62800 -13.60400 1.000 51.01000  ? 343 GLN B CD    1 
ATOM   6998 O  OE1   . GLN B 2 343 ? -4.28000  -41.18000 -13.22700 1.000 52.10000  ? 343 GLN B OE1   1 
ATOM   6999 N  NE2   . GLN B 2 343 ? -5.55200  -39.33700 -13.41200 1.000 49.83000  ? 343 GLN B NE2   1 
ATOM   7000 N  N     . GLU B 2 344 ? -6.18200  -43.43900 -18.44400 1.000 49.68000  ? 344 GLU B N     1 
ATOM   7001 C  CA    . GLU B 2 344 ? -5.79400  -43.75500 -19.81800 1.000 55.48000  ? 344 GLU B CA    1 
ATOM   7002 C  C     . GLU B 2 344 ? -6.42200  -45.07800 -20.20900 1.000 59.56000  ? 344 GLU B C     1 
ATOM   7003 O  O     . GLU B 2 344 ? -6.39100  -46.02500 -19.41400 1.000 61.28000  ? 344 GLU B O     1 
ATOM   7004 C  CB    . GLU B 2 344 ? -4.27400  -43.85200 -19.98100 1.000 56.87000  ? 344 GLU B CB    1 
ATOM   7005 C  CG    . GLU B 2 344 ? -3.49200  -42.58200 -19.72000 1.000 64.30000  ? 344 GLU B CG    1 
ATOM   7006 C  CD    . GLU B 2 344 ? -3.64400  -41.55600 -20.83200 1.000 82.31000  ? 344 GLU B CD    1 
ATOM   7007 O  OE1   . GLU B 2 344 ? -4.27300  -41.87500 -21.87200 1.000 87.18000  ? 344 GLU B OE1   1 
ATOM   7008 O  OE2   . GLU B 2 344 ? -3.13000  -40.42600 -20.66000 1.000 85.06000  ? 344 GLU B OE2   1 
ATOM   7009 N  N     . PRO B 2 345 ? -6.92800  -45.14200 -21.43500 1.000 57.67000  ? 345 PRO B N     1 
ATOM   7010 C  CA    . PRO B 2 345 ? -7.53200  -46.35700 -21.98400 1.000 54.06000  ? 345 PRO B CA    1 
ATOM   7011 C  C     . PRO B 2 345 ? -6.85900  -47.69500 -21.67500 1.000 54.70000  ? 345 PRO B C     1 
ATOM   7012 O  O     . PRO B 2 345 ? -5.70300  -47.94300 -22.01600 1.000 52.01000  ? 345 PRO B O     1 
ATOM   7013 C  CB    . PRO B 2 345 ? -7.40500  -46.15100 -23.49600 1.000 64.21000  ? 345 PRO B CB    1 
ATOM   7014 C  CG    . PRO B 2 345 ? -7.41600  -44.67500 -23.66900 1.000 62.62000  ? 345 PRO B CG    1 
ATOM   7015 C  CD    . PRO B 2 345 ? -6.70600  -44.11600 -22.46900 1.000 52.60000  ? 345 PRO B CD    1 
ATOM   7016 N  N     . PHE B 2 346 ? -7.63600  -48.54600 -21.01900 1.000 57.81000  ? 346 PHE B N     1 
ATOM   7017 C  CA    . PHE B 2 346 ? -7.27200  -49.91200 -20.61800 1.000 56.50000  ? 346 PHE B CA    1 
ATOM   7018 C  C     . PHE B 2 346 ? -6.35800  -49.92500 -19.39600 1.000 52.24000  ? 346 PHE B C     1 
ATOM   7019 O  O     . PHE B 2 346 ? -5.91900  -50.98700 -18.95000 1.000 50.74000  ? 346 PHE B O     1 
ATOM   7020 C  CB    . PHE B 2 346 ? -6.61500  -50.69500 -21.76400 1.000 57.29000  ? 346 PHE B CB    1 
ATOM   7021 C  CG    . PHE B 2 346 ? -7.36900  -50.61300 -23.05900 1.000 57.13000  ? 346 PHE B CG    1 
ATOM   7022 C  CD1   . PHE B 2 346 ? -8.62800  -51.19400 -23.18200 1.000 59.24000  ? 346 PHE B CD1   1 
ATOM   7023 C  CD2   . PHE B 2 346 ? -6.83300  -49.94300 -24.14500 1.000 53.82000  ? 346 PHE B CD2   1 
ATOM   7024 C  CE1   . PHE B 2 346 ? -9.33500  -51.11200 -24.36800 1.000 53.88000  ? 346 PHE B CE1   1 
ATOM   7025 C  CE2   . PHE B 2 346 ? -7.52900  -49.86000 -25.33100 1.000 58.39000  ? 346 PHE B CE2   1 
ATOM   7026 C  CZ    . PHE B 2 346 ? -8.78500  -50.44400 -25.44300 1.000 58.87000  ? 346 PHE B CZ    1 
ATOM   7027 N  N     . LYS B 2 347 ? -6.08300  -48.75200 -18.84300 1.000 52.99000  ? 347 LYS B N     1 
ATOM   7028 C  CA    . LYS B 2 347 ? -5.30800  -48.67100 -17.61400 1.000 51.60000  ? 347 LYS B CA    1 
ATOM   7029 C  C     . LYS B 2 347 ? -6.20100  -48.37500 -16.39700 1.000 47.56000  ? 347 LYS B C     1 
ATOM   7030 O  O     . LYS B 2 347 ? -6.16500  -47.27800 -15.82500 1.000 49.38000  ? 347 LYS B O     1 
ATOM   7031 C  CB    . LYS B 2 347 ? -4.21900  -47.61600 -17.76400 1.000 53.24000  ? 347 LYS B CB    1 
ATOM   7032 C  CG    . LYS B 2 347 ? -2.82600  -48.20700 -17.96600 1.000 59.23000  ? 347 LYS B CG    1 
ATOM   7033 C  CD    . LYS B 2 347 ? -2.54000  -48.56000 -19.40800 1.000 61.02000  ? 347 LYS B CD    1 
ATOM   7034 C  CE    . LYS B 2 347 ? -1.05400  -48.86100 -19.60100 1.000 60.38000  ? 347 LYS B CE    1 
ATOM   7035 N  NZ    . LYS B 2 347 ? -0.63600  -50.12500 -18.93500 1.000 60.73000  ? 347 LYS B NZ    1 
ATOM   7036 N  N     . ASN B 2 348 ? -7.00400  -49.36300 -16.01100 1.000 42.99000  ? 348 ASN B N     1 
ATOM   7037 C  CA    . ASN B 2 348 ? -7.97200  -49.19200 -14.93200 1.000 47.37000  ? 348 ASN B CA    1 
ATOM   7038 C  C     . ASN B 2 348 ? -7.32900  -49.05000 -13.57400 1.000 46.34000  ? 348 ASN B C     1 
ATOM   7039 O  O     . ASN B 2 348 ? -6.37400  -49.74700 -13.24400 1.000 52.13000  ? 348 ASN B O     1 
ATOM   7040 C  CB    . ASN B 2 348 ? -8.95800  -50.35900 -14.88800 1.000 41.75000  ? 348 ASN B CB    1 
ATOM   7041 C  CG    . ASN B 2 348 ? -9.82300  -50.42500 -16.12300 1.000 52.45000  ? 348 ASN B CG    1 
ATOM   7042 O  OD1   . ASN B 2 348 ? -10.09000 -49.39300 -16.76800 1.000 45.58000  ? 348 ASN B OD1   1 
ATOM   7043 N  ND2   . ASN B 2 348 ? -10.26000 -51.64300 -16.48200 1.000 48.45000  ? 348 ASN B ND2   1 
ATOM   7044 N  N     . LEU B 2 349 ? -7.87200  -48.13300 -12.78900 1.000 43.58000  ? 349 LEU B N     1 
ATOM   7045 C  CA    . LEU B 2 349 ? -7.48000  -47.98800 -11.40200 1.000 43.14000  ? 349 LEU B CA    1 
ATOM   7046 C  C     . LEU B 2 349 ? -8.42100  -48.84500 -10.56400 1.000 43.30000  ? 349 LEU B C     1 
ATOM   7047 O  O     . LEU B 2 349 ? -8.01400  -49.50300 -9.61000  1.000 50.37000  ? 349 LEU B O     1 
ATOM   7048 C  CB    . LEU B 2 349 ? -7.51400  -46.51400 -10.97500 1.000 43.21000  ? 349 LEU B CB    1 
ATOM   7049 C  CG    . LEU B 2 349 ? -6.34900  -45.58300 -11.35000 1.000 38.65000  ? 349 LEU B CG    1 
ATOM   7050 C  CD1   . LEU B 2 349 ? -6.21000  -45.41600 -12.84000 1.000 48.50000  ? 349 LEU B CD1   1 
ATOM   7051 C  CD2   . LEU B 2 349 ? -6.54900  -44.22400 -10.70500 1.000 45.12000  ? 349 LEU B CD2   1 
ATOM   7052 N  N     . LYS B 2 350 ? -9.68900  -48.84200 -10.94000 1.000 45.11000  ? 350 LYS B N     1 
ATOM   7053 C  CA    . LYS B 2 350 ? -10.66900 -49.69800 -10.29200 1.000 45.07000  ? 350 LYS B CA    1 
ATOM   7054 C  C     . LYS B 2 350 ? -11.69600 -50.11400 -11.31100 1.000 46.10000  ? 350 LYS B C     1 
ATOM   7055 O  O     . LYS B 2 350 ? -11.92200 -49.42100 -12.30200 1.000 47.71000  ? 350 LYS B O     1 
ATOM   7056 C  CB    . LYS B 2 350 ? -11.37200 -49.01000 -9.11800  1.000 44.69000  ? 350 LYS B CB    1 
ATOM   7057 C  CG    . LYS B 2 350 ? -12.02600 -50.03200 -8.19900  1.000 51.31000  ? 350 LYS B CG    1 
ATOM   7058 C  CD    . LYS B 2 350 ? -13.03000 -49.44400 -7.23100  1.000 55.86000  ? 350 LYS B CD    1 
ATOM   7059 C  CE    . LYS B 2 350 ? -13.64100 -50.57500 -6.39800  1.000 59.56000  ? 350 LYS B CE    1 
ATOM   7060 N  NZ    . LYS B 2 350 ? -14.64000 -50.10500 -5.39700  1.000 63.15000  ? 350 LYS B NZ    1 
ATOM   7061 N  N     . THR B 2 351 ? -12.29100 -51.26800 -11.07500 1.000 41.41000  ? 351 THR B N     1 
ATOM   7062 C  CA    . THR B 2 351 ? -13.39400 -51.75000 -11.86900 1.000 45.36000  ? 351 THR B CA    1 
ATOM   7063 C  C     . THR B 2 351 ? -14.35100 -52.36100 -10.87800 1.000 45.26000  ? 351 THR B C     1 
ATOM   7064 O  O     . THR B 2 351 ? -13.91700 -53.02800 -9.95000  1.000 53.49000  ? 351 THR B O     1 
ATOM   7065 C  CB    . THR B 2 351 ? -12.95700 -52.78300 -12.89700 1.000 43.52000  ? 351 THR B CB    1 
ATOM   7066 O  OG1   . THR B 2 351 ? -12.26300 -53.83500 -12.22700 1.000 50.66000  ? 351 THR B OG1   1 
ATOM   7067 C  CG2   . THR B 2 351 ? -12.03500 -52.15700 -13.92100 1.000 41.94000  ? 351 THR B CG2   1 
ATOM   7068 N  N     . GLY B 2 352 ? -15.64400 -52.13000 -11.04100 1.000 40.20000  ? 352 GLY B N     1 
ATOM   7069 C  CA    . GLY B 2 352 ? -16.56000 -52.54200 -10.00200 1.000 40.20000  ? 352 GLY B CA    1 
ATOM   7070 C  C     . GLY B 2 352 ? -17.93800 -52.87700 -10.49700 1.000 42.65000  ? 352 GLY B C     1 
ATOM   7071 O  O     . GLY B 2 352 ? -18.21000 -52.91400 -11.69700 1.000 45.38000  ? 352 GLY B O     1 
ATOM   7072 N  N     . LYS B 2 353 ? -18.82200 -53.12000 -9.54800  1.000 48.19000  ? 353 LYS B N     1 
ATOM   7073 C  CA    . LYS B 2 353 ? -20.18400 -53.47000 -9.86300  1.000 44.82000  ? 353 LYS B CA    1 
ATOM   7074 C  C     . LYS B 2 353 ? -21.09000 -52.70000 -8.91100  1.000 55.36000  ? 353 LYS B C     1 
ATOM   7075 O  O     . LYS B 2 353 ? -20.68900 -52.37400 -7.78700  1.000 56.01000  ? 353 LYS B O     1 
ATOM   7076 C  CB    . LYS B 2 353 ? -20.38200 -54.97400 -9.74100  1.000 45.86000  ? 353 LYS B CB    1 
ATOM   7077 C  CG    . LYS B 2 353 ? -21.53300 -55.51300 -10.54300 1.000 53.20000  ? 353 LYS B CG    1 
ATOM   7078 C  CD    . LYS B 2 353 ? -21.62700 -57.03300 -10.40800 1.000 65.47000  ? 353 LYS B CD    1 
ATOM   7079 C  CE    . LYS B 2 353 ? -22.09500 -57.46700 -9.02100  1.000 59.60000  ? 353 LYS B CE    1 
ATOM   7080 N  NZ    . LYS B 2 353 ? -22.99400 -58.66600 -9.09700  1.000 61.51000  ? 353 LYS B NZ    1 
ATOM   7081 N  N     . TYR B 2 354 ? -22.29000 -52.37400 -9.37900  1.000 54.49000  ? 354 TYR B N     1 
ATOM   7082 C  CA    . TYR B 2 354 ? -23.30200 -51.74900 -8.54900  1.000 52.04000  ? 354 TYR B CA    1 
ATOM   7083 C  C     . TYR B 2 354 ? -24.62500 -52.46300 -8.82500  1.000 53.61000  ? 354 TYR B C     1 
ATOM   7084 O  O     . TYR B 2 354 ? -25.12000 -52.42400 -9.94500  1.000 53.55000  ? 354 TYR B O     1 
ATOM   7085 C  CB    . TYR B 2 354 ? -23.39000 -50.24300 -8.83300  1.000 49.90000  ? 354 TYR B CB    1 
ATOM   7086 C  CG    . TYR B 2 354 ? -24.39300 -49.51900 -7.96800  1.000 58.50000  ? 354 TYR B CG    1 
ATOM   7087 C  CD1   . TYR B 2 354 ? -24.10300 -49.20100 -6.64100  1.000 65.06000  ? 354 TYR B CD1   1 
ATOM   7088 C  CD2   . TYR B 2 354 ? -25.64400 -49.16300 -8.46900  1.000 60.41000  ? 354 TYR B CD2   1 
ATOM   7089 C  CE1   . TYR B 2 354 ? -25.03900 -48.54100 -5.83300  1.000 61.11000  ? 354 TYR B CE1   1 
ATOM   7090 C  CE2   . TYR B 2 354 ? -26.57900 -48.51000 -7.67400  1.000 57.15000  ? 354 TYR B CE2   1 
ATOM   7091 C  CZ    . TYR B 2 354 ? -26.27100 -48.20300 -6.36000  1.000 62.38000  ? 354 TYR B CZ    1 
ATOM   7092 O  OH    . TYR B 2 354 ? -27.19600 -47.55300 -5.57700  1.000 68.90000  ? 354 TYR B OH    1 
ATOM   7093 N  N     . ALA B 2 355 ? -25.16500 -53.15300 -7.81800  1.000 57.59000  ? 355 ALA B N     1 
ATOM   7094 C  CA    . ALA B 2 355 ? -26.44000 -53.86800 -7.94800  1.000 58.85000  ? 355 ALA B CA    1 
ATOM   7095 C  C     . ALA B 2 355 ? -27.53900 -53.15600 -7.17100  1.000 66.97000  ? 355 ALA B C     1 
ATOM   7096 O  O     . ALA B 2 355 ? -27.27700 -52.53800 -6.13700  1.000 64.59000  ? 355 ALA B O     1 
ATOM   7097 C  CB    . ALA B 2 355 ? -26.31300 -55.29700 -7.47300  1.000 49.96000  ? 355 ALA B CB    1 
ATOM   7098 N  N     . ARG B 2 356 ? -28.76500 -53.24100 -7.68300  1.000 71.42000  ? 356 ARG B N     1 
ATOM   7099 C  CA    . ARG B 2 356 ? -29.91800 -52.59000 -7.06600  1.000 71.43000  ? 356 ARG B CA    1 
ATOM   7100 C  C     . ARG B 2 356 ? -31.13500 -53.52200 -7.05100  1.000 80.68000  ? 356 ARG B C     1 
ATOM   7101 O  O     . ARG B 2 356 ? -31.03900 -54.69400 -7.44700  1.000 72.01000  ? 356 ARG B O     1 
ATOM   7102 C  CB    . ARG B 2 356 ? -30.24600 -51.27900 -7.79500  1.000 70.49000  ? 356 ARG B CB    1 
ATOM   7103 C  CG    . ARG B 2 356 ? -29.52800 -50.05700 -7.21900  1.000 75.32000  ? 356 ARG B CG    1 
ATOM   7104 C  CD    . ARG B 2 356 ? -30.02900 -49.76400 -5.80800  1.000 83.19000  ? 356 ARG B CD    1 
ATOM   7105 N  NE    . ARG B 2 356 ? -29.04300 -49.16900 -4.90600  1.000 82.77000  ? 356 ARG B NE    1 
ATOM   7106 C  CZ    . ARG B 2 356 ? -28.36400 -49.85100 -3.98400  1.000 88.68000  ? 356 ARG B CZ    1 
ATOM   7107 N  NH1   . ARG B 2 356 ? -28.55200 -51.16200 -3.84400  1.000 87.53000  ? 356 ARG B NH1   1 
ATOM   7108 N  NH2   . ARG B 2 356 ? -27.49000 -49.22500 -3.20200  1.000 86.63000  ? 356 ARG B NH2   1 
ATOM   7109 N  N     . MET B 2 357 ? -32.26700 -52.99500 -6.57400  1.000 92.49000  ? 357 MET B N     1 
ATOM   7110 C  CA    . MET B 2 357 ? -33.53400 -53.73800 -6.50100  1.000 91.70000  ? 357 MET B CA    1 
ATOM   7111 C  C     . MET B 2 357 ? -33.89600 -54.40800 -7.83000  1.000 84.35000  ? 357 MET B C     1 
ATOM   7112 O  O     . MET B 2 357 ? -34.11400 -53.72400 -8.82400  1.000 84.71000  ? 357 MET B O     1 
ATOM   7113 C  CB    . MET B 2 357 ? -34.67300 -52.80100 -6.05700  1.000 93.86000  ? 357 MET B CB    1 
ATOM   7114 C  CG    . MET B 2 357 ? -36.08600 -53.28000 -6.41700  1.000 103.00000 ? 357 MET B CG    1 
ATOM   7115 S  SD    . MET B 2 357 ? -37.36500 -52.10500 -5.89800  1.000 114.88000 ? 357 MET B SD    1 
ATOM   7116 C  CE    . MET B 2 357 ? -38.72100 -52.50600 -7.00700  1.000 75.60000  ? 357 MET B CE    1 
ATOM   7117 N  N     . THR B 2 362 ? -38.71500 -50.46700 -10.96700 1.000 56.68000  ? 362 THR B N     1 
ATOM   7118 C  CA    . THR B 2 362 ? -37.33400 -50.23400 -11.39100 1.000 54.31000  ? 362 THR B CA    1 
ATOM   7119 C  C     . THR B 2 362 ? -37.23300 -48.90900 -12.14500 1.000 54.46000  ? 362 THR B C     1 
ATOM   7120 O  O     . THR B 2 362 ? -38.07400 -48.58500 -12.98000 1.000 61.36000  ? 362 THR B O     1 
ATOM   7121 C  CB    . THR B 2 362 ? -36.80000 -51.39600 -12.28500 1.000 57.88000  ? 362 THR B CB    1 
ATOM   7122 O  OG1   . THR B 2 362 ? -36.12500 -52.35800 -11.46900 1.000 69.73000  ? 362 THR B OG1   1 
ATOM   7123 C  CG2   . THR B 2 362 ? -35.81700 -50.89900 -13.32600 1.000 52.30000  ? 362 THR B CG2   1 
ATOM   7124 N  N     . ASN B 2 363 ? -36.20000 -48.13700 -11.84600 1.000 48.40000  ? 363 ASN B N     1 
ATOM   7125 C  CA    . ASN B 2 363 ? -36.00500 -46.86900 -12.51600 1.000 43.85000  ? 363 ASN B CA    1 
ATOM   7126 C  C     . ASN B 2 363 ? -34.52500 -46.70300 -12.88600 1.000 40.02000  ? 363 ASN B C     1 
ATOM   7127 O  O     . ASN B 2 363 ? -33.70500 -46.35100 -12.05100 1.000 39.36000  ? 363 ASN B O     1 
ATOM   7128 C  CB    . ASN B 2 363 ? -36.51900 -45.72900 -11.61100 1.000 41.09000  ? 363 ASN B CB    1 
ATOM   7129 C  CG    . ASN B 2 363 ? -36.26200 -44.32300 -12.18000 1.000 45.16000  ? 363 ASN B CG    1 
ATOM   7130 O  OD1   . ASN B 2 363 ? -35.40400 -44.11500 -13.04700 1.000 46.96000  ? 363 ASN B OD1   1 
ATOM   7131 N  ND2   . ASN B 2 363 ? -36.99100 -43.34100 -11.65000 1.000 45.02000  ? 363 ASN B ND2   1 
ATOM   7132 N  N     . ASP B 2 364 ? -34.20100 -46.93700 -14.15000 1.000 37.76000  ? 364 ASP B N     1 
ATOM   7133 C  CA    . ASP B 2 364 ? -32.83500 -46.81600 -14.60900 1.000 37.04000  ? 364 ASP B CA    1 
ATOM   7134 C  C     . ASP B 2 364 ? -32.21500 -45.47500 -14.27600 1.000 39.21000  ? 364 ASP B C     1 
ATOM   7135 O  O     . ASP B 2 364 ? -31.09300 -45.42400 -13.75800 1.000 43.05000  ? 364 ASP B O     1 
ATOM   7136 C  CB    . ASP B 2 364 ? -32.75800 -47.04300 -16.10900 1.000 41.05000  ? 364 ASP B CB    1 
ATOM   7137 C  CG    . ASP B 2 364 ? -32.79000 -48.49600 -16.46700 1.000 43.43000  ? 364 ASP B CG    1 
ATOM   7138 O  OD1   . ASP B 2 364 ? -32.71500 -49.32800 -15.53700 1.000 51.09000  ? 364 ASP B OD1   1 
ATOM   7139 O  OD2   . ASP B 2 364 ? -32.86700 -48.80800 -17.67500 1.000 47.52000  ? 364 ASP B OD2   1 
ATOM   7140 N  N     . VAL B 2 365 ? -32.92000 -44.38700 -14.56400 1.000 36.70000  ? 365 VAL B N     1 
ATOM   7141 C  CA    . VAL B 2 365 ? -32.32800 -43.07000 -14.31800 1.000 37.29000  ? 365 VAL B CA    1 
ATOM   7142 C  C     . VAL B 2 365 ? -31.96500 -42.85800 -12.84900 1.000 38.65000  ? 365 VAL B C     1 
ATOM   7143 O  O     . VAL B 2 365 ? -30.89700 -42.32300 -12.54500 1.000 35.12000  ? 365 VAL B O     1 
ATOM   7144 C  CB    . VAL B 2 365 ? -33.24200 -41.95300 -14.74600 1.000 37.26000  ? 365 VAL B CB    1 
ATOM   7145 C  CG1   . VAL B 2 365 ? -32.48200 -40.63200 -14.69500 1.000 40.35000  ? 365 VAL B CG1   1 
ATOM   7146 C  CG2   . VAL B 2 365 ? -33.76200 -42.23500 -16.14900 1.000 41.91000  ? 365 VAL B CG2   1 
ATOM   7147 N  N     . LYS B 2 366 ? -32.83900 -43.29400 -11.94400 1.000 39.10000  ? 366 LYS B N     1 
ATOM   7148 C  CA    . LYS B 2 366 ? -32.53100 -43.24200 -10.52000 1.000 36.89000  ? 366 LYS B CA    1 
ATOM   7149 C  C     . LYS B 2 366 ? -31.30800 -44.09100 -10.18200 1.000 38.22000  ? 366 LYS B C     1 
ATOM   7150 O  O     . LYS B 2 366 ? -30.33300 -43.59500 -9.62800  1.000 38.65000  ? 366 LYS B O     1 
ATOM   7151 C  CB    . LYS B 2 366 ? -33.73000 -43.70300 -9.71100  1.000 38.74000  ? 366 LYS B CB    1 
ATOM   7152 C  CG    . LYS B 2 366 ? -33.49100 -43.77400 -8.21300  1.000 40.09000  ? 366 LYS B CG    1 
ATOM   7153 C  CD    . LYS B 2 366 ? -34.83700 -43.88900 -7.48900  1.000 36.38000  ? 366 LYS B CD    1 
ATOM   7154 C  CE    . LYS B 2 366 ? -34.67900 -44.15300 -6.01100  1.000 38.64000  ? 366 LYS B CE    1 
ATOM   7155 N  NZ    . LYS B 2 366 ? -34.01000 -45.46600 -5.77600  1.000 57.41000  ? 366 LYS B NZ    1 
ATOM   7156 N  N     . GLN B 2 367 ? -31.36200 -45.37100 -10.52700 1.000 37.03000  ? 367 GLN B N     1 
ATOM   7157 C  CA    . GLN B 2 367 ? -30.25300 -46.27900 -10.27600 1.000 38.46000  ? 367 GLN B CA    1 
ATOM   7158 C  C     . GLN B 2 367 ? -28.94500 -45.72300 -10.81100 1.000 36.55000  ? 367 GLN B C     1 
ATOM   7159 O  O     . GLN B 2 367 ? -27.92100 -45.79200 -10.13700 1.000 40.82000  ? 367 GLN B O     1 
ATOM   7160 C  CB    . GLN B 2 367 ? -30.51700 -47.64500 -10.90400 1.000 39.11000  ? 367 GLN B CB    1 
ATOM   7161 C  CG    . GLN B 2 367 ? -31.33600 -48.57500 -10.05700 1.000 42.81000  ? 367 GLN B CG    1 
ATOM   7162 C  CD    . GLN B 2 367 ? -31.71500 -49.85000 -10.79400 1.000 54.20000  ? 367 GLN B CD    1 
ATOM   7163 O  OE1   . GLN B 2 367 ? -31.29400 -50.08300 -11.93500 1.000 51.44000  ? 367 GLN B OE1   1 
ATOM   7164 N  NE2   . GLN B 2 367 ? -32.52100 -50.68400 -10.14500 1.000 58.20000  ? 367 GLN B NE2   1 
ATOM   7165 N  N     . LEU B 2 368 ? -28.98000 -45.17500 -12.02000 1.000 32.42000  ? 368 LEU B N     1 
ATOM   7166 C  CA    . LEU B 2 368 ? -27.78500 -44.58000 -12.60700 1.000 32.69000  ? 368 LEU B CA    1 
ATOM   7167 C  C     . LEU B 2 368 ? -27.27000 -43.41300 -11.78900 1.000 33.85000  ? 368 LEU B C     1 
ATOM   7168 O  O     . LEU B 2 368 ? -26.05900 -43.22000 -11.67600 1.000 33.52000  ? 368 LEU B O     1 
ATOM   7169 C  CB    . LEU B 2 368 ? -28.05000 -44.11000 -14.03400 1.000 35.04000  ? 368 LEU B CB    1 
ATOM   7170 C  CG    . LEU B 2 368 ? -26.78700 -43.66700 -14.77400 1.000 30.56000  ? 368 LEU B CG    1 
ATOM   7171 C  CD1   . LEU B 2 368 ? -25.69700 -44.67500 -14.54200 1.000 29.99000  ? 368 LEU B CD1   1 
ATOM   7172 C  CD2   . LEU B 2 368 ? -27.06800 -43.56700 -16.25200 1.000 31.53000  ? 368 LEU B CD2   1 
ATOM   7173 N  N     . THR B 2 369 ? -28.19400 -42.63000 -11.23300 1.000 39.62000  ? 369 THR B N     1 
ATOM   7174 C  CA    . THR B 2 369 ? -27.84900 -41.43500 -10.46100 1.000 35.30000  ? 369 THR B CA    1 
ATOM   7175 C  C     . THR B 2 369 ? -27.23800 -41.84600 -9.13200  1.000 35.96000  ? 369 THR B C     1 
ATOM   7176 O  O     . THR B 2 369 ? -26.25600 -41.24600 -8.67500  1.000 36.02000  ? 369 THR B O     1 
ATOM   7177 C  CB    . THR B 2 369 ? -29.08400 -40.53900 -10.23500 1.000 33.65000  ? 369 THR B CB    1 
ATOM   7178 O  OG1   . THR B 2 369 ? -29.50500 -40.00500 -11.49400 1.000 31.17000  ? 369 THR B OG1   1 
ATOM   7179 C  CG2   . THR B 2 369 ? -28.76100 -39.38600 -9.30000  1.000 34.55000  ? 369 THR B CG2   1 
ATOM   7180 N  N     . GLU B 2 370 ? -27.82200 -42.88700 -8.53600  1.000 37.49000  ? 370 GLU B N     1 
ATOM   7181 C  CA    . GLU B 2 370 ? -27.27100 -43.54900 -7.35800  1.000 38.51000  ? 370 GLU B CA    1 
ATOM   7182 C  C     . GLU B 2 370 ? -25.89000 -44.14500 -7.62900  1.000 41.64000  ? 370 GLU B C     1 
ATOM   7183 O  O     . GLU B 2 370 ? -24.95900 -43.94900 -6.83500  1.000 45.70000  ? 370 GLU B O     1 
ATOM   7184 C  CB    . GLU B 2 370 ? -28.21200 -44.64800 -6.87100  1.000 38.69000  ? 370 GLU B CB    1 
ATOM   7185 C  CG    . GLU B 2 370 ? -29.23600 -44.16500 -5.88000  1.000 45.60000  ? 370 GLU B CG    1 
ATOM   7186 C  CD    . GLU B 2 370 ? -30.39100 -45.12800 -5.74000  1.000 57.65000  ? 370 GLU B CD    1 
ATOM   7187 O  OE1   . GLU B 2 370 ? -30.24100 -46.29700 -6.16500  1.000 59.46000  ? 370 GLU B OE1   1 
ATOM   7188 O  OE2   . GLU B 2 370 ? -31.44900 -44.71200 -5.21600  1.000 61.32000  ? 370 GLU B OE2   1 
ATOM   7189 N  N     . ALA B 2 371 ? -25.75700 -44.87900 -8.73500  1.000 37.48000  ? 371 ALA B N     1 
ATOM   7190 C  CA    . ALA B 2 371 ? -24.45800 -45.42400 -9.13900  1.000 38.26000  ? 371 ALA B CA    1 
ATOM   7191 C  C     . ALA B 2 371 ? -23.38900 -44.33500 -9.19400  1.000 36.25000  ? 371 ALA B C     1 
ATOM   7192 O  O     . ALA B 2 371 ? -22.32900 -44.48400 -8.59600  1.000 35.85000  ? 371 ALA B O     1 
ATOM   7193 C  CB    . ALA B 2 371 ? -24.56500 -46.11300 -10.48600 1.000 33.96000  ? 371 ALA B CB    1 
ATOM   7194 N  N     . VAL B 2 372 ? -23.68900 -43.24200 -9.90400  1.000 34.21000  ? 372 VAL B N     1 
ATOM   7195 C  CA    . VAL B 2 372 ? -22.78300 -42.10200 -10.04900 1.000 33.80000  ? 372 VAL B CA    1 
ATOM   7196 C  C     . VAL B 2 372 ? -22.38000 -41.48700 -8.70800  1.000 35.62000  ? 372 VAL B C     1 
ATOM   7197 O  O     . VAL B 2 372 ? -21.24800 -41.02800 -8.54200  1.000 37.53000  ? 372 VAL B O     1 
ATOM   7198 C  CB    . VAL B 2 372 ? -23.40700 -40.98300 -10.94500 1.000 35.53000  ? 372 VAL B CB    1 
ATOM   7199 C  CG1   . VAL B 2 372 ? -22.61300 -39.69600 -10.85100 1.000 36.41000  ? 372 VAL B CG1   1 
ATOM   7200 C  CG2   . VAL B 2 372 ? -23.46600 -41.41200 -12.40300 1.000 29.77000  ? 372 VAL B CG2   1 
ATOM   7201 N  N     . GLN B 2 373 ? -23.29200 -41.46800 -7.74500  1.000 37.09000  ? 373 GLN B N     1 
ATOM   7202 C  CA    . GLN B 2 373 ? -22.94100 -40.92700 -6.43600  1.000 37.77000  ? 373 GLN B CA    1 
ATOM   7203 C  C     . GLN B 2 373 ? -22.02700 -41.87400 -5.66300  1.000 39.80000  ? 373 GLN B C     1 
ATOM   7204 O  O     . GLN B 2 373 ? -21.05500 -41.43900 -5.03800  1.000 43.93000  ? 373 GLN B O     1 
ATOM   7205 C  CB    . GLN B 2 373 ? -24.19800 -40.62000 -5.63300  1.000 36.89000  ? 373 GLN B CB    1 
ATOM   7206 C  CG    . GLN B 2 373 ? -24.97700 -39.44700 -6.19700  1.000 43.05000  ? 373 GLN B CG    1 
ATOM   7207 C  CD    . GLN B 2 373 ? -26.30100 -39.24600 -5.50500  1.000 39.77000  ? 373 GLN B CD    1 
ATOM   7208 O  OE1   . GLN B 2 373 ? -26.34500 -38.88500 -4.32400  1.000 44.50000  ? 373 GLN B OE1   1 
ATOM   7209 N  NE2   . GLN B 2 373 ? -27.39600 -39.48400 -6.23200  1.000 33.90000  ? 373 GLN B NE2   1 
ATOM   7210 N  N     . LYS B 2 374 ? -22.32800 -43.16700 -5.71500  1.000 34.55000  ? 374 LYS B N     1 
ATOM   7211 C  CA    . LYS B 2 374 ? -21.49800 -44.14700 -5.04500  1.000 32.95000  ? 374 LYS B CA    1 
ATOM   7212 C  C     . LYS B 2 374 ? -20.08200 -44.13700 -5.61600  1.000 36.30000  ? 374 LYS B C     1 
ATOM   7213 O  O     . LYS B 2 374 ? -19.11400 -44.16900 -4.87100  1.000 43.10000  ? 374 LYS B O     1 
ATOM   7214 C  CB    . LYS B 2 374 ? -22.11900 -45.53900 -5.16800  1.000 41.09000  ? 374 LYS B CB    1 
ATOM   7215 C  CG    . LYS B 2 374 ? -21.51900 -46.54900 -4.20500  1.000 52.68000  ? 374 LYS B CG    1 
ATOM   7216 C  CD    . LYS B 2 374 ? -21.56100 -46.01700 -2.76600  1.000 60.07000  ? 374 LYS B CD    1 
ATOM   7217 C  CE    . LYS B 2 374 ? -20.40500 -46.56700 -1.91600  1.000 55.91000  ? 374 LYS B CE    1 
ATOM   7218 N  NZ    . LYS B 2 374 ? -20.33900 -48.06800 -1.91700  1.000 53.11000  ? 374 LYS B NZ    1 
ATOM   7219 N  N     . ILE B 2 375 ? -19.96500 -44.07300 -6.93800  1.000 33.51000  ? 375 ILE B N     1 
ATOM   7220 C  CA    . ILE B 2 375 ? -18.67100 -44.12200 -7.61100  1.000 32.33000  ? 375 ILE B CA    1 
ATOM   7221 C  C     . ILE B 2 375 ? -17.85200 -42.86600 -7.32800  1.000 37.90000  ? 375 ILE B C     1 
ATOM   7222 O  O     . ILE B 2 375 ? -16.63400 -42.92700 -7.16200  1.000 40.43000  ? 375 ILE B O     1 
ATOM   7223 C  CB    . ILE B 2 375 ? -18.85700 -44.29400 -9.12800  1.000 31.57000  ? 375 ILE B CB    1 
ATOM   7224 C  CG1   . ILE B 2 375 ? -19.46100 -45.66300 -9.41700  1.000 35.92000  ? 375 ILE B CG1   1 
ATOM   7225 C  CG2   . ILE B 2 375 ? -17.54300 -44.16700 -9.85800  1.000 29.57000  ? 375 ILE B CG2   1 
ATOM   7226 C  CD1   . ILE B 2 375 ? -20.07600 -45.78700 -10.78100 1.000 36.85000  ? 375 ILE B CD1   1 
ATOM   7227 N  N     . THR B 2 376 ? -18.52200 -41.72200 -7.26300  1.000 37.06000  ? 376 THR B N     1 
ATOM   7228 C  CA    . THR B 2 376 ? -17.83800 -40.47800 -6.94500  1.000 37.78000  ? 376 THR B CA    1 
ATOM   7229 C  C     . THR B 2 376 ? -17.33800 -40.55000 -5.51900  1.000 38.03000  ? 376 THR B C     1 
ATOM   7230 O  O     . THR B 2 376 ? -16.20900 -40.18000 -5.22800  1.000 42.43000  ? 376 THR B O     1 
ATOM   7231 C  CB    . THR B 2 376 ? -18.75200 -39.25500 -7.10600  1.000 35.85000  ? 376 THR B CB    1 
ATOM   7232 O  OG1   . THR B 2 376 ? -19.27700 -39.23600 -8.43600  1.000 33.56000  ? 376 THR B OG1   1 
ATOM   7233 C  CG2   . THR B 2 376 ? -17.97300 -37.97900 -6.84900  1.000 34.12000  ? 376 THR B CG2   1 
ATOM   7234 N  N     . THR B 2 377 ? -18.19900 -41.04100 -4.63700  1.000 40.08000  ? 377 THR B N     1 
ATOM   7235 C  CA    . THR B 2 377 ? -17.87600 -41.16800 -3.22700  1.000 39.79000  ? 377 THR B CA    1 
ATOM   7236 C  C     . THR B 2 377 ? -16.60600 -41.96200 -3.04000  1.000 40.30000  ? 377 THR B C     1 
ATOM   7237 O  O     . THR B 2 377 ? -15.68700 -41.52800 -2.34100  1.000 41.43000  ? 377 THR B O     1 
ATOM   7238 C  CB    . THR B 2 377 ? -19.01200 -41.84100 -2.45200  1.000 39.04000  ? 377 THR B CB    1 
ATOM   7239 O  OG1   . THR B 2 377 ? -20.10300 -40.92700 -2.34400  1.000 38.25000  ? 377 THR B OG1   1 
ATOM   7240 C  CG2   . THR B 2 377 ? -18.55700 -42.21500 -1.05600  1.000 42.36000  ? 377 THR B CG2   1 
ATOM   7241 N  N     . GLU B 2 378 ? -16.55500 -43.12100 -3.68700  1.000 44.47000  ? 378 GLU B N     1 
ATOM   7242 C  CA    . GLU B 2 378 ? -15.38000 -43.97100 -3.63000  1.000 40.17000  ? 378 GLU B CA    1 
ATOM   7243 C  C     . GLU B 2 378 ? -14.15600 -43.25700 -4.13700  1.000 43.38000  ? 378 GLU B C     1 
ATOM   7244 O  O     . GLU B 2 378 ? -13.08000 -43.39500 -3.55700  1.000 47.06000  ? 378 GLU B O     1 
ATOM   7245 C  CB    . GLU B 2 378 ? -15.60400 -45.23400 -4.43000  1.000 39.22000  ? 378 GLU B CB    1 
ATOM   7246 C  CG    . GLU B 2 378 ? -16.62700 -46.13800 -3.82100  1.000 46.04000  ? 378 GLU B CG    1 
ATOM   7247 C  CD    . GLU B 2 378 ? -16.73300 -47.42400 -4.57200  1.000 55.71000  ? 378 GLU B CD    1 
ATOM   7248 O  OE1   . GLU B 2 378 ? -15.91100 -47.61800 -5.50300  1.000 57.26000  ? 378 GLU B OE1   1 
ATOM   7249 O  OE2   . GLU B 2 378 ? -17.62900 -48.23500 -4.23400  1.000 64.16000  ? 378 GLU B OE2   1 
ATOM   7250 N  N     . SER B 2 379 ? -14.30700 -42.49200 -5.21400  1.000 34.61000  ? 379 SER B N     1 
ATOM   7251 C  CA    . SER B 2 379 ? -13.14800 -41.80700 -5.76800  1.000 38.44000  ? 379 SER B CA    1 
ATOM   7252 C  C     . SER B 2 379 ? -12.60200 -40.77500 -4.80400  1.000 43.63000  ? 379 SER B C     1 
ATOM   7253 O  O     . SER B 2 379 ? -11.39700 -40.69100 -4.61800  1.000 49.06000  ? 379 SER B O     1 
ATOM   7254 C  CB    . SER B 2 379 ? -13.48800 -41.13200 -7.08100  1.000 40.65000  ? 379 SER B CB    1 
ATOM   7255 O  OG    . SER B 2 379 ? -14.00500 -42.08600 -7.97200  1.000 53.53000  ? 379 SER B OG    1 
ATOM   7256 N  N     . ILE B 2 380 ? -13.48400 -39.97700 -4.20500  1.000 41.30000  ? 380 ILE B N     1 
ATOM   7257 C  CA    . ILE B 2 380 ? -13.05100 -38.96900 -3.24600  1.000 39.81000  ? 380 ILE B CA    1 
ATOM   7258 C  C     . ILE B 2 380 ? -12.32000 -39.65600 -2.09600  1.000 47.41000  ? 380 ILE B C     1 
ATOM   7259 O  O     . ILE B 2 380 ? -11.25000 -39.21800 -1.67500  1.000 47.09000  ? 380 ILE B O     1 
ATOM   7260 C  CB    . ILE B 2 380 ? -14.22800 -38.15000 -2.70900  1.000 41.77000  ? 380 ILE B CB    1 
ATOM   7261 C  CG1   . ILE B 2 380 ? -14.92700 -37.41300 -3.85400  1.000 43.75000  ? 380 ILE B CG1   1 
ATOM   7262 C  CG2   . ILE B 2 380 ? -13.74100 -37.14300 -1.68800  1.000 46.92000  ? 380 ILE B CG2   1 
ATOM   7263 C  CD1   . ILE B 2 380 ? -16.17200 -36.66600 -3.44400  1.000 41.55000  ? 380 ILE B CD1   1 
ATOM   7264 N  N     . VAL B 2 381 ? -12.88000 -40.76200 -1.61400  1.000 46.27000  ? 381 VAL B N     1 
ATOM   7265 C  CA    . VAL B 2 381 ? -12.25800 -41.50300 -0.52800  1.000 37.49000  ? 381 VAL B CA    1 
ATOM   7266 C  C     . VAL B 2 381 ? -10.91400 -42.10300 -0.94000  1.000 45.44000  ? 381 VAL B C     1 
ATOM   7267 O  O     . VAL B 2 381 ? -9.93600  -41.93700 -0.22700  1.000 54.17000  ? 381 VAL B O     1 
ATOM   7268 C  CB    . VAL B 2 381 ? -13.18100 -42.59100 -0.02100  1.000 43.65000  ? 381 VAL B CB    1 
ATOM   7269 C  CG1   . VAL B 2 381 ? -12.40000 -43.61000 0.78200   1.000 47.28000  ? 381 VAL B CG1   1 
ATOM   7270 C  CG2   . VAL B 2 381 ? -14.32900 -41.96200 0.80500   1.000 44.05000  ? 381 VAL B CG2   1 
ATOM   7271 N  N     . ILE B 2 382 ? -10.84400 -42.75200 -2.10300  1.000 48.63000  ? 382 ILE B N     1 
ATOM   7272 C  CA    . ILE B 2 382 ? -9.59500  -43.38300 -2.56600  1.000 44.14000  ? 382 ILE B CA    1 
ATOM   7273 C  C     . ILE B 2 382 ? -8.51700  -42.42400 -3.09100  1.000 41.74000  ? 382 ILE B C     1 
ATOM   7274 O  O     . ILE B 2 382 ? -7.36600  -42.55300 -2.69900  1.000 49.90000  ? 382 ILE B O     1 
ATOM   7275 C  CB    . ILE B 2 382 ? -9.88200  -44.43200 -3.65600  1.000 44.43000  ? 382 ILE B CB    1 
ATOM   7276 C  CG1   . ILE B 2 382 ? -10.60900 -45.62500 -3.04000  1.000 38.52000  ? 382 ILE B CG1   1 
