data_6UJZ
# 
_entry.id   6UJZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UJZ         
WWPDB D_1000244737 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UJZ 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Lansdon, E.B.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0001-9461-1475 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Commun Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2399-3642 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            2 
_citation.language                  ? 
_citation.page_first                469 
_citation.page_last                 469 
_citation.title                     
'Elucidating molecular interactions ofL-nucleotides with HIV-1 reverse transcriptase and mechanism of M184V-caused drug resistance.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s42003-019-0706-x 
_citation.pdbx_database_id_PubMed   31872074 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hung, M.'       1 ? 
primary 'Tokarsky, E.J.' 2 ? 
primary 'Lagpacan, L.'   3 ? 
primary 'Zhang, L.'      4 ? 
primary 'Suo, Z.'        5 ? 
primary 'Lansdon, E.B.'  6 ? 
# 
_cell.angle_alpha                  90.0 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.0 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.0 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UJZ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     168.277 
_cell.length_a_esd                 ? 
_cell.length_b                     168.829 
_cell.length_b_esd                 ? 
_cell.length_c                     102.548 
_cell.length_c_esd                 ? 
_cell.volume                       2913392.53919 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UJZ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            'C 2c 2' 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'p66 Reverse transcriptase/RNaseH' 65887.328 1  2.7.7.49,2.7.7.7,3.1.26.13 Q845C,C867S ? ? 
2 polymer     man 'p51 Reverse transcriptase/RNaseH' 51382.984 1  2.7.7.49,2.7.7.7,3.1.26.13 C867S       ? ? 
3 polymer     syn 'primer DNA' 6360.099  1  ?                          ?           ? ? 
4 polymer     syn 'template DNA' 8448.421  1  ?                          ?           ? ? 
5 non-polymer syn 'SULFATE ION' 96.063    2  ?                          ?           ? ? 
6 non-polymer syn 'MAGNESIUM ION' 24.305    1  ?                          ?           ? ? 
7 non-polymer syn 
;[[(2~{S},5~{R})-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
487.186   1  ?                          ?           ? ? 
8 water       nat water 18.015    47 ?                          ?           ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Exoribonuclease H, p66 RT' 
2 'Exoribonuclease H, p51 RT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVT
LTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
DKLVSAGIRKVL
;
;MGSSHHHHHHSSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFL
WMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENRE
ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPK
FKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVT
LTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
DKLVSAGIRKVL
;
A ? 
2 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
B ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(DG)(DC)(DG)(DC)(DC)
(DOC)
;
ACAGTCCCTGTTCGGGCGCCC P ? 
4 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DG)(DG)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGGGGGCGCCCGAACAGGGACTGTG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  PRO n 
1 14  ILE n 
1 15  SER n 
1 16  PRO n 
1 17  ILE n 
1 18  GLU n 
1 19  THR n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LYS n 
1 24  LEU n 
1 25  LYS n 
1 26  PRO n 
1 27  GLY n 
1 28  MET n 
1 29  ASP n 
1 30  GLY n 
1 31  PRO n 
1 32  LYS n 
1 33  VAL n 
1 34  LYS n 
1 35  GLN n 
1 36  TRP n 
1 37  PRO n 
1 38  LEU n 
1 39  THR n 
1 40  GLU n 
1 41  GLU n 
1 42  LYS n 
1 43  ILE n 
1 44  LYS n 
1 45  ALA n 
1 46  LEU n 
1 47  VAL n 
1 48  GLU n 
1 49  ILE n 
1 50  CYS n 
1 51  THR n 
1 52  GLU n 
1 53  MET n 
1 54  GLU n 
1 55  LYS n 
1 56  GLU n 
1 57  GLY n 
1 58  LYS n 
1 59  ILE n 
1 60  SER n 
1 61  LYS n 
1 62  ILE n 
1 63  GLY n 
1 64  PRO n 
1 65  GLU n 
1 66  ASN n 
1 67  PRO n 
1 68  TYR n 
1 69  ASN n 
1 70  THR n 
1 71  PRO n 
1 72  VAL n 
1 73  PHE n 
1 74  ALA n 
1 75  ILE n 
1 76  LYS n 
1 77  LYS n 
1 78  LYS n 
1 79  ASP n 
1 80  SER n 
1 81  THR n 
1 82  LYS n 
1 83  TRP n 
1 84  ARG n 
1 85  LYS n 
1 86  LEU n 
1 87  VAL n 
1 88  ASP n 
1 89  PHE n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  ASN n 
1 94  LYS n 
1 95  ARG n 
1 96  THR n 
1 97  GLN n 
1 98  ASP n 
1 99  PHE n 
1 100 TRP n 
1 101 GLU n 
1 102 VAL n 
1 103 GLN n 
1 104 LEU n 
1 105 GLY n 
1 106 ILE n 
1 107 PRO n 
1 108 HIS n 
1 109 PRO n 
1 110 ALA n 
1 111 GLY n 
1 112 LEU n 
1 113 LYS n 
1 114 LYS n 
1 115 LYS n 
1 116 LYS n 
1 117 SER n 
1 118 VAL n 
1 119 THR n 
1 120 VAL n 
1 121 LEU n 
1 122 ASP n 
1 123 VAL n 
1 124 GLY n 
1 125 ASP n 
1 126 ALA n 
1 127 TYR n 
1 128 PHE n 
1 129 SER n 
1 130 VAL n 
1 131 PRO n 
1 132 LEU n 
1 133 ASP n 
1 134 GLU n 
1 135 ASP n 
1 136 PHE n 
1 137 ARG n 
1 138 LYS n 
1 139 TYR n 
1 140 THR n 
1 141 ALA n 
1 142 PHE n 
1 143 THR n 
1 144 ILE n 
1 145 PRO n 
1 146 SER n 
1 147 ILE n 
1 148 ASN n 
1 149 ASN n 
1 150 GLU n 
1 151 THR n 
1 152 PRO n 
1 153 GLY n 
1 154 ILE n 
1 155 ARG n 
1 156 TYR n 
1 157 GLN n 
1 158 TYR n 
1 159 ASN n 
1 160 VAL n 
1 161 LEU n 
1 162 PRO n 
1 163 GLN n 
1 164 GLY n 
1 165 TRP n 
1 166 LYS n 
1 167 GLY n 
1 168 SER n 
1 169 PRO n 
1 170 ALA n 
1 171 ILE n 
1 172 PHE n 
1 173 GLN n 
1 174 SER n 
1 175 SER n 
1 176 MET n 
1 177 THR n 
1 178 LYS n 
1 179 ILE n 
1 180 LEU n 
1 181 GLU n 
1 182 PRO n 
1 183 PHE n 
1 184 ARG n 
1 185 LYS n 
1 186 GLN n 
1 187 ASN n 
1 188 PRO n 
1 189 ASP n 
1 190 ILE n 
1 191 VAL n 
1 192 ILE n 
1 193 TYR n 
1 194 GLN n 
1 195 TYR n 
1 196 MET n 
1 197 ASP n 
1 198 ASP n 
1 199 LEU n 
1 200 TYR n 
1 201 VAL n 
1 202 GLY n 
1 203 SER n 
1 204 ASP n 
1 205 LEU n 
1 206 GLU n 
1 207 ILE n 
1 208 GLY n 
1 209 GLN n 
1 210 HIS n 
1 211 ARG n 
1 212 THR n 
1 213 LYS n 
1 214 ILE n 
1 215 GLU n 
1 216 GLU n 
1 217 LEU n 
1 218 ARG n 
1 219 GLN n 
1 220 HIS n 
1 221 LEU n 
1 222 LEU n 
1 223 ARG n 
1 224 TRP n 
1 225 GLY n 
1 226 LEU n 
1 227 THR n 
1 228 THR n 
1 229 PRO n 
1 230 ASP n 
1 231 LYS n 
1 232 LYS n 
1 233 HIS n 
1 234 GLN n 
1 235 LYS n 
1 236 GLU n 
1 237 PRO n 
1 238 PRO n 
1 239 PHE n 
1 240 LEU n 
1 241 TRP n 
1 242 MET n 
1 243 GLY n 
1 244 TYR n 
1 245 GLU n 
1 246 LEU n 
1 247 HIS n 
1 248 PRO n 
1 249 ASP n 
1 250 LYS n 
1 251 TRP n 
1 252 THR n 
1 253 VAL n 
1 254 GLN n 
1 255 PRO n 
1 256 ILE n 
1 257 VAL n 
1 258 LEU n 
1 259 PRO n 
1 260 GLU n 
1 261 LYS n 
1 262 ASP n 
1 263 SER n 
1 264 TRP n 
1 265 THR n 
1 266 VAL n 
1 267 ASN n 
1 268 ASP n 
1 269 ILE n 
1 270 CYS n 
1 271 LYS n 
1 272 LEU n 
1 273 VAL n 
1 274 GLY n 
1 275 LYS n 
1 276 LEU n 
1 277 ASN n 
1 278 TRP n 
1 279 ALA n 
1 280 SER n 
1 281 GLN n 
1 282 ILE n 
1 283 TYR n 
1 284 PRO n 
1 285 GLY n 
1 286 ILE n 
1 287 LYS n 
1 288 VAL n 
1 289 ARG n 
1 290 GLN n 
1 291 LEU n 
1 292 SER n 
1 293 LYS n 
1 294 LEU n 
1 295 LEU n 
1 296 ARG n 
1 297 GLY n 
1 298 THR n 
1 299 LYS n 
1 300 ALA n 
1 301 LEU n 
1 302 THR n 
1 303 GLU n 
1 304 VAL n 
1 305 ILE n 
1 306 PRO n 
1 307 LEU n 
1 308 THR n 
1 309 GLU n 
1 310 GLU n 
1 311 ALA n 
1 312 GLU n 
1 313 LEU n 
1 314 GLU n 
1 315 LEU n 
1 316 ALA n 
1 317 GLU n 
1 318 ASN n 
1 319 ARG n 
1 320 GLU n 
1 321 ILE n 
1 322 LEU n 
1 323 LYS n 
1 324 GLU n 
1 325 PRO n 
1 326 VAL n 
1 327 HIS n 
1 328 GLY n 
1 329 VAL n 
1 330 TYR n 
1 331 TYR n 
1 332 ASP n 
1 333 PRO n 
1 334 SER n 
1 335 LYS n 
1 336 ASP n 
1 337 LEU n 
1 338 ILE n 
1 339 ALA n 
1 340 GLU n 
1 341 ILE n 
1 342 GLN n 
1 343 LYS n 
1 344 GLN n 
1 345 GLY n 
1 346 GLN n 
1 347 GLY n 
1 348 GLN n 
1 349 TRP n 
1 350 THR n 
1 351 TYR n 
1 352 GLN n 
1 353 ILE n 
1 354 TYR n 
1 355 GLN n 
1 356 GLU n 
1 357 PRO n 
1 358 PHE n 
1 359 LYS n 
1 360 ASN n 
1 361 LEU n 
1 362 LYS n 
1 363 THR n 
1 364 GLY n 
1 365 LYS n 
1 366 TYR n 
1 367 ALA n 
1 368 ARG n 
1 369 MET n 
1 370 ARG n 
1 371 GLY n 
1 372 ALA n 
1 373 HIS n 
1 374 THR n 
1 375 ASN n 
1 376 ASP n 
1 377 VAL n 
1 378 LYS n 
1 379 GLN n 
1 380 LEU n 
1 381 THR n 
1 382 GLU n 
1 383 ALA n 
1 384 VAL n 
1 385 GLN n 
1 386 LYS n 
1 387 ILE n 
1 388 THR n 
1 389 THR n 
1 390 GLU n 
1 391 SER n 
1 392 ILE n 
1 393 VAL n 
1 394 ILE n 
1 395 TRP n 
1 396 GLY n 
1 397 LYS n 
1 398 THR n 
1 399 PRO n 
1 400 LYS n 
1 401 PHE n 
1 402 LYS n 
1 403 LEU n 
1 404 PRO n 
1 405 ILE n 
1 406 GLN n 
1 407 LYS n 
1 408 GLU n 
1 409 THR n 
1 410 TRP n 
1 411 GLU n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 THR n 
1 416 GLU n 
1 417 TYR n 
1 418 TRP n 
1 419 GLN n 
1 420 ALA n 
1 421 THR n 
1 422 TRP n 
1 423 ILE n 
1 424 PRO n 
1 425 GLU n 
1 426 TRP n 
1 427 GLU n 
1 428 PHE n 
1 429 VAL n 
1 430 ASN n 
1 431 THR n 
1 432 PRO n 
1 433 PRO n 
1 434 LEU n 
1 435 VAL n 
1 436 LYS n 
1 437 LEU n 
1 438 TRP n 
1 439 TYR n 
1 440 GLN n 
1 441 LEU n 
1 442 GLU n 
1 443 LYS n 
1 444 GLU n 
1 445 PRO n 
1 446 ILE n 
1 447 VAL n 
1 448 GLY n 
1 449 ALA n 
1 450 GLU n 
1 451 THR n 
1 452 PHE n 
1 453 TYR n 
1 454 VAL n 
1 455 ASP n 
1 456 GLY n 
1 457 ALA n 
1 458 ALA n 
1 459 ASN n 
1 460 ARG n 
1 461 GLU n 
1 462 THR n 
1 463 LYS n 
1 464 LEU n 
1 465 GLY n 
1 466 LYS n 
1 467 ALA n 
1 468 GLY n 
1 469 TYR n 
1 470 VAL n 
1 471 THR n 
1 472 ASN n 
1 473 ARG n 
1 474 GLY n 
1 475 ARG n 
1 476 GLN n 
1 477 LYS n 
1 478 VAL n 
1 479 VAL n 
1 480 THR n 
1 481 LEU n 
1 482 THR n 
1 483 ASP n 
1 484 THR n 
1 485 THR n 
1 486 ASN n 
1 487 GLN n 
1 488 LYS n 
1 489 THR n 
1 490 GLU n 
1 491 LEU n 
1 492 GLN n 
1 493 ALA n 
1 494 ILE n 
1 495 TYR n 
1 496 LEU n 
1 497 ALA n 
1 498 LEU n 
1 499 GLN n 
1 500 ASP n 
1 501 SER n 
1 502 GLY n 
1 503 LEU n 
1 504 GLU n 
1 505 VAL n 
1 506 ASN n 
1 507 ILE n 
1 508 VAL n 
1 509 THR n 
1 510 ASP n 
1 511 SER n 
1 512 GLN n 
1 513 TYR n 
1 514 ALA n 
1 515 LEU n 
1 516 GLY n 
1 517 ILE n 
1 518 ILE n 
1 519 GLN n 
1 520 ALA n 
1 521 GLN n 
1 522 PRO n 
1 523 ASP n 
1 524 GLN n 
1 525 SER n 
1 526 GLU n 
1 527 SER n 
1 528 GLU n 
1 529 LEU n 
1 530 VAL n 
1 531 ASN n 
1 532 GLN n 
1 533 ILE n 
1 534 ILE n 
1 535 GLU n 
1 536 GLN n 
1 537 LEU n 
1 538 ILE n 
1 539 LYS n 
1 540 LYS n 
1 541 GLU n 
1 542 LYS n 
1 543 VAL n 
1 544 TYR n 
1 545 LEU n 
1 546 ALA n 
1 547 TRP n 
1 548 VAL n 
1 549 PRO n 
1 550 ALA n 
1 551 HIS n 
1 552 LYS n 
1 553 GLY n 
1 554 ILE n 
1 555 GLY n 
1 556 GLY n 
1 557 ASN n 
1 558 GLU n 
1 559 GLN n 
1 560 VAL n 
1 561 ASP n 
1 562 LYS n 
1 563 LEU n 
1 564 VAL n 
1 565 SER n 
1 566 ALA n 
1 567 GLY n 
1 568 ILE n 
1 569 ARG n 
1 570 LYS n 
1 571 VAL n 
1 572 LEU n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 ARG n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
2 429 LEU n 
2 430 GLU n 
2 431 LYS n 
2 432 GLU n 
2 433 PRO n 
2 434 ILE n 
2 435 VAL n 
2 436 GLY n 
2 437 ALA n 
2 438 GLU n 
2 439 THR n 
2 440 PHE n 
3 1   DA  n 
3 2   DC  n 
3 3   DA  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DG  n 
3 15  DG  n 
3 16  DG  n 
3 17  DC  n 
3 18  DG  n 
3 19  DC  n 
3 20  DC  n 
3 21  DOC n 
4 1   DA  n 
4 2   DT  n 
4 3   DG  n 
4 4   DG  n 
4 5   DG  n 
4 6   DG  n 
4 7   DG  n 
4 8   DG  n 
4 9   DC  n 
4 10  DG  n 
4 11  DC  n 
4 12  DC  n 
4 13  DC  n 
4 14  DG  n 
4 15  DA  n 
4 16  DA  n 
4 17  DC  n 
4 18  DA  n 
4 19  DG  n 
4 20  DG  n 
4 21  DG  n 
4 22  DA  n 
4 23  DC  n 
4 24  DT  n 
4 25  DG  n 
4 26  DT  n 
4 27  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 572 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 440 HIV-1 ? gag-pol ? 'isolate HXB2' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)' 11706 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 21 'Human immunodeficiency virus 1' ? 11676 ? 
4 1 sample 1 27 'Human immunodeficiency virus 1' ? 11676 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1H2 P04585 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL

;
588 
2 UNP POL_HV1H2 P04585 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
;
588 
3 PDB 6UJZ      6UJZ   ? 3 ? 1   
4 PDB 6UJZ      6UJZ   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6UJZ A 13 ? 572 ? P04585 588 ? 1147 ? 1   560 
2 2 6UJZ B 1  ? 440 ? P04585 588 ? 1027 ? 1   440 
3 3 6UJZ P 1  ? 21  ? 6UJZ   802 ? 822  ? 802 822 
4 4 6UJZ T 1  ? 27  ? 6UJZ   701 ? 727  ? 701 727 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6UJZ MET A 1   ? UNP P04585 ?   ?   'initiating methionine' -11 1  
1 6UJZ GLY A 2   ? UNP P04585 ?   ?   'expression tag'        -10 2  
1 6UJZ SER A 3   ? UNP P04585 ?   ?   'expression tag'        -9  3  
1 6UJZ SER A 4   ? UNP P04585 ?   ?   'expression tag'        -8  4  
1 6UJZ HIS A 5   ? UNP P04585 ?   ?   'expression tag'        -7  5  
1 6UJZ HIS A 6   ? UNP P04585 ?   ?   'expression tag'        -6  6  
1 6UJZ HIS A 7   ? UNP P04585 ?   ?   'expression tag'        -5  7  
1 6UJZ HIS A 8   ? UNP P04585 ?   ?   'expression tag'        -4  8  
1 6UJZ HIS A 9   ? UNP P04585 ?   ?   'expression tag'        -3  9  
1 6UJZ HIS A 10  ? UNP P04585 ?   ?   'expression tag'        -2  10 
1 6UJZ SER A 11  ? UNP P04585 ?   ?   'expression tag'        -1  11 
1 6UJZ SER A 12  ? UNP P04585 ?   ?   'expression tag'        0   12 
1 6UJZ CYS A 270 ? UNP P04585 GLN 845 'engineered mutation'   258 13 
1 6UJZ SER A 292 ? UNP P04585 CYS 867 'engineered mutation'   280 14 
2 6UJZ SER B 280 ? UNP P04585 CYS 867 'engineered mutation'   280 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'           133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'         121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'      331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'       307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'      347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'       291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P'      322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER ? 'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'                 24.305  
N8G non-polymer         . 
;[[(2~{S},5~{R})-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
? 'C8 H13 F N3 O12 P3 S' 487.186 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'           105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'              96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'          117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UJZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.76 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.39 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2% PEG 4000, 100mM MES pH 6.0, 10mM magnesium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-07-21 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            60.077967744 
_reflns.entry_id                         6UJZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.55 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       47323 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.8 
_reflns.pdbx_Rmerge_I_obs                0.094 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.55 
_reflns_shell.d_res_low                   2.71 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4516 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.886 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               63.4463326859 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6UJZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5564255195 
_refine.ls_d_res_low                             47.3428641098 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     47318 
_refine.ls_number_reflns_R_free                  3803 
_refine.ls_number_reflns_R_work                  85867 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.1813403992 
_refine.ls_percent_reflns_R_free                 4.24110627858 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.186949198587 
_refine.ls_R_factor_R_free                       0.236264879966 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.184750582552 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33937601348 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3KK1 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.3274335792 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.36764792705 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.5564255195 
_refine_hist.d_res_low                        47.3428641098 
_refine_hist.number_atoms_solvent             47 
_refine_hist.number_atoms_total               8743 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        7795 
_refine_hist.pdbx_number_atoms_nucleic_acid   862 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00975857313568 ? 9012  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.1670038054     ? 12418 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0449525120858  ? 1348  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00598265718258 ? 1410  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 19.0497459853    ? 3459  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5564255195 2.5888     . . 133 2761 84.8182883939 . . . 0.315435443922 . 0.294824998155 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5888       2.6228     . . 128 3141 97.147102526  . . . 0.320452832667 . 0.273853813405 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6228       2.6588     . . 136 3146 97.0431697221 . . . 0.310508909637 . 0.282937796225 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6588       2.6968     . . 139 3159 97.4298375185 . . . 0.328486801564 . 0.264920419641 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6968       2.737      . . 135 3107 97.0658682635 . . . 0.33655915851  . 0.278599789003 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.737        2.7798     . . 140 3173 97.1839249047 . . . 0.314702336784 . 0.263284775191 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7798       2.8253     . . 143 3190 97.6560210958 . . . 0.338131014615 . 0.274282790721 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8253       2.874      . . 129 3089 97.2205438066 . . . 0.29054413671  . 0.260248233789 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.874        2.9263     . . 146 3201 98.0949589683 . . . 0.310634791817 . 0.265844067443 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9263       2.9826     . . 144 3182 98.4023668639 . . . 0.349984350742 . 0.261163145195 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9826       3.0434     . . 142 3195 98.6694263749 . . . 0.367313410728 . 0.277000377871 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0434       3.1096     . . 144 3216 99.2614475628 . . . 0.314145605655 . 0.26302809386  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1096       3.1819     . . 139 3225 99.556081681  . . . 0.350430704888 . 0.242338906579 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1819       3.2615     . . 134 3197 99.0484686292 . . . 0.290331892394 . 0.230176216779 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2615       3.3496     . . 151 3225 98.6845951476 . . . 0.246414318746 . 0.217368803686 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3496       3.4482     . . 132 3146 97.9970104634 . . . 0.292807191408 . 0.196560394821 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4482       3.5594     . . 143 3219 99.438036084  . . . 0.235427085857 . 0.20598013509  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5594       3.6866     . . 139 3246 99.6467471298 . . . 0.250781200011 . 0.189342318362 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6866       3.8342     . . 145 3255 99.7359929598 . . . 0.230588036983 . 0.18014641835  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8342       4.0086     . . 147 3212 99.7327790974 . . . 0.206569173864 . 0.161833806507 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0086       4.2198     . . 142 3218 99.5260663507 . . . 0.194137981938 . 0.157275270499 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2198       4.484      . . 146 3246 99.3847055377 . . . 0.228919631727 . 0.144935876277 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.484        4.8299     . . 146 3191 99.4042299672 . . . 0.203445714751 . 0.137546357616 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8299       5.3153     . . 139 3231 99.7336490086 . . . 0.197024554825 . 0.137888109806 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3153       6.0831     . . 152 3227 99.616745283  . . . 0.180886159949 . 0.154379999488 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.0831       7.6588     . . 141 3235 99.7930830624 . . . 0.190263155266 . 0.150110208142 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.6588       47.3428641 . . 148 3234 99.7345915659 . . . 0.170818110642 . 0.144457096291 . . . . . . . . . . . 
# 
_struct.entry_id                     6UJZ 
_struct.title                        'HIV-1 wild-type reverse transcriptase-DNA complex with (+)-FTC-TP' 
_struct.pdbx_descriptor              'Reverse transcriptase/RNaseH/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UJZ 
_struct_keywords.text            
'HIV-1 reverse transcriptase NRTI polymerase DNA complex, VIRAL PROTEIN, Viral Protein-DNA complex' 
_struct_keywords.pdbx_keywords   'Viral Protein/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 39  ? GLU A 56  ? THR A 27  GLU A 44  1 ? 18 
HELX_P HELX_P2  AA2 PHE A 89  ? THR A 96  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 108 ? LEU A 112 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 126 ? VAL A 130 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 133 ? ALA A 141 ? ASP A 121 ALA A 129 5 ? 9  
HELX_P HELX_P6  AA6 GLY A 167 ? ASN A 187 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  AA7 GLU A 206 ? TRP A 224 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 229 ? HIS A 233 ? PRO A 217 HIS A 221 5 ? 5  
HELX_P HELX_P9  AA9 VAL A 266 ? SER A 280 ? VAL A 254 SER A 268 1 ? 15 
HELX_P HELX_P10 AB1 VAL A 288 ? LEU A 295 ? VAL A 276 LEU A 283 1 ? 8  
HELX_P HELX_P11 AB2 THR A 308 ? GLU A 324 ? THR A 296 GLU A 312 1 ? 17 
HELX_P HELX_P12 AB3 ASN A 375 ? GLY A 396 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 AB4 GLN A 406 ? THR A 415 ? GLN A 394 THR A 403 1 ? 10 
HELX_P HELX_P14 AB5 THR A 485 ? ASP A 500 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P15 AB6 SER A 511 ? ALA A 520 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 AB7 SER A 527 ? LYS A 540 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 GLY A 556 ? ALA A 566 ? GLY A 544 ALA A 554 1 ? 11 
HELX_P HELX_P18 AB9 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 77  ? THR B 84  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P20 AC2 GLY B 99  ? LYS B 103 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P21 AC3 GLY B 112 ? VAL B 118 ? GLY B 112 VAL B 118 5 ? 7  
HELX_P HELX_P22 AC4 ASP B 121 ? ALA B 129 ? ASP B 121 ALA B 129 5 ? 9  
HELX_P HELX_P23 AC5 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P24 AC6 LYS B 154 ? PHE B 160 ? LYS B 154 PHE B 160 1 ? 7  
HELX_P HELX_P25 AC7 PHE B 160 ? ASN B 175 ? PHE B 160 ASN B 175 1 ? 16 
HELX_P HELX_P26 AC8 GLU B 194 ? ARG B 211 ? GLU B 194 ARG B 211 1 ? 18 
HELX_P HELX_P27 AC9 HIS B 235 ? TRP B 239 ? HIS B 235 TRP B 239 5 ? 5  
HELX_P HELX_P28 AD1 THR B 253 ? SER B 268 ? THR B 253 SER B 268 1 ? 16 
HELX_P HELX_P29 AD2 VAL B 276 ? LEU B 282 ? VAL B 276 LEU B 282 1 ? 7  
HELX_P HELX_P30 AD3 THR B 296 ? LEU B 310 ? THR B 296 LEU B 310 1 ? 15 
HELX_P HELX_P31 AD4 ASN B 363 ? GLY B 384 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P32 AD5 GLN B 394 ? TRP B 402 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P33 AD6 THR B 403 ? TYR B 405 ? THR B 403 TYR B 405 5 ? 3  
HELX_P HELX_P34 AD7 PRO B 420 ? GLN B 428 ? PRO B 420 GLN B 428 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 122 OD2   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 110 A MG  603 1_555 ? ? ? ? ? ? ?            1.886 ? 
metalc2  metalc ?    ? A VAL 123 O     ? ? ? 1_555 G MG  .  MG  ? ? A VAL 111 A MG  603 1_555 ? ? ? ? ? ? ?            2.127 ? 
metalc3  metalc ?    ? A ASP 197 OD2   ? ? ? 1_555 G MG  .  MG  ? ? A ASP 185 A MG  603 1_555 ? ? ? ? ? ? ?            2.307 ? 
covale1  covale both ? C DC  20  "O3'" ? ? ? 1_555 C DOC 21 P   ? ? P DC  821 P DOC 822 1_555 ? ? ? ? ? ? ?            1.596 ? 
metalc4  metalc ?    ? G MG  .   MG    ? ? ? 1_555 H N8G .  OAC ? ? A MG  603 A N8G 604 1_555 ? ? ? ? ? ? ?            2.113 ? 
metalc5  metalc ?    ? G MG  .   MG    ? ? ? 1_555 H N8G .  OAI ? ? A MG  603 A N8G 604 1_555 ? ? ? ? ? ? ?            2.156 ? 
metalc6  metalc ?    ? G MG  .   MG    ? ? ? 1_555 H N8G .  OAD ? ? A MG  603 A N8G 604 1_555 ? ? ? ? ? ? ?            2.006 ? 
hydrog1  hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  23 N3  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  23 O2  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  23 N4  ? ? P DG  805 T DC  723 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  22 N1  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  22 N6  ? ? P DT  806 T DA  722 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2  ? ? P DC  807 T DG  721 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  20 N1  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  20 O6  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  20 N2  ? ? P DC  808 T DG  720 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DC  8   N3    ? ? ? 1_555 D DG  19 N1  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DC  8   N4    ? ? ? 1_555 D DG  19 O6  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DC  8   O2    ? ? ? 1_555 D DG  19 N2  ? ? P DC  809 T DG  719 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DT  9   N3    ? ? ? 1_555 D DA  18 N1  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DT  9   O4    ? ? ? 1_555 D DA  18 N6  ? ? P DT  810 T DA  718 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4  ? ? P DG  811 T DC  717 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  16 N1  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  16 N6  ? ? P DT  812 T DA  716 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DT  12  N3    ? ? ? 1_555 D DA  15 N1  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DT  12  O4    ? ? ? 1_555 D DA  15 N6  ? ? P DT  813 T DA  715 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2  ? ? P DC  814 T DG  714 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4  ? ? P DG  815 T DC  713 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D DC  12 N3  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D DC  12 O2  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D DC  12 N4  ? ? P DG  816 T DC  712 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? C DG  16  N1    ? ? ? 1_555 D DC  11 N3  ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? C DG  16  N2    ? ? ? 1_555 D DC  11 O2  ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? C DG  16  O6    ? ? ? 1_555 D DC  11 N4  ? ? P DG  817 T DC  711 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2  ? ? P DC  818 T DG  710 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? C DG  18  N1    ? ? ? 1_555 D DC  9  N3  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? C DG  18  N2    ? ? ? 1_555 D DC  9  O2  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? C DG  18  O6    ? ? ? 1_555 D DC  9  N4  ? ? P DG  819 T DC  709 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D DG  8  N1  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? C DC  19  N4    ? ? ? 1_555 D DG  8  O6  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? C DC  19  O2    ? ? ? 1_555 D DG  8  N2  ? ? P DC  820 T DG  708 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? C DC  20  N3    ? ? ? 1_555 D DG  7  N1  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? C DC  20  N4    ? ? ? 1_555 D DG  7  O6  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? C DC  20  O2    ? ? ? 1_555 D DG  7  N2  ? ? P DC  821 T DG  707 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? C DOC 21  N3    ? ? ? 1_555 D DG  6  N1  ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? C DOC 21  N4    ? ? ? 1_555 D DG  6  O6  ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? C DOC 21  O2    ? ? ? 1_555 D DG  6  N2  ? ? P DOC 822 T DG  706 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 237 A . ? PRO 225 A PRO 238 A ? PRO 226 A 1 0.93  
2 PRO 432 A . ? PRO 420 A PRO 433 A ? PRO 421 A 1 -0.58 
3 GLY 555 A . ? GLY 543 A GLY 556 A ? GLY 544 A 1 -1.93 
4 TYR 232 B . ? TYR 232 B GLU 233 B ? GLU 233 B 1 6.24  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 5 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 59  ? LYS A 61  ? ILE A 47  LYS A 49  
AA1 2 ILE A 154 ? TYR A 158 ? ILE A 142 TYR A 146 
AA1 3 PHE A 142 ? ILE A 144 ? PHE A 130 ILE A 132 
AA2 1 VAL A 72  ? LYS A 76  ? VAL A 60  LYS A 64  
AA2 2 TRP A 83  ? VAL A 87  ? TRP A 71  VAL A 75  
AA3 1 SER A 117 ? ASP A 122 ? SER A 105 ASP A 110 
AA3 2 ASP A 198 ? SER A 203 ? ASP A 186 SER A 191 
AA3 3 VAL A 191 ? TYR A 195 ? VAL A 179 TYR A 183 
AA4 1 PHE A 239 ? TRP A 241 ? PHE A 227 TRP A 229 
AA4 2 TYR A 244 ? LEU A 246 ? TYR A 232 LEU A 234 
AA4 3 TRP A 251 ? VAL A 253 ? TRP A 239 VAL A 241 
AA5 1 TRP A 264 ? THR A 265 ? TRP A 252 THR A 253 
AA5 2 VAL A 304 ? ILE A 305 ? VAL A 292 ILE A 293 
AA6 1 ASN A 360 ? TYR A 366 ? ASN A 348 TYR A 354 
AA6 2 GLN A 348 ? TYR A 354 ? GLN A 336 TYR A 342 
AA6 3 ILE A 338 ? GLY A 345 ? ILE A 326 GLY A 333 
AA6 4 LYS A 400 ? LEU A 403 ? LYS A 388 LEU A 391 
AA6 5 TRP A 426 ? PHE A 428 ? TRP A 414 PHE A 416 
AA7 1 HIS A 373 ? THR A 374 ? HIS A 361 THR A 362 
AA7 2 GLN A 524 ? SER A 525 ? GLN A 512 SER A 513 
AA8 1 GLN A 476 ? LEU A 481 ? GLN A 464 LEU A 469 
AA8 2 GLY A 465 ? THR A 471 ? GLY A 453 THR A 459 
AA8 3 GLU A 450 ? ALA A 458 ? GLU A 438 ALA A 446 
AA8 4 GLU A 504 ? THR A 509 ? GLU A 492 THR A 497 
AA8 5 LYS A 542 ? TRP A 547 ? LYS A 530 TRP A 535 
AA9 1 ILE B 47  ? LYS B 49  ? ILE B 47  LYS B 49  
AA9 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
AA9 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
AB1 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
AB1 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
AB2 1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
AB2 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
AB2 3 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
AB3 1 ASN B 348 ? ALA B 355 ? ASN B 348 ALA B 355 
AB3 2 GLN B 336 ? TYR B 342 ? GLN B 336 TYR B 342 
AB3 3 LEU B 325 ? GLY B 333 ? LEU B 325 GLY B 333 
AB3 4 PRO B 387 ? LEU B 391 ? PRO B 387 LEU B 391 
AB3 5 GLU B 413 ? PHE B 416 ? GLU B 413 PHE B 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 60  ? N SER A 48  O GLN A 157 ? O GLN A 145 
AA1 2 3 O ILE A 154 ? O ILE A 142 N ILE A 144 ? N ILE A 132 
AA2 1 2 N ILE A 75  ? N ILE A 63  O ARG A 84  ? O ARG A 72  
AA3 1 2 N THR A 119 ? N THR A 107 O VAL A 201 ? O VAL A 189 
AA3 2 3 O GLY A 202 ? O GLY A 190 N VAL A 191 ? N VAL A 179 
AA4 1 2 N PHE A 239 ? N PHE A 227 O LEU A 246 ? O LEU A 234 
AA4 2 3 N GLU A 245 ? N GLU A 233 O THR A 252 ? O THR A 240 
AA5 1 2 N TRP A 264 ? N TRP A 252 O ILE A 305 ? O ILE A 293 
AA6 1 2 O LEU A 361 ? O LEU A 349 N ILE A 353 ? N ILE A 341 
AA6 2 3 O TYR A 354 ? O TYR A 342 N ILE A 338 ? N ILE A 326 
AA6 3 4 N ALA A 339 ? N ALA A 327 O LYS A 400 ? O LYS A 388 
AA6 4 5 N LEU A 403 ? N LEU A 391 O GLU A 427 ? O GLU A 415 
AA7 1 2 N THR A 374 ? N THR A 362 O GLN A 524 ? O GLN A 512 
AA8 1 2 O VAL A 479 ? O VAL A 467 N ALA A 467 ? N ALA A 455 
AA8 2 3 O VAL A 470 ? O VAL A 458 N TYR A 453 ? N TYR A 441 
AA8 3 4 N PHE A 452 ? N PHE A 440 O ASN A 506 ? O ASN A 494 
AA8 4 5 N ILE A 507 ? N ILE A 495 O TYR A 544 ? O TYR A 532 
AA9 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
AA9 2 3 O TYR B 144 ? O TYR B 144 N PHE B 130 ? N PHE B 130 
AB1 1 2 N ILE B 63  ? N ILE B 63  O ARG B 72  ? O ARG B 72  
AB2 1 2 N LEU B 109 ? N LEU B 109 O LEU B 187 ? O LEU B 187 
AB2 2 3 O TYR B 188 ? O TYR B 188 N TYR B 181 ? N TYR B 181 
AB3 1 2 O LYS B 350 ? O LYS B 350 N ILE B 341 ? N ILE B 341 
AB3 2 3 O GLN B 336 ? O GLN B 336 N GLN B 332 ? N GLN B 332 
AB3 3 4 N LEU B 325 ? N LEU B 325 O LYS B 388 ? O LYS B 388 
AB3 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 601 ? 6  'binding site for residue SO4 A 601' 
AC2 Software A SO4 602 ? 2  'binding site for residue SO4 A 602' 
AC3 Software A MG  603 ? 4  'binding site for residue MG A 603'  
AC4 Software A N8G 604 ? 16 'binding site for residue N8G A 604' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ARG A 218 ? ARG A 206 . ? 8_557 ? 
2  AC1 6  GLY A 448 ? GLY A 436 . ? 1_555 ? 
3  AC1 6  ASN A 472 ? ASN A 460 . ? 1_555 ? 
4  AC1 6  ARG A 473 ? ARG A 461 . ? 1_555 ? 
5  AC1 6  HOH I .   ? HOH A 701 . ? 1_555 ? 
6  AC1 6  ALA B 288 ? ALA B 288 . ? 1_555 ? 
7  AC2 2  GLN A 352 ? GLN A 340 . ? 1_555 ? 
8  AC2 2  THR B 200 ? THR B 200 . ? 6_754 ? 
9  AC3 4  ASP A 122 ? ASP A 110 . ? 1_555 ? 
10 AC3 4  VAL A 123 ? VAL A 111 . ? 1_555 ? 
11 AC3 4  ASP A 197 ? ASP A 185 . ? 1_555 ? 
12 AC3 4  N8G H .   ? N8G A 604 . ? 1_555 ? 
13 AC4 16 LYS A 77  ? LYS A 65  . ? 1_555 ? 
14 AC4 16 LYS A 82  ? LYS A 70  . ? 1_555 ? 
15 AC4 16 ARG A 84  ? ARG A 72  . ? 1_555 ? 
16 AC4 16 ASP A 122 ? ASP A 110 . ? 1_555 ? 
17 AC4 16 VAL A 123 ? VAL A 111 . ? 1_555 ? 
18 AC4 16 GLY A 124 ? GLY A 112 . ? 1_555 ? 
19 AC4 16 ASP A 125 ? ASP A 113 . ? 1_555 ? 
20 AC4 16 ALA A 126 ? ALA A 114 . ? 1_555 ? 
21 AC4 16 TYR A 127 ? TYR A 115 . ? 1_555 ? 
22 AC4 16 GLN A 163 ? GLN A 151 . ? 1_555 ? 
23 AC4 16 ASP A 197 ? ASP A 185 . ? 1_555 ? 
24 AC4 16 LYS A 232 ? LYS A 220 . ? 1_555 ? 
25 AC4 16 MG  G .   ? MG  A 603 . ? 1_555 ? 
26 AC4 16 DOC C 21  ? DOC P 822 . ? 1_555 ? 
27 AC4 16 DG  D 5   ? DG  T 705 . ? 1_555 ? 
28 AC4 16 DG  D 6   ? DG  T 706 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UJZ 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005943 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005923 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009752 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C   ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
F   ? ? 8.95735 ?       7.27484  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG  ? ? 9.41153 2.53737 2.59044  63.03566 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N   ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O   ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O1- ? ? 5.12366 3.84317 3.49406  27.47979 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P   ? ? 9.51135 5.44231 1.42069  35.72801 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S   ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 13  ? 157.84500 39.43900 112.07900 1.000 62.51000  ?  1   PRO A N     1 
ATOM   2    C  CA    . PRO A 1 13  ? 157.25800 40.66800 112.63500 1.000 67.87000  ?  1   PRO A CA    1 
ATOM   3    C  C     . PRO A 1 13  ? 158.22400 41.84600 112.53700 1.000 66.28000  ?  1   PRO A C     1 
ATOM   4    O  O     . PRO A 1 13  ? 159.13300 41.80300 111.70400 1.000 65.37000  ?  1   PRO A O     1 
ATOM   5    C  CB    . PRO A 1 13  ? 156.97400 40.30300 114.11100 1.000 58.54000  ?  1   PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 13  ? 157.96000 39.24800 114.43700 1.000 56.71000  ?  1   PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 13  ? 158.17500 38.46600 113.13900 1.000 66.00000  ?  1   PRO A CD    1 
ATOM   8    N  N     . ILE A 1 14  ? 158.02000 42.86200 113.37900 1.000 61.69000  ?  2   ILE A N     1 
ATOM   9    C  CA    . ILE A 1 14  ? 158.80200 44.10000 113.37000 1.000 57.25000  ?  2   ILE A CA    1 
ATOM   10   C  C     . ILE A 1 14  ? 159.37100 44.39100 114.75400 1.000 59.54000  ?  2   ILE A C     1 
ATOM   11   O  O     . ILE A 1 14  ? 158.61100 44.60500 115.69900 1.000 62.34000  ?  2   ILE A O     1 
ATOM   12   C  CB    . ILE A 1 14  ? 157.95600 45.32400 112.93100 1.000 58.47000  ?  2   ILE A CB    1 
ATOM   13   C  CG1   . ILE A 1 14  ? 157.50900 45.20500 111.47400 1.000 58.13000  ?  2   ILE A CG1   1 
ATOM   14   C  CG2   . ILE A 1 14  ? 158.73600 46.61400 113.12700 1.000 54.92000  ?  2   ILE A CG2   1 
ATOM   15   C  CD1   . ILE A 1 14  ? 156.56000 46.30600 111.05900 1.000 57.66000  ?  2   ILE A CD1   1 
ATOM   16   N  N     . SER A 1 15  ? 160.70100 44.40200 114.86400 1.000 54.52000  ?  3   SER A N     1 
ATOM   17   C  CA    . SER A 1 15  ? 161.40600 44.68100 116.11900 1.000 51.21000  ?  3   SER A CA    1 
ATOM   18   C  C     . SER A 1 15  ? 160.87100 45.92700 116.86300 1.000 56.03000  ?  3   SER A C     1 
ATOM   19   O  O     . SER A 1 15  ? 160.69000 47.00500 116.24700 1.000 50.21000  ?  3   SER A O     1 
ATOM   20   C  CB    . SER A 1 15  ? 162.91400 44.84800 115.83800 1.000 50.89000  ?  3   SER A CB    1 
ATOM   21   O  OG    . SER A 1 15  ? 163.65200 45.10700 117.01900 1.000 47.93000  ?  3   SER A OG    1 
ATOM   22   N  N     . PRO A 1 16  ? 160.62100 45.78500 118.19300 1.000 59.15000  ?  4   PRO A N     1 
ATOM   23   C  CA    . PRO A 1 16  ? 160.35000 46.92800 119.07200 1.000 50.99000  ?  4   PRO A CA    1 
ATOM   24   C  C     . PRO A 1 16  ? 161.64200 47.65100 119.41800 1.000 49.40000  ?  4   PRO A C     1 
ATOM   25   O  O     . PRO A 1 16  ? 161.73700 48.26200 120.47300 1.000 50.21000  ?  4   PRO A O     1 
ATOM   26   C  CB    . PRO A 1 16  ? 159.77200 46.27600 120.31200 1.000 48.06000  ?  4   PRO A CB    1 
ATOM   27   C  CG    . PRO A 1 16  ? 160.54600 45.01400 120.40400 1.000 50.31000  ?  4   PRO A CG    1 
ATOM   28   C  CD    . PRO A 1 16  ? 160.66800 44.53000 118.97300 1.000 52.82000  ?  4   PRO A CD    1 
ATOM   29   N  N     . ILE A 1 17  ? 162.65000 47.55100 118.56100 1.000 51.42000  ?  5   ILE A N     1 
ATOM   30   C  CA    . ILE A 1 17  ? 163.85900 48.33100 118.77100 1.000 53.20000  ?  5   ILE A CA    1 
ATOM   31   C  C     . ILE A 1 17  ? 163.58400 49.77900 118.40900 1.000 50.59000  ?  5   ILE A C     1 
ATOM   32   O  O     . ILE A 1 17  ? 162.71800 50.06600 117.58100 1.000 51.20000  ?  5   ILE A O     1 
ATOM   33   C  CB    . ILE A 1 17  ? 165.03900 47.79600 117.96100 1.000 53.65000  ?  5   ILE A CB    1 
ATOM   34   C  CG1   . ILE A 1 17  ? 166.29800 48.60400 118.28200 1.000 54.72000  ?  5   ILE A CG1   1 
ATOM   35   C  CG2   . ILE A 1 17  ? 164.71800 47.79300 116.47400 1.000 52.44000  ?  5   ILE A CG2   1 
ATOM   36   C  CD1   . ILE A 1 17  ? 167.59400 47.79400 118.15700 1.000 53.35000  ?  5   ILE A CD1   1 
ATOM   37   N  N     . GLU A 1 18  ? 164.28500 50.68700 119.07800 1.000 51.19000  ?  6   GLU A N     1 
ATOM   38   C  CA    . GLU A 1 18  ? 164.12300 52.10200 118.82800 1.000 48.16000  ?  6   GLU A CA    1 
ATOM   39   C  C     . GLU A 1 18  ? 164.70600 52.40800 117.48000 1.000 50.06000  ?  6   GLU A C     1 
ATOM   40   O  O     . GLU A 1 18  ? 165.70000 51.78200 117.07400 1.000 49.39000  ?  6   GLU A O     1 
ATOM   41   C  CB    . GLU A 1 18  ? 164.81400 52.93500 119.89600 1.000 57.83000  ?  6   GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 18  ? 164.50700 52.50300 121.31100 1.000 67.97000  ?  6   GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 18  ? 164.99100 53.52500 122.33100 1.000 85.60000  ?  6   GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 18  ? 165.09900 54.72200 121.96000 1.000 87.23000  ?  6   GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 18  ? 165.27100 53.13400 123.49100 1.000 86.02000  ?  6   GLU A OE2   1 
ATOM   46   N  N     . THR A 1 19  ? 164.08900 53.35800 116.78700 1.000 45.45000  ?  7   THR A N     1 
ATOM   47   C  CA    . THR A 1 19  ? 164.54800 53.74400 115.46900 1.000 46.80000  ?  7   THR A CA    1 
ATOM   48   C  C     . THR A 1 19  ? 165.83600 54.52100 115.61500 1.000 49.43000  ?  7   THR A C     1 
ATOM   49   O  O     . THR A 1 19  ? 166.12300 55.03800 116.68600 1.000 57.10000  ?  7   THR A O     1 
ATOM   50   C  CB    . THR A 1 19  ? 163.52400 54.59900 114.72200 1.000 50.82000  ?  7   THR A CB    1 
ATOM   51   O  OG1   . THR A 1 19  ? 163.17100 55.73300 115.53100 1.000 53.97000  ?  7   THR A OG1   1 
ATOM   52   C  CG2   . THR A 1 19  ? 162.28700 53.77300 114.38800 1.000 50.94000  ?  7   THR A CG2   1 
ATOM   53   N  N     . VAL A 1 20  ? 166.62000 54.57700 114.54900 1.000 47.61000  ?  8   VAL A N     1 
ATOM   54   C  CA    . VAL A 1 20  ? 167.76000 55.46200 114.49900 1.000 47.04000  ?  8   VAL A CA    1 
ATOM   55   C  C     . VAL A 1 20  ? 167.39500 56.74100 113.78200 1.000 52.58000  ?  8   VAL A C     1 
ATOM   56   O  O     . VAL A 1 20  ? 166.90300 56.70600 112.65300 1.000 57.74000  ?  8   VAL A O     1 
ATOM   57   C  CB    . VAL A 1 20  ? 168.92400 54.81800 113.79300 1.000 46.48000  ?  8   VAL A CB    1 
ATOM   58   C  CG1   . VAL A 1 20  ? 170.05300 55.82500 113.65100 1.000 46.41000  ?  8   VAL A CG1   1 
ATOM   59   C  CG2   . VAL A 1 20  ? 169.34900 53.58700 114.57200 1.000 48.83000  ?  8   VAL A CG2   1 
ATOM   60   N  N     . PRO A 1 21  ? 167.64500 57.87900 114.43000 1.000 57.12000  ?  9   PRO A N     1 
ATOM   61   C  CA    . PRO A 1 21  ? 167.28600 59.19300 113.88600 1.000 56.42000  ?  9   PRO A CA    1 
ATOM   62   C  C     . PRO A 1 21  ? 168.14800 59.58100 112.68600 1.000 57.66000  ?  9   PRO A C     1 
ATOM   63   O  O     . PRO A 1 21  ? 169.36700 59.74700 112.79500 1.000 60.70000  ?  9   PRO A O     1 
ATOM   64   C  CB    . PRO A 1 21  ? 167.52700 60.14600 115.07000 1.000 55.93000  ?  9   PRO A CB    1 
ATOM   65   C  CG    . PRO A 1 21  ? 167.71900 59.25000 116.29100 1.000 53.13000  ?  9   PRO A CG    1 
ATOM   66   C  CD    . PRO A 1 21  ? 168.27500 57.97700 115.75700 1.000 55.88000  ?  9   PRO A CD    1 
ATOM   67   N  N     . VAL A 1 22  ? 167.49900 59.75000 111.54600 1.000 57.83000  ?  10  VAL A N     1 
ATOM   68   C  CA    . VAL A 1 22  ? 168.17700 60.15400 110.32600 1.000 58.67000  ?  10  VAL A CA    1 
ATOM   69   C  C     . VAL A 1 22  ? 167.64800 61.47500 109.78800 1.000 61.15000  ?  10  VAL A C     1 
ATOM   70   O  O     . VAL A 1 22  ? 166.60000 61.95400 110.21400 1.000 66.88000  ?  10  VAL A O     1 
ATOM   71   C  CB    . VAL A 1 22  ? 168.00500 59.10200 109.26900 1.000 62.54000  ?  10  VAL A CB    1 
ATOM   72   C  CG1   . VAL A 1 22  ? 168.82300 57.87500 109.63900 1.000 64.65000  ?  10  VAL A CG1   1 
ATOM   73   C  CG2   . VAL A 1 22  ? 166.53800 58.75300 109.17800 1.000 57.13000  ?  10  VAL A CG2   1 
ATOM   74   N  N     . LYS A 1 23  ? 168.37500 62.07200 108.85600 1.000 59.08000  ?  11  LYS A N     1 
ATOM   75   C  CA    . LYS A 1 23  ? 167.90800 63.29600 108.23100 1.000 63.71000  ?  11  LYS A CA    1 
ATOM   76   C  C     . LYS A 1 23  ? 168.58700 63.51900 106.89700 1.000 64.42000  ?  11  LYS A C     1 
ATOM   77   O  O     . LYS A 1 23  ? 169.64900 62.94800 106.62100 1.000 59.95000  ?  11  LYS A O     1 
ATOM   78   C  CB    . LYS A 1 23  ? 168.13800 64.50100 109.14200 1.000 57.93000  ?  11  LYS A CB    1 
ATOM   79   C  CG    . LYS A 1 23  ? 169.52800 64.60100 109.66300 1.000 66.49000  ?  11  LYS A CG    1 
ATOM   80   C  CD    . LYS A 1 23  ? 169.59000 65.55900 110.85500 1.000 79.70000  ?  11  LYS A CD    1 
ATOM   81   C  CE    . LYS A 1 23  ? 170.92100 65.44000 111.62900 1.000 80.08000  ?  11  LYS A CE    1 
ATOM   82   N  NZ    . LYS A 1 23  ? 172.13100 65.37800 110.73700 1.000 75.92000  ?  11  LYS A NZ    1 
ATOM   83   N  N     . LEU A 1 24  ? 167.94600 64.33900 106.06900 1.000 59.16000  ?  12  LEU A N     1 
ATOM   84   C  CA    . LEU A 1 24  ? 168.48100 64.72300 104.77600 1.000 61.86000  ?  12  LEU A CA    1 
ATOM   85   C  C     . LEU A 1 24  ? 169.64600 65.68900 104.95700 1.000 62.38000  ?  12  LEU A C     1 
ATOM   86   O  O     . LEU A 1 24  ? 169.73600 66.36300 105.97500 1.000 64.67000  ?  12  LEU A O     1 
ATOM   87   C  CB    . LEU A 1 24  ? 167.38600 65.35600 103.92400 1.000 62.49000  ?  12  LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 24  ? 166.25200 64.43100 103.49500 1.000 61.90000  ?  12  LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 24  ? 165.21700 65.22700 102.74000 1.000 65.01000  ?  12  LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 24  ? 166.77000 63.27100 102.63400 1.000 63.08000  ?  12  LEU A CD2   1 
ATOM   91   N  N     . LYS A 1 25  ? 170.55100 65.74200 103.99100 1.000 60.52000  ?  13  LYS A N     1 
ATOM   92   C  CA    . LYS A 1 25  ? 171.58600 66.76100 104.02400 1.000 65.32000  ?  13  LYS A CA    1 
ATOM   93   C  C     . LYS A 1 25  ? 170.91300 68.13000 103.95100 1.000 72.54000  ?  13  LYS A C     1 
ATOM   94   O  O     . LYS A 1 25  ? 169.89000 68.27700 103.27500 1.000 72.01000  ?  13  LYS A O     1 
ATOM   95   C  CB    . LYS A 1 25  ? 172.57500 66.56300 102.88000 1.000 65.19000  ?  13  LYS A CB    1 
ATOM   96   C  CG    . LYS A 1 25  ? 173.57700 65.47100 103.14900 1.000 65.62000  ?  13  LYS A CG    1 
ATOM   97   C  CD    . LYS A 1 25  ? 174.41100 65.11500 101.93100 1.000 61.57000  ?  13  LYS A CD    1 
ATOM   98   C  CE    . LYS A 1 25  ? 175.70700 64.43100 102.37900 1.000 68.52000  ?  13  LYS A CE    1 
ATOM   99   N  NZ    . LYS A 1 25  ? 176.33600 63.60700 101.31200 1.000 76.27000  ?  13  LYS A NZ    1 
ATOM   100  N  N     . PRO A 1 26  ? 171.46600 69.12800 104.67000 1.000 73.78000  ?  14  PRO A N     1 
ATOM   101  C  CA    . PRO A 1 26  ? 170.89400 70.47700 104.79100 1.000 69.92000  ?  14  PRO A CA    1 
ATOM   102  C  C     . PRO A 1 26  ? 170.48800 71.11400 103.45900 1.000 76.45000  ?  14  PRO A C     1 
ATOM   103  O  O     . PRO A 1 26  ? 171.21300 71.03000 102.45900 1.000 71.74000  ?  14  PRO A O     1 
ATOM   104  C  CB    . PRO A 1 26  ? 172.02100 71.26900 105.44100 1.000 66.55000  ?  14  PRO A CB    1 
ATOM   105  C  CG    . PRO A 1 26  ? 172.71000 70.25800 106.29900 1.000 68.47000  ?  14  PRO A CG    1 
ATOM   106  C  CD    . PRO A 1 26  ? 172.66000 68.96600 105.51900 1.000 74.39000  ?  14  PRO A CD    1 
ATOM   107  N  N     . GLY A 1 27  ? 169.30600 71.72600 103.46100 1.000 76.56000  ?  15  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 27  ? 168.79800 72.44500 102.30900 1.000 79.39000  ?  15  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 27  ? 168.26400 71.55900 101.20400 1.000 79.10000  ?  15  GLY A C     1 
ATOM   110  O  O     . GLY A 1 27  ? 167.83000 72.04700 100.15600 1.000 83.45000  ?  15  GLY A O     1 
ATOM   111  N  N     . MET A 1 28  ? 168.29400 70.25100 101.43000 1.000 79.19000  ?  16  MET A N     1 
ATOM   112  C  CA    . MET A 1 28  ? 167.86000 69.30200 100.41100 1.000 75.79000  ?  16  MET A CA    1 
ATOM   113  C  C     . MET A 1 28  ? 166.48200 68.74300 100.70600 1.000 69.90000  ?  16  MET A C     1 
ATOM   114  O  O     . MET A 1 28  ? 165.93000 68.96500 101.77700 1.000 68.52000  ?  16  MET A O     1 
ATOM   115  C  CB    . MET A 1 28  ? 168.86100 68.16400 100.28900 1.000 76.36000  ?  16  MET A CB    1 
ATOM   116  C  CG    . MET A 1 28  ? 170.25600 68.62500 99.93500  1.000 77.02000  ?  16  MET A CG    1 
ATOM   117  S  SD    . MET A 1 28  ? 170.83900 67.80700 98.44000  1.000 90.11000  ?  16  MET A SD    1 
ATOM   118  C  CE    . MET A 1 28  ? 172.62400 67.99800 98.62000  1.000 84.43000  ?  16  MET A CE    1 
ATOM   119  N  N     . ASP A 1 29  ? 165.92700 68.01200 99.74900  1.000 74.27000  ?  17  ASP A N     1 
ATOM   120  C  CA    . ASP A 1 29  ? 164.57700 67.49400 99.89500  1.000 74.82000  ?  17  ASP A CA    1 
ATOM   121  C  C     . ASP A 1 29  ? 164.47100 66.13200 99.21600  1.000 72.69000  ?  17  ASP A C     1 
ATOM   122  O  O     . ASP A 1 29  ? 165.35100 65.75100 98.45500  1.000 77.34000  ?  17  ASP A O     1 
ATOM   123  C  CB    . ASP A 1 29  ? 163.56200 68.49100 99.31300  1.000 80.76000  ?  17  ASP A CB    1 
ATOM   124  C  CG    . ASP A 1 29  ? 162.12000 68.00200 99.41700  1.000 81.67000  ?  17  ASP A CG    1 
ATOM   125  O  OD1   . ASP A 1 29  ? 161.70800 67.56800 100.52000 1.000 75.66000  ?  17  ASP A OD1   1 
ATOM   126  O  OD2   . ASP A 1 29  ? 161.40700 68.03500 98.38300  1.000 81.28000  ?  17  ASP A OD2   1 
ATOM   127  N  N     . GLY A 1 30  ? 163.39100 65.41100 99.49700  1.000 70.64000  ?  18  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 30  ? 163.21000 64.04800 99.03900  1.000 69.94000  ?  18  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 30  ? 163.16800 63.87000 97.53900  1.000 69.76000  ?  18  GLY A C     1 
ATOM   130  O  O     . GLY A 1 30  ? 162.91400 64.81600 96.80700  1.000 71.53000  ?  18  GLY A O     1 
ATOM   131  N  N     . PRO A 1 31  ? 163.40100 62.63300 97.07700  1.000 69.88000  ?  19  PRO A N     1 
ATOM   132  C  CA    . PRO A 1 31  ? 163.49800 62.34000 95.65100  1.000 69.33000  ?  19  PRO A CA    1 
ATOM   133  C  C     . PRO A 1 31  ? 162.14000 62.43600 94.92800  1.000 74.04000  ?  19  PRO A C     1 
ATOM   134  O  O     . PRO A 1 31  ? 161.10200 61.96100 95.42400  1.000 72.70000  ?  19  PRO A O     1 
ATOM   135  C  CB    . PRO A 1 31  ? 164.02000 60.90200 95.64400  1.000 68.49000  ?  19  PRO A CB    1 
ATOM   136  C  CG    . PRO A 1 31  ? 163.38100 60.29300 96.85300  1.000 61.49000  ?  19  PRO A CG    1 
ATOM   137  C  CD    . PRO A 1 31  ? 163.40000 61.39600 97.88700  1.000 64.71000  ?  19  PRO A CD    1 
ATOM   138  N  N     . LYS A 1 32  ? 162.14600 63.06200 93.75700  1.000 73.43000  ?  20  LYS A N     1 
ATOM   139  C  CA    . LYS A 1 32  ? 160.97400 63.02600 92.89400  1.000 70.87000  ?  20  LYS A CA    1 
ATOM   140  C  C     . LYS A 1 32  ? 161.38900 62.36000 91.58600  1.000 72.17000  ?  20  LYS A C     1 
ATOM   141  O  O     . LYS A 1 32  ? 161.96300 63.00400 90.70900  1.000 76.60000  ?  20  LYS A O     1 
ATOM   142  C  CB    . LYS A 1 32  ? 160.40900 64.43100 92.67000  1.000 68.42000  ?  20  LYS A CB    1 
ATOM   143  C  CG    . LYS A 1 32  ? 159.78600 65.07200 93.91500  1.000 67.47000  ?  20  LYS A CG    1 
ATOM   144  C  CD    . LYS A 1 32  ? 160.44400 66.42000 94.24800  1.000 77.00000  ?  20  LYS A CD    1 
ATOM   145  C  CE    . LYS A 1 32  ? 159.84600 67.08600 95.49600  1.000 71.08000  ?  20  LYS A CE    1 
ATOM   146  N  NZ    . LYS A 1 32  ? 158.40700 67.43200 95.33500  1.000 68.55000  ?  20  LYS A NZ    1 
ATOM   147  N  N     . VAL A 1 33  ? 161.12800 61.06100 91.46800  1.000 66.98000  ?  21  VAL A N     1 
ATOM   148  C  CA    . VAL A 1 33  ? 161.61100 60.31200 90.32100  1.000 65.34000  ?  21  VAL A CA    1 
ATOM   149  C  C     . VAL A 1 33  ? 160.60400 59.31200 89.79100  1.000 69.66000  ?  21  VAL A C     1 
ATOM   150  O  O     . VAL A 1 33  ? 160.14000 58.43100 90.51400  1.000 69.85000  ?  21  VAL A O     1 
ATOM   151  C  CB    . VAL A 1 33  ? 162.90000 59.56800 90.65200  1.000 69.72000  ?  21  VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 33  ? 163.21300 58.54000 89.55800  1.000 64.76000  ?  21  VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 33  ? 164.04200 60.56500 90.83800  1.000 66.61000  ?  21  VAL A CG2   1 
ATOM   154  N  N     . LYS A 1 34  ? 160.28800 59.45500 88.50700  1.000 75.87000  ?  22  LYS A N     1 
ATOM   155  C  CA    . LYS A 1 34  ? 159.32000 58.59800 87.82900  1.000 78.27000  ?  22  LYS A CA    1 
ATOM   156  C  C     . LYS A 1 34  ? 159.65800 57.12000 87.96000  1.000 76.05000  ?  22  LYS A C     1 
ATOM   157  O  O     . LYS A 1 34  ? 160.80200 56.71800 87.73300  1.000 78.86000  ?  22  LYS A O     1 
ATOM   158  C  CB    . LYS A 1 34  ? 159.23300 58.97500 86.34400  1.000 85.75000  ?  22  LYS A CB    1 
ATOM   159  C  CG    . LYS A 1 34  ? 158.61100 57.89900 85.45600  1.000 85.47000  ?  22  LYS A CG    1 
ATOM   160  C  CD    . LYS A 1 34  ? 158.62900 58.31000 83.98400  1.000 95.09000  ?  22  LYS A CD    1 
ATOM   161  C  CE    . LYS A 1 34  ? 157.21200 58.34800 83.40600  1.000 103.96000 ?  22  LYS A CE    1 
ATOM   162  N  NZ    . LYS A 1 34  ? 157.16000 58.67500 81.94700  1.000 98.46000  ?  22  LYS A NZ    1 
ATOM   163  N  N     . GLN A 1 35  ? 158.66700 56.32000 88.34400  1.000 73.79000  ?  23  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 35  ? 158.81000 54.87700 88.29800  1.000 72.23000  ?  23  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 35  ? 159.04800 54.49500 86.86500  1.000 73.81000  ?  23  GLN A C     1 
ATOM   166  O  O     . GLN A 1 35  ? 158.24100 54.83500 86.02000  1.000 80.80000  ?  23  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 35  ? 157.56000 54.17400 88.82700  1.000 69.04000  ?  23  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 35  ? 157.57900 52.66200 88.62800  1.000 72.24000  ?  23  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 35  ? 158.63800 51.97100 89.48600  1.000 75.05000  ?  23  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 35  ? 158.74600 52.22200 90.69000  1.000 72.49000  ?  23  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 35  ? 159.42400 51.10500 88.86700  1.000 71.86000  ?  23  GLN A NE2   1 
ATOM   172  N  N     . TRP A 1 36  ? 160.15400 53.83000 86.55300  1.000 79.57000  ?  24  TRP A N     1 
ATOM   173  C  CA    . TRP A 1 36  ? 160.26800 53.33700 85.18700  1.000 84.85000  ?  24  TRP A CA    1 
ATOM   174  C  C     . TRP A 1 36  ? 159.49600 52.02000 85.10600  1.000 86.18000  ?  24  TRP A C     1 
ATOM   175  O  O     . TRP A 1 36  ? 159.08400 51.47900 86.13400  1.000 83.21000  ?  24  TRP A O     1 
ATOM   176  C  CB    . TRP A 1 36  ? 161.72600 53.17500 84.68100  1.000 88.33000  ?  24  TRP A CB    1 
ATOM   177  C  CG    . TRP A 1 36  ? 162.89500 53.04400 85.65400  1.000 90.55000  ?  24  TRP A CG    1 
ATOM   178  C  CD1   . TRP A 1 36  ? 163.90700 53.95600 85.85000  1.000 88.66000  ?  24  TRP A CD1   1 
ATOM   179  C  CD2   . TRP A 1 36  ? 163.21900 51.91300 86.47200  1.000 87.70000  ?  24  TRP A CD2   1 
ATOM   180  N  NE1   . TRP A 1 36  ? 164.81300 53.47500 86.76500  1.000 85.04000  ?  24  TRP A NE1   1 
ATOM   181  C  CE2   . TRP A 1 36  ? 164.41700 52.22300 87.16500  1.000 85.55000  ?  24  TRP A CE2   1 
ATOM   182  C  CE3   . TRP A 1 36  ? 162.60300 50.67700 86.70500  1.000 84.09000  ?  24  TRP A CE3   1 
ATOM   183  C  CZ2   . TRP A 1 36  ? 165.00700 51.35000 88.06700  1.000 79.18000  ?  24  TRP A CZ2   1 
ATOM   184  C  CZ3   . TRP A 1 36  ? 163.18400 49.81500 87.60300  1.000 85.41000  ?  24  TRP A CZ3   1 
ATOM   185  C  CH2   . TRP A 1 36  ? 164.37400 50.15800 88.28300  1.000 81.30000  ?  24  TRP A CH2   1 
ATOM   186  N  N     . PRO A 1 37  ? 159.25700 51.53300 83.87600  1.000 87.75000  ?  25  PRO A N     1 
ATOM   187  C  CA    . PRO A 1 37  ? 158.36500 50.39800 83.61700  1.000 83.27000  ?  25  PRO A CA    1 
ATOM   188  C  C     . PRO A 1 37  ? 158.95800 49.03800 83.96500  1.000 80.27000  ?  25  PRO A C     1 
ATOM   189  O  O     . PRO A 1 37  ? 160.14900 48.81000 83.76400  1.000 81.59000  ?  25  PRO A O     1 
ATOM   190  C  CB    . PRO A 1 37  ? 158.11600 50.50000 82.11100  1.000 81.55000  ?  25  PRO A CB    1 
ATOM   191  C  CG    . PRO A 1 37  ? 159.33700 51.15700 81.58100  1.000 83.54000  ?  25  PRO A CG    1 
ATOM   192  C  CD    . PRO A 1 37  ? 159.73500 52.15200 82.62400  1.000 83.83000  ?  25  PRO A CD    1 
ATOM   193  N  N     . LEU A 1 38  ? 158.10800 48.13900 84.45500  1.000 81.75000  ?  26  LEU A N     1 
ATOM   194  C  CA    . LEU A 1 38  ? 158.53200 46.79200 84.84000  1.000 84.27000  ?  26  LEU A CA    1 
ATOM   195  C  C     . LEU A 1 38  ? 157.84400 45.66300 84.06600  1.000 81.02000  ?  26  LEU A C     1 
ATOM   196  O  O     . LEU A 1 38  ? 156.67600 45.77200 83.68600  1.000 79.03000  ?  26  LEU A O     1 
ATOM   197  C  CB    . LEU A 1 38  ? 158.28000 46.55700 86.34000  1.000 81.53000  ?  26  LEU A CB    1 
ATOM   198  C  CG    . LEU A 1 38  ? 158.89300 47.48100 87.39000  1.000 76.74000  ?  26  LEU A CG    1 
ATOM   199  C  CD1   . LEU A 1 38  ? 158.21000 47.21000 88.71400  1.000 74.79000  ?  26  LEU A CD1   1 
ATOM   200  C  CD2   . LEU A 1 38  ? 160.40600 47.30100 87.50300  1.000 74.35000  ?  26  LEU A CD2   1 
ATOM   201  N  N     . THR A 1 39  ? 158.59700 44.58200 83.86300  1.000 77.68000  ?  27  THR A N     1 
ATOM   202  C  CA    . THR A 1 39  ? 158.07300 43.26000 83.53500  1.000 73.99000  ?  27  THR A CA    1 
ATOM   203  C  C     . THR A 1 39  ? 156.79200 42.92000 84.26300  1.000 82.01000  ?  27  THR A C     1 
ATOM   204  O  O     . THR A 1 39  ? 156.57500 43.33700 85.40000  1.000 82.82000  ?  27  THR A O     1 
ATOM   205  C  CB    . THR A 1 39  ? 159.08400 42.16500 83.90600  1.000 84.46000  ?  27  THR A CB    1 
ATOM   206  O  OG1   . THR A 1 39  ? 160.30500 42.37400 83.18800  1.000 89.93000  ?  27  THR A OG1   1 
ATOM   207  C  CG2   . THR A 1 39  ? 158.52700 40.76900 83.62100  1.000 80.19000  ?  27  THR A CG2   1 
ATOM   208  N  N     . GLU A 1 40  ? 155.95700 42.12700 83.61000  1.000 87.98000  ?  28  GLU A N     1 
ATOM   209  C  CA    . GLU A 1 40  ? 154.75700 41.59500 84.23700  1.000 86.31000  ?  28  GLU A CA    1 
ATOM   210  C  C     . GLU A 1 40  ? 155.13200 40.71100 85.42500  1.000 85.10000  ?  28  GLU A C     1 
ATOM   211  O  O     . GLU A 1 40  ? 154.58500 40.85400 86.51900  1.000 83.85000  ?  28  GLU A O     1 
ATOM   212  C  CB    . GLU A 1 40  ? 153.93800 40.80100 83.21500  1.000 89.46000  ?  28  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 40  ? 152.64700 40.21300 83.74700  1.000 86.63000  ?  28  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 40  ? 151.66900 41.28100 84.14700  1.000 86.74000  ?  28  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 40  ? 151.99200 42.47500 83.96400  1.000 87.56000  ?  28  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 40  ? 150.58500 40.92600 84.65100  1.000 88.42000  ?  28  GLU A OE2   1 
ATOM   217  N  N     . GLU A 1 41  ? 156.07600 39.80200 85.19300  1.000 87.97000  ?  29  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 41  ? 156.50900 38.84300 86.20700  1.000 89.49000  ?  29  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 41  ? 156.91500 39.55700 87.48800  1.000 86.47000  ?  29  GLU A C     1 
ATOM   220  O  O     . GLU A 1 41  ? 156.61100 39.09800 88.59600  1.000 81.57000  ?  29  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 41  ? 157.67900 38.00200 85.68600  1.000 84.06000  ?  29  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 41  ? 157.94000 36.73900 86.48800  1.000 87.23000  ?  29  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 41  ? 159.19700 36.01500 86.02900  1.000 93.13000  ?  29  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 41  ? 159.92200 36.58000 85.18500  1.000 90.34000  ?  29  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 41  ? 159.46500 34.89000 86.51100  1.000 97.51000  ?  29  GLU A OE2   1 
ATOM   226  N  N     . LYS A 1 42  ? 157.59700 40.68700 87.30600  1.000 83.01000  ?  30  LYS A N     1 
ATOM   227  C  CA    . LYS A 1 42  ? 158.10100 41.49200 88.40800  1.000 81.87000  ?  30  LYS A CA    1 
ATOM   228  C  C     . LYS A 1 42  ? 156.99900 42.30600 89.08400  1.000 81.17000  ?  30  LYS A C     1 
ATOM   229  O  O     . LYS A 1 42  ? 157.03800 42.49100 90.30300  1.000 82.57000  ?  30  LYS A O     1 
ATOM   230  C  CB    . LYS A 1 42  ? 159.22500 42.41300 87.92200  1.000 79.44000  ?  30  LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 42  ? 160.56000 41.69200 87.73600  1.000 78.63000  ?  30  LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 42  ? 161.63800 42.62700 87.21000  1.000 78.31000  ?  30  LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 42  ? 162.87600 41.85400 86.79800  1.000 81.09000  ?  30  LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 42  ? 163.88800 42.73600 86.17300  1.000 84.11000  ?  30  LYS A NZ    1 
ATOM   235  N  N     . ILE A 1 43  ? 156.01500 42.77600 88.31900  1.000 80.13000  ?  31  ILE A N     1 
ATOM   236  C  CA    . ILE A 1 43  ? 154.89100 43.50300 88.91600  1.000 80.79000  ?  31  ILE A CA    1 
ATOM   237  C  C     . ILE A 1 43  ? 154.05400 42.60600 89.83000  1.000 77.36000  ?  31  ILE A C     1 
ATOM   238  O  O     . ILE A 1 43  ? 153.52300 43.05600 90.84500  1.000 75.03000  ?  31  ILE A O     1 
ATOM   239  C  CB    . ILE A 1 43  ? 153.95400 44.10100 87.86000  1.000 80.18000  ?  31  ILE A CB    1 
ATOM   240  C  CG1   . ILE A 1 43  ? 154.71300 45.02500 86.90800  1.000 83.33000  ?  31  ILE A CG1   1 
ATOM   241  C  CG2   . ILE A 1 43  ? 152.85600 44.85900 88.54300  1.000 77.40000  ?  31  ILE A CG2   1 
ATOM   242  C  CD1   . ILE A 1 43  ? 154.15700 45.01500 85.48100  1.000 86.47000  ?  31  ILE A CD1   1 
ATOM   243  N  N     . LYS A 1 44  ? 153.93300 41.33600 89.46600  1.000 75.39000  ?  32  LYS A N     1 
ATOM   244  C  CA    . LYS A 1 44  ? 153.18500 40.40100 90.29100  1.000 77.99000  ?  32  LYS A CA    1 
ATOM   245  C  C     . LYS A 1 44  ? 154.05000 39.93300 91.45500  1.000 76.10000  ?  32  LYS A C     1 
ATOM   246  O  O     . LYS A 1 44  ? 153.55200 39.65800 92.54700  1.000 72.83000  ?  32  LYS A O     1 
ATOM   247  C  CB    . LYS A 1 44  ? 152.68700 39.21900 89.45100  1.000 84.51000  ?  32  LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 44  ? 153.00200 37.83900 90.01000  1.000 88.40000  ?  32  LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 44  ? 152.08000 36.77800 89.39400  1.000 91.21000  ?  32  LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 44  ? 152.72000 35.38000 89.41000  1.000 104.28000 ?  32  LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 44  ? 153.67000 35.14300 88.26200  1.000 97.04000  ?  32  LYS A NZ    1 
ATOM   252  N  N     . ALA A 1 45  ? 155.35300 39.85600 91.21300  1.000 77.61000  ?  33  ALA A N     1 
ATOM   253  C  CA    . ALA A 1 45  ? 156.30800 39.59900 92.27800  1.000 74.81000  ?  33  ALA A CA    1 
ATOM   254  C  C     . ALA A 1 45  ? 156.13300 40.65800 93.34200  1.000 70.53000  ?  33  ALA A C     1 
ATOM   255  O  O     . ALA A 1 45  ? 155.90700 40.35300 94.51100  1.000 66.71000  ?  33  ALA A O     1 
ATOM   256  C  CB    . ALA A 1 45  ? 157.72500 39.61100 91.74400  1.000 72.21000  ?  33  ALA A CB    1 
ATOM   257  N  N     . LEU A 1 46  ? 156.22400 41.90700 92.89900  1.000 69.83000  ?  34  LEU A N     1 
ATOM   258  C  CA    . LEU A 1 46  ? 156.09700 43.06200 93.76100  1.000 61.76000  ?  34  LEU A CA    1 
ATOM   259  C  C     . LEU A 1 46  ? 154.76100 43.09800 94.49300  1.000 67.73000  ?  34  LEU A C     1 
ATOM   260  O  O     . LEU A 1 46  ? 154.72300 43.20600 95.72000  1.000 66.51000  ?  34  LEU A O     1 
ATOM   261  C  CB    . LEU A 1 46  ? 156.27300 44.33600 92.94600  1.000 64.86000  ?  34  LEU A CB    1 
ATOM   262  C  CG    . LEU A 1 46  ? 157.63900 44.53100 92.28900  1.000 68.04000  ?  34  LEU A CG    1 
ATOM   263  C  CD1   . LEU A 1 46  ? 157.80500 45.97200 91.82500  1.000 64.79000  ?  34  LEU A CD1   1 
ATOM   264  C  CD2   . LEU A 1 46  ? 158.74300 44.15200 93.24600  1.000 68.85000  ?  34  LEU A CD2   1 
ATOM   265  N  N     . VAL A 1 47  ? 153.66600 43.01700 93.73900  1.000 74.55000  ?  35  VAL A N     1 
ATOM   266  C  CA    . VAL A 1 47  ? 152.32700 43.10500 94.31900  1.000 65.60000  ?  35  VAL A CA    1 
ATOM   267  C  C     . VAL A 1 47  ? 152.14000 42.08100 95.42100  1.000 66.98000  ?  35  VAL A C     1 
ATOM   268  O  O     . VAL A 1 47  ? 151.60500 42.39800 96.48100  1.000 69.43000  ?  35  VAL A O     1 
ATOM   269  C  CB    . VAL A 1 47  ? 151.22800 42.91100 93.25900  1.000 67.79000  ?  35  VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 47  ? 149.88400 42.59900 93.92800  1.000 57.83000  ?  35  VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 47  ? 151.13000 44.15600 92.37200  1.000 67.05000  ?  35  VAL A CG2   1 
ATOM   272  N  N     . GLU A 1 48  ? 152.59700 40.85800 95.18900  1.000 65.40000  ?  36  GLU A N     1 
ATOM   273  C  CA    . GLU A 1 48  ? 152.46400 39.83400 96.20700  1.000 65.91000  ?  36  GLU A CA    1 
ATOM   274  C  C     . GLU A 1 48  ? 153.22200 40.23000 97.48000  1.000 71.97000  ?  36  GLU A C     1 
ATOM   275  O  O     . GLU A 1 48  ? 152.71100 40.08400 98.60400  1.000 69.35000  ?  36  GLU A O     1 
ATOM   276  C  CB    . GLU A 1 48  ? 152.96300 38.49800 95.68700  1.000 64.38000  ?  36  GLU A CB    1 
ATOM   277  C  CG    . GLU A 1 48  ? 152.68100 37.36300 96.64500  1.000 73.71000  ?  36  GLU A CG    1 
ATOM   278  C  CD    . GLU A 1 48  ? 153.48000 36.11100 96.31800  1.000 93.18000  ?  36  GLU A CD    1 
ATOM   279  O  OE1   . GLU A 1 48  ? 154.01500 36.00600 95.18500  1.000 96.87000  ?  36  GLU A OE1   1 
ATOM   280  O  OE2   . GLU A 1 48  ? 153.57700 35.23200 97.20200  1.000 100.09000 ?  36  GLU A OE2   1 
ATOM   281  N  N     . ILE A 1 49  ? 154.44000 40.73500 97.29100  1.000 68.11000  ?  37  ILE A N     1 
ATOM   282  C  CA    . ILE A 1 49  ? 155.25600 41.23400 98.39500  1.000 65.44000  ?  37  ILE A CA    1 
ATOM   283  C  C     . ILE A 1 49  ? 154.58700 42.42200 99.10300  1.000 66.68000  ?  37  ILE A C     1 
ATOM   284  O  O     . ILE A 1 49  ? 154.52300 42.48000 100.33100 1.000 65.01000  ?  37  ILE A O     1 
ATOM   285  C  CB    . ILE A 1 49  ? 156.65000 41.65200 97.90200  1.000 55.61000  ?  37  ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 49  ? 157.50800 40.42200 97.66800  1.000 63.36000  ?  37  ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 49  ? 157.33600 42.53800 98.90300  1.000 53.93000  ?  37  ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 49  ? 158.76800 40.71100 96.88400  1.000 68.19000  ?  37  ILE A CD1   1 
ATOM   289  N  N     . CYS A 1 50  ? 154.07800 43.36800 98.32900  1.000 64.04000  ?  38  CYS A N     1 
ATOM   290  C  CA    . CYS A 1 50  ? 153.54500 44.57800 98.92000  1.000 61.46000  ?  38  CYS A CA    1 
ATOM   291  C  C     . CYS A 1 50  ? 152.21000 44.37500 99.63400  1.000 63.14000  ?  38  CYS A C     1 
ATOM   292  O  O     . CYS A 1 50  ? 151.90100 45.09000 100.59300 1.000 57.17000  ?  38  CYS A O     1 
ATOM   293  C  CB    . CYS A 1 50  ? 153.41100 45.65000 97.85200  1.000 60.92000  ?  38  CYS A CB    1 
ATOM   294  S  SG    . CYS A 1 50  ? 154.93600 46.56800 97.64000  1.000 68.74000  ?  38  CYS A SG    1 
ATOM   295  N  N     . THR A 1 51  ? 151.42200 43.40300 99.19000  1.000 62.08000  ?  39  THR A N     1 
ATOM   296  C  CA    . THR A 1 51  ? 150.14900 43.18600 99.84800  1.000 65.56000  ?  39  THR A CA    1 
ATOM   297  C  C     . THR A 1 51  ? 150.43600 42.52200 101.18800 1.000 68.24000  ?  39  THR A C     1 
ATOM   298  O  O     . THR A 1 51  ? 149.71700 42.74000 102.17200 1.000 68.66000  ?  39  THR A O     1 
ATOM   299  C  CB    . THR A 1 51  ? 149.15000 42.33600 98.98800  1.000 68.20000  ?  39  THR A CB    1 
ATOM   300  O  OG1   . THR A 1 51  ? 149.60100 40.98100 98.88100  1.000 79.24000  ?  39  THR A OG1   1 
ATOM   301  C  CG2   . THR A 1 51  ? 148.98400 42.93100 97.58900  1.000 61.50000  ?  39  THR A CG2   1 
ATOM   302  N  N     . GLU A 1 52  ? 151.51300 41.73800 101.22800 1.000 69.84000  ?  40  GLU A N     1 
ATOM   303  C  CA    . GLU A 1 52  ? 151.92200 41.04100 102.44800 1.000 68.13000  ?  40  GLU A CA    1 
ATOM   304  C  C     . GLU A 1 52  ? 152.57500 42.00600 103.44000 1.000 65.11000  ?  40  GLU A C     1 
ATOM   305  O  O     . GLU A 1 52  ? 152.26800 41.98900 104.62600 1.000 64.22000  ?  40  GLU A O     1 
ATOM   306  C  CB    . GLU A 1 52  ? 152.88300 39.89700 102.11500 1.000 69.57000  ?  40  GLU A CB    1 
ATOM   307  C  CG    . GLU A 1 52  ? 153.40600 39.12300 103.33700 1.000 75.36000  ?  40  GLU A CG    1 
ATOM   308  C  CD    . GLU A 1 52  ? 154.74100 38.41800 103.06800 1.000 87.19000  ?  40  GLU A CD    1 
ATOM   309  O  OE1   . GLU A 1 52  ? 155.75600 39.11400 102.82000 1.000 85.22000  ?  40  GLU A OE1   1 
ATOM   310  O  OE2   . GLU A 1 52  ? 154.77900 37.16600 103.10200 1.000 95.58000  ?  40  GLU A OE2   1 
ATOM   311  N  N     . MET A 1 53  ? 153.47600 42.84400 102.94500 1.000 60.89000  ?  41  MET A N     1 
ATOM   312  C  CA    . MET A 1 53  ? 154.17200 43.79900 103.79100 1.000 61.86000  ?  41  MET A CA    1 
ATOM   313  C  C     . MET A 1 53  ? 153.19100 44.80300 104.34800 1.000 62.04000  ?  41  MET A C     1 
ATOM   314  O  O     . MET A 1 53  ? 153.26600 45.20600 105.50700 1.000 61.25000  ?  41  MET A O     1 
ATOM   315  C  CB    . MET A 1 53  ? 155.27600 44.52600 103.01300 1.000 58.31000  ?  41  MET A CB    1 
ATOM   316  C  CG    . MET A 1 53  ? 156.54100 43.71500 102.82900 1.000 57.41000  ?  41  MET A CG    1 
ATOM   317  S  SD    . MET A 1 53  ? 157.72500 44.62100 101.83700 1.000 70.22000  ?  41  MET A SD    1 
ATOM   318  C  CE    . MET A 1 53  ? 158.57700 45.64400 103.04300 1.000 52.23000  ?  41  MET A CE    1 
ATOM   319  N  N     . GLU A 1 54  ? 152.26700 45.21700 103.49900 1.000 64.73000  ?  42  GLU A N     1 
ATOM   320  C  CA    . GLU A 1 54  ? 151.29000 46.20500 103.90300 1.000 66.62000  ?  42  GLU A CA    1 
ATOM   321  C  C     . GLU A 1 54  ? 150.43100 45.63100 105.02400 1.000 64.23000  ?  42  GLU A C     1 
ATOM   322  O  O     . GLU A 1 54  ? 150.14100 46.30200 106.01100 1.000 60.14000  ?  42  GLU A O     1 
ATOM   323  C  CB    . GLU A 1 54  ? 150.44800 46.62200 102.70400 1.000 65.73000  ?  42  GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 54  ? 149.59400 47.82800 102.95100 1.000 69.22000  ?  42  GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 54  ? 148.18700 47.43700 103.25000 1.000 73.07000  ?  42  GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 54  ? 147.53000 48.16800 104.02400 1.000 76.49000  ?  42  GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 54  ? 147.74900 46.39500 102.70200 1.000 74.40000  ?  42  GLU A OE2   1 
ATOM   328  N  N     . LYS A 1 55  ? 150.06200 44.36700 104.87000 1.000 64.93000  ?  43  LYS A N     1 
ATOM   329  C  CA    . LYS A 1 55  ? 149.30700 43.66700 105.89000 1.000 63.87000  ?  43  LYS A CA    1 
ATOM   330  C  C     . LYS A 1 55  ? 150.05700 43.68800 107.20700 1.000 68.68000  ?  43  LYS A C     1 
ATOM   331  O  O     . LYS A 1 55  ? 149.44200 43.72000 108.27000 1.000 71.38000  ?  43  LYS A O     1 
ATOM   332  C  CB    . LYS A 1 55  ? 149.03200 42.22500 105.46200 1.000 68.36000  ?  43  LYS A CB    1 
ATOM   333  C  CG    . LYS A 1 55  ? 147.56100 41.83400 105.45000 1.000 75.85000  ?  43  LYS A CG    1 
ATOM   334  C  CD    . LYS A 1 55  ? 147.15300 41.20400 104.11800 1.000 78.16000  ?  43  LYS A CD    1 
ATOM   335  C  CE    . LYS A 1 55  ? 145.67500 40.79400 104.11000 1.000 86.36000  ?  43  LYS A CE    1 
ATOM   336  N  NZ    . LYS A 1 55  ? 145.23700 40.17700 102.81100 1.000 87.72000  ?  43  LYS A NZ    1 
ATOM   337  N  N     . GLU A 1 56  ? 151.38700 43.68200 107.14800 1.000 64.91000  ?  44  GLU A N     1 
ATOM   338  C  CA    . GLU A 1 56  ? 152.17500 43.50700 108.36600 1.000 61.44000  ?  44  GLU A CA    1 
ATOM   339  C  C     . GLU A 1 56  ? 152.65500 44.82900 108.93500 1.000 57.65000  ?  44  GLU A C     1 
ATOM   340  O  O     . GLU A 1 56  ? 153.37200 44.86200 109.93000 1.000 68.68000  ?  44  GLU A O     1 
ATOM   341  C  CB    . GLU A 1 56  ? 153.35600 42.56500 108.10400 1.000 61.11000  ?  44  GLU A CB    1 
ATOM   342  C  CG    . GLU A 1 56  ? 152.98200 41.10100 108.34500 1.000 66.76000  ?  44  GLU A CG    1 
ATOM   343  C  CD    . GLU A 1 56  ? 153.72100 40.11300 107.44500 1.000 71.70000  ?  44  GLU A CD    1 
ATOM   344  O  OE1   . GLU A 1 56  ? 154.92200 40.32100 107.16500 1.000 71.81000  ?  44  GLU A OE1   1 
ATOM   345  O  OE2   . GLU A 1 56  ? 153.08800 39.11900 107.01500 1.000 78.94000  ?  44  GLU A OE2   1 
ATOM   346  N  N     . GLY A 1 57  ? 152.24100 45.92300 108.31900 1.000 52.50000  ?  45  GLY A N     1 
ATOM   347  C  CA    . GLY A 1 57  ? 152.60100 47.23100 108.81200 1.000 50.38000  ?  45  GLY A CA    1 
ATOM   348  C  C     . GLY A 1 57  ? 154.00700 47.63700 108.43200 1.000 56.60000  ?  45  GLY A C     1 
ATOM   349  O  O     . GLY A 1 57  ? 154.51300 48.65600 108.89400 1.000 61.23000  ?  45  GLY A O     1 
ATOM   350  N  N     . LYS A 1 58  ? 154.63700 46.84500 107.57900 1.000 54.40000  ?  46  LYS A N     1 
ATOM   351  C  CA    . LYS A 1 58  ? 155.98000 47.15600 107.12300 1.000 58.46000  ?  46  LYS A CA    1 
ATOM   352  C  C     . LYS A 1 58  ? 155.98500 48.25200 106.05300 1.000 59.29000  ?  46  LYS A C     1 
ATOM   353  O  O     . LYS A 1 58  ? 156.97500 48.97300 105.90900 1.000 56.94000  ?  46  LYS A O     1 
ATOM   354  C  CB    . LYS A 1 58  ? 156.65000 45.87300 106.64300 1.000 54.87000  ?  46  LYS A CB    1 
ATOM   355  C  CG    . LYS A 1 58  ? 156.86500 44.95000 107.82800 1.000 52.18000  ?  46  LYS A CG    1 
ATOM   356  C  CD    . LYS A 1 58  ? 157.36100 43.57500 107.47200 1.000 56.16000  ?  46  LYS A CD    1 
ATOM   357  C  CE    . LYS A 1 58  ? 157.80300 42.85700 108.73700 1.000 56.34000  ?  46  LYS A CE    1 
ATOM   358  N  NZ    . LYS A 1 58  ? 157.60800 41.38500 108.65600 1.000 67.90000  ?  46  LYS A NZ    1 
ATOM   359  N  N     . ILE A 1 59  ? 154.87000 48.39300 105.33500 1.000 59.60000  ?  47  ILE A N     1 
ATOM   360  C  CA    . ILE A 1 59  ? 154.65300 49.54400 104.45300 1.000 58.03000  ?  47  ILE A CA    1 
ATOM   361  C  C     . ILE A 1 59  ? 153.24500 50.13400 104.62300 1.000 62.07000  ?  47  ILE A C     1 
ATOM   362  O  O     . ILE A 1 59  ? 152.29400 49.44500 105.03000 1.000 60.30000  ?  47  ILE A O     1 
ATOM   363  C  CB    . ILE A 1 59  ? 154.86700 49.19400 102.95600 1.000 57.80000  ?  47  ILE A CB    1 
ATOM   364  C  CG1   . ILE A 1 59  ? 153.91500 48.09500 102.49400 1.000 56.04000  ?  47  ILE A CG1   1 
ATOM   365  C  CG2   . ILE A 1 59  ? 156.29900 48.76300 102.69600 1.000 58.57000  ?  47  ILE A CG2   1 
ATOM   366  C  CD1   . ILE A 1 59  ? 154.07800 47.74600 101.02100 1.000 56.42000  ?  47  ILE A CD1   1 
ATOM   367  N  N     . SER A 1 60  ? 153.13200 51.42200 104.30800 1.000 59.98000  ?  48  SER A N     1 
ATOM   368  C  CA    . SER A 1 60  ? 151.87700 52.16400 104.43100 1.000 57.87000  ?  48  SER A CA    1 
ATOM   369  C  C     . SER A 1 60  ? 151.48300 52.80600 103.10400 1.000 62.43000  ?  48  SER A C     1 
ATOM   370  O  O     . SER A 1 60  ? 152.31800 53.43300 102.43300 1.000 57.63000  ?  48  SER A O     1 
ATOM   371  C  CB    . SER A 1 60  ? 151.98900 53.24800 105.50800 1.000 50.75000  ?  48  SER A CB    1 
ATOM   372  O  OG    . SER A 1 60  ? 152.28900 52.67700 106.76700 1.000 46.70000  ?  48  SER A OG    1 
ATOM   373  N  N     . LYS A 1 61  ? 150.21300 52.64200 102.73200 1.000 65.56000  ?  49  LYS A N     1 
ATOM   374  C  CA    . LYS A 1 61  ? 149.63700 53.36400 101.60600 1.000 58.02000  ?  49  LYS A CA    1 
ATOM   375  C  C     . LYS A 1 61  ? 149.72100 54.85000 101.90200 1.000 58.53000  ?  49  LYS A C     1 
ATOM   376  O  O     . LYS A 1 61  ? 149.40200 55.28100 103.01400 1.000 59.30000  ?  49  LYS A O     1 
ATOM   377  C  CB    . LYS A 1 61  ? 148.19600 52.92300 101.36900 1.000 58.92000  ?  49  LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 61  ? 148.07600 51.43700 101.13300 1.000 64.70000  ?  49  LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 61  ? 146.64000 50.95500 101.09100 1.000 70.34000  ?  49  LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 61  ? 146.59500 49.48800 100.66300 1.000 75.51000  ?  49  LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 61  ? 145.29700 49.07400 100.06600 1.000 75.68000  ?  49  LYS A NZ    1 
ATOM   382  N  N     . ILE A 1 62  ? 150.20900 55.61900 100.92800 1.000 62.79000  ?  50  ILE A N     1 
ATOM   383  C  CA    . ILE A 1 62  ? 150.24400 57.08100 101.01400 1.000 67.95000  ?  50  ILE A CA    1 
ATOM   384  C  C     . ILE A 1 62  ? 149.27500 57.73900 100.01200 1.000 73.68000  ?  50  ILE A C     1 
ATOM   385  O  O     . ILE A 1 62  ? 148.76900 57.08800 99.07900  1.000 68.80000  ?  50  ILE A O     1 
ATOM   386  C  CB    . ILE A 1 62  ? 151.65700 57.64600 100.74700 1.000 65.66000  ?  50  ILE A CB    1 
ATOM   387  C  CG1   . ILE A 1 62  ? 152.27700 56.95700 99.52500  1.000 64.58000  ?  50  ILE A CG1   1 
ATOM   388  C  CG2   . ILE A 1 62  ? 152.54200 57.52300 101.97900 1.000 66.77000  ?  50  ILE A CG2   1 
ATOM   389  C  CD1   . ILE A 1 62  ? 153.47000 57.69400 98.95000  1.000 64.68000  ?  50  ILE A CD1   1 
ATOM   390  N  N     . GLY A 1 63  ? 149.04000 59.03600 100.20100 1.000 74.08000  ?  51  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 63  ? 148.20700 59.80700 99.29300  1.000 81.43000  ?  51  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 63  ? 148.94100 60.91800 98.55200  1.000 83.50000  ?  51  GLY A C     1 
ATOM   393  O  O     . GLY A 1 63  ? 150.16000 60.85600 98.36700  1.000 77.27000  ?  51  GLY A O     1 
ATOM   394  N  N     . PRO A 1 64  ? 148.19300 61.94500 98.11400  1.000 85.47000  ?  52  PRO A N     1 
ATOM   395  C  CA    . PRO A 1 64  ? 148.75900 63.07300 97.36000  1.000 81.15000  ?  52  PRO A CA    1 
ATOM   396  C  C     . PRO A 1 64  ? 149.55400 64.04100 98.24500  1.000 81.15000  ?  52  PRO A C     1 
ATOM   397  O  O     . PRO A 1 64  ? 150.26200 64.90600 97.72400  1.000 83.56000  ?  52  PRO A O     1 
ATOM   398  C  CB    . PRO A 1 64  ? 147.51900 63.75800 96.76600  1.000 85.54000  ?  52  PRO A CB    1 
ATOM   399  C  CG    . PRO A 1 64  ? 146.35900 62.78800 96.99900  1.000 87.38000  ?  52  PRO A CG    1 
ATOM   400  C  CD    . PRO A 1 64  ? 146.72700 62.03300 98.22600  1.000 80.71000  ?  52  PRO A CD    1 
ATOM   401  N  N     . GLU A 1 65  ? 149.44800 63.89500 99.56400  1.000 80.12000  ?  53  GLU A N     1 
ATOM   402  C  CA    . GLU A 1 65  ? 150.27700 64.67500 100.48400 1.000 81.11000  ?  53  GLU A CA    1 
ATOM   403  C  C     . GLU A 1 65  ? 151.73400 64.21400 100.46500 1.000 80.26000  ?  53  GLU A C     1 
ATOM   404  O  O     . GLU A 1 65  ? 152.55600 64.71900 101.22400 1.000 79.52000  ?  53  GLU A O     1 
ATOM   405  C  CB    . GLU A 1 65  ? 149.74900 64.58400 101.91300 1.000 81.97000  ?  53  GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 65  ? 149.94300 63.22000 102.54800 1.000 82.18000  ?  53  GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 65  ? 149.02600 62.17100 101.94500 1.000 83.63000  ?  53  GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 65  ? 148.24100 62.53400 101.04200 1.000 76.46000  ?  53  GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 65  ? 149.09000 60.99300 102.37300 1.000 85.65000  ?  53  GLU A OE2   1 
ATOM   410  N  N     . ASN A 1 66  ? 152.04400 63.24400 99.60900  1.000 78.35000  ?  54  ASN A N     1 
ATOM   411  C  CA    . ASN A 1 66  ? 153.41900 62.80700 99.42600  1.000 75.60000  ?  54  ASN A CA    1 
ATOM   412  C  C     . ASN A 1 66  ? 153.91300 63.08500 98.01100  1.000 72.85000  ?  54  ASN A C     1 
ATOM   413  O  O     . ASN A 1 66  ? 153.61500 62.34000 97.07900  1.000 73.57000  ?  54  ASN A O     1 
ATOM   414  C  CB    . ASN A 1 66  ? 153.56400 61.31900 99.75300  1.000 73.25000  ?  54  ASN A CB    1 
ATOM   415  C  CG    . ASN A 1 66  ? 155.01300 60.91800 100.02600 1.000 71.44000  ?  54  ASN A CG    1 
ATOM   416  O  OD1   . ASN A 1 66  ? 155.91200 61.17600 99.20900  1.000 71.30000  ?  54  ASN A OD1   1 
ATOM   417  N  ND2   . ASN A 1 66  ? 155.24800 60.29600 101.18800 1.000 65.04000  ?  54  ASN A ND2   1 
ATOM   418  N  N     . PRO A 1 67  ? 154.67900 64.16300 97.85300  1.000 66.31000  ?  55  PRO A N     1 
ATOM   419  C  CA    . PRO A 1 67  ? 155.24600 64.57600 96.56700  1.000 70.12000  ?  55  PRO A CA    1 
ATOM   420  C  C     . PRO A 1 67  ? 156.26200 63.59100 95.99900  1.000 75.20000  ?  55  PRO A C     1 
ATOM   421  O  O     . PRO A 1 67  ? 156.44500 63.54800 94.78000  1.000 76.43000  ?  55  PRO A O     1 
ATOM   422  C  CB    . PRO A 1 67  ? 155.93700 65.90700 96.89600  1.000 68.96000  ?  55  PRO A CB    1 
ATOM   423  C  CG    . PRO A 1 67  ? 156.16700 65.86100 98.36600  1.000 66.80000  ?  55  PRO A CG    1 
ATOM   424  C  CD    . PRO A 1 67  ? 155.01300 65.10200 98.93300  1.000 65.79000  ?  55  PRO A CD    1 
ATOM   425  N  N     . TYR A 1 68  ? 156.90300 62.80600 96.86000  1.000 74.40000  ?  56  TYR A N     1 
ATOM   426  C  CA    . TYR A 1 68  ? 158.09900 62.07200 96.46000  1.000 68.70000  ?  56  TYR A CA    1 
ATOM   427  C  C     . TYR A 1 68  ? 157.84100 60.73600 95.77500  1.000 65.84000  ?  56  TYR A C     1 
ATOM   428  O  O     . TYR A 1 68  ? 156.73500 60.19500 95.80300  1.000 69.38000  ?  56  TYR A O     1 
ATOM   429  C  CB    . TYR A 1 68  ? 158.96300 61.85200 97.67900  1.000 64.70000  ?  56  TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 68  ? 159.09700 63.08600 98.53800  1.000 67.20000  ?  56  TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 68  ? 159.90400 64.14800 98.14300  1.000 68.53000  ?  56  TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 68  ? 158.43900 63.18200 99.75200  1.000 63.80000  ?  56  TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 68  ? 160.05200 65.27500 98.93600  1.000 65.54000  ?  56  TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 68  ? 158.57800 64.30700 100.55200 1.000 64.50000  ?  56  TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 68  ? 159.38500 65.34900 100.13700 1.000 67.33000  ?  56  TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 68  ? 159.52200 66.46400 100.92900 1.000 67.25000  ?  56  TYR A OH    1 
ATOM   437  N  N     . ASN A 1 69  ? 158.87900 60.21500 95.14200  1.000 62.65000  ?  57  ASN A N     1 
ATOM   438  C  CA    . ASN A 1 69  ? 158.81700 58.87900 94.57800  1.000 63.24000  ?  57  ASN A CA    1 
ATOM   439  C  C     . ASN A 1 69  ? 160.19300 58.45100 94.11500  1.000 61.90000  ?  57  ASN A C     1 
ATOM   440  O  O     . ASN A 1 69  ? 161.03800 59.28700 93.79200  1.000 64.22000  ?  57  ASN A O     1 
ATOM   441  C  CB    . ASN A 1 69  ? 157.82200 58.81400 93.42600  1.000 59.38000  ?  57  ASN A CB    1 
ATOM   442  C  CG    . ASN A 1 69  ? 157.67600 57.41600 92.85000  1.000 62.58000  ?  57  ASN A CG    1 
ATOM   443  O  OD1   . ASN A 1 69  ? 156.85100 56.62200 93.32100  1.000 63.62000  ?  57  ASN A OD1   1 
ATOM   444  N  ND2   . ASN A 1 69  ? 158.46000 57.11200 91.81000  1.000 58.38000  ?  57  ASN A ND2   1 
ATOM   445  N  N     . THR A 1 70  ? 160.40400 57.14100 94.09900  1.000 55.31000  ?  58  THR A N     1 
ATOM   446  C  CA    . THR A 1 70  ? 161.68100 56.55500 93.75900  1.000 58.62000  ?  58  THR A CA    1 
ATOM   447  C  C     . THR A 1 70  ? 161.36900 55.18100 93.17300  1.000 63.15000  ?  58  THR A C     1 
ATOM   448  O  O     . THR A 1 70  ? 160.54100 54.46200 93.72500  1.000 60.84000  ?  58  THR A O     1 
ATOM   449  C  CB    . THR A 1 70  ? 162.61100 56.45000 95.00300  1.000 59.69000  ?  58  THR A CB    1 
ATOM   450  O  OG1   . THR A 1 70  ? 162.54100 57.65900 95.79100  1.000 60.61000  ?  58  THR A OG1   1 
ATOM   451  C  CG2   . THR A 1 70  ? 164.03900 56.20700 94.58100  1.000 57.89000  ?  58  THR A CG2   1 
ATOM   452  N  N     . PRO A 1 71  ? 161.99600 54.82900 92.02900  1.000 67.49000  ?  59  PRO A N     1 
ATOM   453  C  CA    . PRO A 1 71  ? 161.67000 53.59100 91.29100  1.000 68.07000  ?  59  PRO A CA    1 
ATOM   454  C  C     . PRO A 1 71  ? 162.01600 52.28900 92.01100  1.000 67.93000  ?  59  PRO A C     1 
ATOM   455  O  O     . PRO A 1 71  ? 163.05300 52.20700 92.65900  1.000 70.64000  ?  59  PRO A O     1 
ATOM   456  C  CB    . PRO A 1 71  ? 162.49500 53.71000 89.99100  1.000 66.12000  ?  59  PRO A CB    1 
ATOM   457  C  CG    . PRO A 1 71  ? 163.45900 54.80400 90.21400  1.000 68.01000  ?  59  PRO A CG    1 
ATOM   458  C  CD    . PRO A 1 71  ? 162.88600 55.71700 91.25700  1.000 66.28000  ?  59  PRO A CD    1 
ATOM   459  N  N     . VAL A 1 72  ? 161.15100 51.28400 91.87800  1.000 60.84000  ?  60  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 72  ? 161.37200 49.99000 92.50200  1.000 63.50000  ?  60  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 72  ? 161.54400 48.88900 91.46700  1.000 71.38000  ?  60  VAL A C     1 
ATOM   462  O  O     . VAL A 1 72  ? 161.02800 48.99400 90.36100  1.000 75.01000  ?  60  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 72  ? 160.20900 49.59900 93.41600  1.000 65.34000  ?  60  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 72  ? 160.06500 50.60200 94.54700  1.000 67.12000  ?  60  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 72  ? 158.92700 49.51700 92.61900  1.000 66.99000  ?  60  VAL A CG2   1 
ATOM   466  N  N     . PHE A 1 73  ? 162.27200 47.83600 91.82300  1.000 66.64000  ?  61  PHE A N     1 
ATOM   467  C  CA    . PHE A 1 73  ? 162.32900 46.65200 90.97800  1.000 67.14000  ?  61  PHE A CA    1 
ATOM   468  C  C     . PHE A 1 73  ? 162.52900 45.41300 91.82100  1.000 64.53000  ?  61  PHE A C     1 
ATOM   469  O  O     . PHE A 1 73  ? 162.36800 45.44700 93.03200  1.000 62.06000  ?  61  PHE A O     1 
ATOM   470  C  CB    . PHE A 1 73  ? 163.43400 46.76200 89.92600  1.000 71.79000  ?  61  PHE A CB    1 
ATOM   471  C  CG    . PHE A 1 73  ? 164.79700 47.08800 90.48100  1.000 74.70000  ?  61  PHE A CG    1 
ATOM   472  C  CD1   . PHE A 1 73  ? 165.09600 48.37100 90.92800  1.000 69.29000  ?  61  PHE A CD1   1 
ATOM   473  C  CD2   . PHE A 1 73  ? 165.79600 46.12300 90.51100  1.000 71.51000  ?  61  PHE A CD2   1 
ATOM   474  C  CE1   . PHE A 1 73  ? 166.35000 48.67600 91.40600  1.000 65.92000  ?  61  PHE A CE1   1 
ATOM   475  C  CE2   . PHE A 1 73  ? 167.05200 46.42600 90.99100  1.000 70.35000  ?  61  PHE A CE2   1 
ATOM   476  C  CZ    . PHE A 1 73  ? 167.32900 47.70200 91.43800  1.000 67.71000  ?  61  PHE A CZ    1 
ATOM   477  N  N     . ALA A 1 74  ? 162.87000 44.31000 91.17700  1.000 67.71000  ?  62  ALA A N     1 
ATOM   478  C  CA    . ALA A 1 74  ? 163.07900 43.07600 91.91400  1.000 70.25000  ?  62  ALA A CA    1 
ATOM   479  C  C     . ALA A 1 74  ? 164.05300 42.17000 91.17300  1.000 75.27000  ?  62  ALA A C     1 
ATOM   480  O  O     . ALA A 1 74  ? 164.21800 42.28400 89.95600  1.000 78.97000  ?  62  ALA A O     1 
ATOM   481  C  CB    . ALA A 1 74  ? 161.75400 42.37000 92.15200  1.000 65.61000  ?  62  ALA A CB    1 
ATOM   482  N  N     . ILE A 1 75  ? 164.71800 41.28900 91.91100  1.000 66.71000  ?  63  ILE A N     1 
ATOM   483  C  CA    . ILE A 1 75  ? 165.57100 40.29500 91.28900  1.000 71.06000  ?  63  ILE A CA    1 
ATOM   484  C  C     . ILE A 1 75  ? 165.32400 38.97500 91.98700  1.000 74.14000  ?  63  ILE A C     1 
ATOM   485  O  O     . ILE A 1 75  ? 164.91700 38.95600 93.14400  1.000 73.13000  ?  63  ILE A O     1 
ATOM   486  C  CB    . ILE A 1 75  ? 167.06300 40.68800 91.35700  1.000 68.85000  ?  63  ILE A CB    1 
ATOM   487  C  CG1   . ILE A 1 75  ? 167.58600 40.59200 92.78700  1.000 70.12000  ?  63  ILE A CG1   1 
ATOM   488  C  CG2   . ILE A 1 75  ? 167.26200 42.09600 90.83400  1.000 70.73000  ?  63  ILE A CG2   1 
ATOM   489  C  CD1   . ILE A 1 75  ? 168.66800 41.60900 93.10800  1.000 66.36000  ?  63  ILE A CD1   1 
ATOM   490  N  N     . LYS A 1 76  ? 165.52900 37.86900 91.28200  1.000 79.63000  ?  64  LYS A N     1 
ATOM   491  C  CA    . LYS A 1 76  ? 165.41500 36.57100 91.92400  1.000 79.52000  ?  64  LYS A CA    1 
ATOM   492  C  C     . LYS A 1 76  ? 166.49900 36.47400 92.97300  1.000 80.33000  ?  64  LYS A C     1 
ATOM   493  O  O     . LYS A 1 76  ? 167.51900 37.16000 92.87300  1.000 80.55000  ?  64  LYS A O     1 
ATOM   494  C  CB    . LYS A 1 76  ? 165.53100 35.43700 90.90700  1.000 82.82000  ?  64  LYS A CB    1 
ATOM   495  C  CG    . LYS A 1 76  ? 164.18500 34.94600 90.35600  1.000 84.96000  ?  64  LYS A CG    1 
ATOM   496  C  CD    . LYS A 1 76  ? 163.35200 34.30000 91.45600  1.000 87.08000  ?  64  LYS A CD    1 
ATOM   497  C  CE    . LYS A 1 76  ? 162.23000 33.45100 90.89700  1.000 87.84000  ?  64  LYS A CE    1 
ATOM   498  N  NZ    . LYS A 1 76  ? 161.35400 34.21300 89.97200  1.000 87.80000  ?  64  LYS A NZ    1 
ATOM   499  N  N     . LYS A 1 77  ? 166.27500 35.65400 93.99400  1.000 84.23000  ?  65  LYS A N     1 
ATOM   500  C  CA    . LYS A 1 77  ? 167.31000 35.41500 94.99700  1.000 84.22000  ?  65  LYS A CA    1 
ATOM   501  C  C     . LYS A 1 77  ? 168.17800 34.21100 94.59900  1.000 91.95000  ?  65  LYS A C     1 
ATOM   502  O  O     . LYS A 1 77  ? 167.98800 33.62600 93.52600  1.000 85.95000  ?  65  LYS A O     1 
ATOM   503  C  CB    . LYS A 1 77  ? 166.69000 35.18600 96.37400  1.000 77.72000  ?  65  LYS A CB    1 
ATOM   504  C  CG    . LYS A 1 77  ? 166.03700 36.40200 97.01800  1.000 69.92000  ?  65  LYS A CG    1 
ATOM   505  C  CD    . LYS A 1 77  ? 165.24200 35.97000 98.26200  1.000 71.39000  ?  65  LYS A CD    1 
ATOM   506  C  CE    . LYS A 1 77  ? 164.95700 37.11600 99.22000  1.000 64.04000  ?  65  LYS A CE    1 
ATOM   507  N  NZ    . LYS A 1 77  ? 164.40600 36.60200 100.50800 1.000 64.53000  ?  65  LYS A NZ    1 
ATOM   508  N  N     . LYS A 1 78  ? 169.13200 33.85500 95.46300  1.000 94.68000  ?  66  LYS A N     1 
ATOM   509  C  CA    . LYS A 1 78  ? 169.92800 32.63800 95.29500  1.000 92.82000  ?  66  LYS A CA    1 
ATOM   510  C  C     . LYS A 1 78  ? 169.06400 31.38400 95.40100  1.000 99.12000  ?  66  LYS A C     1 
ATOM   511  O  O     . LYS A 1 78  ? 169.43300 30.32000 94.90700  1.000 101.51000 ?  66  LYS A O     1 
ATOM   512  C  CB    . LYS A 1 78  ? 171.04200 32.57100 96.33500  1.000 98.73000  ?  66  LYS A CB    1 
ATOM   513  C  CG    . LYS A 1 78  ? 172.29800 33.36500 95.99400  1.000 96.61000  ?  66  LYS A CG    1 
ATOM   514  C  CD    . LYS A 1 78  ? 173.42900 32.99800 96.95800  1.000 88.07000  ?  66  LYS A CD    1 
ATOM   515  C  CE    . LYS A 1 78  ? 174.71700 33.75900 96.66400  1.000 94.43000  ?  66  LYS A CE    1 
ATOM   516  N  NZ    . LYS A 1 78  ? 175.79700 33.48000 97.67200  1.000 79.81000  ?  66  LYS A NZ    1 
ATOM   517  N  N     . ASP A 1 79  ? 167.91700 31.52200 96.06400  1.000 105.69000 ?  67  ASP A N     1 
ATOM   518  C  CA    . ASP A 1 79  ? 166.91500 30.46100 96.15200  1.000 102.75000 ?  67  ASP A CA    1 
ATOM   519  C  C     . ASP A 1 79  ? 166.20500 30.26200 94.82200  1.000 103.96000 ?  67  ASP A C     1 
ATOM   520  O  O     . ASP A 1 79  ? 165.61600 29.20700 94.57700  1.000 105.87000 ?  67  ASP A O     1 
ATOM   521  C  CB    . ASP A 1 79  ? 165.87900 30.78200 97.23400  1.000 101.95000 ?  67  ASP A CB    1 
ATOM   522  C  CG    . ASP A 1 79  ? 164.88700 29.64300 97.45700  1.000 107.07000 ?  67  ASP A CG    1 
ATOM   523  O  OD1   . ASP A 1 79  ? 165.28100 28.46600 97.29200  1.000 111.63000 ?  67  ASP A OD1   1 
ATOM   524  O  OD2   . ASP A 1 79  ? 163.71700 29.92200 97.80900  1.000 101.18000 ?  67  ASP A OD2   1 
ATOM   525  N  N     . SER A 1 80  ? 166.24000 31.29600 93.98100  1.000 101.91000 ?  68  SER A N     1 
ATOM   526  C  CA    . SER A 1 80  ? 165.59700 31.27200 92.66600  1.000 101.52000 ?  68  SER A CA    1 
ATOM   527  C  C     . SER A 1 80  ? 164.07800 31.03800 92.76800  1.000 101.95000 ?  68  SER A C     1 
ATOM   528  O  O     . SER A 1 80  ? 163.38800 30.93700 91.75300  1.000 104.45000 ?  68  SER A O     1 
ATOM   529  C  CB    . SER A 1 80  ? 166.24100 30.19900 91.76600  1.000 104.32000 ?  68  SER A CB    1 
ATOM   530  O  OG    . SER A 1 80  ? 167.58100 30.52400 91.41100  1.000 97.44000  ?  68  SER A OG    1 
ATOM   531  N  N     . THR A 1 81  ? 163.56400 30.95400 93.99200  1.000 99.16000  ?  69  THR A N     1 
ATOM   532  C  CA    . THR A 1 81  ? 162.14400 30.71600 94.20900  1.000 97.99000  ?  69  THR A CA    1 
ATOM   533  C  C     . THR A 1 81  ? 161.51700 31.94400 94.83000  1.000 98.15000  ?  69  THR A C     1 
ATOM   534  O  O     . THR A 1 81  ? 160.29900 32.11300 94.83200  1.000 96.69000  ?  69  THR A O     1 
ATOM   535  C  CB    . THR A 1 81  ? 161.90100 29.51100 95.12900  1.000 99.76000  ?  69  THR A CB    1 
ATOM   536  O  OG1   . THR A 1 81  ? 162.54500 28.35200 94.58200  1.000 103.43000 ?  69  THR A OG1   1 
ATOM   537  C  CG2   . THR A 1 81  ? 160.39900 29.25200 95.29800  1.000 95.82000  ?  69  THR A CG2   1 
ATOM   538  N  N     . LYS A 1 82  ? 162.36900 32.80000 95.37300  1.000 93.48000  ?  70  LYS A N     1 
ATOM   539  C  CA    . LYS A 1 82  ? 161.89200 33.97200 96.06600  1.000 82.68000  ?  70  LYS A CA    1 
ATOM   540  C  C     . LYS A 1 82  ? 162.46500 35.20700 95.40700  1.000 75.99000  ?  70  LYS A C     1 
ATOM   541  O  O     . LYS A 1 82  ? 163.57800 35.18400 94.87000  1.000 77.11000  ?  70  LYS A O     1 
ATOM   542  C  CB    . LYS A 1 82  ? 162.26200 33.89800 97.55300  1.000 90.16000  ?  70  LYS A CB    1 
ATOM   543  C  CG    . LYS A 1 82  ? 161.48100 32.82100 98.32200  1.000 93.25000  ?  70  LYS A CG    1 
ATOM   544  C  CD    . LYS A 1 82  ? 161.88800 32.72200 99.78700  1.000 93.56000  ?  70  LYS A CD    1 
ATOM   545  C  CE    . LYS A 1 82  ? 161.74000 34.06200 100.51100 1.000 94.98000  ?  70  LYS A CE    1 
ATOM   546  N  NZ    . LYS A 1 82  ? 162.06200 33.96200 101.97000 1.000 83.10000  ?  70  LYS A NZ    1 
ATOM   547  N  N     . TRP A 1 83  ? 161.68400 36.27700 95.42600  1.000 68.19000  ?  71  TRP A N     1 
ATOM   548  C  CA    . TRP A 1 83  ? 162.11100 37.54400 94.86000  1.000 68.68000  ?  71  TRP A CA    1 
ATOM   549  C  C     . TRP A 1 83  ? 162.64300 38.50000 95.92300  1.000 66.41000  ?  71  TRP A C     1 
ATOM   550  O  O     . TRP A 1 83  ? 162.23400 38.44900 97.08400  1.000 68.78000  ?  71  TRP A O     1 
ATOM   551  C  CB    . TRP A 1 83  ? 160.94900 38.21200 94.12500  1.000 74.48000  ?  71  TRP A CB    1 
ATOM   552  C  CG    . TRP A 1 83  ? 160.59600 37.58500 92.82500  1.000 77.06000  ?  71  TRP A CG    1 
ATOM   553  C  CD1   . TRP A 1 83  ? 159.68900 36.59900 92.62000  1.000 75.83000  ?  71  TRP A CD1   1 
ATOM   554  C  CD2   . TRP A 1 83  ? 161.14100 37.91100 91.53500  1.000 77.67000  ?  71  TRP A CD2   1 
ATOM   555  N  NE1   . TRP A 1 83  ? 159.63200 36.28100 91.28500  1.000 81.57000  ?  71  TRP A NE1   1 
ATOM   556  C  CE2   . TRP A 1 83  ? 160.51100 37.07400 90.59700  1.000 81.16000  ?  71  TRP A CE2   1 
ATOM   557  C  CE3   . TRP A 1 83  ? 162.10100 38.82600 91.08900  1.000 78.64000  ?  71  TRP A CE3   1 
ATOM   558  C  CZ2   . TRP A 1 83  ? 160.80800 37.12300 89.23300  1.000 78.55000  ?  71  TRP A CZ2   1 
ATOM   559  C  CZ3   . TRP A 1 83  ? 162.39100 38.87900 89.73400  1.000 78.97000  ?  71  TRP A CZ3   1 
ATOM   560  C  CH2   . TRP A 1 83  ? 161.74800 38.02900 88.82500  1.000 81.81000  ?  71  TRP A CH2   1 
ATOM   561  N  N     . ARG A 1 84  ? 163.52900 39.40000 95.52600  1.000 58.99000  ?  72  ARG A N     1 
ATOM   562  C  CA    . ARG A 1 84  ? 163.95600 40.43700 96.43800  1.000 56.99000  ?  72  ARG A CA    1 
ATOM   563  C  C     . ARG A 1 84  ? 163.48700 41.80500 95.94700  1.000 58.96000  ?  72  ARG A C     1 
ATOM   564  O  O     . ARG A 1 84  ? 163.88900 42.27000 94.88300  1.000 57.96000  ?  72  ARG A O     1 
ATOM   565  C  CB    . ARG A 1 84  ? 165.48000 40.39000 96.61200  1.000 58.58000  ?  72  ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 84  ? 166.10900 41.62400 97.20900  1.000 51.15000  ?  72  ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 84  ? 167.60100 41.41500 97.47600  1.000 56.24000  ?  72  ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 84  ? 167.81600 40.69200 98.73100  1.000 56.91000  ?  72  ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 84  ? 168.43000 39.52100 98.81400  1.000 57.50000  ?  72  ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 84  ? 168.91600 38.94500 97.71800  1.000 69.40000  ?  72  ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 84  ? 168.56100 38.92500 99.98000  1.000 47.74000  ?  72  ARG A NH2   1 
ATOM   572  N  N     . LYS A 1 85  ? 162.61600 42.44300 96.72500  1.000 57.37000  ?  73  LYS A N     1 
ATOM   573  C  CA    . LYS A 1 85  ? 162.19400 43.80700 96.43200  1.000 54.14000  ?  73  LYS A CA    1 
ATOM   574  C  C     . LYS A 1 85  ? 163.32800 44.80800 96.65900  1.000 55.13000  ?  73  LYS A C     1 
ATOM   575  O  O     . LYS A 1 85  ? 163.86600 44.89800 97.75900  1.000 60.05000  ?  73  LYS A O     1 
ATOM   576  C  CB    . LYS A 1 85  ? 160.97700 44.17000 97.28700  1.000 52.77000  ?  73  LYS A CB    1 
ATOM   577  C  CG    . LYS A 1 85  ? 160.58400 45.65500 97.28100  1.000 53.70000  ?  73  LYS A CG    1 
ATOM   578  C  CD    . LYS A 1 85  ? 159.17400 45.80400 97.85600  1.000 58.10000  ?  73  LYS A CD    1 
ATOM   579  C  CE    . LYS A 1 85  ? 158.74500 47.24700 98.07400  1.000 54.42000  ?  73  LYS A CE    1 
ATOM   580  N  NZ    . LYS A 1 85  ? 159.35200 48.22300 97.13100  1.000 54.91000  ?  73  LYS A NZ    1 
ATOM   581  N  N     . LEU A 1 86  ? 163.68700 45.56400 95.62400  1.000 60.66000  ?  74  LEU A N     1 
ATOM   582  C  CA    . LEU A 1 86  ? 164.76600 46.55400 95.70600  1.000 55.53000  ?  74  LEU A CA    1 
ATOM   583  C  C     . LEU A 1 86  ? 164.26100 47.94300 95.36500  1.000 56.70000  ?  74  LEU A C     1 
ATOM   584  O  O     . LEU A 1 86  ? 163.21800 48.08700 94.74800  1.000 67.76000  ?  74  LEU A O     1 
ATOM   585  C  CB    . LEU A 1 86  ? 165.90000 46.18300 94.75700  1.000 55.46000  ?  74  LEU A CB    1 
ATOM   586  C  CG    . LEU A 1 86  ? 166.66600 44.89100 95.03200  1.000 55.66000  ?  74  LEU A CG    1 
ATOM   587  C  CD1   . LEU A 1 86  ? 167.66300 44.62300 93.90900  1.000 60.02000  ?  74  LEU A CD1   1 
ATOM   588  C  CD2   . LEU A 1 86  ? 167.38900 45.00600 96.35900  1.000 56.17000  ?  74  LEU A CD2   1 
ATOM   589  N  N     . VAL A 1 87  ? 165.00500 48.96600 95.75200  1.000 58.50000  ?  75  VAL A N     1 
ATOM   590  C  CA    . VAL A 1 87  ? 164.64700 50.34700 95.45000  1.000 58.80000  ?  75  VAL A CA    1 
ATOM   591  C  C     . VAL A 1 87  ? 165.85900 51.12300 94.98400  1.000 58.79000  ?  75  VAL A C     1 
ATOM   592  O  O     . VAL A 1 87  ? 166.83500 51.24300 95.71500  1.000 60.12000  ?  75  VAL A O     1 
ATOM   593  C  CB    . VAL A 1 87  ? 164.08000 51.08300 96.66400  1.000 58.30000  ?  75  VAL A CB    1 
ATOM   594  C  CG1   . VAL A 1 87  ? 163.90900 52.55100 96.33700  1.000 58.36000  ?  75  VAL A CG1   1 
ATOM   595  C  CG2   . VAL A 1 87  ? 162.79400 50.47100 97.11500  1.000 55.33000  ?  75  VAL A CG2   1 
ATOM   596  N  N     . ASP A 1 88  ? 165.79800 51.65900 93.77400  1.000 64.40000  ?  76  ASP A N     1 
ATOM   597  C  CA    . ASP A 1 88  ? 166.87100 52.50100 93.26400  1.000 63.62000  ?  76  ASP A CA    1 
ATOM   598  C  C     . ASP A 1 88  ? 166.84800 53.85300 93.96500  1.000 58.95000  ?  76  ASP A C     1 
ATOM   599  O  O     . ASP A 1 88  ? 166.36200 54.83100 93.41600  1.000 59.85000  ?  76  ASP A O     1 
ATOM   600  C  CB    . ASP A 1 88  ? 166.73400 52.67700 91.75300  1.000 65.21000  ?  76  ASP A CB    1 
ATOM   601  C  CG    . ASP A 1 88  ? 167.90600 53.42200 91.13200  1.000 68.75000  ?  76  ASP A CG    1 
ATOM   602  O  OD1   . ASP A 1 88  ? 168.64300 54.14700 91.84400  1.000 63.55000  ?  76  ASP A OD1   1 
ATOM   603  O  OD2   . ASP A 1 88  ? 168.07300 53.29000 89.90400  1.000 74.57000  ?  76  ASP A OD2   1 
ATOM   604  N  N     . PHE A 1 89  ? 167.39300 53.90500 95.17200  1.000 54.27000  ?  77  PHE A N     1 
ATOM   605  C  CA    . PHE A 1 89  ? 167.38700 55.13200 95.96100  1.000 55.30000  ?  77  PHE A CA    1 
ATOM   606  C  C     . PHE A 1 89  ? 168.56600 56.06100 95.70200  1.000 54.52000  ?  77  PHE A C     1 
ATOM   607  O  O     . PHE A 1 89  ? 168.85600 56.92400 96.53100  1.000 52.13000  ?  77  PHE A O     1 
ATOM   608  C  CB    . PHE A 1 89  ? 167.38200 54.79000 97.44800  1.000 57.93000  ?  77  PHE A CB    1 
ATOM   609  C  CG    . PHE A 1 89  ? 166.03500 54.59300 98.02100  1.000 53.12000  ?  77  PHE A CG    1 
ATOM   610  C  CD1   . PHE A 1 89  ? 165.03000 55.50100 97.78400  1.000 55.11000  ?  77  PHE A CD1   1 
ATOM   611  C  CD2   . PHE A 1 89  ? 165.77100 53.49900 98.81900  1.000 57.41000  ?  77  PHE A CD2   1 
ATOM   612  C  CE1   . PHE A 1 89  ? 163.76500 55.32300 98.33200  1.000 56.16000  ?  77  PHE A CE1   1 
ATOM   613  C  CE2   . PHE A 1 89  ? 164.49900 53.31100 99.37900  1.000 62.92000  ?  77  PHE A CE2   1 
ATOM   614  C  CZ    . PHE A 1 89  ? 163.49800 54.23000 99.12800  1.000 58.40000  ?  77  PHE A CZ    1 
ATOM   615  N  N     . ARG A 1 90  ? 169.24500 55.89200 94.56900  1.000 59.83000  ?  78  ARG A N     1 
ATOM   616  C  CA    . ARG A 1 90  ? 170.48900 56.62200 94.31000  1.000 54.10000  ?  78  ARG A CA    1 
ATOM   617  C  C     . ARG A 1 90  ? 170.36000 58.12200 94.49200  1.000 54.39000  ?  78  ARG A C     1 
ATOM   618  O  O     . ARG A 1 90  ? 171.32800 58.78600 94.83300  1.000 60.56000  ?  78  ARG A O     1 
ATOM   619  C  CB    . ARG A 1 90  ? 170.99600 56.33200 92.90800  1.000 55.62000  ?  78  ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 90  ? 171.87500 55.12500 92.82600  1.000 55.39000  ?  78  ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 90  ? 172.17600 54.78500 91.40300  1.000 63.06000  ?  78  ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 90  ? 170.98000 54.38900 90.66400  1.000 70.43000  ?  78  ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 90  ? 170.97200 54.12900 89.36100  1.000 74.95000  ?  78  ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 90  ? 172.09700 54.24000 88.66300  1.000 77.24000  ?  78  ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 90  ? 169.85000 53.76700 88.75300  1.000 72.35000  ?  78  ARG A NH2   1 
ATOM   626  N  N     . GLU A 1 91  ? 169.16700 58.66000 94.27600  1.000 57.67000  ?  79  GLU A N     1 
ATOM   627  C  CA    . GLU A 1 91  ? 168.96900 60.09300 94.44900  1.000 60.95000  ?  79  GLU A CA    1 
ATOM   628  C  C     . GLU A 1 91  ? 168.77800 60.44500 95.92400  1.000 58.20000  ?  79  GLU A C     1 
ATOM   629  O  O     . GLU A 1 91  ? 169.37600 61.39400 96.43000  1.000 61.37000  ?  79  GLU A O     1 
ATOM   630  C  CB    . GLU A 1 91  ? 167.77400 60.57800 93.62300  1.000 68.59000  ?  79  GLU A CB    1 
ATOM   631  C  CG    . GLU A 1 91  ? 167.56800 62.09000 93.67300  1.000 69.95000  ?  79  GLU A CG    1 
ATOM   632  C  CD    . GLU A 1 91  ? 168.75500 62.84400 93.10900  1.000 73.25000  ?  79  GLU A CD    1 
ATOM   633  O  OE1   . GLU A 1 91  ? 169.42500 62.28800 92.20600  1.000 79.07000  ?  79  GLU A OE1   1 
ATOM   634  O  OE2   . GLU A 1 91  ? 169.02900 63.97500 93.57600  1.000 73.37000  ?  79  GLU A OE2   1 
ATOM   635  N  N     . LEU A 1 92  ? 167.94800 59.67700 96.62000  1.000 59.28000  ?  80  LEU A N     1 
ATOM   636  C  CA    . LEU A 1 92  ? 167.79600 59.86600 98.06100  1.000 59.24000  ?  80  LEU A CA    1 
ATOM   637  C  C     . LEU A 1 92  ? 169.12100 59.62900 98.78200  1.000 55.40000  ?  80  LEU A C     1 
ATOM   638  O  O     . LEU A 1 92  ? 169.49200 60.36700 99.70100  1.000 55.19000  ?  80  LEU A O     1 
ATOM   639  C  CB    . LEU A 1 92  ? 166.71600 58.94100 98.61200  1.000 58.35000  ?  80  LEU A CB    1 
ATOM   640  C  CG    . LEU A 1 92  ? 166.57100 58.92300 100.12600 1.000 53.02000  ?  80  LEU A CG    1 
ATOM   641  C  CD1   . LEU A 1 92  ? 166.23600 60.31500 100.67400 1.000 53.47000  ?  80  LEU A CD1   1 
ATOM   642  C  CD2   . LEU A 1 92  ? 165.51700 57.90700 100.48900 1.000 55.24000  ?  80  LEU A CD2   1 
ATOM   643  N  N     . ASN A 1 93  ? 169.83600 58.59700 98.35300  1.000 53.29000  ?  81  ASN A N     1 
ATOM   644  C  CA    . ASN A 1 93  ? 171.17000 58.34100 98.88200  1.000 56.58000  ?  81  ASN A CA    1 
ATOM   645  C  C     . ASN A 1 93  ? 172.05600 59.59400 98.83200  1.000 61.59000  ?  81  ASN A C     1 
ATOM   646  O  O     . ASN A 1 93  ? 172.73700 59.92900 99.81300  1.000 63.85000  ?  81  ASN A O     1 
ATOM   647  C  CB    . ASN A 1 93  ? 171.82600 57.18800 98.12200  1.000 50.37000  ?  81  ASN A CB    1 
ATOM   648  C  CG    . ASN A 1 93  ? 171.19600 55.85600 98.45100  1.000 50.81000  ?  81  ASN A CG    1 
ATOM   649  O  OD1   . ASN A 1 93  ? 170.52100 55.73000 99.47500  1.000 57.55000  ?  81  ASN A OD1   1 
ATOM   650  N  ND2   . ASN A 1 93  ? 171.40800 54.85300 97.59900  1.000 50.37000  ?  81  ASN A ND2   1 
ATOM   651  N  N     . LYS A 1 94  ? 172.01800 60.29700 97.70000  1.000 58.86000  ?  82  LYS A N     1 
ATOM   652  C  CA    . LYS A 1 94  ? 172.77500 61.53100 97.53300  1.000 56.60000  ?  82  LYS A CA    1 
ATOM   653  C  C     . LYS A 1 94  ? 172.39000 62.58300 98.56100  1.000 60.75000  ?  82  LYS A C     1 
ATOM   654  O  O     . LYS A 1 94  ? 173.24300 63.32400 99.03700  1.000 64.90000  ?  82  LYS A O     1 
ATOM   655  C  CB    . LYS A 1 94  ? 172.56600 62.09600 96.12900  1.000 63.86000  ?  82  LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 94  ? 173.38900 61.44000 95.03200  1.000 70.67000  ?  82  LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 94  ? 172.95900 61.91300 93.63200  1.000 71.32000  ?  82  LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 94  ? 173.81300 61.26400 92.53600  1.000 74.32000  ?  82  LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 94  ? 173.03900 61.06700 91.27400  1.000 86.34000  ?  82  LYS A NZ    1 
ATOM   660  N  N     . ARG A 1 95  ? 171.10600 62.65600 98.89700  1.000 58.52000  ?  83  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 95  ? 170.61500 63.74000 99.74500  1.000 61.48000  ?  83  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 95  ? 170.44700 63.34100 101.20000 1.000 65.50000  ?  83  ARG A C     1 
ATOM   663  O  O     . ARG A 1 95  ? 170.02900 64.16600 102.02300 1.000 65.03000  ?  83  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 95  ? 169.27700 64.26800 99.22000  1.000 71.09000  ?  83  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 95  ? 169.20500 64.39300 97.70400  1.000 68.65000  ?  83  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 95  ? 168.28600 65.51900 97.27700  1.000 75.14000  ?  83  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 95  ? 168.12800 65.52800 95.82500  1.000 80.25000  ?  83  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 95  ? 166.98100 65.28200 95.19900  1.000 80.57000  ?  83  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 95  ? 165.87900 65.02300 95.89300  1.000 76.76000  ?  83  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 95  ? 166.93400 65.29800 93.87300  1.000 84.94000  ?  83  ARG A NH2   1 
ATOM   671  N  N     . THR A 1 96  ? 170.75100 62.07700 101.51200 1.000 64.48000  ?  84  THR A N     1 
ATOM   672  C  CA    . THR A 1 96  ? 170.74500 61.59700 102.89500 1.000 58.69000  ?  84  THR A CA    1 
ATOM   673  C  C     . THR A 1 96  ? 172.06500 61.90300 103.57900 1.000 57.54000  ?  84  THR A C     1 
ATOM   674  O  O     . THR A 1 96  ? 173.11600 61.88700 102.93100 1.000 62.94000  ?  84  THR A O     1 
ATOM   675  C  CB    . THR A 1 96  ? 170.49700 60.09200 102.97400 1.000 57.10000  ?  84  THR A CB    1 
ATOM   676  O  OG1   . THR A 1 96  ? 169.22800 59.79600 102.39400 1.000 60.74000  ?  84  THR A OG1   1 
ATOM   677  C  CG2   . THR A 1 96  ? 170.48300 59.63900 104.41900 1.000 52.48000  ?  84  THR A CG2   1 
ATOM   678  N  N     . GLN A 1 97  ? 172.00600 62.17700 104.87900 1.000 53.60000  ?  85  GLN A N     1 
ATOM   679  C  CA    . GLN A 1 97  ? 173.19700 62.44400 105.68800 1.000 59.38000  ?  85  GLN A CA    1 
ATOM   680  C  C     . GLN A 1 97  ? 174.24800 61.33100 105.59200 1.000 57.91000  ?  85  GLN A C     1 
ATOM   681  O  O     . GLN A 1 97  ? 173.96800 60.22100 105.13700 1.000 54.16000  ?  85  GLN A O     1 
ATOM   682  C  CB    . GLN A 1 97  ? 172.81200 62.60600 107.15600 1.000 54.03000  ?  85  GLN A CB    1 
ATOM   683  C  CG    . GLN A 1 97  ? 172.13300 61.35500 107.67000 1.000 55.77000  ?  85  GLN A CG    1 
ATOM   684  C  CD    . GLN A 1 97  ? 172.10000 61.28000 109.16100 1.000 58.58000  ?  85  GLN A CD    1 
ATOM   685  O  OE1   . GLN A 1 97  ? 171.18200 61.80200 109.78900 1.000 65.38000  ?  85  GLN A OE1   1 
ATOM   686  N  NE2   . GLN A 1 97  ? 173.10300 60.62800 109.75200 1.000 54.23000  ?  85  GLN A NE2   1 
ATOM   687  N  N     . ASP A 1 98  ? 175.45000 61.62900 106.06200 1.000 55.07000  ?  86  ASP A N     1 
ATOM   688  C  CA    . ASP A 1 98  ? 176.47900 60.61300 106.20000 1.000 54.55000  ?  86  ASP A CA    1 
ATOM   689  C  C     . ASP A 1 98  ? 176.29900 59.77300 107.45500 1.000 56.75000  ?  86  ASP A C     1 
ATOM   690  O  O     . ASP A 1 98  ? 175.86300 60.27300 108.49800 1.000 57.84000  ?  86  ASP A O     1 
ATOM   691  C  CB    . ASP A 1 98  ? 177.85000 61.26000 106.22400 1.000 48.78000  ?  86  ASP A CB    1 
ATOM   692  C  CG    . ASP A 1 98  ? 178.17600 61.94800 104.92400 1.000 63.80000  ?  86  ASP A CG    1 
ATOM   693  O  OD1   . ASP A 1 98  ? 177.73300 61.43400 103.85900 1.000 64.94000  ?  86  ASP A OD1   1 
ATOM   694  O  OD2   . ASP A 1 98  ? 178.86200 62.99700 104.97300 1.000 61.93000  ?  86  ASP A OD2   1 
ATOM   695  N  N     . PHE A 1 99  ? 176.62100 58.49000 107.33600 1.000 54.40000  ?  87  PHE A N     1 
ATOM   696  C  CA    . PHE A 1 99  ? 176.70200 57.58100 108.47700 1.000 50.19000  ?  87  PHE A CA    1 
ATOM   697  C  C     . PHE A 1 99  ? 178.14900 57.19300 108.67200 1.000 50.53000  ?  87  PHE A C     1 
ATOM   698  O  O     . PHE A 1 99  ? 178.93200 57.21600 107.72800 1.000 48.97000  ?  87  PHE A O     1 
ATOM   699  C  CB    . PHE A 1 99  ? 175.86300 56.31900 108.25100 1.000 47.25000  ?  87  PHE A CB    1 
ATOM   700  C  CG    . PHE A 1 99  ? 174.45600 56.60600 107.89300 1.000 51.10000  ?  87  PHE A CG    1 
ATOM   701  C  CD1   . PHE A 1 99  ? 174.10500 56.87600 106.58800 1.000 56.92000  ?  87  PHE A CD1   1 
ATOM   702  C  CD2   . PHE A 1 99  ? 173.48500 56.65500 108.86300 1.000 51.42000  ?  87  PHE A CD2   1 
ATOM   703  C  CE1   . PHE A 1 99  ? 172.80500 57.17500 106.26000 1.000 55.78000  ?  87  PHE A CE1   1 
ATOM   704  C  CE2   . PHE A 1 99  ? 172.17700 56.94600 108.55000 1.000 51.13000  ?  87  PHE A CE2   1 
ATOM   705  C  CZ    . PHE A 1 99  ? 171.83200 57.20400 107.25400 1.000 57.21000  ?  87  PHE A CZ    1 
ATOM   706  N  N     . TRP A 1 100 ? 178.51000 56.82700 109.89500 1.000 55.24000  ?  88  TRP A N     1 
ATOM   707  C  CA    . TRP A 1 100 ? 179.76600 56.12800 110.09800 1.000 50.85000  ?  88  TRP A CA    1 
ATOM   708  C  C     . TRP A 1 100 ? 179.47600 54.63800 109.98800 1.000 47.17000  ?  88  TRP A C     1 
ATOM   709  O  O     . TRP A 1 100 ? 178.63800 54.11400 110.71400 1.000 48.48000  ?  88  TRP A O     1 
ATOM   710  C  CB    . TRP A 1 100 ? 180.41100 56.46700 111.44700 1.000 48.45000  ?  88  TRP A CB    1 
ATOM   711  C  CG    . TRP A 1 100 ? 181.81500 55.96500 111.47100 1.000 48.10000  ?  88  TRP A CG    1 
ATOM   712  C  CD1   . TRP A 1 100 ? 182.26600 54.82800 112.06700 1.000 47.58000  ?  88  TRP A CD1   1 
ATOM   713  C  CD2   . TRP A 1 100 ? 182.94300 56.54100 110.79300 1.000 46.81000  ?  88  TRP A CD2   1 
ATOM   714  N  NE1   . TRP A 1 100 ? 183.61300 54.67800 111.83500 1.000 47.41000  ?  88  TRP A NE1   1 
ATOM   715  C  CE2   . TRP A 1 100 ? 184.05200 55.71000 111.05400 1.000 41.89000  ?  88  TRP A CE2   1 
ATOM   716  C  CE3   . TRP A 1 100 ? 183.12300 57.68400 110.00200 1.000 45.92000  ?  88  TRP A CE3   1 
ATOM   717  C  CZ2   . TRP A 1 100 ? 185.33100 55.98800 110.55800 1.000 44.97000  ?  88  TRP A CZ2   1 
ATOM   718  C  CZ3   . TRP A 1 100 ? 184.39900 57.96100 109.50700 1.000 42.46000  ?  88  TRP A CZ3   1 
ATOM   719  C  CH2   . TRP A 1 100 ? 185.48300 57.11200 109.78800 1.000 45.85000  ?  88  TRP A CH2   1 
ATOM   720  N  N     . GLU A 1 101 ? 180.13400 53.97300 109.04800 1.000 49.20000  ?  89  GLU A N     1 
ATOM   721  C  CA    . GLU A 1 101 ? 179.93800 52.53700 108.83600 1.000 48.97000  ?  89  GLU A CA    1 
ATOM   722  C  C     . GLU A 1 101 ? 180.55000 51.78200 109.99100 1.000 49.18000  ?  89  GLU A C     1 
ATOM   723  O  O     . GLU A 1 101 ? 181.68100 52.08900 110.39200 1.000 52.20000  ?  89  GLU A O     1 
ATOM   724  C  CB    . GLU A 1 101 ? 180.56600 52.07800 107.51900 1.000 42.46000  ?  89  GLU A CB    1 
ATOM   725  C  CG    . GLU A 1 101 ? 180.09100 52.86500 106.33000 1.000 45.21000  ?  89  GLU A CG    1 
ATOM   726  C  CD    . GLU A 1 101 ? 178.58600 52.75500 106.11500 1.000 56.75000  ?  89  GLU A CD    1 
ATOM   727  O  OE1   . GLU A 1 101 ? 177.98000 51.75000 106.58100 1.000 52.94000  ?  89  GLU A OE1   1 
ATOM   728  O  OE2   . GLU A 1 101 ? 178.01700 53.68200 105.48000 1.000 61.05000  ?  89  GLU A OE2   1 
ATOM   729  N  N     . VAL A 1 102 ? 179.81700 50.80400 110.52500 1.000 44.60000  ?  90  VAL A N     1 
ATOM   730  C  CA    . VAL A 1 102 ? 180.31300 50.04900 111.66500 1.000 41.47000  ?  90  VAL A CA    1 
ATOM   731  C  C     . VAL A 1 102 ? 180.92400 48.72500 111.23800 1.000 42.38000  ?  90  VAL A C     1 
ATOM   732  O  O     . VAL A 1 102 ? 181.56700 48.07300 112.04400 1.000 41.34000  ?  90  VAL A O     1 
ATOM   733  C  CB    . VAL A 1 102 ? 179.20900 49.77200 112.71000 1.000 48.17000  ?  90  VAL A CB    1 
ATOM   734  C  CG1   . VAL A 1 102 ? 178.75300 51.07800 113.32000 1.000 45.94000  ?  90  VAL A CG1   1 
ATOM   735  C  CG2   . VAL A 1 102 ? 178.02100 48.96100 112.09500 1.000 38.43000  ?  90  VAL A CG2   1 
ATOM   736  N  N     . GLN A 1 103 ? 180.70800 48.31800 109.99100 1.000 41.69000  ?  91  GLN A N     1 
ATOM   737  C  CA    . GLN A 1 103 ? 181.32500 47.09300 109.47600 1.000 41.22000  ?  91  GLN A CA    1 
ATOM   738  C  C     . GLN A 1 103 ? 182.75900 47.36900 109.04600 1.000 44.92000  ?  91  GLN A C     1 
ATOM   739  O  O     . GLN A 1 103 ? 182.98800 48.04700 108.03900 1.000 46.57000  ?  91  GLN A O     1 
ATOM   740  C  CB    . GLN A 1 103 ? 180.53400 46.53600 108.29100 1.000 39.98000  ?  91  GLN A CB    1 
ATOM   741  C  CG    . GLN A 1 103 ? 180.97200 45.15800 107.87300 1.000 43.60000  ?  91  GLN A CG    1 
ATOM   742  C  CD    . GLN A 1 103 ? 180.47800 44.07900 108.84400 1.000 47.24000  ?  91  GLN A CD    1 
ATOM   743  O  OE1   . GLN A 1 103 ? 179.36500 44.16900 109.36600 1.000 44.58000  ?  91  GLN A OE1   1 
ATOM   744  N  NE2   . GLN A 1 103 ? 181.30300 43.05700 109.08000 1.000 40.76000  ?  91  GLN A NE2   1 
ATOM   745  N  N     . LEU A 1 104 ? 183.72700 46.85700 109.80100 1.000 44.51000  ?  92  LEU A N     1 
ATOM   746  C  CA    . LEU A 1 104 ? 185.13200 47.24200 109.59700 1.000 42.63000  ?  92  LEU A CA    1 
ATOM   747  C  C     . LEU A 1 104 ? 185.91800 46.24600 108.72000 1.000 43.63000  ?  92  LEU A C     1 
ATOM   748  O  O     . LEU A 1 104 ? 187.07300 46.49600 108.34000 1.000 47.24000  ?  92  LEU A O     1 
ATOM   749  C  CB    . LEU A 1 104 ? 185.81900 47.41500 110.95000 1.000 39.92000  ?  92  LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 104 ? 185.01300 48.26200 111.95000 1.000 40.76000  ?  92  LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 104 ? 185.85200 48.72200 113.14600 1.000 35.37000  ?  92  LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 104 ? 184.41700 49.44900 111.24400 1.000 38.68000  ?  92  LEU A CD2   1 
ATOM   753  N  N     . GLY A 1 105 ? 185.27100 45.14000 108.37200 1.000 38.28000  ?  93  GLY A N     1 
ATOM   754  C  CA    . GLY A 1 105 ? 185.89900 44.08900 107.59700 1.000 38.89000  ?  93  GLY A CA    1 
ATOM   755  C  C     . GLY A 1 105 ? 185.04400 42.84100 107.50100 1.000 41.73000  ?  93  GLY A C     1 
ATOM   756  O  O     . GLY A 1 105 ? 183.86500 42.83500 107.88600 1.000 43.90000  ?  93  GLY A O     1 
ATOM   757  N  N     . ILE A 1 106 ? 185.65200 41.77900 106.98400 1.000 41.78000  ?  94  ILE A N     1 
ATOM   758  C  CA    . ILE A 1 106 ? 184.95800 40.54400 106.66400 1.000 36.66000  ?  94  ILE A CA    1 
ATOM   759  C  C     . ILE A 1 106 ? 185.55400 39.44300 107.49900 1.000 40.64000  ?  94  ILE A C     1 
ATOM   760  O  O     . ILE A 1 106 ? 186.77200 39.28900 107.52800 1.000 41.98000  ?  94  ILE A O     1 
ATOM   761  C  CB    . ILE A 1 106 ? 185.10000 40.17500 105.18700 1.000 39.29000  ?  94  ILE A CB    1 
ATOM   762  C  CG1   . ILE A 1 106 ? 185.01000 41.41900 104.30500 1.000 43.86000  ?  94  ILE A CG1   1 
ATOM   763  C  CG2   . ILE A 1 106 ? 184.04200 39.18700 104.80400 1.000 38.83000  ?  94  ILE A CG2   1 
ATOM   764  C  CD1   . ILE A 1 106 ? 183.75800 42.27400 104.59600 1.000 47.23000  ?  94  ILE A CD1   1 
ATOM   765  N  N     . PRO A 1 107 ? 184.71500 38.68100 108.20900 1.000 40.61000  ?  95  PRO A N     1 
ATOM   766  C  CA    . PRO A 1 107 ? 185.37900 37.69000 109.05600 1.000 39.59000  ?  95  PRO A CA    1 
ATOM   767  C  C     . PRO A 1 107 ? 185.97300 36.62900 108.17800 1.000 38.61000  ?  95  PRO A C     1 
ATOM   768  O  O     . PRO A 1 107 ? 185.46700 36.43500 107.08900 1.000 40.59000  ?  95  PRO A O     1 
ATOM   769  C  CB    . PRO A 1 107 ? 184.24400 37.13000 109.93000 1.000 39.35000  ?  95  PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 107 ? 182.97800 37.52300 109.22500 1.000 38.58000  ?  95  PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 107 ? 183.27500 38.78900 108.49200 1.000 39.31000  ?  95  PRO A CD    1 
ATOM   772  N  N     . HIS A 1 108 ? 187.00500 35.94500 108.64600 1.000 43.47000  ?  96  HIS A N     1 
ATOM   773  C  CA    . HIS A 1 108 ? 187.64800 34.93700 107.83800 1.000 43.52000  ?  96  HIS A CA    1 
ATOM   774  C  C     . HIS A 1 108 ? 187.74000 33.57400 108.50700 1.000 43.28000  ?  96  HIS A C     1 
ATOM   775  O  O     . HIS A 1 108 ? 188.26100 33.48100 109.60500 1.000 47.24000  ?  96  HIS A O     1 
ATOM   776  C  CB    . HIS A 1 108 ? 189.04100 35.40100 107.48200 1.000 43.15000  ?  96  HIS A CB    1 
ATOM   777  C  CG    . HIS A 1 108 ? 189.62600 34.62300 106.36100 1.000 45.40000  ?  96  HIS A CG    1 
ATOM   778  N  ND1   . HIS A 1 108 ? 190.05200 33.32300 106.51600 1.000 42.03000  ?  96  HIS A ND1   1 
ATOM   779  C  CD2   . HIS A 1 108 ? 189.78800 34.92900 105.05200 1.000 41.85000  ?  96  HIS A CD2   1 
ATOM   780  C  CE1   . HIS A 1 108 ? 190.48000 32.87100 105.35300 1.000 47.92000  ?  96  HIS A CE1   1 
ATOM   781  N  NE2   . HIS A 1 108 ? 190.33900 33.82800 104.45000 1.000 47.27000  ?  96  HIS A NE2   1 
ATOM   782  N  N     . PRO A 1 109 ? 187.28700 32.50700 107.83100 1.000 41.33000  ?  97  PRO A N     1 
ATOM   783  C  CA    . PRO A 1 109 ? 187.25300 31.18700 108.47700 1.000 41.01000  ?  97  PRO A CA    1 
ATOM   784  C  C     . PRO A 1 109 ? 188.57500 30.82500 109.15900 1.000 44.63000  ?  97  PRO A C     1 
ATOM   785  O  O     . PRO A 1 109 ? 188.55200 30.16100 110.20400 1.000 43.52000  ?  97  PRO A O     1 
ATOM   786  C  CB    . PRO A 1 109 ? 186.94700 30.21800 107.31800 1.000 40.57000  ?  97  PRO A CB    1 
ATOM   787  C  CG    . PRO A 1 109 ? 187.25700 30.95200 106.07200 1.000 41.13000  ?  97  PRO A CG    1 
ATOM   788  C  CD    . PRO A 1 109 ? 187.03900 32.42400 106.38300 1.000 45.46000  ?  97  PRO A CD    1 
ATOM   789  N  N     . ALA A 1 110 ? 189.70200 31.28100 108.60700 1.000 41.03000  ?  98  ALA A N     1 
ATOM   790  C  CA    . ALA A 1 110 ? 191.00800 30.91200 109.16800 1.000 44.84000  ?  98  ALA A CA    1 
ATOM   791  C  C     . ALA A 1 110 ? 191.17000 31.44400 110.59000 1.000 43.44000  ?  98  ALA A C     1 
ATOM   792  O  O     . ALA A 1 110 ? 192.02800 30.99500 111.34200 1.000 42.45000  ?  98  ALA A O     1 
ATOM   793  C  CB    . ALA A 1 110 ? 192.15800 31.42000 108.27100 1.000 43.65000  ?  98  ALA A CB    1 
ATOM   794  N  N     . GLY A 1 111 ? 190.33700 32.41300 110.94900 1.000 41.30000  ?  99  GLY A N     1 
ATOM   795  C  CA    . GLY A 1 111 ? 190.41400 33.02300 112.25800 1.000 38.93000  ?  99  GLY A CA    1 
ATOM   796  C  C     . GLY A 1 111 ? 189.54100 32.32300 113.28100 1.000 42.18000  ?  99  GLY A C     1 
ATOM   797  O  O     . GLY A 1 111 ? 189.62400 32.61600 114.45200 1.000 43.30000  ?  99  GLY A O     1 
ATOM   798  N  N     . LEU A 1 112 ? 188.69900 31.39600 112.84300 1.000 42.01000  ?  100 LEU A N     1 
ATOM   799  C  CA    . LEU A 1 112 ? 187.91300 30.61000 113.77600 1.000 39.86000  ?  100 LEU A CA    1 
ATOM   800  C  C     . LEU A 1 112 ? 188.72800 29.58000 114.57100 1.000 43.48000  ?  100 LEU A C     1 
ATOM   801  O  O     . LEU A 1 112 ? 189.67200 28.95400 114.06000 1.000 43.46000  ?  100 LEU A O     1 
ATOM   802  C  CB    . LEU A 1 112 ? 186.80800 29.88500 113.02900 1.000 38.88000  ?  100 LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 112 ? 185.89400 30.73400 112.17600 1.000 43.50000  ?  100 LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 112 ? 185.11400 29.79800 111.28700 1.000 37.31000  ?  100 LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 112 ? 184.97400 31.59900 113.05900 1.000 41.16000  ?  100 LEU A CD2   1 
ATOM   806  N  N     . LYS A 1 113 ? 188.32600 29.36900 115.81500 1.000 44.82000  ?  101 LYS A N     1 
ATOM   807  C  CA    . LYS A 1 113 ? 188.95400 28.35200 116.64800 1.000 47.54000  ?  101 LYS A CA    1 
ATOM   808  C  C     . LYS A 1 113 ? 188.07400 27.12400 116.63900 1.000 46.43000  ?  101 LYS A C     1 
ATOM   809  O  O     . LYS A 1 113 ? 186.88800 27.23700 116.35800 1.000 51.79000  ?  101 LYS A O     1 
ATOM   810  C  CB    . LYS A 1 113 ? 189.16300 28.87600 118.06000 1.000 41.75000  ?  101 LYS A CB    1 
ATOM   811  C  CG    . LYS A 1 113 ? 189.64600 30.31300 118.07600 1.000 44.54000  ?  101 LYS A CG    1 
ATOM   812  C  CD    . LYS A 1 113 ? 190.09400 30.76100 119.44800 1.000 48.23000  ?  101 LYS A CD    1 
ATOM   813  C  CE    . LYS A 1 113 ? 190.56900 32.19800 119.39600 1.000 46.96000  ?  101 LYS A CE    1 
ATOM   814  N  NZ    . LYS A 1 113 ? 190.97400 32.69200 120.74100 1.000 54.72000  ?  101 LYS A NZ    1 
ATOM   815  N  N     . LYS A 1 114 ? 188.64000 25.95400 116.91900 1.000 47.19000  ?  102 LYS A N     1 
ATOM   816  C  CA    . LYS A 1 114 ? 187.83300 24.73700 116.94200 1.000 48.42000  ?  102 LYS A CA    1 
ATOM   817  C  C     . LYS A 1 114 ? 186.74900 24.84000 118.00100 1.000 49.54000  ?  102 LYS A C     1 
ATOM   818  O  O     . LYS A 1 114 ? 187.03400 25.11600 119.16000 1.000 47.06000  ?  102 LYS A O     1 
ATOM   819  C  CB    . LYS A 1 114 ? 188.68600 23.50100 117.20700 1.000 46.08000  ?  102 LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 114 ? 188.68400 22.51100 116.05800 1.000 59.91000  ?  102 LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 114 ? 190.10300 22.36800 115.46600 1.000 63.55000  ?  102 LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 114 ? 190.15800 21.39900 114.27200 1.000 61.69000  ?  102 LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 114 ? 191.26200 21.71900 113.29000 1.000 66.28000  ?  102 LYS A NZ    1 
ATOM   824  N  N     . LYS A 1 115 ? 185.50100 24.63400 117.59600 1.000 52.50000  ?  103 LYS A N     1 
ATOM   825  C  CA    . LYS A 1 115 ? 184.41000 24.60800 118.55700 1.000 52.96000  ?  103 LYS A CA    1 
ATOM   826  C  C     . LYS A 1 115 ? 183.78900 23.23200 118.56500 1.000 53.05000  ?  103 LYS A C     1 
ATOM   827  O  O     . LYS A 1 115 ? 183.74700 22.56300 117.54400 1.000 54.60000  ?  103 LYS A O     1 
ATOM   828  C  CB    . LYS A 1 115 ? 183.35600 25.66300 118.23600 1.000 46.16000  ?  103 LYS A CB    1 
ATOM   829  C  CG    . LYS A 1 115 ? 183.83600 27.08700 118.43300 1.000 47.86000  ?  103 LYS A CG    1 
ATOM   830  C  CD    . LYS A 1 115 ? 184.37000 27.33200 119.82000 1.000 49.25000  ?  103 LYS A CD    1 
ATOM   831  C  CE    . LYS A 1 115 ? 184.56700 28.81300 120.02900 1.000 49.14000  ?  103 LYS A CE    1 
ATOM   832  N  NZ    . LYS A 1 115 ? 185.44000 29.13700 121.18900 1.000 55.01000  ?  103 LYS A NZ    1 
ATOM   833  N  N     . LYS A 1 116 ? 183.31200 22.81100 119.72500 1.000 52.60000  ?  104 LYS A N     1 
ATOM   834  C  CA    . LYS A 1 116 ? 182.73400 21.48900 119.86100 1.000 52.57000  ?  104 LYS A CA    1 
ATOM   835  C  C     . LYS A 1 116 ? 181.40000 21.42100 119.13900 1.000 47.82000  ?  104 LYS A C     1 
ATOM   836  O  O     . LYS A 1 116 ? 181.08900 20.45200 118.47000 1.000 48.42000  ?  104 LYS A O     1 
ATOM   837  C  CB    . LYS A 1 116 ? 182.56300 21.13200 121.33100 1.000 50.05000  ?  104 LYS A CB    1 
ATOM   838  C  CG    . LYS A 1 116 ? 182.26700 19.68200 121.53300 1.000 55.51000  ?  104 LYS A CG    1 
ATOM   839  C  CD    . LYS A 1 116 ? 182.34300 19.33200 122.99900 1.000 62.07000  ?  104 LYS A CD    1 
ATOM   840  C  CE    . LYS A 1 116 ? 182.11800 17.85300 123.22000 1.000 65.97000  ?  104 LYS A CE    1 
ATOM   841  N  NZ    . LYS A 1 116 ? 182.25700 17.55500 124.66300 1.000 73.47000  ?  104 LYS A NZ    1 
ATOM   842  N  N     . SER A 1 117 ? 180.61100 22.47200 119.27500 1.000 52.19000  ?  105 SER A N     1 
ATOM   843  C  CA    . SER A 1 117 ? 179.32100 22.52500 118.61700 1.000 44.15000  ?  105 SER A CA    1 
ATOM   844  C  C     . SER A 1 117 ? 179.13800 23.83200 117.86200 1.000 47.63000  ?  105 SER A C     1 
ATOM   845  O  O     . SER A 1 117 ? 179.53500 24.91700 118.32500 1.000 48.93000  ?  105 SER A O     1 
ATOM   846  C  CB    . SER A 1 117 ? 178.22900 22.33100 119.63100 1.000 47.69000  ?  105 SER A CB    1 
ATOM   847  O  OG    . SER A 1 117 ? 178.34200 21.05300 120.22200 1.000 53.24000  ?  105 SER A OG    1 
ATOM   848  N  N     . VAL A 1 118 ? 178.54800 23.71500 116.68300 1.000 42.48000  ?  106 VAL A N     1 
ATOM   849  C  CA    . VAL A 1 118 ? 178.42100 24.83500 115.78000 1.000 43.01000  ?  106 VAL A CA    1 
ATOM   850  C  C     . VAL A 1 118 ? 177.02300 24.89800 115.20700 1.000 44.31000  ?  106 VAL A C     1 
ATOM   851  O  O     . VAL A 1 118 ? 176.39800 23.87900 114.93100 1.000 51.10000  ?  106 VAL A O     1 
ATOM   852  C  CB    . VAL A 1 118 ? 179.42600 24.74100 114.61400 1.000 47.01000  ?  106 VAL A CB    1 
ATOM   853  C  CG1   . VAL A 1 118 ? 179.07300 25.73000 113.52500 1.000 42.09000  ?  106 VAL A CG1   1 
ATOM   854  C  CG2   . VAL A 1 118 ? 180.83900 24.96000 115.10900 1.000 46.15000  ?  106 VAL A CG2   1 
ATOM   855  N  N     . THR A 1 119 ? 176.54400 26.11200 115.01000 1.000 44.99000  ?  107 THR A N     1 
ATOM   856  C  CA    . THR A 1 119 ? 175.27000 26.33100 114.37600 1.000 41.26000  ?  107 THR A CA    1 
ATOM   857  C  C     . THR A 1 119 ? 175.37600 27.52800 113.47100 1.000 44.94000  ?  107 THR A C     1 
ATOM   858  O  O     . THR A 1 119 ? 176.14400 28.45100 113.76800 1.000 44.96000  ?  107 THR A O     1 
ATOM   859  C  CB    . THR A 1 119 ? 174.17800 26.57600 115.39000 1.000 40.22000  ?  107 THR A CB    1 
ATOM   860  O  OG1   . THR A 1 119 ? 174.05600 25.42300 116.21400 1.000 41.30000  ?  107 THR A OG1   1 
ATOM   861  C  CG2   . THR A 1 119 ? 172.87400 26.84400 114.68300 1.000 44.01000  ?  107 THR A CG2   1 
ATOM   862  N  N     . VAL A 1 120 ? 174.61700 27.51000 112.37000 1.000 42.03000  ?  108 VAL A N     1 
ATOM   863  C  CA    . VAL A 1 120 ? 174.49000 28.68200 111.52800 1.000 36.82000  ?  108 VAL A CA    1 
ATOM   864  C  C     . VAL A 1 120 ? 173.01900 29.02000 111.31700 1.000 46.63000  ?  108 VAL A C     1 
ATOM   865  O  O     . VAL A 1 120 ? 172.20800 28.17400 110.93500 1.000 47.81000  ?  108 VAL A O     1 
ATOM   866  C  CB    . VAL A 1 120 ? 175.15500 28.49500 110.19600 1.000 39.30000  ?  108 VAL A CB    1 
ATOM   867  C  CG1   . VAL A 1 120 ? 174.80200 29.63900 109.32100 1.000 42.99000  ?  108 VAL A CG1   1 
ATOM   868  C  CG2   . VAL A 1 120 ? 176.66400 28.38700 110.35600 1.000 34.54000  ?  108 VAL A CG2   1 
ATOM   869  N  N     . LEU A 1 121 ? 172.68700 30.27200 111.59000 1.000 46.73000  ?  109 LEU A N     1 
ATOM   870  C  CA    . LEU A 1 121 ? 171.33400 30.77300 111.47400 1.000 45.05000  ?  109 LEU A CA    1 
ATOM   871  C  C     . LEU A 1 121 ? 171.29500 32.01100 110.58100 1.000 47.94000  ?  109 LEU A C     1 
ATOM   872  O  O     . LEU A 1 121 ? 172.19700 32.85300 110.63400 1.000 43.03000  ?  109 LEU A O     1 
ATOM   873  C  CB    . LEU A 1 121 ? 170.78200 31.14800 112.84500 1.000 42.27000  ?  109 LEU A CB    1 
ATOM   874  C  CG    . LEU A 1 121 ? 170.92800 30.14200 113.95400 1.000 45.76000  ?  109 LEU A CG    1 
ATOM   875  C  CD1   . LEU A 1 121 ? 170.86400 30.89400 115.24500 1.000 46.44000  ?  109 LEU A CD1   1 
ATOM   876  C  CD2   . LEU A 1 121 ? 169.79200 29.15000 113.85800 1.000 52.15000  ?  109 LEU A CD2   1 
ATOM   877  N  N     . ASP A 1 122 ? 170.23400 32.13300 109.79000 1.000 44.79000  ?  110 ASP A N     1 
ATOM   878  C  CA    . ASP A 1 122 ? 170.00200 33.33600 109.01600 1.000 49.50000  ?  110 ASP A CA    1 
ATOM   879  C  C     . ASP A 1 122 ? 168.69800 33.93300 109.47700 1.000 48.05000  ?  110 ASP A C     1 
ATOM   880  O  O     . ASP A 1 122 ? 167.71400 33.21900 109.55400 1.000 50.36000  ?  110 ASP A O     1 
ATOM   881  C  CB    . ASP A 1 122 ? 169.94400 33.04400 107.51300 1.000 44.82000  ?  110 ASP A CB    1 
ATOM   882  C  CG    . ASP A 1 122 ? 169.85900 34.31700 106.67700 1.000 53.62000  ?  110 ASP A CG    1 
ATOM   883  O  OD1   . ASP A 1 122 ? 170.91300 34.91300 106.32400 1.000 63.71000  ?  110 ASP A OD1   1 
ATOM   884  O  OD2   . ASP A 1 122 ? 168.73400 34.74900 106.37400 1.000 53.38000  ?  110 ASP A OD2   1 
ATOM   885  N  N     . VAL A 1 123 ? 168.68400 35.22800 109.78200 1.000 44.74000  ?  111 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 123 ? 167.44000 35.90800 110.12200 1.000 47.59000  ?  111 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 123 ? 166.54000 36.03600 108.88900 1.000 50.22000  ?  111 VAL A C     1 
ATOM   888  O  O     . VAL A 1 123 ? 167.02800 36.32500 107.79400 1.000 48.78000  ?  111 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 123 ? 167.70300 37.30200 110.70100 1.000 44.96000  ?  111 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 123 ? 166.45000 38.14200 110.64900 1.000 47.97000  ?  111 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 123 ? 168.18300 37.20500 112.11800 1.000 47.62000  ?  111 VAL A CG2   1 
ATOM   892  N  N     . GLY A 1 124 ? 165.23500 35.81400 109.06400 1.000 51.08000  ?  112 GLY A N     1 
ATOM   893  C  CA    . GLY A 1 124 ? 164.29100 35.87000 107.95700 1.000 47.35000  ?  112 GLY A CA    1 
ATOM   894  C  C     . GLY A 1 124 ? 163.81100 37.28600 107.73300 1.000 50.77000  ?  112 GLY A C     1 
ATOM   895  O  O     . GLY A 1 124 ? 163.44800 37.97500 108.69000 1.000 50.24000  ?  112 GLY A O     1 
ATOM   896  N  N     . ASP A 1 125 ? 163.82900 37.71700 106.47400 1.000 53.54000  ?  113 ASP A N     1 
ATOM   897  C  CA    . ASP A 1 125 ? 163.46700 39.08300 106.07500 1.000 52.71000  ?  113 ASP A CA    1 
ATOM   898  C  C     . ASP A 1 125 ? 164.05100 40.15600 106.98900 1.000 51.63000  ?  113 ASP A C     1 
ATOM   899  O  O     . ASP A 1 125 ? 163.34900 41.06000 107.44100 1.000 51.24000  ?  113 ASP A O     1 
ATOM   900  C  CB    . ASP A 1 125 ? 161.94900 39.21500 105.99600 1.000 56.37000  ?  113 ASP A CB    1 
ATOM   901  C  CG    . ASP A 1 125 ? 161.38700 38.60000 104.71900 1.000 74.50000  ?  113 ASP A CG    1 
ATOM   902  O  OD1   . ASP A 1 125 ? 161.94600 38.90900 103.62900 1.000 70.97000  ?  113 ASP A OD1   1 
ATOM   903  O  OD2   . ASP A 1 125 ? 160.42000 37.79400 104.80300 1.000 75.68000  ?  113 ASP A OD2   1 
ATOM   904  N  N     . ALA A 1 126 ? 165.35700 40.04700 107.21300 1.000 51.26000  ?  114 ALA A N     1 
ATOM   905  C  CA    . ALA A 1 126 ? 166.11500 40.89000 108.13400 1.000 50.30000  ?  114 ALA A CA    1 
ATOM   906  C  C     . ALA A 1 126 ? 165.76500 42.38900 108.13600 1.000 49.96000  ?  114 ALA A C     1 
ATOM   907  O  O     . ALA A 1 126 ? 165.27500 42.90100 109.14600 1.000 50.23000  ?  114 ALA A O     1 
ATOM   908  C  CB    . ALA A 1 126 ? 167.58500 40.72200 107.84900 1.000 51.30000  ?  114 ALA A CB    1 
ATOM   909  N  N     . TYR A 1 127 ? 166.05700 43.09500 107.04300 1.000 43.35000  ?  115 TYR A N     1 
ATOM   910  C  CA    . TYR A 1 127 ? 165.79700 44.52500 106.97500 1.000 42.14000  ?  115 TYR A CA    1 
ATOM   911  C  C     . TYR A 1 127 ? 164.34200 44.86300 107.33300 1.000 51.65000  ?  115 TYR A C     1 
ATOM   912  O  O     . TYR A 1 127 ? 164.07800 45.80100 108.08200 1.000 46.09000  ?  115 TYR A O     1 
ATOM   913  C  CB    . TYR A 1 127 ? 166.10500 45.06000 105.59000 1.000 43.01000  ?  115 TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 127 ? 167.56500 45.33200 105.33400 1.000 49.86000  ?  115 TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 127 ? 168.54800 44.58200 105.95000 1.000 49.16000  ?  115 TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 127 ? 167.96400 46.36700 104.49100 1.000 48.18000  ?  115 TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 127 ? 169.89100 44.83100 105.72300 1.000 40.13000  ?  115 TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 127 ? 169.29800 46.61800 104.26300 1.000 49.99000  ?  115 TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 127 ? 170.26000 45.84200 104.88400 1.000 48.05000  ?  115 TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 127 ? 171.59700 46.09100 104.67300 1.000 49.26000  ?  115 TYR A OH    1 
ATOM   921  N  N     . PHE A 1 128 ? 163.39900 44.08300 106.81000 1.000 51.39000  ?  116 PHE A N     1 
ATOM   922  C  CA    . PHE A 1 128 ? 161.99300 44.41200 106.98200 1.000 49.79000  ?  116 PHE A CA    1 
ATOM   923  C  C     . PHE A 1 128 ? 161.55200 44.15100 108.40100 1.000 52.29000  ?  116 PHE A C     1 
ATOM   924  O  O     . PHE A 1 128 ? 160.37200 44.25600 108.72200 1.000 53.74000  ?  116 PHE A O     1 
ATOM   925  C  CB    . PHE A 1 128 ? 161.12300 43.61600 106.01700 1.000 53.01000  ?  116 PHE A CB    1 
ATOM   926  C  CG    . PHE A 1 128 ? 161.42500 43.88000 104.57900 1.000 55.56000  ?  116 PHE A CG    1 
ATOM   927  C  CD1   . PHE A 1 128 ? 162.13400 45.01000 104.20000 1.000 54.04000  ?  116 PHE A CD1   1 
ATOM   928  C  CD2   . PHE A 1 128 ? 161.01300 42.99400 103.59800 1.000 54.19000  ?  116 PHE A CD2   1 
ATOM   929  C  CE1   . PHE A 1 128 ? 162.41600 45.24400 102.85800 1.000 51.43000  ?  116 PHE A CE1   1 
ATOM   930  C  CE2   . PHE A 1 128 ? 161.29600 43.22900 102.26200 1.000 49.69000  ?  116 PHE A CE2   1 
ATOM   931  C  CZ    . PHE A 1 128 ? 161.98700 44.34900 101.89500 1.000 49.21000  ?  116 PHE A CZ    1 
ATOM   932  N  N     . SER A 1 129 ? 162.50000 43.79600 109.25400 1.000 50.07000  ?  117 SER A N     1 
ATOM   933  C  CA    . SER A 1 129 ? 162.17300 43.52200 110.64500 1.000 50.85000  ?  117 SER A CA    1 
ATOM   934  C  C     . SER A 1 129 ? 162.65100 44.66200 111.52700 1.000 50.48000  ?  117 SER A C     1 
ATOM   935  O  O     . SER A 1 129 ? 162.50700 44.60500 112.74200 1.000 54.62000  ?  117 SER A O     1 
ATOM   936  C  CB    . SER A 1 129 ? 162.79200 42.19100 111.11400 1.000 54.26000  ?  117 SER A CB    1 
ATOM   937  O  OG    . SER A 1 129 ? 161.97300 41.06300 110.81300 1.000 54.99000  ?  117 SER A OG    1 
ATOM   938  N  N     . VAL A 1 130 ? 163.21800 45.69700 110.91300 1.000 47.27000  ?  118 VAL A N     1 
ATOM   939  C  CA    . VAL A 1 130 ? 163.79800 46.79500 111.67100 1.000 45.37000  ?  118 VAL A CA    1 
ATOM   940  C  C     . VAL A 1 130 ? 163.12900 48.10700 111.30200 1.000 50.65000  ?  118 VAL A C     1 
ATOM   941  O  O     . VAL A 1 130 ? 163.12600 48.51400 110.14600 1.000 52.74000  ?  118 VAL A O     1 
ATOM   942  C  CB    . VAL A 1 130 ? 165.32100 46.89000 111.43600 1.000 48.60000  ?  118 VAL A CB    1 
ATOM   943  C  CG1   . VAL A 1 130 ? 165.93800 48.00100 112.27200 1.000 42.66000  ?  118 VAL A CG1   1 
ATOM   944  C  CG2   . VAL A 1 130 ? 165.97800 45.57000 111.76700 1.000 42.86000  ?  118 VAL A CG2   1 
ATOM   945  N  N     . PRO A 1 131 ? 162.53500 48.77300 112.28900 1.000 50.66000  ?  119 PRO A N     1 
ATOM   946  C  CA    . PRO A 1 131 ? 161.77600 49.99700 112.00600 1.000 49.68000  ?  119 PRO A CA    1 
ATOM   947  C  C     . PRO A 1 131 ? 162.63800 51.11300 111.44200 1.000 47.98000  ?  119 PRO A C     1 
ATOM   948  O  O     . PRO A 1 131 ? 163.77000 51.27800 111.88100 1.000 49.07000  ?  119 PRO A O     1 
ATOM   949  C  CB    . PRO A 1 131 ? 161.22600 50.39400 113.37300 1.000 48.70000  ?  119 PRO A CB    1 
ATOM   950  C  CG    . PRO A 1 131 ? 162.13900 49.71500 114.37100 1.000 54.48000  ?  119 PRO A CG    1 
ATOM   951  C  CD    . PRO A 1 131 ? 162.55400 48.42800 113.71900 1.000 49.33000  ?  119 PRO A CD    1 
ATOM   952  N  N     . LEU A 1 132 ? 162.08900 51.86300 110.48900 1.000 50.55000  ?  120 LEU A N     1 
ATOM   953  C  CA    . LEU A 1 132 ? 162.68800 53.09000 109.96600 1.000 46.19000  ?  120 LEU A CA    1 
ATOM   954  C  C     . LEU A 1 132 ? 162.14100 54.32000 110.68900 1.000 50.67000  ?  120 LEU A C     1 
ATOM   955  O  O     . LEU A 1 132 ? 160.99000 54.32100 111.09500 1.000 53.97000  ?  120 LEU A O     1 
ATOM   956  C  CB    . LEU A 1 132 ? 162.41300 53.21600 108.47200 1.000 50.56000  ?  120 LEU A CB    1 
ATOM   957  C  CG    . LEU A 1 132 ? 162.94300 54.51300 107.85800 1.000 50.77000  ?  120 LEU A CG    1 
ATOM   958  C  CD1   . LEU A 1 132 ? 164.46100 54.53200 107.87800 1.000 50.30000  ?  120 LEU A CD1   1 
ATOM   959  C  CD2   . LEU A 1 132 ? 162.44500 54.67000 106.44900 1.000 52.23000  ?  120 LEU A CD2   1 
ATOM   960  N  N     . ASP A 1 133 ? 162.95500 55.36300 110.84200 1.000 53.77000  ?  121 ASP A N     1 
ATOM   961  C  CA    . ASP A 1 133 ? 162.55800 56.57300 111.57300 1.000 59.01000  ?  121 ASP A CA    1 
ATOM   962  C  C     . ASP A 1 133 ? 161.28500 57.18300 110.97900 1.000 57.62000  ?  121 ASP A C     1 
ATOM   963  O  O     . ASP A 1 133 ? 161.18600 57.32900 109.76800 1.000 62.26000  ?  121 ASP A O     1 
ATOM   964  C  CB    . ASP A 1 133 ? 163.70300 57.60500 111.56000 1.000 58.49000  ?  121 ASP A CB    1 
ATOM   965  C  CG    . ASP A 1 133 ? 163.31800 58.94100 112.21000 1.000 62.65000  ?  121 ASP A CG    1 
ATOM   966  O  OD1   . ASP A 1 133 ? 162.22500 59.04300 112.81600 1.000 68.12000  ?  121 ASP A OD1   1 
ATOM   967  O  OD2   . ASP A 1 133 ? 164.12400 59.89700 112.12600 1.000 59.81000  ?  121 ASP A OD2   1 
ATOM   968  N  N     . GLU A 1 134 ? 160.32900 57.55200 111.83000 1.000 55.59000  ?  122 GLU A N     1 
ATOM   969  C  CA    . GLU A 1 134 ? 159.02600 58.02600 111.35700 1.000 61.49000  ?  122 GLU A CA    1 
ATOM   970  C  C     . GLU A 1 134 ? 159.17600 59.29100 110.55300 1.000 62.56000  ?  122 GLU A C     1 
ATOM   971  O  O     . GLU A 1 134 ? 158.63500 59.40000 109.45500 1.000 63.94000  ?  122 GLU A O     1 
ATOM   972  C  CB    . GLU A 1 134 ? 158.07100 58.28500 112.51200 1.000 61.38000  ?  122 GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 134 ? 158.34900 57.43300 113.71400 1.000 72.35000  ?  122 GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 134 ? 157.08100 56.87800 114.32600 1.000 85.14000  ?  122 GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 134 ? 156.06100 56.82600 113.60100 1.000 91.49000  ?  122 GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 134 ? 157.10300 56.50000 115.52300 1.000 89.29000  ?  122 GLU A OE2   1 
ATOM   977  N  N     . ASP A 1 135 ? 159.92400 60.24000 111.10500 1.000 63.45000  ?  123 ASP A N     1 
ATOM   978  C  CA    . ASP A 1 135 ? 160.19200 61.50700 110.44000 1.000 61.24000  ?  123 ASP A CA    1 
ATOM   979  C  C     . ASP A 1 135 ? 160.75000 61.35200 109.04200 1.000 63.55000  ?  123 ASP A C     1 
ATOM   980  O  O     . ASP A 1 135 ? 160.63700 62.26200 108.22300 1.000 64.95000  ?  123 ASP A O     1 
ATOM   981  C  CB    . ASP A 1 135 ? 161.17200 62.33300 111.25700 1.000 64.20000  ?  123 ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 135 ? 160.50800 63.04000 112.40500 1.000 77.87000  ?  123 ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 135 ? 159.25400 63.07600 112.43300 1.000 78.26000  ?  123 ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 135 ? 161.24000 63.56700 113.27300 1.000 84.65000  ?  123 ASP A OD2   1 
ATOM   985  N  N     . PHE A 1 136 ? 161.36600 60.21000 108.76600 1.000 62.73000  ?  124 PHE A N     1 
ATOM   986  C  CA    . PHE A 1 136 ? 162.07800 60.04100 107.51000 1.000 61.54000  ?  124 PHE A CA    1 
ATOM   987  C  C     . PHE A 1 136 ? 161.26100 59.22800 106.52600 1.000 54.86000  ?  124 PHE A C     1 
ATOM   988  O  O     . PHE A 1 136 ? 161.56400 59.22000 105.35200 1.000 57.15000  ?  124 PHE A O     1 