ATOM   7277 C  CG2   . ILE B 2 382 ? -8.60900  -44.92800 -4.26500  1.000 37.33000  ? 382 ILE B CG2   1 
ATOM   7278 C  CD1   . ILE B 2 382 ? -11.47400 -46.35300 -4.00400  1.000 34.28000  ? 382 ILE B CD1   1 
ATOM   7279 N  N     . TRP B 2 383 ? -8.86200  -41.47600 -3.96500  1.000 46.80000  ? 383 TRP B N     1 
ATOM   7280 C  CA    . TRP B 2 383 ? -7.85700  -40.55200 -4.53800  1.000 41.19000  ? 383 TRP B CA    1 
ATOM   7281 C  C     . TRP B 2 383 ? -8.08200  -39.06500 -4.25100  1.000 46.04000  ? 383 TRP B C     1 
ATOM   7282 O  O     . TRP B 2 383 ? -7.27600  -38.22200 -4.64800  1.000 50.99000  ? 383 TRP B O     1 
ATOM   7283 C  CB    . TRP B 2 383 ? -7.77800  -40.72100 -6.05300  1.000 44.58000  ? 383 TRP B CB    1 
ATOM   7284 C  CG    . TRP B 2 383 ? -7.56600  -42.12200 -6.50100  1.000 48.76000  ? 383 TRP B CG    1 
ATOM   7285 C  CD1   . TRP B 2 383 ? -6.39600  -42.82000 -6.48100  1.000 46.20000  ? 383 TRP B CD1   1 
ATOM   7286 C  CD2   . TRP B 2 383 ? -8.54800  -43.00100 -7.05300  1.000 49.22000  ? 383 TRP B CD2   1 
ATOM   7287 N  NE1   . TRP B 2 383 ? -6.59200  -44.09000 -6.97200  1.000 50.29000  ? 383 TRP B NE1   1 
ATOM   7288 C  CE2   . TRP B 2 383 ? -7.90200  -44.22200 -7.34000  1.000 47.79000  ? 383 TRP B CE2   1 
ATOM   7289 C  CE3   . TRP B 2 383 ? -9.90900  -42.87400 -7.33200  1.000 42.66000  ? 383 TRP B CE3   1 
ATOM   7290 C  CZ2   . TRP B 2 383 ? -8.57100  -45.30800 -7.88300  1.000 42.78000  ? 383 TRP B CZ2   1 
ATOM   7291 C  CZ3   . TRP B 2 383 ? -10.57200 -43.95500 -7.87200  1.000 44.63000  ? 383 TRP B CZ3   1 
ATOM   7292 C  CH2   . TRP B 2 383 ? -9.90300  -45.15900 -8.13900  1.000 47.91000  ? 383 TRP B CH2   1 
ATOM   7293 N  N     . GLY B 2 384 ? -9.18600  -38.72900 -3.59800  1.000 45.03000  ? 384 GLY B N     1 
ATOM   7294 C  CA    . GLY B 2 384 ? -9.41600  -37.35200 -3.20200  1.000 44.33000  ? 384 GLY B CA    1 
ATOM   7295 C  C     . GLY B 2 384 ? -9.82800  -36.48500 -4.36400  1.000 45.39000  ? 384 GLY B C     1 
ATOM   7296 O  O     . GLY B 2 384 ? -9.76000  -35.26200 -4.30400  1.000 51.74000  ? 384 GLY B O     1 
ATOM   7297 N  N     . LYS B 2 385 ? -10.25800 -37.12300 -5.44000  1.000 51.66000  ? 385 LYS B N     1 
ATOM   7298 C  CA    . LYS B 2 385 ? -10.71600 -36.38600 -6.60400  1.000 48.48000  ? 385 LYS B CA    1 
ATOM   7299 C  C     . LYS B 2 385 ? -12.03800 -36.95200 -7.12100  1.000 46.77000  ? 385 LYS B C     1 
ATOM   7300 O  O     . LYS B 2 385 ? -12.45600 -38.05600 -6.75300  1.000 49.61000  ? 385 LYS B O     1 
ATOM   7301 C  CB    . LYS B 2 385 ? -9.65400  -36.41100 -7.70400  1.000 43.23000  ? 385 LYS B CB    1 
ATOM   7302 C  CG    . LYS B 2 385 ? -9.79100  -35.28000 -8.68000  1.000 43.03000  ? 385 LYS B CG    1 
ATOM   7303 C  CD    . LYS B 2 385 ? -8.48100  -34.95400 -9.34300  1.000 53.20000  ? 385 LYS B CD    1 
ATOM   7304 C  CE    . LYS B 2 385 ? -7.99900  -36.07400 -10.23900 1.000 52.00000  ? 385 LYS B CE    1 
ATOM   7305 N  NZ    . LYS B 2 385 ? -7.17900  -35.48800 -11.34200 1.000 58.13000  ? 385 LYS B NZ    1 
ATOM   7306 N  N     . THR B 2 386 ? -12.67900 -36.17600 -7.98200  1.000 44.52000  ? 386 THR B N     1 
ATOM   7307 C  CA    . THR B 2 386 ? -13.95700 -36.50500 -8.57500  1.000 36.40000  ? 386 THR B CA    1 
ATOM   7308 C  C     . THR B 2 386 ? -13.75500 -36.94500 -10.02600 1.000 41.54000  ? 386 THR B C     1 
ATOM   7309 O  O     . THR B 2 386 ? -13.06400 -36.26800 -10.80000 1.000 39.76000  ? 386 THR B O     1 
ATOM   7310 C  CB    . THR B 2 386 ? -14.89300 -35.28900 -8.47400  1.000 37.77000  ? 386 THR B CB    1 
ATOM   7311 O  OG1   . THR B 2 386 ? -15.74100 -35.46100 -7.33800  1.000 45.44000  ? 386 THR B OG1   1 
ATOM   7312 C  CG2   . THR B 2 386 ? -15.75600 -35.14500 -9.67800  1.000 44.37000  ? 386 THR B CG2   1 
ATOM   7313 N  N     . PRO B 2 387 ? -14.33700 -38.09500 -10.40200 1.000 43.64000  ? 387 PRO B N     1 
ATOM   7314 C  CA    . PRO B 2 387 ? -14.18000 -38.56800 -11.78200 1.000 38.19000  ? 387 PRO B CA    1 
ATOM   7315 C  C     . PRO B 2 387 ? -15.03800 -37.77600 -12.77700 1.000 40.25000  ? 387 PRO B C     1 
ATOM   7316 O  O     . PRO B 2 387 ? -16.01300 -37.11600 -12.42100 1.000 36.87000  ? 387 PRO B O     1 
ATOM   7317 C  CB    . PRO B 2 387 ? -14.63800 -40.02800 -11.71600 1.000 36.77000  ? 387 PRO B CB    1 
ATOM   7318 C  CG    . PRO B 2 387 ? -15.17100 -40.25600 -10.33200 1.000 36.85000  ? 387 PRO B CG    1 
ATOM   7319 C  CD    . PRO B 2 387 ? -15.30000 -38.91500 -9.65600  1.000 41.32000  ? 387 PRO B CD    1 
ATOM   7320 N  N     . LYS B 2 388 ? -14.64000 -37.82000 -14.03800 1.000 41.21000  ? 388 LYS B N     1 
ATOM   7321 C  CA    . LYS B 2 388 ? -15.47400 -37.32800 -15.11500 1.000 34.11000  ? 388 LYS B CA    1 
ATOM   7322 C  C     . LYS B 2 388 ? -16.29700 -38.52100 -15.61500 1.000 33.45000  ? 388 LYS B C     1 
ATOM   7323 O  O     . LYS B 2 388 ? -15.75100 -39.56300 -15.94600 1.000 36.16000  ? 388 LYS B O     1 
ATOM   7324 C  CB    . LYS B 2 388 ? -14.62100 -36.72800 -16.23100 1.000 32.38000  ? 388 LYS B CB    1 
ATOM   7325 C  CG    . LYS B 2 388 ? -15.36100 -35.70500 -17.05600 1.000 42.37000  ? 388 LYS B CG    1 
ATOM   7326 C  CD    . LYS B 2 388 ? -14.75900 -35.55100 -18.42800 1.000 47.00000  ? 388 LYS B CD    1 
ATOM   7327 C  CE    . LYS B 2 388 ? -15.68000 -34.72700 -19.34400 1.000 49.50000  ? 388 LYS B CE    1 
ATOM   7328 N  NZ    . LYS B 2 388 ? -14.95900 -33.53300 -19.89500 1.000 62.10000  ? 388 LYS B NZ    1 
ATOM   7329 N  N     . PHE B 2 389 ? -17.61000 -38.40300 -15.64400 1.000 35.52000  ? 389 PHE B N     1 
ATOM   7330 C  CA    . PHE B 2 389 ? -18.41600 -39.55200 -16.04900 1.000 36.32000  ? 389 PHE B CA    1 
ATOM   7331 C  C     . PHE B 2 389 ? -18.78500 -39.57000 -17.53900 1.000 35.37000  ? 389 PHE B C     1 
ATOM   7332 O  O     . PHE B 2 389 ? -19.16600 -38.54100 -18.12200 1.000 32.17000  ? 389 PHE B O     1 
ATOM   7333 C  CB    . PHE B 2 389 ? -19.68800 -39.62000 -15.20000 1.000 29.36000  ? 389 PHE B CB    1 
ATOM   7334 C  CG    . PHE B 2 389 ? -19.44700 -40.14800 -13.82700 1.000 33.08000  ? 389 PHE B CG    1 
ATOM   7335 C  CD1   . PHE B 2 389 ? -19.07600 -39.30000 -12.79900 1.000 38.45000  ? 389 PHE B CD1   1 
ATOM   7336 C  CD2   . PHE B 2 389 ? -19.56100 -41.50700 -13.56200 1.000 35.79000  ? 389 PHE B CD2   1 
ATOM   7337 C  CE1   . PHE B 2 389 ? -18.83800 -39.80600 -11.51800 1.000 38.54000  ? 389 PHE B CE1   1 
ATOM   7338 C  CE2   . PHE B 2 389 ? -19.32700 -42.01000 -12.29100 1.000 30.39000  ? 389 PHE B CE2   1 
ATOM   7339 C  CZ    . PHE B 2 389 ? -18.96700 -41.16500 -11.27300 1.000 30.38000  ? 389 PHE B CZ    1 
ATOM   7340 N  N     . LYS B 2 390 ? -18.62600 -40.75100 -18.13900 1.000 32.86000  ? 390 LYS B N     1 
ATOM   7341 C  CA    . LYS B 2 390 ? -19.20800 -41.10100 -19.43200 1.000 31.96000  ? 390 LYS B CA    1 
ATOM   7342 C  C     . LYS B 2 390 ? -20.52100 -41.84000 -19.17900 1.000 36.38000  ? 390 LYS B C     1 
ATOM   7343 O  O     . LYS B 2 390 ? -20.50700 -43.04500 -18.92400 1.000 38.99000  ? 390 LYS B O     1 
ATOM   7344 C  CB    . LYS B 2 390 ? -18.27300 -42.00200 -20.24000 1.000 34.52000  ? 390 LYS B CB    1 
ATOM   7345 C  CG    . LYS B 2 390 ? -17.08300 -41.33500 -20.91400 1.000 38.98000  ? 390 LYS B CG    1 
ATOM   7346 C  CD    . LYS B 2 390 ? -16.36900 -42.35200 -21.80900 1.000 47.08000  ? 390 LYS B CD    1 
ATOM   7347 C  CE    . LYS B 2 390 ? -15.32400 -41.72600 -22.72400 1.000 43.49000  ? 390 LYS B CE    1 
ATOM   7348 N  NZ    . LYS B 2 390 ? -14.36600 -40.91200 -21.95600 1.000 47.27000  ? 390 LYS B NZ    1 
ATOM   7349 N  N     . LEU B 2 391 ? -21.64700 -41.13200 -19.22100 1.000 30.96000  ? 391 LEU B N     1 
ATOM   7350 C  CA    . LEU B 2 391 ? -22.93500 -41.74400 -18.89400 1.000 32.39000  ? 391 LEU B CA    1 
ATOM   7351 C  C     . LEU B 2 391 ? -23.61300 -42.39400 -20.09700 1.000 34.01000  ? 391 LEU B C     1 
ATOM   7352 O  O     . LEU B 2 391 ? -23.72800 -41.77100 -21.15700 1.000 36.11000  ? 391 LEU B O     1 
ATOM   7353 C  CB    . LEU B 2 391 ? -23.86200 -40.69300 -18.29500 1.000 31.61000  ? 391 LEU B CB    1 
ATOM   7354 C  CG    . LEU B 2 391 ? -23.22400 -39.97500 -17.11500 1.000 31.72000  ? 391 LEU B CG    1 
ATOM   7355 C  CD1   . LEU B 2 391 ? -24.13900 -38.88500 -16.57500 1.000 32.88000  ? 391 LEU B CD1   1 
ATOM   7356 C  CD2   . LEU B 2 391 ? -22.88500 -40.99800 -16.04200 1.000 31.59000  ? 391 LEU B CD2   1 
ATOM   7357 N  N     . PRO B 2 392 ? -24.08000 -43.64100 -19.93000 1.000 31.48000  ? 392 PRO B N     1 
ATOM   7358 C  CA    . PRO B 2 392 ? -24.79200 -44.40200 -20.96200 1.000 39.09000  ? 392 PRO B CA    1 
ATOM   7359 C  C     . PRO B 2 392 ? -26.28800 -44.06400 -20.98600 1.000 41.01000  ? 392 PRO B C     1 
ATOM   7360 O  O     . PRO B 2 392 ? -27.15500 -44.91900 -20.74400 1.000 37.71000  ? 392 PRO B O     1 
ATOM   7361 C  CB    . PRO B 2 392 ? -24.55900 -45.84900 -20.53400 1.000 33.72000  ? 392 PRO B CB    1 
ATOM   7362 C  CG    . PRO B 2 392 ? -24.53600 -45.76200 -19.05500 1.000 27.71000  ? 392 PRO B CG    1 
ATOM   7363 C  CD    . PRO B 2 392 ? -23.86400 -44.45300 -18.72100 1.000 33.24000  ? 392 PRO B CD    1 
ATOM   7364 N  N     . ILE B 2 393 ? -26.58700 -42.80600 -21.28300 1.000 33.22000  ? 393 ILE B N     1 
ATOM   7365 C  CA    . ILE B 2 393 ? -27.95600 -42.33500 -21.26200 1.000 33.32000  ? 393 ILE B CA    1 
ATOM   7366 C  C     . ILE B 2 393 ? -28.06700 -41.16200 -22.22600 1.000 37.28000  ? 393 ILE B C     1 
ATOM   7367 O  O     . ILE B 2 393 ? -27.05800 -40.53500 -22.55400 1.000 43.12000  ? 393 ILE B O     1 
ATOM   7368 C  CB    . ILE B 2 393 ? -28.37100 -41.94200 -19.83200 1.000 33.09000  ? 393 ILE B CB    1 
ATOM   7369 C  CG1   . ILE B 2 393 ? -29.86500 -41.62800 -19.75600 1.000 34.47000  ? 393 ILE B CG1   1 
ATOM   7370 C  CG2   . ILE B 2 393 ? -27.53800 -40.77700 -19.34300 1.000 31.49000  ? 393 ILE B CG2   1 
ATOM   7371 C  CD1   . ILE B 2 393 ? -30.36200 -41.42100 -18.35600 1.000 31.42000  ? 393 ILE B CD1   1 
ATOM   7372 N  N     . GLN B 2 394 ? -29.26800 -40.88400 -22.72000 1.000 36.20000  ? 394 GLN B N     1 
ATOM   7373 C  CA    . GLN B 2 394 ? -29.46800 -39.72100 -23.58200 1.000 35.93000  ? 394 GLN B CA    1 
ATOM   7374 C  C     . GLN B 2 394 ? -29.40400 -38.46400 -22.74500 1.000 37.28000  ? 394 GLN B C     1 
ATOM   7375 O  O     . GLN B 2 394 ? -29.90300 -38.44000 -21.62700 1.000 42.48000  ? 394 GLN B O     1 
ATOM   7376 C  CB    . GLN B 2 394 ? -30.81100 -39.79500 -24.31200 1.000 45.10000  ? 394 GLN B CB    1 
ATOM   7377 C  CG    . GLN B 2 394 ? -31.09200 -38.60100 -25.24300 1.000 57.86000  ? 394 GLN B CG    1 
ATOM   7378 C  CD    . GLN B 2 394 ? -32.55900 -38.50600 -25.70500 1.000 67.96000  ? 394 GLN B CD    1 
ATOM   7379 O  OE1   . GLN B 2 394 ? -33.50100 -38.56600 -24.89500 1.000 65.51000  ? 394 GLN B OE1   1 
ATOM   7380 N  NE2   . GLN B 2 394 ? -32.75200 -38.34500 -27.01600 1.000 65.64000  ? 394 GLN B NE2   1 
ATOM   7381 N  N     . LYS B 2 395 ? -28.81100 -37.41100 -23.29000 1.000 39.43000  ? 395 LYS B N     1 
ATOM   7382 C  CA    . LYS B 2 395 ? -28.65600 -36.15100 -22.56600 1.000 36.27000  ? 395 LYS B CA    1 
ATOM   7383 C  C     . LYS B 2 395 ? -29.97300 -35.58700 -21.99800 1.000 46.75000  ? 395 LYS B C     1 
ATOM   7384 O  O     . LYS B 2 395 ? -30.01900 -35.17100 -20.83700 1.000 47.18000  ? 395 LYS B O     1 
ATOM   7385 C  CB    . LYS B 2 395 ? -27.99200 -35.11600 -23.48300 1.000 40.31000  ? 395 LYS B CB    1 
ATOM   7386 C  CG    . LYS B 2 395 ? -27.78500 -33.73800 -22.89000 1.000 46.62000  ? 395 LYS B CG    1 
ATOM   7387 C  CD    . LYS B 2 395 ? -27.25800 -32.79600 -23.95100 1.000 49.23000  ? 395 LYS B CD    1 
ATOM   7388 C  CE    . LYS B 2 395 ? -26.37600 -31.72400 -23.36100 1.000 47.26000  ? 395 LYS B CE    1 
ATOM   7389 N  NZ    . LYS B 2 395 ? -27.15400 -30.74800 -22.55200 1.000 53.96000  ? 395 LYS B NZ    1 
ATOM   7390 N  N     . GLU B 2 396 ? -31.03900 -35.55500 -22.79700 1.000 52.83000  ? 396 GLU B N     1 
ATOM   7391 C  CA    . GLU B 2 396 ? -32.29700 -34.96200 -22.32600 1.000 49.13000  ? 396 GLU B CA    1 
ATOM   7392 C  C     . GLU B 2 396 ? -32.92300 -35.84600 -21.26000 1.000 47.34000  ? 396 GLU B C     1 
ATOM   7393 O  O     . GLU B 2 396 ? -33.50200 -35.34200 -20.28800 1.000 44.13000  ? 396 GLU B O     1 
ATOM   7394 C  CB    . GLU B 2 396 ? -33.29500 -34.74000 -23.47200 1.000 51.93000  ? 396 GLU B CB    1 
ATOM   7395 C  CG    . GLU B 2 396 ? -32.98700 -33.55600 -24.37300 1.000 48.36000  ? 396 GLU B CG    1 
ATOM   7396 C  CD    . GLU B 2 396 ? -31.88800 -33.84600 -25.38400 1.000 62.35000  ? 396 GLU B CD    1 
ATOM   7397 O  OE1   . GLU B 2 396 ? -31.37700 -34.99400 -25.41000 1.000 64.74000  ? 396 GLU B OE1   1 
ATOM   7398 O  OE2   . GLU B 2 396 ? -31.53700 -32.92500 -26.15900 1.000 67.79000  ? 396 GLU B OE2   1 
ATOM   7399 N  N     . THR B 2 397 ? -32.80500 -37.16200 -21.43800 1.000 47.00000  ? 397 THR B N     1 
ATOM   7400 C  CA    . THR B 2 397 ? -33.34100 -38.11000 -20.45400 1.000 46.57000  ? 397 THR B CA    1 
ATOM   7401 C  C     . THR B 2 397 ? -32.70000 -37.85500 -19.09400 1.000 45.11000  ? 397 THR B C     1 
ATOM   7402 O  O     . THR B 2 397 ? -33.39000 -37.74700 -18.08400 1.000 48.55000  ? 397 THR B O     1 
ATOM   7403 C  CB    . THR B 2 397 ? -33.10100 -39.59500 -20.85100 1.000 45.36000  ? 397 THR B CB    1 
ATOM   7404 O  OG1   . THR B 2 397 ? -33.79500 -39.90900 -22.06700 1.000 49.17000  ? 397 THR B OG1   1 
ATOM   7405 C  CG2   . THR B 2 397 ? -33.59600 -40.52600 -19.74100 1.000 40.95000  ? 397 THR B CG2   1 
ATOM   7406 N  N     . TRP B 2 398 ? -31.37600 -37.73500 -19.07900 1.000 41.38000  ? 398 TRP B N     1 
ATOM   7407 C  CA    . TRP B 2 398 ? -30.65500 -37.50300 -17.83600 1.000 40.73000  ? 398 TRP B CA    1 
ATOM   7408 C  C     . TRP B 2 398 ? -30.98900 -36.12900 -17.24000 1.000 42.02000  ? 398 TRP B C     1 
ATOM   7409 O  O     . TRP B 2 398 ? -31.29600 -36.01100 -16.04800 1.000 41.04000  ? 398 TRP B O     1 
ATOM   7410 C  CB    . TRP B 2 398 ? -29.14700 -37.63800 -18.06800 1.000 38.93000  ? 398 TRP B CB    1 
ATOM   7411 C  CG    . TRP B 2 398 ? -28.29400 -37.26100 -16.88300 1.000 37.37000  ? 398 TRP B CG    1 
ATOM   7412 C  CD1   . TRP B 2 398 ? -27.70200 -36.05500 -16.65100 1.000 35.73000  ? 398 TRP B CD1   1 
ATOM   7413 C  CD2   . TRP B 2 398 ? -27.94200 -38.09900 -15.77000 1.000 33.93000  ? 398 TRP B CD2   1 
ATOM   7414 N  NE1   . TRP B 2 398 ? -27.00500 -36.08900 -15.46200 1.000 31.66000  ? 398 TRP B NE1   1 
ATOM   7415 C  CE2   . TRP B 2 398 ? -27.13500 -37.32800 -14.90800 1.000 33.31000  ? 398 TRP B CE2   1 
ATOM   7416 C  CE3   . TRP B 2 398 ? -28.22600 -39.41500 -15.42600 1.000 33.55000  ? 398 TRP B CE3   1 
ATOM   7417 C  CZ2   . TRP B 2 398 ? -26.60200 -37.84600 -13.73100 1.000 34.58000  ? 398 TRP B CZ2   1 
ATOM   7418 C  CZ3   . TRP B 2 398 ? -27.69700 -39.92200 -14.24100 1.000 36.13000  ? 398 TRP B CZ3   1 
ATOM   7419 C  CH2   . TRP B 2 398 ? -26.89600 -39.14000 -13.41300 1.000 33.54000  ? 398 TRP B CH2   1 
ATOM   7420 N  N     . GLU B 2 399 ? -30.93500 -35.08900 -18.06100 1.000 40.45000  ? 399 GLU B N     1 
ATOM   7421 C  CA    . GLU B 2 399 ? -31.13700 -33.74900 -17.53800 1.000 42.91000  ? 399 GLU B CA    1 
ATOM   7422 C  C     . GLU B 2 399 ? -32.55300 -33.54900 -17.03400 1.000 40.04000  ? 399 GLU B C     1 
ATOM   7423 O  O     . GLU B 2 399 ? -32.75100 -32.80400 -16.08200 1.000 41.98000  ? 399 GLU B O     1 
ATOM   7424 C  CB    . GLU B 2 399 ? -30.79400 -32.70400 -18.59200 1.000 49.85000  ? 399 GLU B CB    1 
ATOM   7425 C  CG    . GLU B 2 399 ? -29.29100 -32.53600 -18.81700 1.000 52.87000  ? 399 GLU B CG    1 
ATOM   7426 C  CD    . GLU B 2 399 ? -28.98300 -31.56600 -19.94500 1.000 63.87000  ? 399 GLU B CD    1 
ATOM   7427 O  OE1   . GLU B 2 399 ? -27.84100 -31.05400 -19.98500 1.000 62.91000  ? 399 GLU B OE1   1 
ATOM   7428 O  OE2   . GLU B 2 399 ? -29.88400 -31.31800 -20.79000 1.000 66.13000  ? 399 GLU B OE2   1 
ATOM   7429 N  N     . THR B 2 400 ? -33.52900 -34.21900 -17.65400 1.000 42.50000  ? 400 THR B N     1 
ATOM   7430 C  CA    . THR B 2 400 ? -34.92800 -34.13000 -17.20900 1.000 40.12000  ? 400 THR B CA    1 
ATOM   7431 C  C     . THR B 2 400 ? -35.11100 -34.63500 -15.75800 1.000 46.40000  ? 400 THR B C     1 
ATOM   7432 O  O     . THR B 2 400 ? -35.93400 -34.08700 -15.02600 1.000 42.47000  ? 400 THR B O     1 
ATOM   7433 C  CB    . THR B 2 400 ? -35.91100 -34.93800 -18.14000 1.000 47.02000  ? 400 THR B CB    1 
ATOM   7434 O  OG1   . THR B 2 400 ? -35.89400 -34.42400 -19.47800 1.000 51.20000  ? 400 THR B OG1   1 
ATOM   7435 C  CG2   . THR B 2 400 ? -37.33400 -34.83200 -17.63800 1.000 42.43000  ? 400 THR B CG2   1 
ATOM   7436 N  N     . TRP B 2 401 ? -34.34800 -35.65300 -15.33000 1.000 42.99000  ? 401 TRP B N     1 
ATOM   7437 C  CA    . TRP B 2 401 ? -34.61700 -36.27900 -14.03300 1.000 36.74000  ? 401 TRP B CA    1 
ATOM   7438 C  C     . TRP B 2 401 ? -33.51600 -36.41100 -12.97100 1.000 39.44000  ? 401 TRP B C     1 
ATOM   7439 O  O     . TRP B 2 401 ? -33.84400 -36.74600 -11.83300 1.000 35.35000  ? 401 TRP B O     1 
ATOM   7440 C  CB    . TRP B 2 401 ? -35.18700 -37.67300 -14.27100 1.000 39.47000  ? 401 TRP B CB    1 
ATOM   7441 C  CG    . TRP B 2 401 ? -36.64500 -37.57400 -14.51900 1.000 47.36000  ? 401 TRP B CG    1 
ATOM   7442 C  CD1   . TRP B 2 401 ? -37.60600 -37.15400 -13.63100 1.000 46.75000  ? 401 TRP B CD1   1 
ATOM   7443 C  CD2   . TRP B 2 401 ? -37.32000 -37.85500 -15.73800 1.000 41.61000  ? 401 TRP B CD2   1 
ATOM   7444 N  NE1   . TRP B 2 401 ? -38.84400 -37.16900 -14.22900 1.000 43.73000  ? 401 TRP B NE1   1 
ATOM   7445 C  CE2   . TRP B 2 401 ? -38.69600 -37.58700 -15.52700 1.000 44.42000  ? 401 TRP B CE2   1 
ATOM   7446 C  CE3   . TRP B 2 401 ? -36.89900 -38.31000 -16.99100 1.000 44.00000  ? 401 TRP B CE3   1 
ATOM   7447 C  CZ2   . TRP B 2 401 ? -39.65400 -37.75500 -16.52500 1.000 49.95000  ? 401 TRP B CZ2   1 
ATOM   7448 C  CZ3   . TRP B 2 401 ? -37.84900 -38.48200 -17.98600 1.000 55.05000  ? 401 TRP B CZ3   1 
ATOM   7449 C  CH2   . TRP B 2 401 ? -39.21600 -38.19700 -17.74800 1.000 55.90000  ? 401 TRP B CH2   1 
ATOM   7450 N  N     . TRP B 2 402 ? -32.24700 -36.13000 -13.28100 1.000 38.58000  ? 402 TRP B N     1 
ATOM   7451 C  CA    . TRP B 2 402 ? -31.18200 -36.51400 -12.33400 1.000 40.96000  ? 402 TRP B CA    1 
ATOM   7452 C  C     . TRP B 2 402 ? -31.25400 -35.80400 -10.97200 1.000 42.77000  ? 402 TRP B C     1 
ATOM   7453 O  O     . TRP B 2 402 ? -30.83400 -36.37700 -9.95100  1.000 39.02000  ? 402 TRP B O     1 
ATOM   7454 C  CB    . TRP B 2 402 ? -29.78100 -36.30400 -12.94100 1.000 36.61000  ? 402 TRP B CB    1 
ATOM   7455 C  CG    . TRP B 2 402 ? -29.29500 -34.87300 -13.01000 1.000 38.07000  ? 402 TRP B CG    1 
ATOM   7456 C  CD1   . TRP B 2 402 ? -29.47700 -34.00900 -14.04300 1.000 37.16000  ? 402 TRP B CD1   1 
ATOM   7457 C  CD2   . TRP B 2 402 ? -28.50800 -34.17000 -12.03300 1.000 33.34000  ? 402 TRP B CD2   1 
ATOM   7458 N  NE1   . TRP B 2 402 ? -28.88100 -32.80100 -13.76600 1.000 40.91000  ? 402 TRP B NE1   1 
ATOM   7459 C  CE2   . TRP B 2 402 ? -28.27600 -32.87100 -12.54300 1.000 38.03000  ? 402 TRP B CE2   1 
ATOM   7460 C  CE3   . TRP B 2 402 ? -27.99100 -34.50200 -10.77700 1.000 34.42000  ? 402 TRP B CE3   1 
ATOM   7461 C  CZ2   . TRP B 2 402 ? -27.55200 -31.90300 -11.84000 1.000 32.44000  ? 402 TRP B CZ2   1 
ATOM   7462 C  CZ3   . TRP B 2 402 ? -27.27200 -33.54500 -10.07600 1.000 33.50000  ? 402 TRP B CZ3   1 
ATOM   7463 C  CH2   . TRP B 2 402 ? -27.05900 -32.25800 -10.61200 1.000 35.03000  ? 402 TRP B CH2   1 
ATOM   7464 N  N     . THR B 2 403 ? -31.79900 -34.58800 -10.93700 1.000 37.58000  ? 403 THR B N     1 
ATOM   7465 C  CA    . THR B 2 403 ? -31.87300 -33.84700 -9.67500  1.000 36.70000  ? 403 THR B CA    1 
ATOM   7466 C  C     . THR B 2 403 ? -33.02000 -34.28000 -8.76400  1.000 40.70000  ? 403 THR B C     1 
ATOM   7467 O  O     . THR B 2 403 ? -33.11500 -33.80900 -7.62900  1.000 48.64000  ? 403 THR B O     1 
ATOM   7468 C  CB    . THR B 2 403 ? -32.02200 -32.36100 -9.90100  1.000 38.81000  ? 403 THR B CB    1 
ATOM   7469 O  OG1   . THR B 2 403 ? -33.29700 -32.11400 -10.50200 1.000 41.64000  ? 403 THR B OG1   1 
ATOM   7470 C  CG2   . THR B 2 403 ? -30.92400 -31.85500 -10.80000 1.000 33.88000  ? 403 THR B CG2   1 
ATOM   7471 N  N     . GLU B 2 404 ? -33.89100 -35.16200 -9.24100  1.000 36.40000  ? 404 GLU B N     1 
ATOM   7472 C  CA    . GLU B 2 404 ? -34.86900 -35.76900 -8.33900  1.000 41.97000  ? 404 GLU B CA    1 
ATOM   7473 C  C     . GLU B 2 404 ? -34.20600 -36.82400 -7.44800  1.000 45.93000  ? 404 GLU B C     1 
ATOM   7474 O  O     . GLU B 2 404 ? -34.70500 -37.14200 -6.36600  1.000 47.84000  ? 404 GLU B O     1 
ATOM   7475 C  CB    . GLU B 2 404 ? -36.03300 -36.40400 -9.11400  1.000 44.10000  ? 404 GLU B CB    1 
ATOM   7476 C  CG    . GLU B 2 404 ? -36.87800 -35.41800 -9.92600  1.000 60.19000  ? 404 GLU B CG    1 
ATOM   7477 C  CD    . GLU B 2 404 ? -37.72800 -34.47600 -9.05700  1.000 63.08000  ? 404 GLU B CD    1 
ATOM   7478 O  OE1   . GLU B 2 404 ? -37.63900 -33.24200 -9.24700  1.000 62.59000  ? 404 GLU B OE1   1 
ATOM   7479 O  OE2   . GLU B 2 404 ? -38.49600 -34.96800 -8.20000  1.000 62.25000  ? 404 GLU B OE2   1 
ATOM   7480 N  N     . TYR B 2 405 ? -33.08100 -37.37900 -7.89000  1.000 44.12000  ? 405 TYR B N     1 
ATOM   7481 C  CA    . TYR B 2 405 ? -32.47700 -38.47400 -7.13400  1.000 42.15000  ? 405 TYR B CA    1 
ATOM   7482 C  C     . TYR B 2 405 ? -31.13400 -38.10800 -6.51000  1.000 38.51000  ? 405 TYR B C     1 
ATOM   7483 O  O     . TYR B 2 405 ? -30.46800 -38.96600 -5.94100  1.000 44.82000  ? 405 TYR B O     1 
ATOM   7484 C  CB    . TYR B 2 405 ? -32.33400 -39.70600 -8.03700  1.000 38.28000  ? 405 TYR B CB    1 
ATOM   7485 C  CG    . TYR B 2 405 ? -33.60500 -39.98000 -8.80300  1.000 38.62000  ? 405 TYR B CG    1 
ATOM   7486 C  CD1   . TYR B 2 405 ? -34.73300 -40.46900 -8.16200  1.000 38.44000  ? 405 TYR B CD1   1 
ATOM   7487 C  CD2   . TYR B 2 405 ? -33.69000 -39.71800 -10.15800 1.000 39.90000  ? 405 TYR B CD2   1 
ATOM   7488 C  CE1   . TYR B 2 405 ? -35.90500 -40.70300 -8.85900  1.000 39.85000  ? 405 TYR B CE1   1 
ATOM   7489 C  CE2   . TYR B 2 405 ? -34.86200 -39.94500 -10.86200 1.000 38.31000  ? 405 TYR B CE2   1 
ATOM   7490 C  CZ    . TYR B 2 405 ? -35.96400 -40.43500 -10.21000 1.000 42.12000  ? 405 TYR B CZ    1 
ATOM   7491 O  OH    . TYR B 2 405 ? -37.12800 -40.66200 -10.91800 1.000 49.54000  ? 405 TYR B OH    1 
ATOM   7492 N  N     . TRP B 2 406 ? -30.75000 -36.83800 -6.59600  1.000 39.89000  ? 406 TRP B N     1 
ATOM   7493 C  CA    . TRP B 2 406 ? -29.42300 -36.43000 -6.15100  1.000 42.15000  ? 406 TRP B CA    1 
ATOM   7494 C  C     . TRP B 2 406 ? -29.37500 -36.07600 -4.66500  1.000 40.78000  ? 406 TRP B C     1 
ATOM   7495 O  O     . TRP B 2 406 ? -30.15800 -35.27500 -4.17100  1.000 40.86000  ? 406 TRP B O     1 
ATOM   7496 C  CB    . TRP B 2 406 ? -28.91600 -35.24600 -6.98000  1.000 33.21000  ? 406 TRP B CB    1 
ATOM   7497 C  CG    . TRP B 2 406 ? -27.43800 -35.05400 -6.85300  1.000 33.03000  ? 406 TRP B CG    1 
ATOM   7498 C  CD1   . TRP B 2 406 ? -26.78900 -34.22600 -5.98600  1.000 38.00000  ? 406 TRP B CD1   1 
ATOM   7499 C  CD2   . TRP B 2 406 ? -26.41900 -35.72600 -7.60300  1.000 37.97000  ? 406 TRP B CD2   1 
ATOM   7500 N  NE1   . TRP B 2 406 ? -25.42800 -34.32200 -6.16200  1.000 37.00000  ? 406 TRP B NE1   1 
ATOM   7501 C  CE2   . TRP B 2 406 ? -25.17500 -35.23700 -7.15000  1.000 38.59000  ? 406 TRP B CE2   1 
ATOM   7502 C  CE3   . TRP B 2 406 ? -26.43400 -36.69000 -8.62000  1.000 36.13000  ? 406 TRP B CE3   1 
ATOM   7503 C  CZ2   . TRP B 2 406 ? -23.96100 -35.68400 -7.67600  1.000 36.59000  ? 406 TRP B CZ2   1 
ATOM   7504 C  CZ3   . TRP B 2 406 ? -25.23300 -37.13100 -9.13900  1.000 32.66000  ? 406 TRP B CZ3   1 
ATOM   7505 C  CH2   . TRP B 2 406 ? -24.01500 -36.63100 -8.66700  1.000 36.18000  ? 406 TRP B CH2   1 
ATOM   7506 N  N     . GLN B 2 407 ? -28.42100 -36.66000 -3.95400  1.000 43.71000  ? 407 GLN B N     1 
ATOM   7507 C  CA    . GLN B 2 407 ? -28.32600 -36.42700 -2.52300  1.000 44.17000  ? 407 GLN B CA    1 
ATOM   7508 C  C     . GLN B 2 407 ? -26.94900 -35.95600 -2.07400  1.000 39.58000  ? 407 GLN B C     1 
ATOM   7509 O  O     . GLN B 2 407 ? -26.69500 -35.89900 -0.88800  1.000 47.56000  ? 407 GLN B O     1 
ATOM   7510 C  CB    . GLN B 2 407 ? -28.70800 -37.70700 -1.75900  1.000 43.11000  ? 407 GLN B CB    1 
ATOM   7511 C  CG    . GLN B 2 407 ? -30.21700 -37.97900 -1.71500  1.000 46.19000  ? 407 GLN B CG    1 
ATOM   7512 C  CD    . GLN B 2 407 ? -30.96800 -36.97300 -0.84000  1.000 61.51000  ? 407 GLN B CD    1 
ATOM   7513 O  OE1   . GLN B 2 407 ? -30.61400 -36.76200 0.32300   1.000 71.23000  ? 407 GLN B OE1   1 
ATOM   7514 N  NE2   . GLN B 2 407 ? -32.00100 -36.34300 -1.39800  1.000 46.63000  ? 407 GLN B NE2   1 
ATOM   7515 N  N     . ALA B 2 408 ? -26.05300 -35.63500 -2.99900  1.000 40.73000  ? 408 ALA B N     1 
ATOM   7516 C  CA    . ALA B 2 408 ? -24.69700 -35.24600 -2.60800  1.000 38.05000  ? 408 ALA B CA    1 
ATOM   7517 C  C     . ALA B 2 408 ? -24.60000 -33.72500 -2.58400  1.000 37.46000  ? 408 ALA B C     1 
ATOM   7518 O  O     . ALA B 2 408 ? -25.47900 -33.06100 -3.11600  1.000 35.61000  ? 408 ALA B O     1 
ATOM   7519 C  CB    . ALA B 2 408 ? -23.67000 -35.85200 -3.56600  1.000 33.05000  ? 408 ALA B CB    1 
ATOM   7520 N  N     . THR B 2 409 ? -23.55800 -33.15700 -1.97800  1.000 37.28000  ? 409 THR B N     1 
ATOM   7521 C  CA    . THR B 2 409 ? -23.44100 -31.70300 -2.00700  1.000 37.43000  ? 409 THR B CA    1 
ATOM   7522 C  C     . THR B 2 409 ? -22.52100 -31.24800 -3.12000  1.000 40.19000  ? 409 THR B C     1 
ATOM   7523 O  O     . THR B 2 409 ? -22.52000 -30.06700 -3.47400  1.000 47.92000  ? 409 THR B O     1 
ATOM   7524 C  CB    . THR B 2 409 ? -22.94700 -31.12000 -0.67400  1.000 37.52000  ? 409 THR B CB    1 
ATOM   7525 O  OG1   . THR B 2 409 ? -21.66600 -31.66600 -0.34500  1.000 41.51000  ? 409 THR B OG1   1 
ATOM   7526 C  CG2   . THR B 2 409 ? -23.94200 -31.42200 0.43800   1.000 36.43000  ? 409 THR B CG2   1 
ATOM   7527 N  N     . TRP B 2 410 ? -21.74500 -32.18100 -3.67100  1.000 44.06000  ? 410 TRP B N     1 
ATOM   7528 C  CA    . TRP B 2 410 ? -20.93300 -31.93000 -4.87400  1.000 43.35000  ? 410 TRP B CA    1 
ATOM   7529 C  C     . TRP B 2 410 ? -21.62500 -32.48800 -6.14700  1.000 39.61000  ? 410 TRP B C     1 
ATOM   7530 O  O     . TRP B 2 410 ? -22.62000 -33.22500 -6.08300  1.000 34.76000  ? 410 TRP B O     1 
ATOM   7531 C  CB    . TRP B 2 410 ? -19.52400 -32.53400 -4.71700  1.000 35.97000  ? 410 TRP B CB    1 
ATOM   7532 C  CG    . TRP B 2 410 ? -19.50800 -33.83200 -3.95800  1.000 36.95000  ? 410 TRP B CG    1 
ATOM   7533 C  CD1   . TRP B 2 410 ? -19.00300 -34.04600 -2.70300  1.000 45.97000  ? 410 TRP B CD1   1 
ATOM   7534 C  CD2   . TRP B 2 410 ? -20.04600 -35.09400 -4.38800  1.000 45.16000  ? 410 TRP B CD2   1 
ATOM   7535 N  NE1   . TRP B 2 410 ? -19.18500 -35.36600 -2.32700  1.000 38.45000  ? 410 TRP B NE1   1 
ATOM   7536 C  CE2   . TRP B 2 410 ? -19.82600 -36.02600 -3.34300  1.000 41.74000  ? 410 TRP B CE2   1 
ATOM   7537 C  CE3   . TRP B 2 410 ? -20.68900 -35.53200 -5.55200  1.000 39.19000  ? 410 TRP B CE3   1 
ATOM   7538 C  CZ2   . TRP B 2 410 ? -20.22700 -37.36000 -3.43700  1.000 36.48000  ? 410 TRP B CZ2   1 
ATOM   7539 C  CZ3   . TRP B 2 410 ? -21.08100 -36.86200 -5.63500  1.000 36.77000  ? 410 TRP B CZ3   1 
ATOM   7540 C  CH2   . TRP B 2 410 ? -20.84500 -37.75700 -4.58600  1.000 33.78000  ? 410 TRP B CH2   1 
ATOM   7541 N  N     . ILE B 2 411 ? -21.10600 -32.10700 -7.30700  1.000 37.00000  ? 411 ILE B N     1 
ATOM   7542 C  CA    . ILE B 2 411 ? -21.63800 -32.57300 -8.58000  1.000 32.52000  ? 411 ILE B CA    1 
ATOM   7543 C  C     . ILE B 2 411 ? -20.47900 -32.81500 -9.53700  1.000 31.92000  ? 411 ILE B C     1 
ATOM   7544 O  O     . ILE B 2 411 ? -19.74200 -31.88800 -9.87700  1.000 33.07000  ? 411 ILE B O     1 
ATOM   7545 C  CB    . ILE B 2 411 ? -22.61300 -31.55300 -9.20500  1.000 35.18000  ? 411 ILE B CB    1 
ATOM   7546 C  CG1   . ILE B 2 411 ? -23.71300 -31.17900 -8.21700  1.000 34.69000  ? 411 ILE B CG1   1 
ATOM   7547 C  CG2   . ILE B 2 411 ? -23.21000 -32.08200 -10.49500 1.000 29.12000  ? 411 ILE B CG2   1 
ATOM   7548 C  CD1   . ILE B 2 411 ? -24.17600 -29.75500 -8.36300  1.000 30.85000  ? 411 ILE B CD1   1 
ATOM   7549 N  N     . PRO B 2 412 ? -20.30300 -34.06800 -9.96200  1.000 28.90000  ? 412 PRO B N     1 
ATOM   7550 C  CA    . PRO B 2 412 ? -19.19100 -34.42600 -10.84300 1.000 33.10000  ? 412 PRO B CA    1 
ATOM   7551 C  C     . PRO B 2 412 ? -19.43200 -33.98600 -12.27100 1.000 34.10000  ? 412 PRO B C     1 
ATOM   7552 O  O     . PRO B 2 412 ? -20.58700 -33.87600 -12.69100 1.000 33.46000  ? 412 PRO B O     1 
ATOM   7553 C  CB    . PRO B 2 412 ? -19.14600 -35.95500 -10.75100 1.000 34.72000  ? 412 PRO B CB    1 
ATOM   7554 C  CG    . PRO B 2 412 ? -20.55100 -36.34700 -10.43800 1.000 28.61000  ? 412 PRO B CG    1 
ATOM   7555 C  CD    . PRO B 2 412 ? -21.13100 -35.23100 -9.60700  1.000 30.91000  ? 412 PRO B CD    1 
ATOM   7556 N  N     . GLU B 2 413 ? -18.34700 -33.74100 -12.99900 1.000 33.98000  ? 413 GLU B N     1 
ATOM   7557 C  CA    . GLU B 2 413 ? -18.41500 -33.49200 -14.42400 1.000 30.76000  ? 413 GLU B CA    1 
ATOM   7558 C  C     . GLU B 2 413 ? -18.95600 -34.72900 -15.10400 1.000 32.08000  ? 413 GLU B C     1 
ATOM   7559 O  O     . GLU B 2 413 ? -18.77400 -35.84300 -14.60000 1.000 32.63000  ? 413 GLU B O     1 
ATOM   7560 C  CB    . GLU B 2 413 ? -17.04000 -33.16600 -14.97500 1.000 37.47000  ? 413 GLU B CB    1 
ATOM   7561 C  CG    . GLU B 2 413 ? -16.24900 -32.23500 -14.11000 1.000 44.36000  ? 413 GLU B CG    1 
ATOM   7562 C  CD    . GLU B 2 413 ? -16.50400 -30.80900 -14.44400 1.000 53.23000  ? 413 GLU B CD    1 
ATOM   7563 O  OE1   . GLU B 2 413 ? -17.19700 -30.60100 -15.46800 1.000 64.59000  ? 413 GLU B OE1   1 
ATOM   7564 O  OE2   . GLU B 2 413 ? -16.02200 -29.91200 -13.69700 1.000 56.51000  ? 413 GLU B OE2   1 
ATOM   7565 N  N     . TRP B 2 414 ? -19.62800 -34.54700 -16.23900 1.000 30.33000  ? 414 TRP B N     1 
ATOM   7566 C  CA    . TRP B 2 414 ? -20.06400 -35.69900 -17.02700 1.000 33.20000  ? 414 TRP B CA    1 
ATOM   7567 C  C     . TRP B 2 414 ? -20.27600 -35.40000 -18.48500 1.000 31.59000  ? 414 TRP B C     1 
ATOM   7568 O  O     . TRP B 2 414 ? -20.32900 -34.25300 -18.90300 1.000 35.25000  ? 414 TRP B O     1 
ATOM   7569 C  CB    . TRP B 2 414 ? -21.35100 -36.30200 -16.46900 1.000 27.76000  ? 414 TRP B CB    1 
ATOM   7570 C  CG    . TRP B 2 414 ? -22.48300 -35.37100 -16.30200 1.000 26.98000  ? 414 TRP B CG    1 
ATOM   7571 C  CD1   . TRP B 2 414 ? -23.06400 -34.59600 -17.26500 1.000 29.18000  ? 414 TRP B CD1   1 
ATOM   7572 C  CD2   . TRP B 2 414 ? -23.22400 -35.14200 -15.09600 1.000 25.12000  ? 414 TRP B CD2   1 
ATOM   7573 N  NE1   . TRP B 2 414 ? -24.11500 -33.87900 -16.72400 1.000 31.33000  ? 414 TRP B NE1   1 
ATOM   7574 C  CE2   . TRP B 2 414 ? -24.23200 -34.20000 -15.39500 1.000 29.16000  ? 414 TRP B CE2   1 
ATOM   7575 C  CE3   . TRP B 2 414 ? -23.13000 -35.64100 -13.79300 1.000 26.35000  ? 414 TRP B CE3   1 
ATOM   7576 C  CZ2   . TRP B 2 414 ? -25.13800 -33.74100 -14.43200 1.000 30.40000  ? 414 TRP B CZ2   1 
ATOM   7577 C  CZ3   . TRP B 2 414 ? -24.03400 -35.18900 -12.83600 1.000 26.23000  ? 414 TRP B CZ3   1 
ATOM   7578 C  CH2   . TRP B 2 414 ? -25.02400 -34.25100 -13.16200 1.000 29.70000  ? 414 TRP B CH2   1 
ATOM   7579 N  N     . GLU B 2 415 ? -20.37300 -36.46200 -19.26200 1.000 30.06000  ? 415 GLU B N     1 
ATOM   7580 C  CA    . GLU B 2 415 ? -20.69900 -36.33300 -20.66100 1.000 34.77000  ? 415 GLU B CA    1 
ATOM   7581 C  C     . GLU B 2 415 ? -21.53100 -37.54600 -21.00400 1.000 33.81000  ? 415 GLU B C     1 
ATOM   7582 O  O     . GLU B 2 415 ? -21.52500 -38.52800 -20.25900 1.000 34.07000  ? 415 GLU B O     1 
ATOM   7583 C  CB    . GLU B 2 415 ? -19.44200 -36.22400 -21.52400 1.000 37.54000  ? 415 GLU B CB    1 
ATOM   7584 C  CG    . GLU B 2 415 ? -18.44100 -37.34900 -21.33700 1.000 44.60000  ? 415 GLU B CG    1 
ATOM   7585 C  CD    . GLU B 2 415 ? -17.46500 -37.45400 -22.50400 1.000 53.05000  ? 415 GLU B CD    1 
ATOM   7586 O  OE1   . GLU B 2 415 ? -17.90300 -37.88300 -23.60100 1.000 58.65000  ? 415 GLU B OE1   1 
ATOM   7587 O  OE2   . GLU B 2 415 ? -16.27500 -37.09900 -22.32800 1.000 52.88000  ? 415 GLU B OE2   1 
ATOM   7588 N  N     . PHE B 2 416 ? -22.27900 -37.48000 -22.09700 1.000 37.52000  ? 416 PHE B N     1 
ATOM   7589 C  CA    . PHE B 2 416 ? -23.17700 -38.58100 -22.42300 1.000 34.83000  ? 416 PHE B CA    1 
ATOM   7590 C  C     . PHE B 2 416 ? -22.64900 -39.31700 -23.64300 1.000 38.67000  ? 416 PHE B C     1 
ATOM   7591 O  O     . PHE B 2 416 ? -22.11500 -38.70900 -24.56800 1.000 44.97000  ? 416 PHE B O     1 
ATOM   7592 C  CB    . PHE B 2 416 ? -24.59100 -38.05800 -22.63300 1.000 33.45000  ? 416 PHE B CB    1 
ATOM   7593 C  CG    . PHE B 2 416 ? -25.04300 -37.11900 -21.54700 1.000 34.59000  ? 416 PHE B CG    1 
ATOM   7594 C  CD1   . PHE B 2 416 ? -25.57100 -37.60700 -20.36400 1.000 35.99000  ? 416 PHE B CD1   1 
ATOM   7595 C  CD2   . PHE B 2 416 ? -24.91800 -35.74600 -21.70300 1.000 34.82000  ? 416 PHE B CD2   1 
ATOM   7596 C  CE1   . PHE B 2 416 ? -25.97300 -36.73600 -19.35000 1.000 37.44000  ? 416 PHE B CE1   1 
ATOM   7597 C  CE2   . PHE B 2 416 ? -25.31800 -34.86900 -20.70200 1.000 36.68000  ? 416 PHE B CE2   1 
ATOM   7598 C  CZ    . PHE B 2 416 ? -25.84500 -35.36500 -19.52000 1.000 38.06000  ? 416 PHE B CZ    1 
ATOM   7599 N  N     . VAL B 2 417 ? -22.75500 -40.63900 -23.61900 1.000 41.30000  ? 417 VAL B N     1 
ATOM   7600 C  CA    . VAL B 2 417 ? -22.21800 -41.45800 -24.68500 1.000 42.68000  ? 417 VAL B CA    1 
ATOM   7601 C  C     . VAL B 2 417 ? -23.13400 -42.64200 -24.92400 1.000 52.46000  ? 417 VAL B C     1 
ATOM   7602 O  O     . VAL B 2 417 ? -23.82500 -43.08100 -24.00800 1.000 64.34000  ? 417 VAL B O     1 
ATOM   7603 C  CB    . VAL B 2 417 ? -20.82600 -41.94400 -24.33200 1.000 44.32000  ? 417 VAL B CB    1 
ATOM   7604 C  CG1   . VAL B 2 417 ? -20.91400 -43.03200 -23.27200 1.000 32.09000  ? 417 VAL B CG1   1 
ATOM   7605 C  CG2   . VAL B 2 417 ? -20.12000 -42.44000 -25.57500 1.000 62.86000  ? 417 VAL B CG2   1 
ATOM   7606 N  N     . ASN B 2 418 ? -23.17700 -43.15400 -26.14800 1.000 62.57000  ? 418 ASN B N     1 
ATOM   7607 C  CA    . ASN B 2 418 ? -23.90200 -44.40200 -26.39300 1.000 66.06000  ? 418 ASN B CA    1 
ATOM   7608 C  C     . ASN B 2 418 ? -22.92200 -45.56000 -26.31300 1.000 67.31000  ? 418 ASN B C     1 
ATOM   7609 O  O     . ASN B 2 418 ? -22.05600 -45.69400 -27.18900 1.000 69.33000  ? 418 ASN B O     1 
ATOM   7610 C  CB    . ASN B 2 418 ? -24.61000 -44.39300 -27.75600 1.000 71.68000  ? 418 ASN B CB    1 
ATOM   7611 C  CG    . ASN B 2 418 ? -25.08800 -43.00500 -28.15900 1.000 73.34000  ? 418 ASN B CG    1 
ATOM   7612 O  OD1   . ASN B 2 418 ? -24.59900 -42.43600 -29.13700 1.000 70.06000  ? 418 ASN B OD1   1 
ATOM   7613 N  ND2   . ASN B 2 418 ? -26.03600 -42.44700 -27.39700 1.000 75.66000  ? 418 ASN B ND2   1 
ATOM   7614 N  N     . THR B 2 419 ? -23.04900 -46.36700 -25.25300 1.000 67.06000  ? 419 THR B N     1 
ATOM   7615 C  CA    . THR B 2 419 ? -22.21100 -47.55300 -25.04000 1.000 69.53000  ? 419 THR B CA    1 
ATOM   7616 C  C     . THR B 2 419 ? -22.21400 -48.46500 -26.26600 1.000 73.08000  ? 419 THR B C     1 
ATOM   7617 O  O     . THR B 2 419 ? -23.26800 -48.97900 -26.66000 1.000 72.43000  ? 419 THR B O     1 
ATOM   7618 C  CB    . THR B 2 419 ? -22.68700 -48.40100 -23.80500 1.000 77.96000  ? 419 THR B CB    1 
ATOM   7619 O  OG1   . THR B 2 419 ? -22.49000 -47.68000 -22.57700 1.000 73.76000  ? 419 THR B OG1   1 
ATOM   7620 C  CG2   . THR B 2 419 ? -21.93800 -49.73900 -23.73000 1.000 70.88000  ? 419 THR B CG2   1 
ATOM   7621 N  N     . PRO B 2 420 ? -21.04400 -48.65500 -26.89400 1.000 78.58000  ? 420 PRO B N     1 
ATOM   7622 C  CA    . PRO B 2 420 ? -21.02700 -49.69200 -27.93100 1.000 81.34000  ? 420 PRO B CA    1 
ATOM   7623 C  C     . PRO B 2 420 ? -21.39200 -51.02900 -27.29300 1.000 78.74000  ? 420 PRO B C     1 
ATOM   7624 O  O     . PRO B 2 420 ? -20.72100 -51.42000 -26.33600 1.000 79.37000  ? 420 PRO B O     1 
ATOM   7625 C  CB    . PRO B 2 420 ? -19.57600 -49.67200 -28.43300 1.000 79.51000  ? 420 PRO B CB    1 
ATOM   7626 C  CG    . PRO B 2 420 ? -19.08000 -48.28600 -28.10100 1.000 74.44000  ? 420 PRO B CG    1 
ATOM   7627 C  CD    . PRO B 2 420 ? -19.76000 -47.93800 -26.79600 1.000 77.33000  ? 420 PRO B CD    1 
ATOM   7628 N  N     . PRO B 2 421 ? -22.43600 -51.71200 -27.80100 1.000 76.01000  ? 421 PRO B N     1 
ATOM   7629 C  CA    . PRO B 2 421 ? -23.00600 -52.90600 -27.14700 1.000 78.53000  ? 421 PRO B CA    1 
ATOM   7630 C  C     . PRO B 2 421 ? -21.97600 -54.00700 -26.84800 1.000 75.55000  ? 421 PRO B C     1 
ATOM   7631 O  O     . PRO B 2 421 ? -22.28600 -54.94400 -26.10300 1.000 71.54000  ? 421 PRO B O     1 
ATOM   7632 C  CB    . PRO B 2 421 ? -24.03900 -53.41400 -28.16400 1.000 76.85000  ? 421 PRO B CB    1 
ATOM   7633 C  CG    . PRO B 2 421 ? -24.29200 -52.27200 -29.08700 1.000 73.82000  ? 421 PRO B CG    1 
ATOM   7634 C  CD    . PRO B 2 421 ? -23.03900 -51.45600 -29.12200 1.000 70.75000  ? 421 PRO B CD    1 
ATOM   7635 N  N     . LEU B 2 422 ? -20.77900 -53.88200 -27.42300 1.000 66.83000  ? 422 LEU B N     1 
ATOM   7636 C  CA    . LEU B 2 422 ? -19.70500 -54.83200 -27.20100 1.000 66.63000  ? 422 LEU B CA    1 
ATOM   7637 C  C     . LEU B 2 422 ? -19.17500 -54.79900 -25.77200 1.000 66.57000  ? 422 LEU B C     1 
ATOM   7638 O  O     . LEU B 2 422 ? -19.20900 -55.83200 -25.10300 1.000 62.58000  ? 422 LEU B O     1 
ATOM   7639 C  CB    . LEU B 2 422 ? -18.56400 -54.59300 -28.19000 1.000 65.36000  ? 422 LEU B CB    1 
ATOM   7640 C  CG    . LEU B 2 422 ? -18.81700 -55.32000 -29.51800 1.000 60.50000  ? 422 LEU B CG    1 
ATOM   7641 C  CD1   . LEU B 2 422 ? -17.58300 -55.28300 -30.42300 1.000 47.76000  ? 422 LEU B CD1   1 
ATOM   7642 C  CD2   . LEU B 2 422 ? -19.31500 -56.76300 -29.27700 1.000 52.20000  ? 422 LEU B CD2   1 
ATOM   7643 N  N     . VAL B 2 423 ? -18.70200 -53.64000 -25.29700 1.000 71.15000  ? 423 VAL B N     1 
ATOM   7644 C  CA    . VAL B 2 423 ? -18.14600 -53.53200 -23.92900 1.000 69.08000  ? 423 VAL B CA    1 
ATOM   7645 C  C     . VAL B 2 423 ? -19.19400 -53.89000 -22.84500 1.000 69.30000  ? 423 VAL B C     1 
ATOM   7646 O  O     . VAL B 2 423 ? -18.84200 -54.35300 -21.74600 1.000 61.92000  ? 423 VAL B O     1 
ATOM   7647 C  CB    . VAL B 2 423 ? -17.55100 -52.12000 -23.65400 1.000 60.90000  ? 423 VAL B CB    1 
ATOM   7648 C  CG1   . VAL B 2 423 ? -18.58600 -51.03300 -23.90300 1.000 70.71000  ? 423 VAL B CG1   1 
ATOM   7649 C  CG2   . VAL B 2 423 ? -16.98100 -52.02200 -22.23500 1.000 50.91000  ? 423 VAL B CG2   1 
ATOM   7650 N  N     . LYS B 2 424 ? -20.47500 -53.70600 -23.16700 1.000 65.02000  ? 424 LYS B N     1 
ATOM   7651 C  CA    . LYS B 2 424 ? -21.54800 -54.25600 -22.34100 1.000 68.82000  ? 424 LYS B CA    1 
ATOM   7652 C  C     . LYS B 2 424 ? -21.33900 -55.76600 -22.10400 1.000 71.28000  ? 424 LYS B C     1 
ATOM   7653 O  O     . LYS B 2 424 ? -21.46100 -56.23700 -20.97800 1.000 74.78000  ? 424 LYS B O     1 
ATOM   7654 C  CB    . LYS B 2 424 ? -22.91200 -53.99800 -22.98800 1.000 75.37000  ? 424 LYS B CB    1 
ATOM   7655 C  CG    . LYS B 2 424 ? -24.06800 -54.76400 -22.33400 1.000 79.62000  ? 424 LYS B CG    1 
ATOM   7656 C  CD    . LYS B 2 424 ? -25.30100 -54.79100 -23.24600 1.000 80.08000  ? 424 LYS B CD    1 
ATOM   7657 C  CE    . LYS B 2 424 ? -26.46600 -55.57400 -22.63600 1.000 72.27000  ? 424 LYS B CE    1 
ATOM   7658 N  NZ    . LYS B 2 424 ? -27.71800 -55.41100 -23.44800 1.000 63.51000  ? 424 LYS B NZ    1 
ATOM   7659 N  N     . LEU B 2 425 ? -21.00300 -56.50500 -23.16500 1.000 72.95000  ? 425 LEU B N     1 
ATOM   7660 C  CA    . LEU B 2 425 ? -20.69700 -57.94600 -23.09700 1.000 69.44000  ? 425 LEU B CA    1 
ATOM   7661 C  C     . LEU B 2 425 ? -19.41900 -58.30000 -22.33900 1.000 63.77000  ? 425 LEU B C     1 
ATOM   7662 O  O     . LEU B 2 425 ? -19.32300 -59.35500 -21.71400 1.000 65.11000  ? 425 LEU B O     1 
ATOM   7663 C  CB    . LEU B 2 425 ? -20.56800 -58.51900 -24.50800 1.000 69.67000  ? 425 LEU B CB    1 
ATOM   7664 C  CG    . LEU B 2 425 ? -21.74400 -59.25500 -25.13200 1.000 81.14000  ? 425 LEU B CG    1 
ATOM   7665 C  CD1   . LEU B 2 425 ? -21.50100 -59.36500 -26.63100 1.000 79.65000  ? 425 LEU B CD1   1 
ATOM   7666 C  CD2   . LEU B 2 425 ? -21.92400 -60.63900 -24.49500 1.000 77.02000  ? 425 LEU B CD2   1 
ATOM   7667 N  N     . TRP B 2 426 ? -18.42800 -57.42800 -22.43500 1.000 59.03000  ? 426 TRP B N     1 
ATOM   7668 C  CA    . TRP B 2 426 ? -17.10300 -57.68900 -21.89500 1.000 57.39000  ? 426 TRP B CA    1 
ATOM   7669 C  C     . TRP B 2 426 ? -17.07400 -57.71800 -20.36400 1.000 60.20000  ? 426 TRP B C     1 
ATOM   7670 O  O     . TRP B 2 426 ? -16.40900 -58.55400 -19.74900 1.000 52.58000  ? 426 TRP B O     1 
ATOM   7671 C  CB    . TRP B 2 426 ? -16.12100 -56.62900 -22.40800 1.000 58.30000  ? 426 TRP B CB    1 
ATOM   7672 C  CG    . TRP B 2 426 ? -15.95900 -56.49200 -23.93700 1.000 63.69000  ? 426 TRP B CG    1 
ATOM   7673 C  CD1   . TRP B 2 426 ? -15.49800 -55.37800 -24.61200 1.000 66.69000  ? 426 TRP B CD1   1 
ATOM   7674 C  CD2   . TRP B 2 426 ? -16.22600 -57.48400 -24.95900 1.000 64.05000  ? 426 TRP B CD2   1 
ATOM   7675 N  NE1   . TRP B 2 426 ? -15.46800 -55.61500 -25.97300 1.000 66.83000  ? 426 TRP B NE1   1 
ATOM   7676 C  CE2   . TRP B 2 426 ? -15.90800 -56.89300 -26.21300 1.000 66.27000  ? 426 TRP B CE2   1 
ATOM   7677 C  CE3   . TRP B 2 426 ? -16.71200 -58.80200 -24.94100 1.000 58.91000  ? 426 TRP B CE3   1 
ATOM   7678 C  CZ2   . TRP B 2 426 ? -16.05800 -57.57600 -27.42400 1.000 54.81000  ? 426 TRP B CZ2   1 
ATOM   7679 C  CZ3   . TRP B 2 426 ? -16.86800 -59.47100 -26.14700 1.000 58.50000  ? 426 TRP B CZ3   1 
ATOM   7680 C  CH2   . TRP B 2 426 ? -16.52900 -58.86000 -27.36900 1.000 53.34000  ? 426 TRP B CH2   1 
ATOM   7681 N  N     . TYR B 2 427 ? -17.79200 -56.78600 -19.74800 1.000 64.96000  ? 427 TYR B N     1 
ATOM   7682 C  CA    . TYR B 2 427 ? -17.80600 -56.68400 -18.29500 1.000 62.57000  ? 427 TYR B CA    1 
ATOM   7683 C  C     . TYR B 2 427 ? -18.95300 -57.48400 -17.69200 1.000 67.75000  ? 427 TYR B C     1 
ATOM   7684 O  O     . TYR B 2 427 ? -19.19800 -57.42900 -16.48500 1.000 61.04000  ? 427 TYR B O     1 
ATOM   7685 C  CB    . TYR B 2 427 ? -17.87500 -55.21400 -17.88100 1.000 51.13000  ? 427 TYR B CB    1 
ATOM   7686 C  CG    . TYR B 2 427 ? -16.53700 -54.54800 -18.03500 1.000 45.00000  ? 427 TYR B CG    1 
ATOM   7687 C  CD1   . TYR B 2 427 ? -15.50400 -54.84300 -17.15200 1.000 52.59000  ? 427 TYR B CD1   1 
ATOM   7688 C  CD2   . TYR B 2 427 ? -16.28200 -53.66100 -19.07800 1.000 46.12000  ? 427 TYR B CD2   1 
ATOM   7689 C  CE1   . TYR B 2 427 ? -14.25900 -54.26400 -17.28100 1.000 53.26000  ? 427 TYR B CE1   1 
ATOM   7690 C  CE2   . TYR B 2 427 ? -15.03600 -53.06800 -19.21900 1.000 43.48000  ? 427 TYR B CE2   1 
ATOM   7691 C  CZ    . TYR B 2 427 ? -14.02800 -53.37600 -18.31100 1.000 51.74000  ? 427 TYR B CZ    1 
ATOM   7692 O  OH    . TYR B 2 427 ? -12.77400 -52.80800 -18.42100 1.000 58.88000  ? 427 TYR B OH    1 
ATOM   7693 N  N     . GLN B 2 428 ? -19.61400 -58.26000 -18.55000 1.000 72.71000  ? 428 GLN B N     1 
ATOM   7694 C  CA    . GLN B 2 428 ? -20.85600 -58.94200 -18.21600 1.000 69.24000  ? 428 GLN B CA    1 
ATOM   7695 C  C     . GLN B 2 428 ? -20.70500 -59.93800 -17.07100 1.000 78.53000  ? 428 GLN B C     1 
ATOM   7696 O  O     . GLN B 2 428 ? -19.62700 -60.50600 -16.83900 1.000 71.67000  ? 428 GLN B O     1 
ATOM   7697 C  CB    . GLN B 2 428 ? -21.41100 -59.65600 -19.45600 1.000 69.88000  ? 428 GLN B CB    1 
ATOM   7698 C  CG    . GLN B 2 428 ? -22.93900 -59.84200 -19.48000 1.000 80.88000  ? 428 GLN B CG    1 
ATOM   7699 C  CD    . GLN B 2 428 ? -23.72100 -58.52200 -19.56200 1.000 86.04000  ? 428 GLN B CD    1 
ATOM   7700 O  OE1   . GLN B 2 428 ? -24.27200 -58.04800 -18.55500 1.000 82.95000  ? 428 GLN B OE1   1 
ATOM   7701 N  NE2   . GLN B 2 428 ? -23.79200 -57.94100 -20.76700 1.000 78.71000  ? 428 GLN B NE2   1 
ATOM   7702 N  N     . LEU B 2 429 ? -21.81900 -60.13200 -16.37000 1.000 88.02000  ? 429 LEU B N     1 
ATOM   7703 C  CA    . LEU B 2 429 ? -21.92100 -61.01000 -15.20800 1.000 82.18000  ? 429 LEU B CA    1 
ATOM   7704 C  C     . LEU B 2 429 ? -21.85300 -62.48100 -15.59900 1.000 64.82000  ? 429 LEU B C     1 
ATOM   7705 O  O     . LEU B 2 429 ? -22.18400 -62.82900 -16.72800 1.000 77.30000  ? 429 LEU B O     1 
ATOM   7706 C  CB    . LEU B 2 429 ? -23.22800 -60.72400 -14.47600 1.000 85.20000  ? 429 LEU B CB    1 
ATOM   7707 C  CG    . LEU B 2 429 ? -23.72000 -59.27600 -14.57400 1.000 82.93000  ? 429 LEU B CG    1 
ATOM   7708 C  CD1   . LEU B 2 429 ? -25.07500 -59.14200 -13.88800 1.000 88.03000  ? 429 LEU B CD1   1 
ATOM   7709 C  CD2   . LEU B 2 429 ? -22.70400 -58.29500 -13.97200 1.000 74.21000  ? 429 LEU B CD2   1 
ATOM   7710 O  "O5'" . DG  C 3 4   ? -3.13900  -37.33800 -37.06800 1.000 70.35000  ? 805 DG  P "O5'" 1 
ATOM   7711 C  "C5'" . DG  C 3 4   ? -2.64500  -36.54300 -38.15300 1.000 63.91000  ? 805 DG  P "C5'" 1 
ATOM   7712 C  "C4'" . DG  C 3 4   ? -2.22300  -37.42600 -39.31900 1.000 62.89000  ? 805 DG  P "C4'" 1 
ATOM   7713 O  "O4'" . DG  C 3 4   ? -1.77800  -38.70100 -38.81000 1.000 62.52000  ? 805 DG  P "O4'" 1 
ATOM   7714 C  "C3'" . DG  C 3 4   ? -3.32600  -37.72300 -40.32100 1.000 66.95000  ? 805 DG  P "C3'" 1 
ATOM   7715 O  "O3'" . DG  C 3 4   ? -3.22300  -36.81300 -41.41000 1.000 79.03000  ? 805 DG  P "O3'" 1 
ATOM   7716 C  "C2'" . DG  C 3 4   ? -3.05700  -39.16000 -40.76900 1.000 55.15000  ? 805 DG  P "C2'" 1 
ATOM   7717 C  "C1'" . DG  C 3 4   ? -2.28400  -39.75600 -39.59300 1.000 57.41000  ? 805 DG  P "C1'" 1 
ATOM   7718 N  N9    . DG  C 3 4   ? -3.05400  -40.65600 -38.72400 1.000 61.33000  ? 805 DG  P N9    1 
ATOM   7719 C  C8    . DG  C 3 4   ? -3.11700  -40.63400 -37.33900 1.000 57.61000  ? 805 DG  P C8    1 
ATOM   7720 N  N7    . DG  C 3 4   ? -3.85700  -41.59100 -36.83400 1.000 49.58000  ? 805 DG  P N7    1 
ATOM   7721 C  C5    . DG  C 3 4   ? -4.30600  -42.29800 -37.95400 1.000 54.70000  ? 805 DG  P C5    1 
ATOM   7722 C  C6    . DG  C 3 4   ? -5.13900  -43.44500 -38.04400 1.000 52.92000  ? 805 DG  P C6    1 
ATOM   7723 O  O6    . DG  C 3 4   ? -5.66900  -44.09000 -37.12100 1.000 50.36000  ? 805 DG  P O6    1 
ATOM   7724 N  N1    . DG  C 3 4   ? -5.33600  -43.83200 -39.37000 1.000 49.09000  ? 805 DG  P N1    1 
ATOM   7725 C  C2    . DG  C 3 4   ? -4.79600  -43.19500 -40.46900 1.000 50.96000  ? 805 DG  P C2    1 
ATOM   7726 N  N2    . DG  C 3 4   ? -5.09800  -43.71100 -41.66800 1.000 54.55000  ? 805 DG  P N2    1 
ATOM   7727 N  N3    . DG  C 3 4   ? -4.01400  -42.13300 -40.40100 1.000 48.43000  ? 805 DG  P N3    1 
ATOM   7728 C  C4    . DG  C 3 4   ? -3.81400  -41.73600 -39.12100 1.000 54.89000  ? 805 DG  P C4    1 
ATOM   7729 P  P     . DT  C 3 5   ? -4.48300  -35.89900 -41.82300 1.000 85.86000  ? 806 DT  P P     1 
ATOM   7730 O  OP1   . DT  C 3 5   ? -3.99600  -34.73900 -42.60200 1.000 79.64000  ? 806 DT  P OP1   1 
ATOM   7731 O  OP2   . DT  C 3 5   ? -5.32700  -35.72500 -40.60800 1.000 61.67000  ? 806 DT  P OP2   1 
ATOM   7732 O  "O5'" . DT  C 3 5   ? -5.28400  -36.80900 -42.85500 1.000 75.30000  ? 806 DT  P "O5'" 1 
ATOM   7733 C  "C5'" . DT  C 3 5   ? -4.59200  -37.76100 -43.65300 1.000 76.07000  ? 806 DT  P "C5'" 1 
ATOM   7734 C  "C4'" . DT  C 3 5   ? -5.58900  -38.63200 -44.37600 1.000 70.98000  ? 806 DT  P "C4'" 1 
ATOM   7735 O  "O4'" . DT  C 3 5   ? -5.87700  -39.82100 -43.58600 1.000 63.44000  ? 806 DT  P "O4'" 1 
ATOM   7736 C  "C3'" . DT  C 3 5   ? -6.91900  -37.94100 -44.61900 1.000 67.32000  ? 806 DT  P "C3'" 1 
ATOM   7737 O  "O3'" . DT  C 3 5   ? -7.40800  -38.28500 -45.88000 1.000 73.11000  ? 806 DT  P "O3'" 1 
ATOM   7738 C  "C2'" . DT  C 3 5   ? -7.81300  -38.45800 -43.49600 1.000 63.20000  ? 806 DT  P "C2'" 1 
ATOM   7739 C  "C1'" . DT  C 3 5   ? -7.23700  -39.84100 -43.20500 1.000 59.85000  ? 806 DT  P "C1'" 1 
ATOM   7740 N  N1    . DT  C 3 5   ? -7.32500  -40.20300 -41.76500 1.000 56.29000  ? 806 DT  P N1    1 
ATOM   7741 C  C2    . DT  C 3 5   ? -7.83500  -41.42600 -41.41900 1.000 49.50000  ? 806 DT  P C2    1 
ATOM   7742 O  O2    . DT  C 3 5   ? -8.20200  -42.24500 -42.23800 1.000 53.99000  ? 806 DT  P O2    1 
ATOM   7743 N  N3    . DT  C 3 5   ? -7.89900  -41.66200 -40.07600 1.000 46.56000  ? 806 DT  P N3    1 
ATOM   7744 C  C4    . DT  C 3 5   ? -7.50700  -40.81300 -39.05700 1.000 49.25000  ? 806 DT  P C4    1 
ATOM   7745 O  O4    . DT  C 3 5   ? -7.59600  -41.12800 -37.86700 1.000 52.04000  ? 806 DT  P O4    1 
ATOM   7746 C  C5    . DT  C 3 5   ? -6.98300  -39.53400 -39.48600 1.000 51.63000  ? 806 DT  P C5    1 
ATOM   7747 C  C7    . DT  C 3 5   ? -6.52900  -38.52700 -38.47000 1.000 50.33000  ? 806 DT  P C7    1 
ATOM   7748 C  C6    . DT  C 3 5   ? -6.92200  -39.29000 -40.80500 1.000 51.90000  ? 806 DT  P C6    1 
ATOM   7749 P  P     . DC  C 3 6   ? -8.67800  -37.50900 -46.47300 1.000 80.29000  ? 807 DC  P P     1 
ATOM   7750 O  OP1   . DC  C 3 6   ? -8.45700  -37.43700 -47.93800 1.000 78.04000  ? 807 DC  P OP1   1 
ATOM   7751 O  OP2   . DC  C 3 6   ? -8.95000  -36.28200 -45.67100 1.000 65.81000  ? 807 DC  P OP2   1 
ATOM   7752 O  "O5'" . DC  C 3 6   ? -9.86100  -38.53300 -46.20400 1.000 66.88000  ? 807 DC  P "O5'" 1 
ATOM   7753 C  "C5'" . DC  C 3 6   ? -9.72200  -39.86700 -46.62000 1.000 60.92000  ? 807 DC  P "C5'" 1 
ATOM   7754 C  "C4'" . DC  C 3 6   ? -10.89400 -40.66700 -46.13600 1.000 61.24000  ? 807 DC  P "C4'" 1 
ATOM   7755 O  "O4'" . DC  C 3 6   ? -10.70000 -41.00400 -44.73800 1.000 63.56000  ? 807 DC  P "O4'" 1 
ATOM   7756 C  "C3'" . DC  C 3 6   ? -12.24200 -39.93700 -46.22200 1.000 60.45000  ? 807 DC  P "C3'" 1 
ATOM   7757 O  "O3'" . DC  C 3 6   ? -13.20800 -40.82400 -46.76400 1.000 61.61000  ? 807 DC  P "O3'" 1 
ATOM   7758 C  "C2'" . DC  C 3 6   ? -12.54400 -39.57300 -44.76400 1.000 52.34000  ? 807 DC  P "C2'" 1 
ATOM   7759 C  "C1'" . DC  C 3 6   ? -11.88800 -40.73000 -44.03100 1.000 54.84000  ? 807 DC  P "C1'" 1 
ATOM   7760 N  N1    . DC  C 3 6   ? -11.53100 -40.43800 -42.62700 1.000 56.82000  ? 807 DC  P N1    1 
ATOM   7761 C  C2    . DC  C 3 6   ? -11.80700 -41.39400 -41.64700 1.000 51.39000  ? 807 DC  P C2    1 
ATOM   7762 O  O2    . DC  C 3 6   ? -12.34800 -42.45600 -41.98200 1.000 50.56000  ? 807 DC  P O2    1 
ATOM   7763 N  N3    . DC  C 3 6   ? -11.47300 -41.13000 -40.35500 1.000 51.51000  ? 807 DC  P N3    1 
ATOM   7764 C  C4    . DC  C 3 6   ? -10.88000 -39.97500 -40.03900 1.000 49.60000  ? 807 DC  P C4    1 
ATOM   7765 N  N4    . DC  C 3 6   ? -10.57400 -39.76500 -38.75500 1.000 48.31000  ? 807 DC  P N4    1 
ATOM   7766 C  C5    . DC  C 3 6   ? -10.59000 -38.98000 -41.02600 1.000 48.11000  ? 807 DC  P C5    1 
ATOM   7767 C  C6    . DC  C 3 6   ? -10.93100 -39.25100 -42.29700 1.000 51.03000  ? 807 DC  P C6    1 
ATOM   7768 P  P     . DC  C 3 7   ? -14.65700 -40.31500 -47.22700 1.000 64.17000  ? 808 DC  P P     1 
ATOM   7769 O  OP1   . DC  C 3 7   ? -14.79200 -40.81700 -48.61800 1.000 58.85000  ? 808 DC  P OP1   1 
ATOM   7770 O  OP2   . DC  C 3 7   ? -14.88700 -38.89600 -46.86600 1.000 56.66000  ? 808 DC  P OP2   1 
ATOM   7771 O  "O5'" . DC  C 3 7   ? -15.64400 -41.10700 -46.25800 1.000 56.57000  ? 808 DC  P "O5'" 1 
ATOM   7772 C  "C5'" . DC  C 3 7   ? -15.29600 -42.39300 -45.81800 1.000 47.02000  ? 808 DC  P "C5'" 1 
ATOM   7773 C  "C4'" . DC  C 3 7   ? -16.12900 -42.77100 -44.61800 1.000 48.83000  ? 808 DC  P "C4'" 1 
ATOM   7774 O  "O4'" . DC  C 3 7   ? -15.45800 -42.35400 -43.40500 1.000 49.85000  ? 808 DC  P "O4'" 1 
ATOM   7775 C  "C3'" . DC  C 3 7   ? -17.53600 -42.15900 -44.57800 1.000 43.50000  ? 808 DC  P "C3'" 1 
ATOM   7776 O  "O3'" . DC  C 3 7   ? -18.49600 -43.21000 -44.37500 1.000 44.33000  ? 808 DC  P "O3'" 1 
ATOM   7777 C  "C2'" . DC  C 3 7   ? -17.47800 -41.18900 -43.38700 1.000 43.81000  ? 808 DC  P "C2'" 1 
ATOM   7778 C  "C1'" . DC  C 3 7   ? -16.40200 -41.81700 -42.51000 1.000 46.34000  ? 808 DC  P "C1'" 1 
ATOM   7779 N  N1    . DC  C 3 7   ? -15.68700 -40.84800 -41.61500 1.000 48.30000  ? 808 DC  P N1    1 
ATOM   7780 C  C2    . DC  C 3 7   ? -15.54100 -41.12900 -40.25100 1.000 47.59000  ? 808 DC  P C2    1 
ATOM   7781 O  O2    . DC  C 3 7   ? -16.02700 -42.16600 -39.79700 1.000 50.82000  ? 808 DC  P O2    1 
ATOM   7782 N  N3    . DC  C 3 7   ? -14.87300 -40.24200 -39.46300 1.000 47.52000  ? 808 DC  P N3    1 
ATOM   7783 C  C4    . DC  C 3 7   ? -14.35400 -39.12900 -40.00000 1.000 46.23000  ? 808 DC  P C4    1 
ATOM   7784 N  N4    . DC  C 3 7   ? -13.69700 -38.28100 -39.19500 1.000 48.89000  ? 808 DC  P N4    1 
ATOM   7785 C  C5    . DC  C 3 7   ? -14.48500 -38.83700 -41.38300 1.000 46.13000  ? 808 DC  P C5    1 
ATOM   7786 C  C6    . DC  C 3 7   ? -15.14900 -39.71500 -42.14500 1.000 51.80000  ? 808 DC  P C6    1 
ATOM   7787 P  P     . DC  C 3 8   ? -20.06100 -43.00300 -44.67900 1.000 43.79000  ? 809 DC  P P     1 
ATOM   7788 O  OP1   . DC  C 3 8   ? -20.54300 -44.33500 -45.11700 1.000 41.80000  ? 809 DC  P OP1   1 
ATOM   7789 O  OP2   . DC  C 3 8   ? -20.32700 -41.78500 -45.48600 1.000 40.73000  ? 809 DC  P OP2   1 
ATOM   7790 O  "O5'" . DC  C 3 8   ? -20.65500 -42.75700 -43.23700 1.000 43.53000  ? 809 DC  P "O5'" 1 
ATOM   7791 C  "C5'" . DC  C 3 8   ? -20.47700 -43.74800 -42.27500 1.000 40.87000  ? 809 DC  P "C5'" 1 
ATOM   7792 C  "C4'" . DC  C 3 8   ? -20.77900 -43.21400 -40.89800 1.000 43.30000  ? 809 DC  P "C4'" 1 
ATOM   7793 O  "O4'" . DC  C 3 8   ? -19.73200 -42.30200 -40.49200 1.000 46.71000  ? 809 DC  P "O4'" 1 
ATOM   7794 C  "C3'" . DC  C 3 8   ? -22.10300 -42.43500 -40.75600 1.000 41.67000  ? 809 DC  P "C3'" 1 
ATOM   7795 O  "O3'" . DC  C 3 8   ? -22.83400 -43.00000 -39.69700 1.000 41.48000  ? 809 DC  P "O3'" 1 
ATOM   7796 C  "C2'" . DC  C 3 8   ? -21.63700 -41.01600 -40.39700 1.000 41.83000  ? 809 DC  P "C2'" 1 
ATOM   7797 C  "C1'" . DC  C 3 8   ? -20.32400 -41.31900 -39.70100 1.000 47.00000  ? 809 DC  P "C1'" 1 
ATOM   7798 N  N1    . DC  C 3 8   ? -19.40000 -40.17100 -39.59500 1.000 50.45000  ? 809 DC  P N1    1 
ATOM   7799 C  C2    . DC  C 3 8   ? -18.77300 -39.92500 -38.37400 1.000 48.19000  ? 809 DC  P C2    1 
ATOM   7800 O  O2    . DC  C 3 8   ? -19.01300 -40.68100 -37.41700 1.000 46.21000  ? 809 DC  P O2    1 
ATOM   7801 N  N3    . DC  C 3 8   ? -17.92500 -38.86600 -38.27300 1.000 46.69000  ? 809 DC  P N3    1 
ATOM   7802 C  C4    . DC  C 3 8   ? -17.69800 -38.08900 -39.33800 1.000 47.27000  ? 809 DC  P C4    1 
ATOM   7803 N  N4    . DC  C 3 8   ? -16.85900 -37.05900 -39.19400 1.000 47.82000  ? 809 DC  P N4    1 
ATOM   7804 C  C5    . DC  C 3 8   ? -18.32900 -38.32900 -40.59400 1.000 45.18000  ? 809 DC  P C5    1 
ATOM   7805 C  C6    . DC  C 3 8   ? -19.16600 -39.36900 -40.67800 1.000 48.41000  ? 809 DC  P C6    1 
ATOM   7806 P  P     . DT  C 3 9   ? -24.43200 -42.88000 -39.59600 1.000 42.15000  ? 810 DT  P P     1 
ATOM   7807 O  OP1   . DT  C 3 9   ? -24.93400 -44.27300 -39.48500 1.000 43.42000  ? 810 DT  P OP1   1 
ATOM   7808 O  OP2   . DT  C 3 9   ? -24.93700 -41.96000 -40.64300 1.000 45.28000  ? 810 DT  P OP2   1 
ATOM   7809 O  "O5'" . DT  C 3 9   ? -24.64900 -42.25100 -38.14800 1.000 42.14000  ? 810 DT  P "O5'" 1 
ATOM   7810 C  "C5'" . DT  C 3 9   ? -23.92900 -42.79500 -37.05200 1.000 42.05000  ? 810 DT  P "C5'" 1 
ATOM   7811 C  "C4'" . DT  C 3 9   ? -23.67600 -41.73700 -35.99200 1.000 49.19000  ? 810 DT  P "C4'" 1 
ATOM   7812 O  "O4'" . DT  C 3 9   ? -22.56200 -40.89800 -36.37400 1.000 50.43000  ? 810 DT  P "O4'" 1 
ATOM   7813 C  "C3'" . DT  C 3 9   ? -24.85400 -40.80300 -35.74100 1.000 44.43000  ? 810 DT  P "C3'" 1 
ATOM   7814 O  "O3'" . DT  C 3 9   ? -25.41000 -41.09100 -34.49400 1.000 49.10000  ? 810 DT  P "O3'" 1 
ATOM   7815 C  "C2'" . DT  C 3 9   ? -24.25500 -39.39100 -35.77000 1.000 44.23000  ? 810 DT  P "C2'" 1 
ATOM   7816 C  "C1'" . DT  C 3 9   ? -22.74900 -39.62700 -35.81700 1.000 50.23000  ? 810 DT  P "C1'" 1 
ATOM   7817 N  N1    . DT  C 3 9   ? -22.02300 -38.61800 -36.65300 1.000 48.28000  ? 810 DT  P N1    1 
ATOM   7818 C  C2    . DT  C 3 9   ? -21.03100 -37.87600 -36.07500 1.000 45.67000  ? 810 DT  P C2    1 
ATOM   7819 O  O2    . DT  C 3 9   ? -20.69800 -38.01500 -34.91100 1.000 50.37000  ? 810 DT  P O2    1 
ATOM   7820 N  N3    . DT  C 3 9   ? -20.43000 -36.96900 -36.91100 1.000 44.32000  ? 810 DT  P N3    1 
ATOM   7821 C  C4    . DT  C 3 9   ? -20.73200 -36.72900 -38.24100 1.000 46.89000  ? 810 DT  P C4    1 
ATOM   7822 O  O4    . DT  C 3 9   ? -20.14100 -35.88700 -38.91300 1.000 46.16000  ? 810 DT  P O4    1 
ATOM   7823 C  C5    . DT  C 3 9   ? -21.79300 -37.53400 -38.78500 1.000 43.19000  ? 810 DT  P C5    1 
ATOM   7824 C  C7    . DT  C 3 9   ? -22.20400 -37.35800 -40.20900 1.000 33.60000  ? 810 DT  P C7    1 
ATOM   7825 C  C6    . DT  C 3 9   ? -22.38400 -38.43100 -37.97800 1.000 47.46000  ? 810 DT  P C6    1 
ATOM   7826 P  P     . DG  C 3 10  ? -26.75600 -40.36600 -34.03000 1.000 54.69000  ? 811 DG  P P     1 
ATOM   7827 O  OP1   . DG  C 3 10  ? -27.51400 -41.36800 -33.24200 1.000 54.07000  ? 811 DG  P OP1   1 
ATOM   7828 O  OP2   . DG  C 3 10  ? -27.36200 -39.72600 -35.22100 1.000 48.18000  ? 811 DG  P OP2   1 
ATOM   7829 O  "O5'" . DG  C 3 10  ? -26.24400 -39.20800 -33.06300 1.000 49.05000  ? 811 DG  P "O5'" 1 
ATOM   7830 C  "C5'" . DG  C 3 10  ? -25.53400 -39.54000 -31.88300 1.000 48.67000  ? 811 DG  P "C5'" 1 
ATOM   7831 C  "C4'" . DG  C 3 10  ? -24.84300 -38.31500 -31.32300 1.000 50.16000  ? 811 DG  P "C4'" 1 
ATOM   7832 O  "O4'" . DG  C 3 10  ? -23.94800 -37.79300 -32.32100 1.000 45.13000  ? 811 DG  P "O4'" 1 
ATOM   7833 C  "C3'" . DG  C 3 10  ? -25.78700 -37.17200 -30.94600 1.000 50.08000  ? 811 DG  P "C3'" 1 
ATOM   7834 O  "O3'" . DG  C 3 10  ? -25.69100 -36.89300 -29.56900 1.000 55.89000  ? 811 DG  P "O3'" 1 
ATOM   7835 C  "C2'" . DG  C 3 10  ? -25.31500 -35.98100 -31.77400 1.000 54.41000  ? 811 DG  P "C2'" 1 
ATOM   7836 C  "C1'" . DG  C 3 10  ? -23.93900 -36.39500 -32.26200 1.000 50.41000  ? 811 DG  P "C1'" 1 