ATOM   989  C  CB    . PHE A 1 136 ? 163.44100 59.37500 107.76400 1.000 56.83000  ?  124 PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 136 ? 164.41600 59.47300 106.61700 1.000 49.10000  ?  124 PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 136 ? 165.27100 60.55900 106.50600 1.000 56.95000  ?  124 PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 136 ? 164.51500 58.46000 105.68300 1.000 52.06000  ?  124 PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 136 ? 166.18600 60.65100 105.46200 1.000 54.52000  ?  124 PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 136 ? 165.43500 58.53600 104.63400 1.000 53.12000  ?  124 PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 136 ? 166.27100 59.63500 104.52900 1.000 52.69000  ?  124 PHE A CZ    1 
ATOM   996  N  N     . ARG A 1 137 ? 160.22100 58.55900 106.99900 1.000 51.38000  ?  125 ARG A N     1 
ATOM   997  C  CA    . ARG A 1 137 ? 159.51900 57.57400 106.17000 1.000 56.11000  ?  125 ARG A CA    1 
ATOM   998  C  C     . ARG A 1 137 ? 159.01100 58.10300 104.84300 1.000 55.76000  ?  125 ARG A C     1 
ATOM   999  O  O     . ARG A 1 137 ? 158.95500 57.36600 103.85300 1.000 56.96000  ?  125 ARG A O     1 
ATOM   1000 C  CB    . ARG A 1 137 ? 158.35500 56.96000 106.96100 1.000 59.01000  ?  125 ARG A CB    1 
ATOM   1001 C  CG    . ARG A 1 137 ? 158.85900 56.12100 108.13300 1.000 56.82000  ?  125 ARG A CG    1 
ATOM   1002 C  CD    . ARG A 1 137 ? 157.76500 55.49800 108.95000 1.000 58.14000  ?  125 ARG A CD    1 
ATOM   1003 N  NE    . ARG A 1 137 ? 158.34600 54.80400 110.09300 1.000 57.62000  ?  125 ARG A NE    1 
ATOM   1004 C  CZ    . ARG A 1 137 ? 157.64700 54.15100 111.01100 1.000 55.32000  ?  125 ARG A CZ    1 
ATOM   1005 N  NH1   . ARG A 1 137 ? 156.33500 54.10400 110.91400 1.000 59.42000  ?  125 ARG A NH1   1 
ATOM   1006 N  NH2   . ARG A 1 137 ? 158.26000 53.54300 112.02000 1.000 50.43000  ?  125 ARG A NH2   1 
ATOM   1007 N  N     . LYS A 1 138 ? 158.66500 59.38200 104.80300 1.000 59.76000  ?  126 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 138 ? 158.01800 59.92500 103.61200 1.000 57.31000  ?  126 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 138 ? 158.91900 59.95900 102.39000 1.000 59.74000  ?  126 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 138 ? 158.43900 59.80200 101.26100 1.000 64.18000  ?  126 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 138 ? 157.48000 61.32500 103.88000 1.000 57.66000  ?  126 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 138 ? 158.44200 62.30700 104.51100 1.000 62.03000  ?  126 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 138 ? 157.77100 63.67600 104.54200 1.000 61.70000  ?  126 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 138 ? 158.58100 64.70300 105.28200 1.000 62.08000  ?  126 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 138 ? 158.57600 64.40000 106.73400 1.000 71.57000  ?  126 LYS A NZ    1 
ATOM   1016 N  N     . TYR A 1 139 ? 160.21700 60.15100 102.59300 1.000 56.89000  ?  127 TYR A N     1 
ATOM   1017 C  CA    . TYR A 1 139 ? 161.14200 60.15600 101.45900 1.000 56.38000  ?  127 TYR A CA    1 
ATOM   1018 C  C     . TYR A 1 139 ? 161.28700 58.80700 100.79900 1.000 52.17000  ?  127 TYR A C     1 
ATOM   1019 O  O     . TYR A 1 139 ? 161.93200 58.71400 99.77200  1.000 59.06000  ?  127 TYR A O     1 
ATOM   1020 C  CB    . TYR A 1 139 ? 162.51600 60.63200 101.88000 1.000 57.10000  ?  127 TYR A CB    1 
ATOM   1021 C  CG    . TYR A 1 139 ? 162.46300 61.91800 102.63400 1.000 57.99000  ?  127 TYR A CG    1 
ATOM   1022 C  CD1   . TYR A 1 139 ? 161.95800 63.06100 102.04600 1.000 58.32000  ?  127 TYR A CD1   1 
ATOM   1023 C  CD2   . TYR A 1 139 ? 162.91300 61.98800 103.93900 1.000 59.00000  ?  127 TYR A CD2   1 
ATOM   1024 C  CE1   . TYR A 1 139 ? 161.90200 64.23200 102.73400 1.000 63.03000  ?  127 TYR A CE1   1 
ATOM   1025 C  CE2   . TYR A 1 139 ? 162.86500 63.15900 104.64200 1.000 61.83000  ?  127 TYR A CE2   1 
ATOM   1026 C  CZ    . TYR A 1 139 ? 162.35600 64.28100 104.03600 1.000 63.85000  ?  127 TYR A CZ    1 
ATOM   1027 O  OH    . TYR A 1 139 ? 162.30600 65.45600 104.74500 1.000 65.72000  ?  127 TYR A OH    1 
ATOM   1028 N  N     . THR A 1 140 ? 160.69200 57.76700 101.37900 1.000 52.62000  ?  128 THR A N     1 
ATOM   1029 C  CA    . THR A 1 140 ? 160.79600 56.42500 100.81300 1.000 53.91000  ?  128 THR A CA    1 
ATOM   1030 C  C     . THR A 1 140 ? 159.59600 56.05900 99.94900  1.000 55.36000  ?  128 THR A C     1 
ATOM   1031 O  O     . THR A 1 140 ? 159.40300 54.88500 99.60900  1.000 52.63000  ?  128 THR A O     1 
ATOM   1032 C  CB    . THR A 1 140 ? 160.93700 55.35500 101.90400 1.000 53.08000  ?  128 THR A CB    1 
ATOM   1033 O  OG1   . THR A 1 140 ? 159.72300 55.29900 102.67800 1.000 56.58000  ?  128 THR A OG1   1 
ATOM   1034 C  CG2   . THR A 1 140 ? 162.11100 55.68200 102.80200 1.000 48.14000  ?  128 THR A CG2   1 
ATOM   1035 N  N     . ALA A 1 141 ? 158.78200 57.05200 99.60500  1.000 58.17000  ?  129 ALA A N     1 
ATOM   1036 C  CA    . ALA A 1 141 ? 157.60200 56.78400 98.78700  1.000 60.40000  ?  129 ALA A CA    1 
ATOM   1037 C  C     . ALA A 1 141 ? 158.01800 56.09200 97.49700  1.000 57.55000  ?  129 ALA A C     1 
ATOM   1038 O  O     . ALA A 1 141 ? 159.01300 56.47600 96.87400  1.000 55.61000  ?  129 ALA A O     1 
ATOM   1039 C  CB    . ALA A 1 141 ? 156.84400 58.06800 98.48600  1.000 62.85000  ?  129 ALA A CB    1 
ATOM   1040 N  N     . PHE A 1 142 ? 157.28100 55.04500 97.14500  1.000 51.99000  ?  130 PHE A N     1 
ATOM   1041 C  CA    . PHE A 1 142 ? 157.40900 54.40400 95.85100  1.000 54.24000  ?  130 PHE A CA    1 
ATOM   1042 C  C     . PHE A 1 142 ? 156.00700 54.09100 95.34800  1.000 62.57000  ?  130 PHE A C     1 
ATOM   1043 O  O     . PHE A 1 142 ? 155.01300 54.36400 96.03400  1.000 64.92000  ?  130 PHE A O     1 
ATOM   1044 C  CB    . PHE A 1 142 ? 158.26200 53.13600 95.91900  1.000 52.47000  ?  130 PHE A CB    1 
ATOM   1045 C  CG    . PHE A 1 142 ? 157.66500 52.04200 96.75400  1.000 53.54000  ?  130 PHE A CG    1 
ATOM   1046 C  CD1   . PHE A 1 142 ? 157.76600 52.07200 98.13800  1.000 51.42000  ?  130 PHE A CD1   1 
ATOM   1047 C  CD2   . PHE A 1 142 ? 157.01100 50.97200 96.15400  1.000 56.68000  ?  130 PHE A CD2   1 
ATOM   1048 C  CE1   . PHE A 1 142 ? 157.21100 51.06200 98.91800  1.000 54.00000  ?  130 PHE A CE1   1 
ATOM   1049 C  CE2   . PHE A 1 142 ? 156.44600 49.94900 96.92600  1.000 58.13000  ?  130 PHE A CE2   1 
ATOM   1050 C  CZ    . PHE A 1 142 ? 156.54900 49.99800 98.31500  1.000 55.15000  ?  130 PHE A CZ    1 
ATOM   1051 N  N     . THR A 1 143 ? 155.93500 53.52100 94.14900  1.000 63.11000  ?  131 THR A N     1 
ATOM   1052 C  CA    . THR A 1 143 ? 154.66400 53.21700 93.49600  1.000 67.98000  ?  131 THR A CA    1 
ATOM   1053 C  C     . THR A 1 143 ? 154.73500 51.87900 92.81100  1.000 66.05000  ?  131 THR A C     1 
ATOM   1054 O  O     . THR A 1 143 ? 155.62700 51.66800 91.98200  1.000 66.50000  ?  131 THR A O     1 
ATOM   1055 C  CB    . THR A 1 143 ? 154.29600 54.28800 92.43600  1.000 64.40000  ?  131 THR A CB    1 
ATOM   1056 O  OG1   . THR A 1 143 ? 155.44500 54.56500 91.64000  1.000 77.42000  ?  131 THR A OG1   1 
ATOM   1057 C  CG2   . THR A 1 143 ? 153.93100 55.55800 93.07200  1.000 60.83000  ?  131 THR A CG2   1 
ATOM   1058 N  N     . ILE A 1 144 ? 153.82000 50.97800 93.17100  1.000 70.65000  ?  132 ILE A N     1 
ATOM   1059 C  CA    . ILE A 1 144 ? 153.62400 49.77900 92.36700  1.000 76.78000  ?  132 ILE A CA    1 
ATOM   1060 C  C     . ILE A 1 144 ? 152.56700 50.07300 91.30300  1.000 80.09000  ?  132 ILE A C     1 
ATOM   1061 O  O     . ILE A 1 144 ? 151.33300 50.29700 91.61400  1.000 85.58000  ?  132 ILE A O     1 
ATOM   1062 C  CB    . ILE A 1 144 ? 153.15900 48.51800 93.13000  1.000 75.70000  ?  132 ILE A CB    1 
ATOM   1063 C  CG1   . ILE A 1 144 ? 154.19800 48.10000 94.13800  1.000 75.56000  ?  132 ILE A CG1   1 
ATOM   1064 C  CG2   . ILE A 1 144 ? 152.98700 47.31400 92.17600  1.000 73.73000  ?  132 ILE A CG2   1 
ATOM   1065 C  CD1   . ILE A 1 144 ? 154.15900 46.57700 94.36900  1.000 72.40000  ?  132 ILE A CD1   1 
ATOM   1066 N  N     . PRO A 1 145 ? 153.07700 50.06800 90.04500  1.000 82.56000  ?  133 PRO A N     1 
ATOM   1067 C  CA    . PRO A 1 145 ? 152.44500 49.95000 88.74200  1.000 83.90000  ?  133 PRO A CA    1 
ATOM   1068 C  C     . PRO A 1 145 ? 151.74400 48.61900 88.62100  1.000 85.70000  ?  133 PRO A C     1 
ATOM   1069 O  O     . PRO A 1 145 ? 152.25200 47.69400 89.19400  1.000 87.17000  ?  133 PRO A O     1 
ATOM   1070 C  CB    . PRO A 1 145 ? 153.64200 50.07600 87.77500  1.000 78.31000  ?  133 PRO A CB    1 
ATOM   1071 C  CG    . PRO A 1 145 ? 154.77200 49.49300 88.53800  1.000 79.27000  ?  133 PRO A CG    1 
ATOM   1072 C  CD    . PRO A 1 145 ? 154.54000 50.18500 89.85800  1.000 78.31000  ?  133 PRO A CD    1 
ATOM   1073 N  N     . SER A 1 146 ? 150.61600 48.51500 87.91700  1.000 102.88000 ?  134 SER A N     1 
ATOM   1074 C  CA    . SER A 1 146 ? 149.83200 47.23000 87.91500  1.000 110.42000 ?  134 SER A CA    1 
ATOM   1075 C  C     . SER A 1 146 ? 149.32500 47.01800 86.56600  1.000 97.61000  ?  134 SER A C     1 
ATOM   1076 O  O     . SER A 1 146 ? 149.32000 48.05600 85.88500  1.000 102.52000 ?  134 SER A O     1 
ATOM   1077 C  CB    . SER A 1 146 ? 148.58900 47.24400 88.82100  1.000 111.68000 ?  134 SER A CB    1 
ATOM   1078 O  OG    . SER A 1 146 ? 148.17100 45.80900 88.96200  1.000 94.98000  ?  134 SER A OG    1 
ATOM   1079 N  N     . THR A 1 151 ? 142.50300 47.73600 86.96100  1.000 98.14000  ?  139 THR A N     1 
ATOM   1080 C  CA    . THR A 1 151 ? 143.12000 48.08000 88.24300  1.000 100.50000 ?  139 THR A CA    1 
ATOM   1081 C  C     . THR A 1 151 ? 144.20900 49.13700 88.04700  1.000 99.29000  ?  139 THR A C     1 
ATOM   1082 O  O     . THR A 1 151 ? 144.91700 49.11100 87.03800  1.000 98.37000  ?  139 THR A O     1 
ATOM   1083 C  CB    . THR A 1 151 ? 143.72200 46.82800 88.93800  1.000 101.67000 ?  139 THR A CB    1 
ATOM   1084 O  OG1   . THR A 1 151 ? 145.03100 46.54800 88.41700  1.000 102.80000 ?  139 THR A OG1   1 
ATOM   1085 C  CG2   . THR A 1 151 ? 142.82500 45.61500 88.73600  1.000 102.71000 ?  139 THR A CG2   1 
ATOM   1086 N  N     . PRO A 1 152 ? 144.34100 50.08500 89.00100  1.000 98.31000  ?  140 PRO A N     1 
ATOM   1087 C  CA    . PRO A 1 152 ? 145.40100 51.08700 88.85700  1.000 96.71000  ?  140 PRO A CA    1 
ATOM   1088 C  C     . PRO A 1 152 ? 146.63900 50.80700 89.72200  1.000 96.80000  ?  140 PRO A C     1 
ATOM   1089 O  O     . PRO A 1 152 ? 146.78900 49.73100 90.31000  1.000 92.78000  ?  140 PRO A O     1 
ATOM   1090 C  CB    . PRO A 1 152 ? 144.71700 52.37000 89.32800  1.000 92.36000  ?  140 PRO A CB    1 
ATOM   1091 C  CG    . PRO A 1 152 ? 143.88000 51.89700 90.46500  1.000 96.24000  ?  140 PRO A CG    1 
ATOM   1092 C  CD    . PRO A 1 152 ? 143.43500 50.45100 90.10500  1.000 97.77000  ?  140 PRO A CD    1 
ATOM   1093 N  N     . GLY A 1 153 ? 147.52300 51.79700 89.80100  1.000 96.13000  ?  141 GLY A N     1 
ATOM   1094 C  CA    . GLY A 1 153 ? 148.76200 51.66600 90.55100  1.000 91.63000  ?  141 GLY A CA    1 
ATOM   1095 C  C     . GLY A 1 153 ? 148.68300 52.15800 91.98700  1.000 85.75000  ?  141 GLY A C     1 
ATOM   1096 O  O     . GLY A 1 153 ? 147.99900 53.13500 92.28200  1.000 91.95000  ?  141 GLY A O     1 
ATOM   1097 N  N     . ILE A 1 154 ? 149.39400 51.47700 92.88200  1.000 80.25000  ?  142 ILE A N     1 
ATOM   1098 C  CA    . ILE A 1 154 ? 149.35700 51.80100 94.30800  1.000 78.83000  ?  142 ILE A CA    1 
ATOM   1099 C  C     . ILE A 1 154 ? 150.62600 52.48500 94.81400  1.000 72.26000  ?  142 ILE A C     1 
ATOM   1100 O  O     . ILE A 1 154 ? 151.73800 52.14300 94.40900  1.000 73.75000  ?  142 ILE A O     1 
ATOM   1101 C  CB    . ILE A 1 154 ? 149.12300 50.55100 95.15600  1.000 75.97000  ?  142 ILE A CB    1 
ATOM   1102 C  CG1   . ILE A 1 154 ? 148.02200 49.70000 94.52600  1.000 74.85000  ?  142 ILE A CG1   1 
ATOM   1103 C  CG2   . ILE A 1 154 ? 148.77700 50.95600 96.59600  1.000 70.75000  ?  142 ILE A CG2   1 
ATOM   1104 C  CD1   . ILE A 1 154 ? 147.53000 48.61300 95.43200  1.000 76.36000  ?  142 ILE A CD1   1 
ATOM   1105 N  N     . ARG A 1 155 ? 150.44300 53.45700 95.70100  1.000 70.35000  ?  143 ARG A N     1 
ATOM   1106 C  CA    . ARG A 1 155 ? 151.55000 54.22900 96.27000  1.000 66.91000  ?  143 ARG A CA    1 
ATOM   1107 C  C     . ARG A 1 155 ? 151.82700 53.92000 97.74200  1.000 65.06000  ?  143 ARG A C     1 
ATOM   1108 O  O     . ARG A 1 155 ? 150.96100 54.10400 98.59200  1.000 66.42000  ?  143 ARG A O     1 
ATOM   1109 C  CB    . ARG A 1 155 ? 151.27600 55.72200 96.13100  1.000 63.18000  ?  143 ARG A CB    1 
ATOM   1110 C  CG    . ARG A 1 155 ? 151.36400 56.21300 94.71400  1.000 64.18000  ?  143 ARG A CG    1 
ATOM   1111 C  CD    . ARG A 1 155 ? 152.29900 57.39600 94.59700  1.000 61.66000  ?  143 ARG A CD    1 
ATOM   1112 N  NE    . ARG A 1 155 ? 151.90000 58.51400 95.43300  1.000 66.13000  ?  143 ARG A NE    1 
ATOM   1113 C  CZ    . ARG A 1 155 ? 152.76200 59.31300 96.05200  1.000 75.55000  ?  143 ARG A CZ    1 
ATOM   1114 N  NH1   . ARG A 1 155 ? 154.07500 59.09800 95.93700  1.000 76.35000  ?  143 ARG A NH1   1 
ATOM   1115 N  NH2   . ARG A 1 155 ? 152.31300 60.31800 96.79400  1.000 74.49000  ?  143 ARG A NH2   1 
ATOM   1116 N  N     . TYR A 1 156 ? 153.04600 53.48200 98.04500  1.000 65.69000  ?  144 TYR A N     1 
ATOM   1117 C  CA    . TYR A 1 156 ? 153.40700 53.16300 99.42400  1.000 61.21000  ?  144 TYR A CA    1 
ATOM   1118 C  C     . TYR A 1 156 ? 154.60200 53.96300 99.93900  1.000 58.39000  ?  144 TYR A C     1 
ATOM   1119 O  O     . TYR A 1 156 ? 155.35500 54.57700 99.17100  1.000 61.08000  ?  144 TYR A O     1 
ATOM   1120 C  CB    . TYR A 1 156 ? 153.74900 51.68800 99.56300  1.000 55.88000  ?  144 TYR A CB    1 
ATOM   1121 C  CG    . TYR A 1 156 ? 152.68500 50.67600 99.21900  1.000 59.48000  ?  144 TYR A CG    1 
ATOM   1122 C  CD1   . TYR A 1 156 ? 151.63900 50.41500 100.09200 1.000 60.61000  ?  144 TYR A CD1   1 
ATOM   1123 C  CD2   . TYR A 1 156 ? 152.77600 49.91000 98.05100  1.000 62.89000  ?  144 TYR A CD2   1 
ATOM   1124 C  CE1   . TYR A 1 156 ? 150.68400 49.44100 99.79800  1.000 65.01000  ?  144 TYR A CE1   1 
ATOM   1125 C  CE2   . TYR A 1 156 ? 151.83300 48.93000 97.74800  1.000 61.17000  ?  144 TYR A CE2   1 
ATOM   1126 C  CZ    . TYR A 1 156 ? 150.78900 48.70100 98.63000  1.000 61.76000  ?  144 TYR A CZ    1 
ATOM   1127 O  OH    . TYR A 1 156 ? 149.84200 47.73900 98.35000  1.000 64.18000  ?  144 TYR A OH    1 
ATOM   1128 N  N     . GLN A 1 157 ? 154.78200 53.92900 101.25000 1.000 58.30000  ?  145 GLN A N     1 
ATOM   1129 C  CA    . GLN A 1 157 ? 156.04400 54.32600 101.85200 1.000 58.00000  ?  145 GLN A CA    1 
ATOM   1130 C  C     . GLN A 1 157 ? 156.54800 53.22200 102.77700 1.000 57.07000  ?  145 GLN A C     1 
ATOM   1131 O  O     . GLN A 1 157 ? 155.79100 52.31100 103.13900 1.000 53.42000  ?  145 GLN A O     1 
ATOM   1132 C  CB    . GLN A 1 157 ? 155.89200 55.61700 102.62400 1.000 59.54000  ?  145 GLN A CB    1 
ATOM   1133 C  CG    . GLN A 1 157 ? 155.28800 55.42900 103.99200 1.000 56.55000  ?  145 GLN A CG    1 
ATOM   1134 C  CD    . GLN A 1 157 ? 155.08900 56.75300 104.67800 1.000 60.19000  ?  145 GLN A CD    1 
ATOM   1135 O  OE1   . GLN A 1 157 ? 155.20600 57.81300 104.04900 1.000 61.79000  ?  145 GLN A OE1   1 
ATOM   1136 N  NE2   . GLN A 1 157 ? 154.79800 56.71300 105.97400 1.000 62.59000  ?  145 GLN A NE2   1 
ATOM   1137 N  N     . TYR A 1 158 ? 157.82600 53.31100 103.15300 1.000 58.91000  ?  146 TYR A N     1 
ATOM   1138 C  CA    . TYR A 1 158 ? 158.45400 52.31400 104.02100 1.000 54.67000  ?  146 TYR A CA    1 
ATOM   1139 C  C     . TYR A 1 158 ? 158.30500 52.64800 105.51100 1.000 55.23000  ?  146 TYR A C     1 
ATOM   1140 O  O     . TYR A 1 158 ? 158.50100 53.78400 105.93400 1.000 59.05000  ?  146 TYR A O     1 
ATOM   1141 C  CB    . TYR A 1 158 ? 159.94100 52.15500 103.66200 1.000 51.56000  ?  146 TYR A CB    1 
ATOM   1142 C  CG    . TYR A 1 158 ? 160.17800 51.07700 102.63100 1.000 57.82000  ?  146 TYR A CG    1 
ATOM   1143 C  CD1   . TYR A 1 158 ? 160.12000 51.35900 101.26100 1.000 57.63000  ?  146 TYR A CD1   1 
ATOM   1144 C  CD2   . TYR A 1 158 ? 160.43200 49.76300 103.01700 1.000 56.52000  ?  146 TYR A CD2   1 
ATOM   1145 C  CE1   . TYR A 1 158 ? 160.32100 50.35100 100.29600 1.000 51.84000  ?  146 TYR A CE1   1 
ATOM   1146 C  CE2   . TYR A 1 158 ? 160.62700 48.75200 102.06500 1.000 55.18000  ?  146 TYR A CE2   1 
ATOM   1147 C  CZ    . TYR A 1 158 ? 160.56200 49.05500 100.71100 1.000 54.05000  ?  146 TYR A CZ    1 
ATOM   1148 O  OH    . TYR A 1 158 ? 160.75600 48.06200 99.78100  1.000 58.27000  ?  146 TYR A OH    1 
ATOM   1149 N  N     . ASN A 1 159 ? 157.94700 51.65100 106.30600 1.000 54.95000  ?  147 ASN A N     1 
ATOM   1150 C  CA    . ASN A 1 159 ? 157.98500 51.80100 107.75400 1.000 55.76000  ?  147 ASN A CA    1 
ATOM   1151 C  C     . ASN A 1 159 ? 159.20100 51.09300 108.32400 1.000 52.15000  ?  147 ASN A C     1 
ATOM   1152 O  O     . ASN A 1 159 ? 159.57100 51.30600 109.47000 1.000 55.43000  ?  147 ASN A O     1 
ATOM   1153 C  CB    . ASN A 1 159 ? 156.71300 51.24100 108.40200 1.000 58.98000  ?  147 ASN A CB    1 
ATOM   1154 C  CG    . ASN A 1 159 ? 155.44200 51.89300 107.87100 1.000 58.34000  ?  147 ASN A CG    1 
ATOM   1155 O  OD1   . ASN A 1 159 ? 155.41600 53.09300 107.58800 1.000 55.85000  ?  147 ASN A OD1   1 
ATOM   1156 N  ND2   . ASN A 1 159 ? 154.37400 51.09400 107.73900 1.000 56.48000  ?  147 ASN A ND2   1 
ATOM   1157 N  N     . VAL A 1 160 ? 159.80900 50.23600 107.51400 1.000 53.11000  ?  148 VAL A N     1 
ATOM   1158 C  CA    . VAL A 1 160 ? 160.95300 49.43000 107.92900 1.000 53.40000  ?  148 VAL A CA    1 
ATOM   1159 C  C     . VAL A 1 160 ? 162.12800 49.81300 107.05200 1.000 50.59000  ?  148 VAL A C     1 
ATOM   1160 O  O     . VAL A 1 160 ? 161.95300 50.62900 106.17000 1.000 58.75000  ?  148 VAL A O     1 
ATOM   1161 C  CB    . VAL A 1 160 ? 160.64700 47.93600 107.80800 1.000 50.95000  ?  148 VAL A CB    1 
ATOM   1162 C  CG1   . VAL A 1 160 ? 159.51600 47.57200 108.73900 1.000 51.76000  ?  148 VAL A CG1   1 
ATOM   1163 C  CG2   . VAL A 1 160 ? 160.27400 47.58800 106.37600 1.000 48.97000  ?  148 VAL A CG2   1 
ATOM   1164 N  N     . LEU A 1 161 ? 163.31400 49.25000 107.26500 1.000 47.89000  ?  149 LEU A N     1 
ATOM   1165 C  CA    . LEU A 1 161 ? 164.44800 49.57700 106.38400 1.000 51.81000  ?  149 LEU A CA    1 
ATOM   1166 C  C     . LEU A 1 161 ? 164.25600 49.05400 104.96800 1.000 51.84000  ?  149 LEU A C     1 
ATOM   1167 O  O     . LEU A 1 161 ? 163.90100 47.89200 104.77500 1.000 53.53000  ?  149 LEU A O     1 
ATOM   1168 C  CB    . LEU A 1 161 ? 165.75800 49.01900 106.92700 1.000 45.51000  ?  149 LEU A CB    1 
ATOM   1169 C  CG    . LEU A 1 161 ? 166.15900 49.48500 108.32200 1.000 50.86000  ?  149 LEU A CG    1 
ATOM   1170 C  CD1   . LEU A 1 161 ? 167.46300 48.76400 108.79000 1.000 43.68000  ?  149 LEU A CD1   1 
ATOM   1171 C  CD2   . LEU A 1 161 ? 166.25900 51.00000 108.38100 1.000 42.00000  ?  149 LEU A CD2   1 
ATOM   1172 N  N     . PRO A 1 162 ? 164.51800 49.90400 103.96800 1.000 50.73000  ?  150 PRO A N     1 
ATOM   1173 C  CA    . PRO A 1 162 ? 164.39500 49.50500 102.56100 1.000 54.91000  ?  150 PRO A CA    1 
ATOM   1174 C  C     . PRO A 1 162 ? 165.72600 49.00900 102.00100 1.000 49.53000  ?  150 PRO A C     1 
ATOM   1175 O  O     . PRO A 1 162 ? 166.77600 49.44400 102.47500 1.000 47.82000  ?  150 PRO A O     1 
ATOM   1176 C  CB    . PRO A 1 162 ? 163.95900 50.80200 101.87600 1.000 49.83000  ?  150 PRO A CB    1 
ATOM   1177 C  CG    . PRO A 1 162 ? 164.64800 51.87600 102.66900 1.000 48.59000  ?  150 PRO A CG    1 
ATOM   1178 C  CD    . PRO A 1 162 ? 164.88000 51.32400 104.09100 1.000 48.86000  ?  150 PRO A CD    1 
ATOM   1179 N  N     . GLN A 1 163 ? 165.68200 48.12500 101.00900 1.000 50.94000  ?  151 GLN A N     1 
ATOM   1180 C  CA    . GLN A 1 163 ? 166.90900 47.61400 100.40000 1.000 51.52000  ?  151 GLN A CA    1 
ATOM   1181 C  C     . GLN A 1 163 ? 167.27900 48.44200 99.19200  1.000 52.53000  ?  151 GLN A C     1 
ATOM   1182 O  O     . GLN A 1 163 ? 166.61300 48.36000 98.17200  1.000 56.34000  ?  151 GLN A O     1 
ATOM   1183 C  CB    . GLN A 1 163 ? 166.76100 46.13800 100.00900 1.000 48.39000  ?  151 GLN A CB    1 
ATOM   1184 C  CG    . GLN A 1 163 ? 166.41800 45.26400 101.18600 1.000 45.11000  ?  151 GLN A CG    1 
ATOM   1185 C  CD    . GLN A 1 163 ? 166.11900 43.84200 100.80500 1.000 46.53000  ?  151 GLN A CD    1 
ATOM   1186 O  OE1   . GLN A 1 163 ? 166.98300 43.11500 100.32700 1.000 47.69000  ?  151 GLN A OE1   1 
ATOM   1187 N  NE2   . GLN A 1 163 ? 164.89600 43.42300 101.04600 1.000 49.01000  ?  151 GLN A NE2   1 
ATOM   1188 N  N     . GLY A 1 164 ? 168.33900 49.24000 99.32200  1.000 50.75000  ?  152 GLY A N     1 
ATOM   1189 C  CA    . GLY A 1 164 ? 168.83100 50.07700 98.24200  1.000 47.76000  ?  152 GLY A CA    1 
ATOM   1190 C  C     . GLY A 1 164 ? 169.11200 51.44500 98.82600  1.000 51.26000  ?  152 GLY A C     1 
ATOM   1191 O  O     . GLY A 1 164 ? 169.69600 52.33700 98.19000  1.000 50.47000  ?  152 GLY A O     1 
ATOM   1192 N  N     . TRP A 1 165 ? 168.66300 51.61800 100.06200 1.000 50.39000  ?  153 TRP A N     1 
ATOM   1193 C  CA    . TRP A 1 165 ? 168.97800 52.82600 100.81000 1.000 49.99000  ?  153 TRP A CA    1 
ATOM   1194 C  C     . TRP A 1 165 ? 170.35800 52.65400 101.42500 1.000 51.30000  ?  153 TRP A C     1 
ATOM   1195 O  O     . TRP A 1 165 ? 170.71300 51.54500 101.87100 1.000 49.53000  ?  153 TRP A O     1 
ATOM   1196 C  CB    . TRP A 1 165 ? 167.93300 53.09500 101.89600 1.000 48.14000  ?  153 TRP A CB    1 
ATOM   1197 C  CG    . TRP A 1 165 ? 168.13400 54.39500 102.63800 1.000 48.45000  ?  153 TRP A CG    1 
ATOM   1198 C  CD1   . TRP A 1 165 ? 168.46700 55.60900 102.10000 1.000 49.49000  ?  153 TRP A CD1   1 
ATOM   1199 C  CD2   . TRP A 1 165 ? 168.05500 54.59400 104.05100 1.000 47.88000  ?  153 TRP A CD2   1 
ATOM   1200 N  NE1   . TRP A 1 165 ? 168.56800 56.55800 103.08700 1.000 46.21000  ?  153 TRP A NE1   1 
ATOM   1201 C  CE2   . TRP A 1 165 ? 168.32200 55.96300 104.29900 1.000 50.42000  ?  153 TRP A CE2   1 
ATOM   1202 C  CE3   . TRP A 1 165 ? 167.75800 53.75600 105.13600 1.000 44.54000  ?  153 TRP A CE3   1 
ATOM   1203 C  CZ2   . TRP A 1 165 ? 168.30000 56.51600 105.59100 1.000 49.31000  ?  153 TRP A CZ2   1 
ATOM   1204 C  CZ3   . TRP A 1 165 ? 167.73600 54.30900 106.42000 1.000 46.12000  ?  153 TRP A CZ3   1 
ATOM   1205 C  CH2   . TRP A 1 165 ? 168.01200 55.67600 106.63000 1.000 48.09000  ?  153 TRP A CH2   1 
ATOM   1206 N  N     . LYS A 1 166 ? 171.11500 53.74900 101.45500 1.000 49.18000  ?  154 LYS A N     1 
ATOM   1207 C  CA    . LYS A 1 166 ? 172.49400 53.72100 101.92000 1.000 51.53000  ?  154 LYS A CA    1 
ATOM   1208 C  C     . LYS A 1 166 ? 172.61000 53.65600 103.45800 1.000 52.03000  ?  154 LYS A C     1 
ATOM   1209 O  O     . LYS A 1 166 ? 173.61400 53.18000 103.97500 1.000 55.18000  ?  154 LYS A O     1 
ATOM   1210 C  CB    . LYS A 1 166 ? 173.26000 54.92800 101.37200 1.000 46.43000  ?  154 LYS A CB    1 
ATOM   1211 C  CG    . LYS A 1 166 ? 173.20100 56.15600 102.23100 1.000 50.50000  ?  154 LYS A CG    1 
ATOM   1212 C  CD    . LYS A 1 166 ? 174.28700 57.16300 101.84200 1.000 51.93000  ?  154 LYS A CD    1 
ATOM   1213 C  CE    . LYS A 1 166 ? 174.35200 58.31000 102.84300 1.000 53.18000  ?  154 LYS A CE    1 
ATOM   1214 N  NZ    . LYS A 1 166 ? 175.13700 59.48300 102.35600 1.000 55.04000  ?  154 LYS A NZ    1 
ATOM   1215 N  N     . GLY A 1 167 ? 171.58500 54.10000 104.18400 1.000 50.64000  ?  155 GLY A N     1 
ATOM   1216 C  CA    . GLY A 1 167 ? 171.58900 54.02000 105.63900 1.000 44.22000  ?  155 GLY A CA    1 
ATOM   1217 C  C     . GLY A 1 167 ? 171.24100 52.64300 106.20600 1.000 48.69000  ?  155 GLY A C     1 
ATOM   1218 O  O     . GLY A 1 167 ? 171.49700 52.35700 107.37300 1.000 47.05000  ?  155 GLY A O     1 
ATOM   1219 N  N     . SER A 1 168 ? 170.67900 51.76900 105.37600 1.000 52.67000  ?  156 SER A N     1 
ATOM   1220 C  CA    . SER A 1 168 ? 170.11600 50.50700 105.87200 1.000 49.32000  ?  156 SER A CA    1 
ATOM   1221 C  C     . SER A 1 168 ? 171.12300 49.52200 106.45300 1.000 49.51000  ?  156 SER A C     1 
ATOM   1222 O  O     . SER A 1 168 ? 170.85700 48.91000 107.49600 1.000 47.25000  ?  156 SER A O     1 
ATOM   1223 C  CB    . SER A 1 168 ? 169.34200 49.80400 104.76200 1.000 48.84000  ?  156 SER A CB    1 
ATOM   1224 O  OG    . SER A 1 168 ? 168.11800 50.46000 104.49800 1.000 52.44000  ?  156 SER A OG    1 
ATOM   1225 N  N     . PRO A 1 169 ? 172.25700 49.32000 105.76400 1.000 49.23000  ?  157 PRO A N     1 
ATOM   1226 C  CA    . PRO A 1 169 ? 173.24600 48.35600 106.27300 1.000 46.83000  ?  157 PRO A CA    1 
ATOM   1227 C  C     . PRO A 1 169 ? 173.80600 48.75400 107.64300 1.000 41.99000  ?  157 PRO A C     1 
ATOM   1228 O  O     . PRO A 1 169 ? 173.80800 47.95200 108.57300 1.000 43.20000  ?  157 PRO A O     1 
ATOM   1229 C  CB    . PRO A 1 169 ? 174.34400 48.36800 105.19300 1.000 45.68000  ?  157 PRO A CB    1 
ATOM   1230 C  CG    . PRO A 1 169 ? 173.62200 48.80800 103.92900 1.000 45.35000  ?  157 PRO A CG    1 
ATOM   1231 C  CD    . PRO A 1 169 ? 172.57100 49.78400 104.40000 1.000 46.76000  ?  157 PRO A CD    1 
ATOM   1232 N  N     . ALA A 1 170 ? 174.26700 49.98000 107.78400 1.000 42.49000  ?  158 ALA A N     1 
ATOM   1233 C  CA    . ALA A 1 170 ? 174.83900 50.37600 109.05700 1.000 41.60000  ?  158 ALA A CA    1 
ATOM   1234 C  C     . ALA A 1 170 ? 173.77100 50.30500 110.14800 1.000 44.19000  ?  158 ALA A C     1 
ATOM   1235 O  O     . ALA A 1 170 ? 174.01900 49.82300 111.25500 1.000 37.57000  ?  158 ALA A O     1 
ATOM   1236 C  CB    . ALA A 1 170 ? 175.42600 51.76500 108.96800 1.000 38.81000  ?  158 ALA A CB    1 
ATOM   1237 N  N     . ILE A 1 171 ? 172.57000 50.77100 109.82900 1.000 46.95000  ?  159 ILE A N     1 
ATOM   1238 C  CA    . ILE A 1 171 ? 171.50700 50.78900 110.83000 1.000 43.57000  ?  159 ILE A CA    1 
ATOM   1239 C  C     . ILE A 1 171 ? 171.11400 49.36900 111.20800 1.000 43.75000  ?  159 ILE A C     1 
ATOM   1240 O  O     . ILE A 1 171 ? 170.78800 49.09500 112.36500 1.000 47.56000  ?  159 ILE A O     1 
ATOM   1241 C  CB    . ILE A 1 171 ? 170.27500 51.57800 110.35200 1.000 43.52000  ?  159 ILE A CB    1 
ATOM   1242 C  CG1   . ILE A 1 171 ? 170.56800 53.07700 110.44900 1.000 42.88000  ?  159 ILE A CG1   1 
ATOM   1243 C  CG2   . ILE A 1 171 ? 169.04700 51.22500 111.18900 1.000 37.56000  ?  159 ILE A CG2   1 
ATOM   1244 C  CD1   . ILE A 1 171 ? 169.52500 53.94500 109.80000 1.000 45.73000  ?  159 ILE A CD1   1 
ATOM   1245 N  N     . PHE A 1 172 ? 171.16600 48.45200 110.25300 1.000 43.09000  ?  160 PHE A N     1 
ATOM   1246 C  CA    . PHE A 1 172 ? 170.85900 47.08100 110.59300 1.000 41.95000  ?  160 PHE A CA    1 
ATOM   1247 C  C     . PHE A 1 172 ? 171.97300 46.53300 111.46700 1.000 40.61000  ?  160 PHE A C     1 
ATOM   1248 O  O     . PHE A 1 172 ? 171.72600 45.94300 112.50900 1.000 42.53000  ?  160 PHE A O     1 
ATOM   1249 C  CB    . PHE A 1 172 ? 170.67700 46.18900 109.36500 1.000 39.37000  ?  160 PHE A CB    1 
ATOM   1250 C  CG    . PHE A 1 172 ? 170.31900 44.77400 109.72500 1.000 42.03000  ?  160 PHE A CG    1 
ATOM   1251 C  CD1   . PHE A 1 172 ? 168.99800 44.42000 109.96600 1.000 44.14000  ?  160 PHE A CD1   1 
ATOM   1252 C  CD2   . PHE A 1 172 ? 171.30600 43.81400 109.89200 1.000 39.14000  ?  160 PHE A CD2   1 
ATOM   1253 C  CE1   . PHE A 1 172 ? 168.66100 43.12400 110.32400 1.000 41.90000  ?  160 PHE A CE1   1 
ATOM   1254 C  CE2   . PHE A 1 172 ? 170.98500 42.51300 110.26100 1.000 40.33000  ?  160 PHE A CE2   1 
ATOM   1255 C  CZ    . PHE A 1 172 ? 169.65500 42.17200 110.48400 1.000 46.67000  ?  160 PHE A CZ    1 
ATOM   1256 N  N     . GLN A 1 173 ? 173.20000 46.73700 111.03500 1.000 41.55000  ?  161 GLN A N     1 
ATOM   1257 C  CA    . GLN A 1 173 ? 174.33800 46.16900 111.73400 1.000 41.91000  ?  161 GLN A CA    1 
ATOM   1258 C  C     . GLN A 1 173 ? 174.44800 46.68300 113.14500 1.000 41.22000  ?  161 GLN A C     1 
ATOM   1259 O  O     . GLN A 1 173 ? 174.73600 45.91700 114.06600 1.000 42.84000  ?  161 GLN A O     1 
ATOM   1260 C  CB    . GLN A 1 173 ? 175.61200 46.44800 110.96600 1.000 40.28000  ?  161 GLN A CB    1 
ATOM   1261 C  CG    . GLN A 1 173 ? 175.65000 45.62700 109.71500 1.000 39.61000  ?  161 GLN A CG    1 
ATOM   1262 C  CD    . GLN A 1 173 ? 176.47400 46.25400 108.65200 1.000 40.88000  ?  161 GLN A CD    1 
ATOM   1263 O  OE1   . GLN A 1 173 ? 176.50900 45.76800 107.53100 1.000 44.72000  ?  161 GLN A OE1   1 
ATOM   1264 N  NE2   . GLN A 1 173 ? 177.12300 47.36000 108.97900 1.000 44.20000  ?  161 GLN A NE2   1 
ATOM   1265 N  N     . SER A 1 174 ? 174.19100 47.97000 113.32100 1.000 41.69000  ?  162 SER A N     1 
ATOM   1266 C  CA    . SER A 1 174 ? 174.14600 48.55200 114.65400 1.000 39.82000  ?  162 SER A CA    1 
ATOM   1267 C  C     . SER A 1 174 ? 172.97700 47.99800 115.48800 1.000 41.15000  ?  162 SER A C     1 
ATOM   1268 O  O     . SER A 1 174 ? 173.13300 47.70000 116.65700 1.000 44.11000  ?  162 SER A O     1 
ATOM   1269 C  CB    . SER A 1 174 ? 174.04700 50.06600 114.56800 1.000 38.08000  ?  162 SER A CB    1 
ATOM   1270 O  OG    . SER A 1 174 ? 174.18200 50.61700 115.85600 1.000 54.88000  ?  162 SER A OG    1 
ATOM   1271 N  N     . SER A 1 175 ? 171.80300 47.85600 114.89800 1.000 43.24000  ?  163 SER A N     1 
ATOM   1272 C  CA    . SER A 1 175 ? 170.66800 47.33200 115.65200 1.000 45.10000  ?  163 SER A CA    1 
ATOM   1273 C  C     . SER A 1 175 ? 170.89400 45.89800 116.09600 1.000 41.98000  ?  163 SER A C     1 
ATOM   1274 O  O     . SER A 1 175 ? 170.55600 45.53700 117.21300 1.000 44.43000  ?  163 SER A O     1 
ATOM   1275 C  CB    . SER A 1 175 ? 169.38600 47.40900 114.82500 1.000 41.33000  ?  163 SER A CB    1 
ATOM   1276 O  OG    . SER A 1 175 ? 169.15200 48.73200 114.41200 1.000 48.86000  ?  163 SER A OG    1 
ATOM   1277 N  N     . MET A 1 176 ? 171.45100 45.08600 115.20200 1.000 45.04000  ?  164 MET A N     1 
ATOM   1278 C  CA    . MET A 1 176 ? 171.72200 43.67300 115.47400 1.000 42.23000  ?  164 MET A CA    1 
ATOM   1279 C  C     . MET A 1 176 ? 172.69000 43.56100 116.64000 1.000 46.18000  ?  164 MET A C     1 
ATOM   1280 O  O     . MET A 1 176 ? 172.55000 42.66900 117.48400 1.000 45.44000  ?  164 MET A O     1 
ATOM   1281 C  CB    . MET A 1 176 ? 172.27100 42.98300 114.21400 1.000 40.82000  ?  164 MET A CB    1 
ATOM   1282 C  CG    . MET A 1 176 ? 172.52500 41.47700 114.31900 1.000 43.89000  ?  164 MET A CG    1 
ATOM   1283 S  SD    . MET A 1 176 ? 171.10100 40.44500 114.75000 1.000 50.35000  ?  164 MET A SD    1 
ATOM   1284 C  CE    . MET A 1 176 ? 170.65300 39.79600 113.14900 1.000 53.51000  ?  164 MET A CE    1 
ATOM   1285 N  N     . THR A 1 177 ? 173.64500 44.49600 116.69700 1.000 47.54000  ?  165 THR A N     1 
ATOM   1286 C  CA    . THR A 1 177 ? 174.64100 44.54100 117.76100 1.000 43.35000  ?  165 THR A CA    1 
ATOM   1287 C  C     . THR A 1 177 ? 173.99000 44.90100 119.09200 1.000 46.37000  ?  165 THR A C     1 
ATOM   1288 O  O     . THR A 1 177 ? 174.32200 44.28000 120.11900 1.000 45.13000  ?  165 THR A O     1 
ATOM   1289 C  CB    . THR A 1 177 ? 175.79100 45.53800 117.43300 1.000 40.71000  ?  165 THR A CB    1 
ATOM   1290 O  OG1   . THR A 1 177 ? 176.45600 45.09900 116.25300 1.000 44.21000  ?  165 THR A OG1   1 
ATOM   1291 C  CG2   . THR A 1 177 ? 176.84100 45.56600 118.52100 1.000 41.17000  ?  165 THR A CG2   1 
ATOM   1292 N  N     . LYS A 1 178 ? 173.07300 45.87800 119.09900 1.000 41.78000  ?  166 LYS A N     1 
ATOM   1293 C  CA    . LYS A 1 178 ? 172.36000 46.20300 120.35000 1.000 41.94000  ?  166 LYS A CA    1 
ATOM   1294 C  C     . LYS A 1 178 ? 171.61800 44.95700 120.80800 1.000 44.93000  ?  166 LYS A C     1 
ATOM   1295 O  O     . LYS A 1 178 ? 171.76100 44.51700 121.94100 1.000 48.14000  ?  166 LYS A O     1 
ATOM   1296 C  CB    . LYS A 1 178 ? 171.37900 47.38400 120.20800 1.000 40.82000  ?  166 LYS A CB    1 
ATOM   1297 C  CG    . LYS A 1 178 ? 172.02300 48.62600 119.63000 1.000 49.02000  ?  166 LYS A CG    1 
ATOM   1298 C  CD    . LYS A 1 178 ? 171.77800 49.94500 120.38400 1.000 57.58000  ?  166 LYS A CD    1 
ATOM   1299 C  CE    . LYS A 1 178 ? 172.58400 51.11400 119.69000 1.000 60.70000  ?  166 LYS A CE    1 
ATOM   1300 N  NZ    . LYS A 1 178 ? 173.25400 52.17100 120.56900 1.000 51.05000  ?  166 LYS A NZ    1 
ATOM   1301 N  N     . ILE A 1 179 ? 170.86400 44.36600 119.89400 1.000 44.62000  ?  167 ILE A N     1 
ATOM   1302 C  CA    . ILE A 1 179 ? 170.05300 43.19500 120.19800 1.000 44.83000  ?  167 ILE A CA    1 
ATOM   1303 C  C     . ILE A 1 179 ? 170.87000 42.02800 120.77300 1.000 43.51000  ?  167 ILE A C     1 
ATOM   1304 O  O     . ILE A 1 179 ? 170.43100 41.37500 121.71200 1.000 46.58000  ?  167 ILE A O     1 
ATOM   1305 C  CB    . ILE A 1 179 ? 169.27900 42.73800 118.93100 1.000 39.90000  ?  167 ILE A CB    1 
ATOM   1306 C  CG1   . ILE A 1 179 ? 168.20900 43.77100 118.57800 1.000 40.70000  ?  167 ILE A CG1   1 
ATOM   1307 C  CG2   . ILE A 1 179 ? 168.66700 41.39700 119.14800 1.000 43.95000  ?  167 ILE A CG2   1 
ATOM   1308 C  CD1   . ILE A 1 179 ? 167.46700 43.49100 117.29000 1.000 42.14000  ?  167 ILE A CD1   1 
ATOM   1309 N  N     . LEU A 1 180 ? 172.05800 41.77000 120.23800 1.000 43.70000  ?  168 LEU A N     1 
ATOM   1310 C  CA    . LEU A 1 180 ? 172.86900 40.65000 120.73900 1.000 45.35000  ?  168 LEU A CA    1 
ATOM   1311 C  C     . LEU A 1 180 ? 173.67700 41.00000 121.99800 1.000 44.23000  ?  168 LEU A C     1 
ATOM   1312 O  O     . LEU A 1 180 ? 174.16700 40.11300 122.68700 1.000 44.01000  ?  168 LEU A O     1 
ATOM   1313 C  CB    . LEU A 1 180 ? 173.82400 40.13400 119.64700 1.000 39.61000  ?  168 LEU A CB    1 
ATOM   1314 C  CG    . LEU A 1 180 ? 173.16700 39.46900 118.43500 1.000 38.01000  ?  168 LEU A CG    1 
ATOM   1315 C  CD1   . LEU A 1 180 ? 174.18500 39.21800 117.41100 1.000 39.83000  ?  168 LEU A CD1   1 
ATOM   1316 C  CD2   . LEU A 1 180 ? 172.53300 38.16100 118.83200 1.000 39.48000  ?  168 LEU A CD2   1 
ATOM   1317 N  N     . GLU A 1 181 ? 173.82100 42.28000 122.30700 1.000 44.45000  ?  169 GLU A N     1 
ATOM   1318 C  CA    . GLU A 1 181 ? 174.65400 42.65600 123.45200 1.000 48.93000  ?  169 GLU A CA    1 
ATOM   1319 C  C     . GLU A 1 181 ? 174.28400 41.88900 124.74200 1.000 52.28000  ?  169 GLU A C     1 
ATOM   1320 O  O     . GLU A 1 181 ? 175.12900 41.17400 125.29800 1.000 51.90000  ?  169 GLU A O     1 
ATOM   1321 C  CB    . GLU A 1 181 ? 174.58100 44.16200 123.68500 1.000 45.58000  ?  169 GLU A CB    1 
ATOM   1322 C  CG    . GLU A 1 181 ? 175.65100 44.67800 124.60900 1.000 52.32000  ?  169 GLU A CG    1 
ATOM   1323 C  CD    . GLU A 1 181 ? 175.15500 44.83500 126.03200 1.000 66.12000  ?  169 GLU A CD    1 
ATOM   1324 O  OE1   . GLU A 1 181 ? 176.00500 44.93700 126.94900 1.000 73.80000  ?  169 GLU A OE1   1 
ATOM   1325 O  OE2   . GLU A 1 181 ? 173.91400 44.85500 126.23000 1.000 60.32000  ?  169 GLU A OE2   1 
ATOM   1326 N  N     . PRO A 1 182 ? 173.01800 42.00000 125.19100 1.000 44.38000  ?  170 PRO A N     1 
ATOM   1327 C  CA    . PRO A 1 182 ? 172.53700 41.30000 126.38900 1.000 46.50000  ?  170 PRO A CA    1 
ATOM   1328 C  C     . PRO A 1 182 ? 172.78500 39.79400 126.35100 1.000 48.02000  ?  170 PRO A C     1 
ATOM   1329 O  O     . PRO A 1 182 ? 173.21700 39.20800 127.34700 1.000 54.57000  ?  170 PRO A O     1 
ATOM   1330 C  CB    . PRO A 1 182 ? 171.02700 41.58100 126.39700 1.000 40.33000  ?  170 PRO A CB    1 
ATOM   1331 C  CG    . PRO A 1 182 ? 170.84000 42.75300 125.54400 1.000 47.32000  ?  170 PRO A CG    1 
ATOM   1332 C  CD    . PRO A 1 182 ? 171.92400 42.69600 124.49700 1.000 48.41000  ?  170 PRO A CD    1 
ATOM   1333 N  N     . PHE A 1 183 ? 172.50700 39.15800 125.22400 1.000 48.23000  ?  171 PHE A N     1 
ATOM   1334 C  CA    . PHE A 1 183 ? 172.77700 37.73300 125.12400 1.000 43.54000  ?  171 PHE A CA    1 
ATOM   1335 C  C     . PHE A 1 183 ? 174.28400 37.43900 125.18800 1.000 47.45000  ?  171 PHE A C     1 
ATOM   1336 O  O     . PHE A 1 183 ? 174.69900 36.37000 125.63200 1.000 48.29000  ?  171 PHE A O     1 
ATOM   1337 C  CB    . PHE A 1 183 ? 172.18500 37.16900 123.84600 1.000 38.89000  ?  171 PHE A CB    1 
ATOM   1338 C  CG    . PHE A 1 183 ? 172.37100 35.69300 123.71000 1.000 45.58000  ?  171 PHE A CG    1 
ATOM   1339 C  CD1   . PHE A 1 183 ? 173.53800 35.17400 123.19200 1.000 37.16000  ?  171 PHE A CD1   1 
ATOM   1340 C  CD2   . PHE A 1 183 ? 171.38400 34.81600 124.12400 1.000 45.44000  ?  171 PHE A CD2   1 
ATOM   1341 C  CE1   . PHE A 1 183 ? 173.70200 33.82200 123.06500 1.000 39.90000  ?  171 PHE A CE1   1 
ATOM   1342 C  CE2   . PHE A 1 183 ? 171.56300 33.44900 124.00600 1.000 45.64000  ?  171 PHE A CE2   1 
ATOM   1343 C  CZ    . PHE A 1 183 ? 172.70400 32.95700 123.47300 1.000 39.69000  ?  171 PHE A CZ    1 
ATOM   1344 N  N     . ARG A 1 184 ? 175.09700 38.39100 124.74800 1.000 46.71000  ?  172 ARG A N     1 
ATOM   1345 C  CA    . ARG A 1 184 ? 176.52700 38.18900 124.72400 1.000 46.94000  ?  172 ARG A CA    1 
ATOM   1346 C  C     . ARG A 1 184 ? 177.06700 38.29600 126.13500 1.000 44.48000  ?  172 ARG A C     1 
ATOM   1347 O  O     . ARG A 1 184 ? 177.86900 37.47300 126.55100 1.000 45.86000  ?  172 ARG A O     1 
ATOM   1348 C  CB    . ARG A 1 184 ? 177.21700 39.19300 123.77700 1.000 47.93000  ?  172 ARG A CB    1 
ATOM   1349 C  CG    . ARG A 1 184 ? 177.34900 38.70000 122.33500 1.000 37.70000  ?  172 ARG A CG    1 
ATOM   1350 C  CD    . ARG A 1 184 ? 178.18500 39.60500 121.46300 1.000 38.32000  ?  172 ARG A CD    1 
ATOM   1351 N  NE    . ARG A 1 184 ? 178.40700 39.03200 120.13200 1.000 37.19000  ?  172 ARG A NE    1 
ATOM   1352 C  CZ    . ARG A 1 184 ? 177.90500 39.52900 119.00800 1.000 40.17000  ?  172 ARG A CZ    1 
ATOM   1353 N  NH1   . ARG A 1 184 ? 177.15800 40.62000 119.04200 1.000 49.16000  ?  172 ARG A NH1   1 
ATOM   1354 N  NH2   . ARG A 1 184 ? 178.14500 38.94600 117.84900 1.000 39.36000  ?  172 ARG A NH2   1 
ATOM   1355 N  N     . LYS A 1 185 ? 176.60600 39.29100 126.88400 1.000 50.09000  ?  173 LYS A N     1 
ATOM   1356 C  CA    . LYS A 1 185 ? 177.09300 39.48900 128.25200 1.000 49.89000  ?  173 LYS A CA    1 
ATOM   1357 C  C     . LYS A 1 185 ? 176.64800 38.35500 129.17900 1.000 51.81000  ?  173 LYS A C     1 
ATOM   1358 O  O     . LYS A 1 185 ? 177.39200 37.89900 130.05500 1.000 54.50000  ?  173 LYS A O     1 
ATOM   1359 C  CB    . LYS A 1 185 ? 176.63600 40.84300 128.78300 1.000 48.04000  ?  173 LYS A CB    1 
ATOM   1360 C  CG    . LYS A 1 185 ? 177.54900 41.95200 128.29400 1.000 58.72000  ?  173 LYS A CG    1 
ATOM   1361 C  CD    . LYS A 1 185 ? 177.60700 43.12900 129.22500 1.000 65.40000  ?  173 LYS A CD    1 
ATOM   1362 C  CE    . LYS A 1 185 ? 178.94700 43.86600 129.08000 1.000 69.89000  ?  173 LYS A CE    1 
ATOM   1363 N  NZ    . LYS A 1 185 ? 179.96800 43.38800 130.07900 1.000 70.10000  ?  173 LYS A NZ    1 
ATOM   1364 N  N     . GLN A 1 186 ? 175.43900 37.87600 128.95400 1.000 50.45000  ?  174 GLN A N     1 
ATOM   1365 C  CA    . GLN A 1 186 ? 174.95800 36.73500 129.68900 1.000 52.33000  ?  174 GLN A CA    1 
ATOM   1366 C  C     . GLN A 1 186 ? 175.70800 35.47500 129.26900 1.000 48.47000  ?  174 GLN A C     1 
ATOM   1367 O  O     . GLN A 1 186 ? 175.96100 34.61300 130.07900 1.000 51.48000  ?  174 GLN A O     1 
ATOM   1368 C  CB    . GLN A 1 186 ? 173.45500 36.56300 129.48300 1.000 49.13000  ?  174 GLN A CB    1 
ATOM   1369 C  CG    . GLN A 1 186 ? 172.92300 35.33300 130.14100 1.000 55.83000  ?  174 GLN A CG    1 
ATOM   1370 C  CD    . GLN A 1 186 ? 171.42600 35.37100 130.29600 1.000 65.04000  ?  174 GLN A CD    1 
ATOM   1371 O  OE1   . GLN A 1 186 ? 170.82300 36.45300 130.26900 1.000 69.56000  ?  174 GLN A OE1   1 
ATOM   1372 N  NE2   . GLN A 1 186 ? 170.80800 34.19500 130.47100 1.000 58.25000  ?  174 GLN A NE2   1 
ATOM   1373 N  N     . ASN A 1 187 ? 176.07100 35.36400 128.00500 1.000 46.36000  ?  175 ASN A N     1 
ATOM   1374 C  CA    . ASN A 1 187 ? 176.70300 34.13800 127.55200 1.000 46.48000  ?  175 ASN A CA    1 
ATOM   1375 C  C     . ASN A 1 187 ? 178.05900 34.42500 126.93200 1.000 51.17000  ?  175 ASN A C     1 
ATOM   1376 O  O     . ASN A 1 187 ? 178.26300 34.24700 125.73300 1.000 54.79000  ?  175 ASN A O     1 
ATOM   1377 C  CB    . ASN A 1 187 ? 175.79200 33.40700 126.56300 1.000 47.48000  ?  175 ASN A CB    1 
ATOM   1378 C  CG    . ASN A 1 187 ? 174.43600 33.06500 127.16400 1.000 51.24000  ?  175 ASN A CG    1 
ATOM   1379 O  OD1   . ASN A 1 187 ? 174.24800 31.97900 127.68300 1.000 52.74000  ?  175 ASN A OD1   1 
ATOM   1380 N  ND2   . ASN A 1 187 ? 173.49100 33.99900 127.09900 1.000 52.51000  ?  175 ASN A ND2   1 
ATOM   1381 N  N     . PRO A 1 188 ? 179.00300 34.87900 127.75600 1.000 54.18000  ?  176 PRO A N     1 
ATOM   1382 C  CA    . PRO A 1 188 ? 180.31100 35.30500 127.26000 1.000 49.75000  ?  176 PRO A CA    1 
ATOM   1383 C  C     . PRO A 1 188 ? 181.03600 34.21800 126.49700 1.000 53.90000  ?  176 PRO A C     1 
ATOM   1384 O  O     . PRO A 1 188 ? 181.84800 34.54200 125.63600 1.000 58.45000  ?  176 PRO A O     1 
ATOM   1385 C  CB    . PRO A 1 188 ? 181.07000 35.65300 128.53100 1.000 47.93000  ?  176 PRO A CB    1 
ATOM   1386 C  CG    . PRO A 1 188 ? 180.27400 35.02400 129.64800 1.000 49.23000  ?  176 PRO A CG    1 
ATOM   1387 C  CD    . PRO A 1 188 ? 178.88200 35.04600 129.21400 1.000 53.24000  ?  176 PRO A CD    1 
ATOM   1388 N  N     . ASP A 1 189 ? 180.74400 32.95400 126.77800 1.000 54.17000  ?  177 ASP A N     1 
ATOM   1389 C  CA    . ASP A 1 189 ? 181.52500 31.88700 126.16300 1.000 52.24000  ?  177 ASP A CA    1 
ATOM   1390 C  C     . ASP A 1 189 ? 180.83700 31.20400 124.98900 1.000 49.60000  ?  177 ASP A C     1 
ATOM   1391 O  O     . ASP A 1 189 ? 181.33700 30.22800 124.45600 1.000 52.79000  ?  177 ASP A O     1 
ATOM   1392 C  CB    . ASP A 1 189 ? 181.93300 30.88400 127.24200 1.000 54.17000  ?  177 ASP A CB    1 
ATOM   1393 C  CG    . ASP A 1 189 ? 183.02500 31.46700 128.17600 1.000 68.53000  ?  177 ASP A CG    1 
ATOM   1394 O  OD1   . ASP A 1 189 ? 184.19900 31.58200 127.72100 1.000 76.03000  ?  177 ASP A OD1   1 
ATOM   1395 O  OD2   . ASP A 1 189 ? 182.72100 31.85000 129.33700 1.000 58.81000  ?  177 ASP A OD2   1 
ATOM   1396 N  N     . ILE A 1 190 ? 179.69900 31.73200 124.56500 1.000 46.98000  ?  178 ILE A N     1 
ATOM   1397 C  CA    . ILE A 1 190 ? 179.16200 31.37000 123.27100 1.000 44.96000  ?  178 ILE A CA    1 
ATOM   1398 C  C     . ILE A 1 190 ? 179.73900 32.39400 122.28400 1.000 48.44000  ?  178 ILE A C     1 
ATOM   1399 O  O     . ILE A 1 190 ? 179.67600 33.59800 122.52100 1.000 48.33000  ?  178 ILE A O     1 
ATOM   1400 C  CB    . ILE A 1 190 ? 177.61800 31.39600 123.24600 1.000 47.76000  ?  178 ILE A CB    1 
ATOM   1401 C  CG1   . ILE A 1 190 ? 177.02000 30.45700 124.30800 1.000 41.35000  ?  178 ILE A CG1   1 
ATOM   1402 C  CG2   . ILE A 1 190 ? 177.09800 31.08000 121.85500 1.000 42.72000  ?  178 ILE A CG2   1 
ATOM   1403 C  CD1   . ILE A 1 190 ? 177.55100 29.07600 124.24000 1.000 39.76000  ?  178 ILE A CD1   1 
ATOM   1404 N  N     . VAL A 1 191 ? 180.33900 31.93400 121.20000 1.000 40.90000  ?  179 VAL A N     1 
ATOM   1405 C  CA    . VAL A 1 191 ? 180.89700 32.86500 120.23900 1.000 42.51000  ?  179 VAL A CA    1 
ATOM   1406 C  C     . VAL A 1 191 ? 179.91100 33.05200 119.08800 1.000 44.46000  ?  179 VAL A C     1 
ATOM   1407 O  O     . VAL A 1 191 ? 179.38800 32.07900 118.55000 1.000 42.74000  ?  179 VAL A O     1 
ATOM   1408 C  CB    . VAL A 1 191 ? 182.27100 32.37700 119.70500 1.000 46.27000  ?  179 VAL A CB    1 
ATOM   1409 C  CG1   . VAL A 1 191 ? 182.22000 30.91700 119.37700 1.000 50.57000  ?  179 VAL A CG1   1 
ATOM   1410 C  CG2   . VAL A 1 191 ? 182.65900 33.13500 118.48000 1.000 45.62000  ?  179 VAL A CG2   1 
ATOM   1411 N  N     . ILE A 1 192 ? 179.64700 34.30500 118.72500 1.000 45.93000  ?  180 ILE A N     1 
ATOM   1412 C  CA    . ILE A 1 192 ? 178.65400 34.60000 117.70800 1.000 37.36000  ?  180 ILE A CA    1 
ATOM   1413 C  C     . ILE A 1 192 ? 179.24500 35.52700 116.64000 1.000 41.32000  ?  180 ILE A C     1 
ATOM   1414 O  O     . ILE A 1 192 ? 179.42700 36.73200 116.85300 1.000 39.11000  ?  180 ILE A O     1 
ATOM   1415 C  CB    . ILE A 1 192 ? 177.39200 35.22400 118.33100 1.000 40.28000  ?  180 ILE A CB    1 
ATOM   1416 C  CG1   . ILE A 1 192 ? 176.82100 34.32000 119.42500 1.000 42.36000  ?  180 ILE A CG1   1 
ATOM   1417 C  CG2   . ILE A 1 192 ? 176.31000 35.50200 117.26600 1.000 39.95000  ?  180 ILE A CG2   1 
ATOM   1418 C  CD1   . ILE A 1 192 ? 175.58400 34.94100 120.16800 1.000 37.83000  ?  180 ILE A CD1   1 
ATOM   1419 N  N     . TYR A 1 193 ? 179.59400 34.94600 115.49700 1.000 41.44000  ?  181 TYR A N     1 
ATOM   1420 C  CA    . TYR A 1 193 ? 180.08200 35.73600 114.38100 1.000 36.33000  ?  181 TYR A CA    1 
ATOM   1421 C  C     . TYR A 1 193 ? 178.86700 36.29100 113.67800 1.000 41.24000  ?  181 TYR A C     1 
ATOM   1422 O  O     . TYR A 1 193 ? 178.02400 35.55100 113.16900 1.000 39.48000  ?  181 TYR A O     1 
ATOM   1423 C  CB    . TYR A 1 193 ? 180.95300 34.91100 113.44300 1.000 34.33000  ?  181 TYR A CB    1 
ATOM   1424 C  CG    . TYR A 1 193 ? 182.42000 34.91300 113.82500 1.000 37.94000  ?  181 TYR A CG    1 
ATOM   1425 C  CD1   . TYR A 1 193 ? 182.88500 34.18700 114.91100 1.000 35.94000  ?  181 TYR A CD1   1 
ATOM   1426 C  CD2   . TYR A 1 193 ? 183.33800 35.65100 113.09400 1.000 40.05000  ?  181 TYR A CD2   1 
ATOM   1427 C  CE1   . TYR A 1 193 ? 184.22700 34.18700 115.25300 1.000 40.24000  ?  181 TYR A CE1   1 
ATOM   1428 C  CE2   . TYR A 1 193 ? 184.68500 35.66400 113.42100 1.000 39.92000  ?  181 TYR A CE2   1 
ATOM   1429 C  CZ    . TYR A 1 193 ? 185.13300 34.93300 114.49400 1.000 46.22000  ?  181 TYR A CZ    1 
ATOM   1430 O  OH    . TYR A 1 193 ? 186.48500 34.96400 114.79000 1.000 42.56000  ?  181 TYR A OH    1 
ATOM   1431 N  N     . GLN A 1 194 ? 178.78400 37.61300 113.68400 1.000 41.37000  ?  182 GLN A N     1 
ATOM   1432 C  CA    . GLN A 1 194 ? 177.59900 38.33500 113.28100 1.000 37.79000  ?  182 GLN A CA    1 
ATOM   1433 C  C     . GLN A 1 194 ? 177.84300 39.11700 112.01000 1.000 43.24000  ?  182 GLN A C     1 
ATOM   1434 O  O     . GLN A 1 194 ? 178.41800 40.20100 112.06700 1.000 47.23000  ?  182 GLN A O     1 
ATOM   1435 C  CB    . GLN A 1 194 ? 177.20100 39.27000 114.40600 1.000 38.71000  ?  182 GLN A CB    1 
ATOM   1436 C  CG    . GLN A 1 194 ? 176.10400 40.24300 114.08700 1.000 37.48000  ?  182 GLN A CG    1 
ATOM   1437 C  CD    . GLN A 1 194 ? 176.15600 41.41000 115.03600 1.000 39.99000  ?  182 GLN A CD    1 
ATOM   1438 O  OE1   . GLN A 1 194 ? 176.64700 41.29000 116.16800 1.000 40.82000  ?  182 GLN A OE1   1 
ATOM   1439 N  NE2   . GLN A 1 194 ? 175.69500 42.55400 114.57800 1.000 43.15000  ?  182 GLN A NE2   1 
ATOM   1440 N  N     . TYR A 1 195 ? 177.43100 38.58400 110.85800 1.000 41.02000  ?  183 TYR A N     1 
ATOM   1441 C  CA    . TYR A 1 195 ? 177.65400 39.28900 109.60300 1.000 37.14000  ?  183 TYR A CA    1 
ATOM   1442 C  C     . TYR A 1 195 ? 176.33400 39.53300 108.87600 1.000 42.99000  ?  183 TYR A C     1 
ATOM   1443 O  O     . TYR A 1 195 ? 175.72400 38.60100 108.34900 1.000 46.66000  ?  183 TYR A O     1 
ATOM   1444 C  CB    . TYR A 1 195 ? 178.62600 38.51200 108.71800 1.000 37.52000  ?  183 TYR A CB    1 
ATOM   1445 C  CG    . TYR A 1 195 ? 179.07100 39.29100 107.51300 1.000 40.08000  ?  183 TYR A CG    1 
ATOM   1446 C  CD1   . TYR A 1 195 ? 180.14400 40.17200 107.58600 1.000 38.96000  ?  183 TYR A CD1   1 
ATOM   1447 C  CD2   . TYR A 1 195 ? 178.40900 39.16200 106.30700 1.000 37.03000  ?  183 TYR A CD2   1 
ATOM   1448 C  CE1   . TYR A 1 195 ? 180.54500 40.89100 106.47700 1.000 44.21000  ?  183 TYR A CE1   1 
ATOM   1449 C  CE2   . TYR A 1 195 ? 178.79900 39.86900 105.19500 1.000 38.63000  ?  183 TYR A CE2   1 
ATOM   1450 C  CZ    . TYR A 1 195 ? 179.85900 40.73900 105.27600 1.000 43.25000  ?  183 TYR A CZ    1 
ATOM   1451 O  OH    . TYR A 1 195 ? 180.23400 41.44900 104.15700 1.000 37.99000  ?  183 TYR A OH    1 
ATOM   1452 N  N     . MET A 1 196 ? 175.93300 40.80300 108.81200 1.000 42.03000  ?  184 MET A N     1 
ATOM   1453 C  CA    . MET A 1 196 ? 174.55600 41.19900 108.52600 1.000 43.64000  ?  184 MET A CA    1 
ATOM   1454 C  C     . MET A 1 196 ? 173.63900 40.46900 109.46500 1.000 44.75000  ?  184 MET A C     1 
ATOM   1455 O  O     . MET A 1 196 ? 173.68400 40.67800 110.66300 1.000 44.32000  ?  184 MET A O     1 
ATOM   1456 C  CB    . MET A 1 196 ? 174.11600 40.90900 107.08900 1.000 44.58000  ?  184 MET A CB    1 
ATOM   1457 C  CG    . MET A 1 196 ? 174.15500 42.10000 106.15100 1.000 49.71000  ?  184 MET A CG    1 
ATOM   1458 S  SD    . MET A 1 196 ? 173.56900 43.69800 106.76100 1.000 53.27000  ?  184 MET A SD    1 
ATOM   1459 C  CE    . MET A 1 196 ? 174.57700 44.66800 105.66500 1.000 46.55000  ?  184 MET A CE    1 
ATOM   1460 N  N     . ASP A 1 197 ? 172.81600 39.60300 108.89800 1.000 42.72000  ?  185 ASP A N     1 
ATOM   1461 C  CA    . ASP A 1 197 ? 171.78500 38.92300 109.65800 1.000 48.53000  ?  185 ASP A CA    1 
ATOM   1462 C  C     . ASP A 1 197 ? 172.17700 37.46900 109.80800 1.000 46.41000  ?  185 ASP A C     1 
ATOM   1463 O  O     . ASP A 1 197 ? 171.41300 36.64700 110.28900 1.000 45.65000  ?  185 ASP A O     1 
ATOM   1464 C  CB    . ASP A 1 197 ? 170.44100 39.04000 108.94900 1.000 48.34000  ?  185 ASP A CB    1 
ATOM   1465 C  CG    . ASP A 1 197 ? 170.41200 38.26400 107.64800 1.000 49.17000  ?  185 ASP A CG    1 
ATOM   1466 O  OD1   . ASP A 1 197 ? 171.47900 38.12200 106.99300 1.000 46.21000  ?  185 ASP A OD1   1 
ATOM   1467 O  OD2   . ASP A 1 197 ? 169.31900 37.76800 107.30500 1.000 53.82000  ?  185 ASP A OD2   1 
ATOM   1468 N  N     . ASP A 1 198 ? 173.37900 37.16600 109.34600 1.000 43.90000  ?  186 ASP A N     1 
ATOM   1469 C  CA    . ASP A 1 198 ? 173.92600 35.82000 109.37500 1.000 42.29000  ?  186 ASP A CA    1 
ATOM   1470 C  C     . ASP A 1 198 ? 174.63500 35.53500 110.70300 1.000 43.76000  ?  186 ASP A C     1 
ATOM   1471 O  O     . ASP A 1 198 ? 175.47100 36.32000 111.14300 1.000 43.54000  ?  186 ASP A O     1 
ATOM   1472 C  CB    . ASP A 1 198 ? 174.89100 35.68100 108.21900 1.000 49.01000  ?  186 ASP A CB    1 
ATOM   1473 C  CG    . ASP A 1 198 ? 175.16600 34.26800 107.85600 1.000 55.13000  ?  186 ASP A CG    1 
ATOM   1474 O  OD1   . ASP A 1 198 ? 174.31900 33.40100 108.15500 1.000 58.44000  ?  186 ASP A OD1   1 
ATOM   1475 O  OD2   . ASP A 1 198 ? 176.22600 34.04400 107.22900 1.000 59.15000  ?  186 ASP A OD2   1 
ATOM   1476 N  N     . LEU A 1 199 ? 174.29800 34.43900 111.36200 1.000 44.55000  ?  187 LEU A N     1 
ATOM   1477 C  CA    . LEU A 1 199 ? 174.98000 34.12000 112.60500 1.000 43.80000  ?  187 LEU A CA    1 
ATOM   1478 C  C     . LEU A 1 199 ? 175.66500 32.72800 112.59800 1.000 45.53000  ?  187 LEU A C     1 
ATOM   1479 O  O     . LEU A 1 199 ? 175.01600 31.68300 112.44600 1.000 46.50000  ?  187 LEU A O     1 
ATOM   1480 C  CB    . LEU A 1 199 ? 174.00300 34.23200 113.78600 1.000 37.59000  ?  187 LEU A CB    1 
ATOM   1481 C  CG    . LEU A 1 199 ? 173.23400 35.55800 113.87200 1.000 41.03000  ?  187 LEU A CG    1 
ATOM   1482 C  CD1   . LEU A 1 199 ? 172.28500 35.58300 115.06800 1.000 36.92000  ?  187 LEU A CD1   1 
ATOM   1483 C  CD2   . LEU A 1 199 ? 174.15300 36.74300 113.94800 1.000 39.32000  ?  187 LEU A CD2   1 
ATOM   1484 N  N     . TYR A 1 200 ? 176.98700 32.73800 112.75500 1.000 42.45000  ?  188 TYR A N     1 
ATOM   1485 C  CA    . TYR A 1 200 ? 177.73800 31.54500 113.14900 1.000 43.78000  ?  188 TYR A CA    1 
ATOM   1486 C  C     . TYR A 1 200 ? 177.77100 31.46900 114.67300 1.000 41.05000  ?  188 TYR A C     1 
ATOM   1487 O  O     . TYR A 1 200 ? 178.21400 32.39500 115.34100 1.000 41.36000  ?  188 TYR A O     1 
ATOM   1488 C  CB    . TYR A 1 200 ? 179.14800 31.60000 112.57100 1.000 41.45000  ?  188 TYR A CB    1 
ATOM   1489 C  CG    . TYR A 1 200 ? 180.10100 30.52400 113.04800 1.000 44.74000  ?  188 TYR A CG    1 
ATOM   1490 C  CD1   . TYR A 1 200 ? 180.69800 30.58800 114.30500 1.000 41.20000  ?  188 TYR A CD1   1 
ATOM   1491 C  CD2   . TYR A 1 200 ? 180.45800 29.47400 112.20500 1.000 43.05000  ?  188 TYR A CD2   1 
ATOM   1492 C  CE1   . TYR A 1 200 ? 181.59400 29.62300 114.71300 1.000 42.97000  ?  188 TYR A CE1   1 
ATOM   1493 C  CE2   . TYR A 1 200 ? 181.34300 28.51300 112.60100 1.000 43.10000  ?  188 TYR A CE2   1 
ATOM   1494 C  CZ    . TYR A 1 200 ? 181.91700 28.58400 113.85800 1.000 49.13000  ?  188 TYR A CZ    1 
ATOM   1495 O  OH    . TYR A 1 200 ? 182.81200 27.60000 114.25300 1.000 53.38000  ?  188 TYR A OH    1 
ATOM   1496 N  N     . VAL A 1 201 ? 177.27900 30.38300 115.23700 1.000 45.00000  ?  189 VAL A N     1 
ATOM   1497 C  CA    . VAL A 1 201 ? 177.27200 30.26400 116.68600 1.000 41.83000  ?  189 VAL A CA    1 
ATOM   1498 C  C     . VAL A 1 201 ? 178.03900 29.03600 117.12500 1.000 47.31000  ?  189 VAL A C     1 
ATOM   1499 O  O     . VAL A 1 201 ? 177.68700 27.92400 116.73500 1.000 45.67000  ?  189 VAL A O     1 
ATOM   1500 C  CB    . VAL A 1 201 ? 175.87200 30.17000 117.23300 1.000 40.34000  ?  189 VAL A CB    1 
ATOM   1501 C  CG1   . VAL A 1 201 ? 175.92300 30.12200 118.73000 1.000 44.01000  ?  189 VAL A CG1   1 
ATOM   1502 C  CG2   . VAL A 1 201 ? 175.06700 31.35200 116.80200 1.000 43.23000  ?  189 VAL A CG2   1 
ATOM   1503 N  N     . GLY A 1 202 ? 179.08400 29.23200 117.92900 1.000 47.01000  ?  190 GLY A N     1 
ATOM   1504 C  CA    . GLY A 1 202 ? 179.95200 28.13100 118.31900 1.000 46.16000  ?  190 GLY A CA    1 
ATOM   1505 C  C     . GLY A 1 202 ? 180.13900 28.01400 119.81800 1.000 47.71000  ?  190 GLY A C     1 
ATOM   1506 O  O     . GLY A 1 202 ? 180.13300 29.00300 120.54900 1.000 48.02000  ?  190 GLY A O     1 
ATOM   1507 N  N     . SER A 1 203 ? 180.30200 26.79500 120.29600 1.000 48.10000  ?  191 SER A N     1 
ATOM   1508 C  CA    . SER A 1 203 ? 180.40900 26.60700 121.73000 1.000 48.63000  ?  191 SER A CA    1 
ATOM   1509 C  C     . SER A 1 203 ? 181.21500 25.37400 122.02900 1.000 51.62000  ?  191 SER A C     1 
ATOM   1510 O  O     . SER A 1 203 ? 181.49700 24.58700 121.12400 1.000 54.19000  ?  191 SER A O     1 
ATOM   1511 C  CB    . SER A 1 203 ? 179.03500 26.48100 122.37500 1.000 44.12000  ?  191 SER A CB    1 
ATOM   1512 O  OG    . SER A 1 203 ? 178.47100 25.21000 122.09800 1.000 44.25000  ?  191 SER A OG    1 
ATOM   1513 N  N     . ASP A 1 204 ? 181.56400 25.20400 123.30100 1.000 45.65000  ?  192 ASP A N     1 
ATOM   1514 C  CA    . ASP A 1 204 ? 182.27400 24.01700 123.73400 1.000 51.24000  ?  192 ASP A CA    1 
ATOM   1515 C  C     . ASP A 1 204 ? 181.41900 23.12600 124.61700 1.000 50.84000  ?  192 ASP A C     1 
ATOM   1516 O  O     . ASP A 1 204 ? 181.94000 22.39800 125.45300 1.000 52.40000  ?  192 ASP A O     1 
ATOM   1517 C  CB    . ASP A 1 204 ? 183.54500 24.41300 124.45800 1.000 47.40000  ?  192 ASP A CB    1 
ATOM   1518 C  CG    . ASP A 1 204 ? 184.60100 24.92200 123.50800 1.000 56.91000  ?  192 ASP A CG    1 
ATOM   1519 O  OD1   . ASP A 1 204 ? 185.09800 24.11900 122.66800 1.000 55.05000  ?  192 ASP A OD1   1 
ATOM   1520 O  OD2   . ASP A 1 204 ? 184.92900 26.12400 123.60400 1.000 63.28000  ?  192 ASP A OD2   1 
ATOM   1521 N  N     . LEU A 1 205 ? 180.10800 23.19600 124.41200 1.000 46.84000  ?  193 LEU A N     1 
ATOM   1522 C  CA    . LEU A 1 205 ? 179.13700 22.39300 125.13700 1.000 47.97000  ?  193 LEU A CA    1 
ATOM   1523 C  C     . LEU A 1 205 ? 178.90100 21.08700 124.40100 1.000 50.86000  ?  193 LEU A C     1 
ATOM   1524 O  O     . LEU A 1 205 ? 179.22600 20.98500 123.22900 1.000 46.34000  ?  193 LEU A O     1 
ATOM   1525 C  CB    . LEU A 1 205 ? 177.82500 23.17800 125.28300 1.000 48.02000  ?  193 LEU A CB    1 
ATOM   1526 C  CG    . LEU A 1 205 ? 178.07800 24.56100 125.88700 1.000 46.90000  ?  193 LEU A CG    1 
ATOM   1527 C  CD1   . LEU A 1 205 ? 176.88800 25.47500 125.75500 1.000 40.79000  ?  193 LEU A CD1   1 
ATOM   1528 C  CD2   . LEU A 1 205 ? 178.51300 24.42700 127.36200 1.000 47.36000  ?  193 LEU A CD2   1 
ATOM   1529 N  N     . GLU A 1 206 ? 178.34300 20.08300 125.07300 1.000 59.30000  ?  194 GLU A N     1 
ATOM   1530 C  CA    . GLU A 1 206 ? 177.86400 18.90300 124.34100 1.000 59.20000  ?  194 GLU A CA    1 
ATOM   1531 C  C     . GLU A 1 206 ? 176.69900 19.35500 123.47000 1.000 56.91000  ?  194 GLU A C     1 
ATOM   1532 O  O     . GLU A 1 206 ? 176.01900 20.33900 123.79000 1.000 54.52000  ?  194 GLU A O     1 
ATOM   1533 C  CB    . GLU A 1 206 ? 177.42100 17.77300 125.27700 1.000 63.60000  ?  194 GLU A CB    1 
ATOM   1534 C  CG    . GLU A 1 206 ? 178.42600 17.39200 126.37000 1.000 74.37000  ?  194 GLU A CG    1 
ATOM   1535 C  CD    . GLU A 1 206 ? 179.40800 16.28200 125.95700 1.000 83.65000  ?  194 GLU A CD    1 
ATOM   1536 O  OE1   . GLU A 1 206 ? 179.73800 16.17500 124.75200 1.000 82.76000  ?  194 GLU A OE1   1 
ATOM   1537 O  OE2   . GLU A 1 206 ? 179.85200 15.51400 126.84800 1.000 86.40000  ?  194 GLU A OE2   1 
ATOM   1538 N  N     . ILE A 1 207 ? 176.46700 18.63800 122.38000 1.000 55.15000  ?  195 ILE A N     1 
ATOM   1539 C  CA    . ILE A 1 207 ? 175.47400 19.03000 121.38500 1.000 54.36000  ?  195 ILE A CA    1 
ATOM   1540 C  C     . ILE A 1 207 ? 174.08100 19.21200 122.01600 1.000 52.82000  ?  195 ILE A C     1 
ATOM   1541 O  O     . ILE A 1 207 ? 173.31300 20.09000 121.62200 1.000 46.99000  ?  195 ILE A O     1 
ATOM   1542 C  CB    . ILE A 1 207 ? 175.42900 17.99100 120.24400 1.000 53.15000  ?  195 ILE A CB    1 
ATOM   1543 C  CG1   . ILE A 1 207 ? 174.68700 18.54600 119.03700 1.000 57.74000  ?  195 ILE A CG1   1 
ATOM   1544 C  CG2   . ILE A 1 207 ? 174.82900 16.68100 120.73200 1.000 50.06000  ?  195 ILE A CG2   1 
ATOM   1545 C  CD1   . ILE A 1 207 ? 174.14700 17.45700 118.12800 1.000 68.92000  ?  195 ILE A CD1   1 
ATOM   1546 N  N     . GLY A 1 208 ? 173.78000 18.39700 123.01900 1.000 50.74000  ?  196 GLY A N     1 
ATOM   1547 C  CA    . GLY A 1 208 ? 172.59500 18.59600 123.83900 1.000 47.43000  ?  196 GLY A CA    1 
ATOM   1548 C  C     . GLY A 1 208 ? 172.46800 19.97900 124.46000 1.000 48.46000  ?  196 GLY A C     1 
ATOM   1549 O  O     . GLY A 1 208 ? 171.53400 20.70900 124.14400 1.000 55.16000  ?  196 GLY A O     1 
ATOM   1550 N  N     . GLN A 1 209 ? 173.39200 20.34900 125.34700 1.000 53.89000  ?  197 GLN A N     1 
ATOM   1551 C  CA    . GLN A 1 209 ? 173.43600 21.71600 125.89600 1.000 51.76000  ?  197 GLN A CA    1 
ATOM   1552 C  C     . GLN A 1 209 ? 173.57100 22.82200 124.84400 1.000 55.21000  ?  197 GLN A C     1 
ATOM   1553 O  O     . GLN A 1 209 ? 173.03700 23.92400 125.03200 1.000 51.69000  ?  197 GLN A O     1 
ATOM   1554 C  CB    . GLN A 1 209 ? 174.59000 21.86900 126.86500 1.000 45.37000  ?  197 GLN A CB    1 
ATOM   1555 C  CG    . GLN A 1 209 ? 174.27300 21.47500 128.25500 1.000 60.46000  ?  197 GLN A CG    1 
ATOM   1556 C  CD    . GLN A 1 209 ? 175.53200 21.24200 129.04200 1.000 67.76000  ?  197 GLN A CD    1 
ATOM   1557 O  OE1   . GLN A 1 209 ? 176.57200 20.87200 128.46500 1.000 69.85000  ?  197 GLN A OE1   1 
ATOM   1558 N  NE2   . GLN A 1 209 ? 175.46400 21.44800 130.36700 1.000 67.77000  ?  197 GLN A NE2   1 
ATOM   1559 N  N     . HIS A 1 210 ? 174.31300 22.54900 123.76500 1.000 51.16000  ?  198 HIS A N     1 
ATOM   1560 C  CA    . HIS A 1 210 ? 174.49800 23.54700 122.72300 1.000 46.54000  ?  198 HIS A CA    1 
ATOM   1561 C  C     . HIS A 1 210 ? 173.12800 23.88800 122.15100 1.000 46.92000  ?  198 HIS A C     1 
ATOM   1562 O  O     . HIS A 1 210 ? 172.75900 25.06600 122.08200 1.000 45.82000  ?  198 HIS A O     1 
ATOM   1563 C  CB    . HIS A 1 210 ? 175.46600 23.05000 121.63400 1.000 45.51000  ?  198 HIS A CB    1 
ATOM   1564 C  CG    . HIS A 1 210 ? 175.60300 23.98000 120.47000 1.000 42.18000  ?  198 HIS A CG    1 
ATOM   1565 N  ND1   . HIS A 1 210 ? 176.43700 25.08200 120.49100 1.000 42.21000  ?  198 HIS A ND1   1 
ATOM   1566 C  CD2   . HIS A 1 210 ? 175.01700 23.97200 119.24600 1.000 41.05000  ?  198 HIS A CD2   1 
ATOM   1567 C  CE1   . HIS A 1 210 ? 176.35400 25.71100 119.32800 1.000 46.36000  ?  198 HIS A CE1   1 
ATOM   1568 N  NE2   . HIS A 1 210 ? 175.49700 25.05900 118.55400 1.000 42.88000  ?  198 HIS A NE2   1 
ATOM   1569 N  N     . ARG A 1 211 ? 172.35800 22.85200 121.80200 1.000 50.15000  ?  199 ARG A N     1 
ATOM   1570 C  CA    . ARG A 1 211 ? 171.07400 23.04300 121.12300 1.000 50.56000  ?  199 ARG A CA    1 
ATOM   1571 C  C     . ARG A 1 211 ? 170.14700 23.83700 122.01700 1.000 51.00000  ?  199 ARG A C     1 
ATOM   1572 O  O     . ARG A 1 211 ? 169.32300 24.62200 121.56200 1.000 52.49000  ?  199 ARG A O     1 
ATOM   1573 C  CB    . ARG A 1 211 ? 170.45000 21.71000 120.73800 1.000 50.10000  ?  199 ARG A CB    1 
ATOM   1574 C  CG    . ARG A 1 211 ? 171.18100 20.99900 119.58300 1.000 56.63000  ?  199 ARG A CG    1 
ATOM   1575 C  CD    . ARG A 1 211 ? 170.32800 19.83000 119.07400 1.000 66.87000  ?  199 ARG A CD    1 
ATOM   1576 N  NE    . ARG A 1 211 ? 170.87700 19.06700 117.94700 1.000 70.59000  ?  199 ARG A NE    1 
ATOM   1577 C  CZ    . ARG A 1 211 ? 171.50300 19.58400 116.89000 1.000 70.36000  ?  199 ARG A CZ    1 
ATOM   1578 N  NH1   . ARG A 1 211 ? 171.70600 20.89300 116.78700 1.000 67.11000  ?  199 ARG A NH1   1 
ATOM   1579 N  NH2   . ARG A 1 211 ? 171.94900 18.77700 115.93400 1.000 75.17000  ?  199 ARG A NH2   1 
ATOM   1580 N  N     . THR A 1 212 ? 170.32300 23.66400 123.30900 1.000 48.96000  ?  200 THR A N     1 
ATOM   1581 C  CA    . THR A 1 212 ? 169.53400 24.41300 124.25800 1.000 52.46000  ?  200 THR A CA    1 
ATOM   1582 C  C     . THR A 1 212 ? 169.89400 25.90500 124.28600 1.000 53.68000  ?  200 THR A C     1 
ATOM   1583 O  O     . THR A 1 212 ? 169.00500 26.76200 124.39400 1.000 51.08000  ?  200 THR A O     1 
ATOM   1584 C  CB    . THR A 1 212 ? 169.68700 23.80700 125.64300 1.000 50.98000  ?  200 THR A CB    1 
ATOM   1585 O  OG1   . THR A 1 212 ? 168.63100 22.86600 125.82200 1.000 50.84000  ?  200 THR A OG1   1 
ATOM   1586 C  CG2   . THR A 1 212 ? 169.61400 24.88100 126.72200 1.000 51.35000  ?  200 THR A CG2   1 
ATOM   1587 N  N     . LYS A 1 213 ? 171.18700 26.20800 124.18100 1.000 51.02000  ?  201 LYS A N     1 
ATOM   1588 C  CA    . LYS A 1 213 ? 171.64100 27.59200 124.11100 1.000 47.90000  ?  201 LYS A CA    1 
ATOM   1589 C  C     . LYS A 1 213 ? 171.18100 28.23600 122.82000 1.000 47.23000  ?  201 LYS A C     1 
ATOM   1590 O  O     . LYS A 1 213 ? 170.86300 29.41500 122.79700 1.000 44.95000  ?  201 LYS A O     1 
ATOM   1591 C  CB    . LYS A 1 213 ? 173.15900 27.67300 124.22800 1.000 43.66000  ?  201 LYS A CB    1 
ATOM   1592 C  CG    . LYS A 1 213 ? 173.62900 27.74300 125.68100 1.000 53.57000  ?  201 LYS A CG    1 
ATOM   1593 C  CD    . LYS A 1 213 ? 173.42800 29.15200 126.25000 1.000 49.66000  ?  201 LYS A CD    1 
ATOM   1594 C  CE    . LYS A 1 213 ? 173.00900 29.10400 127.69900 1.000 47.69000  ?  201 LYS A CE    1 
ATOM   1595 N  NZ    . LYS A 1 213 ? 173.74200 28.00400 128.35100 1.000 50.59000  ?  201 LYS A NZ    1 
ATOM   1596 N  N     . ILE A 1 214 ? 171.14800 27.45600 121.74500 1.000 44.53000  ?  202 ILE A N     1 
ATOM   1597 C  CA    . ILE A 1 214 ? 170.66300 27.96800 120.48500 1.000 45.77000  ?  202 ILE A CA    1 
ATOM   1598 C  C     . ILE A 1 214 ? 169.20700 28.39000 120.61300 1.000 47.24000  ?  202 ILE A C     1 
ATOM   1599 O  O     . ILE A 1 214 ? 168.82500 29.46400 120.14100 1.000 45.79000  ?  202 ILE A O     1 
ATOM   1600 C  CB    . ILE A 1 214 ? 170.78600 26.94400 119.35000 1.000 48.48000  ?  202 ILE A CB    1 
ATOM   1601 C  CG1   . ILE A 1 214 ? 172.25500 26.67500 119.05300 1.000 44.06000  ?  202 ILE A CG1   1 
ATOM   1602 C  CG2   . ILE A 1 214 ? 170.09200 27.47300 118.10500 1.000 40.75000  ?  202 ILE A CG2   1 
ATOM   1603 C  CD1   . ILE A 1 214 ? 173.04100 27.93800 118.72900 1.000 45.07000  ?  202 ILE A CD1   1 
ATOM   1604 N  N     . GLU A 1 215 ? 168.40100 27.55700 121.26600 1.000 46.24000  ?  203 GLU A N     1 
ATOM   1605 C  CA    . GLU A 1 215 ? 166.99900 27.88400 121.45400 1.000 46.17000  ?  203 GLU A CA    1 
ATOM   1606 C  C     . GLU A 1 215 ? 166.82900 29.18300 122.23600 1.000 45.28000  ?  203 GLU A C     1 
ATOM   1607 O  O     . GLU A 1 215 ? 165.95300 29.98400 121.92600 1.000 48.45000  ?  203 GLU A O     1 
ATOM   1608 C  CB    . GLU A 1 215 ? 166.27600 26.74100 122.14600 1.000 47.26000  ?  203 GLU A CB    1 
ATOM   1609 C  CG    . GLU A 1 215 ? 165.85500 25.67500 121.17800 1.000 50.94000  ?  203 GLU A CG    1 
ATOM   1610 C  CD    . GLU A 1 215 ? 165.14900 26.26900 119.97900 1.000 59.15000  ?  203 GLU A CD    1 
ATOM   1611 O  OE1   . GLU A 1 215 ? 164.09900 26.94100 120.18100 1.000 63.26000  ?  203 GLU A OE1   1 
ATOM   1612 O  OE2   . GLU A 1 215 ? 165.66000 26.08300 118.84600 1.000 55.50000  ?  203 GLU A OE2   1 
ATOM   1613 N  N     . GLU A 1 216 ? 167.68500 29.38400 123.23200 1.000 42.08000  ?  204 GLU A N     1 
ATOM   1614 C  CA    . GLU A 1 216 ? 167.66200 30.57900 124.05700 1.000 43.49000  ?  204 GLU A CA    1 
ATOM   1615 C  C     . GLU A 1 216 ? 168.03700 31.80600 123.22900 1.000 49.29000  ?  204 GLU A C     1 
ATOM   1616 O  O     . GLU A 1 216 ? 167.41100 32.86900 123.37400 1.000 51.57000  ?  204 GLU A O     1 
ATOM   1617 C  CB    . GLU A 1 216 ? 168.59900 30.40500 125.25500 1.000 46.80000  ?  204 GLU A CB    1 
ATOM   1618 C  CG    . GLU A 1 216 ? 168.65000 31.57300 126.24200 1.000 53.12000  ?  204 GLU A CG    1 
ATOM   1619 C  CD    . GLU A 1 216 ? 169.74000 31.37800 127.31000 1.000 66.01000  ?  204 GLU A CD    1 
ATOM   1620 O  OE1   . GLU A 1 216 ? 169.92600 30.20300 127.75900 1.000 63.39000  ?  204 GLU A OE1   1 
ATOM   1621 O  OE2   . GLU A 1 216 ? 170.41600 32.38800 127.67600 1.000 61.45000  ?  204 GLU A OE2   1 
ATOM   1622 N  N     . LEU A 1 217 ? 169.03200 31.65800 122.34100 1.000 49.58000  ?  205 LEU A N     1 
ATOM   1623 C  CA    . LEU A 1 217 ? 169.39200 32.72400 121.39900 1.000 45.55000  ?  205 LEU A CA    1 
ATOM   1624 C  C     . LEU A 1 217 ? 168.24700 32.98500 120.43400 1.000 44.80000  ?  205 LEU A C     1 
ATOM   1625 O  O     . LEU A 1 217 ? 167.94600 34.12600 120.12900 1.000 47.66000  ?  205 LEU A O     1 
ATOM   1626 C  CB    . LEU A 1 217 ? 170.66400 32.38600 120.61300 1.000 47.37000  ?  205 LEU A CB    1 
ATOM   1627 C  CG    . LEU A 1 217 ? 171.08900 33.34100 119.47600 1.000 45.97000  ?  205 LEU A CG    1 
ATOM   1628 C  CD1   . LEU A 1 217 ? 171.37800 34.73900 119.96700 1.000 38.46000  ?  205 LEU A CD1   1 
ATOM   1629 C  CD2   . LEU A 1 217 ? 172.30200 32.80800 118.71200 1.000 46.39000  ?  205 LEU A CD2   1 
ATOM   1630 N  N     . ARG A 1 218 ? 167.60900 31.92700 119.95100 1.000 46.54000  ?  206 ARG A N     1 
ATOM   1631 C  CA    . ARG A 1 218 ? 166.53300 32.08700 118.98400 1.000 41.87000  ?  206 ARG A CA    1 
ATOM   1632 C  C     . ARG A 1 218 ? 165.35300 32.80000 119.64400 1.000 48.60000  ?  206 ARG A C     1 
ATOM   1633 O  O     . ARG A 1 218 ? 164.78000 33.72600 119.06100 1.000 49.10000  ?  206 ARG A O     1 
ATOM   1634 C  CB    . ARG A 1 218 ? 166.11800 30.73700 118.40200 1.000 44.67000  ?  206 ARG A CB    1 
ATOM   1635 C  CG    . ARG A 1 218 ? 167.09400 30.18900 117.34000 1.000 42.01000  ?  206 ARG A CG    1 
ATOM   1636 C  CD    . ARG A 1 218 ? 166.51800 28.99700 116.61200 1.000 38.47000  ?  206 ARG A CD    1 
ATOM   1637 N  NE    . ARG A 1 218 ? 165.22300 29.35400 116.04900 1.000 46.55000  ?  206 ARG A NE    1 
ATOM   1638 C  CZ    . ARG A 1 218 ? 164.06400 28.82000 116.42400 1.000 51.05000  ?  206 ARG A CZ    1 
ATOM   1639 N  NH1   . ARG A 1 218 ? 164.03700 27.87000 117.35100 1.000 47.90000  ?  206 ARG A NH1   1 
ATOM   1640 N  NH2   . ARG A 1 218 ? 162.92700 29.22300 115.86100 1.000 55.00000  ?  206 ARG A NH2   1 
ATOM   1641 N  N     . GLN A 1 219 ? 165.00600 32.40000 120.86600 1.000 46.29000  ?  207 GLN A N     1 
ATOM   1642 C  CA    . GLN A 1 219 ? 163.96100 33.09900 121.60400 1.000 47.68000  ?  207 GLN A CA    1 
ATOM   1643 C  C     . GLN A 1 219 ? 164.36300 34.54300 121.84200 1.000 53.66000  ?  207 GLN A C     1 
ATOM   1644 O  O     . GLN A 1 219 ? 163.51600 35.45700 121.77100 1.000 52.10000  ?  207 GLN A O     1 
ATOM   1645 C  CB    . GLN A 1 219 ? 163.66600 32.43300 122.94700 1.000 48.79000  ?  207 GLN A CB    1 
ATOM   1646 C  CG    . GLN A 1 219 ? 162.72100 31.26600 122.85900 1.000 51.14000  ?  207 GLN A CG    1 
ATOM   1647 C  CD    . GLN A 1 219 ? 161.44600 31.63200 122.13500 1.000 61.53000  ?  207 GLN A CD    1 
ATOM   1648 O  OE1   . GLN A 1 219 ? 160.70000 32.51300 122.57900 1.000 63.12000  ?  207 GLN A OE1   1 
ATOM   1649 N  NE2   . GLN A 1 219 ? 161.19100 30.97000 121.00300 1.000 59.15000  ?  207 GLN A NE2   1 
ATOM   1650 N  N     . HIS A 1 220 ? 165.64900 34.75700 122.13700 1.000 49.46000  ?  208 HIS A N     1 
ATOM   1651 C  CA    . HIS A 1 220 ? 166.10900 36.10800 122.41100 1.000 46.15000  ?  208 HIS A CA    1 
ATOM   1652 C  C     . HIS A 1 220 ? 165.90200 36.98500 121.18400 1.000 46.20000  ?  208 HIS A C     1 
ATOM   1653 O  O     . HIS A 1 220 ? 165.39800 38.09300 121.28900 1.000 47.23000  ?  208 HIS A O     1 
ATOM   1654 C  CB    . HIS A 1 220 ? 167.57100 36.12900 122.84400 1.000 46.72000  ?  208 HIS A CB    1 
ATOM   1655 C  CG    . HIS A 1 220 ? 168.08500 37.50800 123.12900 1.000 50.98000  ?  208 HIS A CG    1 
ATOM   1656 N  ND1   . HIS A 1 220 ? 167.95100 38.11200 124.36100 1.000 51.42000  ?  208 HIS A ND1   1 