ATOM   7837 N  N9    . DG  C 3 10  ? -23.66400 -35.90100 -33.60000 1.000 49.50000  ? 811 DG  P N9    1 
ATOM   7838 C  C8    . DG  C 3 10  ? -24.28900 -36.28900 -34.75300 1.000 47.10000  ? 811 DG  P C8    1 
ATOM   7839 N  N7    . DG  C 3 10  ? -23.84800 -35.67900 -35.81200 1.000 45.22000  ? 811 DG  P N7    1 
ATOM   7840 C  C5    . DG  C 3 10  ? -22.87300 -34.82200 -35.33000 1.000 46.87000  ? 811 DG  P C5    1 
ATOM   7841 C  C6    . DG  C 3 10  ? -22.05300 -33.90400 -36.01900 1.000 52.37000  ? 811 DG  P C6    1 
ATOM   7842 O  O6    . DG  C 3 10  ? -22.02700 -33.66200 -37.23600 1.000 54.56000  ? 811 DG  P O6    1 
ATOM   7843 N  N1    . DG  C 3 10  ? -21.19700 -33.23000 -35.15500 1.000 50.41000  ? 811 DG  P N1    1 
ATOM   7844 C  C2    . DG  C 3 10  ? -21.14400 -33.42100 -33.80000 1.000 50.47000  ? 811 DG  P C2    1 
ATOM   7845 N  N2    . DG  C 3 10  ? -20.25600 -32.67300 -33.13100 1.000 56.53000  ? 811 DG  P N2    1 
ATOM   7846 N  N3    . DG  C 3 10  ? -21.90400 -34.28700 -33.14200 1.000 52.60000  ? 811 DG  P N3    1 
ATOM   7847 C  C4    . DG  C 3 10  ? -22.74600 -34.94500 -33.96800 1.000 48.41000  ? 811 DG  P C4    1 
ATOM   7848 P  P     . DT  C 3 11  ? -26.79200 -35.96700 -28.85400 1.000 64.99000  ? 812 DT  P P     1 
ATOM   7849 O  OP1   . DT  C 3 11  ? -26.93800 -36.49800 -27.47900 1.000 67.40000  ? 812 DT  P OP1   1 
ATOM   7850 O  OP2   . DT  C 3 11  ? -27.97400 -35.84000 -29.73700 1.000 53.76000  ? 812 DT  P OP2   1 
ATOM   7851 O  "O5'" . DT  C 3 11  ? -26.09500 -34.53100 -28.79100 1.000 61.86000  ? 812 DT  P "O5'" 1 
ATOM   7852 C  "C5'" . DT  C 3 11  ? -24.86100 -34.37600 -28.11600 1.000 58.98000  ? 812 DT  P "C5'" 1 
ATOM   7853 C  "C4'" . DT  C 3 11  ? -24.26700 -33.02200 -28.41800 1.000 55.68000  ? 812 DT  P "C4'" 1 
ATOM   7854 O  "O4'" . DT  C 3 11  ? -23.87000 -32.96500 -29.80900 1.000 50.12000  ? 812 DT  P "O4'" 1 
ATOM   7855 C  "C3'" . DT  C 3 11  ? -25.22800 -31.85400 -28.20200 1.000 58.04000  ? 812 DT  P "C3'" 1 
ATOM   7856 O  "O3'" . DT  C 3 11  ? -24.69700 -30.94900 -27.25700 1.000 62.69000  ? 812 DT  P "O3'" 1 
ATOM   7857 C  "C2'" . DT  C 3 11  ? -25.35300 -31.20100 -29.57300 1.000 57.29000  ? 812 DT  P "C2'" 1 
ATOM   7858 C  "C1'" . DT  C 3 11  ? -24.10000 -31.66400 -30.27900 1.000 54.16000  ? 812 DT  P "C1'" 1 
ATOM   7859 N  N1    . DT  C 3 11  ? -24.28900 -31.72200 -31.72700 1.000 54.51000  ? 812 DT  P N1    1 
ATOM   7860 C  C2    . DT  C 3 11  ? -23.50200 -30.94400 -32.54500 1.000 57.56000  ? 812 DT  P C2    1 
ATOM   7861 O  O2    . DT  C 3 11  ? -22.61900 -30.20600 -32.12800 1.000 60.01000  ? 812 DT  P O2    1 
ATOM   7862 N  N3    . DT  C 3 11  ? -23.77800 -31.06500 -33.87800 1.000 54.25000  ? 812 DT  P N3    1 
ATOM   7863 C  C4    . DT  C 3 11  ? -24.74500 -31.85900 -34.45800 1.000 51.58000  ? 812 DT  P C4    1 
ATOM   7864 O  O4    . DT  C 3 11  ? -24.90900 -31.90000 -35.67300 1.000 49.21000  ? 812 DT  P O4    1 
ATOM   7865 C  C5    . DT  C 3 11  ? -25.54200 -32.64300 -33.52900 1.000 50.23000  ? 812 DT  P C5    1 
ATOM   7866 C  C7    . DT  C 3 11  ? -26.62200 -33.55100 -34.02300 1.000 45.34000  ? 812 DT  P C7    1 
ATOM   7867 C  C6    . DT  C 3 11  ? -25.28100 -32.52800 -32.23100 1.000 51.29000  ? 812 DT  P C6    1 
ATOM   7868 P  P     . DT  C 3 12  ? -25.58100 -29.70200 -26.76100 1.000 68.06000  ? 813 DT  P P     1 
ATOM   7869 O  OP1   . DT  C 3 12  ? -25.31100 -29.56100 -25.31200 1.000 69.28000  ? 813 DT  P OP1   1 
ATOM   7870 O  OP2   . DT  C 3 12  ? -26.98100 -29.85300 -27.24700 1.000 56.67000  ? 813 DT  P OP2   1 
ATOM   7871 O  "O5'" . DT  C 3 12  ? -24.92800 -28.47200 -27.52100 1.000 49.70000  ? 813 DT  P "O5'" 1 
ATOM   7872 C  "C5'" . DT  C 3 12  ? -23.53100 -28.42900 -27.68600 1.000 55.19000  ? 813 DT  P "C5'" 1 
ATOM   7873 C  "C4'" . DT  C 3 12  ? -23.13200 -27.20400 -28.46900 1.000 61.71000  ? 813 DT  P "C4'" 1 
ATOM   7874 O  "O4'" . DT  C 3 12  ? -23.26200 -27.48200 -29.88600 1.000 61.43000  ? 813 DT  P "O4'" 1 
ATOM   7875 C  "C3'" . DT  C 3 12  ? -23.98400 -25.96400 -28.21100 1.000 65.23000  ? 813 DT  P "C3'" 1 
ATOM   7876 O  "O3'" . DT  C 3 12  ? -23.16900 -24.80500 -28.35700 1.000 73.52000  ? 813 DT  P "O3'" 1 
ATOM   7877 C  "C2'" . DT  C 3 12  ? -25.03100 -26.05700 -29.31900 1.000 62.68000  ? 813 DT  P "C2'" 1 
ATOM   7878 C  "C1'" . DT  C 3 12  ? -24.17500 -26.57000 -30.46500 1.000 62.00000  ? 813 DT  P "C1'" 1 
ATOM   7879 N  N1    . DT  C 3 12  ? -24.93100 -27.28000 -31.54500 1.000 57.47000  ? 813 DT  P N1    1 
ATOM   7880 C  C2    . DT  C 3 12  ? -24.54400 -27.08800 -32.84400 1.000 57.41000  ? 813 DT  P C2    1 
ATOM   7881 O  O2    . DT  C 3 12  ? -23.62200 -26.35200 -33.15800 1.000 63.70000  ? 813 DT  P O2    1 
ATOM   7882 N  N3    . DT  C 3 12  ? -25.27200 -27.78600 -33.77100 1.000 56.84000  ? 813 DT  P N3    1 
ATOM   7883 C  C4    . DT  C 3 12  ? -26.33200 -28.63600 -33.53400 1.000 57.78000  ? 813 DT  P C4    1 
ATOM   7884 O  O4    . DT  C 3 12  ? -26.92400 -29.20900 -34.44300 1.000 57.94000  ? 813 DT  P O4    1 
ATOM   7885 C  C5    . DT  C 3 12  ? -26.69200 -28.79900 -32.13900 1.000 56.16000  ? 813 DT  P C5    1 
ATOM   7886 C  C7    . DT  C 3 12  ? -27.83000 -29.70000 -31.75100 1.000 55.34000  ? 813 DT  P C7    1 
ATOM   7887 C  C6    . DT  C 3 12  ? -25.98000 -28.12400 -31.22200 1.000 56.01000  ? 813 DT  P C6    1 
ATOM   7888 P  P     . DC  C 3 13  ? -23.67900 -23.37300 -27.84100 1.000 79.03000  ? 814 DC  P P     1 
ATOM   7889 O  OP1   . DC  C 3 13  ? -22.97100 -23.12400 -26.56600 1.000 82.61000  ? 814 DC  P OP1   1 
ATOM   7890 O  OP2   . DC  C 3 13  ? -25.16300 -23.33100 -27.90900 1.000 66.41000  ? 814 DC  P OP2   1 
ATOM   7891 O  "O5'" . DC  C 3 13  ? -23.08000 -22.35000 -28.91600 1.000 70.25000  ? 814 DC  P "O5'" 1 
ATOM   7892 C  "C5'" . DC  C 3 13  ? -22.56400 -22.83800 -30.15000 1.000 74.02000  ? 814 DC  P "C5'" 1 
ATOM   7893 C  "C4'" . DC  C 3 13  ? -23.26700 -22.17200 -31.31600 1.000 69.90000  ? 814 DC  P "C4'" 1 
ATOM   7894 O  "O4'" . DC  C 3 13  ? -23.98200 -23.16500 -32.11300 1.000 70.99000  ? 814 DC  P "O4'" 1 
ATOM   7895 C  "C3'" . DC  C 3 13  ? -24.32400 -21.12800 -30.92300 1.000 71.32000  ? 814 DC  P "C3'" 1 
ATOM   7896 O  "O3'" . DC  C 3 13  ? -24.26500 -20.06900 -31.82600 1.000 76.53000  ? 814 DC  P "O3'" 1 
ATOM   7897 C  "C2'" . DC  C 3 13  ? -25.62000 -21.89400 -31.11900 1.000 67.92000  ? 814 DC  P "C2'" 1 
ATOM   7898 C  "C1'" . DC  C 3 13  ? -25.25500 -22.63900 -32.38400 1.000 65.44000  ? 814 DC  P "C1'" 1 
ATOM   7899 N  N1    . DC  C 3 13  ? -26.19500 -23.72000 -32.74300 1.000 62.94000  ? 814 DC  P N1    1 
ATOM   7900 C  C2    . DC  C 3 13  ? -26.38200 -24.04500 -34.09200 1.000 61.45000  ? 814 DC  P C2    1 
ATOM   7901 O  O2    . DC  C 3 13  ? -25.71900 -23.44800 -34.96100 1.000 63.36000  ? 814 DC  P O2    1 
ATOM   7902 N  N3    . DC  C 3 13  ? -27.27400 -25.01000 -34.40900 1.000 55.63000  ? 814 DC  P N3    1 
ATOM   7903 C  C4    . DC  C 3 13  ? -27.95600 -25.63400 -33.44300 1.000 60.03000  ? 814 DC  P C4    1 
ATOM   7904 N  N4    . DC  C 3 13  ? -28.82000 -26.59400 -33.80300 1.000 61.35000  ? 814 DC  P N4    1 
ATOM   7905 C  C5    . DC  C 3 13  ? -27.78500 -25.30500 -32.06700 1.000 56.06000  ? 814 DC  P C5    1 
ATOM   7906 C  C6    . DC  C 3 13  ? -26.91300 -24.34400 -31.76700 1.000 58.05000  ? 814 DC  P C6    1 
ATOM   7907 P  P     . DG  C 3 14  ? -24.05000 -18.56600 -31.32000 1.000 77.99000  ? 815 DG  P P     1 
ATOM   7908 O  OP1   . DG  C 3 14  ? -22.60800 -18.41200 -31.00800 1.000 73.40000  ? 815 DG  P OP1   1 
ATOM   7909 O  OP2   . DG  C 3 14  ? -25.08700 -18.29000 -30.28800 1.000 69.79000  ? 815 DG  P OP2   1 
ATOM   7910 O  "O5'" . DG  C 3 14  ? -24.33000 -17.72600 -32.64500 1.000 66.75000  ? 815 DG  P "O5'" 1 
ATOM   7911 C  "C5'" . DG  C 3 14  ? -23.67200 -18.10000 -33.84100 1.000 67.70000  ? 815 DG  P "C5'" 1 
ATOM   7912 C  "C4'" . DG  C 3 14  ? -24.64900 -18.20700 -34.99500 1.000 63.34000  ? 815 DG  P "C4'" 1 
ATOM   7913 O  "O4'" . DG  C 3 14  ? -25.42800 -19.41400 -34.87800 1.000 72.14000  ? 815 DG  P "O4'" 1 
ATOM   7914 C  "C3'" . DG  C 3 14  ? -25.66300 -17.06500 -35.11200 1.000 68.58000  ? 815 DG  P "C3'" 1 
ATOM   7915 O  "O3'" . DG  C 3 14  ? -25.54100 -16.47700 -36.39100 1.000 80.17000  ? 815 DG  P "O3'" 1 
ATOM   7916 C  "C2'" . DG  C 3 14  ? -27.02500 -17.75800 -34.94100 1.000 65.92000  ? 815 DG  P "C2'" 1 
ATOM   7917 C  "C1'" . DG  C 3 14  ? -26.70000 -19.15900 -35.40800 1.000 65.85000  ? 815 DG  P "C1'" 1 
ATOM   7918 N  N9    . DG  C 3 14  ? -27.62500 -20.19200 -34.93800 1.000 61.45000  ? 815 DG  P N9    1 
ATOM   7919 C  C8    . DG  C 3 14  ? -27.95600 -20.49100 -33.63400 1.000 61.62000  ? 815 DG  P C8    1 
ATOM   7920 N  N7    . DG  C 3 14  ? -28.80600 -21.48100 -33.52500 1.000 58.25000  ? 815 DG  P N7    1 
ATOM   7921 C  C5    . DG  C 3 14  ? -29.04200 -21.87000 -34.84400 1.000 59.24000  ? 815 DG  P C5    1 
ATOM   7922 C  C6    . DG  C 3 14  ? -29.86700 -22.89600 -35.36000 1.000 58.40000  ? 815 DG  P C6    1 
ATOM   7923 O  O6    . DG  C 3 14  ? -30.57800 -23.69600 -34.73800 1.000 60.80000  ? 815 DG  P O6    1 
ATOM   7924 N  N1    . DG  C 3 14  ? -29.82200 -22.94600 -36.75100 1.000 58.56000  ? 815 DG  P N1    1 
ATOM   7925 C  C2    . DG  C 3 14  ? -29.06700 -22.12400 -37.54400 1.000 57.75000  ? 815 DG  P C2    1 
ATOM   7926 N  N2    . DG  C 3 14  ? -29.15200 -22.33900 -38.86400 1.000 60.93000  ? 815 DG  P N2    1 
ATOM   7927 N  N3    . DG  C 3 14  ? -28.27900 -21.16300 -37.07900 1.000 58.39000  ? 815 DG  P N3    1 
ATOM   7928 C  C4    . DG  C 3 14  ? -28.31900 -21.09200 -35.72300 1.000 61.10000  ? 815 DG  P C4    1 
ATOM   7929 P  P     . DG  C 3 15  ? -26.20700 -15.04900 -36.71400 1.000 84.72000  ? 816 DG  P P     1 
ATOM   7930 O  OP1   . DG  C 3 15  ? -25.19300 -14.34200 -37.53200 1.000 78.39000  ? 816 DG  P OP1   1 
ATOM   7931 O  OP2   . DG  C 3 15  ? -26.70200 -14.44600 -35.45700 1.000 76.85000  ? 816 DG  P OP2   1 
ATOM   7932 O  "O5'" . DG  C 3 15  ? -27.47700 -15.40900 -37.63200 1.000 66.11000  ? 816 DG  P "O5'" 1 
ATOM   7933 C  "C5'" . DG  C 3 15  ? -27.27700 -15.71300 -38.99900 1.000 61.39000  ? 816 DG  P "C5'" 1 
ATOM   7934 C  "C4'" . DG  C 3 15  ? -28.52600 -16.31100 -39.62200 1.000 64.95000  ? 816 DG  P "C4'" 1 
ATOM   7935 O  "O4'" . DG  C 3 15  ? -28.70800 -17.66700 -39.17100 1.000 61.75000  ? 816 DG  P "O4'" 1 
ATOM   7936 C  "C3'" . DG  C 3 15  ? -29.83300 -15.62200 -39.28400 1.000 60.22000  ? 816 DG  P "C3'" 1 
ATOM   7937 O  "O3'" . DG  C 3 15  ? -29.99700 -14.49000 -40.12500 1.000 62.22000  ? 816 DG  P "O3'" 1 
ATOM   7938 C  "C2'" . DG  C 3 15  ? -30.83800 -16.71900 -39.63000 1.000 66.91000  ? 816 DG  P "C2'" 1 
ATOM   7939 C  "C1'" . DG  C 3 15  ? -30.08900 -17.99400 -39.21100 1.000 64.37000  ? 816 DG  P "C1'" 1 
ATOM   7940 N  N9    . DG  C 3 15  ? -30.47900 -18.49600 -37.88900 1.000 68.24000  ? 816 DG  P N9    1 
ATOM   7941 C  C8    . DG  C 3 15  ? -30.05700 -18.01200 -36.66700 1.000 66.17000  ? 816 DG  P C8    1 
ATOM   7942 N  N7    . DG  C 3 15  ? -30.56000 -18.65700 -35.65000 1.000 62.30000  ? 816 DG  P N7    1 
ATOM   7943 C  C5    . DG  C 3 15  ? -31.37000 -19.63200 -36.22800 1.000 60.51000  ? 816 DG  P C5    1 
ATOM   7944 C  C6    . DG  C 3 15  ? -32.16600 -20.62800 -35.61400 1.000 58.97000  ? 816 DG  P C6    1 
ATOM   7945 O  O6    . DG  C 3 15  ? -32.31900 -20.84700 -34.39200 1.000 55.62000  ? 816 DG  P O6    1 
ATOM   7946 N  N1    . DG  C 3 15  ? -32.82000 -21.41700 -36.56600 1.000 53.16000  ? 816 DG  P N1    1 
ATOM   7947 C  C2    . DG  C 3 15  ? -32.71700 -21.25400 -37.93600 1.000 53.18000  ? 816 DG  P C2    1 
ATOM   7948 N  N2    . DG  C 3 15  ? -33.42700 -22.10100 -38.69200 1.000 51.53000  ? 816 DG  P N2    1 
ATOM   7949 N  N3    . DG  C 3 15  ? -31.97600 -20.32500 -38.51900 1.000 55.41000  ? 816 DG  P N3    1 
ATOM   7950 C  C4    . DG  C 3 15  ? -31.33200 -19.55000 -37.60800 1.000 59.74000  ? 816 DG  P C4    1 
ATOM   7951 P  P     . DG  C 3 16  ? -31.34000 -13.60300 -40.09700 1.000 78.93000  ? 817 DG  P P     1 
ATOM   7952 O  OP1   . DG  C 3 16  ? -30.96700 -12.27900 -40.65200 1.000 75.67000  ? 817 DG  P OP1   1 
ATOM   7953 O  OP2   . DG  C 3 16  ? -31.94400 -13.64600 -38.74500 1.000 70.40000  ? 817 DG  P OP2   1 
ATOM   7954 O  "O5'" . DG  C 3 16  ? -32.31700 -14.37100 -41.10600 1.000 58.65000  ? 817 DG  P "O5'" 1 
ATOM   7955 C  "C5'" . DG  C 3 16  ? -33.70100 -14.16500 -41.03300 1.000 50.71000  ? 817 DG  P "C5'" 1 
ATOM   7956 C  "C4'" . DG  C 3 16  ? -34.44300 -15.36400 -41.56500 1.000 49.47000  ? 817 DG  P "C4'" 1 
ATOM   7957 O  "O4'" . DG  C 3 16  ? -33.79400 -16.58400 -41.12300 1.000 57.46000  ? 817 DG  P "O4'" 1 
ATOM   7958 C  "C3'" . DG  C 3 16  ? -35.85100 -15.48300 -41.05400 1.000 55.33000  ? 817 DG  P "C3'" 1 
ATOM   7959 O  "O3'" . DG  C 3 16  ? -36.69300 -14.71200 -41.83900 1.000 61.43000  ? 817 DG  P "O3'" 1 
ATOM   7960 C  "C2'" . DG  C 3 16  ? -36.12200 -16.97800 -41.18700 1.000 52.09000  ? 817 DG  P "C2'" 1 
ATOM   7961 C  "C1'" . DG  C 3 16  ? -34.78500 -17.53900 -40.72900 1.000 52.04000  ? 817 DG  P "C1'" 1 
ATOM   7962 N  N9    . DG  C 3 16  ? -34.67800 -17.73100 -39.27700 1.000 50.46000  ? 817 DG  P N9    1 
ATOM   7963 C  C8    . DG  C 3 16  ? -33.92200 -16.97800 -38.40800 1.000 50.42000  ? 817 DG  P C8    1 
ATOM   7964 N  N7    . DG  C 3 16  ? -33.98300 -17.37700 -37.17600 1.000 49.82000  ? 817 DG  P N7    1 
ATOM   7965 C  C5    . DG  C 3 16  ? -34.83200 -18.47500 -37.21900 1.000 52.99000  ? 817 DG  P C5    1 
ATOM   7966 C  C6    . DG  C 3 16  ? -35.27800 -19.31700 -36.17200 1.000 49.34000  ? 817 DG  P C6    1 
ATOM   7967 O  O6    . DG  C 3 16  ? -34.98900 -19.25000 -34.96000 1.000 47.25000  ? 817 DG  P O6    1 
ATOM   7968 N  N1    . DG  C 3 16  ? -36.14700 -20.31400 -36.64400 1.000 49.14000  ? 817 DG  P N1    1 
ATOM   7969 C  C2    . DG  C 3 16  ? -36.52300 -20.47600 -37.96200 1.000 45.24000  ? 817 DG  P C2    1 
ATOM   7970 N  N2    . DG  C 3 16  ? -37.36000 -21.48900 -38.22500 1.000 36.34000  ? 817 DG  P N2    1 
ATOM   7971 N  N3    . DG  C 3 16  ? -36.10800 -19.69200 -38.94900 1.000 51.45000  ? 817 DG  P N3    1 
ATOM   7972 C  C4    . DG  C 3 16  ? -35.26900 -18.71300 -38.50700 1.000 49.66000  ? 817 DG  P C4    1 
ATOM   7973 P  P     . DC  C 3 17  ? -37.51600 -13.53500 -41.13800 1.000 57.65000  ? 818 DC  P P     1 
ATOM   7974 O  OP1   . DC  C 3 17  ? -37.96800 -12.56000 -42.17200 1.000 60.27000  ? 818 DC  P OP1   1 
ATOM   7975 O  OP2   . DC  C 3 17  ? -36.69900 -13.10800 -39.97500 1.000 52.58000  ? 818 DC  P OP2   1 
ATOM   7976 O  "O5'" . DC  C 3 17  ? -38.81000 -14.28300 -40.63800 1.000 50.43000  ? 818 DC  P "O5'" 1 
ATOM   7977 C  "C5'" . DC  C 3 17  ? -39.58900 -14.99000 -41.57400 1.000 54.67000  ? 818 DC  P "C5'" 1 
ATOM   7978 C  "C4'" . DC  C 3 17  ? -40.28400 -16.13000 -40.88700 1.000 53.03000  ? 818 DC  P "C4'" 1 
ATOM   7979 O  "O4'" . DC  C 3 17  ? -39.28500 -16.96500 -40.26100 1.000 60.44000  ? 818 DC  P "O4'" 1 
ATOM   7980 C  "C3'" . DC  C 3 17  ? -41.15900 -15.72400 -39.72200 1.000 54.11000  ? 818 DC  P "C3'" 1 
ATOM   7981 O  "O3'" . DC  C 3 17  ? -42.41200 -15.22000 -40.16700 1.000 49.04000  ? 818 DC  P "O3'" 1 
ATOM   7982 C  "C2'" . DC  C 3 17  ? -41.29100 -17.05100 -38.99100 1.000 48.13000  ? 818 DC  P "C2'" 1 
ATOM   7983 C  "C1'" . DC  C 3 17  ? -39.86100 -17.59200 -39.11700 1.000 58.00000  ? 818 DC  P "C1'" 1 
ATOM   7984 N  N1    . DC  C 3 17  ? -39.01000 -17.31200 -37.91000 1.000 48.09000  ? 818 DC  P N1    1 
ATOM   7985 C  C2    . DC  C 3 17  ? -39.13800 -18.12800 -36.78700 1.000 46.41000  ? 818 DC  P C2    1 
ATOM   7986 O  O2    . DC  C 3 17  ? -39.94100 -19.07300 -36.81500 1.000 48.45000  ? 818 DC  P O2    1 
ATOM   7987 N  N3    . DC  C 3 17  ? -38.37800 -17.86800 -35.69800 1.000 45.95000  ? 818 DC  P N3    1 
ATOM   7988 C  C4    . DC  C 3 17  ? -37.52600 -16.84600 -35.70400 1.000 43.60000  ? 818 DC  P C4    1 
ATOM   7989 N  N4    . DC  C 3 17  ? -36.80600 -16.63400 -34.60100 1.000 43.77000  ? 818 DC  P N4    1 
ATOM   7990 C  C5    . DC  C 3 17  ? -37.37200 -16.00100 -36.84400 1.000 45.05000  ? 818 DC  P C5    1 
ATOM   7991 C  C6    . DC  C 3 17  ? -38.13400 -16.26400 -37.91400 1.000 49.13000  ? 818 DC  P C6    1 
ATOM   7992 P  P     . DG  C 3 18  ? -43.21800 -14.19400 -39.22800 1.000 49.09000  ? 819 DG  P P     1 
ATOM   7993 O  OP1   . DG  C 3 18  ? -44.37500 -13.65100 -39.97500 1.000 57.01000  ? 819 DG  P OP1   1 
ATOM   7994 O  OP2   . DG  C 3 18  ? -42.24000 -13.26900 -38.61300 1.000 40.49000  ? 819 DG  P OP2   1 
ATOM   7995 O  "O5'" . DG  C 3 18  ? -43.80100 -15.13800 -38.07800 1.000 50.19000  ? 819 DG  P "O5'" 1 
ATOM   7996 C  "C5'" . DG  C 3 18  ? -44.66200 -16.20900 -38.42200 1.000 47.89000  ? 819 DG  P "C5'" 1 
ATOM   7997 C  "C4'" . DG  C 3 18  ? -45.08800 -16.96000 -37.18400 1.000 46.56000  ? 819 DG  P "C4'" 1 
ATOM   7998 O  "O4'" . DG  C 3 18  ? -43.94100 -17.63900 -36.62900 1.000 44.56000  ? 819 DG  P "O4'" 1 
ATOM   7999 C  "C3'" . DG  C 3 18  ? -45.59200 -16.07500 -36.06900 1.000 42.27000  ? 819 DG  P "C3'" 1 
ATOM   8000 O  "O3'" . DG  C 3 18  ? -46.94700 -15.88600 -36.22600 1.000 40.13000  ? 819 DG  P "O3'" 1 
ATOM   8001 C  "C2'" . DG  C 3 18  ? -45.30400 -16.92000 -34.83600 1.000 36.45000  ? 819 DG  P "C2'" 1 
ATOM   8002 C  "C1'" . DG  C 3 18  ? -43.99700 -17.59600 -35.22000 1.000 39.77000  ? 819 DG  P "C1'" 1 
ATOM   8003 N  N9    . DG  C 3 18  ? -42.79700 -16.93200 -34.72400 1.000 40.11000  ? 819 DG  P N9    1 
ATOM   8004 C  C8    . DG  C 3 18  ? -41.96000 -16.08200 -35.41900 1.000 43.57000  ? 819 DG  P C8    1 
ATOM   8005 N  N7    . DG  C 3 18  ? -40.94300 -15.66200 -34.71400 1.000 37.59000  ? 819 DG  P N7    1 
ATOM   8006 C  C5    . DG  C 3 18  ? -41.11400 -16.28000 -33.47200 1.000 41.39000  ? 819 DG  P C5    1 
ATOM   8007 C  C6    . DG  C 3 18  ? -40.31800 -16.21300 -32.29700 1.000 41.36000  ? 819 DG  P C6    1 
ATOM   8008 O  O6    . DG  C 3 18  ? -39.26900 -15.57100 -32.12500 1.000 36.80000  ? 819 DG  P O6    1 
ATOM   8009 N  N1    . DG  C 3 18  ? -40.84300 -17.00800 -31.26000 1.000 37.50000  ? 819 DG  P N1    1 
ATOM   8010 C  C2    . DG  C 3 18  ? -41.99600 -17.76400 -31.35800 1.000 39.68000  ? 819 DG  P C2    1 
ATOM   8011 N  N2    . DG  C 3 18  ? -42.36200 -18.45600 -30.26800 1.000 35.01000  ? 819 DG  P N2    1 
ATOM   8012 N  N3    . DG  C 3 18  ? -42.74500 -17.83200 -32.45200 1.000 46.81000  ? 819 DG  P N3    1 
ATOM   8013 C  C4    . DG  C 3 18  ? -42.24400 -17.06800 -33.46800 1.000 43.22000  ? 819 DG  P C4    1 
ATOM   8014 P  P     . DC  C 3 19  ? -47.60600 -14.49600 -35.80200 1.000 36.74000  ? 820 DC  P P     1 
ATOM   8015 O  OP1   . DC  C 3 19  ? -49.04400 -14.64300 -36.10500 1.000 40.54000  ? 820 DC  P OP1   1 
ATOM   8016 O  OP2   . DC  C 3 19  ? -46.73000 -13.43400 -36.34000 1.000 28.12000  ? 820 DC  P OP2   1 
ATOM   8017 O  "O5'" . DC  C 3 19  ? -47.49200 -14.45300 -34.20700 1.000 39.04000  ? 820 DC  P "O5'" 1 
ATOM   8018 C  "C5'" . DC  C 3 19  ? -48.25300 -15.34600 -33.42100 1.000 35.23000  ? 820 DC  P "C5'" 1 
ATOM   8019 C  "C4'" . DC  C 3 19  ? -47.78900 -15.31900 -31.97300 1.000 38.42000  ? 820 DC  P "C4'" 1 
ATOM   8020 O  "O4'" . DC  C 3 19  ? -46.45300 -15.86400 -31.86200 1.000 39.79000  ? 820 DC  P "O4'" 1 
ATOM   8021 C  "C3'" . DC  C 3 19  ? -47.67000 -13.94300 -31.35600 1.000 30.43000  ? 820 DC  P "C3'" 1 
ATOM   8022 O  "O3'" . DC  C 3 19  ? -48.90900 -13.53600 -30.90300 1.000 32.36000  ? 820 DC  P "O3'" 1 
ATOM   8023 C  "C2'" . DC  C 3 19  ? -46.75000 -14.22800 -30.18000 1.000 36.28000  ? 820 DC  P "C2'" 1 
ATOM   8024 C  "C1'" . DC  C 3 19  ? -45.79500 -15.24700 -30.76600 1.000 38.08000  ? 820 DC  P "C1'" 1 
ATOM   8025 N  N1    . DC  C 3 19  ? -44.52700 -14.63200 -31.21600 1.000 41.29000  ? 820 DC  P N1    1 
ATOM   8026 C  C2    . DC  C 3 19  ? -43.48100 -14.58600 -30.31800 1.000 38.64000  ? 820 DC  P C2    1 
ATOM   8027 O  O2    . DC  C 3 19  ? -43.66200 -15.06400 -29.18300 1.000 39.58000  ? 820 DC  P O2    1 
ATOM   8028 N  N3    . DC  C 3 19  ? -42.30300 -14.03100 -30.70400 1.000 36.01000  ? 820 DC  P N3    1 
ATOM   8029 C  C4    . DC  C 3 19  ? -42.17900 -13.52300 -31.92900 1.000 36.81000  ? 820 DC  P C4    1 
ATOM   8030 N  N4    . DC  C 3 19  ? -41.00700 -12.97500 -32.26000 1.000 33.10000  ? 820 DC  P N4    1 
ATOM   8031 C  C5    . DC  C 3 19  ? -43.25200 -13.55100 -32.86800 1.000 33.35000  ? 820 DC  P C5    1 
ATOM   8032 C  C6    . DC  C 3 19  ? -44.40200 -14.10400 -32.47300 1.000 37.00000  ? 820 DC  P C6    1 
ATOM   8033 P  P     . DC  C 3 20  ? -49.14500 -12.01300 -30.48200 1.000 31.83000  ? 821 DC  P P     1 
ATOM   8034 O  OP1   . DC  C 3 20  ? -50.56300 -11.89800 -30.06700 1.000 31.47000  ? 821 DC  P OP1   1 
ATOM   8035 O  OP2   . DC  C 3 20  ? -48.53700 -11.21500 -31.57000 1.000 35.85000  ? 821 DC  P OP2   1 
ATOM   8036 O  "O5'" . DC  C 3 20  ? -48.24100 -11.80300 -29.18100 1.000 33.30000  ? 821 DC  P "O5'" 1 
ATOM   8037 C  "C5'" . DC  C 3 20  ? -48.60800 -12.42700 -27.94700 1.000 34.15000  ? 821 DC  P "C5'" 1 
ATOM   8038 C  "C4'" . DC  C 3 20  ? -47.66100 -11.99700 -26.84700 1.000 34.90000  ? 821 DC  P "C4'" 1 
ATOM   8039 O  "O4'" . DC  C 3 20  ? -46.32100 -12.47200 -27.13900 1.000 31.56000  ? 821 DC  P "O4'" 1 
ATOM   8040 C  "C3'" . DC  C 3 20  ? -47.51100 -10.49700 -26.72500 1.000 30.63000  ? 821 DC  P "C3'" 1 
ATOM   8041 O  "O3'" . DC  C 3 20  ? -48.50100 -10.00500 -25.88800 1.000 30.64000  ? 821 DC  P "O3'" 1 
ATOM   8042 C  "C2'" . DC  C 3 20  ? -46.13400 -10.34400 -26.09700 1.000 30.72000  ? 821 DC  P "C2'" 1 
ATOM   8043 C  "C1'" . DC  C 3 20  ? -45.37400 -11.54600 -26.64600 1.000 30.08000  ? 821 DC  P "C1'" 1 
ATOM   8044 N  N1    . DC  C 3 20  ? -44.44300 -11.20200 -27.72500 1.000 33.33000  ? 821 DC  P N1    1 
ATOM   8045 C  C2    . DC  C 3 20  ? -43.14900 -10.83500 -27.39200 1.000 33.13000  ? 821 DC  P C2    1 
ATOM   8046 O  O2    . DC  C 3 20  ? -42.83400 -10.79200 -26.19600 1.000 30.71000  ? 821 DC  P O2    1 
ATOM   8047 N  N3    . DC  C 3 20  ? -42.27300 -10.54100 -28.38600 1.000 36.66000  ? 821 DC  P N3    1 
ATOM   8048 C  C4    . DC  C 3 20  ? -42.66800 -10.60700 -29.66100 1.000 34.75000  ? 821 DC  P C4    1 
ATOM   8049 N  N4    . DC  C 3 20  ? -41.77400 -10.30500 -30.60800 1.000 34.51000  ? 821 DC  P N4    1 
ATOM   8050 C  C5    . DC  C 3 20  ? -43.99500 -10.98200 -30.01800 1.000 31.36000  ? 821 DC  P C5    1 
ATOM   8051 C  C6    . DC  C 3 20  ? -44.84300 -11.26400 -29.02600 1.000 32.41000  ? 821 DC  P C6    1 
HETATM 8052 N  N1    . DOC C 3 21  ? -43.89700 -6.83500  -26.57000 1.000 31.12000  ? 822 DOC P N1    1 
HETATM 8053 C  C2    . DOC C 3 21  ? -42.56200 -6.73900  -26.90800 1.000 36.43000  ? 822 DOC P C2    1 
HETATM 8054 N  N3    . DOC C 3 21  ? -42.17200 -6.95000  -28.18100 1.000 35.94000  ? 822 DOC P N3    1 
HETATM 8055 C  C4    . DOC C 3 21  ? -43.12900 -7.26800  -29.19400 1.000 33.63000  ? 822 DOC P C4    1 
HETATM 8056 C  C5    . DOC C 3 21  ? -44.41800 -7.36700  -28.87300 1.000 30.03000  ? 822 DOC P C5    1 
HETATM 8057 C  C6    . DOC C 3 21  ? -44.81700 -7.13700  -27.55200 1.000 31.67000  ? 822 DOC P C6    1 
HETATM 8058 O  O2    . DOC C 3 21  ? -41.71300 -6.48300  -26.06300 1.000 39.33000  ? 822 DOC P O2    1 
HETATM 8059 N  N4    . DOC C 3 21  ? -42.69000 -7.46200  -30.53700 1.000 31.59000  ? 822 DOC P N4    1 
HETATM 8060 C  "C1'" . DOC C 3 21  ? -44.33900 -6.49600  -25.23300 1.000 35.87000  ? 822 DOC P "C1'" 1 
HETATM 8061 C  "C2'" . DOC C 3 21  ? -44.91000 -5.24000  -24.57400 1.000 41.14000  ? 822 DOC P "C2'" 1 
HETATM 8062 C  "C3'" . DOC C 3 21  ? -46.33400 -5.56700  -24.38100 1.000 34.99000  ? 822 DOC P "C3'" 1 
HETATM 8063 C  "C4'" . DOC C 3 21  ? -46.32100 -7.02500  -24.04700 1.000 27.15000  ? 822 DOC P "C4'" 1 
HETATM 8064 O  "O4'" . DOC C 3 21  ? -45.03500 -7.59000  -24.49600 1.000 30.53000  ? 822 DOC P "O4'" 1 
HETATM 8065 C  "C5'" . DOC C 3 21  ? -47.57400 -7.75200  -24.34500 1.000 29.25000  ? 822 DOC P "C5'" 1 
HETATM 8066 O  "O5'" . DOC C 3 21  ? -47.79600 -7.80900  -25.70100 1.000 32.82000  ? 822 DOC P "O5'" 1 
HETATM 8067 P  P     . DOC C 3 21  ? -49.04200 -8.55700  -26.26400 1.000 28.79000  ? 822 DOC P P     1 
HETATM 8068 O  OP1   . DOC C 3 21  ? -50.23300 -8.41100  -25.26400 1.000 32.33000  ? 822 DOC P OP1   1 
HETATM 8069 O  OP2   . DOC C 3 21  ? -49.37200 -8.04500  -27.64300 1.000 42.81000  ? 822 DOC P OP2   1 
ATOM   8070 P  P     . DG  D 4 4   ? -39.62600 -3.93800  -41.01300 1.000 159.49000 ? 704 DG  T P     1 
ATOM   8071 O  OP1   . DG  D 4 4   ? -39.95100 -5.37200  -41.11700 1.000 112.16000 ? 704 DG  T OP1   1 
ATOM   8072 O  OP2   . DG  D 4 4   ? -40.40400 -3.08100  -40.09900 1.000 139.08000 ? 704 DG  T OP2   1 
ATOM   8073 O  "O5'" . DG  D 4 4   ? -38.05800 -3.73200  -40.76400 1.000 119.46000 ? 704 DG  T "O5'" 1 
ATOM   8074 C  "C5'" . DG  D 4 4   ? -37.50700 -2.39900  -40.75800 1.000 108.71000 ? 704 DG  T "C5'" 1 
ATOM   8075 C  "C4'" . DG  D 4 4   ? -36.00300 -2.39600  -41.08600 1.000 105.85000 ? 704 DG  T "C4'" 1 
ATOM   8076 O  "O4'" . DG  D 4 4   ? -35.70800 -1.39500  -42.09100 1.000 111.72000 ? 704 DG  T "O4'" 1 
ATOM   8077 C  "C3'" . DG  D 4 4   ? -35.08100 -2.12100  -39.90900 1.000 93.35000  ? 704 DG  T "C3'" 1 
ATOM   8078 O  "O3'" . DG  D 4 4   ? -34.18700 -3.18600  -39.75400 1.000 90.34000  ? 704 DG  T "O3'" 1 
ATOM   8079 C  "C2'" . DG  D 4 4   ? -34.35500 -0.80200  -40.22000 1.000 92.08000  ? 704 DG  T "C2'" 1 
ATOM   8080 C  "C1'" . DG  D 4 4   ? -34.70900 -0.48200  -41.66400 1.000 105.90000 ? 704 DG  T "C1'" 1 
ATOM   8081 N  N9    . DG  D 4 4   ? -35.22900 0.87700   -41.83700 1.000 100.30000 ? 704 DG  T N9    1 
ATOM   8082 C  C8    . DG  D 4 4   ? -34.54700 1.99100   -42.28400 1.000 96.91000  ? 704 DG  T C8    1 
ATOM   8083 N  N7    . DG  D 4 4   ? -35.28800 3.06600   -42.33600 1.000 92.90000  ? 704 DG  T N7    1 
ATOM   8084 C  C5    . DG  D 4 4   ? -36.54100 2.63400   -41.89800 1.000 93.83000  ? 704 DG  T C5    1 
ATOM   8085 C  C6    . DG  D 4 4   ? -37.76000 3.34600   -41.74000 1.000 96.70000  ? 704 DG  T C6    1 
ATOM   8086 O  O6    . DG  D 4 4   ? -37.98500 4.54300   -41.96100 1.000 95.28000  ? 704 DG  T O6    1 
ATOM   8087 N  N1    . DG  D 4 4   ? -38.78900 2.51600   -41.26900 1.000 98.71000  ? 704 DG  T N1    1 
ATOM   8088 C  C2    . DG  D 4 4   ? -38.65500 1.16800   -40.99800 1.000 98.14000  ? 704 DG  T C2    1 
ATOM   8089 N  N2    . DG  D 4 4   ? -39.74700 0.52300   -40.54700 1.000 92.75000  ? 704 DG  T N2    1 
ATOM   8090 N  N3    . DG  D 4 4   ? -37.52700 0.50400   -41.14300 1.000 95.27000  ? 704 DG  T N3    1 
ATOM   8091 C  C4    . DG  D 4 4   ? -36.51500 1.29300   -41.58800 1.000 94.76000  ? 704 DG  T C4    1 
ATOM   8092 P  P     . DG  D 4 5   ? -34.43200 -4.20400  -38.55500 1.000 68.44000  ? 705 DG  T P     1 
ATOM   8093 O  OP1   . DG  D 4 5   ? -33.36600 -5.22000  -38.59300 1.000 59.18000  ? 705 DG  T OP1   1 
ATOM   8094 O  OP2   . DG  D 4 5   ? -35.86100 -4.59500  -38.65000 1.000 67.22000  ? 705 DG  T OP2   1 
ATOM   8095 O  "O5'" . DG  D 4 5   ? -34.24000 -3.27600  -37.27300 1.000 60.05000  ? 705 DG  T "O5'" 1 
ATOM   8096 C  "C5'" . DG  D 4 5   ? -32.98000 -2.69500  -37.00300 1.000 54.08000  ? 705 DG  T "C5'" 1 
ATOM   8097 C  "C4'" . DG  D 4 5   ? -32.88300 -2.26600  -35.55300 1.000 53.28000  ? 705 DG  T "C4'" 1 
ATOM   8098 O  "O4'" . DG  D 4 5   ? -33.91000 -1.29500  -35.26900 1.000 54.55000  ? 705 DG  T "O4'" 1 
ATOM   8099 C  "C3'" . DG  D 4 5   ? -33.11600 -3.35200  -34.52800 1.000 46.89000  ? 705 DG  T "C3'" 1 
ATOM   8100 O  "O3'" . DG  D 4 5   ? -31.95200 -4.08700  -34.31000 1.000 49.93000  ? 705 DG  T "O3'" 1 
ATOM   8101 C  "C2'" . DG  D 4 5   ? -33.46700 -2.51200  -33.32300 1.000 49.94000  ? 705 DG  T "C2'" 1 
ATOM   8102 C  "C1'" . DG  D 4 5   ? -34.40100 -1.50700  -33.96300 1.000 47.19000  ? 705 DG  T "C1'" 1 
ATOM   8103 N  N9    . DG  D 4 5   ? -35.77300 -1.99800  -34.02900 1.000 47.04000  ? 705 DG  T N9    1 
ATOM   8104 C  C8    . DG  D 4 5   ? -36.48700 -2.35600  -35.14500 1.000 48.44000  ? 705 DG  T C8    1 
ATOM   8105 N  N7    . DG  D 4 5   ? -37.69100 -2.78200  -34.87300 1.000 50.50000  ? 705 DG  T N7    1 
ATOM   8106 C  C5    . DG  D 4 5   ? -37.77800 -2.70600  -33.48300 1.000 51.85000  ? 705 DG  T C5    1 
ATOM   8107 C  C6    . DG  D 4 5   ? -38.84800 -3.03400  -32.59200 1.000 43.99000  ? 705 DG  T C6    1 
ATOM   8108 O  O6    . DG  D 4 5   ? -39.98300 -3.47100  -32.85500 1.000 39.29000  ? 705 DG  T O6    1 
ATOM   8109 N  N1    . DG  D 4 5   ? -38.49500 -2.81300  -31.26600 1.000 40.66000  ? 705 DG  T N1    1 
ATOM   8110 C  C2    . DG  D 4 5   ? -37.28500 -2.33900  -30.84000 1.000 41.64000  ? 705 DG  T C2    1 
ATOM   8111 N  N2    . DG  D 4 5   ? -37.14000 -2.19000  -29.52000 1.000 38.97000  ? 705 DG  T N2    1 
ATOM   8112 N  N3    . DG  D 4 5   ? -36.28400 -2.02900  -31.64800 1.000 47.80000  ? 705 DG  T N3    1 
ATOM   8113 C  C4    . DG  D 4 5   ? -36.60100 -2.23500  -32.95400 1.000 50.42000  ? 705 DG  T C4    1 
ATOM   8114 P  P     . DG  D 4 6   ? -32.06200 -5.57000  -33.69100 1.000 45.45000  ? 706 DG  T P     1 
ATOM   8115 O  OP1   . DG  D 4 6   ? -30.70300 -6.16800  -33.64500 1.000 39.30000  ? 706 DG  T OP1   1 
ATOM   8116 O  OP2   . DG  D 4 6   ? -33.12500 -6.27400  -34.45300 1.000 58.60000  ? 706 DG  T OP2   1 
ATOM   8117 O  "O5'" . DG  D 4 6   ? -32.61300 -5.34100  -32.19300 1.000 44.01000  ? 706 DG  T "O5'" 1 
ATOM   8118 C  "C5'" . DG  D 4 6   ? -31.83200 -4.62000  -31.25300 1.000 42.42000  ? 706 DG  T "C5'" 1 
ATOM   8119 C  "C4'" . DG  D 4 6   ? -32.47800 -4.62700  -29.87800 1.000 40.71000  ? 706 DG  T "C4'" 1 
ATOM   8120 O  "O4'" . DG  D 4 6   ? -33.78900 -4.04500  -29.95400 1.000 39.55000  ? 706 DG  T "O4'" 1 
ATOM   8121 C  "C3'" . DG  D 4 6   ? -32.71800 -6.00100  -29.29700 1.000 36.67000  ? 706 DG  T "C3'" 1 
ATOM   8122 O  "O3'" . DG  D 4 6   ? -31.59900 -6.42800  -28.66500 1.000 34.69000  ? 706 DG  T "O3'" 1 
ATOM   8123 C  "C2'" . DG  D 4 6   ? -33.82500 -5.74000  -28.29800 1.000 35.94000  ? 706 DG  T "C2'" 1 
ATOM   8124 C  "C1'" . DG  D 4 6   ? -34.65000 -4.71000  -29.04000 1.000 38.42000  ? 706 DG  T "C1'" 1 
ATOM   8125 N  N9    . DG  D 4 6   ? -35.76100 -5.26900  -29.78500 1.000 37.33000  ? 706 DG  T N9    1 
ATOM   8126 C  C8    . DG  D 4 6   ? -35.80500 -5.54100  -31.13200 1.000 37.37000  ? 706 DG  T C8    1 
ATOM   8127 N  N7    . DG  D 4 6   ? -36.96700 -5.99600  -31.53100 1.000 38.71000  ? 706 DG  T N7    1 
ATOM   8128 C  C5    . DG  D 4 6   ? -37.73800 -6.00900  -30.37400 1.000 37.92000  ? 706 DG  T C5    1 
ATOM   8129 C  C6    . DG  D 4 6   ? -39.06800 -6.40200  -30.18300 1.000 38.19000  ? 706 DG  T C6    1 
ATOM   8130 O  O6    . DG  D 4 6   ? -39.86900 -6.84000  -31.02500 1.000 44.44000  ? 706 DG  T O6    1 
ATOM   8131 N  N1    . DG  D 4 6   ? -39.45700 -6.26100  -28.85700 1.000 34.25000  ? 706 DG  T N1    1 
ATOM   8132 C  C2    . DG  D 4 6   ? -38.66300 -5.80700  -27.84000 1.000 32.85000  ? 706 DG  T C2    1 
ATOM   8133 N  N2    . DG  D 4 6   ? -39.22700 -5.75700  -26.62600 1.000 33.11000  ? 706 DG  T N2    1 
ATOM   8134 N  N3    . DG  D 4 6   ? -37.41600 -5.42300  -28.00000 1.000 36.18000  ? 706 DG  T N3    1 
ATOM   8135 C  C4    . DG  D 4 6   ? -37.01400 -5.56100  -29.29300 1.000 39.61000  ? 706 DG  T C4    1 
ATOM   8136 P  P     . DG  D 4 7   ? -31.20400 -7.95900  -28.78100 1.000 33.75000  ? 707 DG  T P     1 
ATOM   8137 O  OP1   . DG  D 4 7   ? -29.73600 -8.06600  -28.55400 1.000 37.79000  ? 707 DG  T OP1   1 
ATOM   8138 O  OP2   . DG  D 4 7   ? -31.84000 -8.39900  -30.04300 1.000 38.40000  ? 707 DG  T OP2   1 
ATOM   8139 O  "O5'" . DG  D 4 7   ? -32.02500 -8.66000  -27.60600 1.000 37.26000  ? 707 DG  T "O5'" 1 
ATOM   8140 C  "C5'" . DG  D 4 7   ? -31.65300 -8.47600  -26.24300 1.000 30.24000  ? 707 DG  T "C5'" 1 
ATOM   8141 C  "C4'" . DG  D 4 7   ? -32.78300 -8.92600  -25.35500 1.000 33.81000  ? 707 DG  T "C4'" 1 
ATOM   8142 O  "O4'" . DG  D 4 7   ? -33.96200 -8.15400  -25.69300 1.000 35.52000  ? 707 DG  T "O4'" 1 
ATOM   8143 C  "C3'" . DG  D 4 7   ? -33.24600 -10.34300 -25.59300 1.000 36.46000  ? 707 DG  T "C3'" 1 
ATOM   8144 O  "O3'" . DG  D 4 7   ? -32.39300 -11.26700 -24.97700 1.000 28.29000  ? 707 DG  T "O3'" 1 
ATOM   8145 C  "C2'" . DG  D 4 7   ? -34.62600 -10.29600 -24.95600 1.000 30.89000  ? 707 DG  T "C2'" 1 
ATOM   8146 C  "C1'" . DG  D 4 7   ? -35.12100 -8.94200  -25.47500 1.000 31.30000  ? 707 DG  T "C1'" 1 
ATOM   8147 N  N9    . DG  D 4 7   ? -35.88000 -9.03800  -26.73100 1.000 33.33000  ? 707 DG  T N9    1 
ATOM   8148 C  C8    . DG  D 4 7   ? -35.38700 -8.96800  -28.01700 1.000 34.32000  ? 707 DG  T C8    1 
ATOM   8149 N  N7    . DG  D 4 7   ? -36.31500 -9.10200  -28.94000 1.000 33.58000  ? 707 DG  T N7    1 
ATOM   8150 C  C5    . DG  D 4 7   ? -37.49500 -9.27500  -28.22100 1.000 31.79000  ? 707 DG  T C5    1 
ATOM   8151 C  C6    . DG  D 4 7   ? -38.82800 -9.47700  -28.67300 1.000 35.69000  ? 707 DG  T C6    1 
ATOM   8152 O  O6    . DG  D 4 7   ? -39.24800 -9.54200  -29.83600 1.000 36.93000  ? 707 DG  T O6    1 
ATOM   8153 N  N1    . DG  D 4 7   ? -39.72200 -9.60900  -27.60700 1.000 33.80000  ? 707 DG  T N1    1 
ATOM   8154 C  C2    . DG  D 4 7   ? -39.37500 -9.54400  -26.28200 1.000 29.03000  ? 707 DG  T C2    1 
ATOM   8155 N  N2    . DG  D 4 7   ? -40.36500 -9.69300  -25.41500 1.000 31.80000  ? 707 DG  T N2    1 
ATOM   8156 N  N3    . DG  D 4 7   ? -38.14100 -9.36600  -25.83800 1.000 30.46000  ? 707 DG  T N3    1 
ATOM   8157 C  C4    . DG  D 4 7   ? -37.24900 -9.23900  -26.86200 1.000 35.00000  ? 707 DG  T C4    1 
ATOM   8158 P  P     . DG  D 4 8   ? -32.42900 -12.81600 -25.41700 1.000 33.29000  ? 708 DG  T P     1 
ATOM   8159 O  OP1   . DG  D 4 8   ? -31.34800 -13.49600 -24.66000 1.000 29.22000  ? 708 DG  T OP1   1 
ATOM   8160 O  OP2   . DG  D 4 8   ? -32.39900 -12.93100 -26.89400 1.000 37.26000  ? 708 DG  T OP2   1 
ATOM   8161 O  "O5'" . DG  D 4 8   ? -33.89500 -13.30300 -24.95000 1.000 30.99000  ? 708 DG  T "O5'" 1 
ATOM   8162 C  "C5'" . DG  D 4 8   ? -34.20400 -13.37600 -23.55500 1.000 28.08000  ? 708 DG  T "C5'" 1 
ATOM   8163 C  "C4'" . DG  D 4 8   ? -35.63200 -13.82900 -23.32300 1.000 29.42000  ? 708 DG  T "C4'" 1 
ATOM   8164 O  "O4'" . DG  D 4 8   ? -36.54800 -12.85200 -23.86200 1.000 34.91000  ? 708 DG  T "O4'" 1 
ATOM   8165 C  "C3'" . DG  D 4 8   ? -36.02000 -15.13100 -23.99700 1.000 29.31000  ? 708 DG  T "C3'" 1 
ATOM   8166 O  "O3'" . DG  D 4 8   ? -35.62600 -16.19300 -23.19700 1.000 34.19000  ? 708 DG  T "O3'" 1 
ATOM   8167 C  "C2'" . DG  D 4 8   ? -37.53400 -14.99200 -24.02600 1.000 30.76000  ? 708 DG  T "C2'" 1 
ATOM   8168 C  "C1'" . DG  D 4 8   ? -37.68100 -13.51200 -24.39900 1.000 31.89000  ? 708 DG  T "C1'" 1 
ATOM   8169 N  N9    . DG  D 4 8   ? -37.67000 -13.29600 -25.83200 1.000 31.25000  ? 708 DG  T N9    1 
ATOM   8170 C  C8    . DG  D 4 8   ? -36.56300 -13.05300 -26.61300 1.000 32.37000  ? 708 DG  T C8    1 
ATOM   8171 N  N7    . DG  D 4 8   ? -36.84200 -12.93200 -27.87800 1.000 32.62000  ? 708 DG  T N7    1 
ATOM   8172 C  C5    . DG  D 4 8   ? -38.21400 -13.12000 -27.94300 1.000 32.72000  ? 708 DG  T C5    1 
ATOM   8173 C  C6    . DG  D 4 8   ? -39.06300 -13.10100 -29.05600 1.000 33.31000  ? 708 DG  T C6    1 
ATOM   8174 O  O6    . DG  D 4 8   ? -38.75400 -12.88900 -30.23100 1.000 38.85000  ? 708 DG  T O6    1 
ATOM   8175 N  N1    . DG  D 4 8   ? -40.39300 -13.33600 -28.70400 1.000 30.46000  ? 708 DG  T N1    1 
ATOM   8176 C  C2    . DG  D 4 8   ? -40.83600 -13.55600 -27.42500 1.000 28.47000  ? 708 DG  T C2    1 
ATOM   8177 N  N2    . DG  D 4 8   ? -42.15100 -13.74200 -27.28500 1.000 27.99000  ? 708 DG  T N2    1 
ATOM   8178 N  N3    . DG  D 4 8   ? -40.04300 -13.57900 -26.35500 1.000 27.13000  ? 708 DG  T N3    1 
ATOM   8179 C  C4    . DG  D 4 8   ? -38.74500 -13.34500 -26.69300 1.000 32.32000  ? 708 DG  T C4    1 
ATOM   8180 P  P     . DC  D 4 9   ? -34.85100 -17.45400 -23.81500 1.000 32.38000  ? 709 DC  T P     1 
ATOM   8181 O  OP1   . DC  D 4 9   ? -34.12900 -18.03100 -22.65700 1.000 33.24000  ? 709 DC  T OP1   1 
ATOM   8182 O  OP2   . DC  D 4 9   ? -34.16000 -17.12600 -25.09100 1.000 33.78000  ? 709 DC  T OP2   1 
ATOM   8183 O  "O5'" . DC  D 4 9   ? -36.02700 -18.43400 -24.23200 1.000 34.62000  ? 709 DC  T "O5'" 1 
ATOM   8184 C  "C5'" . DC  D 4 9   ? -36.88300 -18.93900 -23.25800 1.000 32.36000  ? 709 DC  T "C5'" 1 
ATOM   8185 C  "C4'" . DC  D 4 9   ? -38.19500 -19.29400 -23.88800 1.000 33.02000  ? 709 DC  T "C4'" 1 
ATOM   8186 O  "O4'" . DC  D 4 9   ? -38.74300 -18.11200 -24.51400 1.000 34.73000  ? 709 DC  T "O4'" 1 
ATOM   8187 C  "C3'" . DC  D 4 9   ? -38.08800 -20.27400 -25.02300 1.000 33.13000  ? 709 DC  T "C3'" 1 
ATOM   8188 O  "O3'" . DC  D 4 9   ? -38.01100 -21.56100 -24.51400 1.000 38.20000  ? 709 DC  T "O3'" 1 
ATOM   8189 C  "C2'" . DC  D 4 9   ? -39.41000 -20.01300 -25.75300 1.000 33.07000  ? 709 DC  T "C2'" 1 
ATOM   8190 C  "C1'" . DC  D 4 9   ? -39.53000 -18.48800 -25.62900 1.000 29.19000  ? 709 DC  T "C1'" 1 
ATOM   8191 N  N1    . DC  D 4 9   ? -38.99800 -17.78000 -26.77800 1.000 33.46000  ? 709 DC  T N1    1 
ATOM   8192 C  C2    . DC  D 4 9   ? -39.81300 -17.55300 -27.89200 1.000 34.57000  ? 709 DC  T C2    1 
ATOM   8193 O  O2    . DC  D 4 9   ? -40.97400 -17.96600 -27.87500 1.000 40.07000  ? 709 DC  T O2    1 
ATOM   8194 N  N3    . DC  D 4 9   ? -39.29400 -16.89100 -28.96100 1.000 33.12000  ? 709 DC  T N3    1 
ATOM   8195 C  C4    . DC  D 4 9   ? -38.01600 -16.45600 -28.92000 1.000 34.07000  ? 709 DC  T C4    1 
ATOM   8196 N  N4    . DC  D 4 9   ? -37.53900 -15.81200 -29.97800 1.000 32.53000  ? 709 DC  T N4    1 
ATOM   8197 C  C5    . DC  D 4 9   ? -37.17400 -16.67600 -27.79300 1.000 31.17000  ? 709 DC  T C5    1 
ATOM   8198 C  C6    . DC  D 4 9   ? -37.70100 -17.33300 -26.75200 1.000 35.47000  ? 709 DC  T C6    1 
ATOM   8199 P  P     . DG  D 4 10  ? -37.54600 -22.77900 -25.44900 1.000 38.11000  ? 710 DG  T P     1 
ATOM   8200 O  OP1   . DG  D 4 10  ? -37.78800 -24.03400 -24.69700 1.000 31.66000  ? 710 DG  T OP1   1 
ATOM   8201 O  OP2   . DG  D 4 10  ? -36.20200 -22.45500 -25.96200 1.000 28.99000  ? 710 DG  T OP2   1 
ATOM   8202 O  "O5'" . DG  D 4 10  ? -38.59700 -22.76400 -26.63700 1.000 35.43000  ? 710 DG  T "O5'" 1 
ATOM   8203 C  "C5'" . DG  D 4 10  ? -39.86000 -23.32900 -26.43800 1.000 32.41000  ? 710 DG  T "C5'" 1 
ATOM   8204 C  "C4'" . DG  D 4 10  ? -40.66400 -23.26200 -27.70800 1.000 30.36000  ? 710 DG  T "C4'" 1 
ATOM   8205 O  "O4'" . DG  D 4 10  ? -40.73600 -21.90400 -28.13400 1.000 32.90000  ? 710 DG  T "O4'" 1 
ATOM   8206 C  "C3'" . DG  D 4 10  ? -40.04500 -23.99200 -28.87100 1.000 31.37000  ? 710 DG  T "C3'" 1 
ATOM   8207 O  "O3'" . DG  D 4 10  ? -40.46000 -25.31800 -28.82500 1.000 39.63000  ? 710 DG  T "O3'" 1 
ATOM   8208 C  "C2'" . DG  D 4 10  ? -40.66400 -23.27500 -30.05300 1.000 36.20000  ? 710 DG  T "C2'" 1 
ATOM   8209 C  "C1'" . DG  D 4 10  ? -40.77800 -21.84900 -29.54300 1.000 36.22000  ? 710 DG  T "C1'" 1 
ATOM   8210 N  N9    . DG  D 4 10  ? -39.69600 -20.99500 -30.00200 1.000 37.59000  ? 710 DG  T N9    1 
ATOM   8211 C  C8    . DG  D 4 10  ? -38.60400 -20.58000 -29.28400 1.000 35.12000  ? 710 DG  T C8    1 
ATOM   8212 N  N7    . DG  D 4 10  ? -37.79800 -19.81300 -29.96800 1.000 36.85000  ? 710 DG  T N7    1 
ATOM   8213 C  C5    . DG  D 4 10  ? -38.39900 -19.72000 -31.21800 1.000 34.68000  ? 710 DG  T C5    1 
ATOM   8214 C  C6    . DG  D 4 10  ? -37.98500 -19.03200 -32.37800 1.000 38.70000  ? 710 DG  T C6    1 
ATOM   8215 O  O6    . DG  D 4 10  ? -36.96900 -18.32900 -32.54000 1.000 38.59000  ? 710 DG  T O6    1 
ATOM   8216 N  N1    . DG  D 4 10  ? -38.88200 -19.21100 -33.42700 1.000 42.06000  ? 710 DG  T N1    1 
ATOM   8217 C  C2    . DG  D 4 10  ? -40.02900 -19.96100 -33.36700 1.000 39.94000  ? 710 DG  T C2    1 
ATOM   8218 N  N2    . DG  D 4 10  ? -40.76900 -20.01100 -34.48600 1.000 41.34000  ? 710 DG  T N2    1 
ATOM   8219 N  N3    . DG  D 4 10  ? -40.42800 -20.61000 -32.28400 1.000 42.40000  ? 710 DG  T N3    1 
ATOM   8220 C  C4    . DG  D 4 10  ? -39.56700 -20.44100 -31.25200 1.000 38.38000  ? 710 DG  T C4    1 
ATOM   8221 P  P     . DC  D 4 11  ? -39.59800 -26.47100 -29.52100 1.000 43.89000  ? 711 DC  T P     1 
ATOM   8222 O  OP1   . DC  D 4 11  ? -40.24100 -27.75300 -29.13200 1.000 46.61000  ? 711 DC  T OP1   1 
ATOM   8223 O  OP2   . DC  D 4 11  ? -38.16300 -26.20800 -29.27100 1.000 32.51000  ? 711 DC  T OP2   1 
ATOM   8224 O  "O5'" . DC  D 4 11  ? -39.85200 -26.23900 -31.07500 1.000 42.18000  ? 711 DC  T "O5'" 1 
ATOM   8225 C  "C5'" . DC  D 4 11  ? -41.16300 -26.29300 -31.59300 1.000 39.03000  ? 711 DC  T "C5'" 1 
ATOM   8226 C  "C4'" . DC  D 4 11  ? -41.11200 -25.96100 -33.05600 1.000 44.93000  ? 711 DC  T "C4'" 1 
ATOM   8227 O  "O4'" . DC  D 4 11  ? -40.71400 -24.58400 -33.20800 1.000 46.83000  ? 711 DC  T "O4'" 1 
ATOM   8228 C  "C3'" . DC  D 4 11  ? -40.08200 -26.77400 -33.79800 1.000 47.96000  ? 711 DC  T "C3'" 1 
ATOM   8229 O  "O3'" . DC  D 4 11  ? -40.74000 -27.90600 -34.35100 1.000 62.12000  ? 711 DC  T "O3'" 1 
ATOM   8230 C  "C2'" . DC  D 4 11  ? -39.54800 -25.82100 -34.87300 1.000 44.59000  ? 711 DC  T "C2'" 1 
ATOM   8231 C  "C1'" . DC  D 4 11  ? -39.88600 -24.42600 -34.33700 1.000 44.84000  ? 711 DC  T "C1'" 1 
ATOM   8232 N  N1    . DC  D 4 11  ? -38.70700 -23.63500 -33.91400 1.000 39.88000  ? 711 DC  T N1    1 
ATOM   8233 C  C2    . DC  D 4 11  ? -38.17000 -22.66600 -34.76500 1.000 42.98000  ? 711 DC  T C2    1 
ATOM   8234 O  O2    . DC  D 4 11  ? -38.67700 -22.48700 -35.87900 1.000 48.08000  ? 711 DC  T O2    1 
ATOM   8235 N  N3    . DC  D 4 11  ? -37.10000 -21.94900 -34.34700 1.000 45.08000  ? 711 DC  T N3    1 
ATOM   8236 C  C4    . DC  D 4 11  ? -36.58200 -22.16400 -33.14600 1.000 43.03000  ? 711 DC  T C4    1 
ATOM   8237 N  N4    . DC  D 4 11  ? -35.52500 -21.43300 -32.78200 1.000 41.77000  ? 711 DC  T N4    1 
ATOM   8238 C  C5    . DC  D 4 11  ? -37.11800 -23.14200 -32.26500 1.000 41.22000  ? 711 DC  T C5    1 
ATOM   8239 C  C6    . DC  D 4 11  ? -38.17200 -23.84600 -32.68700 1.000 40.86000  ? 711 DC  T C6    1 
ATOM   8240 P  P     . DC  D 4 12  ? -39.96800 -28.93200 -35.31400 1.000 61.59000  ? 712 DC  T P     1 
ATOM   8241 O  OP1   . DC  D 4 12  ? -40.82500 -30.13900 -35.33200 1.000 51.49000  ? 712 DC  T OP1   1 
ATOM   8242 O  OP2   . DC  D 4 12  ? -38.52800 -29.01700 -34.93200 1.000 47.16000  ? 712 DC  T OP2   1 
ATOM   8243 O  "O5'" . DC  D 4 12  ? -40.07300 -28.21000 -36.73100 1.000 59.71000  ? 712 DC  T "O5'" 1 
ATOM   8244 C  "C5'" . DC  D 4 12  ? -39.46700 -28.77900 -37.84000 1.000 58.46000  ? 712 DC  T "C5'" 1 
ATOM   8245 C  "C4'" . DC  D 4 12  ? -38.54600 -27.80100 -38.53900 1.000 52.93000  ? 712 DC  T "C4'" 1 
ATOM   8246 O  "O4'" . DC  D 4 12  ? -38.17800 -26.71100 -37.68300 1.000 59.06000  ? 712 DC  T "O4'" 1 
ATOM   8247 C  "C3'" . DC  D 4 12  ? -37.22400 -28.40100 -38.91700 1.000 58.96000  ? 712 DC  T "C3'" 1 
ATOM   8248 O  "O3'" . DC  D 4 12  ? -37.37900 -29.06900 -40.11500 1.000 55.97000  ? 712 DC  T "O3'" 1 
ATOM   8249 C  "C2'" . DC  D 4 12  ? -36.31100 -27.17300 -39.06000 1.000 55.78000  ? 712 DC  T "C2'" 1 
ATOM   8250 C  "C1'" . DC  D 4 12  ? -37.02400 -26.10300 -38.24400 1.000 51.42000  ? 712 DC  T "C1'" 1 
ATOM   8251 N  N1    . DC  D 4 12  ? -36.20000 -25.54100 -37.16500 1.000 49.96000  ? 712 DC  T N1    1 
ATOM   8252 C  C2    . DC  D 4 12  ? -35.41700 -24.41100 -37.41000 1.000 50.17000  ? 712 DC  T C2    1 
ATOM   8253 O  O2    . DC  D 4 12  ? -35.42100 -23.90800 -38.53500 1.000 54.92000  ? 712 DC  T O2    1 
ATOM   8254 N  N3    . DC  D 4 12  ? -34.67800 -23.89600 -36.41000 1.000 48.42000  ? 712 DC  T N3    1 
ATOM   8255 C  C4    . DC  D 4 12  ? -34.70600 -24.45600 -35.21000 1.000 49.01000  ? 712 DC  T C4    1 
ATOM   8256 N  N4    . DC  D 4 12  ? -33.96300 -23.90400 -34.24300 1.000 48.19000  ? 712 DC  T N4    1 
ATOM   8257 C  C5    . DC  D 4 12  ? -35.49400 -25.60800 -34.94100 1.000 48.32000  ? 712 DC  T C5    1 
ATOM   8258 C  C6    . DC  D 4 12  ? -36.21800 -26.11500 -35.94000 1.000 49.96000  ? 712 DC  T C6    1 
ATOM   8259 P  P     . DC  D 4 13  ? -36.28300 -30.12500 -40.58100 1.000 61.99000  ? 713 DC  T P     1 
ATOM   8260 O  OP1   . DC  D 4 13  ? -36.94400 -30.82400 -41.72800 1.000 62.53000  ? 713 DC  T OP1   1 
ATOM   8261 O  OP2   . DC  D 4 13  ? -35.82300 -30.87100 -39.38100 1.000 63.03000  ? 713 DC  T OP2   1 
ATOM   8262 O  "O5'" . DC  D 4 13  ? -35.04400 -29.20700 -41.06200 1.000 62.90000  ? 713 DC  T "O5'" 1 
ATOM   8263 C  "C5'" . DC  D 4 13  ? -35.21600 -28.28000 -42.14900 1.000 57.92000  ? 713 DC  T "C5'" 1 
ATOM   8264 C  "C4'" . DC  D 4 13  ? -34.04700 -27.32300 -42.23200 1.000 55.96000  ? 713 DC  T "C4'" 1 
ATOM   8265 O  "O4'" . DC  D 4 13  ? -33.97900 -26.54500 -41.03300 1.000 58.84000  ? 713 DC  T "O4'" 1 
ATOM   8266 C  "C3'" . DC  D 4 13  ? -32.69400 -27.98800 -42.34100 1.000 62.72000  ? 713 DC  T "C3'" 1 
ATOM   8267 O  "O3'" . DC  D 4 13  ? -32.37500 -28.15600 -43.72000 1.000 72.80000  ? 713 DC  T "O3'" 1 
ATOM   8268 C  "C2'" . DC  D 4 13  ? -31.74600 -26.98500 -41.67400 1.000 63.34000  ? 713 DC  T "C2'" 1 
ATOM   8269 C  "C1'" . DC  D 4 13  ? -32.66100 -26.09800 -40.83000 1.000 52.09000  ? 713 DC  T "C1'" 1 
ATOM   8270 N  N1    . DC  D 4 13  ? -32.38300 -26.17600 -39.38300 1.000 52.84000  ? 713 DC  T N1    1 
ATOM   8271 C  C2    . DC  D 4 13  ? -31.46600 -25.29700 -38.78600 1.000 57.28000  ? 713 DC  T C2    1 
ATOM   8272 O  O2    . DC  D 4 13  ? -30.88100 -24.46300 -39.48900 1.000 60.58000  ? 713 DC  T O2    1 
ATOM   8273 N  N3    . DC  D 4 13  ? -31.24300 -25.39000 -37.44100 1.000 57.52000  ? 713 DC  T N3    1 
ATOM   8274 C  C4    . DC  D 4 13  ? -31.89900 -26.30800 -36.71800 1.000 60.26000  ? 713 DC  T C4    1 
ATOM   8275 N  N4    . DC  D 4 13  ? -31.65200 -26.37200 -35.40300 1.000 58.22000  ? 713 DC  T N4    1 
ATOM   8276 C  C5    . DC  D 4 13  ? -32.83600 -27.20100 -37.31300 1.000 56.78000  ? 713 DC  T C5    1 
ATOM   8277 C  C6    . DC  D 4 13  ? -33.04100 -27.10100 -38.63200 1.000 57.61000  ? 713 DC  T C6    1 
ATOM   8278 P  P     . DG  D 4 14  ? -31.20500 -29.14900 -44.18600 1.000 72.01000  ? 714 DG  T P     1 
ATOM   8279 O  OP1   . DG  D 4 14  ? -31.39000 -29.29000 -45.64900 1.000 78.53000  ? 714 DG  T OP1   1 
ATOM   8280 O  OP2   . DG  D 4 14  ? -31.20800 -30.34300 -43.30400 1.000 68.07000  ? 714 DG  T OP2   1 
ATOM   8281 O  "O5'" . DG  D 4 14  ? -29.87700 -28.29600 -43.97000 1.000 56.71000  ? 714 DG  T "O5'" 1 
ATOM   8282 C  "C5'" . DG  D 4 14  ? -29.73200 -27.10800 -44.69100 1.000 57.39000  ? 714 DG  T "C5'" 1 
ATOM   8283 C  "C4'" . DG  D 4 14  ? -28.54200 -26.32400 -44.20500 1.000 61.18000  ? 714 DG  T "C4'" 1 
ATOM   8284 O  "O4'" . DG  D 4 14  ? -28.70000 -26.01700 -42.79700 1.000 67.97000  ? 714 DG  T "O4'" 1 
ATOM   8285 C  "C3'" . DG  D 4 14  ? -27.20600 -27.03500 -44.34400 1.000 67.61000  ? 714 DG  T "C3'" 1 
ATOM   8286 O  "O3'" . DG  D 4 14  ? -26.22800 -26.09800 -44.78200 1.000 78.24000  ? 714 DG  T "O3'" 1 
ATOM   8287 C  "C2'" . DG  D 4 14  ? -26.92500 -27.54600 -42.92700 1.000 68.96000  ? 714 DG  T "C2'" 1 
ATOM   8288 C  "C1'" . DG  D 4 14  ? -27.58300 -26.47900 -42.06400 1.000 67.36000  ? 714 DG  T "C1'" 1 
ATOM   8289 N  N9    . DG  D 4 14  ? -28.06700 -26.97500 -40.77000 1.000 62.63000  ? 714 DG  T N9    1 
ATOM   8290 C  C8    . DG  D 4 14  ? -28.90600 -28.04900 -40.55500 1.000 61.06000  ? 714 DG  T C8    1 
ATOM   8291 N  N7    . DG  D 4 14  ? -29.18200 -28.25400 -39.29600 1.000 56.97000  ? 714 DG  T N7    1 
ATOM   8292 C  C5    . DG  D 4 14  ? -28.48300 -27.25100 -38.62900 1.000 61.44000  ? 714 DG  T C5    1 
ATOM   8293 C  C6    . DG  D 4 14  ? -28.40000 -26.96700 -37.24200 1.000 61.53000  ? 714 DG  T C6    1 
ATOM   8294 O  O6    . DG  D 4 14  ? -28.94700 -27.57000 -36.29800 1.000 60.06000  ? 714 DG  T O6    1 
ATOM   8295 N  N1    . DG  D 4 14  ? -27.57800 -25.86400 -36.99100 1.000 56.02000  ? 714 DG  T N1    1 
ATOM   8296 C  C2    . DG  D 4 14  ? -26.92200 -25.13200 -37.95400 1.000 56.88000  ? 714 DG  T C2    1 
ATOM   8297 N  N2    . DG  D 4 14  ? -26.17700 -24.10700 -37.51300 1.000 56.89000  ? 714 DG  T N2    1 
ATOM   8298 N  N3    . DG  D 4 14  ? -26.99800 -25.38200 -39.25700 1.000 58.32000  ? 714 DG  T N3    1 
ATOM   8299 C  C4    . DG  D 4 14  ? -27.79300 -26.45300 -39.52200 1.000 60.77000  ? 714 DG  T C4    1 
ATOM   8300 P  P     . DA  D 4 15  ? -24.74700 -26.56900 -45.19000 1.000 71.61000  ? 715 DA  T P     1 
ATOM   8301 O  OP1   . DA  D 4 15  ? -24.37700 -25.83800 -46.42200 1.000 76.09000  ? 715 DA  T OP1   1 
ATOM   8302 O  OP2   . DA  D 4 15  ? -24.68100 -28.04700 -45.16400 1.000 71.31000  ? 715 DA  T OP2   1 
ATOM   8303 O  "O5'" . DA  D 4 15  ? -23.85800 -25.95600 -44.02800 1.000 70.40000  ? 715 DA  T "O5'" 1 
ATOM   8304 C  "C5'" . DA  D 4 15  ? -23.85100 -24.56000 -43.85500 1.000 66.24000  ? 715 DA  T "C5'" 1 
ATOM   8305 C  "C4'" . DA  D 4 15  ? -23.03200 -24.17600 -42.65100 1.000 70.45000  ? 715 DA  T "C4'" 1 
ATOM   8306 O  "O4'" . DA  D 4 15  ? -23.69600 -24.63600 -41.45800 1.000 73.65000  ? 715 DA  T "O4'" 1 
ATOM   8307 C  "C3'" . DA  D 4 15  ? -21.62900 -24.76500 -42.60500 1.000 76.38000  ? 715 DA  T "C3'" 1 
ATOM   8308 O  "O3'" . DA  D 4 15  ? -20.75000 -23.79400 -42.11100 1.000 83.71000  ? 715 DA  T "O3'" 1 
ATOM   8309 C  "C2'" . DA  D 4 15  ? -21.76900 -25.94100 -41.63500 1.000 70.14000  ? 715 DA  T "C2'" 1 
ATOM   8310 C  "C1'" . DA  D 4 15  ? -22.81400 -25.40900 -40.67600 1.000 67.80000  ? 715 DA  T "C1'" 1 
ATOM   8311 N  N9    . DA  D 4 15  ? -23.61400 -26.43500 -40.03200 1.000 64.08000  ? 715 DA  T N9    1 
ATOM   8312 C  C8    . DA  D 4 15  ? -24.33300 -27.42000 -40.64300 1.000 57.16000  ? 715 DA  T C8    1 
ATOM   8313 N  N7    . DA  D 4 15  ? -25.00400 -28.17800 -39.81000 1.000 62.06000  ? 715 DA  T N7    1 
ATOM   8314 C  C5    . DA  D 4 15  ? -24.72300 -27.63800 -38.56300 1.000 62.02000  ? 715 DA  T C5    1 
ATOM   8315 C  C6    . DA  D 4 15  ? -25.13000 -27.98800 -37.25200 1.000 56.08000  ? 715 DA  T C6    1 
ATOM   8316 N  N6    . DA  D 4 15  ? -25.93700 -29.01400 -36.97700 1.000 46.88000  ? 715 DA  T N6    1 
ATOM   8317 N  N1    . DA  D 4 15  ? -24.65900 -27.23900 -36.23400 1.000 59.26000  ? 715 DA  T N1    1 
ATOM   8318 C  C2    . DA  D 4 15  ? -23.84000 -26.20900 -36.50700 1.000 58.46000  ? 715 DA  T C2    1 
ATOM   8319 N  N3    . DA  D 4 15  ? -23.38800 -25.78500 -37.68800 1.000 60.42000  ? 715 DA  T N3    1 
ATOM   8320 C  C4    . DA  D 4 15  ? -23.87200 -26.55300 -38.68500 1.000 64.81000  ? 715 DA  T C4    1 
ATOM   8321 P  P     . DA  D 4 16  ? -19.19100 -23.85600 -42.47600 1.000 95.80000  ? 716 DA  T P     1 
ATOM   8322 O  OP1   . DA  D 4 16  ? -18.80100 -22.45700 -42.79000 1.000 85.92000  ? 716 DA  T OP1   1 
ATOM   8323 O  OP2   . DA  D 4 16  ? -18.99700 -24.94400 -43.46700 1.000 89.38000  ? 716 DA  T OP2   1 
ATOM   8324 O  "O5'" . DA  D 4 16  ? -18.50600 -24.31900 -41.10700 1.000 75.61000  ? 716 DA  T "O5'" 1 
ATOM   8325 C  "C5'" . DA  D 4 16  ? -18.53700 -23.44900 -39.99100 1.000 75.18000  ? 716 DA  T "C5'" 1 
ATOM   8326 C  "C4'" . DA  D 4 16  ? -18.44800 -24.22700 -38.69800 1.000 76.54000  ? 716 DA  T "C4'" 1 
ATOM   8327 O  "O4'" . DA  D 4 16  ? -19.53400 -25.16000 -38.61800 1.000 74.43000  ? 716 DA  T "O4'" 1 
ATOM   8328 C  "C3'" . DA  D 4 16  ? -17.18100 -25.06600 -38.53200 1.000 78.07000  ? 716 DA  T "C3'" 1 
ATOM   8329 O  "O3'" . DA  D 4 16  ? -16.29200 -24.39800 -37.63300 1.000 77.51000  ? 716 DA  T "O3'" 1 
ATOM   8330 C  "C2'" . DA  D 4 16  ? -17.68300 -26.42500 -37.97100 1.000 68.71000  ? 716 DA  T "C2'" 1 
ATOM   8331 C  "C1'" . DA  D 4 16  ? -19.16400 -26.16800 -37.71700 1.000 66.55000  ? 716 DA  T "C1'" 1 
ATOM   8332 N  N9    . DA  D 4 16  ? -20.03800 -27.31500 -37.94400 1.000 63.88000  ? 716 DA  T N9    1 
ATOM   8333 C  C8    . DA  D 4 16  ? -20.37900 -27.86700 -39.14700 1.000 63.33000  ? 716 DA  T C8    1 
ATOM   8334 N  N7    . DA  D 4 16  ? -21.22300 -28.86700 -39.05100 1.000 64.27000  ? 716 DA  T N7    1 
ATOM   8335 C  C5    . DA  D 4 16  ? -21.46000 -28.97200 -37.68900 1.000 62.50000  ? 716 DA  T C5    1 
ATOM   8336 C  C6    . DA  D 4 16  ? -22.26400 -29.84800 -36.92400 1.000 58.53000  ? 716 DA  T C6    1 
ATOM   8337 N  N6    . DA  D 4 16  ? -23.00500 -30.82300 -37.45400 1.000 53.26000  ? 716 DA  T N6    1 
ATOM   8338 N  N1    . DA  D 4 16  ? -22.27200 -29.67800 -35.58600 1.000 58.87000  ? 716 DA  T N1    1 
ATOM   8339 C  C2    . DA  D 4 16  ? -21.52600 -28.70000 -35.05600 1.000 58.67000  ? 716 DA  T C2    1 
ATOM   8340 N  N3    . DA  D 4 16  ? -20.73400 -27.82000 -35.66900 1.000 59.83000  ? 716 DA  T N3    1 
ATOM   8341 C  C4    . DA  D 4 16  ? -20.74400 -28.01400 -36.99500 1.000 61.03000  ? 716 DA  T C4    1 
ATOM   8342 P  P     . DC  D 4 17  ? -14.82400 -24.97500 -37.34500 1.000 85.15000  ? 717 DC  T P     1 
ATOM   8343 O  OP1   . DC  D 4 17  ? -14.02500 -23.90000 -36.70200 1.000 86.66000  ? 717 DC  T OP1   1 
ATOM   8344 O  OP2   . DC  D 4 17  ? -14.37200 -25.63600 -38.59000 1.000 77.84000  ? 717 DC  T OP2   1 
ATOM   8345 O  "O5'" . DC  D 4 17  ? -15.08000 -26.10400 -36.24800 1.000 78.69000  ? 717 DC  T "O5'" 1 
ATOM   8346 C  "C5'" . DC  D 4 17  ? -15.81700 -25.78600 -35.08500 1.000 73.72000  ? 717 DC  T "C5'" 1 
ATOM   8347 C  "C4'" . DC  D 4 17  ? -16.07000 -27.02800 -34.27500 1.000 68.31000  ? 717 DC  T "C4'" 1 
ATOM   8348 O  "O4'" . DC  D 4 17  ? -17.13000 -27.80300 -34.88900 1.000 67.29000  ? 717 DC  T "O4'" 1 
ATOM   8349 C  "C3'" . DC  D 4 17  ? -14.86700 -27.97700 -34.16900 1.000 67.09000  ? 717 DC  T "C3'" 1 
ATOM   8350 O  "O3'" . DC  D 4 17  ? -14.73200 -28.39900 -32.82800 1.000 67.97000  ? 717 DC  T "O3'" 1 
ATOM   8351 C  "C2'" . DC  D 4 17  ? -15.26900 -29.13600 -35.07600 1.000 68.46000  ? 717 DC  T "C2'" 1 
ATOM   8352 C  "C1'" . DC  D 4 17  ? -16.75600 -29.15200 -34.80700 1.000 70.68000  ? 717 DC  T "C1'" 1 
ATOM   8353 N  N1    . DC  D 4 17  ? -17.55600 -29.96000 -35.77000 1.000 68.73000  ? 717 DC  T N1    1 
ATOM   8354 C  C2    . DC  D 4 17  ? -18.54000 -30.81700 -35.27500 1.000 60.46000  ? 717 DC  T C2    1 
ATOM   8355 O  O2    . DC  D 4 17  ? -18.72200 -30.87700 -34.05000 1.000 60.55000  ? 717 DC  T O2    1 
ATOM   8356 N  N3    . DC  D 4 17  ? -19.27100 -31.54700 -36.14600 1.000 57.37000  ? 717 DC  T N3    1 
ATOM   8357 C  C4    . DC  D 4 17  ? -19.04200 -31.45000 -37.45000 1.000 56.98000  ? 717 DC  T C4    1 
ATOM   8358 N  N4    . DC  D 4 17  ? -19.79100 -32.19500 -38.26600 1.000 57.81000  ? 717 DC  T N4    1 
ATOM   8359 C  C5    . DC  D 4 17  ? -18.04000 -30.58100 -37.97800 1.000 59.07000  ? 717 DC  T C5    1 
ATOM   8360 C  C6    . DC  D 4 17  ? -17.32500 -29.86200 -37.11100 1.000 63.46000  ? 717 DC  T C6    1 
ATOM   8361 P  P     . DA  D 4 18  ? -13.39700 -29.13800 -32.33100 1.000 77.84000  ? 718 DA  T P     1 
ATOM   8362 O  OP1   . DA  D 4 18  ? -12.70500 -28.20800 -31.41000 1.000 75.25000  ? 718 DA  T OP1   1 
ATOM   8363 O  OP2   . DA  D 4 18  ? -12.69500 -29.74900 -33.48400 1.000 67.05000  ? 718 DA  T OP2   1 
ATOM   8364 O  "O5'" . DA  D 4 18  ? -13.95500 -30.34200 -31.46100 1.000 70.92000  ? 718 DA  T "O5'" 1 
ATOM   8365 C  "C5'" . DA  D 4 18  ? -15.06100 -30.13900 -30.60700 1.000 66.01000  ? 718 DA  T "C5'" 1 
ATOM   8366 C  "C4'" . DA  D 4 18  ? -15.58900 -31.47000 -30.13800 1.000 63.62000  ? 718 DA  T "C4'" 1 
ATOM   8367 O  "O4'" . DA  D 4 18  ? -16.47400 -32.01200 -31.15000 1.000 63.80000  ? 718 DA  T "O4'" 1 
ATOM   8368 C  "C3'" . DA  D 4 18  ? -14.50700 -32.52000 -29.90300 1.000 66.50000  ? 718 DA  T "C3'" 1 
ATOM   8369 O  "O3'" . DA  D 4 18  ? -14.80400 -33.27100 -28.74600 1.000 71.30000  ? 718 DA  T "O3'" 1 
ATOM   8370 C  "C2'" . DA  D 4 18  ? -14.55200 -33.37900 -31.16500 1.000 67.69000  ? 718 DA  T "C2'" 1 
ATOM   8371 C  "C1'" . DA  D 4 18  ? -16.01900 -33.28500 -31.56400 1.000 66.11000  ? 718 DA  T "C1'" 1 
ATOM   8372 N  N9    . DA  D 4 18  ? -16.24400 -33.40900 -33.00500 1.000 62.64000  ? 718 DA  T N9    1 
ATOM   8373 C  C8    . DA  D 4 18  ? -15.60900 -32.72200 -34.00000 1.000 62.86000  ? 718 DA  T C8    1 
ATOM   8374 N  N7    . DA  D 4 18  ? -16.01900 -33.03700 -35.20700 1.000 64.32000  ? 718 DA  T N7    1 
ATOM   8375 C  C5    . DA  D 4 18  ? -16.99000 -33.99900 -34.98800 1.000 57.04000  ? 718 DA  T C5    1 
ATOM   8376 C  C6    . DA  D 4 18  ? -17.81100 -34.73200 -35.86300 1.000 52.87000  ? 718 DA  T C6    1 
ATOM   8377 N  N6    . DA  D 4 18  ? -17.77200 -34.60200 -37.19000 1.000 53.03000  ? 718 DA  T N6    1 
ATOM   8378 N  N1    . DA  D 4 18  ? -18.67500 -35.61300 -35.31700 1.000 53.75000  ? 718 DA  T N1    1 
ATOM   8379 C  C2    . DA  D 4 18  ? -18.71200 -35.74400 -33.98300 1.000 53.49000  ? 718 DA  T C2    1 
ATOM   8380 N  N3    . DA  D 4 18  ? -17.99400 -35.10900 -33.06100 1.000 54.94000  ? 718 DA  T N3    1 
ATOM   8381 C  C4    . DA  D 4 18  ? -17.14400 -34.24000 -33.63600 1.000 58.75000  ? 718 DA  T C4    1 
ATOM   8382 P  P     . DG  D 4 19  ? -13.66900 -34.17600 -28.05300 1.000 82.06000  ? 719 DG  T P     1 
ATOM   8383 O  OP1   . DG  D 4 19  ? -13.86000 -34.09700 -26.58500 1.000 76.93000  ? 719 DG  T OP1   1 
ATOM   8384 O  OP2   . DG  D 4 19  ? -12.34900 -33.93100 -28.69200 1.000 73.31000  ? 719 DG  T OP2   1 
ATOM   8385 O  "O5'" . DG  D 4 19  ? -14.09400 -35.63500 -28.45100 1.000 75.88000  ? 719 DG  T "O5'" 1 
ATOM   8386 C  "C5'" . DG  D 4 19  ? -15.33700 -36.12700 -28.03200 1.000 74.45000  ? 719 DG  T "C5'" 1 
ATOM   8387 C  "C4'" . DG  D 4 19  ? -15.59300 -37.42200 -28.73800 1.000 72.60000  ? 719 DG  T "C4'" 1 
ATOM   8388 O  "O4'" . DG  D 4 19  ? -15.89200 -37.13500 -30.12300 1.000 66.53000  ? 719 DG  T "O4'" 1 
ATOM   8389 C  "C3'" . DG  D 4 19  ? -14.37500 -38.35900 -28.74900 1.000 67.04000  ? 719 DG  T "C3'" 1 
ATOM   8390 O  "O3'" . DG  D 4 19  ? -14.75700 -39.63700 -28.35100 1.000 66.76000  ? 719 DG  T "O3'" 1 
ATOM   8391 C  "C2'" . DG  D 4 19  ? -13.90600 -38.33700 -30.20100 1.000 64.72000  ? 719 DG  T "C2'" 1 
ATOM   8392 C  "C1'" . DG  D 4 19  ? -15.20700 -38.06000 -30.92200 1.000 65.48000  ? 719 DG  T "C1'" 1 
ATOM   8393 N  N9    . DG  D 4 19  ? -15.04400 -37.51500 -32.26500 1.000 60.00000  ? 719 DG  T N9    1 
ATOM   8394 C  C8    . DG  D 4 19  ? -14.15800 -36.55300 -32.68600 1.000 62.42000  ? 719 DG  T C8    1 
ATOM   8395 N  N7    . DG  D 4 19  ? -14.25300 -36.28500 -33.96200 1.000 59.10000  ? 719 DG  T N7    1 