ATOM   1657 C  CD2   . HIS A 1 220 ? 168.70600 38.41200 122.33400 1.000 52.69000  ?  208 HIS A CD2   1 
ATOM   1658 C  CE1   . HIS A 1 220 ? 168.47800 39.32400 124.31800 1.000 51.05000  ?  208 HIS A CE1   1 
ATOM   1659 N  NE2   . HIS A 1 220 ? 168.94000 39.53300 123.09900 1.000 56.28000  ?  208 HIS A NE2   1 
ATOM   1660 N  N     . LEU A 1 221 ? 166.28300 36.47700 120.01700 1.000 47.27000  ?  209 LEU A N     1 
ATOM   1661 C  CA    . LEU A 1 221 ? 166.09200 37.20600 118.77300 1.000 47.07000  ?  209 LEU A CA    1 
ATOM   1662 C  C     . LEU A 1 221 ? 164.60600 37.40700 118.48400 1.000 45.38000  ?  209 LEU A C     1 
ATOM   1663 O  O     . LEU A 1 221 ? 164.20600 38.46400 118.02900 1.000 50.73000  ?  209 LEU A O     1 
ATOM   1664 C  CB    . LEU A 1 221 ? 166.76700 36.47500 117.61000 1.000 41.96000  ?  209 LEU A CB    1 
ATOM   1665 C  CG    . LEU A 1 221 ? 168.29200 36.47200 117.60200 1.000 45.45000  ?  209 LEU A CG    1 
ATOM   1666 C  CD1   . LEU A 1 221 ? 168.83300 35.47300 116.58400 1.000 40.81000  ?  209 LEU A CD1   1 
ATOM   1667 C  CD2   . LEU A 1 221 ? 168.82800 37.88800 117.32800 1.000 41.78000  ?  209 LEU A CD2   1 
ATOM   1668 N  N     . LEU A 1 222 ? 163.79400 36.39000 118.73200 1.000 44.12000  ?  210 LEU A N     1 
ATOM   1669 C  CA    . LEU A 1 222 ? 162.35700 36.49200 118.49000 1.000 46.69000  ?  210 LEU A CA    1 
ATOM   1670 C  C     . LEU A 1 222 ? 161.69400 37.52600 119.41600 1.000 48.53000  ?  210 LEU A C     1 
ATOM   1671 O  O     . LEU A 1 222 ? 160.75500 38.19700 119.02100 1.000 42.63000  ?  210 LEU A O     1 
ATOM   1672 C  CB    . LEU A 1 222 ? 161.69300 35.12600 118.66000 1.000 49.23000  ?  210 LEU A CB    1 
ATOM   1673 C  CG    . LEU A 1 222 ? 160.20400 34.92400 118.34700 1.000 49.25000  ?  210 LEU A CG    1 
ATOM   1674 C  CD1   . LEU A 1 222 ? 159.89700 35.25600 116.89900 1.000 45.34000  ?  210 LEU A CD1   1 
ATOM   1675 C  CD2   . LEU A 1 222 ? 159.80600 33.48800 118.65200 1.000 48.64000  ?  210 LEU A CD2   1 
ATOM   1676 N  N     . ARG A 1 223 ? 162.20000 37.68800 120.63400 1.000 50.35000  ?  211 ARG A N     1 
ATOM   1677 C  CA    . ARG A 1 223 ? 161.63500 38.70600 121.51600 1.000 43.86000  ?  211 ARG A CA    1 
ATOM   1678 C  C     . ARG A 1 223 ? 161.87400 40.10400 120.91000 1.000 44.49000  ?  211 ARG A C     1 
ATOM   1679 O  O     . ARG A 1 223 ? 161.01400 40.97600 121.03500 1.000 47.20000  ?  211 ARG A O     1 
ATOM   1680 C  CB    . ARG A 1 223 ? 162.18600 38.52800 122.95300 1.000 43.81000  ?  211 ARG A CB    1 
ATOM   1681 C  CG    . ARG A 1 223 ? 163.03400 39.62900 123.57900 1.000 48.78000  ?  211 ARG A CG    1 
ATOM   1682 C  CD    . ARG A 1 223 ? 162.31100 40.91200 123.51800 1.000 50.56000  ?  211 ARG A CD    1 
ATOM   1683 N  NE    . ARG A 1 223 ? 162.57600 41.85400 124.57600 1.000 47.82000  ?  211 ARG A NE    1 
ATOM   1684 C  CZ    . ARG A 1 223 ? 162.01500 43.05800 124.59400 1.000 53.96000  ?  211 ARG A CZ    1 
ATOM   1685 N  NH1   . ARG A 1 223 ? 161.20800 43.42100 123.59600 1.000 53.71000  ?  211 ARG A NH1   1 
ATOM   1686 N  NH2   . ARG A 1 223 ? 162.25500 43.89900 125.59000 1.000 61.93000  ?  211 ARG A NH2   1 
ATOM   1687 N  N     . TRP A 1 224 ? 163.00700 40.30000 120.22300 1.000 49.66000  ?  212 TRP A N     1 
ATOM   1688 C  CA    . TRP A 1 224 ? 163.29800 41.56600 119.51100 1.000 47.67000  ?  212 TRP A CA    1 
ATOM   1689 C  C     . TRP A 1 224 ? 162.80300 41.59000 118.07000 1.000 48.37000  ?  212 TRP A C     1 
ATOM   1690 O  O     . TRP A 1 224 ? 163.21100 42.45600 117.31300 1.000 45.95000  ?  212 TRP A O     1 
ATOM   1691 C  CB    . TRP A 1 224 ? 164.81200 41.89300 119.51800 1.000 44.61000  ?  212 TRP A CB    1 
ATOM   1692 C  CG    . TRP A 1 224 ? 165.24900 42.26200 120.88300 1.000 49.99000  ?  212 TRP A CG    1 
ATOM   1693 C  CD1   . TRP A 1 224 ? 165.90900 41.46800 121.76900 1.000 50.49000  ?  212 TRP A CD1   1 
ATOM   1694 C  CD2   . TRP A 1 224 ? 164.97600 43.49300 121.57000 1.000 48.23000  ?  212 TRP A CD2   1 
ATOM   1695 N  NE1   . TRP A 1 224 ? 166.09200 42.13900 122.95300 1.000 56.27000  ?  212 TRP A NE1   1 
ATOM   1696 C  CE2   . TRP A 1 224 ? 165.51700 43.37600 122.86100 1.000 48.22000  ?  212 TRP A CE2   1 
ATOM   1697 C  CE3   . TRP A 1 224 ? 164.33100 44.67700 121.21400 1.000 46.18000  ?  212 TRP A CE3   1 
ATOM   1698 C  CZ2   . TRP A 1 224 ? 165.43300 44.39700 123.79500 1.000 41.63000  ?  212 TRP A CZ2   1 
ATOM   1699 C  CZ3   . TRP A 1 224 ? 164.25500 45.68400 122.13200 1.000 45.93000  ?  212 TRP A CZ3   1 
ATOM   1700 C  CH2   . TRP A 1 224 ? 164.80600 45.54200 123.41600 1.000 43.81000  ?  212 TRP A CH2   1 
ATOM   1701 N  N     . GLY A 1 225 ? 161.92300 40.65500 117.70400 1.000 49.57000  ?  213 GLY A N     1 
ATOM   1702 C  CA    . GLY A 1 225 ? 161.26300 40.66800 116.40800 1.000 49.20000  ?  213 GLY A CA    1 
ATOM   1703 C  C     . GLY A 1 225 ? 162.03300 40.04100 115.24900 1.000 50.72000  ?  213 GLY A C     1 
ATOM   1704 O  O     . GLY A 1 225 ? 161.64100 40.16900 114.08900 1.000 51.97000  ?  213 GLY A O     1 
ATOM   1705 N  N     . LEU A 1 226 ? 163.12800 39.35600 115.55000 1.000 47.41000  ?  214 LEU A N     1 
ATOM   1706 C  CA    . LEU A 1 226 ? 163.90000 38.72500 114.50300 1.000 40.68000  ?  214 LEU A CA    1 
ATOM   1707 C  C     . LEU A 1 226 ? 163.71100 37.22100 114.50800 1.000 43.22000  ?  214 LEU A C     1 
ATOM   1708 O  O     . LEU A 1 226 ? 164.09500 36.53500 115.45200 1.000 49.75000  ?  214 LEU A O     1 
ATOM   1709 C  CB    . LEU A 1 226 ? 165.36700 39.07500 114.64900 1.000 49.52000  ?  214 LEU A CB    1 
ATOM   1710 C  CG    . LEU A 1 226 ? 165.67400 40.56700 114.58200 1.000 46.70000  ?  214 LEU A CG    1 
ATOM   1711 C  CD1   . LEU A 1 226 ? 167.13700 40.77900 114.80500 1.000 43.91000  ?  214 LEU A CD1   1 
ATOM   1712 C  CD2   . LEU A 1 226 ? 165.27300 41.13600 113.26000 1.000 43.98000  ?  214 LEU A CD2   1 
ATOM   1713 N  N     . THR A 1 227 ? 163.11200 36.71900 113.43500 1.000 42.85000  ?  215 THR A N     1 
ATOM   1714 C  CA    . THR A 1 227 ? 162.84100 35.29900 113.26700 1.000 43.28000  ?  215 THR A CA    1 
ATOM   1715 C  C     . THR A 1 227 ? 164.02800 34.53800 112.68200 1.000 48.56000  ?  215 THR A C     1 
ATOM   1716 O  O     . THR A 1 227 ? 164.86500 35.07800 111.92900 1.000 47.98000  ?  215 THR A O     1 
ATOM   1717 C  CB    . THR A 1 227 ? 161.63000 35.05200 112.33100 1.000 44.73000  ?  215 THR A CB    1 
ATOM   1718 O  OG1   . THR A 1 227 ? 161.97200 35.45600 110.99700 1.000 44.60000  ?  215 THR A OG1   1 
ATOM   1719 C  CG2   . THR A 1 227 ? 160.40600 35.82000 112.80300 1.000 41.99000  ?  215 THR A CG2   1 
ATOM   1720 N  N     . THR A 1 228 ? 164.08300 33.26000 113.01400 1.000 43.21000  ?  216 THR A N     1 
ATOM   1721 C  CA    . THR A 1 228 ? 165.11100 32.42700 112.45900 1.000 45.91000  ?  216 THR A CA    1 
ATOM   1722 C  C     . THR A 1 228 ? 164.47200 31.15500 111.96100 1.000 44.05000  ?  216 THR A C     1 
ATOM   1723 O  O     . THR A 1 228 ? 164.26900 30.21800 112.72100 1.000 49.24000  ?  216 THR A O     1 
ATOM   1724 C  CB    . THR A 1 228 ? 166.22700 32.13200 113.48800 1.000 46.97000  ?  216 THR A CB    1 
ATOM   1725 O  OG1   . THR A 1 228 ? 165.65000 31.62000 114.68800 1.000 44.18000  ?  216 THR A OG1   1 
ATOM   1726 C  CG2   . THR A 1 228 ? 166.99400 33.40400 113.79600 1.000 42.09000  ?  216 THR A CG2   1 
ATOM   1727 N  N     . PRO A 1 229 ? 164.14500 31.13100 110.66200 1.000 48.72000  ?  217 PRO A N     1 
ATOM   1728 C  CA    . PRO A 1 229 ? 163.43000 30.03100 110.02000 1.000 47.61000  ?  217 PRO A CA    1 
ATOM   1729 C  C     . PRO A 1 229 ? 164.26000 28.77100 110.04400 1.000 51.58000  ?  217 PRO A C     1 
ATOM   1730 O  O     . PRO A 1 229 ? 165.45900 28.83500 109.76800 1.000 52.04000  ?  217 PRO A O     1 
ATOM   1731 C  CB    . PRO A 1 229 ? 163.24100 30.52400 108.58900 1.000 43.77000  ?  217 PRO A CB    1 
ATOM   1732 C  CG    . PRO A 1 229 ? 163.42200 32.00000 108.66500 1.000 45.20000  ?  217 PRO A CG    1 
ATOM   1733 C  CD    . PRO A 1 229 ? 164.46900 32.18900 109.69500 1.000 45.19000  ?  217 PRO A CD    1 
ATOM   1734 N  N     . ASP A 1 230 ? 163.63400 27.64500 110.37600 1.000 54.03000  ?  218 ASP A N     1 
ATOM   1735 C  CA    . ASP A 1 230 ? 164.35700 26.39000 110.43000 1.000 53.75000  ?  218 ASP A CA    1 
ATOM   1736 C  C     . ASP A 1 230 ? 165.02400 26.08400 109.09100 1.000 51.30000  ?  218 ASP A C     1 
ATOM   1737 O  O     . ASP A 1 230 ? 166.07100 25.45000 109.05200 1.000 54.17000  ?  218 ASP A O     1 
ATOM   1738 C  CB    . ASP A 1 230 ? 163.43800 25.24100 110.83900 1.000 48.88000  ?  218 ASP A CB    1 
ATOM   1739 C  CG    . ASP A 1 230 ? 164.20300 23.94700 111.03000 1.000 57.53000  ?  218 ASP A CG    1 
ATOM   1740 O  OD1   . ASP A 1 230 ? 165.21400 23.96300 111.78400 1.000 58.73000  ?  218 ASP A OD1   1 
ATOM   1741 O  OD2   . ASP A 1 230 ? 163.83000 22.92700 110.40200 1.000 56.25000  ?  218 ASP A OD2   1 
ATOM   1742 N  N     . LYS A 1 231 ? 164.42400 26.56500 108.00700 1.000 52.31000  ?  219 LYS A N     1 
ATOM   1743 C  CA    . LYS A 1 231 ? 164.94400 26.37400 106.66200 1.000 46.82000  ?  219 LYS A CA    1 
ATOM   1744 C  C     . LYS A 1 231 ? 166.38600 26.87500 106.51700 1.000 53.50000  ?  219 LYS A C     1 
ATOM   1745 O  O     . LYS A 1 231 ? 167.17600 26.31500 105.75600 1.000 55.75000  ?  219 LYS A O     1 
ATOM   1746 C  CB    . LYS A 1 231 ? 164.03400 27.08100 105.65600 1.000 49.38000  ?  219 LYS A CB    1 
ATOM   1747 C  CG    . LYS A 1 231 ? 164.38600 26.87200 104.18000 1.000 62.32000  ?  219 LYS A CG    1 
ATOM   1748 C  CD    . LYS A 1 231 ? 163.64600 27.90800 103.31200 1.000 72.76000  ?  219 LYS A CD    1 
ATOM   1749 C  CE    . LYS A 1 231 ? 163.73900 27.62100 101.80800 1.000 83.81000  ?  219 LYS A CE    1 
ATOM   1750 N  NZ    . LYS A 1 231 ? 162.89300 28.56900 101.00800 1.000 84.20000  ?  219 LYS A NZ    1 
ATOM   1751 N  N     . LYS A 1 232 ? 166.74700 27.93500 107.22600 1.000 50.56000  ?  220 LYS A N     1 
ATOM   1752 C  CA    . LYS A 1 232 ? 168.11300 28.43200 107.09600 1.000 48.06000  ?  220 LYS A CA    1 
ATOM   1753 C  C     . LYS A 1 232 ? 168.91900 28.21400 108.38200 1.000 46.66000  ?  220 LYS A C     1 
ATOM   1754 O  O     . LYS A 1 232 ? 169.88200 28.91200 108.67700 1.000 45.86000  ?  220 LYS A O     1 
ATOM   1755 C  CB    . LYS A 1 232 ? 168.10000 29.89400 106.68500 1.000 47.15000  ?  220 LYS A CB    1 
ATOM   1756 C  CG    . LYS A 1 232 ? 168.70000 30.07100 105.30800 1.000 57.95000  ?  220 LYS A CG    1 
ATOM   1757 C  CD    . LYS A 1 232 ? 168.72600 31.51300 104.87100 1.000 60.86000  ?  220 LYS A CD    1 
ATOM   1758 C  CE    . LYS A 1 232 ? 167.43200 31.87900 104.17100 1.000 58.82000  ?  220 LYS A CE    1 
ATOM   1759 N  NZ    . LYS A 1 232 ? 167.61700 33.23000 103.57000 1.000 61.07000  ?  220 LYS A NZ    1 
ATOM   1760 N  N     . HIS A 1 233 ? 168.51800 27.18400 109.11100 1.000 49.17000  ?  221 HIS A N     1 
ATOM   1761 C  CA    . HIS A 1 233 ? 169.08000 26.83500 110.39600 1.000 49.81000  ?  221 HIS A CA    1 
ATOM   1762 C  C     . HIS A 1 233 ? 169.91100 25.57000 110.21500 1.000 49.48000  ?  221 HIS A C     1 
ATOM   1763 O  O     . HIS A 1 233 ? 169.39200 24.46800 110.27500 1.000 51.46000  ?  221 HIS A O     1 
ATOM   1764 C  CB    . HIS A 1 233 ? 167.93000 26.66800 111.39200 1.000 48.80000  ?  221 HIS A CB    1 
ATOM   1765 C  CG    . HIS A 1 233 ? 168.33700 26.31900 112.78800 1.000 49.26000  ?  221 HIS A CG    1 
ATOM   1766 N  ND1   . HIS A 1 233 ? 169.55400 25.77000 113.10800 1.000 54.64000  ?  221 HIS A ND1   1 
ATOM   1767 C  CD2   . HIS A 1 233 ? 167.64300 26.39800 113.94800 1.000 52.61000  ?  221 HIS A CD2   1 
ATOM   1768 C  CE1   . HIS A 1 233 ? 169.60700 25.54200 114.41100 1.000 49.32000  ?  221 HIS A CE1   1 
ATOM   1769 N  NE2   . HIS A 1 233 ? 168.46200 25.91900 114.94200 1.000 48.44000  ?  221 HIS A NE2   1 
ATOM   1770 N  N     . GLN A 1 234 ? 171.20300 25.73300 109.95800 1.000 49.63000  ?  222 GLN A N     1 
ATOM   1771 C  CA    . GLN A 1 234 ? 172.06100 24.57800 109.71000 1.000 46.99000  ?  222 GLN A CA    1 
ATOM   1772 C  C     . GLN A 1 234 ? 172.53200 23.96400 111.01200 1.000 51.94000  ?  222 GLN A C     1 
ATOM   1773 O  O     . GLN A 1 234 ? 173.04900 24.66000 111.88200 1.000 51.35000  ?  222 GLN A O     1 
ATOM   1774 C  CB    . GLN A 1 234 ? 173.27100 24.95900 108.87300 1.000 41.05000  ?  222 GLN A CB    1 
ATOM   1775 C  CG    . GLN A 1 234 ? 172.99100 25.89500 107.73900 1.000 40.42000  ?  222 GLN A CG    1 
ATOM   1776 C  CD    . GLN A 1 234 ? 174.23900 26.11500 106.91200 1.000 47.89000  ?  222 GLN A CD    1 
ATOM   1777 O  OE1   . GLN A 1 234 ? 175.04700 25.19800 106.74400 1.000 53.72000  ?  222 GLN A OE1   1 
ATOM   1778 N  NE2   . GLN A 1 234 ? 174.42200 27.32800 106.41500 1.000 44.04000  ?  222 GLN A NE2   1 
ATOM   1779 N  N     . LYS A 1 235 ? 172.38600 22.65100 111.12600 1.000 56.03000  ?  223 LYS A N     1 
ATOM   1780 C  CA    . LYS A 1 235 ? 172.68200 21.96700 112.36700 1.000 55.96000  ?  223 LYS A CA    1 
ATOM   1781 C  C     . LYS A 1 235 ? 173.80300 20.94500 112.23100 1.000 60.50000  ?  223 LYS A C     1 
ATOM   1782 O  O     . LYS A 1 235 ? 174.38600 20.52900 113.23200 1.000 63.78000  ?  223 LYS A O     1 
ATOM   1783 C  CB    . LYS A 1 235 ? 171.41900 21.28800 112.89200 1.000 57.15000  ?  223 LYS A CB    1 
ATOM   1784 C  CG    . LYS A 1 235 ? 170.23800 22.23100 112.99900 1.000 54.71000  ?  223 LYS A CG    1 
ATOM   1785 C  CD    . LYS A 1 235 ? 169.22900 21.78500 114.05100 1.000 54.21000  ?  223 LYS A CD    1 
ATOM   1786 C  CE    . LYS A 1 235 ? 167.90200 22.47400 113.81100 1.000 58.50000  ?  223 LYS A CE    1 
ATOM   1787 N  NZ    . LYS A 1 235 ? 167.55300 22.39000 112.34600 1.000 58.59000  ?  223 LYS A NZ    1 
ATOM   1788 N  N     . GLU A 1 236 ? 174.10000 20.53500 111.00100 1.000 58.86000  ?  224 GLU A N     1 
ATOM   1789 C  CA    . GLU A 1 236 ? 175.09700 19.48400 110.76700 1.000 59.69000  ?  224 GLU A CA    1 
ATOM   1790 C  C     . GLU A 1 236 ? 176.19600 20.00300 109.87700 1.000 57.22000  ?  224 GLU A C     1 
ATOM   1791 O  O     . GLU A 1 236 ? 175.97900 20.91900 109.09900 1.000 58.45000  ?  224 GLU A O     1 
ATOM   1792 C  CB    . GLU A 1 236 ? 174.47600 18.24400 110.10600 1.000 62.68000  ?  224 GLU A CB    1 
ATOM   1793 C  CG    . GLU A 1 236 ? 173.19000 17.72500 110.74600 1.000 71.10000  ?  224 GLU A CG    1 
ATOM   1794 C  CD    . GLU A 1 236 ? 173.38700 17.19700 112.17300 1.000 84.35000  ?  224 GLU A CD    1 
ATOM   1795 O  OE1   . GLU A 1 236 ? 174.55200 17.12300 112.64700 1.000 85.53000  ?  224 GLU A OE1   1 
ATOM   1796 O  OE2   . GLU A 1 236 ? 172.36600 16.86200 112.82500 1.000 88.04000  ?  224 GLU A OE2   1 
ATOM   1797 N  N     . PRO A 1 237 ? 177.38800 19.40700 109.96300 1.000 58.31000  ?  225 PRO A N     1 
ATOM   1798 C  CA    . PRO A 1 237 ? 178.41900 19.81200 109.00900 1.000 54.75000  ?  225 PRO A CA    1 
ATOM   1799 C  C     . PRO A 1 237 ? 178.19300 19.14300 107.64900 1.000 54.68000  ?  225 PRO A C     1 
ATOM   1800 O  O     . PRO A 1 237 ? 177.56800 18.08700 107.58600 1.000 55.87000  ?  225 PRO A O     1 
ATOM   1801 C  CB    . PRO A 1 237 ? 179.71200 19.32500 109.66600 1.000 50.59000  ?  225 PRO A CB    1 
ATOM   1802 C  CG    . PRO A 1 237 ? 179.32200 18.88500 111.05500 1.000 49.70000  ?  225 PRO A CG    1 
ATOM   1803 C  CD    . PRO A 1 237 ? 177.90900 18.46600 110.95900 1.000 57.08000  ?  225 PRO A CD    1 
ATOM   1804 N  N     . PRO A 1 238 ? 178.71000 19.74000 106.57500 1.000 52.81000  ?  226 PRO A N     1 
ATOM   1805 C  CA    . PRO A 1 238 ? 179.49300 20.97600 106.60400 1.000 57.29000  ?  226 PRO A CA    1 
ATOM   1806 C  C     . PRO A 1 238 ? 178.59900 22.20100 106.58300 1.000 55.29000  ?  226 PRO A C     1 
ATOM   1807 O  O     . PRO A 1 238 ? 177.60400 22.19700 105.87200 1.000 59.17000  ?  226 PRO A O     1 
ATOM   1808 C  CB    . PRO A 1 238 ? 180.31000 20.89100 105.31400 1.000 50.67000  ?  226 PRO A CB    1 
ATOM   1809 C  CG    . PRO A 1 238 ? 179.39300 20.22500 104.38400 1.000 57.54000  ?  226 PRO A CG    1 
ATOM   1810 C  CD    . PRO A 1 238 ? 178.61000 19.20600 105.20900 1.000 52.74000  ?  226 PRO A CD    1 
ATOM   1811 N  N     . PHE A 1 239 ? 178.95800 23.24000 107.32000 1.000 51.90000  ?  227 PHE A N     1 
ATOM   1812 C  CA    . PHE A 1 239 ? 178.15600 24.45100 107.32200 1.000 49.52000  ?  227 PHE A CA    1 
ATOM   1813 C  C     . PHE A 1 239 ? 178.49900 25.35700 106.14800 1.000 49.15000  ?  227 PHE A C     1 
ATOM   1814 O  O     . PHE A 1 239 ? 179.66400 25.54300 105.82300 1.000 55.60000  ?  227 PHE A O     1 
ATOM   1815 C  CB    . PHE A 1 239 ? 178.34800 25.17800 108.64600 1.000 46.78000  ?  227 PHE A CB    1 
ATOM   1816 C  CG    . PHE A 1 239 ? 178.01500 24.33000 109.83900 1.000 47.45000  ?  227 PHE A CG    1 
ATOM   1817 C  CD1   . PHE A 1 239 ? 176.73000 24.29000 110.34000 1.000 48.69000  ?  227 PHE A CD1   1 
ATOM   1818 C  CD2   . PHE A 1 239 ? 178.98200 23.55200 110.44800 1.000 49.42000  ?  227 PHE A CD2   1 
ATOM   1819 C  CE1   . PHE A 1 239 ? 176.42000 23.50200 111.44600 1.000 48.96000  ?  227 PHE A CE1   1 
ATOM   1820 C  CE2   . PHE A 1 239 ? 178.67400 22.76300 111.55600 1.000 48.70000  ?  227 PHE A CE2   1 
ATOM   1821 C  CZ    . PHE A 1 239 ? 177.38700 22.74300 112.04600 1.000 49.59000  ?  227 PHE A CZ    1 
ATOM   1822 N  N     . LEU A 1 240 ? 177.48700 25.89800 105.48400 1.000 48.10000  ?  228 LEU A N     1 
ATOM   1823 C  CA    . LEU A 1 240 ? 177.73200 26.93000 104.48900 1.000 47.80000  ?  228 LEU A CA    1 
ATOM   1824 C  C     . LEU A 1 240 ? 177.74800 28.27100 105.18400 1.000 49.56000  ?  228 LEU A C     1 
ATOM   1825 O  O     . LEU A 1 240 ? 176.78000 28.62800 105.86400 1.000 51.65000  ?  228 LEU A O     1 
ATOM   1826 C  CB    . LEU A 1 240 ? 176.67500 26.90800 103.40000 1.000 50.87000  ?  228 LEU A CB    1 
ATOM   1827 C  CG    . LEU A 1 240 ? 176.89700 26.01700 102.18100 1.000 56.32000  ?  228 LEU A CG    1 
ATOM   1828 C  CD1   . LEU A 1 240 ? 177.83600 24.85000 102.46300 1.000 59.66000  ?  228 LEU A CD1   1 
ATOM   1829 C  CD2   . LEU A 1 240 ? 175.55400 25.49900 101.73000 1.000 57.44000  ?  228 LEU A CD2   1 
ATOM   1830 N  N     . TRP A 1 241 ? 178.84300 29.01400 105.02200 1.000 48.14000  ?  229 TRP A N     1 
ATOM   1831 C  CA    . TRP A 1 241 ? 179.03000 30.25500 105.76500 1.000 39.95000  ?  229 TRP A CA    1 
ATOM   1832 C  C     . TRP A 1 241 ? 180.02300 31.20300 105.09400 1.000 44.84000  ?  229 TRP A C     1 
ATOM   1833 O  O     . TRP A 1 241 ? 181.19500 30.89500 104.95100 1.000 46.46000  ?  229 TRP A O     1 
ATOM   1834 C  CB    . TRP A 1 241 ? 179.48000 29.93200 107.18600 1.000 40.27000  ?  229 TRP A CB    1 
ATOM   1835 C  CG    . TRP A 1 241 ? 179.76100 31.12700 108.00800 1.000 46.17000  ?  229 TRP A CG    1 
ATOM   1836 C  CD1   . TRP A 1 241 ? 178.85200 31.92700 108.62300 1.000 42.56000  ?  229 TRP A CD1   1 
ATOM   1837 C  CD2   . TRP A 1 241 ? 181.04600 31.67200 108.31500 1.000 45.89000  ?  229 TRP A CD2   1 
ATOM   1838 N  NE1   . TRP A 1 241 ? 179.48700 32.93800 109.29300 1.000 43.41000  ?  229 TRP A NE1   1 
ATOM   1839 C  CE2   . TRP A 1 241 ? 180.83500 32.81200 109.10900 1.000 41.42000  ?  229 TRP A CE2   1 
ATOM   1840 C  CE3   . TRP A 1 241 ? 182.35400 31.32100 107.97600 1.000 46.83000  ?  229 TRP A CE3   1 
ATOM   1841 C  CZ2   . TRP A 1 241 ? 181.87900 33.60000 109.57700 1.000 38.80000  ?  229 TRP A CZ2   1 
ATOM   1842 C  CZ3   . TRP A 1 241 ? 183.39700 32.11100 108.44300 1.000 43.43000  ?  229 TRP A CZ3   1 
ATOM   1843 C  CH2   . TRP A 1 241 ? 183.14800 33.23100 109.24600 1.000 42.62000  ?  229 TRP A CH2   1 
ATOM   1844 N  N     . MET A 1 242 ? 179.53100 32.35800 104.67200 1.000 47.88000  ?  230 MET A N     1 
ATOM   1845 C  CA    . MET A 1 242 ? 180.37200 33.41900 104.13000 1.000 44.02000  ?  230 MET A CA    1 
ATOM   1846 C  C     . MET A 1 242 ? 181.12000 33.03900 102.86300 1.000 45.27000  ?  230 MET A C     1 
ATOM   1847 O  O     . MET A 1 242 ? 182.09900 33.69800 102.49000 1.000 50.34000  ?  230 MET A O     1 
ATOM   1848 C  CB    . MET A 1 242 ? 181.35300 33.87100 105.20000 1.000 40.46000  ?  230 MET A CB    1 
ATOM   1849 C  CG    . MET A 1 242 ? 180.66400 34.53500 106.36800 1.000 43.66000  ?  230 MET A CG    1 
ATOM   1850 S  SD    . MET A 1 242 ? 179.91300 36.11100 105.89100 1.000 45.35000  ?  230 MET A SD    1 
ATOM   1851 C  CE    . MET A 1 242 ? 181.36000 37.07400 105.44300 1.000 39.67000  ?  230 MET A CE    1 
ATOM   1852 N  N     . GLY A 1 243 ? 180.65600 31.98800 102.20200 1.000 45.54000  ?  231 GLY A N     1 
ATOM   1853 C  CA    . GLY A 1 243 ? 181.23100 31.54800 100.94200 1.000 47.79000  ?  231 GLY A CA    1 
ATOM   1854 C  C     . GLY A 1 243 ? 182.13100 30.33800 101.12000 1.000 48.83000  ?  231 GLY A C     1 
ATOM   1855 O  O     . GLY A 1 243 ? 182.90200 29.95800 100.23400 1.000 47.30000  ?  231 GLY A O     1 
ATOM   1856 N  N     . TYR A 1 244 ? 182.03200 29.73100 102.29000 1.000 49.52000  ?  232 TYR A N     1 
ATOM   1857 C  CA    . TYR A 1 244 ? 182.87600 28.60400 102.62900 1.000 48.18000  ?  232 TYR A CA    1 
ATOM   1858 C  C     . TYR A 1 244 ? 182.02900 27.42000 103.00600 1.000 52.37000  ?  232 TYR A C     1 
ATOM   1859 O  O     . TYR A 1 244 ? 180.81700 27.52300 103.20500 1.000 54.02000  ?  232 TYR A O     1 
ATOM   1860 C  CB    . TYR A 1 244 ? 183.81600 28.94700 103.79200 1.000 43.38000  ?  232 TYR A CB    1 
ATOM   1861 C  CG    . TYR A 1 244 ? 184.57500 30.24000 103.60700 1.000 50.33000  ?  232 TYR A CG    1 
ATOM   1862 C  CD1   . TYR A 1 244 ? 185.77700 30.26400 102.91300 1.000 44.43000  ?  232 TYR A CD1   1 
ATOM   1863 C  CD2   . TYR A 1 244 ? 184.08800 31.43900 104.11900 1.000 44.18000  ?  232 TYR A CD2   1 
ATOM   1864 C  CE1   . TYR A 1 244 ? 186.46800 31.43000 102.73800 1.000 45.21000  ?  232 TYR A CE1   1 
ATOM   1865 C  CE2   . TYR A 1 244 ? 184.77800 32.62300 103.93900 1.000 40.48000  ?  232 TYR A CE2   1 
ATOM   1866 C  CZ    . TYR A 1 244 ? 185.97600 32.61200 103.24600 1.000 46.29000  ?  232 TYR A CZ    1 
ATOM   1867 O  OH    . TYR A 1 244 ? 186.70000 33.77700 103.05600 1.000 40.63000  ?  232 TYR A OH    1 
ATOM   1868 N  N     . GLU A 1 245 ? 182.69600 26.29000 103.12900 1.000 52.46000  ?  233 GLU A N     1 
ATOM   1869 C  CA    . GLU A 1 245 ? 182.11300 25.13500 103.74700 1.000 51.11000  ?  233 GLU A CA    1 
ATOM   1870 C  C     . GLU A 1 245 ? 182.96600 24.84300 104.93000 1.000 48.42000  ?  233 GLU A C     1 
ATOM   1871 O  O     . GLU A 1 245 ? 184.15200 24.59800 104.76300 1.000 53.28000  ?  233 GLU A O     1 
ATOM   1872 C  CB    . GLU A 1 245 ? 182.08000 23.96800 102.77700 1.000 55.32000  ?  233 GLU A CB    1 
ATOM   1873 C  CG    . GLU A 1 245 ? 181.36400 24.34900 101.52300 1.000 61.42000  ?  233 GLU A CG    1 
ATOM   1874 C  CD    . GLU A 1 245 ? 181.24000 23.21800 100.54500 1.000 73.89000  ?  233 GLU A CD    1 
ATOM   1875 O  OE1   . GLU A 1 245 ? 180.37700 22.32400 100.77400 1.000 69.03000  ?  233 GLU A OE1   1 
ATOM   1876 O  OE2   . GLU A 1 245 ? 182.01200 23.24500 99.54700  1.000 78.03000  ?  233 GLU A OE2   1 
ATOM   1877 N  N     . LEU A 1 246 ? 182.37800 24.90400 106.12400 1.000 49.12000  ?  234 LEU A N     1 
ATOM   1878 C  CA    . LEU A 1 246 ? 183.12400 24.63500 107.35000 1.000 47.82000  ?  234 LEU A CA    1 
ATOM   1879 C  C     . LEU A 1 246 ? 182.88000 23.19400 107.79200 1.000 52.36000  ?  234 LEU A C     1 
ATOM   1880 O  O     . LEU A 1 246 ? 181.77200 22.82000 108.17300 1.000 52.98000  ?  234 LEU A O     1 
ATOM   1881 C  CB    . LEU A 1 246 ? 182.73900 25.61500 108.45300 1.000 41.76000  ?  234 LEU A CB    1 
ATOM   1882 C  CG    . LEU A 1 246 ? 182.57500 27.06500 107.99200 1.000 46.42000  ?  234 LEU A CG    1 
ATOM   1883 C  CD1   . LEU A 1 246 ? 182.01700 27.90200 109.11800 1.000 45.48000  ?  234 LEU A CD1   1 
ATOM   1884 C  CD2   . LEU A 1 246 ? 183.89000 27.65700 107.48700 1.000 42.79000  ?  234 LEU A CD2   1 
ATOM   1885 N  N     . HIS A 1 247 ? 183.92100 22.37800 107.68200 1.000 51.25000  ?  235 HIS A N     1 
ATOM   1886 C  CA    . HIS A 1 247 ? 183.88700 21.01700 108.17200 1.000 51.02000  ?  235 HIS A CA    1 
ATOM   1887 C  C     . HIS A 1 247 ? 184.46100 21.05900 109.56900 1.000 55.48000  ?  235 HIS A C     1 
ATOM   1888 O  O     . HIS A 1 247 ? 184.93300 22.10800 110.01300 1.000 56.07000  ?  235 HIS A O     1 
ATOM   1889 C  CB    . HIS A 1 247 ? 184.67900 20.08000 107.26600 1.000 50.10000  ?  235 HIS A CB    1 
ATOM   1890 C  CG    . HIS A 1 247 ? 184.24400 20.13000 105.83800 1.000 51.51000  ?  235 HIS A CG    1 
ATOM   1891 N  ND1   . HIS A 1 247 ? 183.51200 19.12300 105.24900 1.000 52.15000  ?  235 HIS A ND1   1 
ATOM   1892 C  CD2   . HIS A 1 247 ? 184.41000 21.07900 104.88700 1.000 53.60000  ?  235 HIS A CD2   1 
ATOM   1893 C  CE1   . HIS A 1 247 ? 183.26100 19.44100 103.99000 1.000 56.53000  ?  235 HIS A CE1   1 
ATOM   1894 N  NE2   . HIS A 1 247 ? 183.78900 20.62600 103.74600 1.000 54.70000  ?  235 HIS A NE2   1 
ATOM   1895 N  N     . PRO A 1 248 ? 184.42400 19.93000 110.27500 1.000 54.01000  ?  236 PRO A N     1 
ATOM   1896 C  CA    . PRO A 1 248 ? 184.71800 20.09600 111.69800 1.000 51.51000  ?  236 PRO A CA    1 
ATOM   1897 C  C     . PRO A 1 248 ? 186.19100 20.40000 111.95100 1.000 59.94000  ?  236 PRO A C     1 
ATOM   1898 O  O     . PRO A 1 248 ? 186.50300 21.06400 112.94900 1.000 61.31000  ?  236 PRO A O     1 
ATOM   1899 C  CB    . PRO A 1 248 ? 184.30100 18.75200 112.30200 1.000 46.61000  ?  236 PRO A CB    1 
ATOM   1900 C  CG    . PRO A 1 248 ? 183.34300 18.17600 111.31600 1.000 54.94000  ?  236 PRO A CG    1 
ATOM   1901 C  CD    . PRO A 1 248 ? 183.83100 18.61800 109.96800 1.000 52.00000  ?  236 PRO A CD    1 
ATOM   1902 N  N     . ASP A 1 249 ? 187.07000 19.96000 111.05000 1.000 59.14000  ?  237 ASP A N     1 
ATOM   1903 C  CA    . ASP A 1 249 ? 188.51100 20.14700 111.22800 1.000 57.90000  ?  237 ASP A CA    1 
ATOM   1904 C  C     . ASP A 1 249 ? 189.14800 20.88900 110.07200 1.000 57.67000  ?  237 ASP A C     1 
ATOM   1905 O  O     . ASP A 1 249 ? 190.34900 21.15300 110.07900 1.000 62.25000  ?  237 ASP A O     1 
ATOM   1906 C  CB    . ASP A 1 249 ? 189.21900 18.79700 111.39800 1.000 60.82000  ?  237 ASP A CB    1 
ATOM   1907 C  CG    . ASP A 1 249 ? 188.97800 18.18100 112.76700 1.000 75.16000  ?  237 ASP A CG    1 
ATOM   1908 O  OD1   . ASP A 1 249 ? 188.86500 18.94700 113.75400 1.000 74.87000  ?  237 ASP A OD1   1 
ATOM   1909 O  OD2   . ASP A 1 249 ? 188.89600 16.93300 112.86100 1.000 81.44000  ?  237 ASP A OD2   1 
ATOM   1910 N  N     . LYS A 1 250 ? 188.36200 21.21400 109.06300 1.000 52.07000  ?  238 LYS A N     1 
ATOM   1911 C  CA    . LYS A 1 250 ? 188.93200 21.87900 107.91300 1.000 54.88000  ?  238 LYS A CA    1 
ATOM   1912 C  C     . LYS A 1 250 ? 187.87800 22.76400 107.27100 1.000 56.48000  ?  238 LYS A C     1 
ATOM   1913 O  O     . LYS A 1 250 ? 186.67800 22.54400 107.46200 1.000 55.09000  ?  238 LYS A O     1 
ATOM   1914 C  CB    . LYS A 1 250 ? 189.50000 20.85300 106.92000 1.000 57.11000  ?  238 LYS A CB    1 
ATOM   1915 C  CG    . LYS A 1 250 ? 188.49300 19.88500 106.31600 1.000 52.92000  ?  238 LYS A CG    1 
ATOM   1916 C  CD    . LYS A 1 250 ? 189.15700 18.53500 105.97800 1.000 60.56000  ?  238 LYS A CD    1 
ATOM   1917 C  CE    . LYS A 1 250 ? 188.14800 17.52200 105.39300 1.000 72.07000  ?  238 LYS A CE    1 
ATOM   1918 N  NZ    . LYS A 1 250 ? 187.56300 17.95000 104.06200 1.000 69.58000  ?  238 LYS A NZ    1 
ATOM   1919 N  N     . TRP A 1 251 ? 188.32100 23.79000 106.54800 1.000 51.32000  ?  239 TRP A N     1 
ATOM   1920 C  CA    . TRP A 1 251 ? 187.37400 24.59700 105.80900 1.000 50.12000  ?  239 TRP A CA    1 
ATOM   1921 C  C     . TRP A 1 251 ? 187.76800 24.66600 104.36800 1.000 50.57000  ?  239 TRP A C     1 
ATOM   1922 O  O     . TRP A 1 251 ? 188.90800 24.40100 104.01300 1.000 54.82000  ?  239 TRP A O     1 
ATOM   1923 C  CB    . TRP A 1 251 ? 187.25600 26.01000 106.38700 1.000 50.59000  ?  239 TRP A CB    1 
ATOM   1924 C  CG    . TRP A 1 251 ? 188.51700 26.79600 106.39600 1.000 48.28000  ?  239 TRP A CG    1 
ATOM   1925 C  CD1   . TRP A 1 251 ? 189.42200 26.88600 107.42300 1.000 48.37000  ?  239 TRP A CD1   1 
ATOM   1926 C  CD2   . TRP A 1 251 ? 189.01500 27.63600 105.34600 1.000 46.65000  ?  239 TRP A CD2   1 
ATOM   1927 N  NE1   . TRP A 1 251 ? 190.45100 27.72500 107.06800 1.000 45.66000  ?  239 TRP A NE1   1 
ATOM   1928 C  CE2   . TRP A 1 251 ? 190.23000 28.19200 105.79600 1.000 42.41000  ?  239 TRP A CE2   1 
ATOM   1929 C  CE3   . TRP A 1 251 ? 188.54800 27.97700 104.07000 1.000 50.88000  ?  239 TRP A CE3   1 
ATOM   1930 C  CZ2   . TRP A 1 251 ? 190.98700 29.07000 105.01600 1.000 43.63000  ?  239 TRP A CZ2   1 
ATOM   1931 C  CZ3   . TRP A 1 251 ? 189.30800 28.85400 103.29200 1.000 50.49000  ?  239 TRP A CZ3   1 
ATOM   1932 C  CH2   . TRP A 1 251 ? 190.51700 29.38400 103.77200 1.000 46.69000  ?  239 TRP A CH2   1 
ATOM   1933 N  N     . THR A 1 252 ? 186.80700 25.04600 103.54500 1.000 50.01000  ?  240 THR A N     1 
ATOM   1934 C  CA    . THR A 1 252 ? 187.00100 25.09600 102.11800 1.000 53.86000  ?  240 THR A CA    1 
ATOM   1935 C  C     . THR A 1 252 ? 186.26900 26.29100 101.50400 1.000 59.43000  ?  240 THR A C     1 
ATOM   1936 O  O     . THR A 1 252 ? 185.32700 26.84100 102.09700 1.000 57.39000  ?  240 THR A O     1 
ATOM   1937 C  CB    . THR A 1 252 ? 186.52500 23.78200 101.48100 1.000 59.72000  ?  240 THR A CB    1 
ATOM   1938 O  OG1   . THR A 1 252 ? 187.66700 23.04800 101.04100 1.000 61.76000  ?  240 THR A OG1   1 
ATOM   1939 C  CG2   . THR A 1 252 ? 185.57400 24.03100 100.30400 1.000 62.66000  ?  240 THR A CG2   1 
ATOM   1940 N  N     . VAL A 1 253 ? 186.72200 26.71800 100.33200 1.000 58.71000  ?  241 VAL A N     1 
ATOM   1941 C  CA    . VAL A 1 253 ? 186.03000 27.76700 99.62000  1.000 52.82000  ?  241 VAL A CA    1 
ATOM   1942 C  C     . VAL A 1 253 ? 185.09900 27.06400 98.68100  1.000 55.82000  ?  241 VAL A C     1 
ATOM   1943 O  O     . VAL A 1 253 ? 185.42300 26.00000 98.16600  1.000 58.03000  ?  241 VAL A O     1 
ATOM   1944 C  CB    . VAL A 1 253 ? 186.98900 28.69700 98.85800  1.000 55.87000  ?  241 VAL A CB    1 
ATOM   1945 C  CG1   . VAL A 1 253 ? 187.22100 28.19300 97.44500  1.000 53.73000  ?  241 VAL A CG1   1 
ATOM   1946 C  CG2   . VAL A 1 253 ? 186.44800 30.11100 98.83300  1.000 54.21000  ?  241 VAL A CG2   1 
ATOM   1947 N  N     . GLN A 1 254 ? 183.91800 27.62800 98.48600  1.000 63.79000  ?  242 GLN A N     1 
ATOM   1948 C  CA    . GLN A 1 254 ? 182.97700 27.05600 97.53200  1.000 65.41000  ?  242 GLN A CA    1 
ATOM   1949 C  C     . GLN A 1 254 ? 183.52900 27.28100 96.12400  1.000 62.50000  ?  242 GLN A C     1 
ATOM   1950 O  O     . GLN A 1 254 ? 184.04100 28.36500 95.82200  1.000 69.81000  ?  242 GLN A O     1 
ATOM   1951 C  CB    . GLN A 1 254 ? 181.58000 27.67300 97.69800  1.000 60.89000  ?  242 GLN A CB    1 
ATOM   1952 C  CG    . GLN A 1 254 ? 180.99000 27.53900 99.10800  1.000 58.81000  ?  242 GLN A CG    1 
ATOM   1953 C  CD    . GLN A 1 254 ? 179.64600 28.27300 99.27700  1.000 62.76000  ?  242 GLN A CD    1 
ATOM   1954 O  OE1   . GLN A 1 254 ? 179.04600 28.74400 98.30300  1.000 67.27000  ?  242 GLN A OE1   1 
ATOM   1955 N  NE2   . GLN A 1 254 ? 179.17900 28.36900 100.51600 1.000 52.66000  ?  242 GLN A NE2   1 
ATOM   1956 N  N     . PRO A 1 255 ? 183.38300 26.27600 95.25300  1.000 65.05000  ?  243 PRO A N     1 
ATOM   1957 C  CA    . PRO A 1 255 ? 184.04900 26.15500 93.95200  1.000 66.14000  ?  243 PRO A CA    1 
ATOM   1958 C  C     . PRO A 1 255 ? 184.11500 27.46000 93.18300  1.000 74.62000  ?  243 PRO A C     1 
ATOM   1959 O  O     . PRO A 1 255 ? 183.10700 28.17700 93.06200  1.000 74.47000  ?  243 PRO A O     1 
ATOM   1960 C  CB    . PRO A 1 255 ? 183.17100 25.15700 93.20100  1.000 64.03000  ?  243 PRO A CB    1 
ATOM   1961 C  CG    . PRO A 1 255 ? 181.82800 25.30000 93.84800  1.000 67.96000  ?  243 PRO A CG    1 
ATOM   1962 C  CD    . PRO A 1 255 ? 182.15600 25.46400 95.30000  1.000 70.05000  ?  243 PRO A CD    1 
ATOM   1963 N  N     . ILE A 1 256 ? 185.30200 27.75000 92.66200  1.000 72.53000  ?  244 ILE A N     1 
ATOM   1964 C  CA    . ILE A 1 256 ? 185.53400 28.95500 91.88800  1.000 68.49000  ?  244 ILE A CA    1 
ATOM   1965 C  C     . ILE A 1 256 ? 185.59300 28.62600 90.41300  1.000 71.71000  ?  244 ILE A C     1 
ATOM   1966 O  O     . ILE A 1 256 ? 186.54300 28.01300 89.94800  1.000 74.81000  ?  244 ILE A O     1 
ATOM   1967 C  CB    . ILE A 1 256 ? 186.83800 29.63500 92.30900  1.000 70.59000  ?  244 ILE A CB    1 
ATOM   1968 C  CG1   . ILE A 1 256 ? 186.82600 29.88100 93.82200  1.000 66.46000  ?  244 ILE A CG1   1 
ATOM   1969 C  CG2   . ILE A 1 256 ? 187.06300 30.91700 91.50800  1.000 64.79000  ?  244 ILE A CG2   1 
ATOM   1970 C  CD1   . ILE A 1 256 ? 188.12000 30.41600 94.35200  1.000 58.42000  ?  244 ILE A CD1   1 
ATOM   1971 N  N     . VAL A 1 257 ? 184.57300 29.04100 89.67600  1.000 77.62000  ?  245 VAL A N     1 
ATOM   1972 C  CA    . VAL A 1 257 ? 184.49900 28.72300 88.26000  1.000 76.61000  ?  245 VAL A CA    1 
ATOM   1973 C  C     . VAL A 1 257 ? 185.01100 29.90200 87.45500  1.000 75.12000  ?  245 VAL A C     1 
ATOM   1974 O  O     . VAL A 1 257 ? 184.42200 30.98300 87.46500  1.000 74.76000  ?  245 VAL A O     1 
ATOM   1975 C  CB    . VAL A 1 257 ? 183.04700 28.34800 87.83100  1.000 72.42000  ?  245 VAL A CB    1 
ATOM   1976 C  CG1   . VAL A 1 257 ? 182.51000 27.24400 88.72200  1.000 62.28000  ?  245 VAL A CG1   1 
ATOM   1977 C  CG2   . VAL A 1 257 ? 182.11600 29.54500 87.91400  1.000 79.45000  ?  245 VAL A CG2   1 
ATOM   1978 N  N     . LEU A 1 258 ? 186.13500 29.70100 86.77900  1.000 76.49000  ?  246 LEU A N     1 
ATOM   1979 C  CA    . LEU A 1 258 ? 186.68200 30.74100 85.91700  1.000 80.22000  ?  246 LEU A CA    1 
ATOM   1980 C  C     . LEU A 1 258 ? 185.94000 30.83200 84.58800  1.000 88.58000  ?  246 LEU A C     1 
ATOM   1981 O  O     . LEU A 1 258 ? 185.53400 29.81000 84.02900  1.000 91.33000  ?  246 LEU A O     1 
ATOM   1982 C  CB    . LEU A 1 258 ? 188.16100 30.48400 85.65300  1.000 81.59000  ?  246 LEU A CB    1 
ATOM   1983 C  CG    . LEU A 1 258 ? 189.05800 30.63300 86.87600  1.000 84.43000  ?  246 LEU A CG    1 
ATOM   1984 C  CD1   . LEU A 1 258 ? 190.52500 30.48300 86.49200  1.000 79.62000  ?  246 LEU A CD1   1 
ATOM   1985 C  CD2   . LEU A 1 258 ? 188.80100 31.98700 87.53100  1.000 76.19000  ?  246 LEU A CD2   1 
ATOM   1986 N  N     . PRO A 1 259 ? 185.76600 32.05600 84.06600  1.000 89.34000  ?  247 PRO A N     1 
ATOM   1987 C  CA    . PRO A 1 259 ? 185.27900 32.20800 82.68800  1.000 92.25000  ?  247 PRO A CA    1 
ATOM   1988 C  C     . PRO A 1 259 ? 186.16200 31.43300 81.67900  1.000 97.80000  ?  247 PRO A C     1 
ATOM   1989 O  O     . PRO A 1 259 ? 187.17500 30.84600 82.08300  1.000 94.60000  ?  247 PRO A O     1 
ATOM   1990 C  CB    . PRO A 1 259 ? 185.35300 33.72600 82.46000  1.000 93.82000  ?  247 PRO A CB    1 
ATOM   1991 C  CG    . PRO A 1 259 ? 185.21300 34.32000 83.83200  1.000 86.40000  ?  247 PRO A CG    1 
ATOM   1992 C  CD    . PRO A 1 259 ? 185.91500 33.35200 84.75400  1.000 86.27000  ?  247 PRO A CD    1 
ATOM   1993 N  N     . GLU A 1 260 ? 185.79400 31.41800 80.39500  1.000 101.05000 ?  248 GLU A N     1 
ATOM   1994 C  CA    . GLU A 1 260 ? 186.56600 30.65000 79.41400  1.000 98.15000  ?  248 GLU A CA    1 
ATOM   1995 C  C     . GLU A 1 260 ? 186.47700 31.15900 77.98000  1.000 98.89000  ?  248 GLU A C     1 
ATOM   1996 O  O     . GLU A 1 260 ? 186.63300 30.38000 77.03800  1.000 97.98000  ?  248 GLU A O     1 
ATOM   1997 C  CB    . GLU A 1 260 ? 186.12900 29.18800 79.44200  1.000 95.26000  ?  248 GLU A CB    1 
ATOM   1998 C  CG    . GLU A 1 260 ? 187.28700 28.21900 79.53900  1.000 96.24000  ?  248 GLU A CG    1 
ATOM   1999 C  CD    . GLU A 1 260 ? 186.85000 26.86400 80.05200  1.000 103.92000 ?  248 GLU A CD    1 
ATOM   2000 O  OE1   . GLU A 1 260 ? 187.70500 26.12400 80.58100  1.000 106.36000 ?  248 GLU A OE1   1 
ATOM   2001 O  OE2   . GLU A 1 260 ? 185.64700 26.54000 79.92800  1.000 107.32000 ?  248 GLU A OE2   1 
ATOM   2002 N  N     . LYS A 1 261 ? 186.24900 32.46000 77.81600  1.000 98.91000  ?  249 LYS A N     1 
ATOM   2003 C  CA    . LYS A 1 261 ? 186.09600 33.06500 76.48900  1.000 97.56000  ?  249 LYS A CA    1 
ATOM   2004 C  C     . LYS A 1 261 ? 187.34300 32.89400 75.60200  1.000 98.96000  ?  249 LYS A C     1 
ATOM   2005 O  O     . LYS A 1 261 ? 188.34800 32.30700 76.01800  1.000 97.21000  ?  249 LYS A O     1 
ATOM   2006 C  CB    . LYS A 1 261 ? 185.76000 34.55400 76.62600  1.000 92.10000  ?  249 LYS A CB    1 
ATOM   2007 C  CG    . LYS A 1 261 ? 184.83600 34.88500 77.79100  1.000 95.66000  ?  249 LYS A CG    1 
ATOM   2008 C  CD    . LYS A 1 261 ? 183.62400 33.96100 77.81400  1.000 97.40000  ?  249 LYS A CD    1 
ATOM   2009 C  CE    . LYS A 1 261 ? 182.59200 34.41900 78.83800  1.000 97.37000  ?  249 LYS A CE    1 
ATOM   2010 N  NZ    . LYS A 1 261 ? 181.31400 33.66000 78.73300  1.000 93.70000  ?  249 LYS A NZ    1 
ATOM   2011 N  N     . ASP A 1 262 ? 187.26400 33.40000 74.37400  1.000 96.23000  ?  250 ASP A N     1 
ATOM   2012 C  CA    . ASP A 1 262 ? 188.41100 33.41200 73.47200  1.000 97.55000  ?  250 ASP A CA    1 
ATOM   2013 C  C     . ASP A 1 262 ? 188.68100 34.84200 73.01900  1.000 98.49000  ?  250 ASP A C     1 
ATOM   2014 O  O     . ASP A 1 262 ? 189.79500 35.19000 72.62200  1.000 96.10000  ?  250 ASP A O     1 
ATOM   2015 C  CB    . ASP A 1 262 ? 188.17500 32.48900 72.28300  1.000 104.07000 ?  250 ASP A CB    1 
ATOM   2016 C  CG    . ASP A 1 262 ? 187.90700 31.05900 72.70900  1.000 109.99000 ?  250 ASP A CG    1 
ATOM   2017 O  OD1   . ASP A 1 262 ? 188.36200 30.67200 73.81000  1.000 106.58000 ?  250 ASP A OD1   1 
ATOM   2018 O  OD2   . ASP A 1 262 ? 187.23800 30.32400 71.94900  1.000 110.99000 ?  250 ASP A OD2   1 
ATOM   2019 N  N     . SER A 1 263 ? 187.63900 35.66100 73.07400  1.000 94.55000  ?  251 SER A N     1 
ATOM   2020 C  CA    . SER A 1 263 ? 187.80700 37.10200 73.13400  1.000 93.44000  ?  251 SER A CA    1 
ATOM   2021 C  C     . SER A 1 263 ? 187.71400 37.49800 74.62300  1.000 95.23000  ?  251 SER A C     1 
ATOM   2022 O  O     . SER A 1 263 ? 187.04000 36.82500 75.41600  1.000 92.61000  ?  251 SER A O     1 
ATOM   2023 C  CB    . SER A 1 263 ? 186.74800 37.81300 72.27800  1.000 89.15000  ?  251 SER A CB    1 
ATOM   2024 O  OG    . SER A 1 263 ? 186.82100 39.22200 72.41000  1.000 83.51000  ?  251 SER A OG    1 
ATOM   2025 N  N     . TRP A 1 264 ? 188.41000 38.55900 75.01500  1.000 91.73000  ?  252 TRP A N     1 
ATOM   2026 C  CA    . TRP A 1 264 ? 188.32200 39.04100 76.38800  1.000 84.37000  ?  252 TRP A CA    1 
ATOM   2027 C  C     . TRP A 1 264 ? 188.18800 40.55500 76.40900  1.000 83.80000  ?  252 TRP A C     1 
ATOM   2028 O  O     . TRP A 1 264 ? 189.04600 41.25600 75.87300  1.000 86.23000  ?  252 TRP A O     1 
ATOM   2029 C  CB    . TRP A 1 264 ? 189.55500 38.63600 77.20100  1.000 82.59000  ?  252 TRP A CB    1 
ATOM   2030 C  CG    . TRP A 1 264 ? 189.78300 37.15900 77.38800  1.000 81.31000  ?  252 TRP A CG    1 
ATOM   2031 C  CD1   . TRP A 1 264 ? 190.44800 36.32400 76.54100  1.000 86.67000  ?  252 TRP A CD1   1 
ATOM   2032 C  CD2   . TRP A 1 264 ? 189.39800 36.35900 78.51600  1.000 81.18000  ?  252 TRP A CD2   1 
ATOM   2033 N  NE1   . TRP A 1 264 ? 190.48700 35.05100 77.06000  1.000 85.15000  ?  252 TRP A NE1   1 
ATOM   2034 C  CE2   . TRP A 1 264 ? 189.84600 35.04400 78.27000  1.000 81.31000  ?  252 TRP A CE2   1 
ATOM   2035 C  CE3   . TRP A 1 264 ? 188.71100 36.62400 79.70700  1.000 83.62000  ?  252 TRP A CE3   1 
ATOM   2036 C  CZ2   . TRP A 1 264 ? 189.62600 33.99500 79.16400  1.000 84.73000  ?  252 TRP A CZ2   1 
ATOM   2037 C  CZ3   . TRP A 1 264 ? 188.49200 35.57500 80.59900  1.000 86.44000  ?  252 TRP A CZ3   1 
ATOM   2038 C  CH2   . TRP A 1 264 ? 188.94700 34.27900 80.31800  1.000 85.46000  ?  252 TRP A CH2   1 
ATOM   2039 N  N     . THR A 1 265 ? 187.12900 41.06300 77.03200  1.000 80.67000  ?  253 THR A N     1 
ATOM   2040 C  CA    . THR A 1 265 ? 187.00800 42.50300 77.26500  1.000 82.84000  ?  253 THR A CA    1 
ATOM   2041 C  C     . THR A 1 265 ? 187.66700 42.96800 78.57900  1.000 82.69000  ?  253 THR A C     1 
ATOM   2042 O  O     . THR A 1 265 ? 188.03800 42.16300 79.43400  1.000 80.93000  ?  253 THR A O     1 
ATOM   2043 C  CB    . THR A 1 265 ? 185.54000 42.93600 77.29600  1.000 85.08000  ?  253 THR A CB    1 
ATOM   2044 O  OG1   . THR A 1 265 ? 184.89600 42.37000 78.44500  1.000 83.16000  ?  253 THR A OG1   1 
ATOM   2045 C  CG2   . THR A 1 265 ? 184.82900 42.47200 76.04100  1.000 88.66000  ?  253 THR A CG2   1 
ATOM   2046 N  N     . VAL A 1 266 ? 187.81200 44.27600 78.73500  1.000 77.68000  ?  254 VAL A N     1 
ATOM   2047 C  CA    . VAL A 1 266 ? 188.21900 44.82700 80.01100  1.000 77.51000  ?  254 VAL A CA    1 
ATOM   2048 C  C     . VAL A 1 266 ? 187.33400 44.29600 81.14400  1.000 79.08000  ?  254 VAL A C     1 
ATOM   2049 O  O     . VAL A 1 266 ? 187.82000 44.04600 82.24000  1.000 78.98000  ?  254 VAL A O     1 
ATOM   2050 C  CB    . VAL A 1 266 ? 188.16300 46.36100 80.00000  1.000 81.37000  ?  254 VAL A CB    1 
ATOM   2051 C  CG1   . VAL A 1 266 ? 187.97800 46.89900 81.41100  1.000 76.31000  ?  254 VAL A CG1   1 
ATOM   2052 C  CG2   . VAL A 1 266 ? 189.40400 46.94100 79.33400  1.000 81.15000  ?  254 VAL A CG2   1 
ATOM   2053 N  N     . ASN A 1 267 ? 186.04600 44.09400 80.87500  1.000 78.94000  ?  255 ASN A N     1 
ATOM   2054 C  CA    . ASN A 1 267 ? 185.09900 43.71100 81.92700  1.000 82.38000  ?  255 ASN A CA    1 
ATOM   2055 C  C     . ASN A 1 267 ? 185.25400 42.25600 82.37600  1.000 78.62000  ?  255 ASN A C     1 
ATOM   2056 O  O     . ASN A 1 267 ? 185.16500 41.96500 83.56700  1.000 78.47000  ?  255 ASN A O     1 
ATOM   2057 C  CB    . ASN A 1 267 ? 183.64200 43.96700 81.47500  1.000 86.32000  ?  255 ASN A CB    1 
ATOM   2058 C  CG    . ASN A 1 267 ? 182.65200 44.08200 82.65400  1.000 87.67000  ?  255 ASN A CG    1 
ATOM   2059 O  OD1   . ASN A 1 267 ? 182.81300 43.43700 83.69100  1.000 85.46000  ?  255 ASN A OD1   1 
ATOM   2060 N  ND2   . ASN A 1 267 ? 181.62400 44.90600 82.48400  1.000 88.19000  ?  255 ASN A ND2   1 
ATOM   2061 N  N     . ASP A 1 268 ? 185.47700 41.32700 81.45500  1.000 77.92000  ?  256 ASP A N     1 
ATOM   2062 C  CA    . ASP A 1 268 ? 185.58500 39.95100 81.91600  1.000 78.75000  ?  256 ASP A CA    1 
ATOM   2063 C  C     . ASP A 1 268 ? 187.02800 39.64000 82.33200  1.000 82.16000  ?  256 ASP A C     1 
ATOM   2064 O  O     . ASP A 1 268 ? 187.29000 38.60700 82.95700  1.000 83.04000  ?  256 ASP A O     1 
ATOM   2065 C  CB    . ASP A 1 268 ? 185.06100 38.94100 80.87300  1.000 86.96000  ?  256 ASP A CB    1 
ATOM   2066 C  CG    . ASP A 1 268 ? 185.40200 39.31500 79.43900  1.000 93.63000  ?  256 ASP A CG    1 
ATOM   2067 O  OD1   . ASP A 1 268 ? 186.27000 40.18800 79.23900  1.000 92.06000  ?  256 ASP A OD1   1 
ATOM   2068 O  OD2   . ASP A 1 268 ? 184.80800 38.71300 78.51000  1.000 91.59000  ?  256 ASP A OD2   1 
ATOM   2069 N  N     . ILE A 1 269 ? 187.95700 40.54100 82.01700  1.000 79.39000  ?  257 ILE A N     1 
ATOM   2070 C  CA    . ILE A 1 269 ? 189.30000 40.45800 82.59000  1.000 71.90000  ?  257 ILE A CA    1 
ATOM   2071 C  C     . ILE A 1 269 ? 189.21600 40.82100 84.07300  1.000 75.35000  ?  257 ILE A C     1 
ATOM   2072 O  O     . ILE A 1 269 ? 189.64100 40.04400 84.95200  1.000 65.92000  ?  257 ILE A O     1 
ATOM   2073 C  CB    . ILE A 1 269 ? 190.29900 41.39400 81.87900  1.000 72.22000  ?  257 ILE A CB    1 
ATOM   2074 C  CG1   . ILE A 1 269 ? 190.70300 40.80800 80.53800  1.000 77.05000  ?  257 ILE A CG1   1 
ATOM   2075 C  CG2   . ILE A 1 269 ? 191.56900 41.55000 82.68800  1.000 73.25000  ?  257 ILE A CG2   1 
ATOM   2076 C  CD1   . ILE A 1 269 ? 191.35600 39.46900 80.67000  1.000 76.97000  ?  257 ILE A CD1   1 
ATOM   2077 N  N     . CYS A 1 270 ? 188.65500 42.00700 84.32900  1.000 73.19000  ?  258 CYS A N     1 
ATOM   2078 C  CA    . CYS A 1 270 ? 188.42200 42.50100 85.67000  1.000 62.64000  ?  258 CYS A CA    1 
ATOM   2079 C  C     . CYS A 1 270 ? 187.67100 41.45000 86.44300  1.000 67.98000  ?  258 CYS A C     1 
ATOM   2080 O  O     . CYS A 1 270 ? 187.89400 41.26000 87.63500  1.000 71.50000  ?  258 CYS A O     1 
ATOM   2081 C  CB    . CYS A 1 270 ? 187.64600 43.81200 85.64900  1.000 58.57000  ?  258 CYS A CB    1 
ATOM   2082 S  SG    . CYS A 1 270 ? 188.70600 45.26200 85.59400  1.000 75.00000  ?  258 CYS A SG    1 
ATOM   2083 N  N     . LYS A 1 271 ? 186.79600 40.73500 85.75400  1.000 67.78000  ?  259 LYS A N     1 
ATOM   2084 C  CA    . LYS A 1 271 ? 186.04400 39.67400 86.40100  1.000 68.88000  ?  259 LYS A CA    1 
ATOM   2085 C  C     . LYS A 1 271 ? 186.93000 38.46200 86.71600  1.000 62.64000  ?  259 LYS A C     1 
ATOM   2086 O  O     . LYS A 1 271 ? 186.70200 37.74800 87.68100  1.000 61.71000  ?  259 LYS A O     1 
ATOM   2087 C  CB    . LYS A 1 271 ? 184.85900 39.28200 85.52100  1.000 73.65000  ?  259 LYS A CB    1 
ATOM   2088 C  CG    . LYS A 1 271 ? 184.06000 38.10100 86.00000  1.000 74.79000  ?  259 LYS A CG    1 
ATOM   2089 C  CD    . LYS A 1 271 ? 182.74600 38.03200 85.22900  1.000 85.05000  ?  259 LYS A CD    1 
ATOM   2090 C  CE    . LYS A 1 271 ? 181.96900 36.75400 85.53300  1.000 91.68000  ?  259 LYS A CE    1 
ATOM   2091 N  NZ    . LYS A 1 271 ? 180.71700 36.68800 84.72600  1.000 92.61000  ?  259 LYS A NZ    1 
ATOM   2092 N  N     . LEU A 1 272 ? 187.95900 38.24300 85.91000  1.000 69.92000  ?  260 LEU A N     1 
ATOM   2093 C  CA    . LEU A 1 272 ? 188.79800 37.06700 86.08000  1.000 67.15000  ?  260 LEU A CA    1 
ATOM   2094 C  C     . LEU A 1 272 ? 189.86700 37.31400 87.14000  1.000 62.93000  ?  260 LEU A C     1 
ATOM   2095 O  O     . LEU A 1 272 ? 190.19700 36.41600 87.92000  1.000 58.59000  ?  260 LEU A O     1 
ATOM   2096 C  CB    . LEU A 1 272 ? 189.43800 36.67000 84.75100  1.000 71.52000  ?  260 LEU A CB    1 
ATOM   2097 C  CG    . LEU A 1 272 ? 190.52900 35.59200 84.82200  1.000 71.08000  ?  260 LEU A CG    1 
ATOM   2098 C  CD1   . LEU A 1 272 ? 189.96900 34.16100 84.81100  1.000 70.00000  ?  260 LEU A CD1   1 
ATOM   2099 C  CD2   . LEU A 1 272 ? 191.55400 35.80100 83.71600  1.000 62.13000  ?  260 LEU A CD2   1 
ATOM   2100 N  N     . VAL A 1 273 ? 190.40100 38.53300 87.16500  1.000 63.25000  ?  261 VAL A N     1 
ATOM   2101 C  CA    . VAL A 1 273 ? 191.35500 38.93800 88.20200  1.000 62.84000  ?  261 VAL A CA    1 
ATOM   2102 C  C     . VAL A 1 273 ? 190.73200 38.80300 89.59700  1.000 62.13000  ?  261 VAL A C     1 
ATOM   2103 O  O     . VAL A 1 273 ? 191.37500 38.30500 90.54300  1.000 52.67000  ?  261 VAL A O     1 
ATOM   2104 C  CB    . VAL A 1 273 ? 191.83000 40.39700 88.02200  1.000 61.21000  ?  261 VAL A CB    1 
ATOM   2105 C  CG1   . VAL A 1 273 ? 192.88100 40.74000 89.05800  1.000 60.87000  ?  261 VAL A CG1   1 
ATOM   2106 C  CG2   . VAL A 1 273 ? 192.37700 40.62200 86.63100  1.000 67.64000  ?  261 VAL A CG2   1 
ATOM   2107 N  N     . GLY A 1 274 ? 189.48300 39.26100 89.70100  1.000 58.39000  ?  262 GLY A N     1 
ATOM   2108 C  CA    . GLY A 1 274 ? 188.71400 39.21000 90.93400  1.000 56.16000  ?  262 GLY A CA    1 
ATOM   2109 C  C     . GLY A 1 274 ? 188.49600 37.81000 91.47400  1.000 53.67000  ?  262 GLY A C     1 
ATOM   2110 O  O     . GLY A 1 274 ? 188.74500 37.56000 92.64400  1.000 54.61000  ?  262 GLY A O     1 
ATOM   2111 N  N     . LYS A 1 275 ? 188.03200 36.89400 90.63100  1.000 55.38000  ?  263 LYS A N     1 
ATOM   2112 C  CA    . LYS A 1 275 ? 187.90400 35.49900 91.03100  1.000 53.72000  ?  263 LYS A CA    1 
ATOM   2113 C  C     . LYS A 1 275 ? 189.26500 34.90500 91.41600  1.000 56.68000  ?  263 LYS A C     1 
ATOM   2114 O  O     . LYS A 1 275 ? 189.35700 34.05100 92.30900  1.000 54.75000  ?  263 LYS A O     1 
ATOM   2115 C  CB    . LYS A 1 275 ? 187.25200 34.68200 89.91200  1.000 55.67000  ?  263 LYS A CB    1 
ATOM   2116 C  CG    . LYS A 1 275 ? 185.76300 34.94800 89.76100  1.000 62.95000  ?  263 LYS A CG    1 
ATOM   2117 C  CD    . LYS A 1 275 ? 185.15500 34.21300 88.57600  1.000 66.61000  ?  263 LYS A CD    1 
ATOM   2118 C  CE    . LYS A 1 275 ? 183.64400 34.05700 88.73900  1.000 65.76000  ?  263 LYS A CE    1 
ATOM   2119 N  NZ    . LYS A 1 275 ? 183.32000 32.86200 89.57700  1.000 70.13000  ?  263 LYS A NZ    1 
ATOM   2120 N  N     . LEU A 1 276 ? 190.32600 35.35600 90.75200  1.000 53.58000  ?  264 LEU A N     1 
ATOM   2121 C  CA    . LEU A 1 276 ? 191.65700 34.87300 91.08200  1.000 54.38000  ?  264 LEU A CA    1 
ATOM   2122 C  C     . LEU A 1 276 ? 192.11000 35.40300 92.44600  1.000 54.30000  ?  264 LEU A C     1 
ATOM   2123 O  O     . LEU A 1 276 ? 192.62900 34.64300 93.27200  1.000 53.17000  ?  264 LEU A O     1 
ATOM   2124 C  CB    . LEU A 1 276 ? 192.64900 35.26000 89.98700  1.000 58.69000  ?  264 LEU A CB    1 
ATOM   2125 C  CG    . LEU A 1 276 ? 192.62400 34.34700 88.75100  1.000 61.29000  ?  264 LEU A CG    1 
ATOM   2126 C  CD1   . LEU A 1 276 ? 193.56100 34.88300 87.69500  1.000 58.86000  ?  264 LEU A CD1   1 
ATOM   2127 C  CD2   . LEU A 1 276 ? 192.97000 32.88700 89.08600  1.000 57.68000  ?  264 LEU A CD2   1 
ATOM   2128 N  N     . ASN A 1 277 ? 191.90900 36.70400 92.66800  1.000 55.52000  ?  265 ASN A N     1 
ATOM   2129 C  CA    . ASN A 1 277 ? 192.20300 37.33800 93.94800  1.000 51.01000  ?  265 ASN A CA    1 
ATOM   2130 C  C     . ASN A 1 277 ? 191.49600 36.59800 95.06600  1.000 52.58000  ?  265 ASN A C     1 
ATOM   2131 O  O     . ASN A 1 277 ? 192.11100 36.11300 96.01400  1.000 51.30000  ?  265 ASN A O     1 
ATOM   2132 C  CB    . ASN A 1 277 ? 191.77500 38.80300 93.95300  1.000 50.54000  ?  265 ASN A CB    1 
ATOM   2133 C  CG    . ASN A 1 277 ? 192.72000 39.70900 93.15300  1.000 62.74000  ?  265 ASN A CG    1 
ATOM   2134 O  OD1   . ASN A 1 277 ? 193.90300 39.40300 92.95500  1.000 57.17000  ?  265 ASN A OD1   1 
ATOM   2135 N  ND2   . ASN A 1 277 ? 192.19000 40.84700 92.69900  1.000 68.98000  ?  265 ASN A ND2   1 
ATOM   2136 N  N     . TRP A 1 278 ? 190.18700 36.51100 94.93400  1.000 50.35000  ?  266 TRP A N     1 
ATOM   2137 C  CA    . TRP A 1 278 ? 189.38800 35.71900 95.84000  1.000 50.78000  ?  266 TRP A CA    1 
ATOM   2138 C  C     . TRP A 1 278 ? 189.99200 34.33000 96.04800  1.000 49.55000  ?  266 TRP A C     1 
ATOM   2139 O  O     . TRP A 1 278 ? 190.01100 33.82500 97.16300  1.000 50.78000  ?  266 TRP A O     1 
ATOM   2140 C  CB    . TRP A 1 278 ? 187.95300 35.62800 95.30800  1.000 48.04000  ?  266 TRP A CB    1 
ATOM   2141 C  CG    . TRP A 1 278 ? 187.10600 34.64400 96.01100  1.000 48.15000  ?  266 TRP A CG    1 
ATOM   2142 C  CD1   . TRP A 1 278 ? 186.67500 33.44400 95.52600  1.000 52.67000  ?  266 TRP A CD1   1 
ATOM   2143 C  CD2   . TRP A 1 278 ? 186.57300 34.75800 97.33200  1.000 51.85000  ?  266 TRP A CD2   1 
ATOM   2144 N  NE1   . TRP A 1 278 ? 185.90900 32.79600 96.46600  1.000 52.11000  ?  266 TRP A NE1   1 
ATOM   2145 C  CE2   . TRP A 1 278 ? 185.82600 33.58400 97.58600  1.000 51.45000  ?  266 TRP A CE2   1 
ATOM   2146 C  CE3   . TRP A 1 278 ? 186.65500 35.73500 98.33200  1.000 50.65000  ?  266 TRP A CE3   1 
ATOM   2147 C  CZ2   . TRP A 1 278 ? 185.17500 33.35400 98.80200  1.000 46.78000  ?  266 TRP A CZ2   1 
ATOM   2148 C  CZ3   . TRP A 1 278 ? 186.00400 35.50700 99.54300  1.000 46.04000  ?  266 TRP A CZ3   1 
ATOM   2149 C  CH2   . TRP A 1 278 ? 185.27500 34.32800 99.76300  1.000 46.67000  ?  266 TRP A CH2   1 
ATOM   2150 N  N     . ALA A 1 279 ? 190.50100 33.72000 94.98100  1.000 50.80000  ?  267 ALA A N     1 
ATOM   2151 C  CA    . ALA A 1 279 ? 191.01000 32.34700 95.05600  1.000 51.68000  ?  267 ALA A CA    1 
ATOM   2152 C  C     . ALA A 1 279 ? 192.30200 32.23700 95.88500  1.000 50.25000  ?  267 ALA A C     1 
ATOM   2153 O  O     . ALA A 1 279 ? 192.55900 31.22300 96.56400  1.000 46.00000  ?  267 ALA A O     1 
ATOM   2154 C  CB    . ALA A 1 279 ? 191.24100 31.80600 93.64500  1.000 53.26000  ?  267 ALA A CB    1 
ATOM   2155 N  N     . SER A 1 280 ? 193.11100 33.28700 95.81800  1.000 45.17000  ?  268 SER A N     1 
ATOM   2156 C  CA    . SER A 1 280 ? 194.44500 33.24200 96.39300  1.000 51.88000  ?  268 SER A CA    1 
ATOM   2157 C  C     . SER A 1 280 ? 194.46300 33.13500 97.92700  1.000 51.59000  ?  268 SER A C     1 
ATOM   2158 O  O     . SER A 1 280 ? 195.50800 32.85300 98.51600  1.000 50.79000  ?  268 SER A O     1 
ATOM   2159 C  CB    . SER A 1 280 ? 195.24000 34.46300 95.94300  1.000 50.28000  ?  268 SER A CB    1 
ATOM   2160 O  OG    . SER A 1 280 ? 194.55800 35.64700 96.28400  1.000 54.98000  ?  268 SER A OG    1 
ATOM   2161 N  N     . GLN A 1 281 ? 193.31200 33.33500 98.56600  1.000 48.46000  ?  269 GLN A N     1 
ATOM   2162 C  CA    . GLN A 1 281 ? 193.21300 33.20200 100.01100 1.000 41.54000  ?  269 GLN A CA    1 
ATOM   2163 C  C     . GLN A 1 281 ? 193.46200 31.77700 100.47500 1.000 43.26000  ?  269 GLN A C     1 
ATOM   2164 O  O     . GLN A 1 281 ? 193.79000 31.55400 101.63700 1.000 47.23000  ?  269 GLN A O     1 
ATOM   2165 C  CB    . GLN A 1 281 ? 191.84100 33.65600 100.50200 1.000 40.65000  ?  269 GLN A CB    1 
ATOM   2166 C  CG    . GLN A 1 281 ? 190.76800 32.64900 100.25300 1.000 39.33000  ?  269 GLN A CG    1 
ATOM   2167 C  CD    . GLN A 1 281 ? 189.43300 33.13600 100.70200 1.000 46.10000  ?  269 GLN A CD    1 
ATOM   2168 O  OE1   . GLN A 1 281 ? 189.13700 33.11000 101.89600 1.000 49.28000  ?  269 GLN A OE1   1 
ATOM   2169 N  NE2   . GLN A 1 281 ? 188.59900 33.59300 99.75400  1.000 43.19000  ?  269 GLN A NE2   1 
ATOM   2170 N  N     . ILE A 1 282 ? 193.31000 30.79600 99.59400  1.000 44.47000  ?  270 ILE A N     1 
ATOM   2171 C  CA    . ILE A 1 282 ? 193.55900 29.41300 100.02600 1.000 50.10000  ?  270 ILE A CA    1 
ATOM   2172 C  C     . ILE A 1 282 ? 194.30700 28.59000 98.96800  1.000 48.52000  ?  270 ILE A C     1 
ATOM   2173 O  O     . ILE A 1 282 ? 194.87600 27.55400 99.28900  1.000 46.60000  ?  270 ILE A O     1 
ATOM   2174 C  CB    . ILE A 1 282 ? 192.23000 28.69800 100.40800 1.000 44.63000  ?  270 ILE A CB    1 
ATOM   2175 C  CG1   . ILE A 1 282 ? 192.47900 27.31300 100.99800 1.000 49.25000  ?  270 ILE A CG1   1 
ATOM   2176 C  CG2   . ILE A 1 282 ? 191.34200 28.58600 99.20300  1.000 49.50000  ?  270 ILE A CG2   1 
ATOM   2177 C  CD1   . ILE A 1 282 ? 193.14400 27.30700 102.35400 1.000 47.40000  ?  270 ILE A CD1   1 
ATOM   2178 N  N     . TYR A 1 283 ? 194.28700 29.05800 97.71800  1.000 49.00000  ?  271 TYR A N     1 
ATOM   2179 C  CA    . TYR A 1 283 ? 195.10400 28.49400 96.63800  1.000 51.65000  ?  271 TYR A CA    1 
ATOM   2180 C  C     . TYR A 1 283 ? 196.47600 29.15300 96.51700  1.000 54.49000  ?  271 TYR A C     1 
ATOM   2181 O  O     . TYR A 1 283 ? 196.59000 30.28000 96.04200  1.000 56.13000  ?  271 TYR A O     1 
ATOM   2182 C  CB    . TYR A 1 283 ? 194.40000 28.64200 95.29400  1.000 56.36000  ?  271 TYR A CB    1 
ATOM   2183 C  CG    . TYR A 1 283 ? 193.26000 27.69400 95.06500  1.000 57.06000  ?  271 TYR A CG    1 
ATOM   2184 C  CD1   . TYR A 1 283 ? 191.96800 28.02100 95.45900  1.000 59.51000  ?  271 TYR A CD1   1 
ATOM   2185 C  CD2   . TYR A 1 283 ? 193.46600 26.47600 94.42900  1.000 58.99000  ?  271 TYR A CD2   1 
ATOM   2186 C  CE1   . TYR A 1 283 ? 190.90500 27.14000 95.23700  1.000 60.91000  ?  271 TYR A CE1   1 
ATOM   2187 C  CE2   . TYR A 1 283 ? 192.41200 25.58800 94.20200  1.000 64.02000  ?  271 TYR A CE2   1 
ATOM   2188 C  CZ    . TYR A 1 283 ? 191.13400 25.92900 94.60900  1.000 66.47000  ?  271 TYR A CZ    1 
ATOM   2189 O  OH    . TYR A 1 283 ? 190.08800 25.06100 94.38900  1.000 69.54000  ?  271 TYR A OH    1 
ATOM   2190 N  N     . PRO A 1 284 ? 197.53100 28.43900 96.91100  1.000 54.86000  ?  272 PRO A N     1 
ATOM   2191 C  CA    . PRO A 1 284 ? 198.89200 28.97500 96.84900  1.000 51.66000  ?  272 PRO A CA    1 
ATOM   2192 C  C     . PRO A 1 284 ? 199.36100 29.20800 95.41700  1.000 58.25000  ?  272 PRO A C     1 
ATOM   2193 O  O     . PRO A 1 284 ? 198.96500 28.46400 94.51800  1.000 63.16000  ?  272 PRO A O     1 
ATOM   2194 C  CB    . PRO A 1 284 ? 199.72100 27.88700 97.52100  1.000 52.70000  ?  272 PRO A CB    1 
ATOM   2195 C  CG    . PRO A 1 284 ? 198.95100 26.66300 97.32800  1.000 60.53000  ?  272 PRO A CG    1 
ATOM   2196 C  CD    . PRO A 1 284 ? 197.50400 27.03700 97.34700  1.000 52.95000  ?  272 PRO A CD    1 
ATOM   2197 N  N     . GLY A 1 285 ? 200.16500 30.24300 95.19800  1.000 55.97000  ?  273 GLY A N     1 
ATOM   2198 C  CA    . GLY A 1 285 ? 200.76900 30.45800 93.89900  1.000 52.18000  ?  273 GLY A CA    1 
ATOM   2199 C  C     . GLY A 1 285 ? 199.97600 31.18000 92.82900  1.000 59.70000  ?  273 GLY A C     1 
ATOM   2200 O  O     . GLY A 1 285 ? 200.42000 31.27300 91.68300  1.000 64.05000  ?  273 GLY A O     1 
ATOM   2201 N  N     . ILE A 1 286 ? 198.80700 31.70000 93.16800  1.000 59.77000  ?  274 ILE A N     1 
ATOM   2202 C  CA    . ILE A 1 286 ? 198.03800 32.44100 92.18100  1.000 57.77000  ?  274 ILE A CA    1 
ATOM   2203 C  C     . ILE A 1 286 ? 198.77600 33.71300 91.74100  1.000 60.35000  ?  274 ILE A C     1 
ATOM   2204 O  O     . ILE A 1 286 ? 199.36600 34.40300 92.56400  1.000 62.13000  ?  274 ILE A O     1 
ATOM   2205 C  CB    . ILE A 1 286 ? 196.67500 32.82100 92.72200  1.000 57.90000  ?  274 ILE A CB    1 
ATOM   2206 C  CG1   . ILE A 1 286 ? 195.88900 31.56700 93.09100  1.000 54.99000  ?  274 ILE A CG1   1 
ATOM   2207 C  CG2   . ILE A 1 286 ? 195.92500 33.65300 91.69300  1.000 60.85000  ?  274 ILE A CG2   1 
ATOM   2208 C  CD1   . ILE A 1 286 ? 195.32800 30.85800 91.90700  1.000 58.16000  ?  274 ILE A CD1   1 
ATOM   2209 N  N     . LYS A 1 287 ? 198.74300 34.01700 90.44400  1.000 63.28000  ?  275 LYS A N     1 
ATOM   2210 C  CA    . LYS A 1 287 ? 199.43700 35.18700 89.90200  1.000 63.08000  ?  275 LYS A CA    1 
ATOM   2211 C  C     . LYS A 1 287 ? 198.57200 35.96000 88.92300  1.000 65.34000  ?  275 LYS A C     1 
ATOM   2212 O  O     . LYS A 1 287 ? 197.87200 35.37100 88.10500  1.000 66.71000  ?  275 LYS A O     1 
ATOM   2213 C  CB    . LYS A 1 287 ? 200.73100 34.77000 89.20400  1.000 65.63000  ?  275 LYS A CB    1 
ATOM   2214 C  CG    . LYS A 1 287 ? 201.87700 34.53200 90.15200  1.000 64.46000  ?  275 LYS A CG    1 
ATOM   2215 C  CD    . LYS A 1 287 ? 202.64200 33.29600 89.78300  1.000 66.22000  ?  275 LYS A CD    1 
ATOM   2216 C  CE    . LYS A 1 287 ? 203.37500 33.48000 88.48300  1.000 73.38000  ?  275 LYS A CE    1 
ATOM   2217 N  NZ    . LYS A 1 287 ? 204.06100 32.21000 88.14000  1.000 79.82000  ?  275 LYS A NZ    1 
ATOM   2218 N  N     . VAL A 1 288 ? 198.63100 37.28200 88.98800  1.000 61.45000  ?  276 VAL A N     1 
ATOM   2219 C  CA    . VAL A 1 288 ? 197.79400 38.07300 88.12200  1.000 61.66000  ?  276 VAL A CA    1 
ATOM   2220 C  C     . VAL A 1 288 ? 198.48400 39.32500 87.61800  1.000 65.26000  ?  276 VAL A C     1 
ATOM   2221 O  O     . VAL A 1 288 ? 197.81800 40.24100 87.15500  1.000 68.02000  ?  276 VAL A O     1 
ATOM   2222 C  CB    . VAL A 1 288 ? 196.48400 38.47300 88.83000  1.000 66.62000  ?  276 VAL A CB    1 
ATOM   2223 C  CG1   . VAL A 1 288 ? 195.77600 37.23600 89.36500  1.000 60.34000  ?  276 VAL A CG1   1 
ATOM   2224 C  CG2   . VAL A 1 288 ? 196.75000 39.47800 89.94700  1.000 61.56000  ?  276 VAL A CG2   1 
ATOM   2225 N  N     . ARG A 1 289 ? 199.81000 39.36800 87.68000  1.000 64.58000  ?  277 ARG A N     1 
ATOM   2226 C  CA    . ARG A 1 289 ? 200.54100 40.51200 87.13900  1.000 66.93000  ?  277 ARG A CA    1 
ATOM   2227 C  C     . ARG A 1 289 ? 200.27200 40.69900 85.65300  1.000 72.95000  ?  277 ARG A C     1 
ATOM   2228 O  O     . ARG A 1 289 ? 199.85500 41.76700 85.20700  1.000 74.07000  ?  277 ARG A O     1 
ATOM   2229 C  CB    . ARG A 1 289 ? 202.04700 40.34600 87.35700  1.000 72.73000  ?  277 ARG A CB    1 
ATOM   2230 C  CG    . ARG A 1 289 ? 202.93600 41.11700 86.36400  1.000 67.38000  ?  277 ARG A CG    1 
ATOM   2231 C  CD    . ARG A 1 289 ? 203.00100 42.61600 86.67300  1.000 67.93000  ?  277 ARG A CD    1 
ATOM   2232 N  NE    . ARG A 1 289 ? 203.61000 42.86300 87.97800  1.000 72.88000  ?  277 ARG A NE    1 
ATOM   2233 C  CZ    . ARG A 1 289 ? 202.92900 43.16800 89.08100  1.000 71.74000  ?  277 ARG A CZ    1 
ATOM   2234 N  NH1   . ARG A 1 289 ? 201.60600 43.29800 89.04900  1.000 70.18000  ?  277 ARG A NH1   1 
ATOM   2235 N  NH2   . ARG A 1 289 ? 203.57500 43.35500 90.22200  1.000 72.73000  ?  277 ARG A NH2   1 
ATOM   2236 N  N     . GLN A 1 290 ? 200.52700 39.64300 84.89100  1.000 72.66000  ?  278 GLN A N     1 
ATOM   2237 C  CA    . GLN A 1 290 ? 200.44800 39.70100 83.43700  1.000 75.09000  ?  278 GLN A CA    1 
ATOM   2238 C  C     . GLN A 1 290 ? 199.04200 39.99700 82.94200  1.000 76.69000  ?  278 GLN A C     1 
ATOM   2239 O  O     . GLN A 1 290 ? 198.86000 40.67000 81.92100  1.000 78.16000  ?  278 GLN A O     1 
ATOM   2240 C  CB    . GLN A 1 290 ? 200.95300 38.39000 82.83500  1.000 76.61000  ?  278 GLN A CB    1 
ATOM   2241 C  CG    . GLN A 1 290 ? 202.46100 38.27500 82.88500  1.000 77.06000  ?  278 GLN A CG    1 
ATOM   2242 C  CD    . GLN A 1 290 ? 203.12400 39.56700 82.45400  1.000 77.51000  ?  278 GLN A CD    1 
ATOM   2243 O  OE1   . GLN A 1 290 ? 202.86900 40.07300 81.35500  1.000 78.54000  ?  278 GLN A OE1   1 
ATOM   2244 N  NE2   . GLN A 1 290 ? 203.96300 40.12300 83.32700  1.000 72.47000  ?  278 GLN A NE2   1 
ATOM   2245 N  N     . LEU A 1 291 ? 198.05200 39.49200 83.67200  1.000 73.24000  ?  279 LEU A N     1 
ATOM   2246 C  CA    . LEU A 1 291 ? 196.65700 39.74900 83.35900  1.000 66.08000  ?  279 LEU A CA    1 
ATOM   2247 C  C     . LEU A 1 291 ? 196.24000 41.18800 83.68300  1.000 69.19000  ?  279 LEU A C     1 
ATOM   2248 O  O     . LEU A 1 291 ? 195.55200 41.82700 82.89400  1.000 71.16000  ?  279 LEU A O     1 
ATOM   2249 C  CB    . LEU A 1 291 ? 195.77900 38.74900 84.09500  1.000 59.00000  ?  279 LEU A CB    1 
ATOM   2250 C  CG    . LEU A 1 291 ? 195.99000 37.33900 83.55500  1.000 64.14000  ?  279 LEU A CG    1 
ATOM   2251 C  CD1   . LEU A 1 291 ? 195.80200 36.26200 84.61700  1.000 65.79000  ?  279 LEU A CD1   1 
ATOM   2252 C  CD2   . LEU A 1 291 ? 195.04000 37.10300 82.38400  1.000 68.57000  ?  279 LEU A CD2   1 
ATOM   2253 N  N     . SER A 1 292 ? 196.65800 41.72700 84.82000  1.000 68.62000  ?  280 SER A N     1 
ATOM   2254 C  CA    . SER A 1 292 ? 196.22300 43.07900 85.14200  1.000 71.16000  ?  280 SER A CA    1 
ATOM   2255 C  C     . SER A 1 292 ? 196.97500 44.14000 84.34500  1.000 73.85000  ?  280 SER A C     1 
ATOM   2256 O  O     . SER A 1 292 ? 196.51900 45.28100 84.26500  1.000 81.38000  ?  280 SER A O     1 
ATOM   2257 C  CB    . SER A 1 292 ? 196.34800 43.37700 86.64200  1.000 71.38000  ?  280 SER A CB    1 
ATOM   2258 O  OG    . SER A 1 292 ? 197.01500 42.34500 87.32300  1.000 75.91000  ?  280 SER A OG    1 
ATOM   2259 N  N     . LYS A 1 293 ? 198.11400 43.79200 83.75500  1.000 75.61000  ?  281 LYS A N     1 
ATOM   2260 C  CA    . LYS A 1 293 ? 198.80400 44.76300 82.90700  1.000 76.30000  ?  281 LYS A CA    1 
ATOM   2261 C  C     . LYS A 1 293 ? 197.91200 45.10700 81.71800  1.000 76.73000  ?  281 LYS A C     1 
ATOM   2262 O  O     . LYS A 1 293 ? 197.82500 46.27400 81.32800  1.000 80.98000  ?  281 LYS A O     1 
ATOM   2263 C  CB    . LYS A 1 293 ? 200.17100 44.24800 82.44100  1.000 77.95000  ?  281 LYS A CB    1 
ATOM   2264 C  CG    . LYS A 1 293 ? 201.34900 44.89000 83.18700  1.000 83.70000  ?  281 LYS A CG    1 
ATOM   2265 C  CD    . LYS A 1 293 ? 200.90100 46.19600 83.88900  1.000 92.15000  ?  281 LYS A CD    1 
ATOM   2266 C  CE    . LYS A 1 293 ? 202.01900 46.86500 84.70900  1.000 89.36000  ?  281 LYS A CE    1 
ATOM   2267 N  NZ    . LYS A 1 293 ? 201.67100 48.26800 85.12400  1.000 87.16000  ?  281 LYS A NZ    1 
ATOM   2268 N  N     . LEU A 1 294 ? 197.22200 44.09900 81.18100  1.000 71.10000  ?  282 LEU A N     1 
ATOM   2269 C  CA    . LEU A 1 294 ? 196.26200 44.29200 80.08800  1.000 74.63000  ?  282 LEU A CA    1 
ATOM   2270 C  C     . LEU A 1 294 ? 195.34100 45.48500 80.32700  1.000 77.68000  ?  282 LEU A C     1 
ATOM   2271 O  O     . LEU A 1 294 ? 195.05700 46.25200 79.41200  1.000 79.42000  ?  282 LEU A O     1 
ATOM   2272 C  CB    . LEU A 1 294 ? 195.41400 43.03300 79.88300  1.000 70.23000  ?  282 LEU A CB    1 
ATOM   2273 C  CG    . LEU A 1 294 ? 196.07000 41.85400 79.17100  1.000 70.41000  ?  282 LEU A CG    1 
ATOM   2274 C  CD1   . LEU A 1 294 ? 197.45100 41.64000 79.69800  1.000 75.56000  ?  282 LEU A CD1   1 
ATOM   2275 C  CD2   . LEU A 1 294 ? 195.25700 40.58900 79.34200  1.000 72.28000  ?  282 LEU A CD2   1 
ATOM   2276 N  N     . LEU A 1 295 ? 194.89700 45.64300 81.56900  1.000 77.99000  ?  283 LEU A N     1 
ATOM   2277 C  CA    . LEU A 1 295 ? 193.92400 46.66500 81.92700  1.000 75.62000  ?  283 LEU A CA    1 
ATOM   2278 C  C     . LEU A 1 295 ? 194.45300 48.08900 81.85200  1.000 80.22000  ?  283 LEU A C     1 
ATOM   2279 O  O     . LEU A 1 295 ? 193.73100 49.02800 82.17800  1.000 80.68000  ?  283 LEU A O     1 
ATOM   2280 C  CB    . LEU A 1 295 ? 193.40400 46.40900 83.33600  1.000 74.08000  ?  283 LEU A CB    1 
ATOM   2281 C  CG    . LEU A 1 295 ? 192.67300 45.07700 83.50300  1.000 77.94000  ?  283 LEU A CG    1 
ATOM   2282 C  CD1   . LEU A 1 295 ? 192.06100 44.92900 84.89900  1.000 75.22000  ?  283 LEU A CD1   1 
ATOM   2283 C  CD2   . LEU A 1 295 ? 191.61400 44.93400 82.42100  1.000 79.84000  ?  283 LEU A CD2   1 
ATOM   2284 N  N     . ARG A 1 296 ? 195.70400 48.26400 81.43600  1.000 80.73000  ?  284 ARG A N     1 
ATOM   2285 C  CA    . ARG A 1 296 ? 196.29700 49.59900 81.42700  1.000 82.19000  ?  284 ARG A CA    1 
ATOM   2286 C  C     . ARG A 1 296 ? 195.83300 50.42900 80.22700  1.000 86.23000  ?  284 ARG A C     1 
ATOM   2287 O  O     . ARG A 1 296 ? 195.75000 49.92500 79.10600  1.000 78.57000  ?  284 ARG A O     1 
ATOM   2288 C  CB    . ARG A 1 296 ? 197.82000 49.50800 81.44700  1.000 83.14000  ?  284 ARG A CB    1 
ATOM   2289 C  CG    . ARG A 1 296 ? 198.38300 48.90100 82.71800  1.000 82.87000  ?  284 ARG A CG    1 
ATOM   2290 C  CD    . ARG A 1 296 ? 199.87500 49.17000 82.82800  1.000 91.38000  ?  284 ARG A CD    1 
ATOM   2291 N  NE    . ARG A 1 296 ? 200.62900 48.62400 81.69200  1.000 97.82000  ?  284 ARG A NE    1 
ATOM   2292 C  CZ    . ARG A 1 296 ? 201.90600 48.90400 81.41600  1.000 97.48000  ?  284 ARG A CZ    1 
ATOM   2293 N  NH1   . ARG A 1 296 ? 202.60200 49.74000 82.18500  1.000 91.04000  ?  284 ARG A NH1   1 
ATOM   2294 N  NH2   . ARG A 1 296 ? 202.48900 48.34900 80.35900  1.000 99.07000  ?  284 ARG A NH2   1 
ATOM   2295 N  N     . GLY A 1 297 ? 195.51800 51.69900 80.48800  1.000 88.96000  ?  285 GLY A N     1 
ATOM   2296 C  CA    . GLY A 1 297 ? 195.07600 52.63300 79.46300  1.000 86.32000  ?  285 GLY A CA    1 
ATOM   2297 C  C     . GLY A 1 297 ? 193.63400 52.47300 79.01400  1.000 86.87000  ?  285 GLY A C     1 
ATOM   2298 O  O     . GLY A 1 297 ? 192.88400 53.45100 78.93900  1.000 87.71000  ?  285 GLY A O     1 
ATOM   2299 N  N     . THR A 1 298 ? 193.26100 51.22700 78.72800  1.000 87.14000  ?  286 THR A N     1 
ATOM   2300 C  CA    . THR A 1 298 ? 191.97000 50.86200 78.13900  1.000 92.04000  ?  286 THR A CA    1 
ATOM   2301 C  C     . THR A 1 298 ? 190.77100 51.65500 78.68100  1.000 93.28000  ?  286 THR A C     1 
ATOM   2302 O  O     . THR A 1 298 ? 190.47800 51.64100 79.87600  1.000 92.21000  ?  286 THR A O     1 
ATOM   2303 C  CB    . THR A 1 298 ? 191.71200 49.35500 78.33100  1.000 90.82000  ?  286 THR A CB    1 
ATOM   2304 O  OG1   . THR A 1 298 ? 191.43200 49.08300 79.70800  1.000 88.89000  ?  286 THR A OG1   1 
ATOM   2305 C  CG2   . THR A 1 298 ? 192.93300 48.57100 77.91300  1.000 83.70000  ?  286 THR A CG2   1 
ATOM   2306 N  N     . LYS A 1 299 ? 190.06800 52.31700 77.76800  1.000 94.48000  ?  287 LYS A N     1 
ATOM   2307 C  CA    . LYS A 1 299 ? 189.16500 53.40300 78.12000  1.000 94.37000  ?  287 LYS A CA    1 
ATOM   2308 C  C     . LYS A 1 299 ? 187.78000 52.97600 78.59700  1.000 94.83000  ?  287 LYS A C     1 
ATOM   2309 O  O     . LYS A 1 299 ? 187.11200 53.73500 79.29100  1.000 98.65000  ?  287 LYS A O     1 
ATOM   2310 C  CB    . LYS A 1 299 ? 189.01900 54.34500 76.92300  1.000 96.18000  ?  287 LYS A CB    1 
ATOM   2311 C  CG    . LYS A 1 299 ? 188.48200 55.72600 77.27400  1.000 100.77000 ?  287 LYS A CG    1 
ATOM   2312 C  CD    . LYS A 1 299 ? 189.25200 56.80900 76.53000  1.000 101.79000 ?  287 LYS A CD    1 
ATOM   2313 C  CE    . LYS A 1 299 ? 189.33100 56.49500 75.04700  1.000 101.20000 ?  287 LYS A CE    1 
ATOM   2314 N  NZ    . LYS A 1 299 ? 190.16700 57.47600 74.31400  1.000 95.95000  ?  287 LYS A NZ    1 
ATOM   2315 N  N     . ALA A 1 300 ? 187.33500 51.78100 78.23500  1.000 90.27000  ?  288 ALA A N     1 
ATOM   2316 C  CA    . ALA A 1 300 ? 186.01000 51.34900 78.66700  1.000 90.07000  ?  288 ALA A CA    1 
ATOM   2317 C  C     . ALA A 1 300 ? 185.94500 49.84100 78.88200  1.000 90.01000  ?  288 ALA A C     1 
ATOM   2318 O  O     . ALA A 1 300 ? 186.81400 49.09500 78.40900  1.000 87.38000  ?  288 ALA A O     1 
ATOM   2319 C  CB    . ALA A 1 300 ? 184.95700 51.78900 77.66200  1.000 91.86000  ?  288 ALA A CB    1 
ATOM   2320 N  N     . LEU A 1 301 ? 184.91600 49.40300 79.61000  1.000 87.23000  ?  289 LEU A N     1 
ATOM   2321 C  CA    . LEU A 1 301 ? 184.77400 47.99500 79.96900  1.000 85.68000  ?  289 LEU A CA    1 
ATOM   2322 C  C     . LEU A 1 301 ? 184.54300 47.15200 78.73400  1.000 88.41000  ?  289 LEU A C     1 
ATOM   2323 O  O     . LEU A 1 301 ? 185.10200 46.06700 78.58500  1.000 84.56000  ?  289 LEU A O     1 
ATOM   2324 C  CB    . LEU A 1 301 ? 183.62100 47.78500 80.94700  1.000 82.65000  ?  289 LEU A CB    1 