ATOM   8396 C  C5    . DG  D 4 19  ? -15.25900 -37.13300 -34.40500 1.000 53.63000  ? 719 DG  T C5    1 
ATOM   8397 C  C6    . DG  D 4 19  ? -15.80100 -37.30400 -35.68900 1.000 50.19000  ? 719 DG  T C6    1 
ATOM   8398 O  O6    . DG  D 4 19  ? -15.49700 -36.71400 -36.73700 1.000 48.80000  ? 719 DG  T O6    1 
ATOM   8399 N  N1    . DG  D 4 19  ? -16.80600 -38.26500 -35.69200 1.000 50.28000  ? 719 DG  T N1    1 
ATOM   8400 C  C2    . DG  D 4 19  ? -17.22500 -38.97800 -34.58600 1.000 50.98000  ? 719 DG  T C2    1 
ATOM   8401 N  N2    . DG  D 4 19  ? -18.20500 -39.87000 -34.77400 1.000 49.98000  ? 719 DG  T N2    1 
ATOM   8402 N  N3    . DG  D 4 19  ? -16.72300 -38.82700 -33.38700 1.000 53.51000  ? 719 DG  T N3    1 
ATOM   8403 C  C4    . DG  D 4 19  ? -15.74800 -37.89300 -33.37000 1.000 56.24000  ? 719 DG  T C4    1 
ATOM   8404 P  P     . DG  D 4 20  ? -13.64300 -40.71300 -27.94400 1.000 80.70000  ? 720 DG  T P     1 
ATOM   8405 O  OP1   . DG  D 4 20  ? -13.89600 -41.11300 -26.53700 1.000 75.36000  ? 720 DG  T OP1   1 
ATOM   8406 O  OP2   . DG  D 4 20  ? -12.31200 -40.21600 -28.38100 1.000 69.42000  ? 720 DG  T OP2   1 
ATOM   8407 O  "O5'" . DG  D 4 20  ? -14.01300 -41.96000 -28.85400 1.000 73.15000  ? 720 DG  T "O5'" 1 
ATOM   8408 C  "C5'" . DG  D 4 20  ? -15.31300 -42.48800 -28.81300 1.000 65.15000  ? 720 DG  T "C5'" 1 
ATOM   8409 C  "C4'" . DG  D 4 20  ? -15.54500 -43.35900 -30.02000 1.000 63.96000  ? 720 DG  T "C4'" 1 
ATOM   8410 O  "O4'" . DG  D 4 20  ? -15.57400 -42.52600 -31.20600 1.000 64.71000  ? 720 DG  T "O4'" 1 
ATOM   8411 C  "C3'" . DG  D 4 20  ? -14.45900 -44.40100 -30.25700 1.000 61.04000  ? 720 DG  T "C3'" 1 
ATOM   8412 O  "O3'" . DG  D 4 20  ? -15.04800 -45.61800 -30.61800 1.000 69.85000  ? 720 DG  T "O3'" 1 
ATOM   8413 C  "C2'" . DG  D 4 20  ? -13.64300 -43.81100 -31.40200 1.000 59.28000  ? 720 DG  T "C2'" 1 
ATOM   8414 C  "C1'" . DG  D 4 20  ? -14.70400 -43.05300 -32.17300 1.000 63.79000  ? 720 DG  T "C1'" 1 
ATOM   8415 N  N9    . DG  D 4 20  ? -14.17000 -41.95100 -32.96300 1.000 58.61000  ? 720 DG  T N9    1 
ATOM   8416 C  C8    . DG  D 4 20  ? -13.29200 -40.98900 -32.54200 1.000 57.41000  ? 720 DG  T C8    1 
ATOM   8417 N  N7    . DG  D 4 20  ? -12.97400 -40.13300 -33.47300 1.000 55.58000  ? 720 DG  T N7    1 
ATOM   8418 C  C5    . DG  D 4 20  ? -13.69500 -40.55100 -34.58300 1.000 54.78000  ? 720 DG  T C5    1 
ATOM   8419 C  C6    . DG  D 4 20  ? -13.75400 -40.00700 -35.88900 1.000 55.00000  ? 720 DG  T C6    1 
ATOM   8420 O  O6    . DG  D 4 20  ? -13.16200 -39.00700 -36.33700 1.000 57.28000  ? 720 DG  T O6    1 
ATOM   8421 N  N1    . DG  D 4 20  ? -14.59700 -40.74800 -36.71500 1.000 49.05000  ? 720 DG  T N1    1 
ATOM   8422 C  C2    . DG  D 4 20  ? -15.29900 -41.86100 -36.32400 1.000 49.91000  ? 720 DG  T C2    1 
ATOM   8423 N  N2    . DG  D 4 20  ? -16.06700 -42.42900 -37.25700 1.000 47.00000  ? 720 DG  T N2    1 
ATOM   8424 N  N3    . DG  D 4 20  ? -15.25300 -42.38100 -35.10500 1.000 50.54000  ? 720 DG  T N3    1 
ATOM   8425 C  C4    . DG  D 4 20  ? -14.43500 -41.67300 -34.28800 1.000 56.41000  ? 720 DG  T C4    1 
ATOM   8426 P  P     . DG  D 4 21  ? -14.16500 -46.95400 -30.66000 1.000 72.70000  ? 721 DG  T P     1 
ATOM   8427 O  OP1   . DG  D 4 21  ? -14.85300 -47.97000 -29.83100 1.000 73.57000  ? 721 DG  T OP1   1 
ATOM   8428 O  OP2   . DG  D 4 21  ? -12.75000 -46.59300 -30.41400 1.000 69.65000  ? 721 DG  T OP2   1 
ATOM   8429 O  "O5'" . DG  D 4 21  ? -14.28700 -47.41400 -32.16700 1.000 65.67000  ? 721 DG  T "O5'" 1 
ATOM   8430 C  "C5'" . DG  D 4 21  ? -15.55800 -47.65200 -32.71200 1.000 61.76000  ? 721 DG  T "C5'" 1 
ATOM   8431 C  "C4'" . DG  D 4 21  ? -15.42100 -47.88500 -34.18800 1.000 64.67000  ? 721 DG  T "C4'" 1 
ATOM   8432 O  "O4'" . DG  D 4 21  ? -15.11500 -46.62400 -34.82500 1.000 62.56000  ? 721 DG  T "O4'" 1 
ATOM   8433 C  "C3'" . DG  D 4 21  ? -14.28100 -48.83400 -34.55700 1.000 68.72000  ? 721 DG  T "C3'" 1 
ATOM   8434 O  "O3'" . DG  D 4 21  ? -14.69400 -49.69900 -35.58700 1.000 78.03000  ? 721 DG  T "O3'" 1 
ATOM   8435 C  "C2'" . DG  D 4 21  ? -13.17100 -47.89500 -35.02400 1.000 67.35000  ? 721 DG  T "C2'" 1 
ATOM   8436 C  "C1'" . DG  D 4 21  ? -13.97600 -46.77000 -35.63700 1.000 60.36000  ? 721 DG  T "C1'" 1 
ATOM   8437 N  N9    . DG  D 4 21  ? -13.27100 -45.49700 -35.68000 1.000 59.78000  ? 721 DG  T N9    1 
ATOM   8438 C  C8    . DG  D 4 21  ? -12.67300 -44.82900 -34.63400 1.000 58.88000  ? 721 DG  T C8    1 
ATOM   8439 N  N7    . DG  D 4 21  ? -12.12200 -43.69600 -34.99100 1.000 52.89000  ? 721 DG  T N7    1 
ATOM   8440 C  C5    . DG  D 4 21  ? -12.37600 -43.61500 -36.35500 1.000 50.51000  ? 721 DG  T C5    1 
ATOM   8441 C  C6    . DG  D 4 21  ? -12.03100 -42.62200 -37.27900 1.000 47.07000  ? 721 DG  T C6    1 
ATOM   8442 O  O6    . DG  D 4 21  ? -11.40400 -41.57600 -37.07300 1.000 53.00000  ? 721 DG  T O6    1 
ATOM   8443 N  N1    . DG  D 4 21  ? -12.48600 -42.92900 -38.56300 1.000 51.07000  ? 721 DG  T N1    1 
ATOM   8444 C  C2    . DG  D 4 21  ? -13.19100 -44.06600 -38.90300 1.000 55.45000  ? 721 DG  T C2    1 
ATOM   8445 N  N2    . DG  D 4 21  ? -13.55400 -44.19900 -40.19500 1.000 52.73000  ? 721 DG  T N2    1 
ATOM   8446 N  N3    . DG  D 4 21  ? -13.52200 -45.00400 -38.03900 1.000 54.84000  ? 721 DG  T N3    1 
ATOM   8447 C  C4    . DG  D 4 21  ? -13.08300 -44.71400 -36.79000 1.000 56.72000  ? 721 DG  T C4    1 
ATOM   8448 P  P     . DA  D 4 22  ? -13.77300 -50.94700 -36.00400 1.000 87.99000  ? 722 DA  T P     1 
ATOM   8449 O  OP1   . DA  D 4 22  ? -14.68700 -52.12300 -36.13100 1.000 67.29000  ? 722 DA  T OP1   1 
ATOM   8450 O  OP2   . DA  D 4 22  ? -12.58300 -50.96300 -35.10100 1.000 64.92000  ? 722 DA  T OP2   1 
ATOM   8451 O  "O5'" . DA  D 4 22  ? -13.24500 -50.53500 -37.45000 1.000 69.05000  ? 722 DA  T "O5'" 1 
ATOM   8452 C  "C5'" . DA  D 4 22  ? -14.11600 -49.91400 -38.35000 1.000 57.12000  ? 722 DA  T "C5'" 1 
ATOM   8453 C  "C4'" . DA  D 4 22  ? -13.46600 -49.81900 -39.69900 1.000 62.60000  ? 722 DA  T "C4'" 1 
ATOM   8454 O  "O4'" . DA  D 4 22  ? -12.87400 -48.50700 -39.85000 1.000 68.67000  ? 722 DA  T "O4'" 1 
ATOM   8455 C  "C3'" . DA  D 4 22  ? -12.35100 -50.83200 -39.93600 1.000 62.44000  ? 722 DA  T "C3'" 1 
ATOM   8456 O  "O3'" . DA  D 4 22  ? -12.37200 -51.26200 -41.29500 1.000 70.27000  ? 722 DA  T "O3'" 1 
ATOM   8457 C  "C2'" . DA  D 4 22  ? -11.07600 -50.05600 -39.59100 1.000 61.04000  ? 722 DA  T "C2'" 1 
ATOM   8458 C  "C1'" . DA  D 4 22  ? -11.45900 -48.59900 -39.87900 1.000 64.91000  ? 722 DA  T "C1'" 1 
ATOM   8459 N  N9    . DA  D 4 22  ? -10.89800 -47.64900 -38.90600 1.000 61.37000  ? 722 DA  T N9    1 
ATOM   8460 C  C8    . DA  D 4 22  ? -10.76100 -47.83300 -37.55300 1.000 53.27000  ? 722 DA  T C8    1 
ATOM   8461 N  N7    . DA  D 4 22  ? -10.20300 -46.81400 -36.93000 1.000 48.54000  ? 722 DA  T N7    1 
ATOM   8462 C  C5    . DA  D 4 22  ? -9.95300  -45.89600 -37.94100 1.000 50.39000  ? 722 DA  T C5    1 
ATOM   8463 C  C6    . DA  D 4 22  ? -9.37000  -44.60000 -37.93800 1.000 48.72000  ? 722 DA  T C6    1 
ATOM   8464 N  N6    . DA  D 4 22  ? -8.91800  -43.99600 -36.83700 1.000 44.00000  ? 722 DA  T N6    1 
ATOM   8465 N  N1    . DA  D 4 22  ? -9.27200  -43.95100 -39.12400 1.000 48.99000  ? 722 DA  T N1    1 
ATOM   8466 C  C2    . DA  D 4 22  ? -9.72400  -44.56600 -40.23500 1.000 57.19000  ? 722 DA  T C2    1 
ATOM   8467 N  N3    . DA  D 4 22  ? -10.28800 -45.77800 -40.36300 1.000 56.21000  ? 722 DA  T N3    1 
ATOM   8468 C  C4    . DA  D 4 22  ? -10.37400 -46.39500 -39.16900 1.000 53.67000  ? 722 DA  T C4    1 
ATOM   8469 P  P     . DC  D 4 23  ? -11.21200 -52.20600 -41.88400 1.000 75.17000  ? 723 DC  T P     1 
ATOM   8470 O  OP1   . DC  D 4 23  ? -11.82100 -52.88900 -43.05400 1.000 73.43000  ? 723 DC  T OP1   1 
ATOM   8471 O  OP2   . DC  D 4 23  ? -10.60100 -52.97600 -40.77600 1.000 62.01000  ? 723 DC  T OP2   1 
ATOM   8472 O  "O5'" . DC  D 4 23  ? -10.12300 -51.17100 -42.44300 1.000 73.37000  ? 723 DC  T "O5'" 1 
ATOM   8473 C  "C5'" . DC  D 4 23  ? -10.46700 -50.36100 -43.55100 1.000 71.40000  ? 723 DC  T "C5'" 1 
ATOM   8474 C  "C4'" . DC  D 4 23  ? -9.35500  -49.41000 -43.92500 1.000 73.60000  ? 723 DC  T "C4'" 1 
ATOM   8475 O  "O4'" . DC  D 4 23  ? -9.12200  -48.50300 -42.83800 1.000 74.10000  ? 723 DC  T "O4'" 1 
ATOM   8476 C  "C3'" . DC  D 4 23  ? -8.01600  -50.07300 -44.23500 1.000 76.35000  ? 723 DC  T "C3'" 1 
ATOM   8477 O  "O3'" . DC  D 4 23  ? -7.59600  -49.70800 -45.53000 1.000 85.08000  ? 723 DC  T "O3'" 1 
ATOM   8478 C  "C2'" . DC  D 4 23  ? -7.06700  -49.53300 -43.16800 1.000 74.01000  ? 723 DC  T "C2'" 1 
ATOM   8479 C  "C1'" . DC  D 4 23  ? -7.75100  -48.24900 -42.73900 1.000 69.64000  ? 723 DC  T "C1'" 1 
ATOM   8480 N  N1    . DC  D 4 23  ? -7.47200  -47.89000 -41.34100 1.000 59.64000  ? 723 DC  T N1    1 
ATOM   8481 C  C2    . DC  D 4 23  ? -6.98800  -46.60600 -41.03400 1.000 55.57000  ? 723 DC  T C2    1 
ATOM   8482 O  O2    . DC  D 4 23  ? -6.79700  -45.78900 -41.95200 1.000 53.74000  ? 723 DC  T O2    1 
ATOM   8483 N  N3    . DC  D 4 23  ? -6.74000  -46.29800 -39.73800 1.000 51.37000  ? 723 DC  T N3    1 
ATOM   8484 C  C4    . DC  D 4 23  ? -6.96500  -47.20700 -38.78100 1.000 50.54000  ? 723 DC  T C4    1 
ATOM   8485 N  N4    . DC  D 4 23  ? -6.70600  -46.85900 -37.51500 1.000 44.54000  ? 723 DC  T N4    1 
ATOM   8486 C  C5    . DC  D 4 23  ? -7.46200  -48.51500 -39.07900 1.000 49.74000  ? 723 DC  T C5    1 
ATOM   8487 C  C6    . DC  D 4 23  ? -7.69800  -48.80900 -40.36000 1.000 52.36000  ? 723 DC  T C6    1 
ATOM   8488 P  P     . DT  D 4 24  ? -6.59100  -50.66400 -46.33500 1.000 98.59000  ? 724 DT  T P     1 
ATOM   8489 O  OP1   . DT  D 4 24  ? -7.16100  -50.86600 -47.69600 1.000 85.79000  ? 724 DT  T OP1   1 
ATOM   8490 O  OP2   . DT  D 4 24  ? -6.27000  -51.82500 -45.46100 1.000 73.82000  ? 724 DT  T OP2   1 
ATOM   8491 O  "O5'" . DT  D 4 24  ? -5.29100  -49.76000 -46.47600 1.000 95.33000  ? 724 DT  T "O5'" 1 
ATOM   8492 C  "C5'" . DT  D 4 24  ? -5.43800  -48.39100 -46.82300 1.000 95.92000  ? 724 DT  T "C5'" 1 
ATOM   8493 C  "C4'" . DT  D 4 24  ? -4.14900  -47.63400 -46.56800 1.000 98.73000  ? 724 DT  T "C4'" 1 
ATOM   8494 O  "O4'" . DT  D 4 24  ? -3.95400  -47.49000 -45.14300 1.000 96.64000  ? 724 DT  T "O4'" 1 
ATOM   8495 C  "C3'" . DT  D 4 24  ? -2.88800  -48.32700 -47.06400 1.000 97.47000  ? 724 DT  T "C3'" 1 
ATOM   8496 O  "O3'" . DT  D 4 24  ? -2.64800  -47.99600 -48.43400 1.000 112.31000 ? 724 DT  T "O3'" 1 
ATOM   8497 C  "C2'" . DT  D 4 24  ? -1.82400  -47.73400 -46.15600 1.000 98.11000  ? 724 DT  T "C2'" 1 
ATOM   8498 C  "C1'" . DT  D 4 24  ? -2.57100  -47.59500 -44.83700 1.000 94.50000  ? 724 DT  T "C1'" 1 
ATOM   8499 N  N1    . DT  D 4 24  ? -2.36300  -48.74000 -43.90300 1.000 89.59000  ? 724 DT  T N1    1 
ATOM   8500 C  C2    . DT  D 4 24  ? -1.30500  -48.70400 -43.02900 1.000 81.08000  ? 724 DT  T C2    1 
ATOM   8501 O  O2    . DT  D 4 24  ? -0.51500  -47.78100 -42.98000 1.000 72.19000  ? 724 DT  T O2    1 
ATOM   8502 N  N3    . DT  D 4 24  ? -1.20900  -49.78800 -42.19900 1.000 79.13000  ? 724 DT  T N3    1 
ATOM   8503 C  C4    . DT  D 4 24  ? -2.04900  -50.88900 -42.16100 1.000 85.81000  ? 724 DT  T C4    1 
ATOM   8504 O  O4    . DT  D 4 24  ? -1.87900  -51.82000 -41.37800 1.000 90.96000  ? 724 DT  T O4    1 
ATOM   8505 C  C5    . DT  D 4 24  ? -3.13900  -50.86700 -43.10700 1.000 89.94000  ? 724 DT  T C5    1 
ATOM   8506 C  C7    . DT  D 4 24  ? -4.11400  -52.00800 -43.16000 1.000 91.19000  ? 724 DT  T C7    1 
ATOM   8507 C  C6    . DT  D 4 24  ? -3.24300  -49.80500 -43.92300 1.000 92.92000  ? 724 DT  T C6    1 
ATOM   8508 P  P     . DG  D 4 25  ? -1.58900  -48.84500 -49.29800 1.000 113.68000 ? 725 DG  T P     1 
ATOM   8509 O  OP1   . DG  D 4 25  ? -1.64600  -48.34900 -50.69100 1.000 107.41000 ? 725 DG  T OP1   1 
ATOM   8510 O  OP2   . DG  D 4 25  ? -1.80800  -50.29100 -49.03400 1.000 98.48000  ? 725 DG  T OP2   1 
ATOM   8511 O  "O5'" . DG  D 4 25  ? -0.18600  -48.43500 -48.65900 1.000 103.62000 ? 725 DG  T "O5'" 1 
ATOM   8512 C  "C5'" . DG  D 4 25  ? 0.82900   -49.41000 -48.51400 1.000 105.45000 ? 725 DG  T "C5'" 1 
ATOM   8513 C  "C4'" . DG  D 4 25  ? 1.69100   -49.11600 -47.30600 1.000 96.15000  ? 725 DG  T "C4'" 1 
ATOM   8514 O  "O4'" . DG  D 4 25  ? 0.90000   -49.30500 -46.10400 1.000 96.60000  ? 725 DG  T "O4'" 1 
ATOM   8515 C  "C3'" . DG  D 4 25  ? 2.90400   -50.02600 -47.16900 1.000 95.98000  ? 725 DG  T "C3'" 1 
ATOM   8516 O  "O3'" . DG  D 4 25  ? 4.06100   -49.42500 -47.81800 1.000 72.35000  ? 725 DG  T "O3'" 1 
ATOM   8517 C  "C2'" . DG  D 4 25  ? 3.07800   -50.14600 -45.65100 1.000 104.84000 ? 725 DG  T "C2'" 1 
ATOM   8518 C  "C1'" . DG  D 4 25  ? 1.63600   -50.02200 -45.12900 1.000 101.69000 ? 725 DG  T "C1'" 1 
ATOM   8519 N  N9    . DG  D 4 25  ? 0.95500   -51.30600 -44.86400 1.000 97.02000  ? 725 DG  T N9    1 
ATOM   8520 C  C8    . DG  D 4 25  ? 0.26400   -52.08100 -45.76800 1.000 97.18000  ? 725 DG  T C8    1 
ATOM   8521 N  N7    . DG  D 4 25  ? -0.25200  -53.16600 -45.24500 1.000 97.65000  ? 725 DG  T N7    1 
ATOM   8522 C  C5    . DG  D 4 25  ? 0.11200   -53.10900 -43.90500 1.000 95.12000  ? 725 DG  T C5    1 
ATOM   8523 C  C6    . DG  D 4 25  ? -0.16200  -54.01600 -42.83500 1.000 97.51000  ? 725 DG  T C6    1 
ATOM   8524 O  O6    . DG  D 4 25  ? -0.79900  -55.08300 -42.85900 1.000 95.97000  ? 725 DG  T O6    1 
ATOM   8525 N  N1    . DG  D 4 25  ? 0.39000   -53.57500 -41.64200 1.000 93.08000  ? 725 DG  T N1    1 
ATOM   8526 C  C2    . DG  D 4 25  ? 1.11600   -52.41700 -41.49100 1.000 87.25000  ? 725 DG  T C2    1 
ATOM   8527 N  N2    . DG  D 4 25  ? 1.55900   -52.16700 -40.26500 1.000 75.21000  ? 725 DG  T N2    1 
ATOM   8528 N  N3    . DG  D 4 25  ? 1.38300   -51.56100 -42.47300 1.000 86.85000  ? 725 DG  T N3    1 
ATOM   8529 C  C4    . DG  D 4 25  ? 0.85200   -51.96800 -43.65000 1.000 91.87000  ? 725 DG  T C4    1 
HETATM 8530 O  O3G   A 1RZ E 5 .   ? -48.81100 4.08500   -25.12800 0.430 61.78000  ? 601 1RZ A O3G   1 
HETATM 8531 O  O3G   B 1RZ E 5 .   ? -48.47400 2.55800   -22.98800 0.570 55.52000  ? 601 1RZ A O3G   1 
HETATM 8532 P  PG    A 1RZ E 5 .   ? -48.28500 2.78600   -24.57100 0.430 60.80000  ? 601 1RZ A PG    1 
HETATM 8533 P  PG    B 1RZ E 5 .   ? -48.40100 2.92200   -24.44900 0.570 60.91000  ? 601 1RZ A PG    1 
HETATM 8534 O  O1G   A 1RZ E 5 .   ? -48.70400 1.47600   -25.29000 0.430 61.76000  ? 601 1RZ A O1G   1 
HETATM 8535 O  O1G   B 1RZ E 5 .   ? -47.21500 3.80400   -24.89600 0.570 63.46000  ? 601 1RZ A O1G   1 
HETATM 8536 P  PB    A 1RZ E 5 .   ? -45.60900 1.84500   -24.49900 0.430 54.72000  ? 601 1RZ A PB    1 
HETATM 8537 P  PB    B 1RZ E 5 .   ? -46.98300 0.85900   -25.81100 0.570 56.86000  ? 601 1RZ A PB    1 
HETATM 8538 O  O2B   A 1RZ E 5 .   ? -44.26800 2.32300   -25.05600 0.430 57.24000  ? 601 1RZ A O2B   1 
HETATM 8539 O  O2B   B 1RZ E 5 .   ? -47.11000 -0.65600  -26.02500 0.570 58.00000  ? 601 1RZ A O2B   1 
HETATM 8540 O  O1B   A 1RZ E 5 .   ? -45.78000 1.40500   -23.01600 0.430 51.71000  ? 601 1RZ A O1B   1 
HETATM 8541 O  O1B   B 1RZ E 5 .   ? -46.63900 1.86900   -26.91700 0.570 57.26000  ? 601 1RZ A O1B   1 
HETATM 8542 O  O3A   A 1RZ E 5 .   ? -45.70900 0.62000   -25.53300 0.430 54.32000  ? 601 1RZ A O3A   1 
HETATM 8543 O  O3A   B 1RZ E 5 .   ? -45.74500 0.71400   -24.82100 0.570 54.72000  ? 601 1RZ A O3A   1 
HETATM 8544 P  PA    A 1RZ E 5 .   ? -46.20600 -0.92700  -25.17400 0.430 53.51000  ? 601 1RZ A PA    1 
HETATM 8545 P  PA    B 1RZ E 5 .   ? -44.63000 1.90100   -24.59400 0.570 57.45000  ? 601 1RZ A PA    1 
HETATM 8546 O  O1A   A 1RZ E 5 .   ? -46.56300 -1.52800  -26.53500 0.430 48.32000  ? 601 1RZ A O1A   1 
HETATM 8547 O  O1A   B 1RZ E 5 .   ? -45.06400 2.46200   -23.25300 0.570 51.35000  ? 601 1RZ A O1A   1 
HETATM 8548 O  O2A   A 1RZ E 5 .   ? -47.23200 -1.16900  -24.03100 0.430 50.64000  ? 601 1RZ A O2A   1 
HETATM 8549 O  O2A   B 1RZ E 5 .   ? -44.26900 2.91200   -25.72800 0.570 57.66000  ? 601 1RZ A O2A   1 
HETATM 8550 O  "O5'" A 1RZ E 5 .   ? -44.78000 -1.58300  -24.65700 0.430 48.42000  ? 601 1RZ A "O5'" 1 
HETATM 8551 O  "O5'" B 1RZ E 5 .   ? -43.31300 0.95100   -24.33600 0.570 46.54000  ? 601 1RZ A "O5'" 1 
HETATM 8552 C  "C5'" A 1RZ E 5 .   ? -43.71500 -0.78700  -24.11200 0.430 49.04000  ? 601 1RZ A "C5'" 1 
HETATM 8553 C  "C5'" B 1RZ E 5 .   ? -43.48200 -0.42700  -24.01600 0.570 48.91000  ? 601 1RZ A "C5'" 1 
HETATM 8554 C  "C4'" A 1RZ E 5 .   ? -42.33300 -1.39800  -24.03600 0.430 46.38000  ? 601 1RZ A "C4'" 1 
HETATM 8555 C  "C4'" B 1RZ E 5 .   ? -42.20300 -1.23200  -24.02700 0.570 46.39000  ? 601 1RZ A "C4'" 1 
HETATM 8556 O  "O4'" A 1RZ E 5 .   ? -41.75500 -1.09400  -25.29800 0.430 44.63000  ? 601 1RZ A "O4'" 1 
HETATM 8557 O  "O4'" B 1RZ E 5 .   ? -41.67900 -1.00900  -25.32700 0.570 44.77000  ? 601 1RZ A "O4'" 1 
HETATM 8558 S  "S3'" A 1RZ E 5 .   ? -42.36500 -3.16000  -23.80400 0.430 49.38000  ? 601 1RZ A "S3'" 1 
HETATM 8559 S  "S3'" B 1RZ E 5 .   ? -42.44700 -2.97700  -23.81800 0.570 49.66000  ? 601 1RZ A "S3'" 1 
HETATM 8560 C  "C2'" A 1RZ E 5 .   ? -40.86100 -3.25800  -24.70600 0.430 43.84000  ? 601 1RZ A "C2'" 1 
HETATM 8561 C  "C2'" B 1RZ E 5 .   ? -40.93400 -3.20700  -24.68700 0.570 43.91000  ? 601 1RZ A "C2'" 1 
HETATM 8562 C  "C1'" A 1RZ E 5 .   ? -40.81000 -2.09000  -25.67000 0.430 42.50000  ? 601 1RZ A "C1'" 1 
HETATM 8563 C  "C1'" B 1RZ E 5 .   ? -40.80100 -2.07000  -25.68100 0.570 42.45000  ? 601 1RZ A "C1'" 1 
HETATM 8564 N  N1    A 1RZ E 5 .   ? -41.13800 -2.50500  -27.02800 0.430 39.94000  ? 601 1RZ A N1    1 
HETATM 8565 N  N1    B 1RZ E 5 .   ? -41.14800 -2.50200  -27.03000 0.570 39.94000  ? 601 1RZ A N1    1 
HETATM 8566 C  C2    A 1RZ E 5 .   ? -40.16500 -2.61800  -27.98900 0.430 37.96000  ? 601 1RZ A C2    1 
HETATM 8567 C  C2    B 1RZ E 5 .   ? -40.19500 -2.59200  -28.01100 0.570 38.30000  ? 601 1RZ A C2    1 
HETATM 8568 O  O2    A 1RZ E 5 .   ? -38.82200 -2.37300  -27.84700 0.430 38.82000  ? 601 1RZ A O2    1 
HETATM 8569 O  O2    B 1RZ E 5 .   ? -38.85600 -2.30400  -27.90100 0.570 38.82000  ? 601 1RZ A O2    1 
HETATM 8570 N  N3    A 1RZ E 5 .   ? -40.49100 -3.01200  -29.23200 0.430 38.27000  ? 601 1RZ A N3    1 
HETATM 8571 N  N3    B 1RZ E 5 .   ? -40.53400 -3.00400  -29.24200 0.570 38.15000  ? 601 1RZ A N3    1 
HETATM 8572 C  C4    A 1RZ E 5 .   ? -41.75900 -3.30600  -29.56200 0.430 40.09000  ? 601 1RZ A C4    1 
HETATM 8573 C  C4    B 1RZ E 5 .   ? -41.79800 -3.34300  -29.54200 0.570 40.09000  ? 601 1RZ A C4    1 
HETATM 8574 N  N4    A 1RZ E 5 .   ? -41.95100 -3.68600  -30.85000 0.430 41.33000  ? 601 1RZ A N4    1 
HETATM 8575 N  N4    B 1RZ E 5 .   ? -42.00500 -3.73700  -30.82300 0.570 41.63000  ? 601 1RZ A N4    1 
HETATM 8576 C  C5    A 1RZ E 5 .   ? -42.78100 -3.20600  -28.59600 0.430 40.38000  ? 601 1RZ A C5    1 
HETATM 8577 C  C5    B 1RZ E 5 .   ? -42.80300 -3.26900  -28.55600 0.570 40.35000  ? 601 1RZ A C5    1 
HETATM 8578 C  C6    A 1RZ E 5 .   ? -42.43200 -2.79000  -27.31000 0.430 41.98000  ? 601 1RZ A C6    1 
HETATM 8579 C  C6    B 1RZ E 5 .   ? -42.43800 -2.83200  -27.28100 0.570 41.90000  ? 601 1RZ A C6    1 
HETATM 8580 O  O3B   A 1RZ E 5 .   ? -46.70100 2.99100   -24.72700 0.430 57.22000  ? 601 1RZ A O3B   1 
HETATM 8581 O  O3B   B 1RZ E 5 .   ? -48.30900 1.45600   -25.12900 0.570 61.55000  ? 601 1RZ A O3B   1 
HETATM 8582 O  O2C   A 1RZ E 5 .   ? -48.49800 2.61500   -23.10600 0.430 55.54000  ? 601 1RZ A O2C   1 
HETATM 8583 O  O2C   B 1RZ E 5 .   ? -49.63700 3.54200   -25.00100 0.570 60.61000  ? 601 1RZ A O2C   1 
HETATM 8584 S  S     . SO4 F 6 .   ? -27.48300 -75.96800 -40.36300 1.000 57.27000  ? 602 SO4 A S     1 
HETATM 8585 O  O1    . SO4 F 6 .   ? -27.71400 -75.47000 -41.72800 1.000 42.50000  ? 602 SO4 A O1    1 
HETATM 8586 O  O2    . SO4 F 6 .   ? -26.69100 -77.20100 -40.37600 1.000 57.86000  ? 602 SO4 A O2    1 
HETATM 8587 O  O3    . SO4 F 6 .   ? -26.74200 -74.94000 -39.63200 1.000 60.45000  ? 602 SO4 A O3    1 
HETATM 8588 O  O4    . SO4 F 6 .   ? -28.75500 -76.22500 -39.68100 1.000 50.83000  ? 602 SO4 A O4    1 
HETATM 8589 S  S     . SO4 G 6 .   ? -59.17600 -37.43100 -28.71300 1.000 81.14000  ? 603 SO4 A S     1 
HETATM 8590 O  O1    . SO4 G 6 .   ? -57.98300 -37.42700 -29.55700 1.000 71.60000  ? 603 SO4 A O1    1 
HETATM 8591 O  O2    . SO4 G 6 .   ? -60.21200 -36.59100 -29.31300 1.000 72.63000  ? 603 SO4 A O2    1 
HETATM 8592 O  O3    . SO4 G 6 .   ? -58.84700 -36.94600 -27.36600 1.000 68.74000  ? 603 SO4 A O3    1 
HETATM 8593 O  O4    . SO4 G 6 .   ? -59.67500 -38.79600 -28.63100 1.000 87.39000  ? 603 SO4 A O4    1 
HETATM 8594 MG MG    . MG  H 7 .   ? -47.33700 0.37100   -22.12400 1.000 45.18000  ? 604 MG  A MG    1 
HETATM 8595 O  O     . HOH I 8 .   ? -6.76300  -54.81400 -50.30000 1.000 58.09000  ? 701 HOH A O     1 
HETATM 8596 O  O     . HOH I 8 .   ? -21.70800 11.65600  -36.06300 1.000 62.06000  ? 702 HOH A O     1 
HETATM 8597 O  O     . HOH I 8 .   ? -59.55200 -14.99800 -29.27300 1.000 53.26000  ? 703 HOH A O     1 
HETATM 8598 O  O     . HOH I 8 .   ? -36.32000 -60.94400 -45.94700 1.000 40.17000  ? 704 HOH A O     1 
HETATM 8599 O  O     . HOH I 8 .   ? -64.70200 -20.05000 -26.32200 1.000 47.30000  ? 705 HOH A O     1 
HETATM 8600 O  O     . HOH I 8 .   ? -50.06700 -19.20800 -12.00400 1.000 33.07000  ? 706 HOH A O     1 
HETATM 8601 O  O     . HOH I 8 .   ? -28.28300 -42.59500 -26.03600 1.000 55.95000  ? 707 HOH A O     1 
HETATM 8602 O  O     . HOH I 8 .   ? -58.81400 -36.57100 -24.90800 1.000 54.11000  ? 708 HOH A O     1 
HETATM 8603 O  O     . HOH I 8 .   ? -57.67100 -22.88400 -10.47200 1.000 41.06000  ? 709 HOH A O     1 
HETATM 8604 O  O     . HOH I 8 .   ? -58.99700 -20.83900 -29.09300 1.000 41.24000  ? 710 HOH A O     1 
HETATM 8605 O  O     . HOH I 8 .   ? -41.84500 0.86500   -2.08100  1.000 40.96000  ? 711 HOH A O     1 
HETATM 8606 O  O     . HOH I 8 .   ? -32.70300 -72.58700 -32.36700 1.000 41.27000  ? 712 HOH A O     1 
HETATM 8607 O  O     . HOH I 8 .   ? -28.96500 -76.11300 -37.16000 1.000 40.76000  ? 713 HOH A O     1 
HETATM 8608 O  O     . HOH I 8 .   ? -21.10600 -56.49800 -41.95500 1.000 34.59000  ? 714 HOH A O     1 
HETATM 8609 O  O     . HOH I 8 .   ? -31.20800 -55.06400 -28.19300 1.000 53.92000  ? 715 HOH A O     1 
HETATM 8610 O  O     . HOH I 8 .   ? -59.00100 -30.26000 -17.48900 1.000 31.45000  ? 716 HOH A O     1 
HETATM 8611 O  O     . HOH I 8 .   ? -28.44100 -5.24500  -31.99500 1.000 37.25000  ? 717 HOH A O     1 
HETATM 8612 O  O     . HOH I 8 .   ? -45.78400 -32.50300 -36.71000 1.000 55.38000  ? 718 HOH A O     1 
HETATM 8613 O  O     . HOH I 8 .   ? -11.64500 -62.55000 -37.94700 1.000 42.12000  ? 719 HOH A O     1 
HETATM 8614 O  O     . HOH I 8 .   ? -41.20300 -9.41300  -17.43600 1.000 29.04000  ? 720 HOH A O     1 
HETATM 8615 O  O     . HOH I 8 .   ? -53.01700 0.69100   -17.09800 1.000 30.91000  ? 721 HOH A O     1 
HETATM 8616 O  O     . HOH I 8 .   ? -29.01900 2.17600   -17.06700 1.000 32.19000  ? 722 HOH A O     1 
HETATM 8617 O  O     . HOH I 8 .   ? -61.99200 -25.94300 -15.36100 1.000 43.42000  ? 723 HOH A O     1 
HETATM 8618 O  O     . HOH I 8 .   ? -62.32400 -6.94600  3.78900   1.000 48.08000  ? 724 HOH A O     1 
HETATM 8619 O  O     . HOH I 8 .   ? -32.68200 19.59500  -23.33100 1.000 46.45000  ? 725 HOH A O     1 
HETATM 8620 O  O     . HOH I 8 .   ? -42.94400 -57.72400 -26.19200 1.000 44.12000  ? 726 HOH A O     1 
HETATM 8621 O  O     . HOH I 8 .   ? -47.89000 -17.60300 -24.03500 1.000 26.68000  ? 727 HOH A O     1 
HETATM 8622 O  O     . HOH I 8 .   ? -48.93900 -23.00900 -12.83500 1.000 32.35000  ? 728 HOH A O     1 
HETATM 8623 O  O     . HOH I 8 .   ? -16.77600 -71.42100 -38.53200 1.000 43.22000  ? 729 HOH A O     1 
HETATM 8624 O  O     . HOH I 8 .   ? -31.23700 2.28800   -15.50400 1.000 33.27000  ? 730 HOH A O     1 
HETATM 8625 O  O     . HOH I 8 .   ? -28.08800 -10.17300 -24.03400 1.000 32.85000  ? 731 HOH A O     1 
HETATM 8626 O  O     . HOH I 8 .   ? -40.90500 -8.26800  -7.41600  1.000 34.48000  ? 732 HOH A O     1 
HETATM 8627 O  O     . HOH I 8 .   ? -44.46100 -20.37600 -18.77500 1.000 27.43000  ? 733 HOH A O     1 
HETATM 8628 O  O     . HOH I 8 .   ? -35.66000 -45.09500 -24.75900 1.000 33.73000  ? 734 HOH A O     1 
HETATM 8629 O  O     . HOH I 8 .   ? -18.96800 -71.35800 -51.91900 1.000 52.76000  ? 735 HOH A O     1 
HETATM 8630 O  O     . HOH I 8 .   ? -45.29900 5.96500   -16.84600 1.000 34.58000  ? 736 HOH A O     1 
HETATM 8631 O  O     . HOH I 8 .   ? -42.44200 -12.59000 -16.40700 1.000 35.15000  ? 737 HOH A O     1 
HETATM 8632 O  O     . HOH I 8 .   ? -29.18600 -61.35100 -32.52700 1.000 35.39000  ? 738 HOH A O     1 
HETATM 8633 O  O     . HOH I 8 .   ? -36.41400 -8.10800  0.31200   1.000 56.28000  ? 739 HOH A O     1 
HETATM 8634 O  O     . HOH I 8 .   ? -41.45500 -19.98000 -22.39900 1.000 32.40000  ? 740 HOH A O     1 
HETATM 8635 O  O     . HOH I 8 .   ? -18.02700 -62.30100 -40.80100 1.000 31.78000  ? 741 HOH A O     1 
HETATM 8636 O  O     . HOH I 8 .   ? -49.72200 3.86500   -11.75300 1.000 27.81000  ? 742 HOH A O     1 
HETATM 8637 O  O     . HOH I 8 .   ? -43.19500 -29.04200 -31.85400 1.000 49.76000  ? 743 HOH A O     1 
HETATM 8638 O  O     . HOH I 8 .   ? -34.49000 -64.56800 -28.36000 1.000 46.89000  ? 744 HOH A O     1 
HETATM 8639 O  O     . HOH I 8 .   ? -63.63400 -9.53000  -0.58700  1.000 47.04000  ? 745 HOH A O     1 
HETATM 8640 O  O     . HOH I 8 .   ? -41.13300 -6.86300  -16.46400 1.000 27.05000  ? 746 HOH A O     1 
HETATM 8641 O  O     . HOH I 8 .   ? -32.85300 -68.16600 -31.03500 1.000 43.62000  ? 747 HOH A O     1 
HETATM 8642 O  O     . HOH I 8 .   ? -24.43100 -49.53900 -21.20200 1.000 49.37000  ? 748 HOH A O     1 
HETATM 8643 O  O     . HOH I 8 .   ? -59.40000 -3.06800  -11.92800 1.000 38.93000  ? 749 HOH A O     1 
HETATM 8644 O  O     . HOH I 8 .   ? -38.71800 -60.13500 -37.49800 1.000 41.09000  ? 750 HOH A O     1 
HETATM 8645 O  O     . HOH I 8 .   ? -47.18400 -1.77700  -31.71200 1.000 52.02000  ? 751 HOH A O     1 
HETATM 8646 O  O     . HOH I 8 .   ? -54.57300 -3.83700  -21.39600 1.000 36.89000  ? 752 HOH A O     1 
HETATM 8647 O  O     . HOH I 8 .   ? -26.83900 -47.59700 -32.21600 1.000 43.85000  ? 753 HOH A O     1 
HETATM 8648 O  O     . HOH I 8 .   ? -48.63800 -9.99800  -18.01900 1.000 29.68000  ? 754 HOH A O     1 
HETATM 8649 O  O     . HOH I 8 .   ? -65.13500 -10.58600 -9.32000  1.000 42.51000  ? 755 HOH A O     1 
HETATM 8650 O  O     . HOH I 8 .   ? -31.65600 -70.36900 -43.42500 1.000 31.37000  ? 756 HOH A O     1 
HETATM 8651 O  O     . HOH I 8 .   ? -38.87400 -20.78700 -18.56400 1.000 29.97000  ? 757 HOH A O     1 
HETATM 8652 O  O     . HOH I 8 .   ? -56.637   -16.983   -1.648    1.000 43.73000  ? 758 HOH A O     1 
HETATM 8653 O  O     . HOH I 8 .   ? -66.50200 -6.42400  -2.54800  1.000 48.58000  ? 759 HOH A O     1 
HETATM 8654 O  O     . HOH I 8 .   ? -60.38200 -26.88300 -23.12300 1.000 36.78000  ? 760 HOH A O     1 
HETATM 8655 O  O     . HOH I 8 .   ? -36.86700 -34.77200 -25.69100 1.000 34.92000  ? 761 HOH A O     1 
HETATM 8656 O  O     . HOH I 8 .   ? -32.73000 -47.37200 -32.99000 1.000 32.51000  ? 762 HOH A O     1 
HETATM 8657 O  O     . HOH I 8 .   ? -12.41200 -38.58300 -51.22600 1.000 54.35000  ? 763 HOH A O     1 
HETATM 8658 O  O     . HOH I 8 .   ? -59.60900 -16.72500 -13.50800 1.000 43.51000  ? 764 HOH A O     1 
HETATM 8659 O  O     . HOH I 8 .   ? -43.38300 -45.40100 -37.57400 1.000 50.50000  ? 765 HOH A O     1 
HETATM 8660 O  O     . HOH I 8 .   ? -43.48500 -44.98200 -14.42800 1.000 44.02000  ? 766 HOH A O     1 
HETATM 8661 O  O     . HOH I 8 .   ? -56.17000 -12.78600 -2.55100  1.000 41.47000  ? 767 HOH A O     1 
HETATM 8662 O  O     . HOH I 8 .   ? -35.99600 -54.67500 -48.50900 1.000 44.99000  ? 768 HOH A O     1 
HETATM 8663 O  O     . HOH I 8 .   ? -32.95400 1.25600   -13.69500 1.000 32.88000  ? 769 HOH A O     1 
HETATM 8664 O  O     . HOH I 8 .   ? -33.41800 -72.52300 -42.79000 1.000 42.57000  ? 770 HOH A O     1 
HETATM 8665 O  O     . HOH I 8 .   ? -33.08200 -1.89400  -11.71400 1.000 38.05000  ? 771 HOH A O     1 
HETATM 8666 O  O     . HOH I 8 .   ? -56.17600 3.09900   -14.38900 1.000 41.22000  ? 772 HOH A O     1 
HETATM 8667 O  O     . HOH I 8 .   ? -47.68200 -15.30700 -25.85300 1.000 31.69000  ? 773 HOH A O     1 
HETATM 8668 O  O     . HOH I 8 .   ? -40.61900 -30.80900 -32.46500 1.000 50.13000  ? 774 HOH A O     1 
HETATM 8669 O  O     . HOH I 8 .   ? -45.63100 -46.25800 -14.66300 1.000 40.16000  ? 775 HOH A O     1 
HETATM 8670 O  O     . HOH I 8 .   ? -51.54000 -42.35500 -15.76400 1.000 46.54000  ? 776 HOH A O     1 
HETATM 8671 O  O     . HOH I 8 .   ? -51.40900 -30.18700 -32.00700 1.000 39.82000  ? 777 HOH A O     1 
HETATM 8672 O  O     . HOH I 8 .   ? -14.63000 -45.94800 -45.31200 1.000 42.29000  ? 778 HOH A O     1 
HETATM 8673 O  O     . HOH I 8 .   ? -46.70700 -1.24100  -1.51200  1.000 45.90000  ? 779 HOH A O     1 
HETATM 8674 O  O     . HOH I 8 .   ? -44.94200 18.07800  -28.81200 1.000 51.42000  ? 780 HOH A O     1 
HETATM 8675 O  O     . HOH I 8 .   ? -28.67900 -43.42700 -35.10900 1.000 42.30000  ? 781 HOH A O     1 
HETATM 8676 O  O     . HOH I 8 .   ? -36.36100 -47.70600 -16.06600 1.000 43.26000  ? 782 HOH A O     1 
HETATM 8677 O  O     . HOH I 8 .   ? -54.38300 -16.60700 -12.02700 1.000 34.14000  ? 783 HOH A O     1 
HETATM 8678 O  O     . HOH I 8 .   ? -41.28900 -59.04400 -37.21800 1.000 42.49000  ? 784 HOH A O     1 
HETATM 8679 O  O     . HOH I 8 .   ? -24.96400 -44.29700 -51.40600 1.000 43.45000  ? 785 HOH A O     1 
HETATM 8680 O  O     . HOH I 8 .   ? -42.34300 -62.59500 -37.46400 1.000 55.90000  ? 786 HOH A O     1 
HETATM 8681 O  O     . HOH I 8 .   ? -30.29800 -47.65400 -34.62800 1.000 30.97000  ? 787 HOH A O     1 
HETATM 8682 O  O     . HOH I 8 .   ? -58.44900 -15.78700 -15.27400 1.000 40.23000  ? 788 HOH A O     1 
HETATM 8683 O  O     . HOH I 8 .   ? -46.04700 -27.69800 -29.72600 1.000 36.82000  ? 789 HOH A O     1 
HETATM 8684 O  O     . HOH I 8 .   ? -23.15200 -48.51700 -51.02100 1.000 39.74000  ? 790 HOH A O     1 
HETATM 8685 O  O     . HOH I 8 .   ? -58.98600 -35.18700 -23.01900 1.000 37.45000  ? 791 HOH A O     1 
HETATM 8686 O  O     . HOH I 8 .   ? -53.69300 -12.10600 2.87400   1.000 43.59000  ? 792 HOH A O     1 
HETATM 8687 O  O     . HOH I 8 .   ? -36.47600 -33.09400 -22.41600 1.000 46.23000  ? 793 HOH A O     1 
HETATM 8688 O  O     . HOH I 8 .   ? -60.37500 -14.61800 -16.34000 1.000 42.88000  ? 794 HOH A O     1 
HETATM 8689 O  O     . HOH I 8 .   ? -8.96800  -54.43200 -48.33900 1.000 54.20000  ? 795 HOH A O     1 
HETATM 8690 O  O     . HOH I 8 .   ? -41.69600 3.91200   -23.64200 1.000 38.39000  ? 796 HOH A O     1 
HETATM 8691 O  O     . HOH I 8 .   ? -42.96800 10.79700  -23.30200 1.000 49.08000  ? 797 HOH A O     1 
HETATM 8692 O  O     . HOH I 8 .   ? -52.57500 -18.05000 -10.64900 1.000 30.23000  ? 798 HOH A O     1 
HETATM 8693 O  O     . HOH I 8 .   ? -45.93200 -22.56600 -29.75500 1.000 51.55000  ? 799 HOH A O     1 
HETATM 8694 O  O     . HOH I 8 .   ? -32.18300 -16.25100 -19.72600 1.000 33.99000  ? 800 HOH A O     1 
HETATM 8695 O  O     . HOH I 8 .   ? -63.53700 -16.25000 -28.20000 1.000 54.71000  ? 801 HOH A O     1 
HETATM 8696 O  O     . HOH I 8 .   ? -65.96500 -22.40100 -25.70900 1.000 50.67000  ? 802 HOH A O     1 
HETATM 8697 O  O     . HOH I 8 .   ? -45.52700 -56.99300 -26.33000 1.000 40.10000  ? 803 HOH A O     1 
HETATM 8698 O  O     . HOH I 8 .   ? -43.95800 0.00000   0.00000   0.50  29.79000  ? 804 HOH A O     1 
HETATM 8699 O  O     . HOH I 8 .   ? -43.02800 -44.60700 -11.75100 1.000 45.01000  ? 805 HOH A O     1 
HETATM 8700 O  O     . HOH I 8 .   ? -57.26700 -22.72300 -7.90900  1.000 41.07000  ? 806 HOH A O     1 
HETATM 8701 O  O     . HOH I 8 .   ? -27.98200 -46.15700 -34.19400 1.000 39.07000  ? 807 HOH A O     1 
HETATM 8702 O  O     . HOH I 8 .   ? -62.72800 -13.23700 -14.90800 1.000 46.56000  ? 808 HOH A O     1 
HETATM 8703 O  O     . HOH I 8 .   ? -39.65800 -10.35800 -6.04800  1.000 35.63000  ? 809 HOH A O     1 
HETATM 8704 O  O     . HOH J 8 .   ? -20.37200 -6.56400  -2.81500  1.000 47.45000  ? 501 HOH B O     1 
HETATM 8705 O  O     . HOH J 8 .   ? -6.79400  -76.43200 -30.09700 1.000 53.21000  ? 502 HOH B O     1 
HETATM 8706 O  O     . HOH J 8 .   ? -7.26900  -35.39900 6.51100   1.000 52.43000  ? 503 HOH B O     1 
HETATM 8707 O  O     . HOH J 8 .   ? -22.31000 -17.67400 -11.73200 1.000 33.67000  ? 504 HOH B O     1 
HETATM 8708 O  O     . HOH J 8 .   ? -5.26400  -41.24000 12.43900  1.000 58.33000  ? 505 HOH B O     1 
HETATM 8709 O  O     . HOH J 8 .   ? -30.12400 -7.79800  -0.90000  1.000 45.85000  ? 506 HOH B O     1 
HETATM 8710 O  O     . HOH J 8 .   ? -6.14600  -43.43000 12.14600  1.000 62.55000  ? 507 HOH B O     1 
HETATM 8711 O  O     . HOH J 8 .   ? -17.29100 -51.39300 -6.08300  1.000 56.59000  ? 508 HOH B O     1 
HETATM 8712 O  O     . HOH J 8 .   ? -46.32700 -18.67500 -10.90800 1.000 33.73000  ? 509 HOH B O     1 
HETATM 8713 O  O     . HOH J 8 .   ? -15.60900 -25.52000 -19.72000 1.000 54.81000  ? 510 HOH B O     1 
HETATM 8714 O  O     . HOH J 8 .   ? -27.79200 -24.91300 -18.10700 1.000 33.02000  ? 511 HOH B O     1 
HETATM 8715 O  O     . HOH J 8 .   ? -21.90500 -24.62900 -13.53400 1.000 35.34000  ? 512 HOH B O     1 
HETATM 8716 O  O     . HOH J 8 .   ? -11.06000 -71.41500 -41.68000 1.000 46.44000  ? 513 HOH B O     1 
HETATM 8717 O  O     . HOH J 8 .   ? -21.07000 -65.78200 -32.61400 1.000 38.40000  ? 514 HOH B O     1 
HETATM 8718 O  O     . HOH J 8 .   ? -41.11700 -14.85200 -9.01300  1.000 34.51000  ? 515 HOH B O     1 
HETATM 8719 O  O     . HOH J 8 .   ? -20.79400 -22.13300 -12.58200 1.000 33.90000  ? 516 HOH B O     1 
HETATM 8720 O  O     . HOH J 8 .   ? -39.14900 -15.37800 -16.69800 1.000 28.01000  ? 517 HOH B O     1 
HETATM 8721 O  O     . HOH J 8 .   ? -34.83500 -10.92200 2.47800   1.000 52.46000  ? 518 HOH B O     1 
HETATM 8722 O  O     . HOH J 8 .   ? -27.86500 -8.92600  1.49600   1.000 48.36000  ? 519 HOH B O     1 
HETATM 8723 O  O     . HOH J 8 .   ? -29.18600 -19.41700 -12.39400 1.000 29.88000  ? 520 HOH B O     1 
HETATM 8724 O  O     . HOH J 8 .   ? -23.31700 -26.01800 -3.49000  1.000 39.25000  ? 521 HOH B O     1 
HETATM 8725 O  O     . HOH J 8 .   ? -13.51300 -75.09800 -19.65700 1.000 51.53000  ? 522 HOH B O     1 
HETATM 8726 O  O     . HOH J 8 .   ? -15.54100 -74.87900 -19.47600 1.000 62.02000  ? 523 HOH B O     1 
HETATM 8727 O  O     . HOH J 8 .   ? -33.69800 -29.35200 -10.74400 1.000 31.85000  ? 524 HOH B O     1 
HETATM 8728 O  O     . HOH J 8 .   ? -21.92300 -35.60400 -24.15300 1.000 36.00000  ? 525 HOH B O     1 
HETATM 8729 O  O     . HOH J 8 .   ? -49.03800 -23.02100 -4.68700  1.000 45.71000  ? 526 HOH B O     1 
HETATM 8730 O  O     . HOH J 8 .   ? -39.52500 -31.61100 -6.46300  1.000 45.67000  ? 527 HOH B O     1 
HETATM 8731 O  O     . HOH J 8 .   ? -38.96100 -19.49700 -15.26100 1.000 30.76000  ? 528 HOH B O     1 
HETATM 8732 O  O     . HOH J 8 .   ? -41.00500 -26.84800 -0.87000  1.000 35.26000  ? 529 HOH B O     1 
HETATM 8733 O  O     . HOH J 8 .   ? -38.68300 -15.23200 -9.81400  1.000 38.12000  ? 530 HOH B O     1 
HETATM 8734 O  O     . HOH J 8 .   ? -11.81900 -14.76200 2.19500   1.000 50.03000  ? 531 HOH B O     1 
HETATM 8735 O  O     . HOH J 8 .   ? -32.43900 -9.19600  -8.21600  1.000 39.28000  ? 532 HOH B O     1 
HETATM 8736 O  O     . HOH J 8 .   ? -18.80100 -67.64700 -24.57200 1.000 40.21000  ? 533 HOH B O     1 
HETATM 8737 O  O     . HOH J 8 .   ? -5.72900  -81.90500 -28.89100 1.000 61.44000  ? 534 HOH B O     1 
HETATM 8738 O  O     . HOH J 8 .   ? -22.17800 -35.06100 -0.16500  1.000 38.55000  ? 535 HOH B O     1 
HETATM 8739 O  O     . HOH J 8 .   ? -19.79800 -20.46300 -19.41100 1.000 39.12000  ? 536 HOH B O     1 
HETATM 8740 O  O     . HOH J 8 .   ? -42.67900 -19.00500 -8.54500  1.000 33.55000  ? 537 HOH B O     1 
HETATM 8741 O  O     . HOH J 8 .   ? -18.90500 -29.77600 -7.94600  1.000 46.98000  ? 538 HOH B O     1 
HETATM 8742 O  O     . HOH J 8 .   ? -15.07700 -34.27800 -12.41000 1.000 43.14000  ? 539 HOH B O     1 
HETATM 8743 O  O     . HOH J 8 .   ? -26.32200 -22.85000 -20.80100 1.000 34.46000  ? 540 HOH B O     1 
HETATM 8744 O  O     . HOH J 8 .   ? -27.27400 -77.50700 -35.70300 1.000 40.02000  ? 541 HOH B O     1 
HETATM 8745 O  O     . HOH J 8 .   ? -16.18100 -28.97400 -10.78900 1.000 39.28000  ? 542 HOH B O     1 
HETATM 8746 O  O     . HOH J 8 .   ? -0.97700  -60.53700 -18.26100 1.000 59.77000  ? 543 HOH B O     1 
HETATM 8747 O  O     . HOH J 8 .   ? -4.72800  -46.56300 -6.51900  1.000 55.70000  ? 544 HOH B O     1 
HETATM 8748 O  O     . HOH J 8 .   ? -47.33600 -15.76900 -6.69400  1.000 44.84000  ? 545 HOH B O     1 
HETATM 8749 O  O     . HOH J 8 .   ? -36.46000 -29.39000 -11.47100 1.000 39.76000  ? 546 HOH B O     1 
HETATM 8750 O  O     . HOH J 8 .   ? -33.10100 -9.60300  -11.20900 1.000 39.79000  ? 547 HOH B O     1 
HETATM 8751 O  O     . HOH J 8 .   ? -12.86400 -11.53400 -16.79100 1.000 52.87000  ? 548 HOH B O     1 
HETATM 8752 O  O     . HOH J 8 .   ? -48.80900 -17.58800 -7.54900  1.000 43.08000  ? 549 HOH B O     1 
HETATM 8753 O  O     . HOH J 8 .   ? -20.50100 -28.69200 -17.17200 1.000 41.17000  ? 550 HOH B O     1 
HETATM 8754 O  O     . HOH J 8 .   ? -38.93700 -48.93300 -16.31300 1.000 41.35000  ? 551 HOH B O     1 
HETATM 8755 O  O     . HOH J 8 .   ? -20.25900 -31.18000 -17.24000 1.000 36.55000  ? 552 HOH B O     1 
HETATM 8756 O  O     . HOH J 8 .   ? -36.11100 -33.52600 -4.60700  1.000 42.59000  ? 553 HOH B O     1 
HETATM 8757 O  O     . HOH J 8 .   ? -38.01600 -21.64200 -16.16300 1.000 33.43000  ? 554 HOH B O     1 
HETATM 8758 O  O     . HOH K 8 .   ? -38.46700 -22.02300 -40.12700 1.000 47.39000  ? 901 HOH P O     1 
HETATM 8759 O  O     . HOH K 8 .   ? -41.28200 -20.78000 -38.06300 1.000 46.61000  ? 902 HOH P O     1 
HETATM 8760 O  O     . HOH K 8 .   ? -29.18000 -30.25800 -28.48600 1.000 56.96000  ? 903 HOH P O     1 
HETATM 8761 O  O     . HOH K 8 .   ? -16.37800 -35.80100 -41.45100 1.000 45.77000  ? 904 HOH P O     1 
HETATM 8762 O  O     . HOH K 8 .   ? -45.23700 -15.58300 -27.12500 1.000 29.75000  ? 905 HOH P O     1 
HETATM 8763 O  O     . HOH K 8 .   ? -52.47600 -9.40000  -26.33600 1.000 34.15000  ? 906 HOH P O     1 
HETATM 8764 O  O     . HOH K 8 .   ? -8.98600  -40.35600 -35.54600 1.000 51.32000  ? 907 HOH P O     1 
HETATM 8765 O  O     . HOH K 8 .   ? -45.00300 -7.98300  -32.18100 1.000 37.04000  ? 908 HOH P O     1 
HETATM 8766 O  O     . HOH K 8 .   ? -45.10000 -19.64000 -30.66400 1.000 37.05000  ? 909 HOH P O     1 
HETATM 8767 O  O     . HOH K 8 .   ? -49.56100 -9.91300  -34.27600 1.000 43.95000  ? 910 HOH P O     1 
HETATM 8768 O  O     . HOH K 8 .   ? -12.71300 -35.66200 -40.76700 1.000 44.95000  ? 911 HOH P O     1 
HETATM 8769 O  O     . HOH K 8 .   ? -23.67300 -41.76700 -44.77200 1.000 49.20000  ? 912 HOH P O     1 
HETATM 8770 O  O     . HOH K 8 .   ? -33.14600 -17.74600 -32.31100 1.000 44.71000  ? 913 HOH P O     1 
HETATM 8771 O  O     . HOH K 8 .   ? -31.56200 -18.19100 -30.42100 1.000 44.37000  ? 914 HOH P O     1 
HETATM 8772 O  O     . HOH L 8 .   ? -36.70900 -28.98900 -33.46000 1.000 45.22000  ? 801 HOH T O     1 
HETATM 8773 O  O     . HOH L 8 .   ? -39.44700 -30.02400 -30.14900 1.000 43.42000  ? 802 HOH T O     1 
HETATM 8774 O  O     . HOH L 8 .   ? -33.13400 -15.44700 -27.30900 1.000 37.84000  ? 803 HOH T O     1 
HETATM 8775 O  O     . HOH L 8 .   ? -34.77500 -18.35800 -30.95200 1.000 41.63000  ? 804 HOH T O     1 
HETATM 8776 O  O     . HOH L 8 .   ? -7.89900  -48.53600 -48.99700 1.000 54.91000  ? 805 HOH T O     1 
HETATM 8777 O  O     . HOH L 8 .   ? -28.42500 -13.15500 -24.33500 1.000 43.68000  ? 806 HOH T O     1 
HETATM 8778 O  O     . HOH L 8 .   ? -17.02800 -50.93300 -37.78700 1.000 47.81000  ? 807 HOH T O     1 
HETATM 8779 O  O     . HOH L 8 .   ? -10.42000 -38.22100 -34.07900 1.000 48.57000  ? 808 HOH T O     1 
HETATM 8780 O  O     . HOH L 8 .   ? -19.58100 -36.08200 -30.38500 1.000 58.82000  ? 809 HOH T O     1 
HETATM 8781 O  O     . HOH L 8 .   ? -37.49000 -7.03300  -34.79300 1.000 52.91000  ? 810 HOH T O     1 
HETATM 8782 O  O     . HOH L 8 .   ? -39.95800 -7.10300  -34.57200 1.000 39.40000  ? 811 HOH T O     1 
HETATM 8783 O  O     . HOH L 8 .   ? -39.48800 -22.42700 -21.32900 1.000 32.26000  ? 812 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -11 ?   ?   ?   A . n 
A 1 2   GLY 2   -10 ?   ?   ?   A . n 
A 1 3   SER 3   -9  ?   ?   ?   A . n 
A 1 4   SER 4   -8  ?   ?   ?   A . n 
A 1 5   HIS 5   -7  ?   ?   ?   A . n 
A 1 6   HIS 6   -6  ?   ?   ?   A . n 
A 1 7   HIS 7   -5  ?   ?   ?   A . n 
A 1 8   HIS 8   -4  ?   ?   ?   A . n 
A 1 9   HIS 9   -3  ?   ?   ?   A . n 
A 1 10  HIS 10  -2  ?   ?   ?   A . n 
A 1 11  SER 11  -1  ?   ?   ?   A . n 
A 1 12  SER 12  0   ?   ?   ?   A . n 
A 1 13  PRO 13  1   1   PRO PRO A . n 
A 1 14  ILE 14  2   2   ILE ILE A . n 
A 1 15  SER 15  3   3   SER SER A . n 
A 1 16  PRO 16  4   4   PRO PRO A . n 
A 1 17  ILE 17  5   5   ILE ILE A . n 
A 1 18  GLU 18  6   6   GLU GLU A . n 
A 1 19  THR 19  7   7   THR THR A . n 
A 1 20  VAL 20  8   8   VAL VAL A . n 
A 1 21  PRO 21  9   9   PRO PRO A . n 
A 1 22  VAL 22  10  10  VAL VAL A . n 
A 1 23  LYS 23  11  11  LYS LYS A . n 
A 1 24  LEU 24  12  12  LEU LEU A . n 
A 1 25  LYS 25  13  13  LYS LYS A . n 
A 1 26  PRO 26  14  14  PRO PRO A . n 
A 1 27  GLY 27  15  15  GLY GLY A . n 
A 1 28  MET 28  16  16  MET MET A . n 
A 1 29  ASP 29  17  17  ASP ASP A . n 
A 1 30  GLY 30  18  18  GLY GLY A . n 
A 1 31  PRO 31  19  19  PRO PRO A . n 
A 1 32  LYS 32  20  20  LYS LYS A . n 
A 1 33  VAL 33  21  21  VAL VAL A . n 
A 1 34  LYS 34  22  22  LYS LYS A . n 
A 1 35  GLN 35  23  23  GLN GLN A . n 
A 1 36  TRP 36  24  24  TRP TRP A . n 
A 1 37  PRO 37  25  25  PRO PRO A . n 
A 1 38  LEU 38  26  26  LEU LEU A . n 
A 1 39  THR 39  27  27  THR THR A . n 
A 1 40  GLU 40  28  28  GLU GLU A . n 
A 1 41  GLU 41  29  29  GLU GLU A . n 
A 1 42  LYS 42  30  30  LYS LYS A . n 
A 1 43  ILE 43  31  31  ILE ILE A . n 
A 1 44  LYS 44  32  32  LYS LYS A . n 
A 1 45  ALA 45  33  33  ALA ALA A . n 
A 1 46  LEU 46  34  34  LEU LEU A . n 
A 1 47  VAL 47  35  35  VAL VAL A . n 
A 1 48  GLU 48  36  36  GLU GLU A . n 
A 1 49  ILE 49  37  37  ILE ILE A . n 
A 1 50  CYS 50  38  38  CYS CYS A . n 
A 1 51  THR 51  39  39  THR THR A . n 
A 1 52  GLU 52  40  40  GLU GLU A . n 
A 1 53  MET 53  41  41  MET MET A . n 
A 1 54  GLU 54  42  42  GLU GLU A . n 
A 1 55  LYS 55  43  43  LYS LYS A . n 
A 1 56  GLU 56  44  44  GLU GLU A . n 
A 1 57  GLY 57  45  45  GLY GLY A . n 
A 1 58  LYS 58  46  46  LYS LYS A . n 
A 1 59  ILE 59  47  47  ILE ILE A . n 
A 1 60  SER 60  48  48  SER SER A . n 
A 1 61  LYS 61  49  49  LYS LYS A . n 
A 1 62  ILE 62  50  50  ILE ILE A . n 
A 1 63  GLY 63  51  51  GLY GLY A . n 
A 1 64  PRO 64  52  52  PRO PRO A . n 
A 1 65  GLU 65  53  53  GLU GLU A . n 
A 1 66  ASN 66  54  54  ASN ASN A . n 
A 1 67  PRO 67  55  55  PRO PRO A . n 
A 1 68  TYR 68  56  56  TYR TYR A . n 
A 1 69  ASN 69  57  57  ASN ASN A . n 
A 1 70  THR 70  58  58  THR THR A . n 
A 1 71  PRO 71  59  59  PRO PRO A . n 
A 1 72  VAL 72  60  60  VAL VAL A . n 
A 1 73  PHE 73  61  61  PHE PHE A . n 
A 1 74  ALA 74  62  62  ALA ALA A . n 
A 1 75  ILE 75  63  63  ILE ILE A . n 
A 1 76  LYS 76  64  64  LYS LYS A . n 
A 1 77  LYS 77  65  65  LYS LYS A . n 
A 1 78  LYS 78  66  66  LYS LYS A . n 
A 1 79  ASP 79  67  67  ASP ASP A . n 
A 1 80  SER 80  68  68  SER SER A . n 
A 1 81  THR 81  69  69  THR THR A . n 
A 1 82  LYS 82  70  70  LYS LYS A . n 
A 1 83  TRP 83  71  71  TRP TRP A . n 
A 1 84  ARG 84  72  72  ARG ARG A . n 
A 1 85  LYS 85  73  73  LYS LYS A . n 
A 1 86  LEU 86  74  74  LEU LEU A . n 
A 1 87  VAL 87  75  75  VAL VAL A . n 
A 1 88  ASP 88  76  76  ASP ASP A . n 
A 1 89  PHE 89  77  77  PHE PHE A . n 
A 1 90  ARG 90  78  78  ARG ARG A . n 
A 1 91  GLU 91  79  79  GLU GLU A . n 
A 1 92  LEU 92  80  80  LEU LEU A . n 
A 1 93  ASN 93  81  81  ASN ASN A . n 
A 1 94  LYS 94  82  82  LYS LYS A . n 
A 1 95  ARG 95  83  83  ARG ARG A . n 
A 1 96  THR 96  84  84  THR THR A . n 
A 1 97  GLN 97  85  85  GLN GLN A . n 
A 1 98  ASP 98  86  86  ASP ASP A . n 
A 1 99  PHE 99  87  87  PHE PHE A . n 
A 1 100 TRP 100 88  88  TRP TRP A . n 
A 1 101 GLU 101 89  89  GLU GLU A . n 
A 1 102 VAL 102 90  90  VAL VAL A . n 
A 1 103 GLN 103 91  91  GLN GLN A . n 
A 1 104 LEU 104 92  92  LEU LEU A . n 
A 1 105 GLY 105 93  93  GLY GLY A . n 
A 1 106 ILE 106 94  94  ILE ILE A . n 
A 1 107 PRO 107 95  95  PRO PRO A . n 
A 1 108 HIS 108 96  96  HIS HIS A . n 
A 1 109 PRO 109 97  97  PRO PRO A . n 
A 1 110 ALA 110 98  98  ALA ALA A . n 
A 1 111 GLY 111 99  99  GLY GLY A . n 
A 1 112 LEU 112 100 100 LEU LEU A . n 
A 1 113 LYS 113 101 101 LYS LYS A . n 
A 1 114 LYS 114 102 102 LYS LYS A . n 
A 1 115 LYS 115 103 103 LYS LYS A . n 
A 1 116 LYS 116 104 104 LYS LYS A . n 
A 1 117 SER 117 105 105 SER SER A . n 
A 1 118 VAL 118 106 106 VAL VAL A . n 
A 1 119 THR 119 107 107 THR THR A . n 
A 1 120 VAL 120 108 108 VAL VAL A . n 
A 1 121 LEU 121 109 109 LEU LEU A . n 
A 1 122 ASP 122 110 110 ASP ASP A . n 
A 1 123 VAL 123 111 111 VAL VAL A . n 
A 1 124 GLY 124 112 112 GLY GLY A . n 
A 1 125 ASP 125 113 113 ASP ASP A . n 
A 1 126 ALA 126 114 114 ALA ALA A . n 
A 1 127 TYR 127 115 115 TYR TYR A . n 
A 1 128 PHE 128 116 116 PHE PHE A . n 
A 1 129 SER 129 117 117 SER SER A . n 
A 1 130 VAL 130 118 118 VAL VAL A . n 
A 1 131 PRO 131 119 119 PRO PRO A . n 
A 1 132 LEU 132 120 120 LEU LEU A . n 
A 1 133 ASP 133 121 121 ASP ASP A . n 
A 1 134 GLU 134 122 122 GLU GLU A . n 
A 1 135 ASP 135 123 123 ASP ASP A . n 
A 1 136 PHE 136 124 124 PHE PHE A . n 
A 1 137 ARG 137 125 125 ARG ARG A . n 
A 1 138 LYS 138 126 126 LYS LYS A . n 
A 1 139 TYR 139 127 127 TYR TYR A . n 
A 1 140 THR 140 128 128 THR THR A . n 
A 1 141 ALA 141 129 129 ALA ALA A . n 
A 1 142 PHE 142 130 130 PHE PHE A . n 
A 1 143 THR 143 131 131 THR THR A . n 
A 1 144 ILE 144 132 132 ILE ILE A . n 
A 1 145 PRO 145 133 133 PRO PRO A . n 
A 1 146 SER 146 134 134 SER SER A . n 
A 1 147 ILE 147 135 ?   ?   ?   A . n 
A 1 148 ASN 148 136 ?   ?   ?   A . n 
A 1 149 ASN 149 137 ?   ?   ?   A . n 
A 1 150 GLU 150 138 ?   ?   ?   A . n 
A 1 151 THR 151 139 ?   ?   ?   A . n 
A 1 152 PRO 152 140 ?   ?   ?   A . n 
A 1 153 GLY 153 141 ?   ?   ?   A . n 
A 1 154 ILE 154 142 142 ILE ILE A . n 
A 1 155 ARG 155 143 143 ARG ARG A . n 
A 1 156 TYR 156 144 144 TYR TYR A . n 
A 1 157 GLN 157 145 145 GLN GLN A . n 
A 1 158 TYR 158 146 146 TYR TYR A . n 
A 1 159 ASN 159 147 147 ASN ASN A . n 
A 1 160 VAL 160 148 148 VAL VAL A . n 
A 1 161 LEU 161 149 149 LEU LEU A . n 
A 1 162 PRO 162 150 150 PRO PRO A . n 
A 1 163 GLN 163 151 151 GLN GLN A . n 
A 1 164 GLY 164 152 152 GLY GLY A . n 
A 1 165 TRP 165 153 153 TRP TRP A . n 
A 1 166 LYS 166 154 154 LYS LYS A . n 
A 1 167 GLY 167 155 155 GLY GLY A . n 
A 1 168 SER 168 156 156 SER SER A . n 
A 1 169 PRO 169 157 157 PRO PRO A . n 
A 1 170 ALA 170 158 158 ALA ALA A . n 
A 1 171 ILE 171 159 159 ILE ILE A . n 
A 1 172 PHE 172 160 160 PHE PHE A . n 
A 1 173 GLN 173 161 161 GLN GLN A . n 
A 1 174 SER 174 162 162 SER SER A . n 
A 1 175 SER 175 163 163 SER SER A . n 
A 1 176 MET 176 164 164 MET MET A . n 
A 1 177 THR 177 165 165 THR THR A . n 
A 1 178 LYS 178 166 166 LYS LYS A . n 
A 1 179 ILE 179 167 167 ILE ILE A . n 
A 1 180 LEU 180 168 168 LEU LEU A . n 
A 1 181 GLU 181 169 169 GLU GLU A . n 
A 1 182 PRO 182 170 170 PRO PRO A . n 
A 1 183 PHE 183 171 171 PHE PHE A . n 
A 1 184 ARG 184 172 172 ARG ARG A . n 
A 1 185 LYS 185 173 173 LYS LYS A . n 
A 1 186 GLN 186 174 174 GLN GLN A . n 
A 1 187 ASN 187 175 175 ASN ASN A . n 
A 1 188 PRO 188 176 176 PRO PRO A . n 
A 1 189 ASP 189 177 177 ASP ASP A . n 
A 1 190 ILE 190 178 178 ILE ILE A . n 
A 1 191 VAL 191 179 179 VAL VAL A . n 
A 1 192 ILE 192 180 180 ILE ILE A . n 
A 1 193 TYR 193 181 181 TYR TYR A . n 
A 1 194 GLN 194 182 182 GLN GLN A . n 
A 1 195 TYR 195 183 183 TYR TYR A . n 
A 1 196 MET 196 184 184 MET MET A . n 
A 1 197 ASP 197 185 185 ASP ASP A . n 
A 1 198 ASP 198 186 186 ASP ASP A . n 
A 1 199 LEU 199 187 187 LEU LEU A . n 
A 1 200 TYR 200 188 188 TYR TYR A . n 
A 1 201 VAL 201 189 189 VAL VAL A . n 
A 1 202 GLY 202 190 190 GLY GLY A . n 
A 1 203 SER 203 191 191 SER SER A . n 
A 1 204 ASP 204 192 192 ASP ASP A . n 
A 1 205 LEU 205 193 193 LEU LEU A . n 
A 1 206 GLU 206 194 194 GLU GLU A . n 
A 1 207 ILE 207 195 195 ILE ILE A . n 
A 1 208 GLY 208 196 196 GLY GLY A . n 
A 1 209 GLN 209 197 197 GLN GLN A . n 
A 1 210 HIS 210 198 198 HIS HIS A . n 
A 1 211 ARG 211 199 199 ARG ARG A . n 
A 1 212 THR 212 200 200 THR THR A . n 
A 1 213 LYS 213 201 201 LYS LYS A . n 
A 1 214 ILE 214 202 202 ILE ILE A . n 
A 1 215 GLU 215 203 203 GLU GLU A . n 
A 1 216 GLU 216 204 204 GLU GLU A . n 
A 1 217 LEU 217 205 205 LEU LEU A . n 
A 1 218 ARG 218 206 206 ARG ARG A . n 
A 1 219 GLN 219 207 207 GLN GLN A . n 
A 1 220 HIS 220 208 208 HIS HIS A . n 
A 1 221 LEU 221 209 209 LEU LEU A . n 
A 1 222 LEU 222 210 210 LEU LEU A . n 
A 1 223 ARG 223 211 211 ARG ARG A . n 
A 1 224 TRP 224 212 212 TRP TRP A . n 
A 1 225 GLY 225 213 213 GLY GLY A . n 
A 1 226 LEU 226 214 214 LEU LEU A . n 
A 1 227 THR 227 215 215 THR THR A . n 
A 1 228 THR 228 216 216 THR THR A . n 
A 1 229 PRO 229 217 217 PRO PRO A . n 
A 1 230 ASP 230 218 218 ASP ASP A . n 
A 1 231 LYS 231 219 219 LYS LYS A . n 
A 1 232 LYS 232 220 220 LYS LYS A . n 
A 1 233 HIS 233 221 221 HIS HIS A . n 
A 1 234 GLN 234 222 222 GLN GLN A . n 
A 1 235 LYS 235 223 223 LYS LYS A . n 
A 1 236 GLU 236 224 224 GLU GLU A . n 
A 1 237 PRO 237 225 225 PRO PRO A . n 
A 1 238 PRO 238 226 226 PRO PRO A . n 
A 1 239 PHE 239 227 227 PHE PHE A . n 
A 1 240 LEU 240 228 228 LEU LEU A . n 
A 1 241 TRP 241 229 229 TRP TRP A . n 
A 1 242 MET 242 230 230 MET MET A . n 
A 1 243 GLY 243 231 231 GLY GLY A . n 
A 1 244 TYR 244 232 232 TYR TYR A . n 
A 1 245 GLU 245 233 233 GLU GLU A . n 
A 1 246 LEU 246 234 234 LEU LEU A . n 
A 1 247 HIS 247 235 235 HIS HIS A . n 
A 1 248 PRO 248 236 236 PRO PRO A . n 
A 1 249 ASP 249 237 237 ASP ASP A . n 
A 1 250 LYS 250 238 238 LYS LYS A . n 
A 1 251 TRP 251 239 239 TRP TRP A . n 
A 1 252 THR 252 240 240 THR THR A . n 
A 1 253 VAL 253 241 241 VAL VAL A . n 
A 1 254 GLN 254 242 242 GLN GLN A . n 
A 1 255 PRO 255 243 243 PRO PRO A . n 
A 1 256 ILE 256 244 244 ILE ILE A . n 
A 1 257 VAL 257 245 245 VAL VAL A . n 
A 1 258 LEU 258 246 246 LEU LEU A . n 
A 1 259 PRO 259 247 247 PRO PRO A . n 
A 1 260 GLU 260 248 248 GLU GLU A . n 
A 1 261 LYS 261 249 249 LYS LYS A . n 
A 1 262 ASP 262 250 250 ASP ASP A . n 
A 1 263 SER 263 251 251 SER SER A . n 
A 1 264 TRP 264 252 252 TRP TRP A . n 
A 1 265 THR 265 253 253 THR THR A . n 
A 1 266 VAL 266 254 254 VAL VAL A . n 
A 1 267 ASN 267 255 255 ASN ASN A . n 
A 1 268 ASP 268 256 256 ASP ASP A . n 
A 1 269 ILE 269 257 257 ILE ILE A . n 
A 1 270 CYS 270 258 258 CYS CYS A . n 
A 1 271 LYS 271 259 259 LYS LYS A . n 
A 1 272 LEU 272 260 260 LEU LEU A . n 
A 1 273 VAL 273 261 261 VAL VAL A . n 
A 1 274 GLY 274 262 262 GLY GLY A . n 
A 1 275 LYS 275 263 263 LYS LYS A . n 
A 1 276 LEU 276 264 264 LEU LEU A . n 
A 1 277 ASN 277 265 265 ASN ASN A . n 
A 1 278 TRP 278 266 266 TRP TRP A . n 
A 1 279 ALA 279 267 267 ALA ALA A . n 
A 1 280 SER 280 268 268 SER SER A . n 
A 1 281 GLN 281 269 269 GLN GLN A . n 
A 1 282 ILE 282 270 270 ILE ILE A . n 
A 1 283 TYR 283 271 271 TYR TYR A . n 
A 1 284 PRO 284 272 272 PRO PRO A . n 
A 1 285 GLY 285 273 273 GLY GLY A . n 
A 1 286 ILE 286 274 274 ILE ILE A . n 
A 1 287 LYS 287 275 275 LYS LYS A . n 
A 1 288 VAL 288 276 276 VAL VAL A . n 
A 1 289 ARG 289 277 277 ARG ARG A . n 
A 1 290 GLN 290 278 278 GLN GLN A . n 
A 1 291 LEU 291 279 279 LEU LEU A . n 
A 1 292 SER 292 280 280 SER SER A . n 
A 1 293 LYS 293 281 281 LYS LYS A . n 
A 1 294 LEU 294 282 282 LEU LEU A . n 
A 1 295 LEU 295 283 283 LEU LEU A . n 
A 1 296 ARG 296 284 284 ARG ARG A . n 
A 1 297 GLY 297 285 285 GLY GLY A . n 
A 1 298 THR 298 286 286 THR THR A . n 
A 1 299 LYS 299 287 287 LYS LYS A . n 
A 1 300 ALA 300 288 288 ALA ALA A . n 
A 1 301 LEU 301 289 289 LEU LEU A . n 
A 1 302 THR 302 290 290 THR THR A . n 
A 1 303 GLU 303 291 291 GLU GLU A . n 
A 1 304 VAL 304 292 292 VAL VAL A . n 
A 1 305 ILE 305 293 293 ILE ILE A . n 
A 1 306 PRO 306 294 294 PRO PRO A . n 
A 1 307 LEU 307 295 295 LEU LEU A . n 
A 1 308 THR 308 296 296 THR THR A . n 
A 1 309 GLU 309 297 297 GLU GLU A . n 
A 1 310 GLU 310 298 298 GLU GLU A . n 
A 1 311 ALA 311 299 299 ALA ALA A . n 
A 1 312 GLU 312 300 300 GLU GLU A . n 
A 1 313 LEU 313 301 301 LEU LEU A . n 
A 1 314 GLU 314 302 302 GLU GLU A . n 
A 1 315 LEU 315 303 303 LEU LEU A . n 
A 1 316 ALA 316 304 304 ALA ALA A . n 
A 1 317 GLU 317 305 305 GLU GLU A . n 
A 1 318 ASN 318 306 306 ASN ASN A . n 
A 1 319 ARG 319 307 307 ARG ARG A . n 
A 1 320 GLU 320 308 308 GLU GLU A . n 
A 1 321 ILE 321 309 309 ILE ILE A . n 
A 1 322 LEU 322 310 310 LEU LEU A . n 
A 1 323 LYS 323 311 311 LYS LYS A . n 
A 1 324 GLU 324 312 312 GLU GLU A . n 
A 1 325 PRO 325 313 313 PRO PRO A . n 
A 1 326 VAL 326 314 314 VAL VAL A . n 
A 1 327 HIS 327 315 315 HIS HIS A . n 
A 1 328 GLY 328 316 316 GLY GLY A . n 
A 1 329 VAL 329 317 317 VAL VAL A . n 
A 1 330 TYR 330 318 318 TYR TYR A . n 
A 1 331 TYR 331 319 319 TYR TYR A . n 
A 1 332 ASP 332 320 320 ASP ASP A . n 
A 1 333 PRO 333 321 321 PRO PRO A . n 
A 1 334 SER 334 322 322 SER SER A . n 
A 1 335 LYS 335 323 323 LYS LYS A . n 
A 1 336 ASP 336 324 324 ASP ASP A . n 
A 1 337 LEU 337 325 325 LEU LEU A . n 
A 1 338 ILE 338 326 326 ILE ILE A . n 
A 1 339 ALA 339 327 327 ALA ALA A . n 
A 1 340 GLU 340 328 328 GLU GLU A . n 
A 1 341 ILE 341 329 329 ILE ILE A . n 
A 1 342 GLN 342 330 330 GLN GLN A . n 
A 1 343 LYS 343 331 331 LYS LYS A . n 
A 1 344 GLN 344 332 332 GLN GLN A . n 
A 1 345 GLY 345 333 333 GLY GLY A . n 
A 1 346 GLN 346 334 334 GLN GLN A . n 
A 1 347 GLY 347 335 335 GLY GLY A . n 
A 1 348 GLN 348 336 336 GLN GLN A . n 
A 1 349 TRP 349 337 337 TRP TRP A . n 
A 1 350 THR 350 338 338 THR THR A . n 
A 1 351 TYR 351 339 339 TYR TYR A . n 
A 1 352 GLN 352 340 340 GLN GLN A . n 
A 1 353 ILE 353 341 341 ILE ILE A . n 
A 1 354 TYR 354 342 342 TYR TYR A . n 
A 1 355 GLN 355 343 343 GLN GLN A . n 
A 1 356 GLU 356 344 344 GLU GLU A . n 
A 1 357 PRO 357 345 345 PRO PRO A . n 
A 1 358 PHE 358 346 346 PHE PHE A . n 
A 1 359 LYS 359 347 347 LYS LYS A . n 
A 1 360 ASN 360 348 348 ASN ASN A . n 
A 1 361 LEU 361 349 349 LEU LEU A . n 
A 1 362 LYS 362 350 350 LYS LYS A . n 
A 1 363 THR 363 351 351 THR THR A . n 
A 1 364 GLY 364 352 352 GLY GLY A . n 
A 1 365 LYS 365 353 353 LYS LYS A . n 
A 1 366 TYR 366 354 354 TYR TYR A . n 
A 1 367 ALA 367 355 355 ALA ALA A . n 
A 1 368 ARG 368 356 356 ARG ARG A . n 
A 1 369 MET 369 357 357 MET MET A . n 
A 1 370 ARG 370 358 358 ARG ARG A . n 
A 1 371 GLY 371 359 359 GLY GLY A . n 
A 1 372 ALA 372 360 360 ALA ALA A . n 
A 1 373 HIS 373 361 361 HIS HIS A . n 
A 1 374 THR 374 362 362 THR THR A . n 
A 1 375 ASN 375 363 363 ASN ASN A . n 
A 1 376 ASP 376 364 364 ASP ASP A . n 
A 1 377 VAL 377 365 365 VAL VAL A . n 
A 1 378 LYS 378 366 366 LYS LYS A . n 
A 1 379 GLN 379 367 367 GLN GLN A . n 
A 1 380 LEU 380 368 368 LEU LEU A . n 
A 1 381 THR 381 369 369 THR THR A . n 
A 1 382 GLU 382 370 370 GLU GLU A . n 
A 1 383 ALA 383 371 371 ALA ALA A . n 
A 1 384 VAL 384 372 372 VAL VAL A . n 
A 1 385 GLN 385 373 373 GLN GLN A . n 
A 1 386 LYS 386 374 374 LYS LYS A . n 
A 1 387 ILE 387 375 375 ILE ILE A . n 
A 1 388 THR 388 376 376 THR THR A . n 
A 1 389 THR 389 377 377 THR THR A . n 
A 1 390 GLU 390 378 378 GLU GLU A . n 
A 1 391 SER 391 379 379 SER SER A . n 
A 1 392 ILE 392 380 380 ILE ILE A . n 
A 1 393 VAL 393 381 381 VAL VAL A . n 
A 1 394 ILE 394 382 382 ILE ILE A . n 
A 1 395 TRP 395 383 383 TRP TRP A . n 
A 1 396 GLY 396 384 384 GLY GLY A . n 
A 1 397 LYS 397 385 385 LYS LYS A . n 
A 1 398 THR 398 386 386 THR THR A . n 
A 1 399 PRO 399 387 387 PRO PRO A . n 
A 1 400 LYS 400 388 388 LYS LYS A . n 
A 1 401 PHE 401 389 389 PHE PHE A . n 
A 1 402 LYS 402 390 390 LYS LYS A . n 
A 1 403 LEU 403 391 391 LEU LEU A . n 
A 1 404 PRO 404 392 392 PRO PRO A . n 
A 1 405 ILE 405 393 393 ILE ILE A . n 
A 1 406 GLN 406 394 394 GLN GLN A . n 
A 1 407 LYS 407 395 395 LYS LYS A . n 
A 1 408 GLU 408 396 396 GLU GLU A . n 
A 1 409 THR 409 397 397 THR THR A . n 
A 1 410 TRP 410 398 398 TRP TRP A . n 
A 1 411 GLU 411 399 399 GLU GLU A . n 
A 1 412 THR 412 400 400 THR THR A . n 
A 1 413 TRP 413 401 401 TRP TRP A . n 
A 1 414 TRP 414 402 402 TRP TRP A . n 
A 1 415 THR 415 403 403 THR THR A . n 
A 1 416 GLU 416 404 404 GLU GLU A . n 
A 1 417 TYR 417 405 405 TYR TYR A . n 
A 1 418 TRP 418 406 406 TRP TRP A . n 
A 1 419 GLN 419 407 407 GLN GLN A . n 
A 1 420 ALA 420 408 408 ALA ALA A . n 
A 1 421 THR 421 409 409 THR THR A . n 
A 1 422 TRP 422 410 410 TRP TRP A . n 
A 1 423 ILE 423 411 411 ILE ILE A . n 
A 1 424 PRO 424 412 412 PRO PRO A . n 
A 1 425 GLU 425 413 413 GLU GLU A . n 
A 1 426 TRP 426 414 414 TRP TRP A . n 
A 1 427 GLU 427 415 415 GLU GLU A . n 
A 1 428 PHE 428 416 416 PHE PHE A . n 
A 1 429 VAL 429 417 417 VAL VAL A . n 
A 1 430 ASN 430 418 418 ASN ASN A . n 
A 1 431 THR 431 419 419 THR THR A . n 
A 1 432 PRO 432 420 420 PRO PRO A . n 
A 1 433 PRO 433 421 421 PRO PRO A . n 
A 1 434 LEU 434 422 422 LEU LEU A . n 
A 1 435 VAL 435 423 423 VAL VAL A . n 
A 1 436 LYS 436 424 424 LYS LYS A . n 
A 1 437 LEU 437 425 425 LEU LEU A . n 
A 1 438 TRP 438 426 426 TRP TRP A . n 
A 1 439 TYR 439 427 427 TYR TYR A . n 
A 1 440 GLN 440 428 428 GLN GLN A . n 
A 1 441 LEU 441 429 429 LEU LEU A . n 
A 1 442 GLU 442 430 430 GLU GLU A . n 
A 1 443 LYS 443 431 431 LYS LYS A . n 
A 1 444 GLU 444 432 432 GLU GLU A . n 
A 1 445 PRO 445 433 433 PRO PRO A . n 
A 1 446 ILE 446 434 434 ILE ILE A . n 
A 1 447 VAL 447 435 435 VAL VAL A . n 
A 1 448 GLY 448 436 436 GLY GLY A . n 
A 1 449 ALA 449 437 437 ALA ALA A . n 
A 1 450 GLU 450 438 438 GLU GLU A . n 
A 1 451 THR 451 439 439 THR THR A . n 
A 1 452 PHE 452 440 440 PHE PHE A . n 
A 1 453 TYR 453 441 441 TYR TYR A . n 
A 1 454 VAL 454 442 442 VAL VAL A . n 
A 1 455 ASP 455 443 443 ASP ASP A . n 
A 1 456 GLY 456 444 444 GLY GLY A . n 