ATOM   2325 C  CG    . LEU A 1 301 ? 183.77600 48.38000 82.33900  1.000 87.32000  ?  289 LEU A CG    1 
ATOM   2326 C  CD1   . LEU A 1 301 ? 182.97800 49.68500 82.47000  1.000 87.39000  ?  289 LEU A CD1   1 
ATOM   2327 C  CD2   . LEU A 1 301 ? 183.34900 47.34300 83.36600  1.000 80.35000  ?  289 LEU A CD2   1 
ATOM   2328 N  N     . THR A 1 302 ? 183.69900 47.67100 77.85300  1.000 94.22000  ?  290 THR A N     1 
ATOM   2329 C  CA    . THR A 1 302 ? 183.30500 46.96500 76.64700  1.000 95.13000  ?  290 THR A CA    1 
ATOM   2330 C  C     . THR A 1 302 ? 184.51600 46.66800 75.76000  1.000 88.07000  ?  290 THR A C     1 
ATOM   2331 O  O     . THR A 1 302 ? 184.55000 45.65100 75.06400  1.000 85.00000  ?  290 THR A O     1 
ATOM   2332 C  CB    . THR A 1 302 ? 182.25300 47.77600 75.86400  1.000 98.03000  ?  290 THR A CB    1 
ATOM   2333 O  OG1   . THR A 1 302 ? 181.91200 47.08500 74.65700  1.000 109.19000 ?  290 THR A OG1   1 
ATOM   2334 C  CG2   . THR A 1 302 ? 182.78900 49.16200 75.53000  1.000 94.55000  ?  290 THR A CG2   1 
ATOM   2335 N  N     . GLU A 1 303 ? 185.51600 47.54600 75.81900  1.000 91.52000  ?  291 GLU A N     1 
ATOM   2336 C  CA    . GLU A 1 303 ? 186.73700 47.41000 75.02000  1.000 88.29000  ?  291 GLU A CA    1 
ATOM   2337 C  C     . GLU A 1 303 ? 187.33800 46.01100 75.09700  1.000 83.03000  ?  291 GLU A C     1 
ATOM   2338 O  O     . GLU A 1 303 ? 187.46400 45.43500 76.17200  1.000 87.60000  ?  291 GLU A O     1 
ATOM   2339 C  CB    . GLU A 1 303 ? 187.77100 48.43900 75.46200  1.000 88.44000  ?  291 GLU A CB    1 
ATOM   2340 C  CG    . GLU A 1 303 ? 189.01700 48.46500 74.60800  1.000 87.11000  ?  291 GLU A CG    1 
ATOM   2341 C  CD    . GLU A 1 303 ? 189.80400 49.75000 74.78600  1.000 97.09000  ?  291 GLU A CD    1 
ATOM   2342 O  OE1   . GLU A 1 303 ? 189.42100 50.56000 75.66000  1.000 96.59000  ?  291 GLU A OE1   1 
ATOM   2343 O  OE2   . GLU A 1 303 ? 190.80100 49.95300 74.05200  1.000 104.83000 ?  291 GLU A OE2   1 
ATOM   2344 N  N     . VAL A 1 304 ? 187.68700 45.45500 73.94800  1.000 82.53000  ?  292 VAL A N     1 
ATOM   2345 C  CA    . VAL A 1 304 ? 188.24100 44.11600 73.91100  1.000 82.66000  ?  292 VAL A CA    1 
ATOM   2346 C  C     . VAL A 1 304 ? 189.75000 44.18600 73.92800  1.000 84.02000  ?  292 VAL A C     1 
ATOM   2347 O  O     . VAL A 1 304 ? 190.34600 45.11200 73.37900  1.000 81.37000  ?  292 VAL A O     1 
ATOM   2348 C  CB    . VAL A 1 304 ? 187.77400 43.34300 72.67900  1.000 75.84000  ?  292 VAL A CB    1 
ATOM   2349 C  CG1   . VAL A 1 304 ? 188.58400 42.06700 72.50400  1.000 76.70000  ?  292 VAL A CG1   1 
ATOM   2350 C  CG2   . VAL A 1 304 ? 186.31600 43.02600 72.81500  1.000 80.99000  ?  292 VAL A CG2   1 
ATOM   2351 N  N     . ILE A 1 305 ? 190.36500 43.20700 74.57600  1.000 88.14000  ?  293 ILE A N     1 
ATOM   2352 C  CA    . ILE A 1 305 ? 191.81200 43.16000 74.66200  1.000 87.54000  ?  293 ILE A CA    1 
ATOM   2353 C  C     . ILE A 1 305 ? 192.33000 41.76900 74.33700  1.000 86.97000  ?  293 ILE A C     1 
ATOM   2354 O  O     . ILE A 1 305 ? 191.77700 40.76000 74.78200  1.000 85.82000  ?  293 ILE A O     1 
ATOM   2355 C  CB    . ILE A 1 305 ? 192.30200 43.58500 76.04900  1.000 87.44000  ?  293 ILE A CB    1 
ATOM   2356 C  CG1   . ILE A 1 305 ? 191.56500 44.85400 76.49200  1.000 87.20000  ?  293 ILE A CG1   1 
ATOM   2357 C  CG2   . ILE A 1 305 ? 193.81500 43.78300 76.03800  1.000 86.34000  ?  293 ILE A CG2   1 
ATOM   2358 C  CD1   . ILE A 1 305 ? 192.31100 45.67500 77.51100  1.000 85.59000  ?  293 ILE A CD1   1 
ATOM   2359 N  N     . PRO A 1 306 ? 193.38500 41.71900 73.52000  1.000 91.10000  ?  294 PRO A N     1 
ATOM   2360 C  CA    . PRO A 1 306 ? 194.01300 40.45400 73.13200  1.000 90.31000  ?  294 PRO A CA    1 
ATOM   2361 C  C     . PRO A 1 306 ? 194.99400 39.96500 74.19300  1.000 86.15000  ?  294 PRO A C     1 
ATOM   2362 O  O     . PRO A 1 306 ? 195.84100 40.72500 74.66800  1.000 81.98000  ?  294 PRO A O     1 
ATOM   2363 C  CB    . PRO A 1 306 ? 194.74000 40.80600 71.81800  1.000 92.65000  ?  294 PRO A CB    1 
ATOM   2364 C  CG    . PRO A 1 306 ? 194.26600 42.22700 71.44100  1.000 83.65000  ?  294 PRO A CG    1 
ATOM   2365 C  CD    . PRO A 1 306 ? 193.89800 42.86200 72.73900  1.000 86.94000  ?  294 PRO A CD    1 
ATOM   2366 N  N     . LEU A 1 307 ? 194.87900 38.69900 74.56100  1.000 82.24000  ?  295 LEU A N     1 
ATOM   2367 C  CA    . LEU A 1 307 ? 195.77100 38.15500 75.56200  1.000 83.10000  ?  295 LEU A CA    1 
ATOM   2368 C  C     . LEU A 1 307 ? 197.20100 38.15500 75.06600  1.000 86.98000  ?  295 LEU A C     1 
ATOM   2369 O  O     . LEU A 1 307 ? 197.50600 37.48400 74.08500  1.000 95.61000  ?  295 LEU A O     1 
ATOM   2370 C  CB    . LEU A 1 307 ? 195.35500 36.73600 75.95000  1.000 82.10000  ?  295 LEU A CB    1 
ATOM   2371 C  CG    . LEU A 1 307 ? 194.16600 36.67400 76.90800  1.000 80.92000  ?  295 LEU A CG    1 
ATOM   2372 C  CD1   . LEU A 1 307 ? 194.25600 35.44200 77.78300  1.000 82.16000  ?  295 LEU A CD1   1 
ATOM   2373 C  CD2   . LEU A 1 307 ? 194.09800 37.93400 77.75700  1.000 81.13000  ?  295 LEU A CD2   1 
ATOM   2374 N  N     . THR A 1 308 ? 198.07800 38.89900 75.74200  1.000 88.10000  ?  296 THR A N     1 
ATOM   2375 C  CA    . THR A 1 308 ? 199.51600 38.78700 75.48500  1.000 84.09000  ?  296 THR A CA    1 
ATOM   2376 C  C     . THR A 1 308 ? 199.95900 37.35600 75.70200  1.000 86.44000  ?  296 THR A C     1 
ATOM   2377 O  O     . THR A 1 308 ? 199.26900 36.56900 76.35200  1.000 83.47000  ?  296 THR A O     1 
ATOM   2378 C  CB    . THR A 1 308 ? 200.37900 39.69800 76.38700  1.000 82.84000  ?  296 THR A CB    1 
ATOM   2379 O  OG1   . THR A 1 308 ? 200.36000 39.21200 77.73600  1.000 88.28000  ?  296 THR A OG1   1 
ATOM   2380 C  CG2   . THR A 1 308 ? 199.88800 41.13300 76.34100  1.000 80.70000  ?  296 THR A CG2   1 
ATOM   2381 N  N     . GLU A 1 309 ? 201.11900 37.03300 75.14400  1.000 93.94000  ?  297 GLU A N     1 
ATOM   2382 C  CA    . GLU A 1 309 ? 201.66900 35.69000 75.19500  1.000 91.06000  ?  297 GLU A CA    1 
ATOM   2383 C  C     . GLU A 1 309 ? 201.93100 35.29300 76.64000  1.000 88.13000  ?  297 GLU A C     1 
ATOM   2384 O  O     . GLU A 1 309 ? 201.75500 34.13300 77.01500  1.000 86.19000  ?  297 GLU A O     1 
ATOM   2385 C  CB    . GLU A 1 309 ? 202.94600 35.63200 74.36100  1.000 89.58000  ?  297 GLU A CB    1 
ATOM   2386 C  CG    . GLU A 1 309 ? 203.55700 34.25400 74.20000  1.000 98.54000  ?  297 GLU A CG    1 
ATOM   2387 C  CD    . GLU A 1 309 ? 204.58900 34.20700 73.06700  1.000 100.58000 ?  297 GLU A CD    1 
ATOM   2388 O  OE1   . GLU A 1 309 ? 204.24800 34.65900 71.94400  1.000 101.38000 ?  297 GLU A OE1   1 
ATOM   2389 O  OE2   . GLU A 1 309 ? 205.73300 33.72800 73.30000  1.000 92.51000  ?  297 GLU A OE2   1 
ATOM   2390 N  N     . GLU A 1 310 ? 202.32900 36.28400 77.44100  1.000 90.97000  ?  298 GLU A N     1 
ATOM   2391 C  CA    . GLU A 1 310 ? 202.67000 36.09400 78.85700  1.000 90.23000  ?  298 GLU A CA    1 
ATOM   2392 C  C     . GLU A 1 310 ? 201.43000 35.96500 79.72500  1.000 86.00000  ?  298 GLU A C     1 
ATOM   2393 O  O     . GLU A 1 310 ? 201.36300 35.09900 80.59900  1.000 83.70000  ?  298 GLU A O     1 
ATOM   2394 C  CB    . GLU A 1 310 ? 203.51700 37.25700 79.37200  1.000 85.18000  ?  298 GLU A CB    1 
ATOM   2395 C  CG    . GLU A 1 310 ? 203.95300 38.22900 78.29100  1.000 92.94000  ?  298 GLU A CG    1 
ATOM   2396 C  CD    . GLU A 1 310 ? 205.17700 37.74700 77.54300  1.000 98.41000  ?  298 GLU A CD    1 
ATOM   2397 O  OE1   . GLU A 1 310 ? 205.47600 36.53400 77.59800  1.000 100.05000 ?  298 GLU A OE1   1 
ATOM   2398 O  OE2   . GLU A 1 310 ? 205.85200 38.58700 76.91200  1.000 102.96000 ?  298 GLU A OE2   1 
ATOM   2399 N  N     . ALA A 1 311 ? 200.46500 36.85100 79.49200  1.000 81.61000  ?  299 ALA A N     1 
ATOM   2400 C  CA    . ALA A 1 311 ? 199.17200 36.77500 80.15700  1.000 81.19000  ?  299 ALA A CA    1 
ATOM   2401 C  C     . ALA A 1 311 ? 198.53000 35.41900 79.87500  1.000 81.01000  ?  299 ALA A C     1 
ATOM   2402 O  O     . ALA A 1 311 ? 198.14100 34.69600 80.79000  1.000 76.68000  ?  299 ALA A O     1 
ATOM   2403 C  CB    . ALA A 1 311 ? 198.27200 37.91100 79.69800  1.000 80.70000  ?  299 ALA A CB    1 
ATOM   2404 N  N     . GLU A 1 312 ? 198.42600 35.10400 78.59000  1.000 87.32000  ?  300 GLU A N     1 
ATOM   2405 C  CA    . GLU A 1 312 ? 198.04700 33.78900 78.08500  1.000 83.68000  ?  300 GLU A CA    1 
ATOM   2406 C  C     . GLU A 1 312 ? 198.60600 32.65700 78.94800  1.000 79.31000  ?  300 GLU A C     1 
ATOM   2407 O  O     . GLU A 1 312 ? 197.87200 31.79600 79.43200  1.000 74.96000  ?  300 GLU A O     1 
ATOM   2408 C  CB    . GLU A 1 312 ? 198.55500 33.67100 76.64300  1.000 91.45000  ?  300 GLU A CB    1 
ATOM   2409 C  CG    . GLU A 1 312 ? 197.96400 32.58200 75.76600  1.000 96.32000  ?  300 GLU A CG    1 
ATOM   2410 C  CD    . GLU A 1 312 ? 198.41600 32.73700 74.31100  1.000 100.00000 ?  300 GLU A CD    1 
ATOM   2411 O  OE1   . GLU A 1 312 ? 199.31700 31.98100 73.87000  1.000 101.83000 ?  300 GLU A OE1   1 
ATOM   2412 O  OE2   . GLU A 1 312 ? 197.87700 33.63000 73.61600  1.000 97.85000  ?  300 GLU A OE2   1 
ATOM   2413 N  N     . LEU A 1 313 ? 199.91900 32.68200 79.14600  1.000 79.36000  ?  301 LEU A N     1 
ATOM   2414 C  CA    . LEU A 1 313 ? 200.61100 31.61400 79.85200  1.000 81.36000  ?  301 LEU A CA    1 
ATOM   2415 C  C     . LEU A 1 313 ? 200.25200 31.60400 81.33800  1.000 80.12000  ?  301 LEU A C     1 
ATOM   2416 O  O     . LEU A 1 313 ? 200.06400 30.53700 81.94300  1.000 74.10000  ?  301 LEU A O     1 
ATOM   2417 C  CB    . LEU A 1 313 ? 202.12400 31.75700 79.67000  1.000 83.11000  ?  301 LEU A CB    1 
ATOM   2418 C  CG    . LEU A 1 313 ? 202.99300 30.75200 80.43500  1.000 86.01000  ?  301 LEU A CG    1 
ATOM   2419 C  CD1   . LEU A 1 313 ? 203.31100 29.54700 79.55900  1.000 86.31000  ?  301 LEU A CD1   1 
ATOM   2420 C  CD2   . LEU A 1 313 ? 204.26800 31.40500 80.96500  1.000 78.80000  ?  301 LEU A CD2   1 
ATOM   2421 N  N     . GLU A 1 314 ? 200.15800 32.80600 81.90900  1.000 80.30000  ?  302 GLU A N     1 
ATOM   2422 C  CA    . GLU A 1 314 ? 199.83300 33.00400 83.32500  1.000 77.74000  ?  302 GLU A CA    1 
ATOM   2423 C  C     . GLU A 1 314 ? 198.46300 32.43400 83.66800  1.000 72.63000  ?  302 GLU A C     1 
ATOM   2424 O  O     . GLU A 1 314 ? 198.31800 31.66200 84.61400  1.000 72.22000  ?  302 GLU A O     1 
ATOM   2425 C  CB    . GLU A 1 314 ? 199.89000 34.49500 83.67300  1.000 76.71000  ?  302 GLU A CB    1 
ATOM   2426 C  CG    . GLU A 1 314 ? 199.77400 34.82700 85.16500  1.000 77.50000  ?  302 GLU A CG    1 
ATOM   2427 C  CD    . GLU A 1 314 ? 200.02800 36.31000 85.45500  1.000 79.89000  ?  302 GLU A CD    1 
ATOM   2428 O  OE1   . GLU A 1 314 ? 199.09500 37.11100 85.22300  1.000 77.79000  ?  302 GLU A OE1   1 
ATOM   2429 O  OE2   . GLU A 1 314 ? 201.15400 36.67500 85.90000  1.000 79.66000  ?  302 GLU A OE2   1 
ATOM   2430 N  N     . LEU A 1 315 ? 197.46500 32.81500 82.87800  1.000 73.90000  ?  303 LEU A N     1 
ATOM   2431 C  CA    . LEU A 1 315 ? 196.11400 32.28000 83.00300  1.000 75.33000  ?  303 LEU A CA    1 
ATOM   2432 C  C     . LEU A 1 315 ? 196.09000 30.74800 82.99600  1.000 74.54000  ?  303 LEU A C     1 
ATOM   2433 O  O     . LEU A 1 315 ? 195.33400 30.11800 83.74000  1.000 76.27000  ?  303 LEU A O     1 
ATOM   2434 C  CB    . LEU A 1 315 ? 195.23300 32.82400 81.87700  1.000 75.05000  ?  303 LEU A CB    1 
ATOM   2435 C  CG    . LEU A 1 315 ? 193.81300 32.27000 81.84100  1.000 76.20000  ?  303 LEU A CG    1 
ATOM   2436 C  CD1   . LEU A 1 315 ? 193.24300 32.22800 83.24400  1.000 75.15000  ?  303 LEU A CD1   1 
ATOM   2437 C  CD2   . LEU A 1 315 ? 192.94900 33.12500 80.94600  1.000 77.40000  ?  303 LEU A CD2   1 
ATOM   2438 N  N     . ALA A 1 316 ? 196.92200 30.15000 82.15500  1.000 77.84000  ?  304 ALA A N     1 
ATOM   2439 C  CA    . ALA A 1 316 ? 197.06400 28.70300 82.14300  1.000 72.90000  ?  304 ALA A CA    1 
ATOM   2440 C  C     . ALA A 1 316 ? 197.53000 28.18300 83.49900  1.000 70.53000  ?  304 ALA A C     1 
ATOM   2441 O  O     . ALA A 1 316 ? 196.90700 27.28300 84.05300  1.000 73.78000  ?  304 ALA A O     1 
ATOM   2442 C  CB    . ALA A 1 316 ? 198.02700 28.28400 81.06000  1.000 76.89000  ?  304 ALA A CB    1 
ATOM   2443 N  N     . GLU A 1 317 ? 198.61400 28.74800 84.03600  1.000 69.81000  ?  305 GLU A N     1 
ATOM   2444 C  CA    . GLU A 1 317 ? 199.19600 28.24300 85.29000  1.000 73.21000  ?  305 GLU A CA    1 
ATOM   2445 C  C     . GLU A 1 317 ? 198.17300 28.28200 86.41800  1.000 71.99000  ?  305 GLU A C     1 
ATOM   2446 O  O     . GLU A 1 317 ? 198.00800 27.30800 87.17000  1.000 69.88000  ?  305 GLU A O     1 
ATOM   2447 C  CB    . GLU A 1 317 ? 200.43500 29.05100 85.69800  1.000 75.71000  ?  305 GLU A CB    1 
ATOM   2448 C  CG    . GLU A 1 317 ? 201.44100 29.33400 84.57700  1.000 80.92000  ?  305 GLU A CG    1 
ATOM   2449 C  CD    . GLU A 1 317 ? 202.63600 30.16200 85.05600  1.000 84.78000  ?  305 GLU A CD    1 
ATOM   2450 O  OE1   . GLU A 1 317 ? 202.79600 30.31400 86.29000  1.000 86.45000  ?  305 GLU A OE1   1 
ATOM   2451 O  OE2   . GLU A 1 317 ? 203.40800 30.66700 84.20400  1.000 84.63000  ?  305 GLU A OE2   1 
ATOM   2452 N  N     . ASN A 1 318 ? 197.49500 29.42500 86.52300  1.000 67.72000  ?  306 ASN A N     1 
ATOM   2453 C  CA    . ASN A 1 318 ? 196.40000 29.59300 87.46300  1.000 68.63000  ?  306 ASN A CA    1 
ATOM   2454 C  C     . ASN A 1 318 ? 195.32500 28.52300 87.27400  1.000 70.38000  ?  306 ASN A C     1 
ATOM   2455 O  O     . ASN A 1 318 ? 194.84800 27.94500 88.25900  1.000 68.17000  ?  306 ASN A O     1 
ATOM   2456 C  CB    . ASN A 1 318 ? 195.78400 30.98600 87.32300  1.000 67.75000  ?  306 ASN A CB    1 
ATOM   2457 C  CG    . ASN A 1 318 ? 196.64000 32.06000 87.94400  1.000 64.30000  ?  306 ASN A CG    1 
ATOM   2458 O  OD1   . ASN A 1 318 ? 197.32000 31.82200 88.94000  1.000 65.96000  ?  306 ASN A OD1   1 
ATOM   2459 N  ND2   . ASN A 1 318 ? 196.61600 33.25200 87.36300  1.000 62.52000  ?  306 ASN A ND2   1 
ATOM   2460 N  N     . ARG A 1 319 ? 194.95300 28.25100 86.02000  1.000 65.00000  ?  307 ARG A N     1 
ATOM   2461 C  CA    . ARG A 1 319 ? 193.94900 27.21900 85.73900  1.000 67.30000  ?  307 ARG A CA    1 
ATOM   2462 C  C     . ARG A 1 319 ? 194.34900 25.84400 86.27200  1.000 67.93000  ?  307 ARG A C     1 
ATOM   2463 O  O     . ARG A 1 319 ? 193.50100 25.08000 86.72800  1.000 68.09000  ?  307 ARG A O     1 
ATOM   2464 C  CB    . ARG A 1 319 ? 193.67200 27.12900 84.24300  1.000 69.49000  ?  307 ARG A CB    1 
ATOM   2465 C  CG    . ARG A 1 319 ? 192.66400 28.14700 83.75000  1.000 71.98000  ?  307 ARG A CG    1 
ATOM   2466 C  CD    . ARG A 1 319 ? 192.45900 28.05800 82.25400  1.000 74.06000  ?  307 ARG A CD    1 
ATOM   2467 N  NE    . ARG A 1 319 ? 191.59000 29.12900 81.77900  1.000 80.81000  ?  307 ARG A NE    1 
ATOM   2468 C  CZ    . ARG A 1 319 ? 190.27000 29.14500 81.94100  1.000 87.90000  ?  307 ARG A CZ    1 
ATOM   2469 N  NH1   . ARG A 1 319 ? 189.65600 28.14600 82.57200  1.000 86.02000  ?  307 ARG A NH1   1 
ATOM   2470 N  NH2   . ARG A 1 319 ? 189.56300 30.16700 81.47400  1.000 91.01000  ?  307 ARG A NH2   1 
ATOM   2471 N  N     . GLU A 1 320 ? 195.64100 25.54000 86.22300  1.000 69.55000  ?  308 GLU A N     1 
ATOM   2472 C  CA    . GLU A 1 320 ? 196.13200 24.26700 86.71900  1.000 69.34000  ?  308 GLU A CA    1 
ATOM   2473 C  C     . GLU A 1 320 ? 196.11200 24.26500 88.22900  1.000 69.49000  ?  308 GLU A C     1 
ATOM   2474 O  O     . GLU A 1 320 ? 195.78700 23.25700 88.85900  1.000 67.49000  ?  308 GLU A O     1 
ATOM   2475 C  CB    . GLU A 1 320 ? 197.54200 23.99500 86.20200  1.000 70.89000  ?  308 GLU A CB    1 
ATOM   2476 C  CG    . GLU A 1 320 ? 197.61700 23.88200 84.68700  1.000 79.35000  ?  308 GLU A CG    1 
ATOM   2477 C  CD    . GLU A 1 320 ? 196.46400 23.05800 84.08700  1.000 84.88000  ?  308 GLU A CD    1 
ATOM   2478 O  OE1   . GLU A 1 320 ? 195.77100 23.57400 83.17000  1.000 78.28000  ?  308 GLU A OE1   1 
ATOM   2479 O  OE2   . GLU A 1 320 ? 196.25600 21.90000 84.52900  1.000 82.21000  ?  308 GLU A OE2   1 
ATOM   2480 N  N     . ILE A 1 321 ? 196.47300 25.40700 88.80300  1.000 67.85000  ?  309 ILE A N     1 
ATOM   2481 C  CA    . ILE A 1 321 ? 196.43100 25.58300 90.24500  1.000 70.47000  ?  309 ILE A CA    1 
ATOM   2482 C  C     . ILE A 1 321 ? 195.02900 25.32100 90.79100  1.000 68.83000  ?  309 ILE A C     1 
ATOM   2483 O  O     . ILE A 1 321 ? 194.84800 24.55000 91.73600  1.000 67.57000  ?  309 ILE A O     1 
ATOM   2484 C  CB    . ILE A 1 321 ? 196.88600 27.00800 90.65200  1.000 69.33000  ?  309 ILE A CB    1 
ATOM   2485 C  CG1   . ILE A 1 321 ? 198.34200 27.23100 90.23800  1.000 65.64000  ?  309 ILE A CG1   1 
ATOM   2486 C  CG2   . ILE A 1 321 ? 196.70100 27.23500 92.16800  1.000 65.97000  ?  309 ILE A CG2   1 
ATOM   2487 C  CD1   . ILE A 1 321 ? 198.87200 28.61000 90.53000  1.000 65.48000  ?  309 ILE A CD1   1 
ATOM   2488 N  N     . LEU A 1 322 ? 194.03800 25.95600 90.18000  1.000 66.89000  ?  310 LEU A N     1 
ATOM   2489 C  CA    . LEU A 1 322 ? 192.66300 25.84800 90.65200  1.000 68.69000  ?  310 LEU A CA    1 
ATOM   2490 C  C     . LEU A 1 322 ? 192.09700 24.42100 90.56300  1.000 72.59000  ?  310 LEU A C     1 
ATOM   2491 O  O     . LEU A 1 322 ? 191.17000 24.07300 91.31100  1.000 74.18000  ?  310 LEU A O     1 
ATOM   2492 C  CB    . LEU A 1 322 ? 191.77900 26.82600 89.87700  1.000 68.06000  ?  310 LEU A CB    1 
ATOM   2493 C  CG    . LEU A 1 322 ? 191.89600 28.29100 90.31100  1.000 62.46000  ?  310 LEU A CG    1 
ATOM   2494 C  CD1   . LEU A 1 322 ? 191.06700 29.23500 89.43800  1.000 65.89000  ?  310 LEU A CD1   1 
ATOM   2495 C  CD2   . LEU A 1 322 ? 191.47100 28.39400 91.74700  1.000 62.71000  ?  310 LEU A CD2   1 
ATOM   2496 N  N     . LYS A 1 323 ? 192.66200 23.59600 89.67600  1.000 70.71000  ?  311 LYS A N     1 
ATOM   2497 C  CA    . LYS A 1 323 ? 192.20100 22.21000 89.50700  1.000 71.87000  ?  311 LYS A CA    1 
ATOM   2498 C  C     . LYS A 1 323 ? 192.43800 21.32900 90.73700  1.000 72.69000  ?  311 LYS A C     1 
ATOM   2499 O  O     . LYS A 1 323 ? 191.66100 20.42200 91.00100  1.000 76.91000  ?  311 LYS A O     1 
ATOM   2500 C  CB    . LYS A 1 323 ? 192.86500 21.55900 88.28800  1.000 70.97000  ?  311 LYS A CB    1 
ATOM   2501 C  CG    . LYS A 1 323 ? 192.24400 21.94900 86.94600  1.000 72.21000  ?  311 LYS A CG    1 
ATOM   2502 C  CD    . LYS A 1 323 ? 192.96100 21.28000 85.77800  1.000 77.20000  ?  311 LYS A CD    1 
ATOM   2503 C  CE    . LYS A 1 323 ? 192.29100 21.57800 84.43800  1.000 86.42000  ?  311 LYS A CE    1 
ATOM   2504 N  NZ    . LYS A 1 323 ? 193.21400 21.26700 83.29700  1.000 86.33000  ?  311 LYS A NZ    1 
ATOM   2505 N  N     . GLU A 1 324 ? 193.50500 21.58600 91.48200  1.000 74.70000  ?  312 GLU A N     1 
ATOM   2506 C  CA    . GLU A 1 324 ? 193.82800 20.77000 92.65200  1.000 75.97000  ?  312 GLU A CA    1 
ATOM   2507 C  C     . GLU A 1 324 ? 192.81600 20.98600 93.76100  1.000 78.31000  ?  312 GLU A C     1 
ATOM   2508 O  O     . GLU A 1 324 ? 192.05700 21.95800 93.74800  1.000 79.00000  ?  312 GLU A O     1 
ATOM   2509 C  CB    . GLU A 1 324 ? 195.23000 21.08500 93.18800  1.000 80.19000  ?  312 GLU A CB    1 
ATOM   2510 C  CG    . GLU A 1 324 ? 196.30800 21.25500 92.12800  1.000 84.44000  ?  312 GLU A CG    1 
ATOM   2511 C  CD    . GLU A 1 324 ? 196.50100 20.01700 91.28300  1.000 89.60000  ?  312 GLU A CD    1 
ATOM   2512 O  OE1   . GLU A 1 324 ? 196.43700 18.89700 91.84300  1.000 96.45000  ?  312 GLU A OE1   1 
ATOM   2513 O  OE2   . GLU A 1 324 ? 196.71000 20.17200 90.05900  1.000 87.85000  ?  312 GLU A OE2   1 
ATOM   2514 N  N     . PRO A 1 325 ? 192.80600 20.07600 94.73500  1.000 75.04000  ?  313 PRO A N     1 
ATOM   2515 C  CA    . PRO A 1 325 ? 191.90500 20.21500 95.87000  1.000 71.95000  ?  313 PRO A CA    1 
ATOM   2516 C  C     . PRO A 1 325 ? 192.66000 20.85500 97.02000  1.000 74.30000  ?  313 PRO A C     1 
ATOM   2517 O  O     . PRO A 1 325 ? 193.85300 20.60200 97.16300  1.000 75.55000  ?  313 PRO A O     1 
ATOM   2518 C  CB    . PRO A 1 325 ? 191.51200 18.76700 96.17200  1.000 70.28000  ?  313 PRO A CB    1 
ATOM   2519 C  CG    . PRO A 1 325 ? 192.71600 17.94200 95.69100  1.000 74.00000  ?  313 PRO A CG    1 
ATOM   2520 C  CD    . PRO A 1 325 ? 193.58800 18.83400 94.82100  1.000 73.45000  ?  313 PRO A CD    1 
ATOM   2521 N  N     . VAL A 1 326 ? 191.99500 21.66900 97.82700  1.000 68.45000  ?  314 VAL A N     1 
ATOM   2522 C  CA    . VAL A 1 326 ? 192.70700 22.38600 98.86500  1.000 60.82000  ?  314 VAL A CA    1 
ATOM   2523 C  C     . VAL A 1 326 ? 191.80600 22.70000 100.07400 1.000 59.62000  ?  314 VAL A C     1 
ATOM   2524 O  O     . VAL A 1 326 ? 190.59200 22.65200 100.00100 1.000 58.22000  ?  314 VAL A O     1 
ATOM   2525 C  CB    . VAL A 1 326 ? 193.33100 23.67500 98.26500  1.000 61.51000  ?  314 VAL A CB    1 
ATOM   2526 C  CG1   . VAL A 1 326 ? 192.26900 24.53600 97.58700  1.000 61.22000  ?  314 VAL A CG1   1 
ATOM   2527 C  CG2   . VAL A 1 326 ? 194.08600 24.45700 99.31700  1.000 67.27000  ?  314 VAL A CG2   1 
ATOM   2528 N  N     . HIS A 1 327 ? 192.40300 22.98500 101.21200 1.000 56.55000  ?  315 HIS A N     1 
ATOM   2529 C  CA    . HIS A 1 327 ? 191.60200 23.36900 102.34500 1.000 54.88000  ?  315 HIS A CA    1 
ATOM   2530 C  C     . HIS A 1 327 ? 192.45500 24.12300 103.34300 1.000 56.69000  ?  315 HIS A C     1 
ATOM   2531 O  O     . HIS A 1 327 ? 193.67000 24.24100 103.18400 1.000 56.16000  ?  315 HIS A O     1 
ATOM   2532 C  CB    . HIS A 1 327 ? 190.97500 22.15200 102.98800 1.000 52.10000  ?  315 HIS A CB    1 
ATOM   2533 C  CG    . HIS A 1 327 ? 191.97400 21.17400 103.51300 1.000 59.65000  ?  315 HIS A CG    1 
ATOM   2534 N  ND1   . HIS A 1 327 ? 192.48500 21.24800 104.79100 1.000 62.22000  ?  315 HIS A ND1   1 
ATOM   2535 C  CD2   . HIS A 1 327 ? 192.56500 20.10300 102.93400 1.000 59.41000  ?  315 HIS A CD2   1 
ATOM   2536 C  CE1   . HIS A 1 327 ? 193.34000 20.25800 104.98000 1.000 58.78000  ?  315 HIS A CE1   1 
ATOM   2537 N  NE2   . HIS A 1 327 ? 193.40200 19.54700 103.87000 1.000 51.40000  ?  315 HIS A NE2   1 
ATOM   2538 N  N     . GLY A 1 328 ? 191.80500 24.66600 104.35600 1.000 51.20000  ?  316 GLY A N     1 
ATOM   2539 C  CA    . GLY A 1 328 ? 192.51300 25.36100 105.39700 1.000 48.01000  ?  316 GLY A CA    1 
ATOM   2540 C  C     . GLY A 1 328 ? 192.14400 24.69600 106.69400 1.000 50.95000  ?  316 GLY A C     1 
ATOM   2541 O  O     . GLY A 1 328 ? 191.28500 23.80800 106.72700 1.000 54.94000  ?  316 GLY A O     1 
ATOM   2542 N  N     . VAL A 1 329 ? 192.78600 25.12900 107.76500 1.000 42.66000  ?  317 VAL A N     1 
ATOM   2543 C  CA    . VAL A 1 329 ? 192.48600 24.61300 109.08100 1.000 49.74000  ?  317 VAL A CA    1 
ATOM   2544 C  C     . VAL A 1 329 ? 192.09200 25.78000 109.98000 1.000 48.44000  ?  317 VAL A C     1 
ATOM   2545 O  O     . VAL A 1 329 ? 192.15700 26.92800 109.56600 1.000 53.18000  ?  317 VAL A O     1 
ATOM   2546 C  CB    . VAL A 1 329 ? 193.69000 23.84500 109.65100 1.000 50.42000  ?  317 VAL A CB    1 
ATOM   2547 C  CG1   . VAL A 1 329 ? 194.12500 22.79700 108.64600 1.000 44.39000  ?  317 VAL A CG1   1 
ATOM   2548 C  CG2   . VAL A 1 329 ? 194.81400 24.78600 109.93900 1.000 41.72000  ?  317 VAL A CG2   1 
ATOM   2549 N  N     . TYR A 1 330 ? 191.68100 25.49700 111.20200 1.000 49.61000  ?  318 TYR A N     1 
ATOM   2550 C  CA    . TYR A 1 330 ? 191.24900 26.55600 112.09500 1.000 45.82000  ?  318 TYR A CA    1 
ATOM   2551 C  C     . TYR A 1 330 ? 192.38900 27.01200 112.98200 1.000 47.01000  ?  318 TYR A C     1 
ATOM   2552 O  O     . TYR A 1 330 ? 193.46300 26.43500 112.98100 1.000 49.09000  ?  318 TYR A O     1 
ATOM   2553 C  CB    . TYR A 1 330 ? 190.05100 26.09000 112.92100 1.000 42.44000  ?  318 TYR A CB    1 
ATOM   2554 C  CG    . TYR A 1 330 ? 188.89200 25.70000 112.01600 1.000 47.14000  ?  318 TYR A CG    1 
ATOM   2555 C  CD1   . TYR A 1 330 ? 188.30400 26.63100 111.16900 1.000 48.36000  ?  318 TYR A CD1   1 
ATOM   2556 C  CD2   . TYR A 1 330 ? 188.40500 24.41000 111.99100 1.000 47.01000  ?  318 TYR A CD2   1 
ATOM   2557 C  CE1   . TYR A 1 330 ? 187.25700 26.28100 110.32000 1.000 48.16000  ?  318 TYR A CE1   1 
ATOM   2558 C  CE2   . TYR A 1 330 ? 187.36300 24.05500 111.15900 1.000 52.00000  ?  318 TYR A CE2   1 
ATOM   2559 C  CZ    . TYR A 1 330 ? 186.79400 24.99000 110.32200 1.000 53.51000  ?  318 TYR A CZ    1 
ATOM   2560 O  OH    . TYR A 1 330 ? 185.76500 24.62000 109.48300 1.000 54.01000  ?  318 TYR A OH    1 
ATOM   2561 N  N     . TYR A 1 331 ? 192.15800 28.07300 113.73100 1.000 49.61000  ?  319 TYR A N     1 
ATOM   2562 C  CA    . TYR A 1 331 ? 193.21400 28.66500 114.52000 1.000 42.63000  ?  319 TYR A CA    1 
ATOM   2563 C  C     . TYR A 1 331 ? 193.29200 27.96900 115.86000 1.000 43.14000  ?  319 TYR A C     1 
ATOM   2564 O  O     . TYR A 1 331 ? 192.27500 27.77100 116.52900 1.000 46.20000  ?  319 TYR A O     1 
ATOM   2565 C  CB    . TYR A 1 331 ? 192.96000 30.17000 114.66500 1.000 44.05000  ?  319 TYR A CB    1 
ATOM   2566 C  CG    . TYR A 1 331 ? 193.93400 30.92700 115.54000 1.000 46.68000  ?  319 TYR A CG    1 
ATOM   2567 C  CD1   . TYR A 1 331 ? 195.31500 30.82900 115.35100 1.000 44.09000  ?  319 TYR A CD1   1 
ATOM   2568 C  CD2   . TYR A 1 331 ? 193.47000 31.76800 116.53800 1.000 43.55000  ?  319 TYR A CD2   1 
ATOM   2569 C  CE1   . TYR A 1 331 ? 196.20000 31.54000 116.15500 1.000 42.38000  ?  319 TYR A CE1   1 
ATOM   2570 C  CE2   . TYR A 1 331 ? 194.34600 32.47600 117.34200 1.000 45.91000  ?  319 TYR A CE2   1 
ATOM   2571 C  CZ    . TYR A 1 331 ? 195.70500 32.36000 117.15000 1.000 47.41000  ?  319 TYR A CZ    1 
ATOM   2572 O  OH    . TYR A 1 331 ? 196.54500 33.07300 117.96400 1.000 49.72000  ?  319 TYR A OH    1 
ATOM   2573 N  N     . ASP A 1 332 ? 194.50600 27.56200 116.22000 1.000 48.99000  ?  320 ASP A N     1 
ATOM   2574 C  CA    . ASP A 1 332 ? 194.82500 27.10700 117.57000 1.000 47.83000  ?  320 ASP A CA    1 
ATOM   2575 C  C     . ASP A 1 332 ? 195.73100 28.12500 118.25900 1.000 51.97000  ?  320 ASP A C     1 
ATOM   2576 O  O     . ASP A 1 332 ? 196.91300 28.22800 117.92800 1.000 49.59000  ?  320 ASP A O     1 
ATOM   2577 C  CB    . ASP A 1 332 ? 195.49900 25.74700 117.53600 1.000 46.62000  ?  320 ASP A CB    1 
ATOM   2578 C  CG    . ASP A 1 332 ? 195.86300 25.23700 118.93300 1.000 58.28000  ?  320 ASP A CG    1 
ATOM   2579 O  OD1   . ASP A 1 332 ? 195.47600 25.87900 119.94400 1.000 56.46000  ?  320 ASP A OD1   1 
ATOM   2580 O  OD2   . ASP A 1 332 ? 196.52800 24.17800 119.01900 1.000 54.51000  ?  320 ASP A OD2   1 
ATOM   2581 N  N     . PRO A 1 333 ? 195.17700 28.87800 119.22400 1.000 51.04000  ?  321 PRO A N     1 
ATOM   2582 C  CA    . PRO A 1 333 ? 195.86600 30.01100 119.85200 1.000 50.54000  ?  321 PRO A CA    1 
ATOM   2583 C  C     . PRO A 1 333 ? 196.99800 29.60500 120.80000 1.000 54.43000  ?  321 PRO A C     1 
ATOM   2584 O  O     . PRO A 1 333 ? 197.85700 30.42400 121.11900 1.000 56.79000  ?  321 PRO A O     1 
ATOM   2585 C  CB    . PRO A 1 333 ? 194.74000 30.71600 120.61800 1.000 44.36000  ?  321 PRO A CB    1 
ATOM   2586 C  CG    . PRO A 1 333 ? 193.78900 29.67300 120.92300 1.000 42.45000  ?  321 PRO A CG    1 
ATOM   2587 C  CD    . PRO A 1 333 ? 193.80300 28.73900 119.72900 1.000 49.74000  ?  321 PRO A CD    1 
ATOM   2588 N  N     . SER A 1 334 ? 196.99900 28.35500 121.24200 1.000 57.60000  ?  322 SER A N     1 
ATOM   2589 C  CA    . SER A 1 334 ? 198.07000 27.85100 122.09900 1.000 57.17000  ?  322 SER A CA    1 
ATOM   2590 C  C     . SER A 1 334 ? 199.34900 27.63500 121.29900 1.000 56.88000  ?  322 SER A C     1 
ATOM   2591 O  O     . SER A 1 334 ? 200.36200 27.20300 121.83500 1.000 57.24000  ?  322 SER A O     1 
ATOM   2592 C  CB    . SER A 1 334 ? 197.65700 26.53500 122.75100 1.000 57.50000  ?  322 SER A CB    1 
ATOM   2593 O  OG    . SER A 1 334 ? 197.49800 25.53700 121.74900 1.000 59.33000  ?  322 SER A OG    1 
ATOM   2594 N  N     . LYS A 1 335 ? 199.27600 27.90500 120.00100 1.000 59.03000  ?  323 LYS A N     1 
ATOM   2595 C  CA    . LYS A 1 335 ? 200.39700 27.67900 119.09700 1.000 56.45000  ?  323 LYS A CA    1 
ATOM   2596 C  C     . LYS A 1 335 ? 200.82600 28.96900 118.40200 1.000 56.42000  ?  323 LYS A C     1 
ATOM   2597 O  O     . LYS A 1 335 ? 200.17500 30.01400 118.51500 1.000 60.10000  ?  323 LYS A O     1 
ATOM   2598 C  CB    . LYS A 1 335 ? 200.04400 26.61100 118.06100 1.000 52.08000  ?  323 LYS A CB    1 
ATOM   2599 C  CG    . LYS A 1 335 ? 199.90600 25.21500 118.63800 1.000 58.23000  ?  323 LYS A CG    1 
ATOM   2600 C  CD    . LYS A 1 335 ? 199.53900 24.20700 117.54400 1.000 64.55000  ?  323 LYS A CD    1 
ATOM   2601 C  CE    . LYS A 1 335 ? 199.63500 22.76100 118.04800 1.000 67.81000  ?  323 LYS A CE    1 
ATOM   2602 N  NZ    . LYS A 1 335 ? 198.92700 22.56300 119.35600 1.000 68.78000  ?  323 LYS A NZ    1 
ATOM   2603 N  N     . ASP A 1 336 ? 201.94100 28.88600 117.69500 1.000 55.18000  ?  324 ASP A N     1 
ATOM   2604 C  CA    . ASP A 1 336 ? 202.48200 30.02300 116.98100 1.000 54.55000  ?  324 ASP A CA    1 
ATOM   2605 C  C     . ASP A 1 336 ? 201.85200 30.20700 115.61900 1.000 53.18000  ?  324 ASP A C     1 
ATOM   2606 O  O     . ASP A 1 336 ? 201.43500 29.25300 114.97700 1.000 54.93000  ?  324 ASP A O     1 
ATOM   2607 C  CB    . ASP A 1 336 ? 203.99500 29.87400 116.81000 1.000 60.01000  ?  324 ASP A CB    1 
ATOM   2608 C  CG    . ASP A 1 336 ? 204.76500 30.35500 118.01900 1.000 67.42000  ?  324 ASP A CG    1 
ATOM   2609 O  OD1   . ASP A 1 336 ? 204.98100 29.55200 118.94700 1.000 69.37000  ?  324 ASP A OD1   1 
ATOM   2610 O  OD2   . ASP A 1 336 ? 205.15000 31.54100 118.04100 1.000 72.13000  ?  324 ASP A OD2   1 
ATOM   2611 N  N     . LEU A 1 337 ? 201.81700 31.45800 115.19100 1.000 54.15000  ?  325 LEU A N     1 
ATOM   2612 C  CA    . LEU A 1 337 ? 201.47800 31.82800 113.84100 1.000 49.39000  ?  325 LEU A CA    1 
ATOM   2613 C  C     . LEU A 1 337 ? 202.71200 31.97100 112.96200 1.000 51.73000  ?  325 LEU A C     1 
ATOM   2614 O  O     . LEU A 1 337 ? 203.57300 32.80500 113.22700 1.000 49.50000  ?  325 LEU A O     1 
ATOM   2615 C  CB    . LEU A 1 337 ? 200.72700 33.13800 113.85800 1.000 49.47000  ?  325 LEU A CB    1 
ATOM   2616 C  CG    . LEU A 1 337 ? 199.24100 32.95900 113.70100 1.000 51.55000  ?  325 LEU A CG    1 
ATOM   2617 C  CD1   . LEU A 1 337 ? 198.59300 34.32100 113.64100 1.000 49.54000  ?  325 LEU A CD1   1 
ATOM   2618 C  CD2   . LEU A 1 337 ? 199.00900 32.17300 112.42700 1.000 49.52000  ?  325 LEU A CD2   1 
ATOM   2619 N  N     . ILE A 1 338 ? 202.78700 31.19200 111.89300 1.000 49.95000  ?  326 ILE A N     1 
ATOM   2620 C  CA    . ILE A 1 338 ? 203.94000 31.27800 111.01400 1.000 52.09000  ?  326 ILE A CA    1 
ATOM   2621 C  C     . ILE A 1 338 ? 203.55500 31.72100 109.61500 1.000 52.51000  ?  326 ILE A C     1 
ATOM   2622 O  O     . ILE A 1 338 ? 202.65900 31.15100 108.99400 1.000 54.50000  ?  326 ILE A O     1 
ATOM   2623 C  CB    . ILE A 1 338 ? 204.68900 29.92800 110.92300 1.000 54.90000  ?  326 ILE A CB    1 
ATOM   2624 C  CG1   . ILE A 1 338 ? 205.28600 29.57300 112.27400 1.000 47.38000  ?  326 ILE A CG1   1 
ATOM   2625 C  CG2   . ILE A 1 338 ? 205.79700 29.98100 109.87400 1.000 53.73000  ?  326 ILE A CG2   1 
ATOM   2626 C  CD1   . ILE A 1 338 ? 205.03500 28.15800 112.65700 1.000 55.76000  ?  326 ILE A CD1   1 
ATOM   2627 N  N     . ALA A 1 339 ? 204.25600 32.73500 109.11800 1.000 48.36000  ?  327 ALA A N     1 
ATOM   2628 C  CA    . ALA A 1 339 ? 204.07900 33.18100 107.74400 1.000 49.90000  ?  327 ALA A CA    1 
ATOM   2629 C  C     . ALA A 1 339 ? 205.31400 32.85400 106.90100 1.000 51.57000  ?  327 ALA A C     1 
ATOM   2630 O  O     . ALA A 1 339 ? 206.44100 33.17100 107.27300 1.000 55.82000  ?  327 ALA A O     1 
ATOM   2631 C  CB    . ALA A 1 339 ? 203.79500 34.66100 107.71000 1.000 46.89000  ?  327 ALA A CB    1 
ATOM   2632 N  N     . GLU A 1 340 ? 205.08600 32.21400 105.76800 1.000 45.55000  ?  328 GLU A N     1 
ATOM   2633 C  CA    . GLU A 1 340 ? 206.13800 31.79400 104.86300 1.000 48.17000  ?  328 GLU A CA    1 
ATOM   2634 C  C     . GLU A 1 340 ? 205.93800 32.55000 103.56000 1.000 52.70000  ?  328 GLU A C     1 
ATOM   2635 O  O     . GLU A 1 340 ? 204.87700 32.43500 102.95500 1.000 53.24000  ?  328 GLU A O     1 
ATOM   2636 C  CB    . GLU A 1 340 ? 206.03700 30.29100 104.62800 1.000 56.51000  ?  328 GLU A CB    1 
ATOM   2637 C  CG    . GLU A 1 340 ? 207.31700 29.49700 104.47500 1.000 61.97000  ?  328 GLU A CG    1 
ATOM   2638 C  CD    . GLU A 1 340 ? 207.01000 28.00300 104.23300 1.000 77.81000  ?  328 GLU A CD    1 
ATOM   2639 O  OE1   . GLU A 1 340 ? 207.85100 27.15800 104.64100 1.000 72.53000  ?  328 GLU A OE1   1 
ATOM   2640 O  OE2   . GLU A 1 340 ? 205.92200 27.68500 103.64500 1.000 69.99000  ?  328 GLU A OE2   1 
ATOM   2641 N  N     . ILE A 1 341 ? 206.92200 33.33200 103.12600 1.000 49.72000  ?  329 ILE A N     1 
ATOM   2642 C  CA    . ILE A 1 341 ? 206.79600 34.05400 101.85900 1.000 50.38000  ?  329 ILE A CA    1 
ATOM   2643 C  C     . ILE A 1 341 ? 207.65100 33.42300 100.76000 1.000 52.93000  ?  329 ILE A C     1 
ATOM   2644 O  O     . ILE A 1 341 ? 208.72900 32.90300 101.03100 1.000 62.22000  ?  329 ILE A O     1 
ATOM   2645 C  CB    . ILE A 1 341 ? 207.19200 35.54400 102.01500 1.000 49.81000  ?  329 ILE A CB    1 
ATOM   2646 C  CG1   . ILE A 1 341 ? 206.41900 36.20300 103.15900 1.000 48.90000  ?  329 ILE A CG1   1 
ATOM   2647 C  CG2   . ILE A 1 341 ? 206.91800 36.30700 100.74700 1.000 50.84000  ?  329 ILE A CG2   1 
ATOM   2648 C  CD1   . ILE A 1 341 ? 206.54100 37.72900 103.17200 1.000 44.22000  ?  329 ILE A CD1   1 
ATOM   2649 N  N     . GLN A 1 342 ? 207.17600 33.48100 99.52200  1.000 50.02000  ?  330 GLN A N     1 
ATOM   2650 C  CA    . GLN A 1 342 ? 207.91300 32.95900 98.37300  1.000 52.67000  ?  330 GLN A CA    1 
ATOM   2651 C  C     . GLN A 1 342 ? 208.03200 33.99300 97.25600  1.000 56.68000  ?  330 GLN A C     1 
ATOM   2652 O  O     . GLN A 1 342 ? 207.03400 34.57300 96.85400  1.000 54.00000  ?  330 GLN A O     1 
ATOM   2653 C  CB    . GLN A 1 342 ? 207.23200 31.70700 97.81400  1.000 52.91000  ?  330 GLN A CB    1 
ATOM   2654 C  CG    . GLN A 1 342 ? 207.54800 30.43200 98.55700  1.000 60.49000  ?  330 GLN A CG    1 
ATOM   2655 C  CD    . GLN A 1 342 ? 206.42800 29.99800 99.48700  1.000 73.43000  ?  330 GLN A CD    1 
ATOM   2656 O  OE1   . GLN A 1 342 ? 205.23300 30.14600 99.16200  1.000 76.61000  ?  330 GLN A OE1   1 
ATOM   2657 N  NE2   . GLN A 1 342 ? 206.80400 29.46200 100.65900 1.000 68.59000  ?  330 GLN A NE2   1 
ATOM   2658 N  N     . LYS A 1 343 ? 209.23600 34.20900 96.72600  1.000 62.78000  ?  331 LYS A N     1 
ATOM   2659 C  CA    . LYS A 1 343 ? 209.38300 35.14300 95.61100  1.000 56.47000  ?  331 LYS A CA    1 
ATOM   2660 C  C     . LYS A 1 343 ? 208.88200 34.52000 94.32900  1.000 54.30000  ?  331 LYS A C     1 
ATOM   2661 O  O     . LYS A 1 343 ? 209.16200 33.37000 94.05400  1.000 59.66000  ?  331 LYS A O     1 
ATOM   2662 C  CB    . LYS A 1 343 ? 210.82500 35.59000 95.42300  1.000 56.00000  ?  331 LYS A CB    1 
ATOM   2663 C  CG    . LYS A 1 343 ? 210.91700 36.68100 94.38200  1.000 52.55000  ?  331 LYS A CG    1 
ATOM   2664 C  CD    . LYS A 1 343 ? 212.33600 37.07400 94.07200  1.000 49.90000  ?  331 LYS A CD    1 
ATOM   2665 C  CE    . LYS A 1 343 ? 212.31800 38.18800 93.05200  1.000 56.49000  ?  331 LYS A CE    1 
ATOM   2666 N  NZ    . LYS A 1 343 ? 213.58300 38.31100 92.27800  1.000 68.50000  ?  331 LYS A NZ    1 
ATOM   2667 N  N     . GLN A 1 344 ? 208.15200 35.30100 93.54500  1.000 57.37000  ?  332 GLN A N     1 
ATOM   2668 C  CA    . GLN A 1 344 ? 207.41800 34.80600 92.38500  1.000 60.52000  ?  332 GLN A CA    1 
ATOM   2669 C  C     . GLN A 1 344 ? 207.81600 35.50000 91.07600  1.000 59.47000  ?  332 GLN A C     1 
ATOM   2670 O  O     . GLN A 1 344 ? 207.35600 35.11000 90.01500  1.000 63.67000  ?  332 GLN A O     1 
ATOM   2671 C  CB    . GLN A 1 344 ? 205.90500 34.99000 92.60900  1.000 63.16000  ?  332 GLN A CB    1 
ATOM   2672 C  CG    . GLN A 1 344 ? 205.24300 33.93600 93.48000  1.000 64.26000  ?  332 GLN A CG    1 
ATOM   2673 C  CD    . GLN A 1 344 ? 205.05700 32.63200 92.72800  1.000 74.30000  ?  332 GLN A CD    1 
ATOM   2674 O  OE1   . GLN A 1 344 ? 205.31300 32.56800 91.52000  1.000 79.38000  ?  332 GLN A OE1   1 
ATOM   2675 N  NE2   . GLN A 1 344 ? 204.61400 31.58300 93.43200  1.000 65.55000  ?  332 GLN A NE2   1 
ATOM   2676 N  N     . GLY A 1 345 ? 208.63800 36.54200 91.15800  1.000 58.69000  ?  333 GLY A N     1 
ATOM   2677 C  CA    . GLY A 1 345 ? 209.08300 37.26100 89.98100  1.000 57.91000  ?  333 GLY A CA    1 
ATOM   2678 C  C     . GLY A 1 345 ? 208.11800 38.37000 89.63000  1.000 65.01000  ?  333 GLY A C     1 
ATOM   2679 O  O     . GLY A 1 345 ? 206.96300 38.30800 90.02400  1.000 66.53000  ?  333 GLY A O     1 
ATOM   2680 N  N     . GLN A 1 346 ? 208.58500 39.38500 88.90300  1.000 66.38000  ?  334 GLN A N     1 
ATOM   2681 C  CA    . GLN A 1 346 ? 207.72300 40.49500 88.47800  1.000 71.98000  ?  334 GLN A CA    1 
ATOM   2682 C  C     . GLN A 1 346 ? 207.16500 41.38200 89.59900  1.000 70.40000  ?  334 GLN A C     1 
ATOM   2683 O  O     . GLN A 1 346 ? 206.23100 42.15700 89.36500  1.000 71.26000  ?  334 GLN A O     1 
ATOM   2684 C  CB    . GLN A 1 346 ? 206.52400 39.96700 87.67300  1.000 73.18000  ?  334 GLN A CB    1 
ATOM   2685 C  CG    . GLN A 1 346 ? 206.74300 39.99700 86.19200  1.000 69.67000  ?  334 GLN A CG    1 
ATOM   2686 C  CD    . GLN A 1 346 ? 207.98800 39.26800 85.85400  1.000 74.35000  ?  334 GLN A CD    1 
ATOM   2687 O  OE1   . GLN A 1 346 ? 208.11300 38.08800 86.16200  1.000 72.46000  ?  334 GLN A OE1   1 
ATOM   2688 N  NE2   . GLN A 1 346 ? 208.94900 39.96500 85.25900  1.000 87.53000  ?  334 GLN A NE2   1 
ATOM   2689 N  N     . GLY A 1 347 ? 207.71300 41.28600 90.80200  1.000 60.12000  ?  335 GLY A N     1 
ATOM   2690 C  CA    . GLY A 1 347 ? 207.13000 42.02100 91.90600  1.000 61.01000  ?  335 GLY A CA    1 
ATOM   2691 C  C     . GLY A 1 347 ? 205.91000 41.27300 92.41600  1.000 62.41000  ?  335 GLY A C     1 
ATOM   2692 O  O     . GLY A 1 347 ? 204.95300 41.87100 92.91300  1.000 58.00000  ?  335 GLY A O     1 
ATOM   2693 N  N     . GLN A 1 348 ? 205.95700 39.95200 92.27600  1.000 58.21000  ?  336 GLN A N     1 
ATOM   2694 C  CA    . GLN A 1 348 ? 204.88000 39.08300 92.70900  1.000 55.02000  ?  336 GLN A CA    1 
ATOM   2695 C  C     . GLN A 1 348 ? 205.34800 38.17900 93.84200  1.000 56.19000  ?  336 GLN A C     1 
ATOM   2696 O  O     . GLN A 1 348 ? 206.42800 37.60800 93.77800  1.000 56.91000  ?  336 GLN A O     1 
ATOM   2697 C  CB    . GLN A 1 348 ? 204.36000 38.24700 91.54300  1.000 55.42000  ?  336 GLN A CB    1 
ATOM   2698 C  CG    . GLN A 1 348 ? 203.73200 39.08300 90.43400  1.000 59.13000  ?  336 GLN A CG    1 
ATOM   2699 C  CD    . GLN A 1 348 ? 203.06700 38.23100 89.37400  1.000 66.42000  ?  336 GLN A CD    1 
ATOM   2700 O  OE1   . GLN A 1 348 ? 201.84800 38.05100 89.37300  1.000 68.94000  ?  336 GLN A OE1   1 
ATOM   2701 N  NE2   . GLN A 1 348 ? 203.86500 37.70500 88.45700  1.000 70.97000  ?  336 GLN A NE2   1 
ATOM   2702 N  N     . TRP A 1 349 ? 204.53700 38.07900 94.89400  1.000 52.03000  ?  337 TRP A N     1 
ATOM   2703 C  CA    . TRP A 1 349 ? 204.86700 37.26300 96.04800  1.000 51.82000  ?  337 TRP A CA    1 
ATOM   2704 C  C     . TRP A 1 349 ? 203.68500 36.40900 96.47200  1.000 52.16000  ?  337 TRP A C     1 
ATOM   2705 O  O     . TRP A 1 349 ? 202.53200 36.76500 96.24600  1.000 54.69000  ?  337 TRP A O     1 
ATOM   2706 C  CB    . TRP A 1 349 ? 205.33800 38.15600 97.19700  1.000 54.51000  ?  337 TRP A CB    1 
ATOM   2707 C  CG    . TRP A 1 349 ? 206.39000 39.11400 96.73400  1.000 54.99000  ?  337 TRP A CG    1 
ATOM   2708 C  CD1   . TRP A 1 349 ? 206.21100 40.19900 95.93400  1.000 53.78000  ?  337 TRP A CD1   1 
ATOM   2709 C  CD2   . TRP A 1 349 ? 207.78700 39.05000 97.01200  1.000 48.94000  ?  337 TRP A CD2   1 
ATOM   2710 N  NE1   . TRP A 1 349 ? 207.40700 40.81600 95.69000  1.000 53.58000  ?  337 TRP A NE1   1 
ATOM   2711 C  CE2   . TRP A 1 349 ? 208.39300 40.13600 96.35400  1.000 53.86000  ?  337 TRP A CE2   1 
ATOM   2712 C  CE3   . TRP A 1 349 ? 208.58400 38.18700 97.75900  1.000 49.42000  ?  337 TRP A CE3   1 
ATOM   2713 C  CZ2   . TRP A 1 349 ? 209.75300 40.37800 96.42100  1.000 51.90000  ?  337 TRP A CZ2   1 
ATOM   2714 C  CZ3   . TRP A 1 349 ? 209.92600 38.42700 97.82900  1.000 53.01000  ?  337 TRP A CZ3   1 
ATOM   2715 C  CH2   . TRP A 1 349 ? 210.50400 39.51100 97.16300  1.000 54.15000  ?  337 TRP A CH2   1 
ATOM   2716 N  N     . THR A 1 350 ? 203.97000 35.27100 97.08200  1.000 50.49000  ?  338 THR A N     1 
ATOM   2717 C  CA    . THR A 1 350 ? 202.92200 34.40700 97.58100  1.000 46.69000  ?  338 THR A CA    1 
ATOM   2718 C  C     . THR A 1 350 ? 203.26300 34.08100 99.01500  1.000 53.92000  ?  338 THR A C     1 
ATOM   2719 O  O     . THR A 1 350 ? 204.43700 34.00100 99.37800  1.000 51.02000  ?  338 THR A O     1 
ATOM   2720 C  CB    . THR A 1 350 ? 202.78900 33.12200 96.74300  1.000 50.89000  ?  338 THR A CB    1 
ATOM   2721 O  OG1   . THR A 1 350 ? 201.80000 33.33200 95.73400  1.000 62.20000  ?  338 THR A OG1   1 
ATOM   2722 C  CG2   . THR A 1 350 ? 202.33800 31.95200 97.60000  1.000 59.27000  ?  338 THR A CG2   1 
ATOM   2723 N  N     . TYR A 1 351 ? 202.24600 33.91800 99.85300  1.000 56.10000  ?  339 TYR A N     1 
ATOM   2724 C  CA    . TYR A 1 351 ? 202.51000 33.51800 101.22800 1.000 52.17000  ?  339 TYR A CA    1 
ATOM   2725 C  C     . TYR A 1 351 ? 201.49300 32.48300 101.71500 1.000 51.53000  ?  339 TYR A C     1 
ATOM   2726 O  O     . TYR A 1 351 ? 200.35000 32.43300 101.25900 1.000 52.88000  ?  339 TYR A O     1 
ATOM   2727 C  CB    . TYR A 1 351 ? 202.54400 34.74300 102.15400 1.000 46.28000  ?  339 TYR A CB    1 
ATOM   2728 C  CG    . TYR A 1 351 ? 201.27000 35.55200 102.20600 1.000 48.09000  ?  339 TYR A CG    1 
ATOM   2729 C  CD1   . TYR A 1 351 ? 200.22400 35.17200 103.04000 1.000 47.26000  ?  339 TYR A CD1   1 
ATOM   2730 C  CD2   . TYR A 1 351 ? 201.11800 36.70700 101.44900 1.000 46.82000  ?  339 TYR A CD2   1 
ATOM   2731 C  CE1   . TYR A 1 351 ? 199.07100 35.89600 103.11100 1.000 45.80000  ?  339 TYR A CE1   1 
ATOM   2732 C  CE2   . TYR A 1 351 ? 199.95400 37.45000 101.51900 1.000 44.99000  ?  339 TYR A CE2   1 
ATOM   2733 C  CZ    . TYR A 1 351 ? 198.93300 37.02800 102.35300 1.000 49.78000  ?  339 TYR A CZ    1 
ATOM   2734 O  OH    . TYR A 1 351 ? 197.75800 37.73900 102.44400 1.000 56.96000  ?  339 TYR A OH    1 
ATOM   2735 N  N     . GLN A 1 352 ? 201.95700 31.62500 102.60700 1.000 47.87000  ?  340 GLN A N     1 
ATOM   2736 C  CA    . GLN A 1 352 ? 201.11800 30.66700 103.26000 1.000 51.01000  ?  340 GLN A CA    1 
ATOM   2737 C  C     . GLN A 1 352 ? 201.32000 30.90400 104.74500 1.000 50.79000  ?  340 GLN A C     1 
ATOM   2738 O  O     . GLN A 1 352 ? 202.44300 31.10800 105.18700 1.000 49.29000  ?  340 GLN A O     1 
ATOM   2739 C  CB    . GLN A 1 352 ? 201.48400 29.25100 102.83200 1.000 50.01000  ?  340 GLN A CB    1 
ATOM   2740 C  CG    . GLN A 1 352 ? 202.46300 29.24400 101.67300 1.000 61.46000  ?  340 GLN A CG    1 
ATOM   2741 C  CD    . GLN A 1 352 ? 202.37900 27.98400 100.81600 1.000 76.24000  ?  340 GLN A CD    1 
ATOM   2742 O  OE1   . GLN A 1 352 ? 201.39800 27.22300 100.88100 1.000 69.79000  ?  340 GLN A OE1   1 
ATOM   2743 N  NE2   . GLN A 1 352 ? 203.41000 27.76000 100.00000 1.000 74.83000  ?  340 GLN A NE2   1 
ATOM   2744 N  N     . ILE A 1 353 ? 200.22300 30.95100 105.49400 1.000 48.07000  ?  341 ILE A N     1 
ATOM   2745 C  CA    . ILE A 1 353 ? 200.28300 31.12600 106.93100 1.000 48.29000  ?  341 ILE A CA    1 
ATOM   2746 C  C     . ILE A 1 353 ? 199.81300 29.84100 107.55700 1.000 51.65000  ?  341 ILE A C     1 
ATOM   2747 O  O     . ILE A 1 353 ? 198.82800 29.25700 107.08800 1.000 51.38000  ?  341 ILE A O     1 
ATOM   2748 C  CB    . ILE A 1 353 ? 199.40700 32.29200 107.39900 1.000 50.03000  ?  341 ILE A CB    1 
ATOM   2749 C  CG1   . ILE A 1 353 ? 199.75900 33.55200 106.61600 1.000 44.51000  ?  341 ILE A CG1   1 
ATOM   2750 C  CG2   . ILE A 1 353 ? 199.56400 32.52800 108.88000 1.000 44.54000  ?  341 ILE A CG2   1 
ATOM   2751 C  CD1   . ILE A 1 353 ? 198.94100 34.73300 107.00600 1.000 42.17000  ?  341 ILE A CD1   1 
ATOM   2752 N  N     . TYR A 1 354 ? 200.51000 29.39900 108.60200 1.000 48.76000  ?  342 TYR A N     1 
ATOM   2753 C  CA    . TYR A 1 354 ? 200.24300 28.10000 109.20000 1.000 44.88000  ?  342 TYR A CA    1 
ATOM   2754 C  C     . TYR A 1 354 ? 200.72200 28.02600 110.63200 1.000 51.89000  ?  342 TYR A C     1 
ATOM   2755 O  O     . TYR A 1 354 ? 201.28100 28.98100 111.17800 1.000 51.83000  ?  342 TYR A O     1 
ATOM   2756 C  CB    . TYR A 1 354 ? 200.89300 26.98400 108.39100 1.000 52.61000  ?  342 TYR A CB    1 
ATOM   2757 C  CG    . TYR A 1 354 ? 202.41100 27.03800 108.27700 1.000 52.51000  ?  342 TYR A CG    1 
ATOM   2758 C  CD1   . TYR A 1 354 ? 203.21800 26.56700 109.28800 1.000 54.56000  ?  342 TYR A CD1   1 
ATOM   2759 C  CD2   . TYR A 1 354 ? 203.03000 27.52100 107.12800 1.000 56.25000  ?  342 TYR A CD2   1 
ATOM   2760 C  CE1   . TYR A 1 354 ? 204.59800 26.60400 109.18100 1.000 58.96000  ?  342 TYR A CE1   1 
ATOM   2761 C  CE2   . TYR A 1 354 ? 204.40900 27.56000 107.00900 1.000 53.02000  ?  342 TYR A CE2   1 
ATOM   2762 C  CZ    . TYR A 1 354 ? 205.19000 27.10100 108.04000 1.000 58.64000  ?  342 TYR A CZ    1 
ATOM   2763 O  OH    . TYR A 1 354 ? 206.56800 27.13200 107.94500 1.000 58.19000  ?  342 TYR A OH    1 
ATOM   2764 N  N     . GLN A 1 355 ? 200.47800 26.88600 111.26000 1.000 53.73000  ?  343 GLN A N     1 
ATOM   2765 C  CA    . GLN A 1 355 ? 200.89900 26.70500 112.63800 1.000 55.23000  ?  343 GLN A CA    1 
ATOM   2766 C  C     . GLN A 1 355 ? 201.67900 25.42100 112.72500 1.000 56.84000  ?  343 GLN A C     1 
ATOM   2767 O  O     . GLN A 1 355 ? 202.73700 25.36400 113.33400 1.000 58.45000  ?  343 GLN A O     1 
ATOM   2768 C  CB    . GLN A 1 355 ? 199.70100 26.67500 113.57400 1.000 47.36000  ?  343 GLN A CB    1 
ATOM   2769 C  CG    . GLN A 1 355 ? 198.86900 27.90200 113.47900 1.000 47.03000  ?  343 GLN A CG    1 
ATOM   2770 C  CD    . GLN A 1 355 ? 197.88900 27.97300 114.59700 1.000 52.12000  ?  343 GLN A CD    1 
ATOM   2771 O  OE1   . GLN A 1 355 ? 196.81900 27.34800 114.53700 1.000 49.48000  ?  343 GLN A OE1   1 
ATOM   2772 N  NE2   . GLN A 1 355 ? 198.25000 28.70800 115.65700 1.000 48.16000  ?  343 GLN A NE2   1 
ATOM   2773 N  N     . GLU A 1 356 ? 201.12000 24.39900 112.09300 1.000 59.37000  ?  344 GLU A N     1 
ATOM   2774 C  CA    . GLU A 1 356 ? 201.75400 23.11500 111.92100 1.000 60.20000  ?  344 GLU A CA    1 
ATOM   2775 C  C     . GLU A 1 356 ? 202.01900 22.92000 110.42800 1.000 63.86000  ?  344 GLU A C     1 
ATOM   2776 O  O     . GLU A 1 356 ? 201.15500 23.21000 109.59900 1.000 62.25000  ?  344 GLU A O     1 
ATOM   2777 C  CB    . GLU A 1 356 ? 200.86600 22.00700 112.48100 1.000 61.51000  ?  344 GLU A CB    1 
ATOM   2778 C  CG    . GLU A 1 356 ? 201.52700 20.64300 112.48200 1.000 79.31000  ?  344 GLU A CG    1 
ATOM   2779 C  CD    . GLU A 1 356 ? 200.74900 19.61300 113.28200 1.000 91.29000  ?  344 GLU A CD    1 
ATOM   2780 O  OE1   . GLU A 1 356 ? 199.50000 19.74300 113.38000 1.000 88.93000  ?  344 GLU A OE1   1 
ATOM   2781 O  OE2   . GLU A 1 356 ? 201.39600 18.67800 113.81400 1.000 95.37000  ?  344 GLU A OE2   1 
ATOM   2782 N  N     . PRO A 1 357 ? 203.21300 22.42200 110.07500 1.000 66.71000  ?  345 PRO A N     1 
ATOM   2783 C  CA    . PRO A 1 357 ? 203.67000 22.49400 108.68400 1.000 63.03000  ?  345 PRO A CA    1 
ATOM   2784 C  C     . PRO A 1 357 ? 202.75800 21.74000 107.73300 1.000 64.00000  ?  345 PRO A C     1 
ATOM   2785 O  O     . PRO A 1 357 ? 202.26000 20.67700 108.09700 1.000 62.81000  ?  345 PRO A O     1 
ATOM   2786 C  CB    . PRO A 1 357 ? 205.05800 21.85600 108.74500 1.000 64.37000  ?  345 PRO A CB    1 
ATOM   2787 C  CG    . PRO A 1 357 ? 205.48300 22.02500 110.16500 1.000 66.46000  ?  345 PRO A CG    1 
ATOM   2788 C  CD    . PRO A 1 357 ? 204.22300 21.79800 110.94300 1.000 65.05000  ?  345 PRO A CD    1 
ATOM   2789 N  N     . PHE A 1 358 ? 202.52800 22.30800 106.55000 1.000 62.28000  ?  346 PHE A N     1 
ATOM   2790 C  CA    . PHE A 1 358 ? 201.69800 21.67800 105.51600 1.000 63.18000  ?  346 PHE A CA    1 
ATOM   2791 C  C     . PHE A 1 358 ? 200.22200 21.57000 105.87800 1.000 60.55000  ?  346 PHE A C     1 
ATOM   2792 O  O     . PHE A 1 358 ? 199.47300 20.84000 105.23100 1.000 60.06000  ?  346 PHE A O     1 
ATOM   2793 C  CB    . PHE A 1 358 ? 202.23600 20.29000 105.17900 1.000 68.32000  ?  346 PHE A CB    1 
ATOM   2794 C  CG    . PHE A 1 358 ? 203.53700 20.32000 104.44000 1.000 69.41000  ?  346 PHE A CG    1 
ATOM   2795 C  CD1   . PHE A 1 358 ? 203.56300 20.56300 103.07600 1.000 65.98000  ?  346 PHE A CD1   1 
ATOM   2796 C  CD2   . PHE A 1 358 ? 204.73600 20.13600 105.11100 1.000 67.22000  ?  346 PHE A CD2   1 
ATOM   2797 C  CE1   . PHE A 1 358 ? 204.75800 20.60800 102.38600 1.000 67.89000  ?  346 PHE A CE1   1 
ATOM   2798 C  CE2   . PHE A 1 358 ? 205.93600 20.17600 104.42300 1.000 68.16000  ?  346 PHE A CE2   1 
ATOM   2799 C  CZ    . PHE A 1 358 ? 205.94500 20.40900 103.05700 1.000 62.47000  ?  346 PHE A CZ    1 
ATOM   2800 N  N     . LYS A 1 359 ? 199.81700 22.29900 106.91400 1.000 61.27000  ?  347 LYS A N     1 
ATOM   2801 C  CA    . LYS A 1 359 ? 198.40800 22.53900 107.19800 1.000 56.69000  ?  347 LYS A CA    1 
ATOM   2802 C  C     . LYS A 1 359 ? 198.15400 24.04800 107.22600 1.000 55.07000  ?  347 LYS A C     1 
ATOM   2803 O  O     . LYS A 1 359 ? 198.18700 24.67200 108.28300 1.000 56.43000  ?  347 LYS A O     1 
ATOM   2804 C  CB    . LYS A 1 359 ? 198.00300 21.92200 108.52700 1.000 53.85000  ?  347 LYS A CB    1 
ATOM   2805 C  CG    . LYS A 1 359 ? 198.22400 20.44300 108.66300 1.000 55.94000  ?  347 LYS A CG    1 
ATOM   2806 C  CD    . LYS A 1 359 ? 197.63300 19.97900 109.98100 1.000 63.57000  ?  347 LYS A CD    1 
ATOM   2807 C  CE    . LYS A 1 359 ? 197.76300 18.48700 110.18200 1.000 73.81000  ?  347 LYS A CE    1 
ATOM   2808 N  NZ    . LYS A 1 359 ? 197.21200 18.09500 111.50900 1.000 76.89000  ?  347 LYS A NZ    1 
ATOM   2809 N  N     . ASN A 1 360 ? 197.92000 24.64200 106.06800 1.000 53.55000  ?  348 ASN A N     1 
ATOM   2810 C  CA    . ASN A 1 360 ? 197.70700 26.08500 106.00700 1.000 52.15000  ?  348 ASN A CA    1 
ATOM   2811 C  C     . ASN A 1 360 ? 196.47600 26.56200 106.74400 1.000 51.35000  ?  348 ASN A C     1 
ATOM   2812 O  O     . ASN A 1 360 ? 195.44500 25.90000 106.75200 1.000 55.09000  ?  348 ASN A O     1 
ATOM   2813 C  CB    . ASN A 1 360 ? 197.60700 26.54400 104.56100 1.000 50.70000  ?  348 ASN A CB    1 
ATOM   2814 C  CG    . ASN A 1 360 ? 198.92500 26.45500 103.84100 1.000 50.51000  ?  348 ASN A CG    1 
ATOM   2815 O  OD1   . ASN A 1 360 ? 199.98100 26.31700 104.47100 1.000 54.33000  ?  348 ASN A OD1   1 
ATOM   2816 N  ND2   . ASN A 1 360 ? 198.88300 26.55200 102.51800 1.000 48.09000  ?  348 ASN A ND2   1 
ATOM   2817 N  N     . LEU A 1 361 ? 196.60700 27.71000 107.38600 1.000 50.13000  ?  349 LEU A N     1 
ATOM   2818 C  CA    . LEU A 1 361 ? 195.46300 28.45300 107.85900 1.000 46.85000  ?  349 LEU A CA    1 
ATOM   2819 C  C     . LEU A 1 361 ? 194.88800 29.17000 106.64200 1.000 49.05000  ?  349 LEU A C     1 
ATOM   2820 O  O     . LEU A 1 361 ? 193.71900 29.00200 106.28200 1.000 44.47000  ?  349 LEU A O     1 
ATOM   2821 C  CB    . LEU A 1 361 ? 195.87200 29.44200 108.94100 1.000 45.86000  ?  349 LEU A CB    1 
ATOM   2822 C  CG    . LEU A 1 361 ? 195.96000 28.91800 110.36100 1.000 49.03000  ?  349 LEU A CG    1 
ATOM   2823 C  CD1   . LEU A 1 361 ? 196.37000 30.04400 111.26600 1.000 49.73000  ?  349 LEU A CD1   1 
ATOM   2824 C  CD2   . LEU A 1 361 ? 194.59200 28.42400 110.74500 1.000 47.19000  ?  349 LEU A CD2   1 
ATOM   2825 N  N     . LYS A 1 362 ? 195.73600 29.95500 105.98800 1.000 45.48000  ?  350 LYS A N     1 
ATOM   2826 C  CA    . LYS A 1 362 ? 195.35900 30.53900 104.72000 1.000 46.86000  ?  350 LYS A CA    1 
ATOM   2827 C  C     . LYS A 1 362 ? 196.56700 30.94600 103.89100 1.000 49.14000  ?  350 LYS A C     1 
ATOM   2828 O  O     . LYS A 1 362 ? 197.72800 30.80200 104.30000 1.000 47.29000  ?  350 LYS A O     1 
ATOM   2829 C  CB    . LYS A 1 362 ? 194.45300 31.75600 104.93900 1.000 46.64000  ?  350 LYS A CB    1 
ATOM   2830 C  CG    . LYS A 1 362 ? 195.15800 32.95400 105.52500 1.000 43.81000  ?  350 LYS A CG    1 
ATOM   2831 C  CD    . LYS A 1 362 ? 194.15400 34.04400 105.84100 1.000 47.68000  ?  350 LYS A CD    1 
ATOM   2832 C  CE    . LYS A 1 362 ? 193.45200 34.55700 104.60400 1.000 45.37000  ?  350 LYS A CE    1 
ATOM   2833 N  NZ    . LYS A 1 362 ? 194.43900 35.19600 103.68000 1.000 51.69000  ?  350 LYS A NZ    1 
ATOM   2834 N  N     . THR A 1 363 ? 196.27900 31.46900 102.71200 1.000 44.60000  ?  351 THR A N     1 
ATOM   2835 C  CA    . THR A 1 363 ? 197.33200 31.88300 101.82800 1.000 46.05000  ?  351 THR A CA    1 
ATOM   2836 C  C     . THR A 1 363 ? 196.95900 33.25800 101.29800 1.000 51.27000  ?  351 THR A C     1 
ATOM   2837 O  O     . THR A 1 363 ? 195.93600 33.84400 101.71400 1.000 48.08000  ?  351 THR A O     1 
ATOM   2838 C  CB    . THR A 1 363 ? 197.57100 30.85900 100.67200 1.000 51.97000  ?  351 THR A CB    1 
ATOM   2839 O  OG1   . THR A 1 363 ? 196.49500 30.89900 99.72500  1.000 50.77000  ?  351 THR A OG1   1 
ATOM   2840 C  CG2   . THR A 1 363 ? 197.72700 29.42200 101.21900 1.000 47.15000  ?  351 THR A CG2   1 
ATOM   2841 N  N     . GLY A 1 364 ? 197.81100 33.78200 100.42200 1.000 46.42000  ?  352 GLY A N     1 
ATOM   2842 C  CA    . GLY A 1 364 ? 197.62800 35.10200 99.87000  1.000 46.91000  ?  352 GLY A CA    1 
ATOM   2843 C  C     . GLY A 1 364 ? 198.74000 35.44800 98.90500  1.000 50.21000  ?  352 GLY A C     1 
ATOM   2844 O  O     . GLY A 1 364 ? 199.69400 34.69600 98.74800  1.000 53.29000  ?  352 GLY A O     1 
ATOM   2845 N  N     . LYS A 1 365 ? 198.61100 36.59300 98.25100  1.000 50.65000  ?  353 LYS A N     1 
ATOM   2846 C  CA    . LYS A 1 365 ? 199.63700 37.07500 97.34800  1.000 49.87000  ?  353 LYS A CA    1 
ATOM   2847 C  C     . LYS A 1 365 ? 199.86700 38.57100 97.56800  1.000 54.96000  ?  353 LYS A C     1 
ATOM   2848 O  O     . LYS A 1 365 ? 199.03300 39.27100 98.14300  1.000 56.73000  ?  353 LYS A O     1 
ATOM   2849 C  CB    . LYS A 1 365 ? 199.25500 36.78400 95.89500  1.000 54.23000  ?  353 LYS A CB    1 
ATOM   2850 C  CG    . LYS A 1 365 ? 197.93300 37.38200 95.44100  1.000 56.40000  ?  353 LYS A CG    1 
ATOM   2851 C  CD    . LYS A 1 365 ? 197.87700 37.49300 93.89800  1.000 63.18000  ?  353 LYS A CD    1 
ATOM   2852 C  CE    . LYS A 1 365 ? 197.60300 38.93400 93.41000  1.000 63.90000  ?  353 LYS A CE    1 
ATOM   2853 N  NZ    . LYS A 1 365 ? 196.23000 39.40300 93.80800  1.000 63.85000  ?  353 LYS A NZ    1 
ATOM   2854 N  N     . TYR A 1 366 ? 201.02700 39.05500 97.15300  1.000 54.34000  ?  354 TYR A N     1 
ATOM   2855 C  CA    . TYR A 1 366 ? 201.29900 40.48100 97.19200  1.000 51.28000  ?  354 TYR A CA    1 
ATOM   2856 C  C     . TYR A 1 366 ? 201.97700 40.87700 95.88600  1.000 52.48000  ?  354 TYR A C     1 
ATOM   2857 O  O     . TYR A 1 366 ? 202.94500 40.25700 95.47300  1.000 57.51000  ?  354 TYR A O     1 
ATOM   2858 C  CB    . TYR A 1 366 ? 202.16900 40.84700 98.39600  1.000 50.19000  ?  354 TYR A CB    1 
ATOM   2859 C  CG    . TYR A 1 366 ? 202.47300 42.31600 98.42900  1.000 51.10000  ?  354 TYR A CG    1 
ATOM   2860 C  CD1   . TYR A 1 366 ? 201.48000 43.23600 98.74600  1.000 49.88000  ?  354 TYR A CD1   1 
ATOM   2861 C  CD2   . TYR A 1 366 ? 203.73300 42.79500 98.09800  1.000 50.96000  ?  354 TYR A CD2   1 
ATOM   2862 C  CE1   . TYR A 1 366 ? 201.73700 44.60200 98.75200  1.000 54.74000  ?  354 TYR A CE1   1 
ATOM   2863 C  CE2   . TYR A 1 366 ? 204.01200 44.16700 98.10200  1.000 52.55000  ?  354 TYR A CE2   1 
ATOM   2864 C  CZ    . TYR A 1 366 ? 203.00900 45.06800 98.42900  1.000 57.99000  ?  354 TYR A CZ    1 
ATOM   2865 O  OH    . TYR A 1 366 ? 203.26500 46.42800 98.43700  1.000 55.81000  ?  354 TYR A OH    1 
ATOM   2866 N  N     . ALA A 1 367 ? 201.46600 41.89400 95.21700  1.000 56.56000  ?  355 ALA A N     1 
ATOM   2867 C  CA    . ALA A 1 367 ? 202.04900 42.26700 93.93800  1.000 58.96000  ?  355 ALA A CA    1 
ATOM   2868 C  C     . ALA A 1 367 ? 202.09800 43.76500 93.72500  1.000 60.75000  ?  355 ALA A C     1 
ATOM   2869 O  O     . ALA A 1 367 ? 202.48800 44.22100 92.66000  1.000 64.29000  ?  355 ALA A O     1 
ATOM   2870 C  CB    . ALA A 1 367 ? 201.28600 41.62300 92.81300  1.000 53.85000  ?  355 ALA A CB    1 
ATOM   2871 N  N     . ARG A 1 368 ? 201.70300 44.53200 94.73000  1.000 57.80000  ?  356 ARG A N     1 
ATOM   2872 C  CA    . ARG A 1 368 ? 201.55600 45.96000 94.54100  1.000 59.06000  ?  356 ARG A CA    1 
ATOM   2873 C  C     . ARG A 1 368 ? 202.89500 46.60100 94.18500  1.000 61.63000  ?  356 ARG A C     1 
ATOM   2874 O  O     . ARG A 1 368 ? 203.84000 46.54200 94.95900  1.000 64.17000  ?  356 ARG A O     1 
ATOM   2875 C  CB    . ARG A 1 368 ? 200.96400 46.59200 95.79300  1.000 64.02000  ?  356 ARG A CB    1 
ATOM   2876 C  CG    . ARG A 1 368 ? 201.02100 48.10400 95.82200  1.000 70.98000  ?  356 ARG A CG    1 
ATOM   2877 C  CD    . ARG A 1 368 ? 199.63800 48.69900 95.68700  1.000 72.38000  ?  356 ARG A CD    1 
ATOM   2878 N  NE    . ARG A 1 368 ? 199.64000 50.15100 95.84800  1.000 81.40000  ?  356 ARG A NE    1 
ATOM   2879 C  CZ    . ARG A 1 368 ? 199.34300 50.76800 96.98500  1.000 78.07000  ?  356 ARG A CZ    1 
ATOM   2880 N  NH1   . ARG A 1 368 ? 199.02900 50.04900 98.05100  1.000 80.60000  ?  356 ARG A NH1   1 
ATOM   2881 N  NH2   . ARG A 1 368 ? 199.35700 52.09400 97.05600  1.000 77.40000  ?  356 ARG A NH2   1 
ATOM   2882 N  N     . MET A 1 369 ? 202.98000 47.19700 92.99900  1.000 61.59000  ?  357 MET A N     1 
ATOM   2883 C  CA    . MET A 1 369 ? 204.16000 47.97400 92.64000  1.000 65.08000  ?  357 MET A CA    1 
ATOM   2884 C  C     . MET A 1 369 ? 203.98700 49.41000 93.10400  1.000 64.66000  ?  357 MET A C     1 
ATOM   2885 O  O     . MET A 1 369 ? 203.09700 50.12300 92.61800  1.000 72.59000  ?  357 MET A O     1 
ATOM   2886 C  CB    . MET A 1 369 ? 204.42000 47.94100 91.12900  1.000 73.25000  ?  357 MET A CB    1 
ATOM   2887 C  CG    . MET A 1 369 ? 205.90000 47.79600 90.77700  1.000 72.14000  ?  357 MET A CG    1 
ATOM   2888 S  SD    . MET A 1 369 ? 206.36900 46.05700 90.87700  1.000 85.51000  ?  357 MET A SD    1 
ATOM   2889 C  CE    . MET A 1 369 ? 205.81600 45.42100 89.28500  1.000 71.43000  ?  357 MET A CE    1 
ATOM   2890 N  N     . ARG A 1 370 ? 204.81800 49.82800 94.05300  1.000 58.00000  ?  358 ARG A N     1 
ATOM   2891 C  CA    . ARG A 1 370 ? 204.80100 51.20500 94.52200  1.000 60.31000  ?  358 ARG A CA    1 
ATOM   2892 C  C     . ARG A 1 370 ? 206.19300 51.80300 94.48900  1.000 59.42000  ?  358 ARG A C     1 
ATOM   2893 O  O     . ARG A 1 370 ? 207.10100 51.36100 95.18800  1.000 66.28000  ?  358 ARG A O     1 
ATOM   2894 C  CB    . ARG A 1 370 ? 204.21300 51.30200 95.92400  1.000 68.16000  ?  358 ARG A CB    1 
ATOM   2895 C  CG    . ARG A 1 370 ? 204.55000 50.15900 96.84700  1.000 67.35000  ?  358 ARG A CG    1 
ATOM   2896 C  CD    . ARG A 1 370 ? 203.71800 50.28800 98.11200  1.000 75.57000  ?  358 ARG A CD    1 
ATOM   2897 N  NE    . ARG A 1 370 ? 203.82600 51.63600 98.66800  1.000 80.81000  ?  358 ARG A NE    1 
ATOM   2898 C  CZ    . ARG A 1 370 ? 202.79200 52.37100 99.07000  1.000 86.54000  ?  358 ARG A CZ    1 
ATOM   2899 N  NH1   . ARG A 1 370 ? 201.55800 51.88400 98.99400  1.000 84.41000  ?  358 ARG A NH1   1 
ATOM   2900 N  NH2   . ARG A 1 370 ? 202.99400 53.59300 99.55900  1.000 85.68000  ?  358 ARG A NH2   1 
ATOM   2901 N  N     . GLY A 1 371 ? 206.34000 52.82700 93.66600  1.000 59.35000  ?  359 GLY A N     1 
ATOM   2902 C  CA    . GLY A 1 371 ? 207.63000 53.41600 93.38300  1.000 58.14000  ?  359 GLY A CA    1 
ATOM   2903 C  C     . GLY A 1 371 ? 207.97200 53.32600 91.90400  1.000 54.03000  ?  359 GLY A C     1 
ATOM   2904 O  O     . GLY A 1 371 ? 207.75900 52.30600 91.24400  1.000 55.02000  ?  359 GLY A O     1 
ATOM   2905 N  N     . ALA A 1 372 ? 208.49000 54.42000 91.37700  1.000 53.46000  ?  360 ALA A N     1 
ATOM   2906 C  CA    . ALA A 1 372 ? 209.03900 54.42200 90.03600  1.000 55.41000  ?  360 ALA A CA    1 
ATOM   2907 C  C     . ALA A 1 372 ? 210.15600 53.38100 89.95800  1.000 52.19000  ?  360 ALA A C     1 
ATOM   2908 O  O     . ALA A 1 372 ? 210.25700 52.61600 88.99500  1.000 49.07000  ?  360 ALA A O     1 
ATOM   2909 C  CB    . ALA A 1 372 ? 209.56600 55.81000 89.68300  1.000 52.60000  ?  360 ALA A CB    1 
ATOM   2910 N  N     . HIS A 1 373 ? 210.97500 53.36100 91.00600  1.000 45.75000  ?  361 HIS A N     1 
ATOM   2911 C  CA    . HIS A 1 373 ? 212.10800 52.46400 91.09900  1.000 47.21000  ?  361 HIS A CA    1 
ATOM   2912 C  C     . HIS A 1 373 ? 212.13800 51.80200 92.47000  1.000 47.61000  ?  361 HIS A C     1 
ATOM   2913 O  O     . HIS A 1 373 ? 211.93200 52.43100 93.50600  1.000 52.25000  ?  361 HIS A O     1 
ATOM   2914 C  CB    . HIS A 1 373 ? 213.41100 53.22700 90.82200  1.000 44.30000  ?  361 HIS A CB    1 
ATOM   2915 C  CG    . HIS A 1 373 ? 213.21300 54.45400 89.98800  1.000 47.80000  ?  361 HIS A CG    1 
ATOM   2916 N  ND1   . HIS A 1 373 ? 212.94000 54.40000 88.63400  1.000 48.05000  ?  361 HIS A ND1   1 
ATOM   2917 C  CD2   . HIS A 1 373 ? 213.20800 55.76500 90.32200  1.000 45.25000  ?  361 HIS A CD2   1 
ATOM   2918 C  CE1   . HIS A 1 373 ? 212.79500 55.62900 88.16900  1.000 46.53000  ?  361 HIS A CE1   1 
ATOM   2919 N  NE2   . HIS A 1 373 ? 212.94800 56.47700 89.17400  1.000 46.60000  ?  361 HIS A NE2   1 
ATOM   2920 N  N     . THR A 1 374 ? 212.39700 50.51100 92.46100  1.000 48.25000  ?  362 THR A N     1 
ATOM   2921 C  CA    . THR A 1 374 ? 212.35000 49.70800 93.66100  1.000 46.79000  ?  362 THR A CA    1 
ATOM   2922 C  C     . THR A 1 374 ? 213.30200 48.51400 93.52400  1.000 47.80000  ?  362 THR A C     1 
ATOM   2923 O  O     . THR A 1 374 ? 213.93600 48.30800 92.48200  1.000 50.16000  ?  362 THR A O     1 
ATOM   2924 C  CB    . THR A 1 374 ? 210.91700 49.21300 93.91300  1.000 46.64000  ?  362 THR A CB    1 
ATOM   2925 O  OG1   . THR A 1 374 ? 210.84000 48.58700 95.18900  1.000 60.00000  ?  362 THR A OG1   1 
ATOM   2926 C  CG2   . THR A 1 374 ? 210.53700 48.20100 92.89200  1.000 44.01000  ?  362 THR A CG2   1 
ATOM   2927 N  N     . ASN A 1 375 ? 213.40100 47.71900 94.57100  1.000 50.90000  ?  363 ASN A N     1 
ATOM   2928 C  CA    . ASN A 1 375 ? 214.13000 46.47000 94.48300  1.000 49.47000  ?  363 ASN A CA    1 
ATOM   2929 C  C     . ASN A 1 375 ? 213.41900 45.42100 95.31000  1.000 50.14000  ?  363 ASN A C     1 
ATOM   2930 O  O     . ASN A 1 375 ? 212.43100 45.72100 95.96100  1.000 51.82000  ?  363 ASN A O     1 
ATOM   2931 C  CB    . ASN A 1 375 ? 215.57000 46.65000 94.93800  1.000 50.18000  ?  363 ASN A CB    1 
ATOM   2932 C  CG    . ASN A 1 375 ? 215.67800 47.07400 96.37300  1.000 51.71000  ?  363 ASN A CG    1 
ATOM   2933 O  OD1   . ASN A 1 375 ? 214.98800 46.54200 97.24000  1.000 52.53000  ?  363 ASN A OD1   1 
ATOM   2934 N  ND2   . ASN A 1 375 ? 216.56000 48.02800 96.64200  1.000 52.82000  ?  363 ASN A ND2   1 
ATOM   2935 N  N     . ASP A 1 376 ? 213.93000 44.20200 95.29100  1.000 52.29000  ?  364 ASP A N     1 
ATOM   2936 C  CA    . ASP A 1 376 ? 213.27700 43.09100 95.96000  1.000 50.70000  ?  364 ASP A CA    1 
ATOM   2937 C  C     . ASP A 1 376 ? 213.24700 43.17900 97.47600  1.000 52.77000  ?  364 ASP A C     1 
ATOM   2938 O  O     . ASP A 1 376 ? 212.31400 42.67100 98.09800  1.000 52.93000  ?  364 ASP A O     1 
ATOM   2939 C  CB    . ASP A 1 376 ? 213.94700 41.79700 95.55600  1.000 53.09000  ?  364 ASP A CB    1 
ATOM   2940 C  CG    . ASP A 1 376 ? 213.65800 41.43900 94.12700  1.000 60.61000  ?  364 ASP A CG    1 
ATOM   2941 O  OD1   . ASP A 1 376 ? 212.53000 41.75700 93.66900  1.000 61.18000  ?  364 ASP A OD1   1 
ATOM   2942 O  OD2   . ASP A 1 376 ? 214.55600 40.85000 93.47200  1.000 69.40000  ?  364 ASP A OD2   1 
ATOM   2943 N  N     . VAL A 1 377 ? 214.24600 43.80700 98.09000  1.000 46.21000  ?  365 VAL A N     1 
ATOM   2944 C  CA    . VAL A 1 377 ? 214.23300 43.87900 99.54300  1.000 49.90000  ?  365 VAL A CA    1 
ATOM   2945 C  C     . VAL A 1 377 ? 213.13900 44.84900 100.02800 1.000 49.80000  ?  365 VAL A C     1 
ATOM   2946 O  O     . VAL A 1 377 ? 212.45000 44.56500 100.99700 1.000 48.65000  ?  365 VAL A O     1 
ATOM   2947 C  CB    . VAL A 1 377 ? 215.60100 44.28300 100.10300 1.000 47.15000  ?  365 VAL A CB    1 
ATOM   2948 C  CG1   . VAL A 1 377 ? 215.52400 44.34900 101.59100 1.000 42.98000  ?  365 VAL A CG1   1 
ATOM   2949 C  CG2   . VAL A 1 377 ? 216.63800 43.26100 99.68700  1.000 44.90000  ?  365 VAL A CG2   1 
ATOM   2950 N  N     . LYS A 1 378 ? 212.97700 45.98100 99.34700  1.000 50.06000  ?  366 LYS A N     1 
ATOM   2951 C  CA    . LYS A 1 378 ? 211.82900 46.85900 99.56200  1.000 47.49000  ?  366 LYS A CA    1 
ATOM   2952 C  C     . LYS A 1 378 ? 210.51600 46.08900 99.43800  1.000 51.14000  ?  366 LYS A C     1 
ATOM   2953 O  O     . LYS A 1 378 ? 209.65500 46.15200 100.31700 1.000 50.12000  ?  366 LYS A O     1 
ATOM   2954 C  CB    . LYS A 1 378 ? 211.82800 48.01800 98.55900  1.000 48.83000  ?  366 LYS A CB    1 
ATOM   2955 C  CG    . LYS A 1 378 ? 212.77600 49.15100 98.87500  1.000 47.63000  ?  366 LYS A CG    1 
ATOM   2956 C  CD    . LYS A 1 378 ? 212.67200 50.25000 97.82200  1.000 50.42000  ?  366 LYS A CD    1 
ATOM   2957 C  CE    . LYS A 1 378 ? 213.59900 51.42700 98.18100  1.000 52.99000  ?  366 LYS A CE    1 
ATOM   2958 N  NZ    . LYS A 1 378 ? 213.51300 52.62000 97.26900  1.000 52.59000  ?  366 LYS A NZ    1 
ATOM   2959 N  N     . GLN A 1 379 ? 210.36100 45.36800 98.33500  1.000 49.48000  ?  367 GLN A N     1 
ATOM   2960 C  CA    . GLN A 1 379 ? 209.09600 44.71700 98.05700  1.000 50.50000  ?  367 GLN A CA    1 
ATOM   2961 C  C     . GLN A 1 379 ? 208.79900 43.67600 99.11500  1.000 52.82000  ?  367 GLN A C     1 
ATOM   2962 O  O     . GLN A 1 379 ? 207.64300 43.42400 99.44300  1.000 55.48000  ?  367 GLN A O     1 
ATOM   2963 C  CB    . GLN A 1 379 ? 209.10000 44.07200 96.67500  1.000 50.48000  ?  367 GLN A CB    1 
ATOM   2964 C  CG    . GLN A 1 379 ? 209.21400 45.06400 95.52800  1.000 53.75000  ?  367 GLN A CG    1 
ATOM   2965 C  CD    . GLN A 1 379 ? 209.08200 44.39200 94.17500  1.000 60.41000  ?  367 GLN A CD    1 
ATOM   2966 O  OE1   . GLN A 1 379 ? 208.80200 43.20200 94.09400  1.000 67.95000  ?  367 GLN A OE1   1 
ATOM   2967 N  NE2   . GLN A 1 379 ? 209.27400 45.15200 93.10700  1.000 61.63000  ?  367 GLN A NE2   1 
ATOM   2968 N  N     . LEU A 1 380 ? 209.84500 43.06100 99.64400  1.000 48.22000  ?  368 LEU A N     1 
ATOM   2969 C  CA    . LEU A 1 380 ? 209.66300 42.00300 100.60900 1.000 45.95000  ?  368 LEU A CA    1 
ATOM   2970 C  C     . LEU A 1 380 ? 209.14900 42.62700 101.89000 1.000 49.92000  ?  368 LEU A C     1 
ATOM   2971 O  O     . LEU A 1 380 ? 208.27500 42.08400 102.57600 1.000 48.68000  ?  368 LEU A O     1 
ATOM   2972 C  CB    . LEU A 1 380 ? 210.97100 41.26400 100.84100 1.000 46.71000  ?  368 LEU A CB    1 
ATOM   2973 C  CG    . LEU A 1 380 ? 210.91800 40.10500 101.82300 1.000 49.48000  ?  368 LEU A CG    1 
ATOM   2974 C  CD1   . LEU A 1 380 ? 210.14200 38.92900 101.23000 1.000 48.35000  ?  368 LEU A CD1   1 
ATOM   2975 C  CD2   . LEU A 1 380 ? 212.31700 39.69700 102.23400 1.000 51.29000  ?  368 LEU A CD2   1 
ATOM   2976 N  N     . THR A 1 381 ? 209.69900 43.79400 102.18800 1.000 48.38000  ?  369 THR A N     1 
ATOM   2977 C  CA    . THR A 1 381 ? 209.32300 44.56900 103.35000 1.000 46.46000  ?  369 THR A CA    1 
ATOM   2978 C  C     . THR A 1 381 ? 207.87000 45.05100 103.23900 1.000 50.22000  ?  369 THR A C     1 
ATOM   2979 O  O     . THR A 1 381 ? 207.16000 45.14700 104.23900 1.000 51.39000  ?  369 THR A O     1 
ATOM   2980 C  CB    . THR A 1 381 ? 210.28100 45.76600 103.53600 1.000 47.12000  ?  369 THR A CB    1 
ATOM   2981 O  OG1   . THR A 1 381 ? 211.54100 45.28700 104.01800 1.000 45.01000  ?  369 THR A OG1   1 
ATOM   2982 C  CG2   . THR A 1 381 ? 209.73100 46.75100 104.54800 1.000 53.69000  ?  369 THR A CG2   1 
ATOM   2983 N  N     . GLU A 1 382 ? 207.40900 45.33000 102.02800 1.000 49.54000  ?  370 GLU A N     1 
ATOM   2984 C  CA    . GLU A 1 382 ? 206.01500 45.69100 101.85600 1.000 47.60000  ?  370 GLU A CA    1 
ATOM   2985 C  C     . GLU A 1 382 ? 205.08700 44.47900 102.08000 1.000 49.07000  ?  370 GLU A C     1 
ATOM   2986 O  O     . GLU A 1 382 ? 204.02200 44.59200 102.70300 1.000 49.09000  ?  370 GLU A O     1 
ATOM   2987 C  CB    . GLU A 1 382 ? 205.81100 46.30300 100.48400 1.000 46.63000  ?  370 GLU A CB    1 
ATOM   2988 C  CG    . GLU A 1 382 ? 206.48100 47.64100 100.35500 1.000 53.47000  ?  370 GLU A CG    1 
ATOM   2989 C  CD    . GLU A 1 382 ? 206.62700 48.09700 98.90300  1.000 65.74000  ?  370 GLU A CD    1 
ATOM   2990 O  OE1   . GLU A 1 382 ? 207.51300 48.94900 98.64700  1.000 65.92000  ?  370 GLU A OE1   1 
ATOM   2991 O  OE2   . GLU A 1 382 ? 205.86100 47.61100 98.02700  1.000 59.87000  ?  370 GLU A OE2   1 