A 1 457 ALA 457 445 445 ALA ALA A . n 
A 1 458 ALA 458 446 446 ALA ALA A . n 
A 1 459 ASN 459 447 447 ASN ASN A . n 
A 1 460 ARG 460 448 448 ARG ARG A . n 
A 1 461 GLU 461 449 449 GLU GLU A . n 
A 1 462 THR 462 450 450 THR THR A . n 
A 1 463 LYS 463 451 451 LYS LYS A . n 
A 1 464 LEU 464 452 452 LEU LEU A . n 
A 1 465 GLY 465 453 453 GLY GLY A . n 
A 1 466 LYS 466 454 454 LYS LYS A . n 
A 1 467 ALA 467 455 455 ALA ALA A . n 
A 1 468 GLY 468 456 456 GLY GLY A . n 
A 1 469 TYR 469 457 457 TYR TYR A . n 
A 1 470 VAL 470 458 458 VAL VAL A . n 
A 1 471 THR 471 459 459 THR THR A . n 
A 1 472 ASN 472 460 460 ASN ASN A . n 
A 1 473 ARG 473 461 461 ARG ARG A . n 
A 1 474 GLY 474 462 462 GLY GLY A . n 
A 1 475 ARG 475 463 463 ARG ARG A . n 
A 1 476 GLN 476 464 464 GLN GLN A . n 
A 1 477 LYS 477 465 465 LYS LYS A . n 
A 1 478 VAL 478 466 466 VAL VAL A . n 
A 1 479 VAL 479 467 467 VAL VAL A . n 
A 1 480 THR 480 468 468 THR THR A . n 
A 1 481 LEU 481 469 469 LEU LEU A . n 
A 1 482 THR 482 470 470 THR THR A . n 
A 1 483 ASP 483 471 471 ASP ASP A . n 
A 1 484 THR 484 472 472 THR THR A . n 
A 1 485 THR 485 473 473 THR THR A . n 
A 1 486 ASN 486 474 474 ASN ASN A . n 
A 1 487 GLN 487 475 475 GLN GLN A . n 
A 1 488 LYS 488 476 476 LYS LYS A . n 
A 1 489 THR 489 477 477 THR THR A . n 
A 1 490 GLU 490 478 478 GLU GLU A . n 
A 1 491 LEU 491 479 479 LEU LEU A . n 
A 1 492 GLN 492 480 480 GLN GLN A . n 
A 1 493 ALA 493 481 481 ALA ALA A . n 
A 1 494 ILE 494 482 482 ILE ILE A . n 
A 1 495 TYR 495 483 483 TYR TYR A . n 
A 1 496 LEU 496 484 484 LEU LEU A . n 
A 1 497 ALA 497 485 485 ALA ALA A . n 
A 1 498 LEU 498 486 486 LEU LEU A . n 
A 1 499 GLN 499 487 487 GLN GLN A . n 
A 1 500 ASP 500 488 488 ASP ASP A . n 
A 1 501 SER 501 489 489 SER SER A . n 
A 1 502 GLY 502 490 490 GLY GLY A . n 
A 1 503 LEU 503 491 491 LEU LEU A . n 
A 1 504 GLU 504 492 492 GLU GLU A . n 
A 1 505 VAL 505 493 493 VAL VAL A . n 
A 1 506 ASN 506 494 494 ASN ASN A . n 
A 1 507 ILE 507 495 495 ILE ILE A . n 
A 1 508 VAL 508 496 496 VAL VAL A . n 
A 1 509 THR 509 497 497 THR THR A . n 
A 1 510 ASP 510 498 498 ASP ASP A . n 
A 1 511 SER 511 499 499 SER SER A . n 
A 1 512 GLN 512 500 500 GLN GLN A . n 
A 1 513 TYR 513 501 501 TYR TYR A . n 
A 1 514 ALA 514 502 502 ALA ALA A . n 
A 1 515 LEU 515 503 503 LEU LEU A . n 
A 1 516 GLY 516 504 504 GLY GLY A . n 
A 1 517 ILE 517 505 505 ILE ILE A . n 
A 1 518 ILE 518 506 506 ILE ILE A . n 
A 1 519 GLN 519 507 507 GLN GLN A . n 
A 1 520 ALA 520 508 508 ALA ALA A . n 
A 1 521 GLN 521 509 509 GLN GLN A . n 
A 1 522 PRO 522 510 510 PRO PRO A . n 
A 1 523 ASP 523 511 511 ASP ASP A . n 
A 1 524 GLN 524 512 512 GLN GLN A . n 
A 1 525 SER 525 513 513 SER SER A . n 
A 1 526 GLU 526 514 514 GLU GLU A . n 
A 1 527 SER 527 515 515 SER SER A . n 
A 1 528 GLU 528 516 516 GLU GLU A . n 
A 1 529 LEU 529 517 517 LEU LEU A . n 
A 1 530 VAL 530 518 518 VAL VAL A . n 
A 1 531 ASN 531 519 519 ASN ASN A . n 
A 1 532 GLN 532 520 520 GLN GLN A . n 
A 1 533 ILE 533 521 521 ILE ILE A . n 
A 1 534 ILE 534 522 522 ILE ILE A . n 
A 1 535 GLU 535 523 523 GLU GLU A . n 
A 1 536 GLN 536 524 524 GLN GLN A . n 
A 1 537 LEU 537 525 525 LEU LEU A . n 
A 1 538 ILE 538 526 526 ILE ILE A . n 
A 1 539 LYS 539 527 527 LYS LYS A . n 
A 1 540 LYS 540 528 528 LYS LYS A . n 
A 1 541 GLU 541 529 529 GLU GLU A . n 
A 1 542 LYS 542 530 530 LYS LYS A . n 
A 1 543 VAL 543 531 531 VAL VAL A . n 
A 1 544 TYR 544 532 532 TYR TYR A . n 
A 1 545 LEU 545 533 533 LEU LEU A . n 
A 1 546 ALA 546 534 534 ALA ALA A . n 
A 1 547 TRP 547 535 535 TRP TRP A . n 
A 1 548 VAL 548 536 536 VAL VAL A . n 
A 1 549 PRO 549 537 537 PRO PRO A . n 
A 1 550 ALA 550 538 538 ALA ALA A . n 
A 1 551 HIS 551 539 539 HIS HIS A . n 
A 1 552 LYS 552 540 540 LYS LYS A . n 
A 1 553 GLY 553 541 541 GLY GLY A . n 
A 1 554 ILE 554 542 542 ILE ILE A . n 
A 1 555 GLY 555 543 543 GLY GLY A . n 
A 1 556 GLY 556 544 544 GLY GLY A . n 
A 1 557 ASN 557 545 545 ASN ASN A . n 
A 1 558 GLU 558 546 546 GLU GLU A . n 
A 1 559 GLN 559 547 547 GLN GLN A . n 
A 1 560 VAL 560 548 548 VAL VAL A . n 
A 1 561 ASP 561 549 549 ASP ASP A . n 
A 1 562 LYS 562 550 550 LYS LYS A . n 
A 1 563 LEU 563 551 551 LEU LEU A . n 
A 1 564 VAL 564 552 552 VAL VAL A . n 
A 1 565 SER 565 553 553 SER SER A . n 
A 1 566 ALA 566 554 554 ALA ALA A . n 
A 1 567 GLY 567 555 555 GLY GLY A . n 
A 1 568 ILE 568 556 556 ILE ILE A . n 
A 1 569 ARG 569 557 ?   ?   ?   A . n 
A 1 570 LYS 570 558 ?   ?   ?   A . n 
A 1 571 VAL 571 559 ?   ?   ?   A . n 
A 1 572 LEU 572 560 ?   ?   ?   A . n 
B 2 1   PRO 1   1   ?   ?   ?   B . n 
B 2 2   ILE 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   PRO 4   4   ?   ?   ?   B . n 
B 2 5   ILE 5   5   ?   ?   ?   B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  MET 16  16  16  MET MET B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  TRP 24  24  24  TRP TRP B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  45  45  GLY GLY B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  PRO 52  52  52  PRO PRO B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ASN 54  54  54  ASN ASN B . n 
B 2 55  PRO 55  55  55  PRO PRO B . n 
B 2 56  TYR 56  56  56  TYR TYR B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  LYS 64  64  64  LYS LYS B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  ASP 67  67  67  ASP ASP B . n 
B 2 68  SER 68  68  68  SER SER B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  TRP 71  71  71  TRP TRP B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  LEU 74  74  74  LEU LEU B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  ARG 78  78  78  ARG ARG B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  GLN 85  85  85  GLN GLN B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  PHE 87  87  ?   ?   ?   B . n 
B 2 88  TRP 88  88  ?   ?   ?   B . n 
B 2 89  GLU 89  89  ?   ?   ?   B . n 
B 2 90  VAL 90  90  ?   ?   ?   B . n 
B 2 91  GLN 91  91  ?   ?   ?   B . n 
B 2 92  LEU 92  92  ?   ?   ?   B . n 
B 2 93  GLY 93  93  ?   ?   ?   B . n 
B 2 94  ILE 94  94  ?   ?   ?   B . n 
B 2 95  PRO 95  95  ?   ?   ?   B . n 
B 2 96  HIS 96  96  96  HIS HIS B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  GLY 99  99  99  GLY GLY B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 LYS 103 103 103 LYS LYS B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 ASP 113 113 113 ASP ASP B . n 
B 2 114 ALA 114 114 114 ALA ALA B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 PHE 116 116 116 PHE PHE B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 GLU 122 122 122 GLU GLU B . n 
B 2 123 ASP 123 123 123 ASP ASP B . n 
B 2 124 PHE 124 124 124 PHE PHE B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 THR 128 128 128 THR THR B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 THR 131 131 131 THR THR B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 ASN 137 137 137 ASN ASN B . n 
B 2 138 GLU 138 138 138 GLU GLU B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 ARG 143 143 143 ARG ARG B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 TYR 146 146 146 TYR TYR B . n 
B 2 147 ASN 147 147 147 ASN ASN B . n 
B 2 148 VAL 148 148 148 VAL VAL B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 PRO 150 150 150 PRO PRO B . n 
B 2 151 GLN 151 151 151 GLN GLN B . n 
B 2 152 GLY 152 152 152 GLY GLY B . n 
B 2 153 TRP 153 153 153 TRP TRP B . n 
B 2 154 LYS 154 154 154 LYS LYS B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 PRO 157 157 157 PRO PRO B . n 
B 2 158 ALA 158 158 158 ALA ALA B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 GLN 161 161 161 GLN GLN B . n 
B 2 162 SER 162 162 162 SER SER B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 MET 164 164 164 MET MET B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 LYS 166 166 166 LYS LYS B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 GLU 169 169 169 GLU GLU B . n 
B 2 170 PRO 170 170 170 PRO PRO B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 ARG 172 172 172 ARG ARG B . n 
B 2 173 LYS 173 173 173 LYS LYS B . n 
B 2 174 GLN 174 174 174 GLN GLN B . n 
B 2 175 ASN 175 175 175 ASN ASN B . n 
B 2 176 PRO 176 176 176 PRO PRO B . n 
B 2 177 ASP 177 177 177 ASP ASP B . n 
B 2 178 ILE 178 178 178 ILE ILE B . n 
B 2 179 VAL 179 179 179 VAL VAL B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 GLN 182 182 182 GLN GLN B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 MET 184 184 184 MET MET B . n 
B 2 185 ASP 185 185 185 ASP ASP B . n 
B 2 186 ASP 186 186 186 ASP ASP B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 TYR 188 188 188 TYR TYR B . n 
B 2 189 VAL 189 189 189 VAL VAL B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 GLU 194 194 194 GLU GLU B . n 
B 2 195 ILE 195 195 195 ILE ILE B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLN 197 197 197 GLN GLN B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 ARG 199 199 199 ARG ARG B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 ARG 206 206 206 ARG ARG B . n 
B 2 207 GLN 207 207 207 GLN GLN B . n 
B 2 208 HIS 208 208 208 HIS HIS B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 LEU 210 210 210 LEU LEU B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 TRP 212 212 212 TRP TRP B . n 
B 2 213 GLY 213 213 ?   ?   ?   B . n 
B 2 214 LEU 214 214 ?   ?   ?   B . n 
B 2 215 THR 215 215 ?   ?   ?   B . n 
B 2 216 THR 216 216 ?   ?   ?   B . n 
B 2 217 PRO 217 217 ?   ?   ?   B . n 
B 2 218 ASP 218 218 ?   ?   ?   B . n 
B 2 219 LYS 219 219 ?   ?   ?   B . n 
B 2 220 LYS 220 220 ?   ?   ?   B . n 
B 2 221 HIS 221 221 ?   ?   ?   B . n 
B 2 222 GLN 222 222 ?   ?   ?   B . n 
B 2 223 LYS 223 223 ?   ?   ?   B . n 
B 2 224 GLU 224 224 ?   ?   ?   B . n 
B 2 225 PRO 225 225 ?   ?   ?   B . n 
B 2 226 PRO 226 226 ?   ?   ?   B . n 
B 2 227 PHE 227 227 ?   ?   ?   B . n 
B 2 228 LEU 228 228 ?   ?   ?   B . n 
B 2 229 TRP 229 229 ?   ?   ?   B . n 
B 2 230 MET 230 230 ?   ?   ?   B . n 
B 2 231 GLY 231 231 ?   ?   ?   B . n 
B 2 232 TYR 232 232 ?   ?   ?   B . n 
B 2 233 GLU 233 233 233 GLU GLU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 HIS 235 235 235 HIS HIS B . n 
B 2 236 PRO 236 236 236 PRO PRO B . n 
B 2 237 ASP 237 237 237 ASP ASP B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 TRP 239 239 239 TRP TRP B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 VAL 241 241 241 VAL VAL B . n 
B 2 242 GLN 242 242 242 GLN GLN B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 VAL 245 245 245 VAL VAL B . n 
B 2 246 LEU 246 246 246 LEU LEU B . n 
B 2 247 PRO 247 247 247 PRO PRO B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 LYS 249 249 249 LYS LYS B . n 
B 2 250 ASP 250 250 250 ASP ASP B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 TRP 252 252 252 TRP TRP B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 VAL 254 254 254 VAL VAL B . n 
B 2 255 ASN 255 255 255 ASN ASN B . n 
B 2 256 ASP 256 256 256 ASP ASP B . n 
B 2 257 ILE 257 257 257 ILE ILE B . n 
B 2 258 GLN 258 258 258 GLN GLN B . n 
B 2 259 LYS 259 259 259 LYS LYS B . n 
B 2 260 LEU 260 260 260 LEU LEU B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 GLY 262 262 262 GLY GLY B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 LEU 264 264 264 LEU LEU B . n 
B 2 265 ASN 265 265 265 ASN ASN B . n 
B 2 266 TRP 266 266 266 TRP TRP B . n 
B 2 267 ALA 267 267 267 ALA ALA B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 ILE 270 270 270 ILE ILE B . n 
B 2 271 TYR 271 271 271 TYR TYR B . n 
B 2 272 PRO 272 272 272 PRO PRO B . n 
B 2 273 GLY 273 273 273 GLY GLY B . n 
B 2 274 ILE 274 274 274 ILE ILE B . n 
B 2 275 LYS 275 275 275 LYS LYS B . n 
B 2 276 VAL 276 276 276 VAL VAL B . n 
B 2 277 ARG 277 277 277 ARG ARG B . n 
B 2 278 GLN 278 278 278 GLN GLN B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 SER 280 280 280 SER SER B . n 
B 2 281 LYS 281 281 281 LYS LYS B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 LEU 283 283 283 LEU LEU B . n 
B 2 284 ARG 284 284 284 ARG ARG B . n 
B 2 285 GLY 285 285 285 GLY GLY B . n 
B 2 286 THR 286 286 286 THR THR B . n 
B 2 287 LYS 287 287 287 LYS LYS B . n 
B 2 288 ALA 288 288 288 ALA ALA B . n 
B 2 289 LEU 289 289 289 LEU LEU B . n 
B 2 290 THR 290 290 290 THR THR B . n 
B 2 291 GLU 291 291 291 GLU GLU B . n 
B 2 292 VAL 292 292 292 VAL VAL B . n 
B 2 293 ILE 293 293 293 ILE ILE B . n 
B 2 294 PRO 294 294 294 PRO PRO B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 THR 296 296 296 THR THR B . n 
B 2 297 GLU 297 297 297 GLU GLU B . n 
B 2 298 GLU 298 298 298 GLU GLU B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 GLU 300 300 300 GLU GLU B . n 
B 2 301 LEU 301 301 301 LEU LEU B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 LEU 303 303 303 LEU LEU B . n 
B 2 304 ALA 304 304 304 ALA ALA B . n 
B 2 305 GLU 305 305 305 GLU GLU B . n 
B 2 306 ASN 306 306 306 ASN ASN B . n 
B 2 307 ARG 307 307 307 ARG ARG B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ILE 309 309 309 ILE ILE B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LYS 311 311 311 LYS LYS B . n 
B 2 312 GLU 312 312 312 GLU GLU B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 HIS 315 315 315 HIS HIS B . n 
B 2 316 GLY 316 316 316 GLY GLY B . n 
B 2 317 VAL 317 317 317 VAL VAL B . n 
B 2 318 TYR 318 318 318 TYR TYR B . n 
B 2 319 TYR 319 319 319 TYR TYR B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 SER 322 322 322 SER SER B . n 
B 2 323 LYS 323 323 323 LYS LYS B . n 
B 2 324 ASP 324 324 324 ASP ASP B . n 
B 2 325 LEU 325 325 325 LEU LEU B . n 
B 2 326 ILE 326 326 326 ILE ILE B . n 
B 2 327 ALA 327 327 327 ALA ALA B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 ILE 329 329 329 ILE ILE B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 LYS 331 331 331 LYS LYS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLY 333 333 333 GLY GLY B . n 
B 2 334 GLN 334 334 334 GLN GLN B . n 
B 2 335 GLY 335 335 335 GLY GLY B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 TRP 337 337 337 TRP TRP B . n 
B 2 338 THR 338 338 338 THR THR B . n 
B 2 339 TYR 339 339 339 TYR TYR B . n 
B 2 340 GLN 340 340 340 GLN GLN B . n 
B 2 341 ILE 341 341 341 ILE ILE B . n 
B 2 342 TYR 342 342 342 TYR TYR B . n 
B 2 343 GLN 343 343 343 GLN GLN B . n 
B 2 344 GLU 344 344 344 GLU GLU B . n 
B 2 345 PRO 345 345 345 PRO PRO B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 ASN 348 348 348 ASN ASN B . n 
B 2 349 LEU 349 349 349 LEU LEU B . n 
B 2 350 LYS 350 350 350 LYS LYS B . n 
B 2 351 THR 351 351 351 THR THR B . n 
B 2 352 GLY 352 352 352 GLY GLY B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 TYR 354 354 354 TYR TYR B . n 
B 2 355 ALA 355 355 355 ALA ALA B . n 
B 2 356 ARG 356 356 356 ARG ARG B . n 
B 2 357 MET 357 357 357 MET MET B . n 
B 2 358 ARG 358 358 ?   ?   ?   B . n 
B 2 359 GLY 359 359 ?   ?   ?   B . n 
B 2 360 ALA 360 360 ?   ?   ?   B . n 
B 2 361 HIS 361 361 ?   ?   ?   B . n 
B 2 362 THR 362 362 362 THR THR B . n 
B 2 363 ASN 363 363 363 ASN ASN B . n 
B 2 364 ASP 364 364 364 ASP ASP B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 LYS 366 366 366 LYS LYS B . n 
B 2 367 GLN 367 367 367 GLN GLN B . n 
B 2 368 LEU 368 368 368 LEU LEU B . n 
B 2 369 THR 369 369 369 THR THR B . n 
B 2 370 GLU 370 370 370 GLU GLU B . n 
B 2 371 ALA 371 371 371 ALA ALA B . n 
B 2 372 VAL 372 372 372 VAL VAL B . n 
B 2 373 GLN 373 373 373 GLN GLN B . n 
B 2 374 LYS 374 374 374 LYS LYS B . n 
B 2 375 ILE 375 375 375 ILE ILE B . n 
B 2 376 THR 376 376 376 THR THR B . n 
B 2 377 THR 377 377 377 THR THR B . n 
B 2 378 GLU 378 378 378 GLU GLU B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 ILE 380 380 380 ILE ILE B . n 
B 2 381 VAL 381 381 381 VAL VAL B . n 
B 2 382 ILE 382 382 382 ILE ILE B . n 
B 2 383 TRP 383 383 383 TRP TRP B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 LYS 385 385 385 LYS LYS B . n 
B 2 386 THR 386 386 386 THR THR B . n 
B 2 387 PRO 387 387 387 PRO PRO B . n 
B 2 388 LYS 388 388 388 LYS LYS B . n 
B 2 389 PHE 389 389 389 PHE PHE B . n 
B 2 390 LYS 390 390 390 LYS LYS B . n 
B 2 391 LEU 391 391 391 LEU LEU B . n 
B 2 392 PRO 392 392 392 PRO PRO B . n 
B 2 393 ILE 393 393 393 ILE ILE B . n 
B 2 394 GLN 394 394 394 GLN GLN B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 GLU 396 396 396 GLU GLU B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 TRP 398 398 398 TRP TRP B . n 
B 2 399 GLU 399 399 399 GLU GLU B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 TRP 401 401 401 TRP TRP B . n 
B 2 402 TRP 402 402 402 TRP TRP B . n 
B 2 403 THR 403 403 403 THR THR B . n 
B 2 404 GLU 404 404 404 GLU GLU B . n 
B 2 405 TYR 405 405 405 TYR TYR B . n 
B 2 406 TRP 406 406 406 TRP TRP B . n 
B 2 407 GLN 407 407 407 GLN GLN B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 THR 409 409 409 THR THR B . n 
B 2 410 TRP 410 410 410 TRP TRP B . n 
B 2 411 ILE 411 411 411 ILE ILE B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 GLU 413 413 413 GLU GLU B . n 
B 2 414 TRP 414 414 414 TRP TRP B . n 
B 2 415 GLU 415 415 415 GLU GLU B . n 
B 2 416 PHE 416 416 416 PHE PHE B . n 
B 2 417 VAL 417 417 417 VAL VAL B . n 
B 2 418 ASN 418 418 418 ASN ASN B . n 
B 2 419 THR 419 419 419 THR THR B . n 
B 2 420 PRO 420 420 420 PRO PRO B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 VAL 423 423 423 VAL VAL B . n 
B 2 424 LYS 424 424 424 LYS LYS B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 TRP 426 426 426 TRP TRP B . n 
B 2 427 TYR 427 427 427 TYR TYR B . n 
B 2 428 GLN 428 428 428 GLN GLN B . n 
B 2 429 LEU 429 429 429 LEU LEU B . n 
B 2 430 GLU 430 430 ?   ?   ?   B . n 
B 2 431 LYS 431 431 ?   ?   ?   B . n 
B 2 432 GLU 432 432 ?   ?   ?   B . n 
B 2 433 PRO 433 433 ?   ?   ?   B . n 
B 2 434 ILE 434 434 ?   ?   ?   B . n 
B 2 435 VAL 435 435 ?   ?   ?   B . n 
B 2 436 GLY 436 436 ?   ?   ?   B . n 
B 2 437 ALA 437 437 ?   ?   ?   B . n 
B 2 438 GLU 438 438 ?   ?   ?   B . n 
B 2 439 THR 439 439 ?   ?   ?   B . n 
B 2 440 PHE 440 440 ?   ?   ?   B . n 
C 3 1   DA  1   802 ?   ?   ?   P . n 
C 3 2   DC  2   803 ?   ?   ?   P . n 
C 3 3   DA  3   804 ?   ?   ?   P . n 
C 3 4   DG  4   805 805 DG  DG  P . n 
C 3 5   DT  5   806 806 DT  DT  P . n 
C 3 6   DC  6   807 807 DC  DC  P . n 
C 3 7   DC  7   808 808 DC  DC  P . n 
C 3 8   DC  8   809 809 DC  DC  P . n 
C 3 9   DT  9   810 810 DT  DT  P . n 
C 3 10  DG  10  811 811 DG  DG  P . n 
C 3 11  DT  11  812 812 DT  DT  P . n 
C 3 12  DT  12  813 813 DT  DT  P . n 
C 3 13  DC  13  814 814 DC  DC  P . n 
C 3 14  DG  14  815 815 DG  DG  P . n 
C 3 15  DG  15  816 816 DG  DG  P . n 
C 3 16  DG  16  817 817 DG  DG  P . n 
C 3 17  DC  17  818 818 DC  DC  P . n 
C 3 18  DG  18  819 819 DG  DG  P . n 
C 3 19  DC  19  820 820 DC  DC  P . n 
C 3 20  DC  20  821 821 DC  DC  P . n 
C 3 21  DOC 21  822 822 DOC DOC P . n 
D 4 1   DA  1   701 ?   ?   ?   T . n 
D 4 2   DT  2   702 ?   ?   ?   T . n 
D 4 3   DG  3   703 ?   ?   ?   T . n 
D 4 4   DG  4   704 704 DG  DG  T . n 
D 4 5   DG  5   705 705 DG  DG  T . n 
D 4 6   DG  6   706 706 DG  DG  T . n 
D 4 7   DG  7   707 707 DG  DG  T . n 
D 4 8   DG  8   708 708 DG  DG  T . n 
D 4 9   DC  9   709 709 DC  DC  T . n 
D 4 10  DG  10  710 710 DG  DG  T . n 
D 4 11  DC  11  711 711 DC  DC  T . n 
D 4 12  DC  12  712 712 DC  DC  T . n 
D 4 13  DC  13  713 713 DC  DC  T . n 
D 4 14  DG  14  714 714 DG  DG  T . n 
D 4 15  DA  15  715 715 DA  DA  T . n 
D 4 16  DA  16  716 716 DA  DA  T . n 
D 4 17  DC  17  717 717 DC  DC  T . n 
D 4 18  DA  18  718 718 DA  DA  T . n 
D 4 19  DG  19  719 719 DG  DG  T . n 
D 4 20  DG  20  720 720 DG  DG  T . n 
D 4 21  DG  21  721 721 DG  DG  T . n 
D 4 22  DA  22  722 722 DA  DA  T . n 
D 4 23  DC  23  723 723 DC  DC  T . n 
D 4 24  DT  24  724 724 DT  DT  T . n 
D 4 25  DG  25  725 725 DG  DG  T . n 
D 4 26  DT  26  726 ?   ?   ?   T . n 
D 4 27  DG  27  727 ?   ?   ?   T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 1RZ 1   601 1   1RZ 1RZ A . 
F 6 SO4 1   602 561 SO4 SO4 A . 
G 6 SO4 1   603 562 SO4 SO4 A . 
H 7 MG  1   604 600 MG  MG  A . 
I 8 HOH 1   701 85  HOH HOH A . 
I 8 HOH 2   702 136 HOH HOH A . 
I 8 HOH 3   703 141 HOH HOH A . 
I 8 HOH 4   704 110 HOH HOH A . 
I 8 HOH 5   705 94  HOH HOH A . 
I 8 HOH 6   706 28  HOH HOH A . 
I 8 HOH 7   707 123 HOH HOH A . 
I 8 HOH 8   708 82  HOH HOH A . 
I 8 HOH 9   709 50  HOH HOH A . 
I 8 HOH 10  710 42  HOH HOH A . 
I 8 HOH 11  711 140 HOH HOH A . 
I 8 HOH 12  712 26  HOH HOH A . 
I 8 HOH 13  713 40  HOH HOH A . 
I 8 HOH 14  714 63  HOH HOH A . 
I 8 HOH 15  715 154 HOH HOH A . 
I 8 HOH 16  716 3   HOH HOH A . 
I 8 HOH 17  717 22  HOH HOH A . 
I 8 HOH 18  718 148 HOH HOH A . 
I 8 HOH 19  719 1   HOH HOH A . 
I 8 HOH 20  720 17  HOH HOH A . 
I 8 HOH 21  721 91  HOH HOH A . 
I 8 HOH 22  722 13  HOH HOH A . 
I 8 HOH 23  723 78  HOH HOH A . 
I 8 HOH 24  724 122 HOH HOH A . 
I 8 HOH 25  725 27  HOH HOH A . 
I 8 HOH 26  726 39  HOH HOH A . 
I 8 HOH 27  727 11  HOH HOH A . 
I 8 HOH 28  728 2   HOH HOH A . 
I 8 HOH 29  729 175 HOH HOH A . 
I 8 HOH 30  730 45  HOH HOH A . 
I 8 HOH 31  731 10  HOH HOH A . 
I 8 HOH 32  732 15  HOH HOH A . 
I 8 HOH 33  733 151 HOH HOH A . 
I 8 HOH 34  734 80  HOH HOH A . 
I 8 HOH 35  735 124 HOH HOH A . 
I 8 HOH 36  736 23  HOH HOH A . 
I 8 HOH 37  737 171 HOH HOH A . 
I 8 HOH 38  738 32  HOH HOH A . 
I 8 HOH 39  739 61  HOH HOH A . 
I 8 HOH 40  740 72  HOH HOH A . 
I 8 HOH 41  741 12  HOH HOH A . 
I 8 HOH 42  742 5   HOH HOH A . 
I 8 HOH 43  743 125 HOH HOH A . 
I 8 HOH 44  744 98  HOH HOH A . 
I 8 HOH 45  745 126 HOH HOH A . 
I 8 HOH 46  746 29  HOH HOH A . 
I 8 HOH 47  747 44  HOH HOH A . 
I 8 HOH 48  748 177 HOH HOH A . 
I 8 HOH 49  749 132 HOH HOH A . 
I 8 HOH 50  750 37  HOH HOH A . 
I 8 HOH 51  751 137 HOH HOH A . 
I 8 HOH 52  752 69  HOH HOH A . 
I 8 HOH 53  753 121 HOH HOH A . 
I 8 HOH 54  754 7   HOH HOH A . 
I 8 HOH 55  755 133 HOH HOH A . 
I 8 HOH 56  756 52  HOH HOH A . 
I 8 HOH 57  757 14  HOH HOH A . 
I 8 HOH 58  758 111 HOH HOH A . 
I 8 HOH 59  759 108 HOH HOH A . 
I 8 HOH 60  760 19  HOH HOH A . 
I 8 HOH 61  761 76  HOH HOH A . 
I 8 HOH 62  762 36  HOH HOH A . 
I 8 HOH 63  763 71  HOH HOH A . 
I 8 HOH 64  764 77  HOH HOH A . 
I 8 HOH 65  765 146 HOH HOH A . 
I 8 HOH 66  766 64  HOH HOH A . 
I 8 HOH 67  767 114 HOH HOH A . 
I 8 HOH 68  768 128 HOH HOH A . 
I 8 HOH 69  769 25  HOH HOH A . 
I 8 HOH 70  770 188 HOH HOH A . 
I 8 HOH 71  771 106 HOH HOH A . 
I 8 HOH 72  772 101 HOH HOH A . 
I 8 HOH 73  773 20  HOH HOH A . 
I 8 HOH 74  774 147 HOH HOH A . 
I 8 HOH 75  775 68  HOH HOH A . 
I 8 HOH 76  776 81  HOH HOH A . 
I 8 HOH 77  777 105 HOH HOH A . 
I 8 HOH 78  778 155 HOH HOH A . 
I 8 HOH 79  779 139 HOH HOH A . 
I 8 HOH 80  780 135 HOH HOH A . 
I 8 HOH 81  781 149 HOH HOH A . 
I 8 HOH 82  782 47  HOH HOH A . 
I 8 HOH 83  783 65  HOH HOH A . 
I 8 HOH 84  784 31  HOH HOH A . 
I 8 HOH 85  785 181 HOH HOH A . 
I 8 HOH 86  786 156 HOH HOH A . 
I 8 HOH 87  787 30  HOH HOH A . 
I 8 HOH 88  788 84  HOH HOH A . 
I 8 HOH 89  789 143 HOH HOH A . 
I 8 HOH 90  790 58  HOH HOH A . 
I 8 HOH 91  791 74  HOH HOH A . 
I 8 HOH 92  792 54  HOH HOH A . 
I 8 HOH 93  793 150 HOH HOH A . 
I 8 HOH 94  794 131 HOH HOH A . 
I 8 HOH 95  795 118 HOH HOH A . 
I 8 HOH 96  796 89  HOH HOH A . 
I 8 HOH 97  797 56  HOH HOH A . 
I 8 HOH 98  798 55  HOH HOH A . 
I 8 HOH 99  799 144 HOH HOH A . 
I 8 HOH 100 800 186 HOH HOH A . 
I 8 HOH 101 801 142 HOH HOH A . 
I 8 HOH 102 802 119 HOH HOH A . 
I 8 HOH 103 803 66  HOH HOH A . 
I 8 HOH 104 804 138 HOH HOH A . 
I 8 HOH 105 805 109 HOH HOH A . 
I 8 HOH 106 806 73  HOH HOH A . 
I 8 HOH 107 807 117 HOH HOH A . 
I 8 HOH 108 808 134 HOH HOH A . 
I 8 HOH 109 809 102 HOH HOH A . 
J 8 HOH 1   501 59  HOH HOH B . 
J 8 HOH 2   502 67  HOH HOH B . 
J 8 HOH 3   503 127 HOH HOH B . 
J 8 HOH 4   504 167 HOH HOH B . 
J 8 HOH 5   505 129 HOH HOH B . 
J 8 HOH 6   506 41  HOH HOH B . 
J 8 HOH 7   507 173 HOH HOH B . 
J 8 HOH 8   508 70  HOH HOH B . 
J 8 HOH 9   509 21  HOH HOH B . 
J 8 HOH 10  510 60  HOH HOH B . 
J 8 HOH 11  511 157 HOH HOH B . 
J 8 HOH 12  512 115 HOH HOH B . 
J 8 HOH 13  513 33  HOH HOH B . 
J 8 HOH 14  514 88  HOH HOH B . 
J 8 HOH 15  515 16  HOH HOH B . 
J 8 HOH 16  516 162 HOH HOH B . 
J 8 HOH 17  517 24  HOH HOH B . 
J 8 HOH 18  518 34  HOH HOH B . 
J 8 HOH 19  519 113 HOH HOH B . 
J 8 HOH 20  520 4   HOH HOH B . 
J 8 HOH 21  521 172 HOH HOH B . 
J 8 HOH 22  522 8   HOH HOH B . 
J 8 HOH 23  523 35  HOH HOH B . 
J 8 HOH 24  524 158 HOH HOH B . 
J 8 HOH 25  525 95  HOH HOH B . 
J 8 HOH 26  526 90  HOH HOH B . 
J 8 HOH 27  527 116 HOH HOH B . 
J 8 HOH 28  528 48  HOH HOH B . 
J 8 HOH 29  529 9   HOH HOH B . 
J 8 HOH 30  530 168 HOH HOH B . 
J 8 HOH 31  531 166 HOH HOH B . 
J 8 HOH 32  532 99  HOH HOH B . 
J 8 HOH 33  533 96  HOH HOH B . 
J 8 HOH 34  534 130 HOH HOH B . 
J 8 HOH 35  535 120 HOH HOH B . 
J 8 HOH 36  536 62  HOH HOH B . 
J 8 HOH 37  537 87  HOH HOH B . 
J 8 HOH 38  538 163 HOH HOH B . 
J 8 HOH 39  539 164 HOH HOH B . 
J 8 HOH 40  540 57  HOH HOH B . 
J 8 HOH 41  541 38  HOH HOH B . 
J 8 HOH 42  542 165 HOH HOH B . 
J 8 HOH 43  543 174 HOH HOH B . 
J 8 HOH 44  544 176 HOH HOH B . 
J 8 HOH 45  545 170 HOH HOH B . 
J 8 HOH 46  546 51  HOH HOH B . 
J 8 HOH 47  547 160 HOH HOH B . 
J 8 HOH 48  548 161 HOH HOH B . 
J 8 HOH 49  549 169 HOH HOH B . 
J 8 HOH 50  550 97  HOH HOH B . 
J 8 HOH 51  551 153 HOH HOH B . 
J 8 HOH 52  552 92  HOH HOH B . 
J 8 HOH 53  553 159 HOH HOH B . 
J 8 HOH 54  554 49  HOH HOH B . 
K 8 HOH 1   901 46  HOH HOH P . 
K 8 HOH 2   902 43  HOH HOH P . 
K 8 HOH 3   903 79  HOH HOH P . 
K 8 HOH 4   904 107 HOH HOH P . 
K 8 HOH 5   905 18  HOH HOH P . 
K 8 HOH 6   906 53  HOH HOH P . 
K 8 HOH 7   907 178 HOH HOH P . 
K 8 HOH 8   908 185 HOH HOH P . 
K 8 HOH 9   909 145 HOH HOH P . 
K 8 HOH 10  910 184 HOH HOH P . 
K 8 HOH 11  911 180 HOH HOH P . 
K 8 HOH 12  912 182 HOH HOH P . 
K 8 HOH 13  913 83  HOH HOH P . 
K 8 HOH 14  914 100 HOH HOH P . 
L 8 HOH 1   801 75  HOH HOH T . 
L 8 HOH 2   802 112 HOH HOH T . 
L 8 HOH 3   803 189 HOH HOH T . 
L 8 HOH 4   804 183 HOH HOH T . 
L 8 HOH 5   805 93  HOH HOH T . 
L 8 HOH 6   806 6   HOH HOH T . 
L 8 HOH 7   807 103 HOH HOH T . 
L 8 HOH 8   808 179 HOH HOH T . 
L 8 HOH 9   809 187 HOH HOH T . 
L 8 HOH 10  810 104 HOH HOH T . 
L 8 HOH 11  811 86  HOH HOH T . 
L 8 HOH 12  812 152 HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13120 ? 
1 MORE         -72   ? 
1 'SSA (A^2)'  45730 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     804 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O   ? A VAL 123 ? A VAL 111 ? 1_555 97.9  ? 
2  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 OD2 ? A ASP 197 ? A ASP 185 ? 1_555 98.8  ? 
3  O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 OD2 ? A ASP 197 ? A ASP 185 ? 1_555 102.7 ? 
4  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O3G B E 1RZ .   ? A 1RZ 601 ? 1_555 97.1  ? 
5  O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O3G B E 1RZ .   ? A 1RZ 601 ? 1_555 83.0  ? 
6  OD2 ? A ASP 197 ? A ASP 185 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O3G B E 1RZ .   ? A 1RZ 601 ? 1_555 162.2 ? 
7  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O1B A E 1RZ .   ? A 1RZ 601 ? 1_555 160.5 ? 
8  O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O1B A E 1RZ .   ? A 1RZ 601 ? 1_555 99.5  ? 
9  OD2 ? A ASP 197 ? A ASP 185 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O1B A E 1RZ .   ? A 1RZ 601 ? 1_555 85.9  ? 
10 O3G B E 1RZ .   ? A 1RZ 601 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O1B A E 1RZ .   ? A 1RZ 601 ? 1_555 76.5  ? 
11 OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2A A E 1RZ .   ? A 1RZ 601 ? 1_555 77.2  ? 
12 O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2A A E 1RZ .   ? A 1RZ 601 ? 1_555 169.5 ? 
13 OD2 ? A ASP 197 ? A ASP 185 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2A A E 1RZ .   ? A 1RZ 601 ? 1_555 69.3  ? 
14 O3G B E 1RZ .   ? A 1RZ 601 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2A A E 1RZ .   ? A 1RZ 601 ? 1_555 106.7 ? 
15 O1B A E 1RZ .   ? A 1RZ 601 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2A A E 1RZ .   ? A 1RZ 601 ? 1_555 86.9  ? 
16 OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2C A E 1RZ .   ? A 1RZ 601 ? 1_555 97.3  ? 
17 O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2C A E 1RZ .   ? A 1RZ 601 ? 1_555 84.9  ? 
18 OD2 ? A ASP 197 ? A ASP 185 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2C A E 1RZ .   ? A 1RZ 601 ? 1_555 161.1 ? 
19 O3G B E 1RZ .   ? A 1RZ 601 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2C A E 1RZ .   ? A 1RZ 601 ? 1_555 1.9   ? 
20 O1B A E 1RZ .   ? A 1RZ 601 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2C A E 1RZ .   ? A 1RZ 601 ? 1_555 75.7  ? 
21 O2A A E 1RZ .   ? A 1RZ 601 ? 1_555 MG ? H MG . ? A MG 604 ? 1_555 O2C A E 1RZ .   ? A 1RZ 601 ? 1_555 104.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-12-25 
2 'Structure model' 1 1 2020-01-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.page_first'              
2 2 'Structure model' '_citation.page_last'               
3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
4 2 'Structure model' '_citation.title'                   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software