ATOM   2992 N  N     . ALA A 1 383 ? 205.52000 43.32000 101.59600 1.000 47.11000  ?  371 ALA A N     1 
ATOM   2993 C  CA    . ALA A 1 383 ? 204.80800 42.06700 101.79000 1.000 40.75000  ?  371 ALA A CA    1 
ATOM   2994 C  C     . ALA A 1 383 ? 204.66300 41.71000 103.25900 1.000 47.84000  ?  371 ALA A C     1 
ATOM   2995 O  O     . ALA A 1 383 ? 203.60200 41.28300 103.69500 1.000 49.90000  ?  371 ALA A O     1 
ATOM   2996 C  CB    . ALA A 1 383 ? 205.51600 40.96900 101.08100 1.000 46.01000  ?  371 ALA A CB    1 
ATOM   2997 N  N     . VAL A 1 384 ? 205.75000 41.85200 104.00900 1.000 47.24000  ?  372 VAL A N     1 
ATOM   2998 C  CA    . VAL A 1 384 ? 205.74200 41.55600 105.42300 1.000 42.85000  ?  372 VAL A CA    1 
ATOM   2999 C  C     . VAL A 1 384 ? 204.78100 42.51200 106.11200 1.000 50.81000  ?  372 VAL A C     1 
ATOM   3000 O  O     . VAL A 1 384 ? 204.02700 42.11300 107.01700 1.000 47.43000  ?  372 VAL A O     1 
ATOM   3001 C  CB    . VAL A 1 384 ? 207.16500 41.65900 106.03900 1.000 43.40000  ?  372 VAL A CB    1 
ATOM   3002 C  CG1   . VAL A 1 384 ? 207.13700 41.62100 107.58000 1.000 41.51000  ?  372 VAL A CG1   1 
ATOM   3003 C  CG2   . VAL A 1 384 ? 208.05500 40.54000 105.48700 1.000 43.49000  ?  372 VAL A CG2   1 
ATOM   3004 N  N     . GLN A 1 385 ? 204.79000 43.77000 105.67600 1.000 49.82000  ?  373 GLN A N     1 
ATOM   3005 C  CA    . GLN A 1 385 ? 203.93900 44.76600 106.29800 1.000 47.09000  ?  373 GLN A CA    1 
ATOM   3006 C  C     . GLN A 1 385 ? 202.45900 44.43400 106.08100 1.000 48.15000  ?  373 GLN A C     1 
ATOM   3007 O  O     . GLN A 1 385 ? 201.66900 44.41900 107.02800 1.000 48.58000  ?  373 GLN A O     1 
ATOM   3008 C  CB    . GLN A 1 385 ? 204.27400 46.14800 105.76900 1.000 46.85000  ?  373 GLN A CB    1 
ATOM   3009 C  CG    . GLN A 1 385 ? 205.11300 46.95400 106.73700 1.000 57.09000  ?  373 GLN A CG    1 
ATOM   3010 C  CD    . GLN A 1 385 ? 206.18000 47.81500 106.04800 1.000 59.82000  ?  373 GLN A CD    1 
ATOM   3011 O  OE1   . GLN A 1 385 ? 207.30900 47.94600 106.54900 1.000 57.56000  ?  373 GLN A OE1   1 
ATOM   3012 N  NE2   . GLN A 1 385 ? 205.82100 48.41700 104.91200 1.000 54.36000  ?  373 GLN A NE2   1 
ATOM   3013 N  N     . LYS A 1 386 ? 202.08900 44.12600 104.84700 1.000 46.25000  ?  374 LYS A N     1 
ATOM   3014 C  CA    . LYS A 1 386 ? 200.70800 43.81100 104.56200 1.000 43.71000  ?  374 LYS A CA    1 
ATOM   3015 C  C     . LYS A 1 386 ? 200.27500 42.57900 105.35800 1.000 45.70000  ?  374 LYS A C     1 
ATOM   3016 O  O     . LYS A 1 386 ? 199.21800 42.58300 106.00600 1.000 46.14000  ?  374 LYS A O     1 
ATOM   3017 C  CB    . LYS A 1 386 ? 200.50700 43.59900 103.07200 1.000 41.68000  ?  374 LYS A CB    1 
ATOM   3018 C  CG    . LYS A 1 386 ? 199.30200 42.73300 102.77100 1.000 51.81000  ?  374 LYS A CG    1 
ATOM   3019 C  CD    . LYS A 1 386 ? 199.19700 42.38200 101.28400 1.000 61.23000  ?  374 LYS A CD    1 
ATOM   3020 C  CE    . LYS A 1 386 ? 198.41900 41.08000 101.05100 1.000 62.65000  ?  374 LYS A CE    1 
ATOM   3021 N  NZ    . LYS A 1 386 ? 197.15500 41.06000 101.87100 1.000 67.42000  ?  374 LYS A NZ    1 
ATOM   3022 N  N     . ILE A 1 387 ? 201.11000 41.54300 105.34000 1.000 43.50000  ?  375 ILE A N     1 
ATOM   3023 C  CA    . ILE A 1 387 ? 200.80600 40.28700 106.02500 1.000 45.60000  ?  375 ILE A CA    1 
ATOM   3024 C  C     . ILE A 1 387 ? 200.61500 40.47600 107.53400 1.000 42.54000  ?  375 ILE A C     1 
ATOM   3025 O  O     . ILE A 1 387 ? 199.73600 39.86000 108.14900 1.000 43.17000  ?  375 ILE A O     1 
ATOM   3026 C  CB    . ILE A 1 387 ? 201.90900 39.24800 105.76600 1.000 44.30000  ?  375 ILE A CB    1 
ATOM   3027 C  CG1   . ILE A 1 387 ? 201.84200 38.79600 104.31800 1.000 39.79000  ?  375 ILE A CG1   1 
ATOM   3028 C  CG2   . ILE A 1 387 ? 201.78900 38.04400 106.69800 1.000 40.83000  ?  375 ILE A CG2   1 
ATOM   3029 C  CD1   . ILE A 1 387 ? 203.02400 37.93100 103.90500 1.000 44.86000  ?  375 ILE A CD1   1 
ATOM   3030 N  N     . THR A 1 388 ? 201.43600 41.33800 108.11200 1.000 41.82000  ?  376 THR A N     1 
ATOM   3031 C  CA    . THR A 1 388 ? 201.35400 41.66100 109.51800 1.000 41.52000  ?  376 THR A CA    1 
ATOM   3032 C  C     . THR A 1 388 ? 200.02100 42.29100 109.84600 1.000 45.17000  ?  376 THR A C     1 
ATOM   3033 O  O     . THR A 1 388 ? 199.37600 41.94300 110.82700 1.000 47.94000  ?  376 THR A O     1 
ATOM   3034 C  CB    . THR A 1 388 ? 202.48200 42.61100 109.93600 1.000 41.45000  ?  376 THR A CB    1 
ATOM   3035 O  OG1   . THR A 1 388 ? 203.71700 41.90100 109.91800 1.000 45.28000  ?  376 THR A OG1   1 
ATOM   3036 C  CG2   . THR A 1 388 ? 202.26700 43.15500 111.32500 1.000 42.03000  ?  376 THR A CG2   1 
ATOM   3037 N  N     . THR A 1 389 ? 199.60000 43.22600 109.02300 1.000 44.67000  ?  377 THR A N     1 
ATOM   3038 C  CA    . THR A 1 389 ? 198.37400 43.94700 109.30400 1.000 43.97000  ?  377 THR A CA    1 
ATOM   3039 C  C     . THR A 1 389 ? 197.17500 43.04300 109.14900 1.000 45.46000  ?  377 THR A C     1 
ATOM   3040 O  O     . THR A 1 389 ? 196.19400 43.13500 109.89800 1.000 45.70000  ?  377 THR A O     1 
ATOM   3041 C  CB    . THR A 1 389 ? 198.24100 45.14200 108.38500 1.000 49.49000  ?  377 THR A CB    1 
ATOM   3042 O  OG1   . THR A 1 389 ? 199.33100 46.03500 108.65800 1.000 55.38000  ?  377 THR A OG1   1 
ATOM   3043 C  CG2   . THR A 1 389 ? 196.93600 45.83800 108.64000 1.000 46.03000  ?  377 THR A CG2   1 
ATOM   3044 N  N     . GLU A 1 390 ? 197.26500 42.16000 108.16800 1.000 44.94000  ?  378 GLU A N     1 
ATOM   3045 C  CA    . GLU A 1 390 ? 196.23100 41.18200 107.93700 1.000 38.66000  ?  378 GLU A CA    1 
ATOM   3046 C  C     . GLU A 1 390 ? 196.18100 40.14300 109.06500 1.000 43.19000  ?  378 GLU A C     1 
ATOM   3047 O  O     . GLU A 1 390 ? 195.09700 39.69800 109.46500 1.000 45.04000  ?  378 GLU A O     1 
ATOM   3048 C  CB    . GLU A 1 390 ? 196.45900 40.52200 106.59000 1.000 41.10000  ?  378 GLU A CB    1 
ATOM   3049 C  CG    . GLU A 1 390 ? 195.57400 39.32200 106.31800 1.000 50.44000  ?  378 GLU A CG    1 
ATOM   3050 C  CD    . GLU A 1 390 ? 195.94900 38.65600 105.00600 1.000 62.24000  ?  378 GLU A CD    1 
ATOM   3051 O  OE1   . GLU A 1 390 ? 195.40300 37.56500 104.69700 1.000 56.81000  ?  378 GLU A OE1   1 
ATOM   3052 O  OE2   . GLU A 1 390 ? 196.80900 39.23700 104.29100 1.000 62.04000  ?  378 GLU A OE2   1 
ATOM   3053 N  N     . SER A 1 391 ? 197.33800 39.75700 109.59600 1.000 41.89000  ?  379 SER A N     1 
ATOM   3054 C  CA    . SER A 1 391 ? 197.33400 38.82000 110.71300 1.000 43.57000  ?  379 SER A CA    1 
ATOM   3055 C  C     . SER A 1 391 ? 196.73300 39.43500 111.96600 1.000 42.30000  ?  379 SER A C     1 
ATOM   3056 O  O     . SER A 1 391 ? 196.15800 38.73800 112.79800 1.000 44.51000  ?  379 SER A O     1 
ATOM   3057 C  CB    . SER A 1 391 ? 198.74000 38.32400 111.01700 1.000 42.27000  ?  379 SER A CB    1 
ATOM   3058 O  OG    . SER A 1 391 ? 199.18800 37.55100 109.93800 1.000 48.73000  ?  379 SER A OG    1 
ATOM   3059 N  N     . ILE A 1 392 ? 196.89100 40.73900 112.10900 1.000 38.84000  ?  380 ILE A N     1 
ATOM   3060 C  CA    . ILE A 1 392 ? 196.38800 41.41200 113.27000 1.000 40.63000  ?  380 ILE A CA    1 
ATOM   3061 C  C     . ILE A 1 392 ? 194.87900 41.49600 113.16300 1.000 44.76000  ?  380 ILE A C     1 
ATOM   3062 O  O     . ILE A 1 392 ? 194.17400 41.31300 114.15300 1.000 49.93000  ?  380 ILE A O     1 
ATOM   3063 C  CB    . ILE A 1 392 ? 197.00000 42.78600 113.41800 1.000 41.30000  ?  380 ILE A CB    1 
ATOM   3064 C  CG1   . ILE A 1 392 ? 198.47800 42.63700 113.78100 1.000 41.36000  ?  380 ILE A CG1   1 
ATOM   3065 C  CG2   . ILE A 1 392 ? 196.23900 43.58100 114.47600 1.000 42.34000  ?  380 ILE A CG2   1 
ATOM   3066 C  CD1   . ILE A 1 392 ? 199.23800 43.93700 113.80500 1.000 39.22000  ?  380 ILE A CD1   1 
ATOM   3067 N  N     . VAL A 1 393 ? 194.37400 41.74900 111.96100 1.000 39.90000  ?  381 VAL A N     1 
ATOM   3068 C  CA    . VAL A 1 393 ? 192.93200 41.75800 111.76000 1.000 39.05000  ?  381 VAL A CA    1 
ATOM   3069 C  C     . VAL A 1 393 ? 192.37200 40.35800 112.03800 1.000 39.43000  ?  381 VAL A C     1 
ATOM   3070 O  O     . VAL A 1 393 ? 191.47400 40.19500 112.85800 1.000 42.20000  ?  381 VAL A O     1 
ATOM   3071 C  CB    . VAL A 1 393 ? 192.54200 42.24700 110.31500 1.000 39.90000  ?  381 VAL A CB    1 
ATOM   3072 C  CG1   . VAL A 1 393 ? 191.13600 41.84400 109.95700 1.000 33.98000  ?  381 VAL A CG1   1 
ATOM   3073 C  CG2   . VAL A 1 393 ? 192.71800 43.76900 110.16300 1.000 33.20000  ?  381 VAL A CG2   1 
ATOM   3074 N  N     . ILE A 1 394 ? 192.92700 39.33600 111.39800 1.000 41.88000  ?  382 ILE A N     1 
ATOM   3075 C  CA    . ILE A 1 394 ? 192.37100 37.98600 111.52800 1.000 42.26000  ?  382 ILE A CA    1 
ATOM   3076 C  C     . ILE A 1 394 ? 192.62000 37.28100 112.87100 1.000 45.47000  ?  382 ILE A C     1 
ATOM   3077 O  O     . ILE A 1 394 ? 191.70600 36.69300 113.45000 1.000 46.09000  ?  382 ILE A O     1 
ATOM   3078 C  CB    . ILE A 1 394 ? 192.90100 37.08400 110.43400 1.000 43.45000  ?  382 ILE A CB    1 
ATOM   3079 C  CG1   . ILE A 1 394 ? 192.32400 37.51100 109.09300 1.000 38.45000  ?  382 ILE A CG1   1 
ATOM   3080 C  CG2   . ILE A 1 394 ? 192.53300 35.63900 110.71000 1.000 43.58000  ?  382 ILE A CG2   1 
ATOM   3081 C  CD1   . ILE A 1 394 ? 192.96700 36.81900 107.94400 1.000 41.35000  ?  382 ILE A CD1   1 
ATOM   3082 N  N     . TRP A 1 395 ? 193.85100 37.31800 113.36700 1.000 47.64000  ?  383 TRP A N     1 
ATOM   3083 C  CA    . TRP A 1 395 ? 194.17200 36.59700 114.60000 1.000 43.09000  ?  383 TRP A CA    1 
ATOM   3084 C  C     . TRP A 1 395 ? 194.50800 37.50900 115.76400 1.000 42.09000  ?  383 TRP A C     1 
ATOM   3085 O  O     . TRP A 1 395 ? 194.63300 37.04900 116.88500 1.000 47.12000  ?  383 TRP A O     1 
ATOM   3086 C  CB    . TRP A 1 395 ? 195.33200 35.63400 114.36100 1.000 40.98000  ?  383 TRP A CB    1 
ATOM   3087 C  CG    . TRP A 1 395 ? 195.03000 34.64900 113.28700 1.000 46.20000  ?  383 TRP A CG    1 
ATOM   3088 C  CD1   . TRP A 1 395 ? 194.20000 33.56600 113.36900 1.000 41.97000  ?  383 TRP A CD1   1 
ATOM   3089 C  CD2   . TRP A 1 395 ? 195.53600 34.66500 111.95100 1.000 43.36000  ?  383 TRP A CD2   1 
ATOM   3090 N  NE1   . TRP A 1 395 ? 194.16100 32.90900 112.15900 1.000 41.35000  ?  383 TRP A NE1   1 
ATOM   3091 C  CE2   . TRP A 1 395 ? 194.97700 33.56700 111.27600 1.000 43.08000  ?  383 TRP A CE2   1 
ATOM   3092 C  CE3   . TRP A 1 395 ? 196.41600 35.49900 111.26400 1.000 42.47000  ?  383 TRP A CE3   1 
ATOM   3093 C  CZ2   . TRP A 1 395 ? 195.27300 33.28200 109.95100 1.000 46.76000  ?  383 TRP A CZ2   1 
ATOM   3094 C  CZ3   . TRP A 1 395 ? 196.70600 35.22100 109.96100 1.000 40.25000  ?  383 TRP A CZ3   1 
ATOM   3095 C  CH2   . TRP A 1 395 ? 196.14300 34.11900 109.31300 1.000 46.31000  ?  383 TRP A CH2   1 
ATOM   3096 N  N     . GLY A 1 396 ? 194.67800 38.79600 115.49600 1.000 46.09000  ?  384 GLY A N     1 
ATOM   3097 C  CA    . GLY A 1 396 ? 194.97500 39.75500 116.54500 1.000 45.76000  ?  384 GLY A CA    1 
ATOM   3098 C  C     . GLY A 1 396 ? 196.40900 39.70700 117.04200 1.000 46.98000  ?  384 GLY A C     1 
ATOM   3099 O  O     . GLY A 1 396 ? 196.71600 40.14000 118.14500 1.000 46.22000  ?  384 GLY A O     1 
ATOM   3100 N  N     . LYS A 1 397 ? 197.30900 39.20400 116.21600 1.000 48.81000  ?  385 LYS A N     1 
ATOM   3101 C  CA    . LYS A 1 397 ? 198.70000 39.18000 116.61200 1.000 50.31000  ?  385 LYS A CA    1 
ATOM   3102 C  C     . LYS A 1 397 ? 199.57400 39.03600 115.39500 1.000 51.13000  ?  385 LYS A C     1 
ATOM   3103 O  O     . LYS A 1 397 ? 199.11900 38.60300 114.33700 1.000 54.88000  ?  385 LYS A O     1 
ATOM   3104 C  CB    . LYS A 1 397 ? 198.94900 38.04200 117.59000 1.000 47.01000  ?  385 LYS A CB    1 
ATOM   3105 C  CG    . LYS A 1 397 ? 198.71800 36.68600 116.97600 1.000 48.33000  ?  385 LYS A CG    1 
ATOM   3106 C  CD    . LYS A 1 397 ? 198.79500 35.60300 118.01600 1.000 54.23000  ?  385 LYS A CD    1 
ATOM   3107 C  CE    . LYS A 1 397 ? 200.16500 34.95000 118.07400 1.000 55.38000  ?  385 LYS A CE    1 
ATOM   3108 N  NZ    . LYS A 1 397 ? 200.03000 33.55700 118.64600 1.000 60.00000  ?  385 LYS A NZ    1 
ATOM   3109 N  N     . THR A 1 398 ? 200.83900 39.38900 115.54200 1.000 50.94000  ?  386 THR A N     1 
ATOM   3110 C  CA    . THR A 1 398 ? 201.78800 39.25500 114.45000 1.000 47.33000  ?  386 THR A CA    1 
ATOM   3111 C  C     . THR A 1 398 ? 202.27100 37.80600 114.34400 1.000 46.07000  ?  386 THR A C     1 
ATOM   3112 O  O     . THR A 1 398 ? 202.38500 37.12300 115.35400 1.000 51.20000  ?  386 THR A O     1 
ATOM   3113 C  CB    . THR A 1 398 ? 202.96100 40.20600 114.67000 1.000 50.26000  ?  386 THR A CB    1 
ATOM   3114 O  OG1   . THR A 1 398 ? 202.43900 41.53500 114.79100 1.000 47.75000  ?  386 THR A OG1   1 
ATOM   3115 C  CG2   . THR A 1 398 ? 203.94200 40.14800 113.49400 1.000 55.09000  ?  386 THR A CG2   1 
ATOM   3116 N  N     . PRO A 1 399 ? 202.52800 37.32400 113.12700 1.000 42.30000  ?  387 PRO A N     1 
ATOM   3117 C  CA    . PRO A 1 399 ? 203.07100 35.97900 112.97300 1.000 47.00000  ?  387 PRO A CA    1 
ATOM   3118 C  C     . PRO A 1 399 ? 204.59100 35.99500 112.94400 1.000 51.83000  ?  387 PRO A C     1 
ATOM   3119 O  O     . PRO A 1 399 ? 205.19900 37.04000 112.75300 1.000 50.61000  ?  387 PRO A O     1 
ATOM   3120 C  CB    . PRO A 1 399 ? 202.52500 35.54400 111.62800 1.000 47.83000  ?  387 PRO A CB    1 
ATOM   3121 C  CG    . PRO A 1 399 ? 202.51100 36.81400 110.84600 1.000 49.50000  ?  387 PRO A CG    1 
ATOM   3122 C  CD    . PRO A 1 399 ? 202.30100 37.95900 111.82100 1.000 47.91000  ?  387 PRO A CD    1 
ATOM   3123 N  N     . LYS A 1 400 ? 205.19400 34.83600 113.16300 1.000 52.95000  ?  388 LYS A N     1 
ATOM   3124 C  CA    . LYS A 1 400 ? 206.62600 34.67500 113.00400 1.000 51.21000  ?  388 LYS A CA    1 
ATOM   3125 C  C     . LYS A 1 400 ? 206.89400 34.42600 111.52400 1.000 51.48000  ?  388 LYS A C     1 
ATOM   3126 O  O     . LYS A 1 400 ? 206.08500 33.78300 110.84600 1.000 55.92000  ?  388 LYS A O     1 
ATOM   3127 C  CB    . LYS A 1 400 ? 207.13300 33.53900 113.90100 1.000 52.65000  ?  388 LYS A CB    1 
ATOM   3128 C  CG    . LYS A 1 400 ? 207.20200 33.98400 115.35200 1.000 58.95000  ?  388 LYS A CG    1 
ATOM   3129 C  CD    . LYS A 1 400 ? 207.54500 32.89100 116.34600 1.000 68.64000  ?  388 LYS A CD    1 
ATOM   3130 C  CE    . LYS A 1 400 ? 207.43100 33.45200 117.77300 1.000 72.39000  ?  388 LYS A CE    1 
ATOM   3131 N  NZ    . LYS A 1 400 ? 208.06900 32.60900 118.83200 1.000 71.79000  ?  388 LYS A NZ    1 
ATOM   3132 N  N     . PHE A 1 401 ? 207.98600 34.96600 110.99600 1.000 49.18000  ?  389 PHE A N     1 
ATOM   3133 C  CA    . PHE A 1 401 ? 208.20200 34.86400 109.55300 1.000 50.67000  ?  389 PHE A CA    1 
ATOM   3134 C  C     . PHE A 1 401 ? 209.30300 33.88300 109.10900 1.000 54.64000  ?  389 PHE A C     1 
ATOM   3135 O  O     . PHE A 1 401 ? 210.33000 33.72100 109.77200 1.000 48.65000  ?  389 PHE A O     1 
ATOM   3136 C  CB    . PHE A 1 401 ? 208.51200 36.23800 108.97600 1.000 49.50000  ?  389 PHE A CB    1 
ATOM   3137 C  CG    . PHE A 1 401 ? 207.32300 37.13400 108.88700 1.000 49.63000  ?  389 PHE A CG    1 
ATOM   3138 C  CD1   . PHE A 1 401 ? 206.93800 37.91100 109.98300 1.000 51.42000  ?  389 PHE A CD1   1 
ATOM   3139 C  CD2   . PHE A 1 401 ? 206.59400 37.21900 107.71300 1.000 42.74000  ?  389 PHE A CD2   1 
ATOM   3140 C  CE1   . PHE A 1 401 ? 205.84100 38.75700 109.90300 1.000 49.00000  ?  389 PHE A CE1   1 
ATOM   3141 C  CE2   . PHE A 1 401 ? 205.49700 38.05000 107.63200 1.000 46.32000  ?  389 PHE A CE2   1 
ATOM   3142 C  CZ    . PHE A 1 401 ? 205.11400 38.82200 108.72900 1.000 45.37000  ?  389 PHE A CZ    1 
ATOM   3143 N  N     . LYS A 1 402 ? 209.05100 33.22800 107.97600 1.000 50.57000  ?  390 LYS A N     1 
ATOM   3144 C  CA    . LYS A 1 402 ? 210.06500 32.47000 107.27300 1.000 50.57000  ?  390 LYS A CA    1 
ATOM   3145 C  C     . LYS A 1 402 ? 210.25100 33.13900 105.91800 1.000 51.63000  ?  390 LYS A C     1 
ATOM   3146 O  O     . LYS A 1 402 ? 209.36900 33.08100 105.07600 1.000 52.29000  ?  390 LYS A O     1 
ATOM   3147 C  CB    . LYS A 1 402 ? 209.66200 31.00800 107.11300 1.000 52.27000  ?  390 LYS A CB    1 
ATOM   3148 C  CG    . LYS A 1 402 ? 209.22300 30.31800 108.39700 1.000 58.41000  ?  390 LYS A CG    1 
ATOM   3149 C  CD    . LYS A 1 402 ? 210.35900 29.60600 109.09600 1.000 62.55000  ?  390 LYS A CD    1 
ATOM   3150 C  CE    . LYS A 1 402 ? 209.85900 28.55200 110.08700 1.000 71.27000  ?  390 LYS A CE    1 
ATOM   3151 N  NZ    . LYS A 1 402 ? 209.66300 29.06000 111.49300 1.000 70.63000  ?  390 LYS A NZ    1 
ATOM   3152 N  N     . LEU A 1 403 ? 211.39200 33.78900 105.71500 1.000 52.23000  ?  391 LEU A N     1 
ATOM   3153 C  CA    . LEU A 1 403 ? 211.61900 34.57400 104.50500 1.000 50.73000  ?  391 LEU A CA    1 
ATOM   3154 C  C     . LEU A 1 403 ? 212.82200 34.06700 103.70700 1.000 53.62000  ?  391 LEU A C     1 
ATOM   3155 O  O     . LEU A 1 403 ? 213.82800 33.64700 104.27600 1.000 58.00000  ?  391 LEU A O     1 
ATOM   3156 C  CB    . LEU A 1 403 ? 211.83200 36.05000 104.86600 1.000 48.15000  ?  391 LEU A CB    1 
ATOM   3157 C  CG    . LEU A 1 403 ? 210.90300 36.78100 105.84000 1.000 50.95000  ?  391 LEU A CG    1 
ATOM   3158 C  CD1   . LEU A 1 403 ? 211.47500 38.15700 106.20500 1.000 50.48000  ?  391 LEU A CD1   1 
ATOM   3159 C  CD2   . LEU A 1 403 ? 209.50700 36.92900 105.26300 1.000 50.89000  ?  391 LEU A CD2   1 
ATOM   3160 N  N     . PRO A 1 404 ? 212.73500 34.12800 102.37900 1.000 52.20000  ?  392 PRO A N     1 
ATOM   3161 C  CA    . PRO A 1 404 ? 213.81700 33.65300 101.52100 1.000 51.78000  ?  392 PRO A CA    1 
ATOM   3162 C  C     . PRO A 1 404 ? 214.87400 34.73300 101.31700 1.000 53.86000  ?  392 PRO A C     1 
ATOM   3163 O  O     . PRO A 1 404 ? 215.09100 35.18800 100.18600 1.000 54.38000  ?  392 PRO A O     1 
ATOM   3164 C  CB    . PRO A 1 404 ? 213.09400 33.34700 100.21800 1.000 52.23000  ?  392 PRO A CB    1 
ATOM   3165 C  CG    . PRO A 1 404 ? 212.06600 34.41800 100.16100 1.000 47.41000  ?  392 PRO A CG    1 
ATOM   3166 C  CD    . PRO A 1 404 ? 211.61600 34.66200 101.58600 1.000 51.87000  ?  392 PRO A CD    1 
ATOM   3167 N  N     . ILE A 1 405 ? 215.49400 35.16300 102.40800 1.000 51.50000  ?  393 ILE A N     1 
ATOM   3168 C  CA    . ILE A 1 405 ? 216.48600 36.21700 102.35400 1.000 54.27000  ?  393 ILE A CA    1 
ATOM   3169 C  C     . ILE A 1 405 ? 217.48100 35.97100 103.46800 1.000 57.45000  ?  393 ILE A C     1 
ATOM   3170 O  O     . ILE A 1 405 ? 217.07300 35.78600 104.61000 1.000 55.07000  ?  393 ILE A O     1 
ATOM   3171 C  CB    . ILE A 1 405 ? 215.83900 37.61500 102.50500 1.000 54.20000  ?  393 ILE A CB    1 
ATOM   3172 C  CG1   . ILE A 1 405 ? 216.85000 38.73500 102.26900 1.000 48.85000  ?  393 ILE A CG1   1 
ATOM   3173 C  CG2   . ILE A 1 405 ? 215.22600 37.78700 103.86600 1.000 46.30000  ?  393 ILE A CG2   1 
ATOM   3174 C  CD1   . ILE A 1 405 ? 216.43200 40.01900 102.92700 1.000 45.30000  ?  393 ILE A CD1   1 
ATOM   3175 N  N     . GLN A 1 406 ? 218.77900 35.95700 103.15000 1.000 56.81000  ?  394 GLN A N     1 
ATOM   3176 C  CA    . GLN A 1 406 ? 219.77800 35.63200 104.16900 1.000 55.35000  ?  394 GLN A CA    1 
ATOM   3177 C  C     . GLN A 1 406 ? 219.90500 36.76200 105.14000 1.000 55.16000  ?  394 GLN A C     1 
ATOM   3178 O  O     . GLN A 1 406 ? 219.85100 37.92700 104.73700 1.000 55.91000  ?  394 GLN A O     1 
ATOM   3179 C  CB    . GLN A 1 406 ? 221.14000 35.36400 103.56700 1.000 58.14000  ?  394 GLN A CB    1 
ATOM   3180 C  CG    . GLN A 1 406 ? 221.11600 34.63200 102.27900 1.000 64.33000  ?  394 GLN A CG    1 
ATOM   3181 C  CD    . GLN A 1 406 ? 222.04400 33.45100 102.31400 1.000 76.83000  ?  394 GLN A CD    1 
ATOM   3182 O  OE1   . GLN A 1 406 ? 221.81000 32.50200 103.06500 1.000 77.04000  ?  394 GLN A OE1   1 
ATOM   3183 N  NE2   . GLN A 1 406 ? 223.12300 33.50500 101.52300 1.000 77.62000  ?  394 GLN A NE2   1 
ATOM   3184 N  N     . LYS A 1 407 ? 220.10600 36.41800 106.40700 1.000 52.78000  ?  395 LYS A N     1 
ATOM   3185 C  CA    . LYS A 1 407 ? 220.29100 37.41700 107.44600 1.000 52.45000  ?  395 LYS A CA    1 
ATOM   3186 C  C     . LYS A 1 407 ? 221.34800 38.46700 107.06000 1.000 60.94000  ?  395 LYS A C     1 
ATOM   3187 O  O     . LYS A 1 407 ? 221.18800 39.64900 107.36700 1.000 61.68000  ?  395 LYS A O     1 
ATOM   3188 C  CB    . LYS A 1 407 ? 220.67800 36.74300 108.75500 1.000 55.26000  ?  395 LYS A CB    1 
ATOM   3189 C  CG    . LYS A 1 407 ? 219.67500 36.91600 109.87300 1.000 59.66000  ?  395 LYS A CG    1 
ATOM   3190 C  CD    . LYS A 1 407 ? 218.42000 36.13800 109.61600 1.000 51.48000  ?  395 LYS A CD    1 
ATOM   3191 C  CE    . LYS A 1 407 ? 217.54000 36.09700 110.85900 1.000 60.30000  ?  395 LYS A CE    1 
ATOM   3192 N  NZ    . LYS A 1 407 ? 216.86600 37.37200 111.22100 1.000 57.60000  ?  395 LYS A NZ    1 
ATOM   3193 N  N     . GLU A 1 408 ? 222.41500 38.04100 106.37700 1.000 61.62000  ?  396 GLU A N     1 
ATOM   3194 C  CA    . GLU A 1 408 ? 223.47500 38.97000 105.96200 1.000 60.65000  ?  396 GLU A CA    1 
ATOM   3195 C  C     . GLU A 1 408 ? 222.96400 39.95800 104.91100 1.000 58.45000  ?  396 GLU A C     1 
ATOM   3196 O  O     . GLU A 1 408 ? 223.34100 41.13200 104.91100 1.000 51.84000  ?  396 GLU A O     1 
ATOM   3197 C  CB    . GLU A 1 408 ? 224.68700 38.21200 105.40400 1.000 63.20000  ?  396 GLU A CB    1 
ATOM   3198 C  CG    . GLU A 1 408 ? 224.78600 36.75600 105.85600 1.000 79.99000  ?  396 GLU A CG    1 
ATOM   3199 C  CD    . GLU A 1 408 ? 225.53900 35.86000 104.85900 1.000 91.03000  ?  396 GLU A CD    1 
ATOM   3200 O  OE1   . GLU A 1 408 ? 224.87800 35.29700 103.94400 1.000 80.83000  ?  396 GLU A OE1   1 
ATOM   3201 O  OE2   . GLU A 1 408 ? 226.78400 35.71000 104.99800 1.000 91.09000  ?  396 GLU A OE2   1 
ATOM   3202 N  N     . THR A 1 409 ? 222.11500 39.47500 104.00500 1.000 56.97000  ?  397 THR A N     1 
ATOM   3203 C  CA    . THR A 1 409 ? 221.54500 40.33300 102.96800 1.000 50.92000  ?  397 THR A CA    1 
ATOM   3204 C  C     . THR A 1 409 ? 220.74200 41.47300 103.58400 1.000 57.12000  ?  397 THR A C     1 
ATOM   3205 O  O     . THR A 1 409 ? 220.93600 42.64700 103.26800 1.000 55.23000  ?  397 THR A O     1 
ATOM   3206 C  CB    . THR A 1 409 ? 220.63300 39.54600 102.03700 1.000 51.80000  ?  397 THR A CB    1 
ATOM   3207 O  OG1   . THR A 1 409 ? 221.34500 38.42600 101.50600 1.000 55.47000  ?  397 THR A OG1   1 
ATOM   3208 C  CG2   . THR A 1 409 ? 220.12700 40.43000 100.91000 1.000 44.09000  ?  397 THR A CG2   1 
ATOM   3209 N  N     . TRP A 1 410 ? 219.83400 41.10100 104.47300 1.000 57.76000  ?  398 TRP A N     1 
ATOM   3210 C  CA    . TRP A 1 410 ? 218.96400 42.05900 105.10000 1.000 54.40000  ?  398 TRP A CA    1 
ATOM   3211 C  C     . TRP A 1 410 ? 219.80500 43.03700 105.88000 1.000 54.71000  ?  398 TRP A C     1 
ATOM   3212 O  O     . TRP A 1 410 ? 219.57700 44.23000 105.82100 1.000 59.09000  ?  398 TRP A O     1 
ATOM   3213 C  CB    . TRP A 1 410 ? 217.95400 41.37100 106.01400 1.000 53.49000  ?  398 TRP A CB    1 
ATOM   3214 C  CG    . TRP A 1 410 ? 217.26700 42.35400 106.85600 1.000 56.65000  ?  398 TRP A CG    1 
ATOM   3215 C  CD1   . TRP A 1 410 ? 217.50000 42.60900 108.17100 1.000 59.58000  ?  398 TRP A CD1   1 
ATOM   3216 C  CD2   . TRP A 1 410 ? 216.26000 43.27300 106.44000 1.000 51.20000  ?  398 TRP A CD2   1 
ATOM   3217 N  NE1   . TRP A 1 410 ? 216.68800 43.62100 108.60700 1.000 55.14000  ?  398 TRP A NE1   1 
ATOM   3218 C  CE2   . TRP A 1 410 ? 215.91400 44.04400 107.55800 1.000 54.99000  ?  398 TRP A CE2   1 
ATOM   3219 C  CE3   . TRP A 1 410 ? 215.61200 43.51300 105.23100 1.000 51.12000  ?  398 TRP A CE3   1 
ATOM   3220 C  CZ2   . TRP A 1 410 ? 214.94900 45.04100 107.50200 1.000 55.00000  ?  398 TRP A CZ2   1 
ATOM   3221 C  CZ3   . TRP A 1 410 ? 214.66200 44.49900 105.17600 1.000 53.03000  ?  398 TRP A CZ3   1 
ATOM   3222 C  CH2   . TRP A 1 410 ? 214.33500 45.25100 106.30600 1.000 55.99000  ?  398 TRP A CH2   1 
ATOM   3223 N  N     . GLU A 1 411 ? 220.79400 42.52100 106.59200 1.000 56.32000  ?  399 GLU A N     1 
ATOM   3224 C  CA    . GLU A 1 411 ? 221.71500 43.35100 107.37400 1.000 60.57000  ?  399 GLU A CA    1 
ATOM   3225 C  C     . GLU A 1 411 ? 222.41100 44.43300 106.56900 1.000 61.57000  ?  399 GLU A C     1 
ATOM   3226 O  O     . GLU A 1 411 ? 222.38400 45.60000 106.94200 1.000 64.68000  ?  399 GLU A O     1 
ATOM   3227 C  CB    . GLU A 1 411 ? 222.76700 42.47300 108.02900 1.000 63.09000  ?  399 GLU A CB    1 
ATOM   3228 C  CG    . GLU A 1 411 ? 222.32900 41.96100 109.36400 1.000 72.11000  ?  399 GLU A CG    1 
ATOM   3229 C  CD    . GLU A 1 411 ? 222.72500 42.91400 110.44800 1.000 78.34000  ?  399 GLU A CD    1 
ATOM   3230 O  OE1   . GLU A 1 411 ? 223.56000 43.79600 110.13400 1.000 72.04000  ?  399 GLU A OE1   1 
ATOM   3231 O  OE2   . GLU A 1 411 ? 222.21000 42.78100 111.58700 1.000 82.26000  ?  399 GLU A OE2   1 
ATOM   3232 N  N     . THR A 1 412 ? 223.05400 44.03100 105.47700 1.000 60.96000  ?  400 THR A N     1 
ATOM   3233 C  CA    . THR A 1 412 ? 223.64900 44.97200 104.54400 1.000 57.85000  ?  400 THR A CA    1 
ATOM   3234 C  C     . THR A 1 412 ? 222.66000 46.07600 104.17500 1.000 64.87000  ?  400 THR A C     1 
ATOM   3235 O  O     . THR A 1 412 ? 222.94900 47.25900 104.35600 1.000 63.61000  ?  400 THR A O     1 
ATOM   3236 C  CB    . THR A 1 412 ? 224.09700 44.26900 103.26300 1.000 60.60000  ?  400 THR A CB    1 
ATOM   3237 O  OG1   . THR A 1 412 ? 224.91000 43.14400 103.59500 1.000 62.74000  ?  400 THR A OG1   1 
ATOM   3238 C  CG2   . THR A 1 412 ? 224.86600 45.22100 102.36300 1.000 56.58000  ?  400 THR A CG2   1 
ATOM   3239 N  N     . TRP A 1 413 ? 221.49600 45.67000 103.66200 1.000 60.92000  ?  401 TRP A N     1 
ATOM   3240 C  CA    . TRP A 1 413 ? 220.47400 46.59900 103.20500 1.000 58.74000  ?  401 TRP A CA    1 
ATOM   3241 C  C     . TRP A 1 413 ? 220.09100 47.60400 104.26200 1.000 57.21000  ?  401 TRP A C     1 
ATOM   3242 O  O     . TRP A 1 413 ? 220.00100 48.79600 103.99700 1.000 56.87000  ?  401 TRP A O     1 
ATOM   3243 C  CB    . TRP A 1 413 ? 219.23000 45.84900 102.77100 1.000 56.43000  ?  401 TRP A CB    1 
ATOM   3244 C  CG    . TRP A 1 413 ? 218.08800 46.75800 102.55800 1.000 56.31000  ?  401 TRP A CG    1 
ATOM   3245 C  CD1   . TRP A 1 413 ? 217.00100 46.90800 103.36500 1.000 54.11000  ?  401 TRP A CD1   1 
ATOM   3246 C  CD2   . TRP A 1 413 ? 217.91700 47.68000 101.47200 1.000 58.32000  ?  401 TRP A CD2   1 
ATOM   3247 N  NE1   . TRP A 1 413 ? 216.15900 47.85400 102.84800 1.000 51.24000  ?  401 TRP A NE1   1 
ATOM   3248 C  CE2   . TRP A 1 413 ? 216.68900 48.34400 101.68700 1.000 53.53000  ?  401 TRP A CE2   1 
ATOM   3249 C  CE3   . TRP A 1 413 ? 218.68000 48.00400 100.33800 1.000 56.85000  ?  401 TRP A CE3   1 
ATOM   3250 C  CZ2   . TRP A 1 413 ? 216.20000 49.31100 100.81000 1.000 53.71000  ?  401 TRP A CZ2   1 
ATOM   3251 C  CZ3   . TRP A 1 413 ? 218.19600 48.96200 99.46300  1.000 56.17000  ?  401 TRP A CZ3   1 
ATOM   3252 C  CH2   . TRP A 1 413 ? 216.96600 49.60600 99.70300  1.000 60.11000  ?  401 TRP A CH2   1 
ATOM   3253 N  N     . TRP A 1 414 ? 219.88300 47.10000 105.46600 1.000 60.55000  ?  402 TRP A N     1 
ATOM   3254 C  CA    . TRP A 1 414 ? 219.48700 47.91700 106.61200 1.000 64.58000  ?  402 TRP A CA    1 
ATOM   3255 C  C     . TRP A 1 414 ? 220.55500 48.90900 107.06400 1.000 70.56000  ?  402 TRP A C     1 
ATOM   3256 O  O     . TRP A 1 414 ? 220.22900 50.03600 107.42600 1.000 73.82000  ?  402 TRP A O     1 
ATOM   3257 C  CB    . TRP A 1 414 ? 219.11100 47.01300 107.78200 1.000 64.05000  ?  402 TRP A CB    1 
ATOM   3258 C  CG    . TRP A 1 414 ? 219.05400 47.70700 109.09200 1.000 71.53000  ?  402 TRP A CG    1 
ATOM   3259 C  CD1   . TRP A 1 414 ? 218.01200 48.42300 109.59500 1.000 74.77000  ?  402 TRP A CD1   1 
ATOM   3260 C  CD2   . TRP A 1 414 ? 220.07900 47.74100 110.08700 1.000 76.44000  ?  402 TRP A CD2   1 
ATOM   3261 N  NE1   . TRP A 1 414 ? 218.32800 48.91100 110.84100 1.000 72.75000  ?  402 TRP A NE1   1 
ATOM   3262 C  CE2   . TRP A 1 414 ? 219.59200 48.49900 111.16700 1.000 76.19000  ?  402 TRP A CE2   1 
ATOM   3263 C  CE3   . TRP A 1 414 ? 221.36700 47.21000 110.16400 1.000 76.17000  ?  402 TRP A CE3   1 
ATOM   3264 C  CZ2   . TRP A 1 414 ? 220.34400 48.73700 112.31100 1.000 80.62000  ?  402 TRP A CZ2   1 
ATOM   3265 C  CZ3   . TRP A 1 414 ? 222.11600 47.44900 111.29600 1.000 78.24000  ?  402 TRP A CZ3   1 
ATOM   3266 C  CH2   . TRP A 1 414 ? 221.60200 48.20300 112.35700 1.000 82.47000  ?  402 TRP A CH2   1 
ATOM   3267 N  N     . THR A 1 415 ? 221.82200 48.50400 107.05200 1.000 70.81000  ?  403 THR A N     1 
ATOM   3268 C  CA    . THR A 1 415 ? 222.88000 49.40300 107.49400 1.000 68.80000  ?  403 THR A CA    1 
ATOM   3269 C  C     . THR A 1 415 ? 223.32300 50.35900 106.38800 1.000 67.50000  ?  403 THR A C     1 
ATOM   3270 O  O     . THR A 1 415 ? 224.31600 51.05800 106.54300 1.000 78.30000  ?  403 THR A O     1 
ATOM   3271 C  CB    . THR A 1 415 ? 224.14300 48.63900 107.99900 1.000 68.85000  ?  403 THR A CB    1 
ATOM   3272 O  OG1   . THR A 1 415 ? 225.05700 48.44800 106.92000 1.000 70.63000  ?  403 THR A OG1   1 
ATOM   3273 C  CG2   . THR A 1 415 ? 223.80600 47.29700 108.59300 1.000 65.70000  ?  403 THR A CG2   1 
ATOM   3274 N  N     . GLU A 1 416 ? 222.61700 50.39300 105.26800 1.000 65.67000  ?  404 GLU A N     1 
ATOM   3275 C  CA    . GLU A 1 416 ? 223.00900 51.30300 104.19100 1.000 68.94000  ?  404 GLU A CA    1 
ATOM   3276 C  C     . GLU A 1 416 ? 221.81800 52.00600 103.53400 1.000 71.40000  ?  404 GLU A C     1 
ATOM   3277 O  O     . GLU A 1 416 ? 221.99400 52.85100 102.65800 1.000 77.18000  ?  404 GLU A O     1 
ATOM   3278 C  CB    . GLU A 1 416 ? 223.81500 50.55900 103.12500 1.000 67.37000  ?  404 GLU A CB    1 
ATOM   3279 C  CG    . GLU A 1 416 ? 222.97000 49.95100 101.99500 1.000 70.06000  ?  404 GLU A CG    1 
ATOM   3280 C  CD    . GLU A 1 416 ? 223.66000 48.75200 101.31600 1.000 78.67000  ?  404 GLU A CD    1 
ATOM   3281 O  OE1   . GLU A 1 416 ? 224.88500 48.55800 101.52500 1.000 87.30000  ?  404 GLU A OE1   1 
ATOM   3282 O  OE2   . GLU A 1 416 ? 222.98200 47.99400 100.57800 1.000 74.58000  ?  404 GLU A OE2   1 
ATOM   3283 N  N     . TYR A 1 417 ? 220.60900 51.65400 103.94600 1.000 67.36000  ?  405 TYR A N     1 
ATOM   3284 C  CA    . TYR A 1 417 ? 219.42900 52.39100 103.51000 1.000 68.45000  ?  405 TYR A CA    1 
ATOM   3285 C  C     . TYR A 1 417 ? 219.27700 53.54400 104.48200 1.000 63.73000  ?  405 TYR A C     1 
ATOM   3286 O  O     . TYR A 1 417 ? 219.38900 53.35000 105.68600 1.000 64.13000  ?  405 TYR A O     1 
ATOM   3287 C  CB    . TYR A 1 417 ? 218.19200 51.48100 103.48500 1.000 64.56000  ?  405 TYR A CB    1 
ATOM   3288 C  CG    . TYR A 1 417 ? 216.98400 52.03400 102.75800 1.000 61.02000  ?  405 TYR A CG    1 
ATOM   3289 C  CD1   . TYR A 1 417 ? 217.11500 52.81000 101.60900 1.000 64.76000  ?  405 TYR A CD1   1 
ATOM   3290 C  CD2   . TYR A 1 417 ? 215.70800 51.75700 103.21600 1.000 58.98000  ?  405 TYR A CD2   1 
ATOM   3291 C  CE1   . TYR A 1 417 ? 215.99300 53.30800 100.95200 1.000 58.22000  ?  405 TYR A CE1   1 
ATOM   3292 C  CE2   . TYR A 1 417 ? 214.59700 52.24000 102.57700 1.000 61.17000  ?  405 TYR A CE2   1 
ATOM   3293 C  CZ    . TYR A 1 417 ? 214.73300 53.01100 101.45100 1.000 64.98000  ?  405 TYR A CZ    1 
ATOM   3294 O  OH    . TYR A 1 417 ? 213.58200 53.46700 100.84700 1.000 70.51000  ?  405 TYR A OH    1 
ATOM   3295 N  N     . TRP A 1 418 ? 219.06700 54.74700 103.96400 1.000 65.96000  ?  406 TRP A N     1 
ATOM   3296 C  CA    . TRP A 1 418 ? 219.04700 55.93900 104.80900 1.000 66.83000  ?  406 TRP A CA    1 
ATOM   3297 C  C     . TRP A 1 418 ? 217.72000 56.09600 105.51900 1.000 63.79000  ?  406 TRP A C     1 
ATOM   3298 O  O     . TRP A 1 418 ? 217.48600 57.10200 106.17700 1.000 68.01000  ?  406 TRP A O     1 
ATOM   3299 C  CB    . TRP A 1 418 ? 219.32900 57.19300 103.98300 1.000 76.11000  ?  406 TRP A CB    1 
ATOM   3300 C  CG    . TRP A 1 418 ? 218.41200 57.31000 102.80700 1.000 77.71000  ?  406 TRP A CG    1 
ATOM   3301 C  CD1   . TRP A 1 418 ? 217.10300 57.72100 102.81400 1.000 76.50000  ?  406 TRP A CD1   1 
ATOM   3302 C  CD2   . TRP A 1 418 ? 218.72400 56.98500 101.45100 1.000 79.09000  ?  406 TRP A CD2   1 
ATOM   3303 N  NE1   . TRP A 1 418 ? 216.58600 57.67400 101.53900 1.000 79.43000  ?  406 TRP A NE1   1 
ATOM   3304 C  CE2   . TRP A 1 418 ? 217.56100 57.22700 100.68100 1.000 82.42000  ?  406 TRP A CE2   1 
ATOM   3305 C  CE3   . TRP A 1 418 ? 219.87600 56.51200 100.80600 1.000 75.64000  ?  406 TRP A CE3   1 
ATOM   3306 C  CZ2   . TRP A 1 418 ? 217.51900 57.01700 99.29300  1.000 78.23000  ?  406 TRP A CZ2   1 
ATOM   3307 C  CZ3   . TRP A 1 418 ? 219.83400 56.30300 99.43000  1.000 72.81000  ?  406 TRP A CZ3   1 
ATOM   3308 C  CH2   . TRP A 1 418 ? 218.66300 56.55900 98.68800  1.000 70.72000  ?  406 TRP A CH2   1 
ATOM   3309 N  N     . GLN A 1 419 ? 216.85600 55.09800 105.37700 1.000 61.74000  ?  407 GLN A N     1 
ATOM   3310 C  CA    . GLN A 1 419 ? 215.54300 55.11600 105.99300 1.000 57.45000  ?  407 GLN A CA    1 
ATOM   3311 C  C     . GLN A 1 419 ? 215.39700 54.10700 107.11300 1.000 59.77000  ?  407 GLN A C     1 
ATOM   3312 O  O     . GLN A 1 419 ? 216.10200 53.09900 107.15500 1.000 61.98000  ?  407 GLN A O     1 
ATOM   3313 C  CB    . GLN A 1 419 ? 214.47500 54.84300 104.94800 1.000 60.16000  ?  407 GLN A CB    1 
ATOM   3314 C  CG    . GLN A 1 419 ? 214.26100 55.97200 103.98300 1.000 63.57000  ?  407 GLN A CG    1 
ATOM   3315 C  CD    . GLN A 1 419 ? 212.79000 56.18200 103.74300 1.000 70.57000  ?  407 GLN A CD    1 
ATOM   3316 O  OE1   . GLN A 1 419 ? 212.05600 55.22700 103.44100 1.000 72.41000  ?  407 GLN A OE1   1 
ATOM   3317 N  NE2   . GLN A 1 419 ? 212.33200 57.42300 103.90100 1.000 66.05000  ?  407 GLN A NE2   1 
ATOM   3318 N  N     . ALA A 1 420 ? 214.46200 54.36500 108.01600 1.000 55.72000  ?  408 ALA A N     1 
ATOM   3319 C  CA    . ALA A 1 420 ? 214.13000 53.37200 109.02100 1.000 54.39000  ?  408 ALA A CA    1 
ATOM   3320 C  C     . ALA A 1 420 ? 213.32500 52.25400 108.38600 1.000 55.50000  ?  408 ALA A C     1 
ATOM   3321 O  O     . ALA A 1 420 ? 212.25400 52.48100 107.81200 1.000 55.25000  ?  408 ALA A O     1 
ATOM   3322 C  CB    . ALA A 1 420 ? 213.35000 53.99500 110.16500 1.000 59.53000  ?  408 ALA A CB    1 
ATOM   3323 N  N     . THR A 1 421 ? 213.83200 51.04000 108.49500 1.000 53.15000  ?  409 THR A N     1 
ATOM   3324 C  CA    . THR A 1 421 ? 213.13300 49.90300 107.94400 1.000 51.97000  ?  409 THR A CA    1 
ATOM   3325 C  C     . THR A 1 421 ? 213.33100 48.78300 108.92600 1.000 52.58000  ?  409 THR A C     1 
ATOM   3326 O  O     . THR A 1 421 ? 214.34400 48.75000 109.62300 1.000 57.38000  ?  409 THR A O     1 
ATOM   3327 C  CB    . THR A 1 421 ? 213.65100 49.52800 106.52300 1.000 51.28000  ?  409 THR A CB    1 
ATOM   3328 O  OG1   . THR A 1 421 ? 212.81400 48.51400 105.95800 1.000 57.48000  ?  409 THR A OG1   1 
ATOM   3329 C  CG2   . THR A 1 421 ? 215.07300 49.03500 106.55900 1.000 50.07000  ?  409 THR A CG2   1 
ATOM   3330 N  N     . TRP A 1 422 ? 212.36400 47.88000 109.01500 1.000 51.89000  ?  410 TRP A N     1 
ATOM   3331 C  CA    . TRP A 1 422 ? 212.44600 46.81700 110.01200 1.000 54.17000  ?  410 TRP A CA    1 
ATOM   3332 C  C     . TRP A 1 422 ? 211.47900 45.68900 109.73100 1.000 54.41000  ?  410 TRP A C     1 
ATOM   3333 O  O     . TRP A 1 422 ? 210.34800 45.91700 109.30900 1.000 58.59000  ?  410 TRP A O     1 
ATOM   3334 C  CB    . TRP A 1 422 ? 212.17800 47.36600 111.41500 1.000 55.96000  ?  410 TRP A CB    1 
ATOM   3335 C  CG    . TRP A 1 422 ? 212.22700 46.30800 112.51200 1.000 64.18000  ?  410 TRP A CG    1 
ATOM   3336 C  CD1   . TRP A 1 422 ? 213.34500 45.68800 113.02800 1.000 63.04000  ?  410 TRP A CD1   1 
ATOM   3337 C  CD2   . TRP A 1 422 ? 211.11400 45.77800 113.24300 1.000 62.14000  ?  410 TRP A CD2   1 
ATOM   3338 N  NE1   . TRP A 1 422 ? 212.98400 44.80300 114.01500 1.000 57.35000  ?  410 TRP A NE1   1 
ATOM   3339 C  CE2   . TRP A 1 422 ? 211.62600 44.83900 114.16500 1.000 54.95000  ?  410 TRP A CE2   1 
ATOM   3340 C  CE3   . TRP A 1 422 ? 209.73700 46.00000 113.19800 1.000 57.38000  ?  410 TRP A CE3   1 
ATOM   3341 C  CZ2   . TRP A 1 422 ? 210.81500 44.14500 115.02500 1.000 50.57000  ?  410 TRP A CZ2   1 
ATOM   3342 C  CZ3   . TRP A 1 422 ? 208.94200 45.30600 114.05100 1.000 58.59000  ?  410 TRP A CZ3   1 
ATOM   3343 C  CH2   . TRP A 1 422 ? 209.47800 44.38900 114.95700 1.000 58.81000  ?  410 TRP A CH2   1 
ATOM   3344 N  N     . ILE A 1 423 ? 211.92700 44.47000 109.98300 1.000 53.71000  ?  411 ILE A N     1 
ATOM   3345 C  CA    . ILE A 1 423 ? 211.06200 43.31600 109.86600 1.000 55.98000  ?  411 ILE A CA    1 
ATOM   3346 C  C     . ILE A 1 423 ? 210.94600 42.61800 111.22200 1.000 53.86000  ?  411 ILE A C     1 
ATOM   3347 O  O     . ILE A 1 423 ? 211.91700 42.49300 111.95400 1.000 50.29000  ?  411 ILE A O     1 
ATOM   3348 C  CB    . ILE A 1 423 ? 211.57600 42.32700 108.82000 1.000 55.45000  ?  411 ILE A CB    1 
ATOM   3349 C  CG1   . ILE A 1 423 ? 211.81700 43.01900 107.49200 1.000 51.16000  ?  411 ILE A CG1   1 
ATOM   3350 C  CG2   . ILE A 1 423 ? 210.57300 41.22600 108.60200 1.000 60.49000  ?  411 ILE A CG2   1 
ATOM   3351 C  CD1   . ILE A 1 423 ? 212.19800 42.04500 106.43100 1.000 54.18000  ?  411 ILE A CD1   1 
ATOM   3352 N  N     . PRO A 1 424 ? 209.73300 42.17400 111.57200 1.000 57.93000  ?  412 PRO A N     1 
ATOM   3353 C  CA    . PRO A 1 424 ? 209.58800 41.46000 112.83300 1.000 52.44000  ?  412 PRO A CA    1 
ATOM   3354 C  C     . PRO A 1 424 ? 210.40700 40.18000 112.85200 1.000 57.10000  ?  412 PRO A C     1 
ATOM   3355 O  O     . PRO A 1 424 ? 211.22900 39.93500 111.96100 1.000 61.48000  ?  412 PRO A O     1 
ATOM   3356 C  CB    . PRO A 1 424 ? 208.08600 41.16700 112.90400 1.000 58.41000  ?  412 PRO A CB    1 
ATOM   3357 C  CG    . PRO A 1 424 ? 207.55300 41.36800 111.51500 1.000 55.09000  ?  412 PRO A CG    1 
ATOM   3358 C  CD    . PRO A 1 424 ? 208.44200 42.38300 110.89100 1.000 61.40000  ?  412 PRO A CD    1 
ATOM   3359 N  N     . GLU A 1 425 ? 210.19500 39.38100 113.89000 1.000 63.59000  ?  413 GLU A N     1 
ATOM   3360 C  CA    . GLU A 1 425 ? 210.95600 38.15900 114.09400 1.000 62.32000  ?  413 GLU A CA    1 
ATOM   3361 C  C     . GLU A 1 425 ? 210.86000 37.25800 112.86100 1.000 60.50000  ?  413 GLU A C     1 
ATOM   3362 O  O     . GLU A 1 425 ? 209.75300 36.87600 112.42200 1.000 56.92000  ?  413 GLU A O     1 
ATOM   3363 C  CB    . GLU A 1 425 ? 210.46200 37.43000 115.34900 1.000 61.73000  ?  413 GLU A CB    1 
ATOM   3364 C  CG    . GLU A 1 425 ? 211.28700 36.19600 115.71700 1.000 72.06000  ?  413 GLU A CG    1 
ATOM   3365 C  CD    . GLU A 1 425 ? 210.53100 35.25200 116.63900 1.000 81.12000  ?  413 GLU A CD    1 
ATOM   3366 O  OE1   . GLU A 1 425 ? 209.38700 35.60300 117.02700 1.000 82.88000  ?  413 GLU A OE1   1 
ATOM   3367 O  OE2   . GLU A 1 425 ? 211.07200 34.16700 116.96800 1.000 81.93000  ?  413 GLU A OE2   1 
ATOM   3368 N  N     . TRP A 1 426 ? 212.01500 36.93900 112.28100 1.000 57.37000  ?  414 TRP A N     1 
ATOM   3369 C  CA    . TRP A 1 426 ? 212.02000 36.01400 111.15500 1.000 56.30000  ?  414 TRP A CA    1 
ATOM   3370 C  C     . TRP A 1 426 ? 213.19500 35.04600 111.16600 1.000 54.77000  ?  414 TRP A C     1 
ATOM   3371 O  O     . TRP A 1 426 ? 214.09500 35.12900 111.98900 1.000 61.11000  ?  414 TRP A O     1 
ATOM   3372 C  CB    . TRP A 1 426 ? 211.99600 36.78900 109.84600 1.000 52.87000  ?  414 TRP A CB    1 
ATOM   3373 C  CG    . TRP A 1 426 ? 213.17300 37.64700 109.67200 1.000 56.10000  ?  414 TRP A CG    1 
ATOM   3374 C  CD1   . TRP A 1 426 ? 213.47500 38.78100 110.36800 1.000 56.98000  ?  414 TRP A CD1   1 
ATOM   3375 C  CD2   . TRP A 1 426 ? 214.22300 37.46100 108.73000 1.000 50.25000  ?  414 TRP A CD2   1 
ATOM   3376 N  NE1   . TRP A 1 426 ? 214.65400 39.31100 109.91000 1.000 49.44000  ?  414 TRP A NE1   1 
ATOM   3377 C  CE2   . TRP A 1 426 ? 215.13100 38.51900 108.90500 1.000 49.09000  ?  414 TRP A CE2   1 
ATOM   3378 C  CE3   . TRP A 1 426 ? 214.48200 36.50400 107.75800 1.000 46.63000  ?  414 TRP A CE3   1 
ATOM   3379 C  CZ2   . TRP A 1 426 ? 216.27900 38.64000 108.14600 1.000 53.48000  ?  414 TRP A CZ2   1 
ATOM   3380 C  CZ3   . TRP A 1 426 ? 215.60700 36.62800 107.00900 1.000 52.32000  ?  414 TRP A CZ3   1 
ATOM   3381 C  CH2   . TRP A 1 426 ? 216.49800 37.68900 107.19700 1.000 55.02000  ?  414 TRP A CH2   1 
ATOM   3382 N  N     . GLU A 1 427 ? 213.15600 34.11200 110.23300 1.000 57.49000  ?  415 GLU A N     1 
ATOM   3383 C  CA    . GLU A 1 427 ? 214.15300 33.07900 110.11000 1.000 55.61000  ?  415 GLU A CA    1 
ATOM   3384 C  C     . GLU A 1 427 ? 214.26400 32.73900 108.63600 1.000 58.54000  ?  415 GLU A C     1 
ATOM   3385 O  O     . GLU A 1 427 ? 213.25700 32.74600 107.93200 1.000 57.60000  ?  415 GLU A O     1 
ATOM   3386 C  CB    . GLU A 1 427 ? 213.76200 31.86700 110.94500 1.000 58.63000  ?  415 GLU A CB    1 
ATOM   3387 C  CG    . GLU A 1 427 ? 214.23500 30.55900 110.37500 1.000 70.75000  ?  415 GLU A CG    1 
ATOM   3388 C  CD    . GLU A 1 427 ? 213.56600 29.37000 111.04200 1.000 86.20000  ?  415 GLU A CD    1 
ATOM   3389 O  OE1   . GLU A 1 427 ? 213.29100 29.45300 112.26200 1.000 91.16000  ?  415 GLU A OE1   1 
ATOM   3390 O  OE2   . GLU A 1 427 ? 213.30300 28.36000 110.34400 1.000 88.72000  ?  415 GLU A OE2   1 
ATOM   3391 N  N     . PHE A 1 428 ? 215.47300 32.45000 108.15700 1.000 59.42000  ?  416 PHE A N     1 
ATOM   3392 C  CA    . PHE A 1 428 ? 215.70100 32.30200 106.71900 1.000 54.68000  ?  416 PHE A CA    1 
ATOM   3393 C  C     . PHE A 1 428 ? 215.22600 30.94800 106.16200 1.000 56.62000  ?  416 PHE A C     1 
ATOM   3394 O  O     . PHE A 1 428 ? 215.17400 29.95900 106.88100 1.000 59.86000  ?  416 PHE A O     1 
ATOM   3395 C  CB    . PHE A 1 428 ? 217.18700 32.52500 106.42800 1.000 56.02000  ?  416 PHE A CB    1 
ATOM   3396 C  CG    . PHE A 1 428 ? 217.64200 31.97500 105.10000 1.000 61.95000  ?  416 PHE A CG    1 
ATOM   3397 C  CD1   . PHE A 1 428 ? 217.33500 32.62000 103.92200 1.000 61.76000  ?  416 PHE A CD1   1 
ATOM   3398 C  CD2   . PHE A 1 428 ? 218.38700 30.82000 105.03400 1.000 63.73000  ?  416 PHE A CD2   1 
ATOM   3399 C  CE1   . PHE A 1 428 ? 217.76100 32.11200 102.70700 1.000 66.28000  ?  416 PHE A CE1   1 
ATOM   3400 C  CE2   . PHE A 1 428 ? 218.81000 30.31000 103.81800 1.000 66.90000  ?  416 PHE A CE2   1 
ATOM   3401 C  CZ    . PHE A 1 428 ? 218.50000 30.95500 102.65900 1.000 67.92000  ?  416 PHE A CZ    1 
ATOM   3402 N  N     . VAL A 1 429 ? 214.87500 30.90700 104.88000 1.000 59.93000  ?  417 VAL A N     1 
ATOM   3403 C  CA    . VAL A 1 429 ? 214.37100 29.67800 104.25100 1.000 62.68000  ?  417 VAL A CA    1 
ATOM   3404 C  C     . VAL A 1 429 ? 214.96500 29.43900 102.87000 1.000 65.52000  ?  417 VAL A C     1 
ATOM   3405 O  O     . VAL A 1 429 ? 214.57700 30.11100 101.92300 1.000 66.21000  ?  417 VAL A O     1 
ATOM   3406 C  CB    . VAL A 1 429 ? 212.83500 29.70600 104.08700 1.000 60.51000  ?  417 VAL A CB    1 
ATOM   3407 C  CG1   . VAL A 1 429 ? 212.30000 28.31500 103.77900 1.000 65.13000  ?  417 VAL A CG1   1 
ATOM   3408 C  CG2   . VAL A 1 429 ? 212.19400 30.22200 105.32300 1.000 63.91000  ?  417 VAL A CG2   1 
ATOM   3409 N  N     . ASN A 1 430 ? 215.86300 28.45900 102.74600 1.000 71.59000  ?  418 ASN A N     1 
ATOM   3410 C  CA    . ASN A 1 430 ? 216.62700 28.23200 101.50600 1.000 73.67000  ?  418 ASN A CA    1 
ATOM   3411 C  C     . ASN A 1 430 ? 215.82300 28.02700 100.23600 1.000 72.30000  ?  418 ASN A C     1 
ATOM   3412 O  O     . ASN A 1 430 ? 216.41500 27.85200 99.17700  1.000 78.59000  ?  418 ASN A O     1 
ATOM   3413 C  CB    . ASN A 1 430 ? 217.53700 27.00900 101.63900 1.000 79.99000  ?  418 ASN A CB    1 
ATOM   3414 C  CG    . ASN A 1 430 ? 218.97900 27.36700 101.98800 1.000 87.41000  ?  418 ASN A CG    1 
ATOM   3415 O  OD1   . ASN A 1 430 ? 219.39100 27.24400 103.14400 1.000 92.67000  ?  418 ASN A OD1   1 
ATOM   3416 N  ND2   . ASN A 1 430 ? 219.75800 27.78600 100.98600 1.000 81.25000  ?  418 ASN A ND2   1 
ATOM   3417 N  N     . THR A 1 431 ? 214.50000 28.03700 100.32600 1.000 62.89000  ?  419 THR A N     1 
ATOM   3418 C  CA    . THR A 1 431 ? 213.67000 27.80900 99.14800  1.000 69.74000  ?  419 THR A CA    1 
ATOM   3419 C  C     . THR A 1 431 ? 213.75100 28.97400 98.15800  1.000 70.86000  ?  419 THR A C     1 
ATOM   3420 O  O     . THR A 1 431 ? 213.17500 30.03700 98.40100  1.000 70.52000  ?  419 THR A O     1 
ATOM   3421 C  CB    . THR A 1 431 ? 212.18000 27.59100 99.51900  1.000 71.59000  ?  419 THR A CB    1 
ATOM   3422 O  OG1   . THR A 1 431 ? 211.52500 28.85800 99.66000  1.000 68.41000  ?  419 THR A OG1   1 
ATOM   3423 C  CG2   . THR A 1 431 ? 212.03800 26.78600 100.81200 1.000 77.31000  ?  419 THR A CG2   1 
ATOM   3424 N  N     . PRO A 1 432 ? 214.45000 28.76200 97.02500  1.000 69.83000  ?  420 PRO A N     1 
ATOM   3425 C  CA    . PRO A 1 432 ? 214.66300 29.78600 95.99200  1.000 65.07000  ?  420 PRO A CA    1 
ATOM   3426 C  C     . PRO A 1 432 ? 213.38400 30.14500 95.28200  1.000 60.42000  ?  420 PRO A C     1 
ATOM   3427 O  O     . PRO A 1 432 ? 212.40400 29.41900 95.42300  1.000 68.84000  ?  420 PRO A O     1 
ATOM   3428 C  CB    . PRO A 1 432 ? 215.64600 29.11500 95.01900  1.000 65.89000  ?  420 PRO A CB    1 
ATOM   3429 C  CG    . PRO A 1 432 ? 215.40700 27.66800 95.19000  1.000 69.26000  ?  420 PRO A CG    1 
ATOM   3430 C  CD    . PRO A 1 432 ? 215.07000 27.47600 96.65300  1.000 72.65000  ?  420 PRO A CD    1 
ATOM   3431 N  N     . PRO A 1 433 ? 213.39300 31.24000 94.51300  1.000 52.76000  ?  421 PRO A N     1 
ATOM   3432 C  CA    . PRO A 1 433 ? 214.55100 32.12800 94.31600  1.000 62.01000  ?  421 PRO A CA    1 
ATOM   3433 C  C     . PRO A 1 433 ? 214.80500 33.13900 95.44100  1.000 58.22000  ?  421 PRO A C     1 
ATOM   3434 O  O     . PRO A 1 433 ? 213.99200 34.04000 95.61100  1.000 60.51000  ?  421 PRO A O     1 
ATOM   3435 C  CB    . PRO A 1 433 ? 214.20000 32.87300 93.01800  1.000 62.58000  ?  421 PRO A CB    1 
ATOM   3436 C  CG    . PRO A 1 433 ? 212.72200 32.84600 92.94700  1.000 60.22000  ?  421 PRO A CG    1 
ATOM   3437 C  CD    . PRO A 1 433 ? 212.28300 31.55500 93.59800  1.000 54.49000  ?  421 PRO A CD    1 
ATOM   3438 N  N     . LEU A 1 434 ? 215.92200 33.01300 96.16000  1.000 57.76000  ?  422 LEU A N     1 
ATOM   3439 C  CA    . LEU A 1 434 ? 216.26100 33.93100 97.25400  1.000 55.41000  ?  422 LEU A CA    1 
ATOM   3440 C  C     . LEU A 1 434 ? 216.27200 35.41400 96.86700  1.000 56.08000  ?  422 LEU A C     1 
ATOM   3441 O  O     . LEU A 1 434 ? 216.58900 35.77900 95.74200  1.000 59.01000  ?  422 LEU A O     1 
ATOM   3442 C  CB    . LEU A 1 434 ? 217.62500 33.57500 97.83700  1.000 48.63000  ?  422 LEU A CB    1 
ATOM   3443 C  CG    . LEU A 1 434 ? 217.79600 32.14300 98.31700  1.000 54.30000  ?  422 LEU A CG    1 
ATOM   3444 C  CD1   . LEU A 1 434 ? 219.05800 32.01800 99.14900  1.000 56.05000  ?  422 LEU A CD1   1 
ATOM   3445 C  CD2   . LEU A 1 434 ? 216.57800 31.71700 99.11500  1.000 63.68000  ?  422 LEU A CD2   1 
ATOM   3446 N  N     . VAL A 1 435 ? 215.93400 36.27600 97.81600  1.000 57.48000  ?  423 VAL A N     1 
ATOM   3447 C  CA    . VAL A 1 435 ? 215.93900 37.71000 97.56300  1.000 57.08000  ?  423 VAL A CA    1 
ATOM   3448 C  C     . VAL A 1 435 ? 217.32400 38.23900 97.84800  1.000 52.53000  ?  423 VAL A C     1 
ATOM   3449 O  O     . VAL A 1 435 ? 217.92800 37.87700 98.85300  1.000 51.57000  ?  423 VAL A O     1 
ATOM   3450 C  CB    . VAL A 1 435 ? 214.91100 38.45700 98.44800  1.000 56.29000  ?  423 VAL A CB    1 
ATOM   3451 C  CG1   . VAL A 1 435 ? 214.89700 39.94900 98.12100  1.000 52.22000  ?  423 VAL A CG1   1 
ATOM   3452 C  CG2   . VAL A 1 435 ? 213.52900 37.85200 98.28900  1.000 53.19000  ?  423 VAL A CG2   1 
ATOM   3453 N  N     . LYS A 1 436 ? 217.83000 39.10400 96.98400  1.000 57.53000  ?  424 LYS A N     1 
ATOM   3454 C  CA    . LYS A 1 436 ? 219.17200 39.62700 97.18800  1.000 58.22000  ?  424 LYS A CA    1 
ATOM   3455 C  C     . LYS A 1 436 ? 219.34700 41.03600 96.64200  1.000 58.02000  ?  424 LYS A C     1 
ATOM   3456 O  O     . LYS A 1 436 ? 218.52500 41.53100 95.87300  1.000 61.07000  ?  424 LYS A O     1 
ATOM   3457 C  CB    . LYS A 1 436 ? 220.19700 38.69700 96.53500  1.000 56.00000  ?  424 LYS A CB    1 
ATOM   3458 C  CG    . LYS A 1 436 ? 219.88800 38.41900 95.08700  1.000 63.51000  ?  424 LYS A CG    1 
ATOM   3459 C  CD    . LYS A 1 436 ? 221.14400 38.23300 94.25100  1.000 71.91000  ?  424 LYS A CD    1 
ATOM   3460 C  CE    . LYS A 1 436 ? 220.77200 38.04500 92.78000  1.000 74.45000  ?  424 LYS A CE    1 
ATOM   3461 N  NZ    . LYS A 1 436 ? 221.94000 37.96000 91.86500  1.000 78.43000  ?  424 LYS A NZ    1 
ATOM   3462 N  N     . LEU A 1 437 ? 220.42900 41.68300 97.04900  1.000 59.48000  ?  425 LEU A N     1 
ATOM   3463 C  CA    . LEU A 1 437 ? 220.82300 42.92800 96.42400  1.000 55.29000  ?  425 LEU A CA    1 
ATOM   3464 C  C     . LEU A 1 437 ? 221.70900 42.58500 95.24500  1.000 54.57000  ?  425 LEU A C     1 
ATOM   3465 O  O     . LEU A 1 437 ? 222.61300 41.77200 95.35300  1.000 55.86000  ?  425 LEU A O     1 
ATOM   3466 C  CB    . LEU A 1 437 ? 221.53200 43.83300 97.41400  1.000 55.79000  ?  425 LEU A CB    1 
ATOM   3467 C  CG    . LEU A 1 437 ? 220.62600 44.17200 98.59500  1.000 55.74000  ?  425 LEU A CG    1 
ATOM   3468 C  CD1   . LEU A 1 437 ? 221.41700 44.74200 99.79100  1.000 58.02000  ?  425 LEU A CD1   1 
ATOM   3469 C  CD2   . LEU A 1 437 ? 219.59500 45.14800 98.10900  1.000 55.00000  ?  425 LEU A CD2   1 
ATOM   3470 N  N     . TRP A 1 438 ? 221.43500 43.20300 94.10900  1.000 54.27000  ?  426 TRP A N     1 
ATOM   3471 C  CA    . TRP A 1 438 ? 222.07000 42.79700 92.87600  1.000 58.47000  ?  426 TRP A CA    1 
ATOM   3472 C  C     . TRP A 1 438 ? 223.31400 43.59600 92.54800  1.000 58.24000  ?  426 TRP A C     1 
ATOM   3473 O  O     . TRP A 1 438 ? 223.94200 43.36700 91.52100  1.000 60.63000  ?  426 TRP A O     1 
ATOM   3474 C  CB    . TRP A 1 438 ? 221.07000 42.89400 91.73300  1.000 57.35000  ?  426 TRP A CB    1 
ATOM   3475 C  CG    . TRP A 1 438 ? 220.00900 41.85100 91.81000  1.000 62.05000  ?  426 TRP A CG    1 
ATOM   3476 C  CD1   . TRP A 1 438 ? 218.91900 41.84800 92.63000  1.000 65.53000  ?  426 TRP A CD1   1 
ATOM   3477 C  CD2   . TRP A 1 438 ? 219.93200 40.65000 91.03700  1.000 69.75000  ?  426 TRP A CD2   1 
ATOM   3478 N  NE1   . TRP A 1 438 ? 218.16500 40.71900 92.41900  1.000 67.28000  ?  426 TRP A NE1   1 
ATOM   3479 C  CE2   . TRP A 1 438 ? 218.76000 39.97100 91.43800  1.000 71.70000  ?  426 TRP A CE2   1 
ATOM   3480 C  CE3   . TRP A 1 438 ? 220.72400 40.09300 90.02900  1.000 72.24000  ?  426 TRP A CE3   1 
ATOM   3481 C  CZ2   . TRP A 1 438 ? 218.36700 38.75800 90.86900  1.000 72.51000  ?  426 TRP A CZ2   1 
ATOM   3482 C  CZ3   . TRP A 1 438 ? 220.33300 38.88600 89.46500  1.000 78.48000  ?  426 TRP A CZ3   1 
ATOM   3483 C  CH2   . TRP A 1 438 ? 219.16600 38.23200 89.89000  1.000 79.09000  ?  426 TRP A CH2   1 
ATOM   3484 N  N     . TYR A 1 439 ? 223.66200 44.54400 93.40600  1.000 51.58000  ?  427 TYR A N     1 
ATOM   3485 C  CA    . TYR A 1 439 ? 224.91300 45.26200 93.26100  1.000 48.63000  ?  427 TYR A CA    1 
ATOM   3486 C  C     . TYR A 1 439 ? 225.01700 46.14600 94.45000  1.000 53.00000  ?  427 TYR A C     1 
ATOM   3487 O  O     . TYR A 1 439 ? 224.06300 46.27700 95.18800  1.000 56.16000  ?  427 TYR A O     1 
ATOM   3488 C  CB    . TYR A 1 439 ? 224.98600 46.08900 91.97900  1.000 47.35000  ?  427 TYR A CB    1 
ATOM   3489 C  CG    . TYR A 1 439 ? 223.90600 47.12200 91.87700  1.000 51.51000  ?  427 TYR A CG    1 
ATOM   3490 C  CD1   . TYR A 1 439 ? 224.03700 48.35600 92.47800  1.000 50.05000  ?  427 TYR A CD1   1 
ATOM   3491 C  CD2   . TYR A 1 439 ? 222.74000 46.85100 91.17600  1.000 54.78000  ?  427 TYR A CD2   1 
ATOM   3492 C  CE1   . TYR A 1 439 ? 223.03400 49.29100 92.39900  1.000 51.24000  ?  427 TYR A CE1   1 
ATOM   3493 C  CE2   . TYR A 1 439 ? 221.73500 47.77300 91.08600  1.000 52.63000  ?  427 TYR A CE2   1 
ATOM   3494 C  CZ    . TYR A 1 439 ? 221.88200 48.99100 91.70100  1.000 53.66000  ?  427 TYR A CZ    1 
ATOM   3495 O  OH    . TYR A 1 439 ? 220.86100 49.89900 91.60300  1.000 52.96000  ?  427 TYR A OH    1 
ATOM   3496 N  N     . GLN A 1 440 ? 226.17100 46.76900 94.62800  1.000 56.54000  ?  428 GLN A N     1 
ATOM   3497 C  CA    . GLN A 1 440 ? 226.41100 47.53400 95.82500  1.000 54.80000  ?  428 GLN A CA    1 
ATOM   3498 C  C     . GLN A 1 440 ? 227.39400 48.65500 95.57800  1.000 54.07000  ?  428 GLN A C     1 
ATOM   3499 O  O     . GLN A 1 440 ? 228.56400 48.41500 95.31900  1.000 62.72000  ?  428 GLN A O     1 
ATOM   3500 C  CB    . GLN A 1 440 ? 226.93000 46.62200 96.92000  1.000 58.14000  ?  428 GLN A CB    1 
ATOM   3501 C  CG    . GLN A 1 440 ? 226.76000 47.19600 98.30100  1.000 69.89000  ?  428 GLN A CG    1 
ATOM   3502 C  CD    . GLN A 1 440 ? 227.15200 46.20400 99.38900  1.000 83.97000  ?  428 GLN A CD    1 
ATOM   3503 O  OE1   . GLN A 1 440 ? 226.85500 46.42300 100.56100 1.000 90.82000  ?  428 GLN A OE1   1 
ATOM   3504 N  NE2   . GLN A 1 440 ? 227.83100 45.11200 99.00600  1.000 79.28000  ?  428 GLN A NE2   1 
ATOM   3505 N  N     . LEU A 1 441 ? 226.91200 49.88300 95.66200  1.000 50.90000  ?  429 LEU A N     1 
ATOM   3506 C  CA    . LEU A 1 441 ? 227.77200 51.04000 95.58900  1.000 51.83000  ?  429 LEU A CA    1 
ATOM   3507 C  C     . LEU A 1 441 ? 228.88200 50.98700 96.63900  1.000 52.51000  ?  429 LEU A C     1 
ATOM   3508 O  O     . LEU A 1 441 ? 228.68500 50.53100 97.76400  1.000 55.04000  ?  429 LEU A O     1 
ATOM   3509 C  CB    . LEU A 1 441 ? 226.94700 52.30700 95.75600  1.000 53.35000  ?  429 LEU A CB    1 
ATOM   3510 C  CG    . LEU A 1 441 ? 225.76900 52.38300 94.78600  1.000 52.91000  ?  429 LEU A CG    1 
ATOM   3511 C  CD1   . LEU A 1 441 ? 225.14600 53.75500 94.82100  1.000 51.65000  ?  429 LEU A CD1   1 
ATOM   3512 C  CD2   . LEU A 1 441 ? 226.22600 52.05700 93.40200  1.000 48.50000  ?  429 LEU A CD2   1 
ATOM   3513 N  N     . GLU A 1 442 ? 230.06200 51.44500 96.25400  1.000 49.96000  ?  430 GLU A N     1 
ATOM   3514 C  CA    . GLU A 1 442 ? 231.18200 51.52400 97.17500  1.000 52.12000  ?  430 GLU A CA    1 
ATOM   3515 C  C     . GLU A 1 442 ? 230.95000 52.63200 98.15500  1.000 52.33000  ?  430 GLU A C     1 
ATOM   3516 O  O     . GLU A 1 442 ? 230.33700 53.63900 97.81000  1.000 52.88000  ?  430 GLU A O     1 
ATOM   3517 C  CB    . GLU A 1 442 ? 232.48400 51.77700 96.42400  1.000 51.62000  ?  430 GLU A CB    1 
ATOM   3518 C  CG    . GLU A 1 442 ? 232.87100 50.63900 95.52900  1.000 52.10000  ?  430 GLU A CG    1 
ATOM   3519 C  CD    . GLU A 1 442 ? 233.05600 49.37400 96.31700  1.000 56.03000  ?  430 GLU A CD    1 
ATOM   3520 O  OE1   . GLU A 1 442 ? 233.93400 49.36200 97.21300  1.000 66.65000  ?  430 GLU A OE1   1 
ATOM   3521 O  OE2   . GLU A 1 442 ? 232.31400 48.40500 96.05800  1.000 56.72000  ?  430 GLU A OE2   1 
ATOM   3522 N  N     . LYS A 1 443 ? 231.46000 52.48000 99.36900  1.000 55.84000  ?  431 LYS A N     1 
ATOM   3523 C  CA    . LYS A 1 443 ? 231.41500 53.60800 100.28000 1.000 54.51000  ?  431 LYS A CA    1 
ATOM   3524 C  C     . LYS A 1 443 ? 232.67300 54.49400 100.16300 1.000 55.55000  ?  431 LYS A C     1 
ATOM   3525 O  O     . LYS A 1 443 ? 232.65700 55.64500 100.57400 1.000 58.99000  ?  431 LYS A O     1 
ATOM   3526 C  CB    . LYS A 1 443 ? 231.21400 53.14900 101.71800 1.000 54.55000  ?  431 LYS A CB    1 
ATOM   3527 C  CG    . LYS A 1 443 ? 230.80800 54.32900 102.60500 1.000 75.98000  ?  431 LYS A CG    1 
ATOM   3528 C  CD    . LYS A 1 443 ? 230.78100 54.01400 104.08800 1.000 87.38000  ?  431 LYS A CD    1 
ATOM   3529 C  CE    . LYS A 1 443 ? 230.52000 55.28800 104.88100 1.000 93.09000  ?  431 LYS A CE    1 
ATOM   3530 N  NZ    . LYS A 1 443 ? 230.29800 55.01900 106.33200 1.000 103.01000 ?  431 LYS A NZ    1 
ATOM   3531 N  N     . GLU A 1 444 ? 233.75400 53.98100 99.58900  1.000 54.77000  ?  432 GLU A N     1 
ATOM   3532 C  CA    . GLU A 1 444 ? 234.93000 54.82800 99.37900  1.000 51.00000  ?  432 GLU A CA    1 
ATOM   3533 C  C     . GLU A 1 444 ? 235.26300 54.89300 97.90600  1.000 52.01000  ?  432 GLU A C     1 
ATOM   3534 O  O     . GLU A 1 444 ? 235.00500 53.94000 97.18500  1.000 51.49000  ?  432 GLU A O     1 
ATOM   3535 C  CB    . GLU A 1 444 ? 236.13800 54.30300 100.15000 1.000 50.80000  ?  432 GLU A CB    1 
ATOM   3536 C  CG    . GLU A 1 444 ? 235.93800 54.17200 101.64000 1.000 51.88000  ?  432 GLU A CG    1 
ATOM   3537 C  CD    . GLU A 1 444 ? 235.37200 55.44100 102.27100 1.000 68.51000  ?  432 GLU A CD    1 
ATOM   3538 O  OE1   . GLU A 1 444 ? 235.91400 56.54800 102.02900 1.000 67.39000  ?  432 GLU A OE1   1 
ATOM   3539 O  OE2   . GLU A 1 444 ? 234.36900 55.33200 103.01500 1.000 78.62000  ?  432 GLU A OE2   1 
ATOM   3540 N  N     . PRO A 1 445 ? 235.85600 56.00700 97.45100  1.000 52.22000  ?  433 PRO A N     1 
ATOM   3541 C  CA    . PRO A 1 445 ? 236.27600 56.05200 96.04500  1.000 47.28000  ?  433 PRO A CA    1 
ATOM   3542 C  C     . PRO A 1 445 ? 237.24900 54.92000 95.76300  1.000 46.44000  ?  433 PRO A C     1 
ATOM   3543 O  O     . PRO A 1 445 ? 237.91700 54.44700 96.68200  1.000 45.52000  ?  433 PRO A O     1 
ATOM   3544 C  CB    . PRO A 1 445 ? 236.94900 57.42200 95.91700  1.000 46.62000  ?  433 PRO A CB    1 
ATOM   3545 C  CG    . PRO A 1 445 ? 237.38500 57.75700 97.28800  1.000 43.36000  ?  433 PRO A CG    1 
ATOM   3546 C  CD    . PRO A 1 445 ? 236.35900 57.16000 98.21600  1.000 48.88000  ?  433 PRO A CD    1 
ATOM   3547 N  N     . ILE A 1 446 ? 237.30200 54.48500 94.51100  1.000 46.04000  ?  434 ILE A N     1 
ATOM   3548 C  CA    . ILE A 1 446 ? 238.08300 53.31800 94.11200  1.000 46.47000  ?  434 ILE A CA    1 
ATOM   3549 C  C     . ILE A 1 446 ? 239.44500 53.67400 93.49500  1.000 53.23000  ?  434 ILE A C     1 
ATOM   3550 O  O     . ILE A 1 446 ? 239.50300 54.36800 92.46600  1.000 48.99000  ?  434 ILE A O     1 
ATOM   3551 C  CB    . ILE A 1 446 ? 237.33700 52.48200 93.08200  1.000 45.78000  ?  434 ILE A CB    1 
ATOM   3552 C  CG1   . ILE A 1 446 ? 235.90700 52.17600 93.53100  1.000 49.38000  ?  434 ILE A CG1   1 
ATOM   3553 C  CG2   . ILE A 1 446 ? 238.08800 51.21900 92.77200  1.000 48.45000  ?  434 ILE A CG2   1 
ATOM   3554 C  CD1   . ILE A 1 446 ? 234.96500 51.99300 92.34500  1.000 41.58000  ?  434 ILE A CD1   1 
ATOM   3555 N  N     . VAL A 1 447 ? 240.52400 53.18200 94.11300  1.000 50.34000  ?  435 VAL A N     1 
ATOM   3556 C  CA    . VAL A 1 447 ? 241.86200 53.28900 93.53200  1.000 47.47000  ?  435 VAL A CA    1 
ATOM   3557 C  C     . VAL A 1 447 ? 241.99500 52.49200 92.23900  1.000 50.90000  ?  435 VAL A C     1 
ATOM   3558 O  O     . VAL A 1 447 ? 241.60800 51.31700 92.17300  1.000 51.92000  ?  435 VAL A O     1 
ATOM   3559 C  CB    . VAL A 1 447 ? 242.94000 52.80400 94.49000  1.000 43.02000  ?  435 VAL A CB    1 
ATOM   3560 C  CG1   . VAL A 1 447 ? 244.30200 52.87100 93.81500  1.000 47.10000  ?  435 VAL A CG1   1 
ATOM   3561 C  CG2   . VAL A 1 447 ? 242.91700 53.64100 95.72500  1.000 41.02000  ?  435 VAL A CG2   1 
ATOM   3562 N  N     . GLY A 1 448 ? 242.54600 53.14700 91.21500  1.000 50.50000  ?  436 GLY A N     1 
ATOM   3563 C  CA    . GLY A 1 448 ? 242.75900 52.51300 89.93400  1.000 48.25000  ?  436 GLY A CA    1 
ATOM   3564 C  C     . GLY A 1 448 ? 241.49700 52.36900 89.11900  1.000 56.01000  ?  436 GLY A C     1 
ATOM   3565 O  O     . GLY A 1 448 ? 241.47800 51.66800 88.11000  1.000 64.11000  ?  436 GLY A O     1 
ATOM   3566 N  N     . ALA A 1 449 ? 240.42400 53.00700 89.55800  1.000 50.46000  ?  437 ALA A N     1 
ATOM   3567 C  CA    . ALA A 1 449 ? 239.25600 53.11200 88.71500  1.000 42.39000  ?  437 ALA A CA    1 
ATOM   3568 C  C     . ALA A 1 449 ? 239.31400 54.47600 88.08800  1.000 46.65000  ?  437 ALA A C     1 
ATOM   3569 O  O     . ALA A 1 449 ? 239.76200 55.42300 88.72000  1.000 49.08000  ?  437 ALA A O     1 
ATOM   3570 C  CB    . ALA A 1 449 ? 238.01700 52.92400 89.49500  1.000 48.02000  ?  437 ALA A CB    1 
ATOM   3571 N  N     . GLU A 1 450 ? 238.92700 54.57100 86.82400  1.000 42.10000  ?  438 GLU A N     1 
ATOM   3572 C  CA    . GLU A 1 450 ? 238.92600 55.84300 86.13600  1.000 41.46000  ?  438 GLU A CA    1 
ATOM   3573 C  C     . GLU A 1 450 ? 237.81600 56.74200 86.70600  1.000 47.26000  ?  438 GLU A C     1 
ATOM   3574 O  O     . GLU A 1 450 ? 236.76600 56.25800 87.10000  1.000 43.97000  ?  438 GLU A O     1 
ATOM   3575 C  CB    . GLU A 1 450 ? 238.72900 55.60600 84.65500  1.000 46.39000  ?  438 GLU A CB    1 
ATOM   3576 C  CG    . GLU A 1 450 ? 238.76800 56.81900 83.78200  1.000 45.77000  ?  438 GLU A CG    1 
ATOM   3577 C  CD    . GLU A 1 450 ? 238.57200 56.43900 82.32000  1.000 53.13000  ?  438 GLU A CD    1 
ATOM   3578 O  OE1   . GLU A 1 450 ? 238.12400 55.29300 82.04700  1.000 49.30000  ?  438 GLU A OE1   1 
ATOM   3579 O  OE2   . GLU A 1 450 ? 238.87600 57.27900 81.44400  1.000 58.95000  ?  438 GLU A OE2   1 
ATOM   3580 N  N     . THR A 1 451 ? 238.03900 58.04800 86.74300  1.000 48.59000  ?  439 THR A N     1 
ATOM   3581 C  CA    . THR A 1 451 ? 237.03800 58.95900 87.28000  1.000 46.13000  ?  439 THR A CA    1 
ATOM   3582 C  C     . THR A 1 451 ? 236.25300 59.66800 86.18400  1.000 45.48000  ?  439 THR A C     1 
ATOM   3583 O  O     . THR A 1 451 ? 236.83000 60.39300 85.37600  1.000 50.84000  ?  439 THR A O     1 
ATOM   3584 C  CB    . THR A 1 451 ? 237.68500 60.01600 88.20600  1.000 46.95000  ?  439 THR A CB    1 
ATOM   3585 O  OG1   . THR A 1 451 ? 238.31500 59.35700 89.31700  1.000 48.92000  ?  439 THR A OG1   1 
ATOM   3586 C  CG2   . THR A 1 451 ? 236.62600 61.01000 88.74100  1.000 40.24000  ?  439 THR A CG2   1 
ATOM   3587 N  N     . PHE A 1 452 ? 234.94000 59.46200 86.16200  1.000 40.18000  ?  440 PHE A N     1 
ATOM   3588 C  CA    . PHE A 1 452 ? 234.05500 60.13600 85.20500  1.000 44.00000  ?  440 PHE A CA    1 
ATOM   3589 C  C     . PHE A 1 452 ? 233.30800 61.29800 85.85100  1.000 47.01000  ?  440 PHE A C     1 
ATOM   3590 O  O     . PHE A 1 452 ? 232.56100 61.10300 86.81400  1.000 47.97000  ?  440 PHE A O     1 
ATOM   3591 C  CB    . PHE A 1 452 ? 233.01500 59.15900 84.62700  1.000 40.55000  ?  440 PHE A CB    1 
ATOM   3592 C  CG    . PHE A 1 452 ? 233.56900 58.17200 83.63900  1.000 41.64000  ?  440 PHE A CG    1 
ATOM   3593 C  CD1   . PHE A 1 452 ? 234.41800 57.16400 84.04700  1.000 44.39000  ?  440 PHE A CD1   1 
ATOM   3594 C  CD2   . PHE A 1 452 ? 233.22300 58.24700 82.29800  1.000 46.64000  ?  440 PHE A CD2   1 
ATOM   3595 C  CE1   . PHE A 1 452 ? 234.92900 56.28100 83.14300  1.000 42.65000  ?  440 PHE A CE1   1 
ATOM   3596 C  CE2   . PHE A 1 452 ? 233.73900 57.36700 81.38900  1.000 46.37000  ?  440 PHE A CE2   1 
ATOM   3597 C  CZ    . PHE A 1 452 ? 234.58600 56.37500 81.81700  1.000 45.70000  ?  440 PHE A CZ    1 
ATOM   3598 N  N     . TYR A 1 453 ? 233.47400 62.49800 85.31700  1.000 45.70000  ?  441 TYR A N     1 
ATOM   3599 C  CA    . TYR A 1 453 ? 232.58900 63.58600 85.69800  1.000 41.76000  ?  441 TYR A CA    1 
ATOM   3600 C  C     . TYR A 1 453 ? 231.46700 63.66700 84.66000  1.000 47.31000  ?  441 TYR A C     1 
ATOM   3601 O  O     . TYR A 1 453 ? 231.71400 63.97500 83.49400  1.000 47.50000  ?  441 TYR A O     1 
ATOM   3602 C  CB    . TYR A 1 453 ? 233.35400 64.90000 85.80400  1.000 39.93000  ?  441 TYR A CB    1 
ATOM   3603 C  CG    . TYR A 1 453 ? 234.45100 64.85200 86.83700  1.000 43.39000  ?  441 TYR A CG    1 
ATOM   3604 C  CD1   . TYR A 1 453 ? 235.70500 64.36800 86.51100  1.000 44.30000  ?  441 TYR A CD1   1 
ATOM   3605 C  CD2   . TYR A 1 453 ? 234.22700 65.26400 88.14300  1.000 43.84000  ?  441 TYR A CD2   1 
ATOM   3606 C  CE1   . TYR A 1 453 ? 236.70200 64.30300 87.44100  1.000 48.40000  ?  441 TYR A CE1   1 
ATOM   3607 C  CE2   . TYR A 1 453 ? 235.22300 65.20400 89.09000  1.000 45.03000  ?  441 TYR A CE2   1 
ATOM   3608 C  CZ    . TYR A 1 453 ? 236.46300 64.72000 88.73500  1.000 50.65000  ?  441 TYR A CZ    1 
ATOM   3609 O  OH    . TYR A 1 453 ? 237.48900 64.65400 89.65200  1.000 46.83000  ?  441 TYR A OH    1 
ATOM   3610 N  N     . VAL A 1 454 ? 230.23800 63.36400 85.07300  1.000 45.66000  ?  442 VAL A N     1 
ATOM   3611 C  CA    . VAL A 1 454 ? 229.11700 63.35400 84.14000  1.000 47.26000  ?  442 VAL A CA    1 
ATOM   3612 C  C     . VAL A 1 454 ? 228.24900 64.58100 84.30100  1.000 48.45000  ?  442 VAL A C     1 
ATOM   3613 O  O     . VAL A 1 454 ? 228.28900 65.23300 85.33400  1.000 50.59000  ?  442 VAL A O     1 
ATOM   3614 C  CB    . VAL A 1 454 ? 228.23900 62.12200 84.31700  1.000 47.26000  ?  442 VAL A CB    1 
ATOM   3615 C  CG1   . VAL A 1 454 ? 229.08400 60.86600 84.18700  1.000 43.89000  ?  442 VAL A CG1   1 
ATOM   3616 C  CG2   . VAL A 1 454 ? 227.52500 62.18000 85.66300  1.000 47.03000  ?  442 VAL A CG2   1 
ATOM   3617 N  N     . ASP A 1 455 ? 227.46800 64.89300 83.26900  1.000 48.79000  ?  443 ASP A N     1 
ATOM   3618 C  CA    . ASP A 1 455 ? 226.54500 66.01100 83.33700  1.000 51.09000  ?  443 ASP A CA    1 
ATOM   3619 C  C     . ASP A 1 455 ? 225.59900 66.05000 82.14800  1.000 52.64000  ?  443 ASP A C     1 
ATOM   3620 O  O     . ASP A 1 455 ? 225.86400 65.46200 81.10800  1.000 53.76000  ?  443 ASP A O     1 
ATOM   3621 C  CB    . ASP A 1 455 ? 227.31300 67.32600 83.43100  1.000 54.32000  ?  443 ASP A CB    1 
ATOM   3622 C  CG    . ASP A 1 455 ? 226.46800 68.45800 84.00500  1.000 59.44000  ?  443 ASP A CG    1 
ATOM   3623 O  OD1   . ASP A 1 455 ? 225.38400 68.19400 84.57700  1.000 58.52000  ?  443 ASP A OD1   1 
ATOM   3624 O  OD2   . ASP A 1 455 ? 226.89700 69.62300 83.88900  1.000 62.74000  ?  443 ASP A OD2   1 
ATOM   3625 N  N     . GLY A 1 456 ? 224.48200 66.74400 82.32100  1.000 50.93000  ?  444 GLY A N     1 
ATOM   3626 C  CA    . GLY A 1 456 ? 223.52000 66.92300 81.25400  1.000 52.15000  ?  444 GLY A CA    1 
ATOM   3627 C  C     . GLY A 1 456 ? 222.92000 68.31900 81.28800  1.000 54.35000  ?  444 GLY A C     1 
ATOM   3628 O  O     . GLY A 1 456 ? 222.91400 68.97900 82.32100  1.000 61.14000  ?  444 GLY A O     1 
ATOM   3629 N  N     . ALA A 1 457 ? 222.44100 68.78400 80.14400  1.000 55.52000  ?  445 ALA A N     1 
ATOM   3630 C  CA    . ALA A 1 457 ? 221.73900 70.04800 80.06600  1.000 52.24000  ?  445 ALA A CA    1 
ATOM   3631 C  C     . ALA A 1 457 ? 220.62400 69.87500 79.06400  1.000 57.20000  ?  445 ALA A C     1 
ATOM   3632 O  O     . ALA A 1 457 ? 220.77400 69.17000 78.07000  1.000 55.62000  ?  445 ALA A O     1 
ATOM   3633 C  CB    . ALA A 1 457 ? 222.65900 71.16700 79.66400  1.000 49.59000  ?  445 ALA A CB    1 
ATOM   3634 N  N     . ALA A 1 458 ? 219.49100 70.49900 79.34100  1.000 60.14000  ?  446 ALA A N     1 
ATOM   3635 C  CA    . ALA A 1 458 ? 218.35700 70.41100 78.45100  1.000 57.40000  ?  446 ALA A CA    1 
ATOM   3636 C  C     . ALA A 1 458 ? 217.74900 71.79300 78.28100  1.000 57.95000  ?  446 ALA A C     1 
ATOM   3637 O  O     . ALA A 1 458 ? 217.67000 72.55600 79.22800  1.000 59.65000  ?  446 ALA A O     1 
ATOM   3638 C  CB    . ALA A 1 458 ? 217.34300 69.41900 78.99100  1.000 51.77000  ?  446 ALA A CB    1 
ATOM   3639 N  N     . ASN A 1 459 ? 217.34700 72.12200 77.06200  1.000 63.11000  ?  447 ASN A N     1 
ATOM   3640 C  CA    . ASN A 1 459 ? 216.66700 73.37500 76.78500  1.000 63.49000  ?  447 ASN A CA    1 
ATOM   3641 C  C     . ASN A 1 459 ? 215.15300 73.19800 76.92900  1.000 65.21000  ?  447 ASN A C     1 
ATOM   3642 O  O     . ASN A 1 459 ? 214.55800 72.38200 76.23300  1.000 68.39000  ?  447 ASN A O     1 
ATOM   3643 C  CB    . ASN A 1 459 ? 217.04600 73.85200 75.38700  1.000 68.59000  ?  447 ASN A CB    1 
ATOM   3644 C  CG    . ASN A 1 459 ? 216.36500 75.15100 74.99500  1.000 74.45000  ?  447 ASN A CG    1 
ATOM   3645 O  OD1   . ASN A 1 459 ? 215.15800 75.32400 75.18300  1.000 73.57000  ?  447 ASN A OD1   1 
ATOM   3646 N  ND2   . ASN A 1 459 ? 217.13900 76.06800 74.42100  1.000 69.72000  ?  447 ASN A ND2   1 
ATOM   3647 N  N     . ARG A 1 460 ? 214.52600 73.95600 77.82200  1.000 63.40000  ?  448 ARG A N     1 
ATOM   3648 C  CA    . ARG A 1 460 ? 213.11700 73.71600 78.14000  1.000 67.97000  ?  448 ARG A CA    1 
ATOM   3649 C  C     . ARG A 1 460 ? 212.18200 74.02500 76.97500  1.000 75.30000  ?  448 ARG A C     1 
ATOM   3650 O  O     . ARG A 1 460 ? 211.09000 73.45900 76.87200  1.000 71.74000  ?  448 ARG A O     1 
ATOM   3651 C  CB    . ARG A 1 460 ? 212.69300 74.53100 79.35400  1.000 66.21000  ?  448 ARG A CB    1 
ATOM   3652 C  CG    . ARG A 1 460 ? 213.61800 74.36800 80.54700  1.000 77.78000  ?  448 ARG A CG    1 
ATOM   3653 C  CD    . ARG A 1 460 ? 212.90900 74.72100 81.84200  1.000 87.07000  ?  448 ARG A CD    1 
ATOM   3654 N  NE    . ARG A 1 460 ? 212.01400 75.86300 81.67500  1.000 86.75000  ?  448 ARG A NE    1 
ATOM   3655 C  CZ    . ARG A 1 460 ? 211.21100 76.31000 82.63000  1.000 83.40000  ?  448 ARG A CZ    1 
ATOM   3656 N  NH1   . ARG A 1 460 ? 211.20900 75.70100 83.80800  1.000 79.95000  ?  448 ARG A NH1   1 
ATOM   3657 N  NH2   . ARG A 1 460 ? 210.42100 77.35900 82.41400  1.000 85.10000  ?  448 ARG A NH2   1 
ATOM   3658 N  N     . GLU A 1 461 ? 212.61100 74.92100 76.09500  1.000 73.63000  ?  449 GLU A N     1 
ATOM   3659 C  CA    . GLU A 1 461 ? 211.79600 75.28600 74.94500  1.000 75.96000  ?  449 GLU A CA    1 
ATOM   3660 C  C     . GLU A 1 461 ? 211.86900 74.23300 73.84900  1.000 72.62000  ?  449 GLU A C     1 
ATOM   3661 O  O     . GLU A 1 461 ? 210.85700 73.62800 73.49500  1.000 71.39000  ?  449 GLU A O     1 
ATOM   3662 C  CB    . GLU A 1 461 ? 212.23300 76.64000 74.39100  1.000 80.72000  ?  449 GLU A CB    1 
ATOM   3663 C  CG    . GLU A 1 461 ? 212.32100 77.73800 75.43500  1.000 85.38000  ?  449 GLU A CG    1 
ATOM   3664 C  CD    . GLU A 1 461 ? 211.56000 78.98800 75.02700  1.000 103.47000 ?  449 GLU A CD    1 
ATOM   3665 O  OE1   . GLU A 1 461 ? 211.89800 80.08000 75.54400  1.000 105.97000 ?  449 GLU A OE1   1 
ATOM   3666 O  OE2   . GLU A 1 461 ? 210.62200 78.87400 74.19500  1.000 102.25000 ?  449 GLU A OE2   1 
ATOM   3667 N  N     . THR A 1 462 ? 213.07500 74.02600 73.32100  1.000 71.21000  ?  450 THR A N     1 
ATOM   3668 C  CA    . THR A 1 462 ? 213.30600 73.11300 72.19700  1.000 69.28000  ?  450 THR A CA    1 
ATOM   3669 C  C     . THR A 1 462 ? 213.23900 71.64200 72.60000  1.000 66.10000  ?  450 THR A C     1 
ATOM   3670 O  O     . THR A 1 462 ? 213.04700 70.76800 71.76100  1.000 65.16000  ?  450 THR A O     1 
ATOM   3671 C  CB    . THR A 1 462 ? 214.68300 73.36600 71.55000  1.000 70.78000  ?  450 THR A CB    1 
ATOM   3672 O  OG1   . THR A 1 462 ? 215.70300 72.73200 72.33100  1.000 73.91000  ?  450 THR A OG1   1 
ATOM   3673 C  CG2   . THR A 1 462 ? 214.97700 74.85300 71.48000  1.000 69.66000  ?  450 THR A CG2   1 
ATOM   3674 N  N     . LYS A 1 463 ? 213.41100 71.38100 73.89100  1.000 68.75000  ?  451 LYS A N     1 
ATOM   3675 C  CA    . LYS A 1 463 ? 213.47000 70.02400 74.40800  1.000 68.63000  ?  451 LYS A CA    1 
ATOM   3676 C  C     . LYS A 1 463 ? 214.71600 69.28300 73.90800  1.000 66.16000  ?  451 LYS A C     1 
ATOM   3677 O  O     . LYS A 1 463 ? 214.79100 68.06000 73.98200  1.000 64.56000  ?  451 LYS A O     1 
ATOM   3678 C  CB    . LYS A 1 463 ? 212.20500 69.25800 74.03000  1.000 65.95000  ?  451 LYS A CB    1 
ATOM   3679 C  CG    . LYS A 1 463 ? 211.20600 69.14000 75.15900  1.000 70.11000  ?  451 LYS A CG    1 
ATOM   3680 C  CD    . LYS A 1 463 ? 210.80600 70.50000 75.70400  1.000 72.22000  ?  451 LYS A CD    1 
ATOM   3681 C  CE    . LYS A 1 463 ? 209.65400 70.35800 76.68700  1.000 75.01000  ?  451 LYS A CE    1 
ATOM   3682 N  NZ    . LYS A 1 463 ? 209.27800 71.64400 77.34100  1.000 77.14000  ?  451 LYS A NZ    1 
ATOM   3683 N  N     . LEU A 1 464 ? 215.68900 70.02900 73.39800  1.000 63.91000  ?  452 LEU A N     1 
ATOM   3684 C  CA    . LEU A 1 464 ? 216.95300 69.43200 72.98200  1.000 64.75000  ?  452 LEU A CA    1 
ATOM   3685 C  C     . LEU A 1 464 ? 217.89700 69.37200 74.17000  1.000 65.52000  ?  452 LEU A C     1 
ATOM   3686 O  O     . LEU A 1 464 ? 217.86100 70.22600 75.05400  1.000 66.15000  ?  452 LEU A O     1 
ATOM   3687 C  CB    . LEU A 1 464 ? 217.60500 70.22300 71.84600  1.000 65.58000  ?  452 LEU A CB    1 
ATOM   3688 C  CG    . LEU A 1 464 ? 217.13800 70.07500 70.39700  1.000 66.67000  ?  452 LEU A CG    1 
ATOM   3689 C  CD1   . LEU A 1 464 ? 215.65100 69.82300 70.29300  1.000 70.78000  ?  452 LEU A CD1   1 
ATOM   3690 C  CD2   . LEU A 1 464 ? 217.51500 71.34100 69.63300  1.000 68.48000  ?  452 LEU A CD2   1 
ATOM   3691 N  N     . GLY A 1 465 ? 218.74900 68.36400 74.19500  1.000 60.08000  ?  453 GLY A N     1 
ATOM   3692 C  CA    . GLY A 1 465 ? 219.66000 68.23600 75.30600  1.000 59.79000  ?  453 GLY A CA    1 
ATOM   3693 C  C     . GLY A 1 465 ? 220.95200 67.54000 74.94500  1.000 55.81000  ?  453 GLY A C     1 
ATOM   3694 O  O     . GLY A 1 465 ? 221.04600 66.84100 73.93500  1.000 52.13000  ?  453 GLY A O     1 
ATOM   3695 N  N     . LYS A 1 466 ? 221.94800 67.74500 75.79200  1.000 47.69000  ?  454 LYS A N     1 
ATOM   3696 C  CA    . LYS A 1 466 ? 223.19700 67.03900 75.69000  1.000 51.58000  ?  454 LYS A CA    1 
ATOM   3697 C  C     . LYS A 1 466 ? 223.49700 66.33800 77.00100  1.000 54.33000  ?  454 LYS A C     1 
ATOM   3698 O  O     . LYS A 1 466 ? 223.15600 66.83600 78.07200  1.000 51.35000  ?  454 LYS A O     1 
ATOM   3699 C  CB    . LYS A 1 466 ? 224.32000 67.99700 75.32400  1.000 52.83000  ?  454 LYS A CB    1 
ATOM   3700 C  CG    . LYS A 1 466 ? 224.29900 68.39400 73.87000  1.000 55.46000  ?  454 LYS A CG    1 
ATOM   3701 C  CD    . LYS A 1 466 ? 225.16000 69.60200 73.65900  1.000 56.83000  ?  454 LYS A CD    1 
ATOM   3702 C  CE    . LYS A 1 466 ? 225.15800 70.01700 72.20800  1.000 61.23000  ?  454 LYS A CE    1 
ATOM   3703 N  NZ    . LYS A 1 466 ? 226.02300 71.21500 72.02400  1.000 60.23000  ?  454 LYS A NZ    1 
ATOM   3704 N  N     . ALA A 1 467 ? 224.12100 65.16900 76.89900  1.000 53.06000  ?  455 ALA A N     1 
ATOM   3705 C  CA    . ALA A 1 467 ? 224.60400 64.42900 78.04900  1.000 43.54000  ?  455 ALA A CA    1 
ATOM   3706 C  C     . ALA A 1 467 ? 226.03100 63.99700 77.76600  1.000 49.54000  ?  455 ALA A C     1 
ATOM   3707 O  O     . ALA A 1 467 ? 226.40000 63.77800 76.61700  1.000 50.34000  ?  455 ALA A O     1 
ATOM   3708 C  CB    . ALA A 1 467 ? 223.72600 63.24900 78.32300  1.000 45.97000  ?  455 ALA A CB    1 
ATOM   3709 N  N     . GLY A 1 468 ? 226.86100 63.88400 78.78800  1.000 49.88000  ?  456 GLY A N     1 
ATOM   3710 C  CA    . GLY A 1 468 ? 228.24500 63.57500 78.50100  1.000 46.74000  ?  456 GLY A CA    1 
ATOM   3711 C  C     . GLY A 1 468 ? 229.11700 63.48300 79.72400  1.000 50.76000  ?  456 GLY A C     1 
ATOM   3712 O  O     . GLY A 1 468 ? 228.66700 63.73200 80.84400  1.000 48.16000  ?  456 GLY A O     1 
ATOM   3713 N  N     . TYR A 1 469 ? 230.37300 63.09800 79.50200  1.000 53.50000  ?  457 TYR A N     1 
ATOM   3714 C  CA    . TYR A 1 469 ? 231.36000 63.03100 80.57200  1.000 49.22000  ?  457 TYR A CA    1 
ATOM   3715 C  C     . TYR A 1 469 ? 232.68300 63.62000 80.14500  1.000 50.99000  ?  457 TYR A C     1 
ATOM   3716 O  O     . TYR A 1 469 ? 232.88500 64.02800 79.00400  1.000 51.51000  ?  457 TYR A O     1 
ATOM   3717 C  CB    . TYR A 1 469 ? 231.58900 61.59400 81.04100  1.000 41.01000  ?  457 TYR A CB    1 
ATOM   3718 C  CG    . TYR A 1 469 ? 232.00100 60.65400 79.93800  1.000 48.56000  ?  457 TYR A CG    1 
ATOM   3719 C  CD1   . TYR A 1 469 ? 233.30300 60.65200 79.44500  1.000 49.86000  ?  457 TYR A CD1   1 
ATOM   3720 C  CD2   . TYR A 1 469 ? 231.08100 59.76700 79.37200  1.000 48.37000  ?  457 TYR A CD2   1 
ATOM   3721 C  CE1   . TYR A 1 469 ? 233.67300 59.80100 78.42800  1.000 48.15000  ?  457 TYR A CE1   1 
ATOM   3722 C  CE2   . TYR A 1 469 ? 231.44900 58.90500 78.36900  1.000 49.43000  ?  457 TYR A CE2   1 
ATOM   3723 C  CZ    . TYR A 1 469 ? 232.74600 58.92900 77.89800  1.000 52.68000  ?  457 TYR A CZ    1 
ATOM   3724 O  OH    . TYR A 1 469 ? 233.10900 58.07300 76.89400  1.000 53.79000  ?  457 TYR A OH    1 
ATOM   3725 N  N     . VAL A 1 470 ? 233.57700 63.63000 81.11600  1.000 52.27000  ?  458 VAL A N     1 
ATOM   3726 C  CA    . VAL A 1 470 ? 234.94900 64.04300 80.98200  1.000 51.05000  ?  458 VAL A CA    1 
ATOM   3727 C  C     . VAL A 1 470 ? 235.62400 63.18100 82.04200  1.000 49.30000  ?  458 VAL A C     1 
ATOM   3728 O  O     . VAL A 1 470 ? 235.06800 63.05000 83.14300  1.000 46.95000  ?  458 VAL A O     1 
ATOM   3729 C  CB    . VAL A 1 470 ? 235.09900 65.56800 81.22500  1.000 57.29000  ?  458 VAL A CB    1 
ATOM   3730 C  CG1   . VAL A 1 470 ? 236.10300 65.88100 82.33000  1.000 52.14000  ?  458 VAL A CG1   1 
ATOM   3731 C  CG2   . VAL A 1 470 ? 235.40700 66.29900 79.93200  1.000 50.77000  ?  458 VAL A CG2   1 
ATOM   3732 N  N     . THR A 1 471 ? 236.75900 62.55100 81.71500  1.000 48.39000  ?  459 THR A N     1 
ATOM   3733 C  CA    . THR A 1 471 ? 237.44200 61.66300 82.67100  1.000 47.44000  ?  459 THR A CA    1 
ATOM   3734 C  C     . THR A 1 471 ? 238.81900 62.18300 83.03400  1.000 48.55000  ?  459 THR A C     1 
ATOM   3735 O  O     . THR A 1 471 ? 239.38500 63.00000 82.31800  1.000 49.72000  ?  459 THR A O     1 
ATOM   3736 C  CB    . THR A 1 471 ? 237.60900 60.23300 82.13100  1.000 46.65000  ?  459 THR A CB    1 
ATOM   3737 O  OG1   . THR A 1 471 ? 238.72300 60.19400 81.23300  1.000 48.86000  ?  459 THR A OG1   1 
ATOM   3738 C  CG2   . THR A 1 471 ? 236.33700 59.75500 81.42100  1.000 46.18000  ?  459 THR A CG2   1 
ATOM   3739 N  N     . ASN A 1 472 ? 239.36800 61.69600 84.14400  1.000 51.04000  ?  460 ASN A N     1 
ATOM   3740 C  CA    . ASN A 1 472 ? 240.69400 62.13500 84.58200  1.000 49.44000  ?  460 ASN A CA    1 
ATOM   3741 C  C     . ASN A 1 472 ? 241.81400 61.62700 83.68500  1.000 51.98000  ?  460 ASN A C     1 
ATOM   3742 O  O     . ASN A 1 472 ? 242.95100 62.05400 83.81000  1.000 51.80000  ?  460 ASN A O     1 
ATOM   3743 C  CB    . ASN A 1 472 ? 240.95800 61.68400 86.00100  1.000 44.57000  ?  460 ASN A CB    1 
ATOM   3744 C  CG    . ASN A 1 472 ? 241.19700 60.20700 86.09600  1.000 49.36000  ?  460 ASN A CG    1 
ATOM   3745 O  OD1   . ASN A 1 472 ? 240.28300 59.41500 85.89500  1.000 53.57000  ?  460 ASN A OD1   1 
ATOM   3746 N  ND2   . ASN A 1 472 ? 242.42500 59.81700 86.40500  1.000 47.98000  ?  460 ASN A ND2   1 
ATOM   3747 N  N     . ARG A 1 473 ? 241.48800 60.70100 82.79300  1.000 52.69000  ?  461 ARG A N     1 
ATOM   3748 C  CA    . ARG A 1 473 ? 242.46600 60.15400 81.86200  1.000 50.35000  ?  461 ARG A CA    1 
ATOM   3749 C  C     . ARG A 1 473 ? 242.35200 60.84600 80.51900  1.000 49.14000  ?  461 ARG A C     1 
ATOM   3750 O  O     . ARG A 1 473 ? 242.94800 60.40900 79.53700  1.000 55.19000  ?  461 ARG A O     1 
ATOM   3751 C  CB    . ARG A 1 473 ? 242.27700 58.64800 81.69800  1.000 47.02000  ?  461 ARG A CB    1 
ATOM   3752 C  CG    . ARG A 1 473 ? 242.67100 57.87600 82.91600  1.000 49.36000  ?  461 ARG A CG    1 
ATOM   3753 C  CD    . ARG A 1 473 ? 242.12900 56.47800 82.91200  1.000 45.78000  ?  461 ARG A CD    1 
ATOM   3754 N  NE    . ARG A 1 473 ? 242.46500 55.81300 84.17000  1.000 53.57000  ?  461 ARG A NE    1 
ATOM   3755 C  CZ    . ARG A 1 473 ? 242.16600 54.54500 84.43500  1.000 58.20000  ?  461 ARG A CZ    1 
ATOM   3756 N  NH1   . ARG A 1 473 ? 241.53900 53.82100 83.51100  1.000 54.49000  ?  461 ARG A NH1   1 
ATOM   3757 N  NH2   . ARG A 1 473 ? 242.49500 54.00100 85.60800  1.000 55.59000  ?  461 ARG A NH2   1 
ATOM   3758 N  N     . GLY A 1 474 ? 241.56200 61.91300 80.47800  1.000 48.02000  ?  462 GLY A N     1 
ATOM   3759 C  CA    . GLY A 1 474 ? 241.48200 62.76000 79.30200  1.000 44.57000  ?  462 GLY A CA    1 
ATOM   3760 C  C     . GLY A 1 474 ? 240.47700 62.37300 78.23100  1.000 50.34000  ?  462 GLY A C     1 
ATOM   3761 O  O     . GLY A 1 474 ? 240.55200 62.86700 77.11100  1.000 54.64000  ?  462 GLY A O     1 
ATOM   3762 N  N     . ARG A 1 475 ? 239.52900 61.50100 78.54900  1.000 47.85000  ?  463 ARG A N     1 
ATOM   3763 C  CA    . ARG A 1 475 ? 238.48400 61.19000 77.58700  1.000 47.65000  ?  463 ARG A CA    1 
ATOM   3764 C  C     . ARG A 1 475 ? 237.31700 62.15100 77.70400  1.000 47.79000  ?  463 ARG A C     1 
ATOM   3765 O  O     . ARG A 1 475 ? 236.98800 62.58300 78.79200  1.000 54.05000  ?  463 ARG A O     1 
ATOM   3766 C  CB    . ARG A 1 475 ? 237.98000 59.78700 77.79900  1.000 48.37000  ?  463 ARG A CB    1 
ATOM   3767 C  CG    . ARG A 1 475 ? 238.99200 58.75000 77.54700  1.000 51.65000  ?  463 ARG A CG    1 
ATOM   3768 C  CD    . ARG A 1 475 ? 238.26900 57.48100 77.24800  1.000 52.05000  ?  463 ARG A CD    1 
ATOM   3769 N  NE    . ARG A 1 475 ? 238.04200 56.68600 78.43600  1.000 51.92000  ?  463 ARG A NE    1 
ATOM   3770 C  CZ    . ARG A 1 475 ? 237.08800 55.77400 78.53000  1.000 54.14000  ?  463 ARG A CZ    1 
ATOM   3771 N  NH1   . ARG A 1 475 ? 236.25200 55.58500 77.51000  1.000 47.37000  ?  463 ARG A NH1   1 
ATOM   3772 N  NH2   . ARG A 1 475 ? 236.97100 55.06200 79.64400  1.000 50.42000  ?  463 ARG A NH2   1 
ATOM   3773 N  N     . GLN A 1 476 ? 236.67500 62.48600 76.60100  1.000 48.96000  ?  464 GLN A N     1 
ATOM   3774 C  CA    . GLN A 1 476 ? 235.42500 63.20900 76.71800  1.000 52.26000  ?  464 GLN A CA    1 
ATOM   3775 C  C     . GLN A 1 476 ? 234.49400 62.79600 75.62300  1.000 51.93000  ?  464 GLN A C     1 
ATOM   3776 O  O     . GLN A 1 476 ? 234.93200 62.51100 74.51900  1.000 55.55000  ?  464 GLN A O     1 
ATOM   3777 C  CB    . GLN A 1 476 ? 235.63800 64.70500 76.70000  1.000 53.78000  ?  464 GLN A CB    1 
ATOM   3778 C  CG    . GLN A 1 476 ? 236.06700 65.29400 75.40300  1.000 60.23000  ?  464 GLN A CG    1 
ATOM   3779 C  CD    . GLN A 1 476 ? 236.21100 66.79700 75.53800  1.000 71.96000  ?  464 GLN A CD    1 
ATOM   3780 O  OE1   . GLN A 1 476 ? 235.33600 67.56300 75.10600  1.000 72.92000  ?  464 GLN A OE1   1 
ATOM   3781 N  NE2   . GLN A 1 476 ? 237.29700 67.23000 76.18700  1.000 68.44000  ?  464 GLN A NE2   1 
ATOM   3782 N  N     . LYS A 1 477 ? 233.21200 62.70600 75.97100  1.000 49.83000  ?  465 LYS A N     1 
ATOM   3783 C  CA    . LYS A 1 477 ? 232.17600 62.29700 75.04700  1.000 49.65000  ?  465 LYS A CA    1 
ATOM   3784 C  C     . LYS A 1 477 ? 230.94300 63.10700 75.34500  1.000 47.40000  ?  465 LYS A C     1 
ATOM   3785 O  O     . LYS A 1 477 ? 230.60600 63.29300 76.49500  1.000 46.70000  ?  465 LYS A O     1 
ATOM   3786 C  CB    . LYS A 1 477 ? 231.86800 60.80500 75.17000  1.000 51.49000  ?  465 LYS A CB    1 
ATOM   3787 C  CG    . LYS A 1 477 ? 231.06200 60.26400 73.98900  1.000 49.77000  ?  465 LYS A CG    1 
ATOM   3788 C  CD    . LYS A 1 477 ? 230.32700 58.96400 74.32400  1.000 58.31000  ?  465 LYS A CD    1 
ATOM   3789 C  CE    . LYS A 1 477 ? 230.98800 57.73800 73.67800  1.000 65.11000  ?  465 LYS A CE    1 
ATOM   3790 N  NZ    . LYS A 1 477 ? 230.07600 56.54200 73.66000  1.000 62.15000  ?  465 LYS A NZ    1 
ATOM   3791 N  N     . VAL A 1 478 ? 230.27700 63.59000 74.30500  1.000 47.04000  ?  466 VAL A N     1 
ATOM   3792 C  CA    . VAL A 1 478 ? 229.01300 64.27200 74.47500  1.000 46.56000  ?  466 VAL A CA    1 
ATOM   3793 C  C     . VAL A 1 478 ? 228.00700 63.63900 73.52900  1.000 50.15000  ?  466 VAL A C     1 
ATOM   3794 O  O     . VAL A 1 478 ? 228.27100 63.52700 72.33900  1.000 56.97000  ?  466 VAL A O     1 
ATOM   3795 C  CB    . VAL A 1 478 ? 229.15000 65.80500 74.23200  1.000 44.86000  ?  466 VAL A CB    1 
ATOM   3796 C  CG1   . VAL A 1 478 ? 227.83900 66.43100 73.92700  1.000 46.98000  ?  466 VAL A CG1   1 
ATOM   3797 C  CG2   . VAL A 1 478 ? 229.70100 66.48100 75.47800  1.000 53.44000  ?  466 VAL A CG2   1 
ATOM   3798 N  N     . VAL A 1 479 ? 226.87400 63.18700 74.06300  1.000 45.96000  ?  467 VAL A N     1 
ATOM   3799 C  CA    . VAL A 1 479 ? 225.77500 62.68400 73.23900  1.000 47.93000  ?  467 VAL A CA    1 
ATOM   3800 C  C     . VAL A 1 479 ? 224.60400 63.67700 73.15400  1.000 51.76000  ?  467 VAL A C     1 
ATOM   3801 O  O     . VAL A 1 479 ? 224.16000 64.22500 74.16400  1.000 51.61000  ?  467 VAL A O     1 
ATOM   3802 C  CB    . VAL A 1 479 ? 225.25100 61.33500 73.77800  1.000 51.18000  ?  467 VAL A CB    1 
ATOM   3803 C  CG1   . VAL A 1 479 ? 223.86000 61.04800 73.26700  1.000 52.38000  ?  467 VAL A CG1   1 
ATOM   3804 C  CG2   . VAL A 1 479 ? 226.18800 60.21600 73.41500  1.000 49.98000  ?  467 VAL A CG2   1 
ATOM   3805 N  N     . THR A 1 480 ? 224.09500 63.90500 71.94700  1.000 58.06000  ?  468 THR A N     1 
ATOM   3806 C  CA    . THR A 1 480 ? 222.95000 64.80500 71.76800  1.000 56.85000  ?  468 THR A CA    1 
ATOM   3807 C  C     . THR A 1 480 ? 221.64600 64.03600 71.84900  1.000 53.27000  ?  468 THR A C     1 
ATOM   3808 O  O     . THR A 1 480 ? 221.55200 62.90000 71.39900  1.000 57.09000  ?  468 THR A O     1 
ATOM   3809 C  CB    . THR A 1 480 ? 223.00100 65.57000 70.42800  1.000 55.96000  ?  468 THR A CB    1 
ATOM   3810 O  OG1   . THR A 1 480 ? 222.80600 64.65300 69.34700  1.000 61.63000  ?  468 THR A OG1   1 
ATOM   3811 C  CG2   . THR A 1 480 ? 224.33900 66.29600 70.26100  1.000 47.32000  ?  468 THR A CG2   1 
ATOM   3812 N  N     . LEU A 1 481 ? 220.64300 64.67200 72.43700  1.000 55.22000  ?  469 LEU A N     1 
ATOM   3813 C  CA    . LEU A 1 481 ? 219.37700 64.02200 72.74400  1.000 56.32000  ?  469 LEU A CA    1 
ATOM   3814 C  C     . LEU A 1 481 ? 218.20700 64.90800 72.29900  1.000 62.73000  ?  469 LEU A C     1 
ATOM   3815 O  O     . LEU A 1 481 ? 218.28600 66.14000 72.35600  1.000 60.02000  ?  469 LEU A O     1 
ATOM   3816 C  CB    . LEU A 1 481 ? 219.27200 63.73000 74.24400  1.000 53.33000  ?  469 LEU A CB    1 
ATOM   3817 C  CG    . LEU A 1 481 ? 220.29400 62.77300 74.86300  1.000 59.65000  ?  469 LEU A CG    1 
ATOM   3818 C  CD1   . LEU A 1 481 ? 220.36500 62.95400 76.36100  1.000 52.83000  ?  469 LEU A CD1   1 
ATOM   3819 C  CD2   . LEU A 1 481 ? 219.93600 61.33900 74.53800  1.000 55.99000  ?  469 LEU A CD2   1 
ATOM   3820 N  N     . THR A 1 482 ? 217.11900 64.28300 71.86600  1.000 57.87000  ?  470 THR A N     1 
ATOM   3821 C  CA    . THR A 1 482 ? 215.94000 65.03800 71.49700  1.000 60.89000  ?  470 THR A CA    1 
ATOM   3822 C  C     . THR A 1 482 ? 214.75200 64.69300 72.36400  1.000 65.66000  ?  470 THR A C     1 
ATOM   3823 O  O     . THR A 1 482 ? 214.61300 63.55800 72.83200  1.000 62.37000  ?  470 THR A O     1 
ATOM   3824 C  CB    . THR A 1 482 ? 215.55900 64.78800 70.05500  1.000 60.91000  ?  470 THR A CB    1 
ATOM   3825 O  OG1   . THR A 1 482 ? 215.44300 63.37700 69.86000  1.000 65.92000  ?  470 THR A OG1   1 
ATOM   3826 C  CG2   . THR A 1 482 ? 216.62300 65.34600 69.12500  1.000 54.44000  ?  470 THR A CG2   1 
ATOM   3827 N  N     . ASP A 1 483 ? 213.88500 65.68100 72.55500  1.000 69.40000  ?  471 ASP A N     1 
ATOM   3828 C  CA    . ASP A 1 483 ? 212.67400 65.48600 73.32800  1.000 65.52000  ?  471 ASP A CA    1 
ATOM   3829 C  C     . ASP A 1 483 ? 213.01800 64.95100 74.70500  1.000 62.19000  ?  471 ASP A C     1 
ATOM   3830 O  O     . ASP A 1 483 ? 212.65600 63.83600 75.05000  1.000 62.01000  ?  471 ASP A O     1 
ATOM   3831 C  CB    . ASP A 1 483 ? 211.73900 64.52400 72.60900  1.000 67.66000  ?  471 ASP A CB    1 
ATOM   3832 C  CG    . ASP A 1 483 ? 210.30100 64.68200 73.04900  1.000 84.01000  ?  471 ASP A CG    1 
ATOM   3833 O  OD1   . ASP A 1 483 ? 210.04400 65.36600 74.07000  1.000 82.01000  ?  471 ASP A OD1   1 
ATOM   3834 O  OD2   . ASP A 1 483 ? 209.42000 64.12600 72.36600  1.000 98.37000  ?  471 ASP A OD2   1 
ATOM   3835 N  N     . THR A 1 484 ? 213.72400 65.74900 75.48800  1.000 60.93000  ?  472 THR A N     1 
ATOM   3836 C  CA    . THR A 1 484 ? 214.28700 65.25000 76.72700  1.000 57.74000  ?  472 THR A CA    1 
ATOM   3837 C  C     . THR A 1 484 ? 214.11700 66.25800 77.85200  1.000 57.39000  ?  472 THR A C     1 
ATOM   3838 O  O     . THR A 1 484 ? 213.47000 67.28000 77.69800  1.000 63.32000  ?  472 THR A O     1 
ATOM   3839 C  CB    . THR A 1 484 ? 215.78700 64.90800 76.54400  1.000 59.75000  ?  472 THR A CB    1 
ATOM   3840 O  OG1   . THR A 1 484 ? 216.26900 64.19500 77.68300  1.000 56.47000  ?  472 THR A OG1   1 
ATOM   3841 C  CG2   . THR A 1 484 ? 216.61700 66.17000 76.36400  1.000 58.18000  ?  472 THR A CG2   1 
ATOM   3842 N  N     . THR A 1 485 ? 214.71000 65.96500 78.99400  1.000 58.37000  ?  473 THR A N     1 
ATOM   3843 C  CA    . THR A 1 485 ? 214.58600 66.82500 80.15100  1.000 51.58000  ?  473 THR A CA    1 
ATOM   3844 C  C     . THR A 1 485 ? 215.87400 66.83100 80.92100  1.000 53.54000  ?  473 THR A C     1 
ATOM   3845 O  O     . THR A 1 485 ? 216.72900 65.95900 80.72700  1.000 57.12000  ?  473 THR A O     1 
ATOM   3846 C  CB    . THR A 1 485 ? 213.50600 66.34800 81.08000  1.000 57.97000  ?  473 THR A CB    1 
ATOM   3847 O  OG1   . THR A 1 485 ? 213.99700 65.20900 81.80100  1.000 53.94000  ?  473 THR A OG1   1 
ATOM   3848 C  CG2   . THR A 1 485 ? 212.27700 65.96900 80.29100  1.000 57.65000  ?  473 THR A CG2   1 
ATOM   3849 N  N     . ASN A 1 486 ? 216.00400 67.79400 81.82000  1.000 55.72000  ?  474 ASN A N     1 
ATOM   3850 C  CA    . ASN A 1 486 ? 217.19200 67.88100 82.64200  1.000 55.99000  ?  474 ASN A CA    1 
ATOM   3851 C  C     . ASN A 1 486 ? 217.47900 66.60700 83.41000  1.000 58.75000  ?  474 ASN A C     1 
ATOM   3852 O  O     . ASN A 1 486 ? 218.60000 66.07700 83.34700  1.000 57.52000  ?  474 ASN A O     1 
ATOM   3853 C  CB    . ASN A 1 486 ? 217.07300 69.03900 83.59900  1.000 57.49000  ?  474 ASN A CB    1 
ATOM   3854 C  CG    . ASN A 1 486 ? 217.32000 70.34100 82.92100  1.000 64.54000  ?  474 ASN A CG    1 
ATOM   3855 O  OD1   . ASN A 1 486 ? 218.47400 70.73500 82.70800  1.000 69.41000  ?  474 ASN A OD1   1 
ATOM   3856 N  ND2   . ASN A 1 486 ? 216.24100 71.02000 82.54300  1.000 71.72000  ?  474 ASN A ND2   1 
ATOM   3857 N  N     . GLN A 1 487 ? 216.47400 66.11300 84.12800  1.000 53.21000  ?  475 GLN A N     1 
ATOM   3858 C  CA    . GLN A 1 487 ? 216.65200 64.89100 84.88700  1.000 51.90000  ?  475 GLN A CA    1 
ATOM   3859 C  C     . GLN A 1 487 ? 217.09700 63.77900 83.93800  1.000 53.12000  ?  475 GLN A C     1 
ATOM   3860 O  O     . GLN A 1 487 ? 218.07300 63.07400 84.20600  1.000 52.42000  ?  475 GLN A O     1 
ATOM   3861 C  CB    . GLN A 1 487 ? 215.36700 64.51700 85.61900  1.000 55.26000  ?  475 GLN A CB    1 
ATOM   3862 C  CG    . GLN A 1 487 ? 214.84500 65.61000 86.55800  1.000 56.94000  ?  475 GLN A CG    1 
ATOM   3863 C  CD    . GLN A 1 487 ? 214.07000 66.70000 85.82200  1.000 65.70000  ?  475 GLN A CD    1 
ATOM   3864 O  OE1   . GLN A 1 487 ? 214.13300 66.80300 84.59100  1.000 65.88000  ?  475 GLN A OE1   1 
ATOM   3865 N  NE2   . GLN A 1 487 ? 213.33500 67.51700 86.57300  1.000 65.33000  ?  475 GLN A NE2   1 
ATOM   3866 N  N     . LYS A 1 488 ? 216.41300 63.66400 82.80300  1.000 52.12000  ?  476 LYS A N     1 
ATOM   3867 C  CA    . LYS A 1 488 ? 216.70900 62.61400 81.83200  1.000 52.28000  ?  476 LYS A CA    1 
ATOM   3868 C  C     . LYS A 1 488 ? 218.14500 62.69000 81.30800  1.000 51.20000  ?  476 LYS A C     1 
ATOM   3869 O  O     . LYS A 1 488 ? 218.79800 61.66200 81.17100  1.000 49.61000  ?  476 LYS A O     1 
ATOM   3870 C  CB    . LYS A 1 488 ? 215.71200 62.66000 80.66900  1.000 47.24000  ?  476 LYS A CB    1 
ATOM   3871 C  CG    . LYS A 1 488 ? 214.48000 61.81200 80.91700  1.000 52.09000  ?  476 LYS A CG    1 
ATOM   3872 C  CD    . LYS A 1 488 ? 213.34000 62.13300 79.97000  1.000 54.36000  ?  476 LYS A CD    1 
ATOM   3873 C  CE    . LYS A 1 488 ? 212.09100 61.34300 80.34400  1.000 58.16000  ?  476 LYS A CE    1 
ATOM   3874 N  NZ    . LYS A 1 488 ? 211.36300 60.77600 79.15600  1.000 58.31000  ?  476 LYS A NZ    1 
ATOM   3875 N  N     . THR A 1 489 ? 218.64700 63.88600 81.02600  1.000 47.07000  ?  477 THR A N     1 
ATOM   3876 C  CA    . THR A 1 489 ? 220.01800 63.97200 80.54700  1.000 53.32000  ?  477 THR A CA    1 
ATOM   3877 C  C     . THR A 1 489 ? 221.00000 63.58100 81.65500  1.000 53.74000  ?  477 THR A C     1 
ATOM   3878 O  O     . THR A 1 489 ? 222.00200 62.90900 81.36800  1.000 53.06000  ?  477 THR A O     1 
ATOM   3879 C  CB    . THR A 1 489 ? 220.37900 65.37500 79.99200  1.000 51.86000  ?  477 THR A CB    1 
ATOM   3880 O  OG1   . THR A 1 489 ? 220.53400 66.31400 81.06500  1.000 53.33000  ?  477 THR A OG1   1 
ATOM   3881 C  CG2   . THR A 1 489 ? 219.30500 65.85100 79.04600  1.000 51.82000  ?  477 THR A CG2   1 
ATOM   3882 N  N     . GLU A 1 490 ? 220.70800 63.95700 82.90600  1.000 51.94000  ?  478 GLU A N     1 
ATOM   3883 C  CA    . GLU A 1 490 ? 221.58500 63.58900 84.03300  1.000 51.66000  ?  478 GLU A CA    1 
ATOM   3884 C  C     . GLU A 1 490 ? 221.69200 62.07300 84.15900  1.000 50.97000  ?  478 GLU A C     1 
ATOM   3885 O  O     . GLU A 1 490 ? 222.75100 61.54600 84.49500  1.000 50.36000  ?  478 GLU A O     1 
ATOM   3886 C  CB    . GLU A 1 490 ? 221.09000 64.17300 85.36000  1.000 48.09000  ?  478 GLU A CB    1 
ATOM   3887 C  CG    . GLU A 1 490 ? 221.17700 65.67600 85.48800  1.000 53.99000  ?  478 GLU A CG    1 
ATOM   3888 C  CD    . GLU A 1 490 ? 222.59500 66.21200 85.53400  1.000 57.76000  ?  478 GLU A CD    1 
ATOM   3889 O  OE1   . GLU A 1 490 ? 223.57300 65.42000 85.54300  1.000 61.56000  ?  478 GLU A OE1   1 
ATOM   3890 O  OE2   . GLU A 1 490 ? 222.72800 67.45000 85.56000  1.000 64.04000  ?  478 GLU A OE2   1 
ATOM   3891 N  N     . LEU A 1 491 ? 220.57800 61.38700 83.89600  1.000 52.04000  ?  479 LEU A N     1 
ATOM   3892 C  CA    . LEU A 1 491 ? 220.51800 59.93000 83.94200  1.000 47.08000  ?  479 LEU A CA    1 
ATOM   3893 C  C     . LEU A 1 491 ? 221.21400 59.33100 82.73600  1.000 54.94000  ?  479 LEU A C     1 
ATOM   3894 O  O     . LEU A 1 491 ? 221.88400 58.29700 82.85900  1.000 55.10000  ?  479 LEU A O     1 
ATOM   3895 C  CB    . LEU A 1 491 ? 219.08200 59.44300 83.99600  1.000 41.83000  ?  479 LEU A CB    1 
ATOM   3896 C  CG    . LEU A 1 491 ? 218.51300 59.33600 85.40100  1.000 46.73000  ?  479 LEU A CG    1 
ATOM   3897 C  CD1   . LEU A 1 491 ? 217.09400 58.80700 85.38100  1.000 39.27000  ?  479 LEU A CD1   1 
ATOM   3898 C  CD2   . LEU A 1 491 ? 219.40800 58.43500 86.19000  1.000 45.69000  ?  479 LEU A CD2   1 
ATOM   3899 N  N     . GLN A 1 492 ? 221.03800 59.97400 81.57500  1.000 48.88000  ?  480 GLN A N     1 
ATOM   3900 C  CA    . GLN A 1 492 ? 221.71000 59.57100 80.34500  1.000 48.96000  ?  480 GLN A CA    1 
ATOM   3901 C  C     . GLN A 1 492 ? 223.24000 59.64700 80.49600  1.000 54.56000  ?  480 GLN A C     1 
ATOM   3902 O  O     . GLN A 1 492 ? 223.96900 58.78100 80.01000  1.000 50.66000  ?  480 GLN A O     1 
ATOM   3903 C  CB    . GLN A 1 492 ? 221.26300 60.45000 79.17500  1.000 50.95000  ?  480 GLN A CB    1 
ATOM   3904 C  CG    . GLN A 1 492 ? 219.86700 60.18800 78.68900  1.000 49.87000  ?  480 GLN A CG    1 
ATOM   3905 C  CD    . GLN A 1 492 ? 219.78100 58.98000 77.77700  1.000 56.39000  ?  480 GLN A CD    1 
ATOM   3906 O  OE1   . GLN A 1 492 ? 220.79400 58.40400 77.38500  1.000 61.94000  ?  480 GLN A OE1   1 
ATOM   3907 N  NE2   . GLN A 1 492 ? 218.56600 58.59600 77.43100  1.000 56.60000  ?  480 GLN A NE2   1 
ATOM   3908 N  N     . ALA A 1 493 ? 223.71900 60.68400 81.17900  1.000 53.28000  ?  481 ALA A N     1 
ATOM   3909 C  CA    . ALA A 1 493 ? 225.15000 60.87000 81.33600  1.000 49.75000  ?  481 ALA A CA    1 
ATOM   3910 C  C     . ALA A 1 493 ? 225.73100 59.75800 82.19800  1.000 52.67000  ?  481 ALA A C     1 
ATOM   3911 O  O     . ALA A 1 493 ? 226.78500 59.20400 81.87700  1.000 54.44000  ?  481 ALA A O     1 
ATOM   3912 C  CB    . ALA A 1 493 ? 225.46000 62.24600 81.93500  1.000 49.19000  ?  481 ALA A CB    1 
ATOM   3913 N  N     . ILE A 1 494 ? 225.04200 59.42300 83.28300  1.000 50.92000  ?  482 ILE A N     1 
ATOM   3914 C  CA    . ILE A 1 494 ? 225.51800 58.37100 84.16200  1.000 48.85000  ?  482 ILE A CA    1 
ATOM   3915 C  C     . ILE A 1 494 ? 225.58500 57.04500 83.41000  1.000 49.15000  ?  482 ILE A C     1 
ATOM   3916 O  O     . ILE A 1 494 ? 226.50400 56.25800 83.59900  1.000 52.31000  ?  482 ILE A O     1 
ATOM   3917 C  CB    . ILE A 1 494 ? 224.62500 58.24000 85.40600  1.000 50.89000  ?  482 ILE A CB    1 
ATOM   3918 C  CG1   . ILE A 1 494 ? 224.98300 59.32800 86.41500  1.000 46.41000  ?  482 ILE A CG1   1 
ATOM   3919 C  CG2   . ILE A 1 494 ? 224.79700 56.88300 86.07600  1.000 43.94000  ?  482 ILE A CG2   1 
ATOM   3920 C  CD1   . ILE A 1 494 ? 224.05300 59.34800 87.58400  1.000 41.56000  ?  482 ILE A CD1   1 
ATOM   3921 N  N     . TYR A 1 495 ? 224.61400 56.82000 82.53700  1.000 49.06000  ?  483 TYR A N     1 
ATOM   3922 C  CA    . TYR A 1 495 ? 224.52800 55.59600 81.75400  1.000 47.77000  ?  483 TYR A CA    1 
ATOM   3923 C  C     . TYR A 1 495 ? 225.68400 55.50800 80.77000  1.000 48.60000  ?  483 TYR A C     1 
ATOM   3924 O  O     . TYR A 1 495 ? 226.32600 54.47100 80.61700  1.000 45.25000  ?  483 TYR A O     1 
ATOM   3925 C  CB    . TYR A 1 495 ? 223.19600 55.55700 81.01800  1.000 45.84000  ?  483 TYR A CB    1 
ATOM   3926 C  CG    . TYR A 1 495 ? 222.98900 54.36800 80.11300  1.000 46.04000  ?  483 TYR A CG    1 
ATOM   3927 C  CD1   . TYR A 1 495 ? 223.07800 53.07000 80.58900  1.000 48.46000  ?  483 TYR A CD1   1 
ATOM   3928 C  CD2   . TYR A 1 495 ? 222.65100 54.54900 78.79700  1.000 49.42000  ?  483 TYR A CD2   1 
ATOM   3929 C  CE1   . TYR A 1 495 ? 222.86200 51.99300 79.75700  1.000 49.59000  ?  483 TYR A CE1   1 
ATOM   3930 C  CE2   . TYR A 1 495 ? 222.43200 53.48200 77.95900  1.000 53.79000  ?  483 TYR A CE2   1 
ATOM   3931 C  CZ    . TYR A 1 495 ? 222.54100 52.21300 78.43800  1.000 54.62000  ?  483 TYR A CZ    1 
ATOM   3932 O  OH    . TYR A 1 495 ? 222.31900 51.17200 77.56700  1.000 64.76000  ?  483 TYR A OH    1 
ATOM   3933 N  N     . LEU A 1 496 ? 225.92000 56.62600 80.10300  1.000 48.93000  ?  484 LEU A N     1 
ATOM   3934 C  CA    . LEU A 1 496 ? 227.02800 56.78500 79.17600  1.000 48.06000  ?  484 LEU A CA    1 
ATOM   3935 C  C     . LEU A 1 496 ? 228.35700 56.44400 79.84700  1.000 49.58000  ?  484 LEU A C     1 
ATOM   3936 O  O     . LEU A 1 496 ? 229.15600 55.68300 79.30700  1.000 48.12000  ?  484 LEU A O     1 
ATOM   3937 C  CB    . LEU A 1 496 ? 227.04700 58.21200 78.64600  1.000 45.51000  ?  484 LEU A CB    1 
ATOM   3938 C  CG    . LEU A 1 496 ? 227.76100 58.42800 77.33200  1.000 55.28000  ?  484 LEU A CG    1 
ATOM   3939 C  CD1   . LEU A 1 496 ? 226.88600 57.87100 76.24500  1.000 58.22000  ?  484 LEU A CD1   1 
ATOM   3940 C  CD2   . LEU A 1 496 ? 228.02700 59.91400 77.12800  1.000 54.22000  ?  484 LEU A CD2   1 
ATOM   3941 N  N     . ALA A 1 497 ? 228.58200 56.98800 81.03900  1.000 48.63000  ?  485 ALA A N     1 
ATOM   3942 C  CA    . ALA A 1 497 ? 229.82000 56.71300 81.75800  1.000 45.76000  ?  485 ALA A CA    1 
ATOM   3943 C  C     . ALA A 1 497 ? 229.92400 55.23100 82.15300  1.000 48.37000  ?  485 ALA A C     1 
ATOM   3944 O  O     . ALA A 1 497 ? 231.02100 54.68400 82.21500  1.000 48.63000  ?  485 ALA A O     1 
ATOM   3945 C  CB    . ALA A 1 497 ? 229.92500 57.60000 82.96800  1.000 40.61000  ?  485 ALA A CB    1 
ATOM   3946 N  N     . LEU A 1 498 ? 228.79100 54.58100 82.40600  1.000 45.29000  ?  486 LEU A N     1 
ATOM   3947 C  CA    . LEU A 1 498 ? 228.79600 53.16600 82.75500  1.000 44.79000  ?  486 LEU A CA    1 
ATOM   3948 C  C     . LEU A 1 498 ? 229.12700 52.33200 81.53400  1.000 48.06000  ?  486 LEU A C     1 
ATOM   3949 O  O     . LEU A 1 498 ? 229.75500 51.28100 81.63500  1.000 46.81000  ?  486 LEU A O     1 
ATOM   3950 C  CB    . LEU A 1 498 ? 227.44400 52.72700 83.33800  1.000 46.04000  ?  486 LEU A CB    1 
ATOM   3951 C  CG    . LEU A 1 498 ? 227.10200 53.18100 84.76000  1.000 44.71000  ?  486 LEU A CG    1 
ATOM   3952 C  CD1   . LEU A 1 498 ? 225.61400 53.04500 85.07100  1.000 36.18000  ?  486 LEU A CD1   1 
ATOM   3953 C  CD2   . LEU A 1 498 ? 227.97000 52.42700 85.78800  1.000 40.90000  ?  486 LEU A CD2   1 
ATOM   3954 N  N     . GLN A 1 499 ? 228.69500 52.81300 80.37800  1.000 46.73000  ?  487 GLN A N     1 
ATOM   3955 C  CA    . GLN A 1 499 ? 228.94900 52.13800 79.12400  1.000 46.15000  ?  487 GLN A CA    1 
ATOM   3956 C  C     . GLN A 1 499 ? 230.41600 52.21000 78.67300  1.000 52.59000  ?  487 GLN A C     1 
ATOM   3957 O  O     . GLN A 1 499 ? 230.95400 51.26100 78.11200  1.000 54.21000  ?  487 GLN A O     1 
ATOM   3958 C  CB    . GLN A 1 499 ? 228.05500 52.72300 78.05000  1.000 44.11000  ?  487 GLN A CB    1 
ATOM   3959 C  CG    . GLN A 1 499 ? 226.69000 52.13800 78.05600  1.000 52.64000  ?  487 GLN A CG    1 
ATOM   3960 C  CD    . GLN A 1 499 ? 225.83700 52.70800 76.95700  1.000 57.62000  ?  487 GLN A CD    1 
ATOM   3961 O  OE1   . GLN A 1 499 ? 225.60300 53.91100 76.91700  1.000 60.40000  ?  487 GLN A OE1   1 
ATOM   3962 N  NE2   . GLN A 1 499 ? 225.36300 51.85300 76.05700  1.000 54.19000  ?  487 GLN A NE2   1 
ATOM   3963 N  N     . ASP A 1 500 ? 231.07600 53.32600 78.92600  1.000 51.33000  ?  488 ASP A N     1 
ATOM   3964 C  CA    . ASP A 1 500 ? 232.40900 53.50700 78.39400  1.000 47.33000  ?  488 ASP A CA    1 
ATOM   3965 C  C     . ASP A 1 500 ? 233.47500 53.31200 79.44700  1.000 48.78000  ?  488 ASP A C     1 
ATOM   3966 O  O     . ASP A 1 500 ? 234.63800 53.61800 79.21600  1.000 55.37000  ?  488 ASP A O     1 
ATOM   3967 C  CB    . ASP A 1 500 ? 232.52900 54.89000 77.76000  1.000 49.06000  ?  488 ASP A CB    1 
ATOM   3968 C  CG    . ASP A 1 500 ? 231.48400 55.11500 76.68000  1.000 55.91000  ?  488 ASP A CG    1 
ATOM   3969 O  OD1   . ASP A 1 500 ? 230.88000 54.11000 76.22800  1.000 51.57000  ?  488 ASP A OD1   1 
ATOM   3970 O  OD2   . ASP A 1 500 ? 231.27200 56.28300 76.28300  1.000 58.21000  ?  488 ASP A OD2   1 
ATOM   3971 N  N     . SER A 1 501 ? 233.08000 52.78400 80.59500  1.000 46.34000  ?  489 SER A N     1 
ATOM   3972 C  CA    . SER A 1 501 ? 234.00000 52.59000 81.70600  1.000 43.52000  ?  489 SER A CA    1 
ATOM   3973 C  C     . SER A 1 501 ? 234.33800 51.12600 81.85600  1.000 46.67000  ?  489 SER A C     1 
ATOM   3974 O  O     . SER A 1 501 ? 233.71600 50.27200 81.22500  1.000 52.09000  ?  489 SER A O     1 
ATOM   3975 C  CB    . SER A 1 501 ? 233.39900 53.11600 83.00700  1.000 44.75000  ?  489 SER A CB    1 
ATOM   3976 O  OG    . SER A 1 501 ? 232.22200 52.41000 83.35100  1.000 45.74000  ?  489 SER A OG    1 
ATOM   3977 N  N     . GLY A 1 502 ? 235.32100 50.82600 82.69500  1.000 44.58000  ?  490 GLY A N     1 
ATOM   3978 C  CA    . GLY A 1 502 ? 235.73200 49.45100 82.87000  1.000 35.47000  ?  490 GLY A CA    1 
ATOM   3979 C  C     . GLY A 1 502 ? 234.88600 48.79500 83.92600  1.000 44.44000  ?  490 GLY A C     1 
ATOM   3980 O  O     . GLY A 1 502 ? 233.82600 49.29200 84.26500  1.000 49.86000  ?  490 GLY A O     1 
ATOM   3981 N  N     . LEU A 1 503 ? 235.36300 47.68100 84.45400  1.000 46.09000  ?  491 LEU A N     1 
ATOM   3982 C  CA    . LEU A 1 503 ? 234.65200 46.95100 85.48800  1.000 45.46000  ?  491 LEU A CA    1 
ATOM   3983 C  C     . LEU A 1 503 ? 234.61100 47.75200 86.77800  1.000 47.73000  ?  491 LEU A C     1 
ATOM   3984 O  O     . LEU A 1 503 ? 233.77200 47.51200 87.64600  1.000 50.08000  ?  491 LEU A O     1 
ATOM   3985 C  CB    . LEU A 1 503 ? 235.30900 45.57700 85.71900  1.000 47.20000  ?  491 LEU A CB    1 
ATOM   3986 C  CG    . LEU A 1 503 ? 235.02500 44.53600 84.62200  1.000 49.85000  ?  491 LEU A CG    1 
ATOM   3987 C  CD1   . LEU A 1 503 ? 235.75000 43.21600 84.87900  1.000 51.31000  ?  491 LEU A CD1   1 
ATOM   3988 C  CD2   . LEU A 1 503 ? 233.52300 44.30100 84.46800  1.000 39.34000  ?  491 LEU A CD2   1 
ATOM   3989 N  N     . GLU A 1 504 ? 235.52300 48.70400 86.91100  1.000 47.40000  ?  492 GLU A N     1 
ATOM   3990 C  CA    . GLU A 1 504 ? 235.53700 49.55400 88.09100  1.000 47.28000  ?  492 GLU A CA    1 
ATOM   3991 C  C     . GLU A 1 504 ? 235.54800 51.00700 87.62600  1.000 48.98000  ?  492 GLU A C     1 
ATOM   3992 O  O     . GLU A 1 504 ? 236.25700 51.34900 86.68100  1.000 52.20000  ?  492 GLU A O     1 
ATOM   3993 C  CB    . GLU A 1 504 ? 236.72800 49.21800 88.98200  1.000 44.53000  ?  492 GLU A CB    1 
ATOM   3994 C  CG    . GLU A 1 504 ? 236.87600 47.70000 89.20500  1.000 48.19000  ?  492 GLU A CG    1 
ATOM   3995 C  CD    . GLU A 1 504 ? 237.76800 47.31300 90.41400  1.000 62.52000  ?  492 GLU A CD    1 
ATOM   3996 O  OE1   . GLU A 1 504 ? 237.92700 46.08900 90.67600  1.000 65.94000  ?  492 GLU A OE1   1 
ATOM   3997 O  OE2   . GLU A 1 504 ? 238.30300 48.21200 91.11100  1.000 63.11000  ?  492 GLU A OE2   1 
ATOM   3998 N  N     . VAL A 1 505 ? 234.72600 51.84400 88.25800  1.000 44.17000  ?  493 VAL A N     1 
ATOM   3999 C  CA    . VAL A 1 505 ? 234.54900 53.22200 87.82800  1.000 40.42000  ?  493 VAL A CA    1 
ATOM   4000 C  C     . VAL A 1 505 ? 234.09000 54.12900 88.98600  1.000 46.40000  ?  493 VAL A C     1 
ATOM   4001 O  O     . VAL A 1 505 ? 233.29100 53.73200 89.86000  1.000 43.48000  ?  493 VAL A O     1 
ATOM   4002 C  CB    . VAL A 1 505 ? 233.53700 53.30300 86.65900  1.000 43.00000  ?  493 VAL A CB    1 
ATOM   4003 C  CG1   . VAL A 1 505 ? 232.20700 52.66900 87.05100  1.000 42.16000  ?  493 VAL A CG1   1 
ATOM   4004 C  CG2   . VAL A 1 505 ? 233.34000 54.72900 86.19900  1.000 43.08000  ?  493 VAL A CG2   1 
ATOM   4005 N  N     . ASN A 1 506 ? 234.64400 55.33700 88.99800  1.000 43.15000  ?  494 ASN A N     1 
ATOM   4006 C  CA    . ASN A 1 506 ? 234.23200 56.40400 89.89000  1.000 40.05000  ?  494 ASN A CA    1 
ATOM   4007 C  C     . ASN A 1 506 ? 233.43200 57.38100 89.07000  1.000 44.27000  ?  494 ASN A C     1 
ATOM   4008 O  O     . ASN A 1 506 ? 233.92600 57.86000 88.04100  1.000 43.52000  ?  494 ASN A O     1 
ATOM   4009 C  CB    . ASN A 1 506 ? 235.42200 57.14200 90.50500  1.000 39.71000  ?  494 ASN A CB    1 
ATOM   4010 C  CG    . ASN A 1 506 ? 236.26800 56.27000 91.39900  1.000 45.50000  ?  494 ASN A CG    1 
ATOM   4011 O  OD1   . ASN A 1 506 ? 235.80200 55.76400 92.43400  1.000 45.61000  ?  494 ASN A OD1   1 
ATOM   4012 N  ND2   . ASN A 1 506 ? 237.54700 56.13700 91.04100  1.000 42.18000  ?  494 ASN A ND2   1 
ATOM   4013 N  N     . ILE A 1 507 ? 232.22200 57.70000 89.52100  1.000 38.85000  ?  495 ILE A N     1 
ATOM   4014 C  CA    . ILE A 1 507 ? 231.38000 58.65500 88.81400  1.000 38.59000  ?  495 ILE A CA    1 
ATOM   4015 C  C     . ILE A 1 507 ? 231.03500 59.82700 89.72900  1.000 45.04000  ?  495 ILE A C     1 
ATOM   4016 O  O     . ILE A 1 507 ? 230.56400 59.63300 90.85000  1.000 45.86000  ?  495 ILE A O     1 
ATOM   4017 C  CB    . ILE A 1 507 ? 230.08000 58.00300 88.31900  1.000 41.46000  ?  495 ILE A CB    1 
ATOM   4018 C  CG1   . ILE A 1 507 ? 230.38800 56.71600 87.54200  1.000 40.38000  ?  495 ILE A CG1   1 
ATOM   4019 C  CG2   . ILE A 1 507 ? 229.22600 59.01100 87.54500  1.000 41.76000  ?  495 ILE A CG2   1 
ATOM   4020 C  CD1   . ILE A 1 507 ? 229.17100 56.01000 87.04700  1.000 40.31000  ?  495 ILE A CD1   1 
ATOM   4021 N  N     . VAL A 1 508 ? 231.28300 61.03900 89.25000  1.000 41.71000  ?  496 VAL A N     1 
ATOM   4022 C  CA    . VAL A 1 508 ? 230.90700 62.24000 89.97000  1.000 39.33000  ?  496 VAL A CA    1 
ATOM   4023 C  C     . VAL A 1 508 ? 229.78200 62.94300 89.21700  1.000 45.94000  ?  496 VAL A C     1 
ATOM   4024 O  O     . VAL A 1 508 ? 229.92100 63.29900 88.03400  1.000 45.02000  ?  496 VAL A O     1 
ATOM   4025 C  CB    . VAL A 1 508 ? 232.09500 63.19900 90.14100  1.000 40.58000  ?  496 VAL A CB    1 
ATOM   4026 C  CG1   . VAL A 1 508 ? 231.65200 64.41300 90.90200  1.000 39.58000  ?  496 VAL A CG1   1 
ATOM   4027 C  CG2   . VAL A 1 508 ? 233.24000 62.50600 90.87500  1.000 37.02000  ?  496 VAL A CG2   1 
ATOM   4028 N  N     . THR A 1 509 ? 228.66700 63.13300 89.91100  1.000 45.87000  ?  497 THR A N     1 
ATOM   4029 C  CA    . THR A 1 509 ? 227.47200 63.75700 89.35200  1.000 45.47000  ?  497 THR A CA    1 
ATOM   4030 C  C     . THR A 1 509 ? 227.12700 64.98800 90.18400  1.000 46.41000  ?  497 THR A C     1 
ATOM   4031 O  O     . THR A 1 509 ? 227.50000 65.06200 91.36100  1.000 47.40000  ?  497 THR A O     1 
ATOM   4032 C  CB    . THR A 1 509 ? 226.26900 62.77400 89.35300  1.000 45.63000  ?  497 THR A CB    1 
ATOM   4033 O  OG1   . THR A 1 509 ? 225.12700 63.39900 88.76200  1.000 48.15000  ?  497 THR A OG1   1 
ATOM   4034 C  CG2   . THR A 1 509 ? 225.90800 62.39500 90.76600  1.000 45.84000  ?  497 THR A CG2   1 
ATOM   4035 N  N     . ASP A 1 510 ? 226.42300 65.95200 89.59900  1.000 48.29000  ?  498 ASP A N     1 
ATOM   4036 C  CA    . ASP A 1 510 ? 225.90300 67.05900 90.40600  1.000 49.96000  ?  498 ASP A CA    1 
ATOM   4037 C  C     . ASP A 1 510 ? 224.37300 66.96500 90.59800  1.000 50.77000  ?  498 ASP A C     1 
ATOM   4038 O  O     . ASP A 1 510 ? 223.74300 67.90000 91.09200  1.000 54.77000  ?  498 ASP A O     1 
ATOM   4039 C  CB    . ASP A 1 510 ? 226.29800 68.41200 89.79800  1.000 47.86000  ?  498 ASP A CB    1 
ATOM   4040 C  CG    . ASP A 1 510 ? 225.69000 68.65500 88.43300  1.000 54.45000  ?  498 ASP A CG    1 
ATOM   4041 O  OD1   . ASP A 1 510 ? 224.56000 68.20200 88.17500  1.000 54.54000  ?  498 ASP A OD1   1 
ATOM   4042 O  OD2   . ASP A 1 510 ? 226.34900 69.32800 87.60300  1.000 63.65000  ?  498 ASP A OD2   1 
ATOM   4043 N  N     . SER A 1 511 ? 223.79700 65.82600 90.21300  1.000 45.56000  ?  499 SER A N     1 
ATOM   4044 C  CA    . SER A 1 511 ? 222.35700 65.62000 90.24100  1.000 43.50000  ?  499 SER A CA    1 
ATOM   4045 C  C     . SER A 1 511 ? 221.87600 64.82900 91.45400  1.000 46.61000  ?  499 SER A C     1 
ATOM   4046 O  O     . SER A 1 511 ? 222.02300 63.60300 91.49000  1.000 45.23000  ?  499 SER A O     1 
ATOM   4047 C  CB    . SER A 1 511 ? 221.91500 64.90400 88.96800  1.000 48.03000  ?  499 SER A CB    1 
ATOM   4048 O  OG    . SER A 1 511 ? 220.62800 64.32400 89.13700  1.000 53.56000  ?  499 SER A OG    1 
ATOM   4049 N  N     . GLN A 1 512 ? 221.29700 65.52200 92.43700  1.000 53.23000  ?  500 GLN A N     1 
ATOM   4050 C  CA    . GLN A 1 512 ? 220.66000 64.86300 93.59300  1.000 50.85000  ?  500 GLN A CA    1 
ATOM   4051 C  C     . GLN A 1 512 ? 219.67500 63.83700 93.13600  1.000 50.67000  ?  500 GLN A C     1 
ATOM   4052 O  O     . GLN A 1 512 ? 219.64400 62.71900 93.65000  1.000 50.04000  ?  500 GLN A O     1 
ATOM   4053 C  CB    . GLN A 1 512 ? 219.91200 65.85400 94.46100  1.000 56.43000  ?  500 GLN A CB    1 
ATOM   4054 C  CG    . GLN A 1 512 ? 220.77000 66.90200 95.07300  1.000 68.03000  ?  500 GLN A CG    1 
ATOM   4055 C  CD    . GLN A 1 512 ? 219.94500 67.94600 95.75300  1.000 72.25000  ?  500 GLN A CD    1 
ATOM   4056 O  OE1   . GLN A 1 512 ? 220.13000 69.14100 95.51300  1.000 75.45000  ?  500 GLN A OE1   1 
ATOM   4057 N  NE2   . GLN A 1 512 ? 219.01800 67.50900 96.61200  1.000 72.76000  ?  500 GLN A NE2   1 
ATOM   4058 N  N     . TYR A 1 513 ? 218.85500 64.27000 92.17500  1.000 46.65000  ?  501 TYR A N     1 
ATOM   4059 C  CA    . TYR A 1 513 ? 217.90700 63.42600 91.47600  1.000 48.13000  ?  501 TYR A CA    1 
ATOM   4060 C  C     . TYR A 1 513 ? 218.46800 62.04600 91.15300  1.000 52.01000  ?  501 TYR A C     1 
ATOM   4061 O  O     . TYR A 1 513 ? 217.95900 61.02900 91.65500  1.000 51.41000  ?  501 TYR A O     1 
ATOM   4062 C  CB    . TYR A 1 513 ? 217.43700 64.09900 90.17200  1.000 50.32000  ?  501 TYR A CB    1 
ATOM   4063 C  CG    . TYR A 1 513 ? 216.54300 63.17200 89.37900  1.000 52.03000  ?  501 TYR A CG    1 
ATOM   4064 C  CD1   . TYR A 1 513 ? 215.34700 62.71600 89.92200  1.000 49.11000  ?  501 TYR A CD1   1 
ATOM   4065 C  CD2   . TYR A 1 513 ? 216.91700 62.70000 88.12200  1.000 53.53000  ?  501 TYR A CD2   1 
ATOM   4066 C  CE1   . TYR A 1 513 ? 214.52300 61.84400 89.22600  1.000 51.98000  ?  501 TYR A CE1   1 
ATOM   4067 C  CE2   . TYR A 1 513 ? 216.10200 61.81900 87.41900  1.000 53.71000  ?  501 TYR A CE2   1 
ATOM   4068 C  CZ    . TYR A 1 513 ? 214.89900 61.39800 87.98000  1.000 54.09000  ?  501 TYR A CZ    1 
ATOM   4069 O  OH    . TYR A 1 513 ? 214.07100 60.52200 87.30800  1.000 51.14000  ?  501 TYR A OH    1 
ATOM   4070 N  N     . ALA A 1 514 ? 219.50900 62.01900 90.31400  1.000 50.50000  ?  502 ALA A N     1 
ATOM   4071 C  CA    . ALA A 1 514 ? 220.10300 60.76500 89.83400  1.000 47.05000  ?  502 ALA A CA    1 
ATOM   4072 C  C     . ALA A 1 514 ? 220.73600 59.97500 90.95500  1.000 46.69000  ?  502 ALA A C     1 
ATOM   4073 O  O     . ALA A 1 514 ? 220.68900 58.74900 90.97900  1.000 48.82000  ?  502 ALA A O     1 
ATOM   4074 C  CB    . ALA A 1 514 ? 221.11400 61.04800 88.78700  1.000 49.48000  ?  502 ALA A CB    1 
ATOM   4075 N  N     . LEU A 1 515 ? 221.32700 60.70600 91.88500  1.000 50.32000  ?  503 LEU A N     1 
ATOM   4076 C  CA    . LEU A 1 515 ? 222.03500 60.12400 93.00600  1.000 47.08000  ?  503 LEU A CA    1 
ATOM   4077 C  C     . LEU A 1 515 ? 221.07700 59.43900 93.95700  1.000 53.52000  ?  503 LEU A C     1 
ATOM   4078 O  O     . LEU A 1 515 ? 221.38300 58.36800 94.48600  1.000 55.31000  ?  503 LEU A O     1 
ATOM   4079 C  CB    . LEU A 1 515 ? 222.81100 61.20000 93.74300  1.000 49.41000  ?  503 LEU A CB    1 
ATOM   4080 C  CG    . LEU A 1 515 ? 223.44900 60.69100 95.01800  1.000 52.62000  ?  503 LEU A CG    1 
ATOM   4081 C  CD1   . LEU A 1 515 ? 224.87000 60.28100 94.72900  1.000 51.48000  ?  503 LEU A CD1   1 
ATOM   4082 C  CD2   . LEU A 1 515 ? 223.38000 61.77600 96.07300  1.000 54.37000  ?  503 LEU A CD2   1 
ATOM   4083 N  N     . GLY A 1 516 ? 219.92000 60.05700 94.18500  1.000 47.70000  ?  504 GLY A N     1 
ATOM   4084 C  CA    . GLY A 1 516 ? 218.91600 59.45700 95.03700  1.000 50.65000  ?  504 GLY A CA    1 
ATOM   4085 C  C     . GLY A 1 516 ? 218.35800 58.14100 94.51200  1.000 48.81000  ?  504 GLY A C     1 
ATOM   4086 O  O     . GLY A 1 516 ? 218.11600 57.21000 95.26700  1.000 54.78000  ?  504 GLY A O     1 
ATOM   4087 N  N     . ILE A 1 517 ? 218.14700 58.05300 93.21300  1.000 45.47000  ?  505 ILE A N     1 
ATOM   4088 C  CA    . ILE A 1 517 ? 217.66000 56.80700 92.63800  1.000 51.57000  ?  505 ILE A CA    1 
ATOM   4089 C  C     . ILE A 1 517 ? 218.68100 55.69000 92.74000  1.000 49.35000  ?  505 ILE A C     1 
ATOM   4090 O  O     . ILE A 1 517 ? 218.39100 54.63100 93.27400  1.000 55.33000  ?  505 ILE A O     1 
ATOM   4091 C  CB    . ILE A 1 517 ? 217.27500 56.96400 91.15200  1.000 50.93000  ?  505 ILE A CB    1 
ATOM   4092 C  CG1   . ILE A 1 517 ? 215.97300 57.76100 91.03500  1.000 45.26000  ?  505 ILE A CG1   1 
ATOM   4093 C  CG2   . ILE A 1 517 ? 217.16200 55.58600 90.50500  1.000 41.93000  ?  505 ILE A CG2   1 
ATOM   4094 C  CD1   . ILE A 1 517 ? 215.68200 58.32700 89.64400  1.000 44.08000  ?  505 ILE A CD1   1 
ATOM   4095 N  N     . ILE A 1 518 ? 219.87000 55.91700 92.20100  1.000 49.25000  ?  506 ILE A N     1 
ATOM   4096 C  CA    . ILE A 1 518 ? 220.87100 54.87100 92.15000  1.000 44.98000  ?  506 ILE A CA    1 
ATOM   4097 C  C     . ILE A 1 518 ? 221.30200 54.43800 93.53900  1.000 49.96000  ?  506 ILE A C     1 
ATOM   4098 O  O     . ILE A 1 518 ? 221.49800 53.24500 93.79500  1.000 49.99000  ?  506 ILE A O     1 
ATOM   4099 C  CB    . ILE A 1 518 ? 222.08600 55.31400 91.36000  1.000 46.72000  ?  506 ILE A CB    1 
ATOM   4100 C  CG1   . ILE A 1 518 ? 221.73400 55.35700 89.86700  1.000 43.10000  ?  506 ILE A CG1   1 
ATOM   4101 C  CG2   . ILE A 1 518 ? 223.23500 54.35900 91.63800  1.000 48.26000  ?  506 ILE A CG2   1 
ATOM   4102 C  CD1   . ILE A 1 518 ? 222.41800 56.44400 89.08700  1.000 44.83000  ?  506 ILE A CD1   1 
ATOM   4103 N  N     . GLN A 1 519 ? 221.43000 55.40200 94.44500  1.000 50.63000  ?  507 GLN A N     1 
ATOM   4104 C  CA    . GLN A 1 519 ? 221.82200 55.09100 95.81800  1.000 53.73000  ?  507 GLN A CA    1 
ATOM   4105 C  C     . GLN A 1 519 ? 220.84800 54.19500 96.55900  1.000 57.24000  ?  507 GLN A C     1 
ATOM   4106 O  O     . GLN A 1 519 ? 221.21800 53.60800 97.57200  1.000 54.67000  ?  507 GLN A O     1 
ATOM   4107 C  CB    . GLN A 1 519 ? 222.00200 56.35500 96.62600  1.000 54.56000  ?  507 GLN A CB    1 
ATOM   4108 C  CG    . GLN A 1 519 ? 223.37700 56.92000 96.54700  1.000 62.42000  ?  507 GLN A CG    1 
ATOM   4109 C  CD    . GLN A 1 519 ? 223.66400 57.81500 97.71500  1.000 71.21000  ?  507 GLN A CD    1 
ATOM   4110 O  OE1   . GLN A 1 519 ? 224.25900 58.87800 97.55900  1.000 77.54000  ?  507 GLN A OE1   1 
ATOM   4111 N  NE2   . GLN A 1 519 ? 223.24100 57.39200 98.90600  1.000 76.90000  ?  507 GLN A NE2   1 
ATOM   4112 N  N     . ALA A 1 520 ? 219.61400 54.08500 96.07200  1.000 52.85000  ?  508 ALA A N     1 
ATOM   4113 C  CA    . ALA A 1 520 ? 218.66100 53.19400 96.72700  1.000 56.44000  ?  508 ALA A CA    1 
ATOM   4114 C  C     . ALA A 1 520 ? 218.66900 51.78500 96.12300  1.000 55.97000  ?  508 ALA A C     1 
ATOM   4115 O  O     . ALA A 1 520 ? 217.86100 50.94100 96.51400  1.000 60.59000  ?  508 ALA A O     1 
ATOM   4116 C  CB    . ALA A 1 520 ? 217.26800 53.78400 96.68800  1.000 46.20000  ?  508 ALA A CB    1 
ATOM   4117 N  N     . GLN A 1 521 ? 219.57600 51.53700 95.18100  1.000 54.23000  ?  509 GLN A N     1 
ATOM   4118 C  CA    . GLN A 1 521 ? 219.86800 50.17600 94.69800  1.000 53.34000  ?  509 GLN A CA    1 
ATOM   4119 C  C     . GLN A 1 521 ? 218.69300 49.47000 94.04200  1.000 53.59000  ?  509 GLN A C     1 
ATOM   4120 O  O     . GLN A 1 521 ? 218.38400 48.31700 94.36300  1.000 52.78000  ?  509 GLN A O     1 
ATOM   4121 C  CB    . GLN A 1 521 ? 220.37700 49.30500 95.84300  1.000 51.59000  ?  509 GLN A CB    1 
ATOM   4122 C  CG    . GLN A 1 521 ? 221.65800 49.83700 96.48600  1.000 59.52000  ?  509 GLN A CG    1 
ATOM   4123 C  CD    . GLN A 1 521 ? 222.06200 49.02900 97.69900  1.000 61.54000  ?  509 GLN A CD    1 
ATOM   4124 O  OE1   . GLN A 1 521 ? 222.88800 48.10300 97.61400  1.000 58.54000  ?  509 GLN A OE1   1 
ATOM   4125 N  NE2   . GLN A 1 521 ? 221.46500 49.36300 98.84300  1.000 59.67000  ?  509 GLN A NE2   1 
ATOM   4126 N  N     . PRO A 1 522 ? 218.03400 50.15300 93.11400  1.000 45.77000  ?  510 PRO A N     1 
ATOM   4127 C  CA    . PRO A 1 522 ? 216.92000 49.52000 92.41700  1.000 46.75000  ?  510 PRO A CA    1 
ATOM   4128 C  C     . PRO A 1 522 ? 217.36800 48.39600 91.49700  1.000 51.40000  ?  510 PRO A C     1 
ATOM   4129 O  O     . PRO A 1 522 ? 218.44900 48.46200 90.88000  1.000 47.59000  ?  510 PRO A O     1 
ATOM   4130 C  CB    . PRO A 1 522 ? 216.32400 50.67200 91.60200  1.000 44.65000  ?  510 PRO A CB    1 
ATOM   4131 C  CG    . PRO A 1 522 ? 217.48700 51.59700 91.38600  1.000 46.47000  ?  510 PRO A CG    1 
ATOM   4132 C  CD    . PRO A 1 522 ? 218.26300 51.53400 92.66800  1.000 45.54000  ?  510 PRO A CD    1 
ATOM   4133 N  N     . ASP A 1 523 ? 216.52600 47.37400 91.38900  1.000 50.70000  ?  511 ASP A N     1 
ATOM   4134 C  CA    . ASP A 1 523 ? 216.73000 46.36000 90.37600  1.000 47.54000  ?  511 ASP A CA    1 
ATOM   4135 C  C     . ASP A 1 523 ? 215.57900 46.31600 89.37700  1.000 46.57000  ?  511 ASP A C     1 
ATOM   4136 O  O     . ASP A 1 523 ? 215.66500 45.60400 88.39200  1.000 50.21000  ?  511 ASP A O     1 
ATOM   4137 C  CB    . ASP A 1 523 ? 216.93400 44.99200 91.01900  1.000 50.94000  ?  511 ASP A CB    1 
ATOM   4138 C  CG    . ASP A 1 523 ? 215.73600 44.53400 91.82000  1.000 54.57000  ?  511 ASP A CG    1 
ATOM   4139 O  OD1   . ASP A 1 523 ? 214.64900 45.12500 91.66300  1.000 57.99000  ?  511 ASP A OD1   1 
ATOM   4140 O  OD2   . ASP A 1 523 ? 215.87500 43.56500 92.60400  1.000 59.75000  ?  511 ASP A OD2   1 
ATOM   4141 N  N     . GLN A 1 524 ? 214.49600 47.04500 89.64700  1.000 48.39000  ?  512 GLN A N     1 
ATOM   4142 C  CA    . GLN A 1 524 ? 213.41500 47.20500 88.66800  1.000 47.25000  ?  512 GLN A CA    1 
ATOM   4143 C  C     . GLN A 1 524 ? 212.98000 48.63900 88.60800  1.000 47.02000  ?  512 GLN A C     1 
ATOM   4144 O  O     . GLN A 1 524 ? 213.04200 49.33600 89.61200  1.000 47.12000  ?  512 GLN A O     1 
ATOM   4145 C  CB    . GLN A 1 524 ? 212.19800 46.36400 89.00100  1.000 46.38000  ?  512 GLN A CB    1 
ATOM   4146 C  CG    . GLN A 1 524 ? 212.50500 45.10200 89.69000  1.000 55.02000  ?  512 GLN A CG    1 
ATOM   4147 C  CD    . GLN A 1 524 ? 211.50200 44.83300 90.77500  1.000 61.20000  ?  512 GLN A CD    1 
ATOM   4148 O  OE1   . GLN A 1 524 ? 210.29000 44.86100 90.52500  1.000 58.27000  ?  512 GLN A OE1   1 
ATOM   4149 N  NE2   . GLN A 1 524 ? 211.99200 44.60200 92.00400  1.000 56.76000  ?  512 GLN A NE2   1 
ATOM   4150 N  N     . SER A 1 525 ? 212.51500 49.06400 87.44100  1.000 41.98000  ?  513 SER A N     1 
ATOM   4151 C  CA    . SER A 1 525 ? 212.06400 50.42700 87.26200  1.000 42.40000  ?  513 SER A CA    1 
ATOM   4152 C  C     . SER A 1 525 ? 211.02300 50.50900 86.16200  1.000 49.43000  ?  513 SER A C     1 
ATOM   4153 O  O     . SER A 1 525 ? 211.01800 49.68600 85.24800  1.000 49.24000  ?  513 SER A O     1 
ATOM   4154 C  CB    . SER A 1 525 ? 213.24400 51.34200 86.92500  1.000 46.37000  ?  513 SER A CB    1 
ATOM   4155 O  OG    . SER A 1 525 ? 212.80200 52.61900 86.47900  1.000 44.92000  ?  513 SER A OG    1 
ATOM   4156 N  N     . GLU A 1 526 ? 210.14600 51.50300 86.26500  1.000 51.40000  ?  514 GLU A N     1 
ATOM   4157 C  CA    . GLU A 1 526 ? 209.22700 51.85300 85.19200  1.000 52.18000  ?  514 GLU A CA    1 
ATOM   4158 C  C     . GLU A 1 526 ? 210.00400 52.40200 84.02300  1.000 54.22000  ?  514 GLU A C     1 
ATOM   4159 O  O     . GLU A 1 526 ? 209.55900 52.33900 82.87400  1.000 53.73000  ?  514 GLU A O     1 
ATOM   4160 C  CB    . GLU A 1 526 ? 208.22200 52.90200 85.64100  1.000 49.67000  ?  514 GLU A CB    1 
ATOM   4161 C  CG    . GLU A 1 526 ? 207.32500 52.45700 86.76500  1.000 61.20000  ?  514 GLU A CG    1 
ATOM   4162 C  CD    . GLU A 1 526 ? 206.63900 53.62600 87.47800  1.000 70.09000  ?  514 GLU A CD    1 
ATOM   4163 O  OE1   . GLU A 1 526 ? 206.85200 54.80800 87.07800  1.000 65.47000  ?  514 GLU A OE1   1 
ATOM   4164 O  OE2   . GLU A 1 526 ? 205.89200 53.35000 88.45100  1.000 73.36000  ?  514 GLU A OE2   1 
ATOM   4165 N  N     . SER A 1 527 ? 211.16300 52.97000 84.33600  1.000 51.18000  ?  515 SER A N     1 
ATOM   4166 C  CA    . SER A 1 527 ? 211.96500 53.67500 83.35000  1.000 47.98000  ?  515 SER A CA    1 
ATOM   4167 C  C     . SER A 1 527 ? 212.82300 52.74000 82.50500  1.000 52.36000  ?  515 SER A C     1 
ATOM   4168 O  O     . SER A 1 527 ? 213.58400 51.93400 83.03800  1.000 55.60000  ?  515 SER A O     1 
ATOM   4169 C  CB    . SER A 1 527 ? 212.84900 54.68900 84.05200  1.000 46.37000  ?  515 SER A CB    1 
ATOM   4170 O  OG    . SER A 1 527 ? 213.72400 55.31500 83.13500  1.000 54.58000  ?  515 SER A OG    1 
ATOM   4171 N  N     . GLU A 1 528 ? 212.69100 52.83900 81.18700  1.000 55.02000  ?  516 GLU A N     1 
ATOM   4172 C  CA    . GLU A 1 528 ? 213.55200 52.08700 80.27500  1.000 60.32000  ?  516 GLU A CA    1 
ATOM   4173 C  C     . GLU A 1 528 ? 215.00300 52.42800 80.60900  1.000 56.39000  ?  516 GLU A C     1 
ATOM   4174 O  O     . GLU A 1 528 ? 215.82500 51.54700 80.87600  1.000 56.74000  ?  516 GLU A O     1 
ATOM   4175 C  CB    . GLU A 1 528 ? 213.21000 52.42600 78.81100  1.000 68.03000  ?  516 GLU A CB    1 
ATOM   4176 C  CG    . GLU A 1 528 ? 214.00100 51.69400 77.72100  1.000 76.82000  ?  516 GLU A CG    1 
ATOM   4177 C  CD    . GLU A 1 528 ? 213.58800 52.13000 76.29700  1.000 96.58000  ?  516 GLU A CD    1 
ATOM   4178 O  OE1   . GLU A 1 528 ? 213.60900 53.35300 76.00500  1.000 93.47000  ?  516 GLU A OE1   1 
ATOM   4179 O  OE2   . GLU A 1 528 ? 213.23300 51.25200 75.47100  1.000 104.27000 ?  516 GLU A OE2   1 
ATOM   4180 N  N     . LEU A 1 529 ? 215.29000 53.72300 80.65100  1.000 53.08000  ?  517 LEU A N     1 
ATOM   4181 C  CA    . LEU A 1 529 ? 216.63500 54.21200 80.90300  1.000 49.95000  ?  517 LEU A CA    1 
ATOM   4182 C  C     . LEU A 1 529 ? 217.19100 53.74900 82.25000  1.000 50.65000  ?  517 LEU A C     1 
ATOM   4183 O  O     . LEU A 1 529 ? 218.34400 53.33400 82.32400  1.000 47.61000  ?  517 LEU A O     1 
ATOM   4184 C  CB    . LEU A 1 529 ? 216.64500 55.72700 80.81700  1.000 45.43000  ?  517 LEU A CB    1 
ATOM   4185 C  CG    . LEU A 1 529 ? 217.96400 56.45600 80.98900  1.000 50.60000  ?  517 LEU A CG    1 
ATOM   4186 C  CD1   . LEU A 1 529 ? 218.97500 55.95100 79.98700  1.000 51.30000  ?  517 LEU A CD1   1 
ATOM   4187 C  CD2   . LEU A 1 529 ? 217.70900 57.93300 80.80400  1.000 48.60000  ?  517 LEU A CD2   1 
ATOM   4188 N  N     . VAL A 1 530 ? 216.37900 53.78400 83.31000  1.000 51.56000  ?  518 VAL A N     1 
ATOM   4189 C  CA    . VAL A 1 530 ? 216.88500 53.36500 84.62100  1.000 47.97000  ?  518 VAL A CA    1 
ATOM   4190 C  C     . VAL A 1 530 ? 217.16300 51.87900 84.61200  1.000 49.28000  ?  518 VAL A C     1 
ATOM   4191 O  O     . VAL A 1 530 ? 218.05500 51.39200 85.30900  1.000 50.34000  ?  518 VAL A O     1 
ATOM   4192 C  CB    . VAL A 1 530 ? 215.92100 53.68600 85.77600  1.000 44.80000  ?  518 VAL A CB    1 
ATOM   4193 C  CG1   . VAL A 1 530 ? 216.41100 53.04900 87.06600  1.000 40.61000  ?  518 VAL A CG1   1 
ATOM   4194 C  CG2   . VAL A 1 530 ? 215.77700 55.17700 85.95400  1.000 44.26000  ?  518 VAL A CG2   1 
ATOM   4195 N  N     . ASN A 1 531 ? 216.38900 51.15400 83.82000  1.000 49.69000  ?  519 ASN A N     1 
ATOM   4196 C  CA    . ASN A 1 531 ? 216.58400 49.72300 83.73600  1.000 49.67000  ?  519 ASN A CA    1 
ATOM   4197 C  C     . ASN A 1 531 ? 217.90900 49.42200 83.04200  1.000 52.23000  ?  519 ASN A C     1 
ATOM   4198 O  O     . ASN A 1 531 ? 218.67300 48.59800 83.53000  1.000 53.73000  ?  519 ASN A O     1 
ATOM   4199 C  CB    . ASN A 1 531 ? 215.40700 49.06500 83.03000  1.000 50.85000  ?  519 ASN A CB    1 
ATOM   4200 C  CG    . ASN A 1 531 ? 214.32600 48.60200 84.01100  1.000 52.75000  ?  519 ASN A CG    1 
ATOM   4201 O  OD1   . ASN A 1 531 ? 214.62400 48.08100 85.08400  1.000 51.85000  ?  519 ASN A OD1   1 
ATOM   4202 N  ND2   . ASN A 1 531 ? 213.07100 48.80000 83.64400  1.000 58.70000  ?  519 ASN A ND2   1 
ATOM   4203 N  N     . GLN A 1 532 ? 218.20200 50.13000 81.94500  1.000 51.69000  ?  520 GLN A N     1 
ATOM   4204 C  CA    . GLN A 1 532 ? 219.49400 50.00900 81.25800  1.000 51.86000  ?  520 GLN A CA    1 
ATOM   4205 C  C     . GLN A 1 532 ? 220.65400 50.33400 82.19300  1.000 48.95000  ?  520 GLN A C     1 
ATOM   4206 O  O     . GLN A 1 532 ? 221.66500 49.63300 82.20500  1.000 49.84000  ?  520 GLN A O     1 
ATOM   4207 C  CB    . GLN A 1 532 ? 219.55400 50.92200 80.02100  1.000 52.86000  ?  520 GLN A CB    1 
ATOM   4208 C  CG    . GLN A 1 532 ? 218.78800 50.38300 78.80900  1.000 59.51000  ?  520 GLN A CG    1 
ATOM   4209 C  CD    . GLN A 1 532 ? 218.62100 51.40800 77.69100  1.000 69.23000  ?  520 GLN A CD    1 
ATOM   4210 O  OE1   . GLN A 1 532 ? 218.03300 52.46800 77.89100  1.000 71.77000  ?  520 GLN A OE1   1 
ATOM   4211 N  NE2   . GLN A 1 532 ? 219.14200 51.09200 76.50700  1.000 78.96000  ?  520 GLN A NE2   1 
ATOM   4212 N  N     . ILE A 1 533 ? 220.49900 51.39600 82.97400  1.000 47.35000  ?  521 ILE A N     1 
ATOM   4213 C  CA    . ILE A 1 533 ? 221.48100 51.74500 83.99000  1.000 48.98000  ?  521 ILE A CA    1 
ATOM   4214 C  C     . ILE A 1 533 ? 221.69600 50.61000 84.98000  1.000 44.90000  ?  521 ILE A C     1 
ATOM   4215 O  O     . ILE A 1 533 ? 222.83400 50.25200 85.25200  1.000 44.82000  ?  521 ILE A O     1 
ATOM   4216 C  CB    . ILE A 1 533 ? 221.08100 53.02100 84.74400  1.000 42.45000  ?  521 ILE A CB    1 
ATOM   4217 C  CG1   . ILE A 1 533 ? 221.36200 54.21300 83.83500  1.000 41.10000  ?  521 ILE A CG1   1 
ATOM   4218 C  CG2   . ILE A 1 533 ? 221.85200 53.12400 86.04500  1.000 31.37000  ?  521 ILE A CG2   1 
ATOM   4219 C  CD1   . ILE A 1 533 ? 221.01100 55.54900 84.40900  1.000 45.24000  ?  521 ILE A CD1   1 
ATOM   4220 N  N     . ILE A 1 534 ? 220.60800 50.03200 85.48700  1.000 45.79000  ?  522 ILE A N     1 
ATOM   4221 C  CA    . ILE A 1 534 ? 220.68000 48.92900 86.45200  1.000 46.23000  ?  522 ILE A CA    1 
ATOM   4222 C  C     . ILE A 1 534 ? 221.41400 47.73000 85.85500  1.000 47.88000  ?  522 ILE A C     1 
ATOM   4223 O  O     . ILE A 1 534 ? 222.22100 47.07300 86.52100  1.000 47.35000  ?  522 ILE A O     1 
ATOM   4224 C  CB    . ILE A 1 534 ? 219.26100 48.48500 86.92300  1.000 51.07000  ?  522 ILE A CB    1 
ATOM   4225 C  CG1   . ILE A 1 534 ? 218.60000 49.56500 87.78300  1.000 48.26000  ?  522 ILE A CG1   1 
ATOM   4226 C  CG2   . ILE A 1 534 ? 219.30100 47.17600 87.70400  1.000 42.87000  ?  522 ILE A CG2   1 
ATOM   4227 C  CD1   . ILE A 1 534 ? 217.10300 49.35600 87.92500  1.000 49.36000  ?  522 ILE A CD1   1 
ATOM   4228 N  N     . GLU A 1 535 ? 221.13800 47.45300 84.59000  1.000 50.76000  ?  523 GLU A N     1 
ATOM   4229 C  CA    . GLU A 1 535 ? 221.79600 46.35800 83.89900  1.000 52.44000  ?  523 GLU A CA    1 
ATOM   4230 C  C     . GLU A 1 535 ? 223.31900 46.53800 83.96700  1.000 51.08000  ?  523 GLU A C     1 
ATOM   4231 O  O     . GLU A 1 535 ? 224.05900 45.61600 84.33500  1.000 50.15000  ?  523 GLU A O     1 
ATOM   4232 C  CB    . GLU A 1 535 ? 221.29900 46.27100 82.45100  1.000 55.82000  ?  523 GLU A CB    1 
ATOM   4233 C  CG    . GLU A 1 535 ? 221.03300 44.83200 82.00800  1.000 73.31000  ?  523 GLU A CG    1 
ATOM   4234 C  CD    . GLU A 1 535 ? 221.46700 44.54200 80.57200  1.000 83.36000  ?  523 GLU A CD    1 
ATOM   4235 O  OE1   . GLU A 1 535 ? 221.09600 45.31900 79.66200  1.000 86.93000  ?  523 GLU A OE1   1 
ATOM   4236 O  OE2   . GLU A 1 535 ? 222.17700 43.53000 80.35900  1.000 85.75000  ?  523 GLU A OE2   1 
ATOM   4237 N  N     . GLN A 1 536 ? 223.77500 47.75000 83.66500  1.000 45.59000  ?  524 GLN A N     1 
ATOM   4238 C  CA    . GLN A 1 536 ? 225.18800 48.08900 83.79600  1.000 44.04000  ?  524 GLN A CA    1 
ATOM   4239 C  C     . GLN A 1 536 ? 225.72500 48.00000 85.22000  1.000 48.63000  ?  524 GLN A C     1 
ATOM   4240 O  O     . GLN A 1 536 ? 226.84000 47.53100 85.42500  1.000 53.08000  ?  524 GLN A O     1 
ATOM   4241 C  CB    . GLN A 1 536 ? 225.43400 49.49300 83.27000  1.000 47.71000  ?  524 GLN A CB    1 
ATOM   4242 C  CG    . GLN A 1 536 ? 225.08000 49.65800 81.80600  1.000 49.23000  ?  524 GLN A CG    1 
ATOM   4243 C  CD    . GLN A 1 536 ? 226.08500 49.00000 80.88200  1.000 48.88000  ?  524 GLN A CD    1 
ATOM   4244 O  OE1   . GLN A 1 536 ? 227.23000 48.74300 81.26000  1.000 51.65000  ?  524 GLN A OE1   1 
ATOM   4245 N  NE2   . GLN A 1 536 ? 225.66000 48.73300 79.65800  1.000 54.75000  ?  524 GLN A NE2   1 
ATOM   4246 N  N     . LEU A 1 537 ? 224.96400 48.47200 86.20800  1.000 50.22000  ?  525 LEU A N     1 
ATOM   4247 C  CA    . LEU A 1 537 ? 225.44700 48.42900 87.59200  1.000 44.86000  ?  525 LEU A CA    1 
ATOM   4248 C  C     . LEU A 1 537 ? 225.67800 46.99200 88.03000  1.000 47.33000  ?  525 LEU A C     1 
ATOM   4249 O  O     . LEU A 1 537 ? 226.58300 46.71600 88.80900  1.000 50.27000  ?  525 LEU A O     1 
ATOM   4250 C  CB    . LEU A 1 537 ? 224.47700 49.12400 88.53600  1.000 44.69000  ?  525 LEU A CB    1 
ATOM   4251 C  CG    . LEU A 1 537 ? 224.32600 50.62500 88.31200  1.000 45.80000  ?  525 LEU A CG    1 
ATOM   4252 C  CD1   . LEU A 1 537 ? 223.04600 51.12100 88.94800  1.000 45.68000  ?  525 LEU A CD1   1 
ATOM   4253 C  CD2   . LEU A 1 537 ? 225.51400 51.36800 88.87200  1.000 44.76000  ?  525 LEU A CD2   1 
ATOM   4254 N  N     . ILE A 1 538 ? 224.86700 46.07000 87.51900  1.000 49.33000  ?  526 ILE A N     1 
ATOM   4255 C  CA    . ILE A 1 538 ? 225.00500 44.67000 87.89600  1.000 48.59000  ?  526 ILE A CA    1 
ATOM   4256 C  C     . ILE A 1 538 ? 226.23800 44.06100 87.25800  1.000 49.76000  ?  526 ILE A C     1 
ATOM   4257 O  O     . ILE A 1 538 ? 226.89000 43.23600 87.87400  1.000 52.38000  ?  526 ILE A O     1 
ATOM   4258 C  CB    . ILE A 1 538 ? 223.76900 43.84300 87.50800  1.000 47.70000  ?  526 ILE A CB    1 
ATOM   4259 C  CG1   . ILE A 1 538 ? 222.54900 44.33300 88.27500  1.000 47.74000  ?  526 ILE A CG1   1 
ATOM   4260 C  CG2   . ILE A 1 538 ? 223.96800 42.41100 87.84800  1.000 46.45000  ?  526 ILE A CG2   1 
ATOM   4261 C  CD1   . ILE A 1 538 ? 221.29900 43.64200 87.91400  1.000 43.18000  ?  526 ILE A CD1   1 
ATOM   4262 N  N     . LYS A 1 539 ? 226.56400 44.46500 86.03000  1.000 52.17000  ?  527 LYS A N     1 
ATOM   4263 C  CA    . LYS A 1 539 ? 227.77500 43.96300 85.35600  1.000 53.47000  ?  527 LYS A CA    1 
ATOM   4264 C  C     . LYS A 1 539 ? 229.09700 44.42300 86.01100  1.000 53.64000  ?  527 LYS A C     1 
ATOM   4265 O  O     . LYS A 1 539 ? 230.12200 43.76800 85.87200  1.000 58.44000  ?  527 LYS A O     1 
ATOM   4266 C  CB    . LYS A 1 539 ? 227.81200 44.38900 83.88700  1.000 46.46000  ?  527 LYS A CB    1 
ATOM   4267 C  CG    . LYS A 1 539 ? 226.62600 44.00000 83.07700  1.000 54.01000  ?  527 LYS A CG    1 
ATOM   4268 C  CD    . LYS A 1 539 ? 227.00300 43.86600 81.61200  1.000 64.53000  ?  527 LYS A CD    1 
ATOM   4269 C  CE    . LYS A 1 539 ? 225.78800 43.41800 80.79300  1.000 71.67000  ?  527 LYS A CE    1 
ATOM   4270 N  NZ    . LYS A 1 539 ? 226.13400 42.85400 79.45600  1.000 75.76000  ?  527 LYS A NZ    1 
ATOM   4271 N  N     . LYS A 1 540 ? 229.07900 45.55600 86.69300  1.000 46.19000  ?  528 LYS A N     1 
ATOM   4272 C  CA    . LYS A 1 540 ? 230.29500 46.11500 87.23800  1.000 45.37000  ?  528 LYS A CA    1 
ATOM   4273 C  C     . LYS A 1 540 ? 230.79900 45.34200 88.45600  1.000 51.29000  ?  528 LYS A C     1 
ATOM   4274 O  O     . LYS A 1 540 ? 230.05700 44.59900 89.09100  1.000 49.34000  ?  528 LYS A O     1 
ATOM   4275 C  CB    . LYS A 1 540 ? 230.06500 47.57200 87.61000  1.000 45.09000  ?  528 LYS A CB    1 
ATOM   4276 C  CG    . LYS A 1 540 ? 229.68300 48.45400 86.45100  1.000 43.00000  ?  528 LYS A CG    1 
ATOM   4277 C  CD    . LYS A 1 540 ? 230.88800 48.75000 85.58800  1.000 44.03000  ?  528 LYS A CD    1 
ATOM   4278 C  CE    . LYS A 1 540 ? 230.52600 49.77600 84.51600  1.000 49.29000  ?  528 LYS A CE    1 
ATOM   4279 N  NZ    . LYS A 1 540 ? 231.40400 49.71000 83.30700  1.000 47.41000  ?  528 LYS A NZ    1 
ATOM   4280 N  N     . GLU A 1 541 ? 232.07900 45.52000 88.75400  1.000 50.24000  ?  529 GLU A N     1 
ATOM   4281 C  CA    . GLU A 1 541 ? 232.69500 44.97400 89.94200  1.000 54.25000  ?  529 GLU A CA    1 
ATOM   4282 C  C     . GLU A 1 541 ? 232.55300 45.96700 91.07100  1.000 49.63000  ?  529 GLU A C     1 
ATOM   4283 O  O     . GLU A 1 541 ? 232.16800 45.62100 92.18100  1.000 46.70000  ?  529 GLU A O     1 
ATOM   4284 C  CB    . GLU A 1 541 ? 234.18300 44.67400 89.70400  1.000 57.52000  ?  529 GLU A CB    1 
ATOM   4285 C  CG    . GLU A 1 541 ? 234.47600 43.34700 89.02300  1.000 65.03000  ?  529 GLU A CG    1 
ATOM   4286 C  CD    . GLU A 1 541 ? 234.01100 42.15400 89.84700  1.000 77.46000  ?  529 GLU A CD    1 
ATOM   4287 O  OE1   . GLU A 1 541 ? 234.59800 41.89500 90.92700  1.000 84.47000  ?  529 GLU A OE1   1 
ATOM   4288 O  OE2   . GLU A 1 541 ? 233.04800 41.48000 89.41500  1.000 83.24000  ?  529 GLU A OE2   1 
ATOM   4289 N  N     . LYS A 1 542 ? 232.91000 47.20900 90.77500  1.000 49.08000  ?  530 LYS A N     1 
ATOM   4290 C  CA    . LYS A 1 542 ? 232.83500 48.29000 91.74400  1.000 47.34000  ?  530 LYS A CA    1 
ATOM   4291 C  C     . LYS A 1 542 ? 232.35700 49.59700 91.10800  1.000 48.85000  ?  530 LYS A C     1 
ATOM   4292 O  O     . LYS A 1 542 ? 232.88200 50.04000 90.08100  1.000 49.92000  ?  530 LYS A O     1 
ATOM   4293 C  CB    . LYS A 1 542 ? 234.19000 48.50900 92.40100  1.000 49.15000  ?  530 LYS A CB    1 
ATOM   4294 C  CG    . LYS A 1 542 ? 234.59100 47.44800 93.37200  1.000 47.81000  ?  530 LYS A CG    1 
ATOM   4295 C  CD    . LYS A 1 542 ? 235.94500 47.77500 93.92700  1.000 53.31000  ?  530 LYS A CD    1 
ATOM   4296 C  CE    . LYS A 1 542 ? 236.38800 46.75000 94.94300  1.000 60.90000  ?  530 LYS A CE    1 
ATOM   4297 N  NZ    . LYS A 1 542 ? 237.41300 47.34700 95.83300  1.000 65.36000  ?  530 LYS A NZ    1 
ATOM   4298 N  N     . VAL A 1 543 ? 231.34200 50.20200 91.71100  1.000 49.97000  ?  531 VAL A N     1 
ATOM   4299 C  CA    . VAL A 1 543 ? 230.94000 51.54100 91.32800  1.000 43.35000  ?  531 VAL A CA    1 
ATOM   4300 C  C     . VAL A 1 543 ? 231.01500 52.41300 92.53900  1.000 41.02000  ?  531 VAL A C     1 
ATOM   4301 O  O     . VAL A 1 543 ? 230.67400 51.98500 93.62400  1.000 50.59000  ?  531 VAL A O     1 
ATOM   4302 C  CB    . VAL A 1 543 ? 229.51400 51.61800 90.77800  1.000 44.44000  ?  531 VAL A CB    1 
ATOM   4303 C  CG1   . VAL A 1 543 ? 229.15300 53.07500 90.53100  1.000 37.09000  ?  531 VAL A CG1   1 
ATOM   4304 C  CG2   . VAL A 1 543 ? 229.38200 50.81600 89.50500  1.000 43.41000  ?  531 VAL A CG2   1 
ATOM   4305 N  N     . TYR A 1 544 ? 231.47300 53.63700 92.36100  1.000 44.61000  ?  532 TYR A N     1 
ATOM   4306 C  CA    . TYR A 1 544 ? 231.39800 54.61800 93.42100  1.000 44.89000  ?  532 TYR A CA    1 
ATOM   4307 C  C     . TYR A 1 544 ? 230.87900 55.91600 92.84200  1.000 45.94000  ?  532 TYR A C     1 
ATOM   4308 O  O     . TYR A 1 544 ? 231.44700 56.46000 91.89200  1.000 44.22000  ?  532 TYR A O     1 
ATOM   4309 C  CB    . TYR A 1 544 ? 232.74600 54.81300 94.08500  1.000 46.33000  ?  532 TYR A CB    1 
ATOM   4310 C  CG    . TYR A 1 544 ? 232.78000 55.96200 95.04900  1.000 46.18000  ?  532 TYR A CG    1 
ATOM   4311 C  CD1   . TYR A 1 544 ? 232.31800 55.81800 96.34800  1.000 48.41000  ?  532 TYR A CD1   1 
ATOM   4312 C  CD2   . TYR A 1 544 ? 233.27200 57.19700 94.66000  1.000 46.52000  ?  532 TYR A CD2   1 
ATOM   4313 C  CE1   . TYR A 1 544 ? 232.36000 56.88200 97.25400  1.000 51.90000  ?  532 TYR A CE1   1 
ATOM   4314 C  CE2   . TYR A 1 544 ? 233.31400 58.27300 95.55100  1.000 51.21000  ?  532 TYR A CE2   1 
ATOM   4315 C  CZ    . TYR A 1 544 ? 232.86000 58.11100 96.84900  1.000 51.79000  ?  532 TYR A CZ    1 
ATOM   4316 O  OH    . TYR A 1 544 ? 232.90800 59.16800 97.73800  1.000 50.71000  ?  532 TYR A OH    1 
ATOM   4317 N  N     . LEU A 1 545 ? 229.79000 56.39300 93.43300  1.000 47.71000  ?  533 LEU A N     1 
ATOM   4318 C  CA    . LEU A 1 545 ? 229.01300 57.50900 92.90400  1.000 51.46000  ?  533 LEU A CA    1 
ATOM   4319 C  C     . LEU A 1 545 ? 229.06700 58.64400 93.91700  1.000 47.37000  ?  533 LEU A C     1 
ATOM   4320 O  O     . LEU A 1 545 ? 228.62800 58.49100 95.03800  1.000 51.35000  ?  533 LEU A O     1 
ATOM   4321 C  CB    . LEU A 1 545 ? 227.56600 57.07000 92.62200  1.000 44.09000  ?  533 LEU A CB    1 
ATOM   4322 C  CG    . LEU A 1 545 ? 226.56000 58.07800 92.07100  1.000 49.34000  ?  533 LEU A CG    1 
ATOM   4323 C  CD1   . LEU A 1 545 ? 227.05800 58.70800 90.78100  1.000 48.40000  ?  533 LEU A CD1   1 
ATOM   4324 C  CD2   . LEU A 1 545 ? 225.21000 57.42200 91.84500  1.000 50.80000  ?  533 LEU A CD2   1 
ATOM   4325 N  N     . ALA A 1 546 ? 229.64700 59.76600 93.52200  1.000 46.90000  ?  534 ALA A N     1 
ATOM   4326 C  CA    . ALA A 1 546 ? 229.82800 60.89200 94.41400  1.000 43.35000  ?  534 ALA A CA    1 
ATOM   4327 C  C     . ALA A 1 546 ? 229.03500 62.09700 93.91900  1.000 48.25000  ?  534 ALA A C     1 
ATOM   4328 O  O     . ALA A 1 546 ? 228.64700 62.16800 92.74600  1.000 50.58000  ?  534 ALA A O     1 
ATOM   4329 C  CB    . ALA A 1 546 ? 231.27300 61.22500 94.52400  1.000 45.38000  ?  534 ALA A CB    1 
ATOM   4330 N  N     . TRP A 1 547 ? 228.77700 63.05100 94.80000  1.000 48.91000  ?  535 TRP A N     1 
ATOM   4331 C  CA    . TRP A 1 547 ? 228.00700 64.21500 94.38400  1.000 46.67000  ?  535 TRP A CA    1 
ATOM   4332 C  C     . TRP A 1 547 ? 228.78000 65.50700 94.57800  1.000 44.76000  ?  535 TRP A C     1 
ATOM   4333 O  O     . TRP A 1 547 ? 229.50200 65.65600 95.55000  1.000 47.73000  ?  535 TRP A O     1 
ATOM   4334 C  CB    . TRP A 1 547 ? 226.70200 64.27200 95.16700  1.000 50.52000  ?  535 TRP A CB    1 
ATOM   4335 C  CG    . TRP A 1 547 ? 225.89000 65.47400 94.85700  1.000 50.73000  ?  535 TRP A CG    1 
ATOM   4336 C  CD1   . TRP A 1 547 ? 225.00600 65.61900 93.83100  1.000 47.04000  ?  535 TRP A CD1   1 
ATOM   4337 C  CD2   . TRP A 1 547 ? 225.88300 66.71100 95.57900  1.000 47.53000  ?  535 TRP A CD2   1 
ATOM   4338 N  NE1   . TRP A 1 547 ? 224.45100 66.87300 93.86300  1.000 48.86000  ?  535 TRP A NE1   1 
ATOM   4339 C  CE2   . TRP A 1 547 ? 224.97100 67.56500 94.92900  1.000 49.32000  ?  535 TRP A CE2   1 
ATOM   4340 C  CE3   . TRP A 1 547 ? 226.56700 67.18200 96.70800  1.000 47.87000  ?  535 TRP A CE3   1 
ATOM   4341 C  CZ2   . TRP A 1 547 ? 224.71500 68.86900 95.37400  1.000 47.61000  ?  535 TRP A CZ2   1 
ATOM   4342 C  CZ3   . TRP A 1 547 ? 226.32000 68.47100 97.14700  1.000 46.69000  ?  535 TRP A CZ3   1 
ATOM   4343 C  CH2   . TRP A 1 547 ? 225.40100 69.30300 96.47600  1.000 48.76000  ?  535 TRP A CH2   1 
ATOM   4344 N  N     . VAL A 1 548 ? 228.62700 66.45000 93.66400  1.000 40.71000  ?  536 VAL A N     1 
ATOM   4345 C  CA    . VAL A 1 548 ? 229.13800 67.78200 93.91700  1.000 46.65000  ?  536 VAL A CA    1 
ATOM   4346 C  C     . VAL A 1 548 ? 228.08000 68.80100 93.54100  1.000 47.22000  ?  536 VAL A C     1 
ATOM   4347 O  O     . VAL A 1 548 ? 227.21100 68.53000 92.71500  1.000 45.79000  ?  536 VAL A O     1 
ATOM   4348 C  CB    . VAL A 1 548 ? 230.46500 68.09300 93.13100  1.000 41.07000  ?  536 VAL A CB    1 
ATOM   4349 C  CG1   . VAL A 1 548 ? 231.60500 67.20400 93.61100  1.000 42.11000  ?  536 VAL A CG1   1 
ATOM   4350 C  CG2   . VAL A 1 548 ? 230.24700 67.93000 91.65700  1.000 45.41000  ?  536 VAL A CG2   1 
ATOM   4351 N  N     . PRO A 1 549 ? 228.16200 69.98600 94.15300  1.000 50.40000  ?  537 PRO A N     1 
ATOM   4352 C  CA    . PRO A 1 549 ? 227.31500 71.13600 93.85200  1.000 51.50000  ?  537 PRO A CA    1 
ATOM   4353 C  C     . PRO A 1 549 ? 227.58900 71.65400 92.45100  1.000 54.26000  ?  537 PRO A C     1 
ATOM   4354 O  O     . PRO A 1 549 ? 228.75300 71.92400 92.14200  1.000 62.08000  ?  537 PRO A O     1 
ATOM   4355 C  CB    . PRO A 1 549 ? 227.73600 72.17000 94.90700  1.000 52.28000  ?  537 PRO A CB    1 
ATOM   4356 C  CG    . PRO A 1 549 ? 228.42200 71.40500 95.95400  1.000 51.82000  ?  537 PRO A CG    1 
ATOM   4357 C  CD    . PRO A 1 549 ? 229.08300 70.26500 95.26400  1.000 50.10000  ?  537 PRO A CD    1 
ATOM   4358 N  N     . ALA A 1 550 ? 226.54700 71.79700 91.63200  1.000 53.69000  ?  538 ALA A N     1 
ATOM   4359 C  CA    . ALA A 1 550 ? 226.69100 72.26400 90.25000  1.000 57.41000  ?  538 ALA A CA    1 
ATOM   4360 C  C     . ALA A 1 550 ? 226.92900 73.75800 90.17100  1.000 64.77000  ?  538 ALA A C     1 
ATOM   4361 O  O     . ALA A 1 550 ? 226.56800 74.49600 91.07900  1.000 68.72000  ?  538 ALA A O     1 
ATOM   4362 C  CB    . ALA A 1 550 ? 225.46900 71.90400 89.44200  1.000 59.00000  ?  538 ALA A CB    1 
ATOM   4363 N  N     . HIS A 1 551 ? 227.53100 74.19700 89.07000  1.000 64.98000  ?  539 HIS A N     1 
ATOM   4364 C  CA    . HIS A 1 551 ? 227.83700 75.61100 88.84700  1.000 67.40000  ?  539 HIS A CA    1 
ATOM   4365 C  C     . HIS A 1 551 ? 228.60400 76.26100 89.99900  1.000 66.19000  ?  539 HIS A C     1 
ATOM   4366 O  O     . HIS A 1 551 ? 228.45600 77.44800 90.24200  1.000 72.39000  ?  539 HIS A O     1 
ATOM   4367 C  CB    . HIS A 1 551 ? 226.55500 76.41300 88.59200  1.000 65.07000  ?  539 HIS A CB    1 
ATOM   4368 C  CG    . HIS A 1 551 ? 225.54300 75.69400 87.76500  1.000 66.02000  ?  539 HIS A CG    1 
ATOM   4369 N  ND1   . HIS A 1 551 ? 224.36100 75.21600 88.28800  1.000 72.56000  ?  539 HIS A ND1   1 
ATOM   4370 C  CD2   . HIS A 1 551 ? 225.53700 75.35900 86.45200  1.000 74.56000  ?  539 HIS A CD2   1 
ATOM   4371 C  CE1   . HIS A 1 551 ? 223.66700 74.61700 87.33500  1.000 77.54000  ?  539 HIS A CE1   1 
ATOM   4372 N  NE2   . HIS A 1 551 ? 224.36000 74.68700 86.21100  1.000 82.25000  ?  539 HIS A NE2   1 
ATOM   4373 N  N     . LYS A 1 552 ? 229.42500 75.50100 90.70700  1.000 65.71000  ?  540 LYS A N     1 
ATOM   4374 C  CA    . LYS A 1 552 ? 230.25000 76.08900 91.75100  1.000 63.19000  ?  540 LYS A CA    1 
ATOM   4375 C  C     . LYS A 1 552 ? 231.73200 76.02600 91.38600  1.000 65.71000  ?  540 LYS A C     1 
ATOM   4376 O  O     . LYS A 1 552 ? 232.59700 76.04200 92.27600  1.000 62.49000  ?  540 LYS A O     1 
ATOM   4377 C  CB    . LYS A 1 552 ? 230.00700 75.38600 93.08600  1.000 70.01000  ?  540 LYS A CB    1 
ATOM   4378 C  CG    . LYS A 1 552 ? 228.64800 75.65900 93.69200  1.000 64.68000  ?  540 LYS A CG    1 
ATOM   4379 C  CD    . LYS A 1 552 ? 228.55200 77.07400 94.23700  1.000 72.15000  ?  540 LYS A CD    1 
ATOM   4380 C  CE    . LYS A 1 552 ? 227.08800 77.43200 94.56900  1.000 78.63000  ?  540 LYS A CE    1 
ATOM   4381 N  NZ    . LYS A 1 552 ? 226.90000 78.82700 95.09800  1.000 74.35000  ?  540 LYS A NZ    1 
ATOM   4382 N  N     . GLY A 1 553 ? 232.01000 75.94500 90.08000  1.000 68.65000  ?  541 GLY A N     1 
ATOM   4383 C  CA    . GLY A 1 553 ? 233.36800 75.97900 89.54800  1.000 68.18000  ?  541 GLY A CA    1 
ATOM   4384 C  C     . GLY A 1 553 ? 234.27000 74.80200 89.91100  1.000 69.82000  ?  541 GLY A C     1 
ATOM   4385 O  O     . GLY A 1 553 ? 235.48100 74.84600 89.69400  1.000 73.95000  ?  541 GLY A O     1 
ATOM   4386 N  N     . ILE A 1 554 ? 233.67700 73.75000 90.46600  1.000 64.62000  ?  542 ILE A N     1 
ATOM   4387 C  CA    . ILE A 1 554 ? 234.41200 72.56500 90.88600  1.000 64.57000  ?  542 ILE A CA    1 
ATOM   4388 C  C     . ILE A 1 554 ? 234.80100 71.69300 89.69500  1.000 65.50000  ?  542 ILE A C     1 
ATOM   4389 O  O     . ILE A 1 554 ? 233.97000 70.96600 89.16300  1.000 67.76000  ?  542 ILE A O     1 
ATOM   4390 C  CB    . ILE A 1 554 ? 233.57500 71.72300 91.86500  1.000 61.77000  ?  542 ILE A CB    1 
ATOM   4391 C  CG1   . ILE A 1 554 ? 233.31400 72.51000 93.14600  1.000 63.44000  ?  542 ILE A CG1   1 
ATOM   4392 C  CG2   . ILE A 1 554 ? 234.26500 70.39600 92.15800  1.000 64.81000  ?  542 ILE A CG2   1 
ATOM   4393 C  CD1   . ILE A 1 554 ? 232.06300 72.06800 93.89100  1.000 59.41000  ?  542 ILE A CD1   1 
ATOM   4394 N  N     . GLY A 1 555 ? 236.05600 71.76000 89.26600  1.000 69.64000  ?  543 GLY A N     1 
ATOM   4395 C  CA    . GLY A 1 555 ? 236.48900 70.92800 88.15600  1.000 64.51000  ?  543 GLY A CA    1 
ATOM   4396 C  C     . GLY A 1 555 ? 236.47400 69.51100 88.66900  1.000 64.95000  ?  543 GLY A C     1 
ATOM   4397 O  O     . GLY A 1 555 ? 236.57800 69.30200 89.88400  1.000 72.78000  ?  543 GLY A O     1 
ATOM   4398 N  N     . GLY A 1 556 ? 236.32300 68.53600 87.78000  1.000 58.30000  ?  544 GLY A N     1 
ATOM   4399 C  CA    . GLY A 1 556 ? 236.13500 68.77800 86.37200  1.000 56.36000  ?  544 GLY A CA    1 
ATOM   4400 C  C     . GLY A 1 556 ? 234.67200 68.64000 86.06500  1.000 56.35000  ?  544 GLY A C     1 
ATOM   4401 O  O     . GLY A 1 556 ? 234.28300 68.34800 84.94100  1.000 59.45000  ?  544 GLY A O     1 
ATOM   4402 N  N     . ASN A 1 557 ? 233.85300 68.83100 87.08800  1.000 54.00000  ?  545 ASN A N     1 
ATOM   4403 C  CA    . ASN A 1 557 ? 232.44300 69.07600 86.87600  1.000 52.95000  ?  545 ASN A CA    1 
ATOM   4404 C  C     . ASN A 1 557 ? 232.32700 70.31400 86.00600  1.000 60.16000  ?  545 ASN A C     1 
ATOM   4405 O  O     . ASN A 1 557 ? 231.49100 70.39200 85.09400  1.000 58.66000  ?  545 ASN A O     1 
ATOM   4406 C  CB    . ASN A 1 557 ? 231.70700 69.26200 88.20700  1.000 52.27000  ?  545 ASN A CB    1 
ATOM   4407 C  CG    . ASN A 1 557 ? 230.28400 69.74500 88.02500  1.000 54.19000  ?  545 ASN A CG    1 
ATOM   4408 O  OD1   . ASN A 1 557 ? 229.97200 70.90900 88.27600  1.000 57.11000  ?  545 ASN A OD1   1 
ATOM   4409 N  ND2   . ASN A 1 557 ? 229.41600 68.85700 87.57800  1.000 54.59000  ?  545 ASN A ND2   1 
ATOM   4410 N  N     . GLU A 1 558 ? 233.19700 71.28000 86.28600  1.000 62.23000  ?  546 GLU A N     1 
ATOM   4411 C  CA    . GLU A 1 558 ? 233.23300 72.51500 85.51700  1.000 64.11000  ?  546 GLU A CA    1 
ATOM   4412 C  C     . GLU A 1 558 ? 233.43700 72.21800 84.04800  1.000 66.38000  ?  546 GLU A C     1 
ATOM   4413 O  O     . GLU A 1 558 ? 232.71100 72.74100 83.19600  1.000 66.09000  ?  546 GLU A O     1 
ATOM   4414 C  CB    . GLU A 1 558 ? 234.34200 73.44400 86.00300  1.000 67.68000  ?  546 GLU A CB    1 
ATOM   4415 C  CG    . GLU A 1 558 ? 234.00000 74.90000 85.76500  1.000 79.44000  ?  546 GLU A CG    1 
ATOM   4416 C  CD    . GLU A 1 558 ? 235.18900 75.71600 85.33700  1.000 87.11000  ?  546 GLU A CD    1 
ATOM   4417 O  OE1   . GLU A 1 558 ? 234.97900 76.76100 84.67600  1.000 90.90000  ?  546 GLU A OE1   1 
ATOM   4418 O  OE2   . GLU A 1 558 ? 236.32700 75.31000 85.66700  1.000 89.08000  ?  546 GLU A OE2   1 
ATOM   4419 N  N     . GLN A 1 559 ? 234.43200 71.37500 83.76300  1.000 63.41000  ?  547 GLN A N     1 
ATOM   4420 C  CA    . GLN A 1 559 ? 234.77700 71.03300 82.39200  1.000 63.70000  ?  547 GLN A CA    1 
ATOM   4421 C  C     . GLN A 1 559 ? 233.59000 70.43600 81.63900  1.000 64.34000  ?  547 GLN A C     1 
ATOM   4422 O  O     . GLN A 1 559 ? 233.27000 70.87800 80.52500  1.000 66.02000  ?  547 GLN A O     1 
ATOM   4423 C  CB    . GLN A 1 559 ? 235.96100 70.06700 82.35900  1.000 65.01000  ?  547 GLN A CB    1 
ATOM   4424 C  CG    . GLN A 1 559 ? 237.30300 70.74700 82.12900  1.000 63.43000  ?  547 GLN A CG    1 
ATOM   4425 C  CD    . GLN A 1 559 ? 237.84300 71.44300 83.37100  1.000 69.36000  ?  547 GLN A CD    1 
ATOM   4426 O  OE1   . GLN A 1 559 ? 237.09200 71.98500 84.18500  1.000 68.53000  ?  547 GLN A OE1   1 
ATOM   4427 N  NE2   . GLN A 1 559 ? 239.16400 71.42600 83.51800  1.000 70.35000  ?  547 GLN A NE2   1 
ATOM   4428 N  N     . VAL A 1 560 ? 232.92300 69.45800 82.25500  1.000 58.93000  ?  548 VAL A N     1 
ATOM   4429 C  CA    . VAL A 1 560 ? 231.84600 68.74900 81.57000  1.000 59.89000  ?  548 VAL A CA    1 
ATOM   4430 C  C     . VAL A 1 560 ? 230.57400 69.58000 81.49400  1.000 58.47000  ?  548 VAL A C     1 
ATOM   4431 O  O     . VAL A 1 560 ? 229.76200 69.38800 80.58400  1.000 59.94000  ?  548 VAL A O     1 
ATOM   4432 C  CB    . VAL A 1 560 ? 231.54300 67.39000 82.24000  1.000 57.85000  ?  548 VAL A CB    1 
ATOM   4433 C  CG1   . VAL A 1 560 ? 231.01800 67.58100 83.64700  1.000 53.49000  ?  548 VAL A CG1   1 
ATOM   4434 C  CG2   . VAL A 1 560 ? 230.56200 66.59500 81.39900  1.000 53.96000  ?  548 VAL A CG2   1 
ATOM   4435 N  N     . ASP A 1 561 ? 230.40600 70.51700 82.42600  1.000 62.08000  ?  549 ASP A N     1 
ATOM   4436 C  CA    . ASP A 1 561 ? 229.28200 71.44900 82.35500  1.000 59.16000  ?  549 ASP A CA    1 
ATOM   4437 C  C     . ASP A 1 561 ? 229.38700 72.31000 81.09800  1.000 61.68000  ?  549 ASP A C     1 
ATOM   4438 O  O     . ASP A 1 561 ? 228.38300 72.54500 80.42000  1.000 64.29000  ?  549 ASP A O     1 
ATOM   4439 C  CB    . ASP A 1 561 ? 229.21300 72.33200 83.59800  1.000 61.20000  ?  549 ASP A CB    1 
ATOM   4440 C  CG    . ASP A 1 561 ? 227.84200 73.00300 83.77100  1.000 74.06000  ?  549 ASP A CG    1 
ATOM   4441 O  OD1   . ASP A 1 561 ? 227.66400 74.12700 83.25800  1.000 73.45000  ?  549 ASP A OD1   1 
ATOM   4442 O  OD2   . ASP A 1 561 ? 226.93900 72.41800 84.42500  1.000 79.82000  ?  549 ASP A OD2   1 
ATOM   4443 N  N     . LYS A 1 562 ? 230.59800 72.76300 80.77400  1.000 59.14000  ?  550 LYS A N     1 
ATOM   4444 C  CA    . LYS A 1 562 ? 230.80800 73.56500 79.57200  1.000 60.78000  ?  550 LYS A CA    1 
ATOM   4445 C  C     . LYS A 1 562 ? 230.44300 72.78000 78.31400  1.000 66.96000  ?  550 LYS A C     1 
ATOM   4446 O  O     . LYS A 1 562 ? 229.76700 73.31800 77.42600  1.000 65.88000  ?  550 LYS A O     1 
ATOM   4447 C  CB    . LYS A 1 562 ? 232.25400 74.06100 79.48600  1.000 66.17000  ?  550 LYS A CB    1 
ATOM   4448 C  CG    . LYS A 1 562 ? 232.60300 75.05700 80.58000  1.000 74.15000  ?  550 LYS A CG    1 
ATOM   4449 C  CD    . LYS A 1 562 ? 233.94400 75.75800 80.35900  1.000 84.88000  ?  550 LYS A CD    1 
ATOM   4450 C  CE    . LYS A 1 562 ? 234.37500 76.55700 81.61000  1.000 86.83000  ?  550 LYS A CE    1 
ATOM   4451 N  NZ    . LYS A 1 562 ? 233.28900 77.43300 82.16000  1.000 78.78000  ?  550 LYS A NZ    1 
ATOM   4452 N  N     . LEU A 1 563 ? 230.87100 71.51300 78.25400  1.000 64.40000  ?  551 LEU A N     1 
ATOM   4453 C  CA    . LEU A 1 563 ? 230.58200 70.62800 77.11700  1.000 59.42000  ?  551 LEU A CA    1 
ATOM   4454 C  C     . LEU A 1 563 ? 229.09800 70.45900 76.81400  1.000 59.63000  ?  551 LEU A C     1 
ATOM   4455 O  O     . LEU A 1 563 ? 228.65200 70.69400 75.69700  1.000 60.87000  ?  551 LEU A O     1 
ATOM   4456 C  CB    . LEU A 1 563 ? 231.16300 69.23600 77.35200  1.000 61.02000  ?  551 LEU A CB    1 
ATOM   4457 C  CG    . LEU A 1 563 ? 232.65800 68.97800 77.28500  1.000 64.71000  ?  551 LEU A CG    1 
ATOM   4458 C  CD1   . LEU A 1 563 ? 232.89400 67.47500 77.29500  1.000 64.45000  ?  551 LEU A CD1   1 
ATOM   4459 C  CD2   . LEU A 1 563 ? 233.24500 69.59400 76.05200  1.000 59.49000  ?  551 LEU A CD2   1 
ATOM   4460 N  N     . VAL A 1 564 ? 228.33800 70.01000 77.80300  1.000 59.98000  ?  552 VAL A N     1 
ATOM   4461 C  CA    . VAL A 1 564 ? 226.93300 69.70700 77.57100  1.000 60.39000  ?  552 VAL A CA    1 
ATOM   4462 C  C     . VAL A 1 564 ? 226.09500 70.97700 77.52400  1.000 62.46000  ?  552 VAL A C     1 
ATOM   4463 O  O     . VAL A 1 564 ? 224.96000 70.95900 77.04500  1.000 62.53000  ?  552 VAL A O     1 
ATOM   4464 C  CB    . VAL A 1 564 ? 226.37800 68.75500 78.65500  1.000 60.26000  ?  552 VAL A CB    1 
ATOM   4465 C  CG1   . VAL A 1 564 ? 227.31000 67.57400 78.82600  1.000 55.94000  ?  552 VAL A CG1   1 
ATOM   4466 C  CG2   . VAL A 1 564 ? 226.20300 69.47700 79.99700  1.000 54.88000  ?  552 VAL A CG2   1 
ATOM   4467 N  N     . SER A 1 565 ? 226.65700 72.07700 78.02100  1.000 62.69000  ?  553 SER A N     1 
ATOM   4468 C  CA    . SER A 1 565 ? 225.95500 73.35800 78.02700  1.000 67.29000  ?  553 SER A CA    1 
ATOM   4469 C  C     . SER A 1 565 ? 225.93500 74.02000 76.65800  1.000 68.18000  ?  553 SER A C     1 
ATOM   4470 O  O     . SER A 1 565 ? 224.95500 74.67900 76.28400  1.000 69.05000  ?  553 SER A O     1 
ATOM   4471 C  CB    . SER A 1 565 ? 226.59600 74.30600 79.03400  1.000 67.26000  ?  553 SER A CB    1 
ATOM   4472 O  OG    . SER A 1 565 ? 225.86100 74.29700 80.23600  1.000 77.80000  ?  553 SER A OG    1 
ATOM   4473 N  N     . ALA A 1 566 ? 227.03500 73.84800 75.93000  1.000 62.97000  ?  554 ALA A N     1 
ATOM   4474 C  CA    . ALA A 1 566 ? 227.23000 74.51400 74.65100  1.000 68.07000  ?  554 ALA A CA    1 
ATOM   4475 C  C     . ALA A 1 566 ? 226.08700 74.21200 73.68800  1.000 65.72000  ?  554 ALA A C     1 
ATOM   4476 O  O     . ALA A 1 566 ? 225.79500 73.05000 73.38500  1.000 64.03000  ?  554 ALA A O     1 
ATOM   4477 C  CB    . ALA A 1 566 ? 228.56800 74.10900 74.04500  1.000 62.38000  ?  554 ALA A CB    1 
ATOM   4478 N  N     . GLY A 1 567 ? 225.42600 75.27100 73.24000  1.000 65.25000  ?  555 GLY A N     1 
ATOM   4479 C  CA    . GLY A 1 567 ? 224.31000 75.14900 72.31900  1.000 67.74000  ?  555 GLY A CA    1 
ATOM   4480 C  C     . GLY A 1 567 ? 223.01700 74.69700 72.96800  1.000 67.25000  ?  555 GLY A C     1 
ATOM   4481 O  O     . GLY A 1 567 ? 222.05700 74.35900 72.27500  1.000 70.92000  ?  555 GLY A O     1 
ATOM   4482 N  N     . ILE A 1 568 ? 222.99100 74.68100 74.29800  1.000 66.80000  ?  556 ILE A N     1 
ATOM   4483 C  CA    . ILE A 1 568 ? 221.80100 74.25900 75.03000  1.000 66.73000  ?  556 ILE A CA    1 
ATOM   4484 C  C     . ILE A 1 568 ? 221.34700 75.33400 76.00200  1.000 67.15000  ?  556 ILE A C     1 
ATOM   4485 O  O     . ILE A 1 568 ? 220.15300 75.55700 76.18300  1.000 67.90000  ?  556 ILE A O     1 
ATOM   4486 C  CB    . ILE A 1 568 ? 222.04400 72.95700 75.82700  1.000 65.74000  ?  556 ILE A CB    1 
ATOM   4487 C  CG1   . ILE A 1 568 ? 222.53000 71.83100 74.91800  1.000 63.83000  ?  556 ILE A CG1   1 
ATOM   4488 C  CG2   . ILE A 1 568 ? 220.77100 72.52800 76.53900  1.000 65.85000  ?  556 ILE A CG2   1 
ATOM   4489 C  CD1   . ILE A 1 568 ? 221.53300 71.45100 73.82900  1.000 61.61000  ?  556 ILE A CD1   1 
ATOM   4490 N  N     . ARG A 1 569 ? 222.32100 75.99300 76.61900  1.000 71.68000  ?  557 ARG A N     1 
ATOM   4491 C  CA    . ARG A 1 569 ? 222.08100 76.86600 77.75500  1.000 73.04000  ?  557 ARG A CA    1 
ATOM   4492 C  C     . ARG A 1 569 ? 222.83700 78.17400 77.58000  1.000 73.06000  ?  557 ARG A C     1 
ATOM   4493 O  O     . ARG A 1 569 ? 223.90400 78.19000 76.96900  1.000 75.44000  ?  557 ARG A O     1 
ATOM   4494 C  CB    . ARG A 1 569 ? 222.51000 76.16700 79.04700  1.000 71.82000  ?  557 ARG A CB    1 
ATOM   4495 C  CG    . ARG A 1 569 ? 222.28200 76.98700 80.29800  1.000 85.19000  ?  557 ARG A CG    1 
ATOM   4496 C  CD    . ARG A 1 569 ? 222.99800 76.37300 81.49700  1.000 90.98000  ?  557 ARG A CD    1 
ATOM   4497 N  NE    . ARG A 1 569 ? 224.35000 76.91400 81.67300  1.000 93.57000  ?  557 ARG A NE    1 
ATOM   4498 C  CZ    . ARG A 1 569 ? 225.32000 76.31600 82.36500  1.000 89.21000  ?  557 ARG A CZ    1 
ATOM   4499 N  NH1   . ARG A 1 569 ? 225.10200 75.13700 82.94900  1.000 82.94000  ?  557 ARG A NH1   1 
ATOM   4500 N  NH2   . ARG A 1 569 ? 226.51400 76.89200 82.45700  1.000 88.78000  ?  557 ARG A NH2   1 
ATOM   4501 N  N     . GLU B 2 6   ? 177.33600 72.89900 134.99600 1.000 103.08000 ?  6   GLU B N     1 
ATOM   4502 C  CA    . GLU B 2 6   ? 177.04800 73.58400 133.74300 1.000 107.02000 ?  6   GLU B CA    1 
ATOM   4503 C  C     . GLU B 2 6   ? 178.29600 73.63600 132.85900 1.000 104.29000 ?  6   GLU B C     1 
ATOM   4504 O  O     . GLU B 2 6   ? 179.38200 73.98700 133.33200 1.000 101.31000 ?  6   GLU B O     1 
ATOM   4505 C  CB    . GLU B 2 6   ? 176.52000 74.99900 134.01000 1.000 111.40000 ?  6   GLU B CB    1 
ATOM   4506 C  CG    . GLU B 2 6   ? 175.29000 75.36000 133.18300 1.000 119.51000 ?  6   GLU B CG    1 
ATOM   4507 C  CD    . GLU B 2 6   ? 174.90400 76.82500 133.29100 1.000 126.53000 ?  6   GLU B CD    1 
ATOM   4508 O  OE1   . GLU B 2 6   ? 175.55200 77.66300 132.62200 1.000 122.99000 ?  6   GLU B OE1   1 
ATOM   4509 O  OE2   . GLU B 2 6   ? 173.94800 77.13700 134.03700 1.000 129.34000 ?  6   GLU B OE2   1 
ATOM   4510 N  N     . THR B 2 7   ? 178.12800 73.30300 131.57700 1.000 101.49000 ?  7   THR B N     1 
ATOM   4511 C  CA    . THR B 2 7   ? 179.25000 73.16100 130.64100 1.000 97.21000  ?  7   THR B CA    1 
ATOM   4512 C  C     . THR B 2 7   ? 179.64300 74.45200 129.90800 1.000 94.46000  ?  7   THR B C     1 
ATOM   4513 O  O     . THR B 2 7   ? 178.81800 75.35100 129.69600 1.000 92.76000  ?  7   THR B O     1 
ATOM   4514 C  CB    . THR B 2 7   ? 178.94200 72.09500 129.55800 1.000 86.57000  ?  7   THR B CB    1 
ATOM   4515 O  OG1   . THR B 2 7   ? 178.07000 72.65600 128.56600 1.000 86.92000  ?  7   THR B OG1   1 
ATOM   4516 C  CG2   . THR B 2 7   ? 178.30100 70.85300 130.17000 1.000 79.23000  ?  7   THR B CG2   1 
ATOM   4517 N  N     . VAL B 2 8   ? 180.91400 74.52300 129.51600 1.000 91.72000  ?  8   VAL B N     1 
ATOM   4518 C  CA    . VAL B 2 8   ? 181.39500 75.59300 128.64300 1.000 92.71000  ?  8   VAL B CA    1 
ATOM   4519 C  C     . VAL B 2 8   ? 180.98900 75.30300 127.19800 1.000 88.05000  ?  8   VAL B C     1 
ATOM   4520 O  O     . VAL B 2 8   ? 181.23900 74.20500 126.69900 1.000 90.23000  ?  8   VAL B O     1 
ATOM   4521 C  CB    . VAL B 2 8   ? 182.94100 75.75100 128.71000 1.000 85.88000  ?  8   VAL B CB    1 
ATOM   4522 C  CG1   . VAL B 2 8   ? 183.41900 76.75300 127.66800 1.000 86.66000  ?  8   VAL B CG1   1 
ATOM   4523 C  CG2   . VAL B 2 8   ? 183.39400 76.16600 130.10200 1.000 83.15000  ?  8   VAL B CG2   1 
ATOM   4524 N  N     . PRO B 2 9   ? 180.34400 76.27200 126.52700 1.000 86.89000  ?  9   PRO B N     1 
ATOM   4525 C  CA    . PRO B 2 9   ? 180.03600 76.08600 125.10100 1.000 86.97000  ?  9   PRO B CA    1 
ATOM   4526 C  C     . PRO B 2 9   ? 181.29400 76.08700 124.23500 1.000 83.90000  ?  9   PRO B C     1 
ATOM   4527 O  O     . PRO B 2 9   ? 182.09000 77.02000 124.29600 1.000 85.61000  ?  9   PRO B O     1 
ATOM   4528 C  CB    . PRO B 2 9   ? 179.13800 77.28800 124.76500 1.000 81.47000  ?  9   PRO B CB    1 
ATOM   4529 C  CG    . PRO B 2 9   ? 179.41400 78.28700 125.83500 1.000 84.82000  ?  9   PRO B CG    1 
ATOM   4530 C  CD    . PRO B 2 9   ? 179.70900 77.48200 127.07400 1.000 87.63000  ?  9   PRO B CD    1 
ATOM   4531 N  N     . VAL B 2 10  ? 181.47600 75.04200 123.44000 1.000 78.22000  ?  10  VAL B N     1 
ATOM   4532 C  CA    . VAL B 2 10  ? 182.62600 74.99600 122.56500 1.000 78.54000  ?  10  VAL B CA    1 
ATOM   4533 C  C     . VAL B 2 10  ? 182.20300 74.68300 121.13900 1.000 76.24000  ?  10  VAL B C     1 
ATOM   4534 O  O     . VAL B 2 10  ? 181.27900 73.90400 120.91000 1.000 77.15000  ?  10  VAL B O     1 
ATOM   4535 C  CB    . VAL B 2 10  ? 183.65300 73.97400 123.04300 1.000 77.52000  ?  10  VAL B CB    1 
ATOM   4536 C  CG1   . VAL B 2 10  ? 185.03600 74.41500 122.60900 1.000 76.93000  ?  10  VAL B CG1   1 
ATOM   4537 C  CG2   . VAL B 2 10  ? 183.60000 73.84900 124.55700 1.000 77.01000  ?  10  VAL B CG2   1 
ATOM   4538 N  N     . LYS B 2 11  ? 182.88200 75.31600 120.18800 1.000 76.33000  ?  11  LYS B N     1 
ATOM   4539 C  CA    . LYS B 2 11  ? 182.54800 75.20000 118.77400 1.000 76.79000  ?  11  LYS B CA    1 
ATOM   4540 C  C     . LYS B 2 11  ? 183.78300 74.86400 117.95900 1.000 75.03000  ?  11  LYS B C     1 
ATOM   4541 O  O     . LYS B 2 11  ? 184.90000 75.15900 118.37500 1.000 75.53000  ?  11  LYS B O     1 
ATOM   4542 C  CB    . LYS B 2 11  ? 181.92700 76.50200 118.25600 1.000 81.71000  ?  11  LYS B CB    1 
ATOM   4543 C  CG    . LYS B 2 11  ? 180.41600 76.60900 118.42700 1.000 87.48000  ?  11  LYS B CG    1 
ATOM   4544 C  CD    . LYS B 2 11  ? 179.94600 78.06300 118.33200 1.000 95.03000  ?  11  LYS B CD    1 
ATOM   4545 C  CE    . LYS B 2 11  ? 180.21500 78.83900 119.62900 1.000 92.78000  ?  11  LYS B CE    1 
ATOM   4546 N  NZ    . LYS B 2 11  ? 179.46400 78.28500 120.81100 1.000 84.27000  ?  11  LYS B NZ    1 
ATOM   4547 N  N     . LEU B 2 12  ? 183.57700 74.24900 116.79700 1.000 75.93000  ?  12  LEU B N     1 
ATOM   4548 C  CA    . LEU B 2 12  ? 184.66800 74.01600 115.85700 1.000 72.82000  ?  12  LEU B CA    1 
ATOM   4549 C  C     . LEU B 2 12  ? 185.08800 75.33000 115.22000 1.000 77.51000  ?  12  LEU B C     1 
ATOM   4550 O  O     . LEU B 2 12  ? 184.32300 76.29500 115.21200 1.000 81.83000  ?  12  LEU B O     1 
ATOM   4551 C  CB    . LEU B 2 12  ? 184.26400 73.02300 114.76700 1.000 69.41000  ?  12  LEU B CB    1 
ATOM   4552 C  CG    . LEU B 2 12  ? 183.80200 71.63400 115.20000 1.000 70.55000  ?  12  LEU B CG    1 
ATOM   4553 C  CD1   . LEU B 2 12  ? 183.77900 70.70300 114.00000 1.000 67.48000  ?  12  LEU B CD1   1 
ATOM   4554 C  CD2   . LEU B 2 12  ? 184.69200 71.09300 116.30300 1.000 66.35000  ?  12  LEU B CD2   1 
ATOM   4555 N  N     . LYS B 2 13  ? 186.31100 75.37000 114.70200 1.000 77.84000  ?  13  LYS B N     1 
ATOM   4556 C  CA    . LYS B 2 13  ? 186.73400 76.47900 113.86600 1.000 76.58000  ?  13  LYS B CA    1 
ATOM   4557 C  C     . LYS B 2 13  ? 185.71700 76.66900 112.74700 1.000 82.61000  ?  13  LYS B C     1 
ATOM   4558 O  O     . LYS B 2 13  ? 185.17200 75.69800 112.21500 1.000 80.29000  ?  13  LYS B O     1 
ATOM   4559 C  CB    . LYS B 2 13  ? 188.12400 76.23500 113.28700 1.000 76.19000  ?  13  LYS B CB    1 
ATOM   4560 C  CG    . LYS B 2 13  ? 189.26200 76.30200 114.29000 1.000 74.74000  ?  13  LYS B CG    1 
ATOM   4561 C  CD    . LYS B 2 13  ? 190.57900 76.51000 113.54600 1.000 75.34000  ?  13  LYS B CD    1 
ATOM   4562 C  CE    . LYS B 2 13  ? 191.71600 76.87900 114.48000 1.000 78.36000  ?  13  LYS B CE    1 
ATOM   4563 N  NZ    . LYS B 2 13  ? 192.02900 75.78400 115.44200 1.000 86.59000  ?  13  LYS B NZ    1 
ATOM   4564 N  N     . PRO B 2 14  ? 185.45000 77.92700 112.39100 1.000 89.81000  ?  14  PRO B N     1 
ATOM   4565 C  CA    . PRO B 2 14  ? 184.41700 78.23600 111.39600 1.000 86.60000  ?  14  PRO B CA    1 
ATOM   4566 C  C     . PRO B 2 14  ? 184.67600 77.56800 110.04400 1.000 82.07000  ?  14  PRO B C     1 
ATOM   4567 O  O     . PRO B 2 14  ? 185.80000 77.58200 109.55000 1.000 81.44000  ?  14  PRO B O     1 
ATOM   4568 C  CB    . PRO B 2 14  ? 184.48800 79.76400 111.28600 1.000 86.34000  ?  14  PRO B CB    1 
ATOM   4569 C  CG    . PRO B 2 14  ? 185.84200 80.13200 111.82100 1.000 86.92000  ?  14  PRO B CG    1 
ATOM   4570 C  CD    . PRO B 2 14  ? 186.12400 79.13700 112.89000 1.000 85.93000  ?  14  PRO B CD    1 
ATOM   4571 N  N     . GLY B 2 15  ? 183.63600 76.97400 109.46500 1.000 83.42000  ?  15  GLY B N     1 
ATOM   4572 C  CA    . GLY B 2 15  ? 183.74700 76.35200 108.16000 1.000 79.96000  ?  15  GLY B CA    1 
ATOM   4573 C  C     . GLY B 2 15  ? 184.50800 75.04500 108.21800 1.000 81.93000  ?  15  GLY B C     1 
ATOM   4574 O  O     . GLY B 2 15  ? 185.07500 74.59800 107.22300 1.000 81.72000  ?  15  GLY B O     1 
ATOM   4575 N  N     . MET B 2 16  ? 184.52600 74.42600 109.39400 1.000 83.47000  ?  16  MET B N     1 
ATOM   4576 C  CA    . MET B 2 16  ? 185.20500 73.14600 109.55400 1.000 76.67000  ?  16  MET B CA    1 
ATOM   4577 C  C     . MET B 2 16  ? 184.30200 72.07900 110.16500 1.000 69.92000  ?  16  MET B C     1 
ATOM   4578 O  O     . MET B 2 16  ? 183.62400 72.31900 111.16400 1.000 69.02000  ?  16  MET B O     1 
ATOM   4579 C  CB    . MET B 2 16  ? 186.46400 73.32200 110.39400 1.000 72.90000  ?  16  MET B CB    1 
ATOM   4580 C  CG    . MET B 2 16  ? 187.69800 73.40200 109.53900 1.000 74.32000  ?  16  MET B CG    1 
ATOM   4581 S  SD    . MET B 2 16  ? 189.14400 73.80900 110.50200 1.000 87.18000  ?  16  MET B SD    1 
ATOM   4582 C  CE    . MET B 2 16  ? 190.45200 73.19200 109.42100 1.000 79.82000  ?  16  MET B CE    1 
ATOM   4583 N  N     . ASP B 2 17  ? 184.29500 70.90400 109.54100 1.000 68.67000  ?  17  ASP B N     1 
ATOM   4584 C  CA    . ASP B 2 17  ? 183.47400 69.79300 110.00500 1.000 66.70000  ?  17  ASP B CA    1 
ATOM   4585 C  C     . ASP B 2 17  ? 184.27200 68.90500 110.95700 1.000 60.58000  ?  17  ASP B C     1 
ATOM   4586 O  O     . ASP B 2 17  ? 185.48600 69.03200 111.05500 1.000 56.90000  ?  17  ASP B O     1 
ATOM   4587 C  CB    . ASP B 2 17  ? 182.95500 68.96800 108.82100 1.000 65.29000  ?  17  ASP B CB    1 
ATOM   4588 C  CG    . ASP B 2 17  ? 181.62900 68.27000 109.13100 1.000 73.40000  ?  17  ASP B CG    1 
ATOM   4589 O  OD1   . ASP B 2 17  ? 181.12900 68.40300 110.27900 1.000 65.83000  ?  17  ASP B OD1   1 
ATOM   4590 O  OD2   . ASP B 2 17  ? 181.08700 67.59000 108.22600 1.000 74.68000  ?  17  ASP B OD2   1 
ATOM   4591 N  N     . GLY B 2 18  ? 183.57600 68.00300 111.64400 1.000 63.03000  ?  18  GLY B N     1 
ATOM   4592 C  CA    . GLY B 2 18  ? 184.19100 67.09100 112.59600 1.000 58.81000  ?  18  GLY B CA    1 
ATOM   4593 C  C     . GLY B 2 18  ? 185.10700 66.05700 111.96500 1.000 53.26000  ?  18  GLY B C     1 
ATOM   4594 O  O     . GLY B 2 18  ? 185.16600 65.91900 110.75300 1.000 55.40000  ?  18  GLY B O     1 
ATOM   4595 N  N     . PRO B 2 19  ? 185.84500 65.31900 112.79200 1.000 53.54000  ?  19  PRO B N     1 
ATOM   4596 C  CA    . PRO B 2 19  ? 186.75900 64.33000 112.22500 1.000 48.97000  ?  19  PRO B CA    1 
ATOM   4597 C  C     . PRO B 2 19  ? 186.05200 63.08900 111.68400 1.000 51.54000  ?  19  PRO B C     1 
ATOM   4598 O  O     . PRO B 2 19  ? 185.04100 62.60200 112.24100 1.000 48.50000  ?  19  PRO B O     1 
ATOM   4599 C  CB    . PRO B 2 19  ? 187.66100 63.98000 113.40800 1.000 48.20000  ?  19  PRO B CB    1 
ATOM   4600 C  CG    . PRO B 2 19  ? 186.84600 64.25200 114.60500 1.000 50.73000  ?  19  PRO B CG    1 
ATOM   4601 C  CD    . PRO B 2 19  ? 185.98900 65.43300 114.25500 1.000 57.72000  ?  19  PRO B CD    1 
ATOM   4602 N  N     . LYS B 2 20  ? 186.60200 62.58200 110.58300 1.000 49.00000  ?  20  LYS B N     1 
ATOM   4603 C  CA    . LYS B 2 20  ? 186.11300 61.36000 109.96500 1.000 44.11000  ?  20  LYS B CA    1 
ATOM   4604 C  C     . LYS B 2 20  ? 187.27600 60.43900 109.57600 1.000 49.43000  ?  20  LYS B C     1 
ATOM   4605 O  O     . LYS B 2 20  ? 187.48500 60.12900 108.39200 1.000 49.02000  ?  20  LYS B O     1 
ATOM   4606 C  CB    . LYS B 2 20  ? 185.25200 61.70000 108.75600 1.000 42.50000  ?  20  LYS B CB    1 
ATOM   4607 C  CG    . LYS B 2 20  ? 183.95800 62.43200 109.08200 1.000 42.48000  ?  20  LYS B CG    1 
ATOM   4608 C  CD    . LYS B 2 20  ? 183.15900 62.69100 107.81900 1.000 41.96000  ?  20  LYS B CD    1 
ATOM   4609 C  CE    . LYS B 2 20  ? 181.95700 63.59000 108.08400 1.000 49.81000  ?  20  LYS B CE    1 
ATOM   4610 N  NZ    . LYS B 2 20  ? 181.02400 63.64800 106.89700 1.000 51.70000  ?  20  LYS B NZ    1 
ATOM   4611 N  N     . VAL B 2 21  ? 188.01400 60.00000 110.59800 1.000 51.18000  ?  21  VAL B N     1 
ATOM   4612 C  CA    . VAL B 2 21  ? 189.20900 59.16100 110.45600 1.000 48.26000  ?  21  VAL B CA    1 
ATOM   4613 C  C     . VAL B 2 21  ? 188.92100 57.69800 110.77700 1.000 48.48000  ?  21  VAL B C     1 
ATOM   4614 O  O     . VAL B 2 21  ? 188.34400 57.39800 111.81500 1.000 48.56000  ?  21  VAL B O     1 
ATOM   4615 C  CB    . VAL B 2 21  ? 190.33000 59.63900 111.39400 1.000 47.43000  ?  21  VAL B CB    1 
ATOM   4616 C  CG1   . VAL B 2 21  ? 191.65500 58.97400 111.03900 1.000 41.15000  ?  21  VAL B CG1   1 
ATOM   4617 C  CG2   . VAL B 2 21  ? 190.43100 61.16200 111.37300 1.000 43.64000  ?  21  VAL B CG2   1 
ATOM   4618 N  N     . LYS B 2 22  ? 189.32600 56.78500 109.89800 1.000 48.05000  ?  22  LYS B N     1 
ATOM   4619 C  CA    . LYS B 2 22  ? 189.03800 55.36600 110.10900 1.000 45.50000  ?  22  LYS B CA    1 
ATOM   4620 C  C     . LYS B 2 22  ? 189.90500 54.75000 111.19800 1.000 44.57000  ?  22  LYS B C     1 
ATOM   4621 O  O     . LYS B 2 22  ? 191.09700 55.00000 111.28000 1.000 49.75000  ?  22  LYS B O     1 
ATOM   4622 C  CB    . LYS B 2 22  ? 189.21400 54.58000 108.81500 1.000 43.65000  ?  22  LYS B CB    1 
ATOM   4623 C  CG    . LYS B 2 22  ? 188.09500 54.75500 107.82900 1.000 48.64000  ?  22  LYS B CG    1 
ATOM   4624 C  CD    . LYS B 2 22  ? 188.46600 54.13200 106.50100 1.000 59.86000  ?  22  LYS B CD    1 
ATOM   4625 C  CE    . LYS B 2 22  ? 187.54100 52.96300 106.14600 1.000 61.66000  ?  22  LYS B CE    1 
ATOM   4626 N  NZ    . LYS B 2 22  ? 187.72900 52.51000 104.72100 1.000 55.97000  ?  22  LYS B NZ    1 
ATOM   4627 N  N     . GLN B 2 23  ? 189.27800 53.94200 112.04000 1.000 47.73000  ?  23  GLN B N     1 
ATOM   4628 C  CA    . GLN B 2 23  ? 189.96600 53.19300 113.08200 1.000 45.93000  ?  23  GLN B CA    1 
ATOM   4629 C  C     . GLN B 2 23  ? 190.88900 52.16300 112.45600 1.000 46.44000  ?  23  GLN B C     1 
ATOM   4630 O  O     . GLN B 2 23  ? 190.51700 51.50300 111.48400 1.000 47.81000  ?  23  GLN B O     1 
ATOM   4631 C  CB    . GLN B 2 23  ? 188.94400 52.49000 113.98200 1.000 46.41000  ?  23  GLN B CB    1 
ATOM   4632 C  CG    . GLN B 2 23  ? 189.53700 51.45400 114.89900 1.000 42.69000  ?  23  GLN B CG    1 
ATOM   4633 C  CD    . GLN B 2 23  ? 190.26200 52.08800 116.04300 1.000 44.47000  ?  23  GLN B CD    1 
ATOM   4634 O  OE1   . GLN B 2 23  ? 189.78600 53.06000 116.62700 1.000 49.09000  ?  23  GLN B OE1   1 
ATOM   4635 N  NE2   . GLN B 2 23  ? 191.42300 51.55800 116.37300 1.000 50.30000  ?  23  GLN B NE2   1 
ATOM   4636 N  N     . TRP B 2 24  ? 192.07500 51.97900 113.01500 1.000 46.59000  ?  24  TRP B N     1 
ATOM   4637 C  CA    . TRP B 2 24  ? 192.97700 51.01200 112.41000 1.000 45.28000  ?  24  TRP B CA    1 
ATOM   4638 C  C     . TRP B 2 24  ? 192.95000 49.67800 113.14900 1.000 46.58000  ?  24  TRP B C     1 
ATOM   4639 O  O     . TRP B 2 24  ? 192.30600 49.53600 114.17900 1.000 45.86000  ?  24  TRP B O     1 
ATOM   4640 C  CB    . TRP B 2 24  ? 194.38800 51.57900 112.33800 1.000 47.91000  ?  24  TRP B CB    1 
ATOM   4641 C  CG    . TRP B 2 24  ? 194.93600 52.11100 113.60800 1.000 47.30000  ?  24  TRP B CG    1 
ATOM   4642 C  CD1   . TRP B 2 24  ? 195.35700 51.38400 114.68100 1.000 53.41000  ?  24  TRP B CD1   1 
ATOM   4643 C  CD2   . TRP B 2 24  ? 195.18700 53.48600 113.92600 1.000 42.92000  ?  24  TRP B CD2   1 
ATOM   4644 N  NE1   . TRP B 2 24  ? 195.84100 52.22200 115.66700 1.000 54.61000  ?  24  TRP B NE1   1 
ATOM   4645 C  CE2   . TRP B 2 24  ? 195.75000 53.51500 115.23000 1.000 53.07000  ?  24  TRP B CE2   1 
ATOM   4646 C  CE3   . TRP B 2 24  ? 194.98700 54.68200 113.25000 1.000 35.98000  ?  24  TRP B CE3   1 
ATOM   4647 C  CZ2   . TRP B 2 24  ? 196.11500 54.71800 115.87000 1.000 46.56000  ?  24  TRP B CZ2   1 
ATOM   4648 C  CZ3   . TRP B 2 24  ? 195.35300 55.86700 113.88400 1.000 46.89000  ?  24  TRP B CZ3   1 
ATOM   4649 C  CH2   . TRP B 2 24  ? 195.90800 55.87500 115.18500 1.000 40.65000  ?  24  TRP B CH2   1 
ATOM   4650 N  N     . PRO B 2 25  ? 193.59200 48.65800 112.58900 1.000 50.82000  ?  25  PRO B N     1 
ATOM   4651 C  CA    . PRO B 2 25  ? 193.43900 47.37500 113.28800 1.000 49.26000  ?  25  PRO B CA    1 
ATOM   4652 C  C     . PRO B 2 25  ? 194.24500 47.32800 114.57300 1.000 51.14000  ?  25  PRO B C     1 
ATOM   4653 O  O     . PRO B 2 25  ? 195.33600 47.90000 114.66600 1.000 54.56000  ?  25  PRO B O     1 
ATOM   4654 C  CB    . PRO B 2 25  ? 193.93500 46.35100 112.26600 1.000 45.41000  ?  25  PRO B CB    1 
ATOM   4655 C  CG    . PRO B 2 25  ? 194.63900 47.12800 111.23200 1.000 45.43000  ?  25  PRO B CG    1 
ATOM   4656 C  CD    . PRO B 2 25  ? 194.07800 48.49800 111.21700 1.000 42.79000  ?  25  PRO B CD    1 
ATOM   4657 N  N     . LEU B 2 26  ? 193.67700 46.67100 115.57100 1.000 48.97000  ?  26  LEU B N     1 
ATOM   4658 C  CA    . LEU B 2 26  ? 194.25100 46.63700 116.90400 1.000 46.34000  ?  26  LEU B CA    1 
ATOM   4659 C  C     . LEU B 2 26  ? 194.60000 45.21600 117.26200 1.000 49.33000  ?  26  LEU B C     1 
ATOM   4660 O  O     . LEU B 2 26  ? 193.92700 44.30200 116.79500 1.000 45.75000  ?  26  LEU B O     1 
ATOM   4661 C  CB    . LEU B 2 26  ? 193.26900 47.18800 117.93100 1.000 46.47000  ?  26  LEU B CB    1 
ATOM   4662 C  CG    . LEU B 2 26  ? 193.03800 48.69600 117.88800 1.000 50.82000  ?  26  LEU B CG    1 
ATOM   4663 C  CD1   . LEU B 2 26  ? 192.18200 49.14800 119.07300 1.000 46.92000  ?  26  LEU B CD1   1 
ATOM   4664 C  CD2   . LEU B 2 26  ? 194.37100 49.40700 117.85900 1.000 48.18000  ?  26  LEU B CD2   1 
ATOM   4665 N  N     . THR B 2 27  ? 195.61600 45.02200 118.10600 1.000 44.13000  ?  27  THR B N     1 
ATOM   4666 C  CA    . THR B 2 27  ? 195.93100 43.68500 118.57600 1.000 39.87000  ?  27  THR B CA    1 
ATOM   4667 C  C     . THR B 2 27  ? 194.90500 43.23100 119.59100 1.000 45.36000  ?  27  THR B C     1 
ATOM   4668 O  O     . THR B 2 27  ? 194.17800 44.03900 120.16500 1.000 48.21000  ?  27  THR B O     1 
ATOM   4669 C  CB    . THR B 2 27  ? 197.31500 43.59000 119.22400 1.000 47.88000  ?  27  THR B CB    1 
ATOM   4670 O  OG1   . THR B 2 27  ? 197.39100 44.49500 120.33300 1.000 49.15000  ?  27  THR B OG1   1 
ATOM   4671 C  CG2   . THR B 2 27  ? 198.41200 43.89500 118.22500 1.000 45.56000  ?  27  THR B CG2   1 
ATOM   4672 N  N     . GLU B 2 28  ? 194.86200 41.92400 119.81300 1.000 48.01000  ?  28  GLU B N     1 
ATOM   4673 C  CA    . GLU B 2 28  ? 193.91200 41.32300 120.73100 1.000 50.54000  ?  28  GLU B CA    1 
ATOM   4674 C  C     . GLU B 2 28  ? 194.10800 41.89600 122.11300 1.000 47.29000  ?  28  GLU B C     1 
ATOM   4675 O  O     . GLU B 2 28  ? 193.15200 42.32300 122.74800 1.000 51.01000  ?  28  GLU B O     1 
ATOM   4676 C  CB    . GLU B 2 28  ? 194.06900 39.80300 120.74100 1.000 52.62000  ?  28  GLU B CB    1 
ATOM   4677 C  CG    . GLU B 2 28  ? 193.14200 39.08500 121.70700 1.000 55.03000  ?  28  GLU B CG    1 
ATOM   4678 C  CD    . GLU B 2 28  ? 192.98800 37.60600 121.37000 1.000 62.52000  ?  28  GLU B CD    1 
ATOM   4679 O  OE1   . GLU B 2 28  ? 191.86300 37.08000 121.52900 1.000 66.20000  ?  28  GLU B OE1   1 
ATOM   4680 O  OE2   . GLU B 2 28  ? 193.98200 36.97400 120.93800 1.000 62.15000  ?  28  GLU B OE2   1 
ATOM   4681 N  N     . GLU B 2 29  ? 195.35300 41.91800 122.57000 1.000 47.14000  ?  29  GLU B N     1 
ATOM   4682 C  CA    . GLU B 2 29  ? 195.69700 42.57100 123.83600 1.000 51.31000  ?  29  GLU B CA    1 
ATOM   4683 C  C     . GLU B 2 29  ? 195.11800 43.96600 123.98400 1.000 50.60000  ?  29  GLU B C     1 
ATOM   4684 O  O     . GLU B 2 29  ? 194.48500 44.27700 124.99200 1.000 51.74000  ?  29  GLU B O     1 
ATOM   4685 C  CB    . GLU B 2 29  ? 197.19800 42.67800 123.98700 1.000 53.06000  ?  29  GLU B CB    1 
ATOM   4686 C  CG    . GLU B 2 29  ? 197.85000 41.50200 124.61600 1.000 60.14000  ?  29  GLU B CG    1 
ATOM   4687 C  CD    . GLU B 2 29  ? 199.33700 41.74800 124.77500 1.000 82.63000  ?  29  GLU B CD    1 
ATOM   4688 O  OE1   . GLU B 2 29  ? 199.79500 42.83000 124.31400 1.000 79.75000  ?  29  GLU B OE1   1 
ATOM   4689 O  OE2   . GLU B 2 29  ? 200.03900 40.87600 125.34900 1.000 89.66000  ?  29  GLU B OE2   1 
ATOM   4690 N  N     . LYS B 2 30  ? 195.36800 44.80900 122.98600 1.000 47.44000  ?  30  LYS B N     1 
ATOM   4691 C  CA    . LYS B 2 30  ? 194.89400 46.18500 123.01200 1.000 49.79000  ?  30  LYS B CA    1 
ATOM   4692 C  C     . LYS B 2 30  ? 193.37400 46.26000 123.00400 1.000 49.00000  ?  30  LYS B C     1 
ATOM   4693 O  O     . LYS B 2 30  ? 192.79000 47.13100 123.65400 1.000 48.02000  ?  30  LYS B O     1 
ATOM   4694 C  CB    . LYS B 2 30  ? 195.46100 46.98200 121.83100 1.000 46.06000  ?  30  LYS B CB    1 
ATOM   4695 C  CG    . LYS B 2 30  ? 196.89300 47.44600 122.02200 1.000 47.79000  ?  30  LYS B CG    1 
ATOM   4696 C  CD    . LYS B 2 30  ? 197.41500 48.08700 120.75500 1.000 52.60000  ?  30  LYS B CD    1 
ATOM   4697 C  CE    . LYS B 2 30  ? 198.92800 48.08700 120.67300 1.000 57.16000  ?  30  LYS B CE    1 
ATOM   4698 N  NZ    . LYS B 2 30  ? 199.48100 49.34500 121.25800 1.000 64.32000  ?  30  LYS B NZ    1 
ATOM   4699 N  N     . ILE B 2 31  ? 192.73200 45.35400 122.26800 1.000 48.54000  ?  31  ILE B N     1 
ATOM   4700 C  CA    . ILE B 2 31  ? 191.26900 45.37000 122.17100 1.000 49.65000  ?  31  ILE B CA    1 
ATOM   4701 C  C     . ILE B 2 31  ? 190.62100 44.93600 123.47500 1.000 48.63000  ?  31  ILE B C     1 
ATOM   4702 O  O     . ILE B 2 31  ? 189.67600 45.57300 123.93900 1.000 48.85000  ?  31  ILE B O     1 
ATOM   4703 C  CB    . ILE B 2 31  ? 190.74400 44.46900 121.03500 1.000 51.11000  ?  31  ILE B CB    1 
ATOM   4704 C  CG1   . ILE B 2 31  ? 191.11400 45.06600 119.67900 1.000 44.36000  ?  31  ILE B CG1   1 
ATOM   4705 C  CG2   . ILE B 2 31  ? 189.21500 44.24300 121.17700 1.000 41.30000  ?  31  ILE B CG2   1 
ATOM   4706 C  CD1   . ILE B 2 31  ? 190.97200 44.09400 118.55600 1.000 42.84000  ?  31  ILE B CD1   1 
ATOM   4707 N  N     . LYS B 2 32  ? 191.13000 43.86000 124.06500 1.000 47.98000  ?  32  LYS B N     1 
ATOM   4708 C  CA    . LYS B 2 32  ? 190.63400 43.41400 125.36200 1.000 44.46000  ?  32  LYS B CA    1 
ATOM   4709 C  C     . LYS B 2 32  ? 190.78800 44.50500 126.39000 1.000 45.13000  ?  32  LYS B C     1 
ATOM   4710 O  O     . LYS B 2 32  ? 189.88100 44.75100 127.17800 1.000 52.74000  ?  32  LYS B O     1 
ATOM   4711 C  CB    . LYS B 2 32  ? 191.35300 42.15600 125.81900 1.000 47.84000  ?  32  LYS B CB    1 
ATOM   4712 C  CG    . LYS B 2 32  ? 190.92600 40.90900 125.07500 1.000 51.97000  ?  32  LYS B CG    1 
ATOM   4713 C  CD    . LYS B 2 32  ? 191.70600 39.70000 125.55500 1.000 58.84000  ?  32  LYS B CD    1 
ATOM   4714 C  CE    . LYS B 2 32  ? 191.12100 38.42100 124.98000 1.000 67.05000  ?  32  LYS B CE    1 
ATOM   4715 N  NZ    . LYS B 2 32  ? 191.24800 37.27800 125.93000 1.000 69.62000  ?  32  LYS B NZ    1 
ATOM   4716 N  N     . ALA B 2 33  ? 191.92000 45.19000 126.37600 1.000 46.49000  ?  33  ALA B N     1 
ATOM   4717 C  CA    . ALA B 2 33  ? 192.10000 46.29900 127.29700 1.000 46.44000  ?  33  ALA B CA    1 
ATOM   4718 C  C     . ALA B 2 33  ? 191.08300 47.41200 127.04000 1.000 50.53000  ?  33  ALA B C     1 
ATOM   4719 O  O     . ALA B 2 33  ? 190.44700 47.90800 127.96400 1.000 50.06000  ?  33  ALA B O     1 
ATOM   4720 C  CB    . ALA B 2 33  ? 193.50100 46.83200 127.20100 1.000 51.00000  ?  33  ALA B CB    1 
ATOM   4721 N  N     . LEU B 2 34  ? 190.91900 47.79600 125.77600 1.000 51.98000  ?  34  LEU B N     1 
ATOM   4722 C  CA    . LEU B 2 34  ? 189.99500 48.86600 125.42900 1.000 46.75000  ?  34  LEU B CA    1 
ATOM   4723 C  C     . LEU B 2 34  ? 188.56400 48.57000 125.80200 1.000 48.69000  ?  34  LEU B C     1 
ATOM   4724 O  O     . LEU B 2 34  ? 187.86000 49.46800 126.22100 1.000 53.38000  ?  34  LEU B O     1 
ATOM   4725 C  CB    . LEU B 2 34  ? 190.06100 49.16500 123.94600 1.000 45.68000  ?  34  LEU B CB    1 
ATOM   4726 C  CG    . LEU B 2 34  ? 191.27000 50.01600 123.63100 1.000 48.19000  ?  34  LEU B CG    1 
ATOM   4727 C  CD1   . LEU B 2 34  ? 191.41600 50.09600 122.13300 1.000 50.51000  ?  34  LEU B CD1   1 
ATOM   4728 C  CD2   . LEU B 2 34  ? 191.08500 51.38000 124.23700 1.000 42.61000  ?  34  LEU B CD2   1 
ATOM   4729 N  N     . VAL B 2 35  ? 188.13400 47.32000 125.63600 1.000 47.55000  ?  35  VAL B N     1 
ATOM   4730 C  CA    . VAL B 2 35  ? 186.76500 46.92500 125.95300 1.000 48.25000  ?  35  VAL B CA    1 
ATOM   4731 C  C     . VAL B 2 35  ? 186.55400 46.90600 127.46500 1.000 50.22000  ?  35  VAL B C     1 
ATOM   4732 O  O     . VAL B 2 35  ? 185.49200 47.22600 127.98200 1.000 50.91000  ?  35  VAL B O     1 
ATOM   4733 C  CB    . VAL B 2 35  ? 186.42000 45.52800 125.36700 1.000 46.10000  ?  35  VAL B CB    1 
ATOM   4734 C  CG1   . VAL B 2 35  ? 185.11400 44.97900 125.96800 1.000 36.07000  ?  35  VAL B CG1   1 
ATOM   4735 C  CG2   . VAL B 2 35  ? 186.32900 45.59400 123.87000 1.000 38.18000  ?  35  VAL B CG2   1 
ATOM   4736 N  N     . GLU B 2 36  ? 187.59100 46.52300 128.18000 1.000 54.92000  ?  36  GLU B N     1 
ATOM   4737 C  CA    . GLU B 2 36  ? 187.51600 46.50500 129.62400 1.000 52.88000  ?  36  GLU B CA    1 
ATOM   4738 C  C     . GLU B 2 36  ? 187.39700 47.92100 130.16900 1.000 57.53000  ?  36  GLU B C     1 
ATOM   4739 O  O     . GLU B 2 36  ? 186.46500 48.22600 130.91400 1.000 60.33000  ?  36  GLU B O     1 
ATOM   4740 C  CB    . GLU B 2 36  ? 188.74000 45.82200 130.17800 1.000 55.95000  ?  36  GLU B CB    1 
ATOM   4741 C  CG    . GLU B 2 36  ? 188.49600 45.08400 131.42800 1.000 63.24000  ?  36  GLU B CG    1 
ATOM   4742 C  CD    . GLU B 2 36  ? 189.78200 44.83300 132.12500 1.000 75.23000  ?  36  GLU B CD    1 
ATOM   4743 O  OE1   . GLU B 2 36  ? 190.03000 45.56600 133.10900 1.000 89.79000  ?  36  GLU B OE1   1 
ATOM   4744 O  OE2   . GLU B 2 36  ? 190.54500 43.93900 131.67300 1.000 68.46000  ?  36  GLU B OE2   1 
ATOM   4745 N  N     . ILE B 2 37  ? 188.34000 48.78000 129.77900 1.000 53.18000  ?  37  ILE B N     1 
ATOM   4746 C  CA    . ILE B 2 37  ? 188.31500 50.19500 130.12400 1.000 50.61000  ?  37  ILE B CA    1 
ATOM   4747 C  C     . ILE B 2 37  ? 186.99200 50.88200 129.72800 1.000 54.24000  ?  37  ILE B C     1 
ATOM   4748 O  O     . ILE B 2 37  ? 186.39400 51.62300 130.51900 1.000 57.86000  ?  37  ILE B O     1 
ATOM   4749 C  CB    . ILE B 2 37  ? 189.48000 50.92600 129.45700 1.000 43.24000  ?  37  ILE B CB    1 
ATOM   4750 C  CG1   . ILE B 2 37  ? 190.80700 50.48600 130.06100 1.000 46.84000  ?  37  ILE B CG1   1 
ATOM   4751 C  CG2   . ILE B 2 37  ? 189.33200 52.41500 129.58200 1.000 45.00000  ?  37  ILE B CG2   1 
ATOM   4752 C  CD1   . ILE B 2 37  ? 192.03900 50.88600 129.20300 1.000 49.07000  ?  37  ILE B CD1   1 
ATOM   4753 N  N     . CYS B 2 38  ? 186.52200 50.63100 128.51600 1.000 50.45000  ?  38  CYS B N     1 
ATOM   4754 C  CA    . CYS B 2 38  ? 185.31900 51.31800 128.04400 1.000 55.18000  ?  38  CYS B CA    1 
ATOM   4755 C  C     . CYS B 2 38  ? 184.02800 50.88800 128.75300 1.000 55.36000  ?  38  CYS B C     1 
ATOM   4756 O  O     . CYS B 2 38  ? 183.17700 51.72700 129.04300 1.000 55.11000  ?  38  CYS B O     1 
ATOM   4757 C  CB    . CYS B 2 38  ? 185.16000 51.13600 126.53500 1.000 53.82000  ?  38  CYS B CB    1 
ATOM   4758 S  SG    . CYS B 2 38  ? 186.32000 52.15200 125.58500 1.000 57.74000  ?  38  CYS B SG    1 
ATOM   4759 N  N     . THR B 2 39  ? 183.86200 49.60400 129.04300 1.000 53.58000  ?  39  THR B N     1 
ATOM   4760 C  CA    . THR B 2 39  ? 182.63500 49.21300 129.70800 1.000 57.65000  ?  39  THR B CA    1 
ATOM   4761 C  C     . THR B 2 39  ? 182.59300 49.87500 131.09500 1.000 61.10000  ?  39  THR B C     1 
ATOM   4762 O  O     . THR B 2 39  ? 181.54700 50.35400 131.53200 1.000 64.91000  ?  39  THR B O     1 
ATOM   4763 C  CB    . THR B 2 39  ? 182.49500 47.69100 129.82200 1.000 60.81000  ?  39  THR B CB    1 
ATOM   4764 O  OG1   . THR B 2 39  ? 183.39000 47.20700 130.81600 1.000 66.80000  ?  39  THR B OG1   1 
ATOM   4765 C  CG2   . THR B 2 39  ? 182.79100 47.01500 128.49300 1.000 54.43000  ?  39  THR B CG2   1 
ATOM   4766 N  N     . GLU B 2 40  ? 183.74600 49.94300 131.75700 1.000 62.18000  ?  40  GLU B N     1 
ATOM   4767 C  CA    . GLU B 2 40  ? 183.88100 50.67200 133.01700 1.000 61.64000  ?  40  GLU B CA    1 
ATOM   4768 C  C     . GLU B 2 40  ? 183.60500 52.16300 132.86100 1.000 62.06000  ?  40  GLU B C     1 
ATOM   4769 O  O     . GLU B 2 40  ? 182.76200 52.70300 133.56800 1.000 63.27000  ?  40  GLU B O     1 
ATOM   4770 C  CB    . GLU B 2 40  ? 185.26600 50.46500 133.59800 1.000 58.23000  ?  40  GLU B CB    1 
ATOM   4771 C  CG    . GLU B 2 40  ? 185.51600 51.15800 134.91800 1.000 65.77000  ?  40  GLU B CG    1 
ATOM   4772 C  CD    . GLU B 2 40  ? 186.98200 51.03800 135.38000 1.000 89.09000  ?  40  GLU B CD    1 
ATOM   4773 O  OE1   . GLU B 2 40  ? 187.81300 50.42600 134.65700 1.000 90.94000  ?  40  GLU B OE1   1 
ATOM   4774 O  OE2   . GLU B 2 40  ? 187.31400 51.56100 136.47100 1.000 97.31000  ?  40  GLU B OE2   1 
ATOM   4775 N  N     . MET B 2 41  ? 184.29700 52.83800 131.94700 1.000 58.37000  ?  41  MET B N     1 
ATOM   4776 C  CA    . MET B 2 41  ? 183.94700 54.23300 131.66100 1.000 58.76000  ?  41  MET B CA    1 
ATOM   4777 C  C     . MET B 2 41  ? 182.45600 54.41600 131.37500 1.000 56.94000  ?  41  MET B C     1 
ATOM   4778 O  O     . MET B 2 41  ? 181.87500 55.45500 131.66600 1.000 56.79000  ?  41  MET B O     1 
ATOM   4779 C  CB    . MET B 2 41  ? 184.73500 54.76900 130.47400 1.000 52.78000  ?  41  MET B CB    1 
ATOM   4780 C  CG    . MET B 2 41  ? 186.20400 54.88400 130.71700 1.000 55.56000  ?  41  MET B CG    1 
ATOM   4781 S  SD    . MET B 2 41  ? 187.02600 55.60900 129.29500 1.000 63.62000  ?  41  MET B SD    1 
ATOM   4782 C  CE    . MET B 2 41  ? 186.83500 57.35600 129.64400 1.000 61.09000  ?  41  MET B CE    1 
ATOM   4783 N  N     . GLU B 2 42  ? 181.83700 53.41300 130.77700 1.000 59.73000  ?  42  GLU B N     1 
ATOM   4784 C  CA    . GLU B 2 42  ? 180.43400 53.53300 130.44900 1.000 57.33000  ?  42  GLU B CA    1 
ATOM   4785 C  C     . GLU B 2 42  ? 179.61200 53.43600 131.73800 1.000 58.66000  ?  42  GLU B C     1 
ATOM   4786 O  O     . GLU B 2 42  ? 178.63300 54.16900 131.91500 1.000 58.17000  ?  42  GLU B O     1 
ATOM   4787 C  CB    . GLU B 2 42  ? 180.01900 52.46300 129.44700 1.000 55.67000  ?  42  GLU B CB    1 
ATOM   4788 C  CG    . GLU B 2 42  ? 178.60500 52.63900 128.94900 1.000 57.53000  ?  42  GLU B CG    1 
ATOM   4789 C  CD    . GLU B 2 42  ? 178.07100 51.40600 128.24200 1.000 64.13000  ?  42  GLU B CD    1 
ATOM   4790 O  OE1   . GLU B 2 42  ? 176.94100 51.48200 127.70900 1.000 70.65000  ?  42  GLU B OE1   1 
ATOM   4791 O  OE2   . GLU B 2 42  ? 178.76800 50.36600 128.21800 1.000 64.29000  ?  42  GLU B OE2   1 
ATOM   4792 N  N     . LYS B 2 43  ? 180.01600 52.54300 132.64000 1.000 56.30000  ?  43  LYS B N     1 
ATOM   4793 C  CA    . LYS B 2 43  ? 179.36700 52.44100 133.95000 1.000 54.82000  ?  43  LYS B CA    1 
ATOM   4794 C  C     . LYS B 2 43  ? 179.42800 53.75100 134.71900 1.000 59.16000  ?  43  LYS B C     1 
ATOM   4795 O  O     . LYS B 2 43  ? 178.51900 54.05800 135.47600 1.000 67.89000  ?  43  LYS B O     1 
ATOM   4796 C  CB    . LYS B 2 43  ? 179.99800 51.33800 134.80600 1.000 58.37000  ?  43  LYS B CB    1 
ATOM   4797 C  CG    . LYS B 2 43  ? 179.67400 49.91800 134.34200 1.000 66.39000  ?  43  LYS B CG    1 
ATOM   4798 C  CD    . LYS B 2 43  ? 180.28300 48.85300 135.26300 1.000 65.69000  ?  43  LYS B CD    1 
ATOM   4799 C  CE    . LYS B 2 43  ? 180.00700 47.44000 134.74600 1.000 65.07000  ?  43  LYS B CE    1 
ATOM   4800 N  NZ    . LYS B 2 43  ? 180.46500 46.38300 135.70700 1.000 67.80000  ?  43  LYS B NZ    1 
ATOM   4801 N  N     . GLU B 2 44  ? 180.49400 54.52200 134.53100 1.000 55.14000  ?  44  GLU B N     1 
ATOM   4802 C  CA    . GLU B 2 44  ? 180.67300 55.76200 135.27300 1.000 54.28000  ?  44  GLU B CA    1 
ATOM   4803 C  C     . GLU B 2 44  ? 180.09500 56.98100 134.55200 1.000 60.28000  ?  44  GLU B C     1 
ATOM   4804 O  O     . GLU B 2 44  ? 180.34300 58.11600 134.95900 1.000 65.42000  ?  44  GLU B O     1 
ATOM   4805 C  CB    . GLU B 2 44  ? 182.15900 55.99500 135.56100 1.000 54.30000  ?  44  GLU B CB    1 
ATOM   4806 C  CG    . GLU B 2 44  ? 182.76000 54.94100 136.45500 1.000 59.11000  ?  44  GLU B CG    1 
ATOM   4807 C  CD    . GLU B 2 44  ? 184.20900 54.65100 136.12300 1.000 72.41000  ?  44  GLU B CD    1 
ATOM   4808 O  OE1   . GLU B 2 44  ? 184.83000 53.81800 136.81500 1.000 70.78000  ?  44  GLU B OE1   1 
ATOM   4809 O  OE2   . GLU B 2 44  ? 184.73100 55.24600 135.15800 1.000 76.22000  ?  44  GLU B OE2   1 
ATOM   4810 N  N     . GLY B 2 45  ? 179.33200 56.76400 133.48800 1.000 49.55000  ?  45  GLY B N     1 
ATOM   4811 C  CA    . GLY B 2 45  ? 178.78600 57.87900 132.73600 1.000 49.57000  ?  45  GLY B CA    1 
ATOM   4812 C  C     . GLY B 2 45  ? 179.74500 58.71000 131.88700 1.000 59.09000  ?  45  GLY B C     1 
ATOM   4813 O  O     . GLY B 2 45  ? 179.32400 59.63000 131.16800 1.000 58.51000  ?  45  GLY B O     1 
ATOM   4814 N  N     . LYS B 2 46  ? 181.03400 58.39300 131.94700 1.000 58.70000  ?  46  LYS B N     1 
ATOM   4815 C  CA    . LYS B 2 46  ? 182.01600 59.16400 131.19600 1.000 59.17000  ?  46  LYS B CA    1 
ATOM   4816 C  C     . LYS B 2 46  ? 181.84100 58.98900 129.66800 1.000 55.60000  ?  46  LYS B C     1 
ATOM   4817 O  O     . LYS B 2 46  ? 182.03100 59.94100 128.90600 1.000 55.15000  ?  46  LYS B O     1 
ATOM   4818 C  CB    . LYS B 2 46  ? 183.42300 58.79200 131.66200 1.000 60.21000  ?  46  LYS B CB    1 
ATOM   4819 C  CG    . LYS B 2 46  ? 183.75200 59.35700 133.04700 1.000 63.27000  ?  46  LYS B CG    1 
ATOM   4820 C  CD    . LYS B 2 46  ? 184.40400 58.33400 133.97800 1.000 67.09000  ?  46  LYS B CD    1 
ATOM   4821 C  CE    . LYS B 2 46  ? 185.79500 57.87300 133.47100 1.000 74.33000  ?  46  LYS B CE    1 
ATOM   4822 N  NZ    . LYS B 2 46  ? 186.64700 57.11000 134.48300 1.000 66.70000  ?  46  LYS B NZ    1 
ATOM   4823 N  N     . ILE B 2 47  ? 181.43400 57.80200 129.22000 1.000 56.17000  ?  47  ILE B N     1 
ATOM   4824 C  CA    . ILE B 2 47  ? 181.09900 57.61300 127.79900 1.000 56.16000  ?  47  ILE B CA    1 
ATOM   4825 C  C     . ILE B 2 47  ? 179.71200 57.00200 127.57000 1.000 56.68000  ?  47  ILE B C     1 
ATOM   4826 O  O     . ILE B 2 47  ? 179.16200 56.35300 128.46200 1.000 61.37000  ?  47  ILE B O     1 
ATOM   4827 C  CB    . ILE B 2 47  ? 182.12900 56.70800 127.08500 1.000 53.60000  ?  47  ILE B CB    1 
ATOM   4828 C  CG1   . ILE B 2 47  ? 182.09500 55.30000 127.69000 1.000 55.41000  ?  47  ILE B CG1   1 
ATOM   4829 C  CG2   . ILE B 2 47  ? 183.51800 57.35500 127.10300 1.000 51.11000  ?  47  ILE B CG2   1 
ATOM   4830 C  CD1   . ILE B 2 47  ? 183.06500 54.32300 127.06400 1.000 53.92000  ?  47  ILE B CD1   1 
ATOM   4831 N  N     . SER B 2 48  ? 179.16400 57.19200 126.37000 1.000 52.53000  ?  48  SER B N     1 
ATOM   4832 C  CA    . SER B 2 48  ? 177.87800 56.58900 125.98800 1.000 52.51000  ?  48  SER B CA    1 
ATOM   4833 C  C     . SER B 2 48  ? 177.95300 55.86100 124.66000 1.000 51.15000  ?  48  SER B C     1 
ATOM   4834 O  O     . SER B 2 48  ? 178.58600 56.37000 123.74500 1.000 54.12000  ?  48  SER B O     1 
ATOM   4835 C  CB    . SER B 2 48  ? 176.79100 57.65500 125.86400 1.000 48.93000  ?  48  SER B CB    1 
ATOM   4836 O  OG    . SER B 2 48  ? 176.49900 58.26600 127.09500 1.000 52.82000  ?  48  SER B OG    1 
ATOM   4837 N  N     . LYS B 2 49  ? 177.27100 54.72000 124.51700 1.000 52.30000  ?  49  LYS B N     1 
ATOM   4838 C  CA    . LYS B 2 49  ? 177.14200 54.08500 123.18500 1.000 53.64000  ?  49  LYS B CA    1 
ATOM   4839 C  C     . LYS B 2 49  ? 176.38200 54.99000 122.22000 1.000 46.58000  ?  49  LYS B C     1 
ATOM   4840 O  O     . LYS B 2 49  ? 175.43700 55.66000 122.60100 1.000 45.89000  ?  49  LYS B O     1 
ATOM   4841 C  CB    . LYS B 2 49  ? 176.46100 52.71100 123.26600 1.000 43.42000  ?  49  LYS B CB    1 
ATOM   4842 C  CG    . LYS B 2 49  ? 177.24800 51.75800 124.12300 1.000 54.31000  ?  49  LYS B CG    1 
ATOM   4843 C  CD    . LYS B 2 49  ? 176.99600 50.28800 123.86300 1.000 51.79000  ?  49  LYS B CD    1 
ATOM   4844 C  CE    . LYS B 2 49  ? 178.02900 49.47200 124.65300 1.000 55.25000  ?  49  LYS B CE    1 
ATOM   4845 N  NZ    . LYS B 2 49  ? 177.97300 48.01300 124.39600 1.000 67.87000  ?  49  LYS B NZ    1 
ATOM   4846 N  N     . ILE B 2 50  ? 176.84200 55.04400 120.98000 1.000 48.79000  ?  50  ILE B N     1 
ATOM   4847 C  CA    . ILE B 2 50  ? 176.17000 55.83600 119.96100 1.000 53.23000  ?  50  ILE B CA    1 
ATOM   4848 C  C     . ILE B 2 50  ? 175.87600 54.97100 118.75800 1.000 48.76000  ?  50  ILE B C     1 
ATOM   4849 O  O     . ILE B 2 50  ? 176.30600 53.82900 118.68700 1.000 51.77000  ?  50  ILE B O     1 
ATOM   4850 C  CB    . ILE B 2 50  ? 177.00800 57.05900 119.51200 1.000 54.23000  ?  50  ILE B CB    1 
ATOM   4851 C  CG1   . ILE B 2 50  ? 178.39300 56.61600 119.01800 1.000 52.02000  ?  50  ILE B CG1   1 
ATOM   4852 C  CG2   . ILE B 2 50  ? 177.11600 58.07100 120.63500 1.000 48.80000  ?  50  ILE B CG2   1 
ATOM   4853 C  CD1   . ILE B 2 50  ? 179.31800 57.77700 118.68000 1.000 49.03000  ?  50  ILE B CD1   1 
ATOM   4854 N  N     . GLY B 2 51  ? 175.14500 55.51800 117.80500 1.000 47.06000  ?  51  GLY B N     1 
ATOM   4855 C  CA    . GLY B 2 51  ? 174.83500 54.75200 116.62800 1.000 44.76000  ?  51  GLY B CA    1 
ATOM   4856 C  C     . GLY B 2 51  ? 175.65600 55.22700 115.45900 1.000 49.28000  ?  51  GLY B C     1 
ATOM   4857 O  O     . GLY B 2 51  ? 176.59500 56.00200 115.62200 1.000 49.62000  ?  51  GLY B O     1 
ATOM   4858 N  N     . PRO B 2 52  ? 175.29800 54.76600 114.25900 1.000 50.26000  ?  52  PRO B N     1 
ATOM   4859 C  CA    . PRO B 2 52  ? 175.99600 55.18300 113.04500 1.000 47.73000  ?  52  PRO B CA    1 
ATOM   4860 C  C     . PRO B 2 52  ? 175.39900 56.43800 112.40600 1.000 52.76000  ?  52  PRO B C     1 
ATOM   4861 O  O     . PRO B 2 52  ? 175.88600 56.86800 111.34700 1.000 52.96000  ?  52  PRO B O     1 
ATOM   4862 C  CB    . PRO B 2 52  ? 175.82900 53.97500 112.12900 1.000 48.36000  ?  52  PRO B CB    1 
ATOM   4863 C  CG    . PRO B 2 52  ? 174.53100 53.37900 112.53200 1.000 46.03000  ?  52  PRO B CG    1 
ATOM   4864 C  CD    . PRO B 2 52  ? 174.30900 53.70600 113.99800 1.000 41.68000  ?  52  PRO B CD    1 
ATOM   4865 N  N     . GLU B 2 53  ? 174.36300 57.01500 113.01300 1.000 49.86000  ?  53  GLU B N     1 
ATOM   4866 C  CA    . GLU B 2 53  ? 173.81800 58.25600 112.47300 1.000 51.88000  ?  53  GLU B CA    1 
ATOM   4867 C  C     . GLU B 2 53  ? 174.73000 59.43300 112.82200 1.000 49.15000  ?  53  GLU B C     1 
ATOM   4868 O  O     . GLU B 2 53  ? 174.69500 60.45300 112.14400 1.000 52.73000  ?  53  GLU B O     1 
ATOM   4869 C  CB    . GLU B 2 53  ? 172.39200 58.50500 112.96300 1.000 49.48000  ?  53  GLU B CB    1 
ATOM   4870 C  CG    . GLU B 2 53  ? 172.25800 58.94600 114.39900 1.000 48.93000  ?  53  GLU B CG    1 
ATOM   4871 C  CD    . GLU B 2 53  ? 172.39800 57.79600 115.35100 1.000 54.34000  ?  53  GLU B CD    1 
ATOM   4872 O  OE1   . GLU B 2 53  ? 172.98500 56.77600 114.92300 1.000 51.84000  ?  53  GLU B OE1   1 
ATOM   4873 O  OE2   . GLU B 2 53  ? 171.92200 57.90800 116.51300 1.000 56.99000  ?  53  GLU B OE2   1 
ATOM   4874 N  N     . ASN B 2 54  ? 175.53400 59.27900 113.87600 1.000 47.61000  ?  54  ASN B N     1 
ATOM   4875 C  CA    . ASN B 2 54  ? 176.67600 60.15800 114.17700 1.000 45.47000  ?  54  ASN B CA    1 
ATOM   4876 C  C     . ASN B 2 54  ? 177.76800 59.89400 113.15700 1.000 47.35000  ?  54  ASN B C     1 
ATOM   4877 O  O     . ASN B 2 54  ? 178.39100 58.84000 113.19400 1.000 49.25000  ?  54  ASN B O     1 
ATOM   4878 C  CB    . ASN B 2 54  ? 177.19600 59.89600 115.60100 1.000 46.59000  ?  54  ASN B CB    1 
ATOM   4879 C  CG    . ASN B 2 54  ? 178.38500 60.78800 115.99500 1.000 51.86000  ?  54  ASN B CG    1 
ATOM   4880 O  OD1   . ASN B 2 54  ? 179.23600 61.11800 115.17600 1.000 52.48000  ?  54  ASN B OD1   1 
ATOM   4881 N  ND2   . ASN B 2 54  ? 178.44500 61.16200 117.27400 1.000 47.74000  ?  54  ASN B ND2   1 
ATOM   4882 N  N     . PRO B 2 55  ? 178.01400 60.84800 112.24200 1.000 54.17000  ?  55  PRO B N     1 
ATOM   4883 C  CA    . PRO B 2 55  ? 178.93000 60.64000 111.10400 1.000 53.43000  ?  55  PRO B CA    1 
ATOM   4884 C  C     . PRO B 2 55  ? 180.41100 60.79300 111.42800 1.000 46.20000  ?  55  PRO B C     1 
ATOM   4885 O  O     . PRO B 2 55  ? 181.22500 60.65800 110.54000 1.000 49.90000  ?  55  PRO B O     1 
ATOM   4886 C  CB    . PRO B 2 55  ? 178.51900 61.73300 110.13700 1.000 46.57000  ?  55  PRO B CB    1 
ATOM   4887 C  CG    . PRO B 2 55  ? 178.13300 62.84400 111.05400 1.000 51.72000  ?  55  PRO B CG    1 
ATOM   4888 C  CD    . PRO B 2 55  ? 177.47900 62.21800 112.25500 1.000 50.17000  ?  55  PRO B CD    1 
ATOM   4889 N  N     . TYR B 2 56  ? 180.75200 61.06600 112.67400 1.000 47.38000  ?  56  TYR B N     1 
ATOM   4890 C  CA    . TYR B 2 56  ? 182.13800 61.36600 113.03000 1.000 54.28000  ?  56  TYR B CA    1 
ATOM   4891 C  C     . TYR B 2 56  ? 182.91200 60.16800 113.60100 1.000 50.41000  ?  56  TYR B C     1 
ATOM   4892 O  O     . TYR B 2 56  ? 182.32100 59.24600 114.18700 1.000 49.66000  ?  56  TYR B O     1 
ATOM   4893 C  CB    . TYR B 2 56  ? 182.15800 62.54200 114.01800 1.000 51.46000  ?  56  TYR B CB    1 
ATOM   4894 C  CG    . TYR B 2 56  ? 181.39100 63.72400 113.48400 1.000 50.42000  ?  56  TYR B CG    1 
ATOM   4895 C  CD1   . TYR B 2 56  ? 181.89300 64.47300 112.43000 1.000 48.77000  ?  56  TYR B CD1   1 
ATOM   4896 C  CD2   . TYR B 2 56  ? 180.15800 64.07900 114.01800 1.000 53.08000  ?  56  TYR B CD2   1 
ATOM   4897 C  CE1   . TYR B 2 56  ? 181.19600 65.54500 111.91000 1.000 52.76000  ?  56  TYR B CE1   1 
ATOM   4898 C  CE2   . TYR B 2 56  ? 179.45400 65.15800 113.51200 1.000 56.03000  ?  56  TYR B CE2   1 
ATOM   4899 C  CZ    . TYR B 2 56  ? 179.98100 65.88300 112.45100 1.000 57.93000  ?  56  TYR B CZ    1 
ATOM   4900 O  OH    . TYR B 2 56  ? 179.29900 66.95300 111.93200 1.000 66.82000  ?  56  TYR B OH    1 
ATOM   4901 N  N     . ASN B 2 57  ? 184.23000 60.17000 113.40300 1.000 46.64000  ?  57  ASN B N     1 
ATOM   4902 C  CA    . ASN B 2 57  ? 185.07600 59.16100 114.04000 1.000 47.53000  ?  57  ASN B CA    1 
ATOM   4903 C  C     . ASN B 2 57  ? 186.51100 59.61000 114.28800 1.000 48.96000  ?  57  ASN B C     1 
ATOM   4904 O  O     . ASN B 2 57  ? 187.08200 60.41000 113.54900 1.000 51.76000  ?  57  ASN B O     1 
ATOM   4905 C  CB    . ASN B 2 57  ? 185.10600 57.87300 113.22900 1.000 45.26000  ?  57  ASN B CB    1 
ATOM   4906 C  CG    . ASN B 2 57  ? 185.44100 56.67600 114.07600 1.000 45.20000  ?  57  ASN B CG    1 
ATOM   4907 O  OD1   . ASN B 2 57  ? 184.66900 56.30300 114.94100 1.000 45.42000  ?  57  ASN B OD1   1 
ATOM   4908 N  ND2   . ASN B 2 57  ? 186.60300 56.07100 113.84300 1.000 47.87000  ?  57  ASN B ND2   1 
ATOM   4909 N  N     . THR B 2 58  ? 187.07700 59.06300 115.35300 1.000 49.20000  ?  58  THR B N     1 
ATOM   4910 C  CA    . THR B 2 58  ? 188.42700 59.35000 115.78900 1.000 47.77000  ?  58  THR B CA    1 
ATOM   4911 C  C     . THR B 2 58  ? 188.98600 58.00000 116.17000 1.000 47.29000  ?  58  THR B C     1 
ATOM   4912 O  O     . THR B 2 58  ? 188.28000 57.22000 116.80800 1.000 46.36000  ?  58  THR B O     1 
ATOM   4913 C  CB    . THR B 2 58  ? 188.45000 60.32700 116.98300 1.000 48.38000  ?  58  THR B CB    1 
ATOM   4914 O  OG1   . THR B 2 58  ? 188.16300 61.66100 116.53800 1.000 52.65000  ?  58  THR B OG1   1 
ATOM   4915 C  CG2   . THR B 2 58  ? 189.78100 60.30300 117.66300 1.000 51.19000  ?  58  THR B CG2   1 
ATOM   4916 N  N     . PRO B 2 59  ? 190.23300 57.70600 115.76200 1.000 42.81000  ?  59  PRO B N     1 
ATOM   4917 C  CA    . PRO B 2 59  ? 190.86500 56.41500 116.04400 1.000 44.65000  ?  59  PRO B CA    1 
ATOM   4918 C  C     . PRO B 2 59  ? 191.13400 56.28200 117.51100 1.000 40.83000  ?  59  PRO B C     1 
ATOM   4919 O  O     . PRO B 2 59  ? 191.26500 57.29800 118.15700 1.000 41.14000  ?  59  PRO B O     1 
ATOM   4920 C  CB    . PRO B 2 59  ? 192.19400 56.45900 115.26500 1.000 43.12000  ?  59  PRO B CB    1 
ATOM   4921 C  CG    . PRO B 2 59  ? 192.16500 57.68800 114.47200 1.000 46.62000  ?  59  PRO B CG    1 
ATOM   4922 C  CD    . PRO B 2 59  ? 191.17300 58.63300 115.12800 1.000 46.71000  ?  59  PRO B CD    1 
ATOM   4923 N  N     . VAL B 2 60  ? 191.22600 55.05700 118.01500 1.000 45.54000  ?  60  VAL B N     1 
ATOM   4924 C  CA    . VAL B 2 60  ? 191.56200 54.82200 119.41200 1.000 47.30000  ?  60  VAL B CA    1 
ATOM   4925 C  C     . VAL B 2 60  ? 192.46000 53.58900 119.55300 1.000 44.03000  ?  60  VAL B C     1 
ATOM   4926 O  O     . VAL B 2 60  ? 192.34500 52.64400 118.77500 1.000 42.02000  ?  60  VAL B O     1 
ATOM   4927 C  CB    . VAL B 2 60  ? 190.28400 54.64100 120.26900 1.000 45.73000  ?  60  VAL B CB    1 
ATOM   4928 C  CG1   . VAL B 2 60  ? 189.52200 53.39600 119.83400 1.000 42.03000  ?  60  VAL B CG1   1 
ATOM   4929 C  CG2   . VAL B 2 60  ? 190.65300 54.53700 121.70800 1.000 46.12000  ?  60  VAL B CG2   1 
ATOM   4930 N  N     . PHE B 2 61  ? 193.35500 53.59700 120.53200 1.000 44.07000  ?  61  PHE B N     1 
ATOM   4931 C  CA    . PHE B 2 61  ? 194.13300 52.39800 120.82800 1.000 46.46000  ?  61  PHE B CA    1 
ATOM   4932 C  C     . PHE B 2 61  ? 194.49400 52.35700 122.28800 1.000 49.82000  ?  61  PHE B C     1 
ATOM   4933 O  O     . PHE B 2 61  ? 193.79000 52.93300 123.09700 1.000 51.10000  ?  61  PHE B O     1 
ATOM   4934 C  CB    . PHE B 2 61  ? 195.38400 52.28900 119.95300 1.000 45.96000  ?  61  PHE B CB    1 
ATOM   4935 C  CG    . PHE B 2 61  ? 196.34300 53.43900 120.06200 1.000 50.18000  ?  61  PHE B CG    1 
ATOM   4936 C  CD1   . PHE B 2 61  ? 195.96400 54.72200 119.73200 1.000 52.63000  ?  61  PHE B CD1   1 
ATOM   4937 C  CD2   . PHE B 2 61  ? 197.66900 53.21300 120.39700 1.000 54.40000  ?  61  PHE B CD2   1 
ATOM   4938 C  CE1   . PHE B 2 61  ? 196.87500 55.77400 119.79800 1.000 52.16000  ?  61  PHE B CE1   1 
ATOM   4939 C  CE2   . PHE B 2 61  ? 198.57900 54.26100 120.45200 1.000 50.32000  ?  61  PHE B CE2   1 
ATOM   4940 C  CZ    . PHE B 2 61  ? 198.17400 55.53800 120.15900 1.000 45.22000  ?  61  PHE B CZ    1 
ATOM   4941 N  N     . ALA B 2 62  ? 195.56900 51.66100 122.64000 1.000 52.18000  ?  62  ALA B N     1 
ATOM   4942 C  CA    . ALA B 2 62  ? 195.90100 51.49900 124.04700 1.000 49.83000  ?  62  ALA B CA    1 
ATOM   4943 C  C     . ALA B 2 62  ? 197.37800 51.20300 124.24900 1.000 60.84000  ?  62  ALA B C     1 
ATOM   4944 O  O     . ALA B 2 62  ? 197.97300 50.40700 123.50900 1.000 62.19000  ?  62  ALA B O     1 
ATOM   4945 C  CB    . ALA B 2 62  ? 195.05700 50.39200 124.66400 1.000 49.01000  ?  62  ALA B CB    1 
ATOM   4946 N  N     . ILE B 2 63  ? 197.96500 51.83200 125.26400 1.000 60.40000  ?  63  ILE B N     1 
ATOM   4947 C  CA    . ILE B 2 63  ? 199.35300 51.57700 125.60800 1.000 60.22000  ?  63  ILE B CA    1 
ATOM   4948 C  C     . ILE B 2 63  ? 199.45100 50.96700 126.99800 1.000 64.12000  ?  63  ILE B C     1 
ATOM   4949 O  O     . ILE B 2 63  ? 198.73200 51.36000 127.92400 1.000 66.46000  ?  63  ILE B O     1 
ATOM   4950 C  CB    . ILE B 2 63  ? 200.19400 52.85000 125.54600 1.000 58.64000  ?  63  ILE B CB    1 
ATOM   4951 C  CG1   . ILE B 2 63  ? 199.70100 53.83600 126.59900 1.000 61.53000  ?  63  ILE B CG1   1 
ATOM   4952 C  CG2   . ILE B 2 63  ? 200.11900 53.45500 124.15500 1.000 52.31000  ?  63  ILE B CG2   1 
ATOM   4953 C  CD1   . ILE B 2 63  ? 200.56400 55.04200 126.76300 1.000 60.67000  ?  63  ILE B CD1   1 
ATOM   4954 N  N     . LYS B 2 64  ? 200.31800 49.96600 127.10500 1.000 69.16000  ?  64  LYS B N     1 
ATOM   4955 C  CA    . LYS B 2 64  ? 200.66600 49.32400 128.36600 1.000 73.30000  ?  64  LYS B CA    1 
ATOM   4956 C  C     . LYS B 2 64  ? 201.92800 50.00800 128.87400 1.000 71.98000  ?  64  LYS B C     1 
ATOM   4957 O  O     . LYS B 2 64  ? 203.03200 49.71800 128.41600 1.000 67.43000  ?  64  LYS B O     1 
ATOM   4958 C  CB    . LYS B 2 64  ? 200.88200 47.81400 128.17900 1.000 71.30000  ?  64  LYS B CB    1 
ATOM   4959 C  CG    . LYS B 2 64  ? 200.95100 47.01100 129.46700 1.000 75.98000  ?  64  LYS B CG    1 
ATOM   4960 C  CD    . LYS B 2 64  ? 201.26100 45.53800 129.19700 1.000 80.01000  ?  64  LYS B CD    1 
ATOM   4961 C  CE    . LYS B 2 64  ? 201.04000 44.69600 130.45600 1.000 86.42000  ?  64  LYS B CE    1 
ATOM   4962 N  NZ    . LYS B 2 64  ? 201.06700 43.22100 130.21000 1.000 84.84000  ?  64  LYS B NZ    1 
ATOM   4963 N  N     . LYS B 2 65  ? 201.74900 50.94500 129.79500 1.000 75.53000  ?  65  LYS B N     1 
ATOM   4964 C  CA    . LYS B 2 65  ? 202.85700 51.77100 130.23800 1.000 87.78000  ?  65  LYS B CA    1 
ATOM   4965 C  C     . LYS B 2 65  ? 203.89300 50.94200 130.99000 1.000 93.59000  ?  65  LYS B C     1 
ATOM   4966 O  O     . LYS B 2 65  ? 203.55800 50.14900 131.88100 1.000 92.69000  ?  65  LYS B O     1 
ATOM   4967 C  CB    . LYS B 2 65  ? 202.37000 52.93000 131.11300 1.000 86.86000  ?  65  LYS B CB    1 
ATOM   4968 C  CG    . LYS B 2 65  ? 201.77900 54.11800 130.35800 1.000 76.00000  ?  65  LYS B CG    1 
ATOM   4969 C  CD    . LYS B 2 65  ? 201.40500 55.16200 131.37200 1.000 81.68000  ?  65  LYS B CD    1 
ATOM   4970 C  CE    . LYS B 2 65  ? 200.46400 56.20200 130.82500 1.000 81.62000  ?  65  LYS B CE    1 
ATOM   4971 N  NZ    . LYS B 2 65  ? 199.99300 57.04800 131.96700 1.000 77.49000  ?  65  LYS B NZ    1 
ATOM   4972 N  N     . LYS B 2 66  ? 205.14700 51.13200 130.57800 1.000 95.47000  ?  66  LYS B N     1 
ATOM   4973 C  CA    . LYS B 2 66  ? 206.34200 50.60500 131.23900 1.000 104.19000 ?  66  LYS B CA    1 
ATOM   4974 C  C     . LYS B 2 66  ? 206.31700 49.09700 131.52600 1.000 108.87000 ?  66  LYS B C     1 
ATOM   4975 O  O     . LYS B 2 66  ? 206.24700 48.26800 130.61000 1.000 102.81000 ?  66  LYS B O     1 
ATOM   4976 C  CB    . LYS B 2 66  ? 206.59500 51.37200 132.55000 1.000 107.31000 ?  66  LYS B CB    1 
ATOM   4977 C  CG    . LYS B 2 66  ? 207.98900 51.14200 133.13800 1.000 110.89000 ?  66  LYS B CG    1 
ATOM   4978 C  CD    . LYS B 2 66  ? 208.15900 51.77700 134.50100 1.000 111.30000 ?  66  LYS B CD    1 
ATOM   4979 C  CE    . LYS B 2 66  ? 209.46900 51.34800 135.13300 1.000 105.57000 ?  66  LYS B CE    1 
ATOM   4980 N  NZ    . LYS B 2 66  ? 209.73400 52.09100 136.39700 1.000 119.20000 ?  66  LYS B NZ    1 
ATOM   4981 N  N     . ASP B 2 67  ? 206.38900 48.76700 132.81500 1.000 108.88000 ?  67  ASP B N     1 
ATOM   4982 C  CA    . ASP B 2 67  ? 206.54500 47.39700 133.27900 1.000 108.50000 ?  67  ASP B CA    1 
ATOM   4983 C  C     . ASP B 2 67  ? 205.21200 46.85800 133.79100 1.000 111.28000 ?  67  ASP B C     1 
ATOM   4984 O  O     . ASP B 2 67  ? 205.07100 45.65700 134.04800 1.000 115.95000 ?  67  ASP B O     1 
ATOM   4985 C  CB    . ASP B 2 67  ? 207.60800 47.34000 134.38700 1.000 114.46000 ?  67  ASP B CB    1 
ATOM   4986 C  CG    . ASP B 2 67  ? 208.48600 46.10200 134.30500 1.000 116.20000 ?  67  ASP B CG    1 
ATOM   4987 O  OD1   . ASP B 2 67  ? 208.04000 45.02300 134.75900 1.000 115.05000 ?  67  ASP B OD1   1 
ATOM   4988 O  OD2   . ASP B 2 67  ? 209.62900 46.21800 133.80200 1.000 108.99000 ?  67  ASP B OD2   1 
ATOM   4989 N  N     . SER B 2 68  ? 204.23400 47.75700 133.92000 1.000 107.20000 ?  68  SER B N     1 
ATOM   4990 C  CA    . SER B 2 68  ? 202.97400 47.45900 134.59700 1.000 100.59000 ?  68  SER B CA    1 
ATOM   4991 C  C     . SER B 2 68  ? 202.06200 46.46800 133.87100 1.000 95.36000  ?  68  SER B C     1 
ATOM   4992 O  O     . SER B 2 68  ? 202.39700 45.93100 132.81000 1.000 95.53000  ?  68  SER B O     1 
ATOM   4993 C  CB    . SER B 2 68  ? 202.19900 48.75600 134.83300 1.000 95.70000  ?  68  SER B CB    1 
ATOM   4994 O  OG    . SER B 2 68  ? 201.05700 48.51000 135.63200 1.000 90.97000  ?  68  SER B OG    1 
ATOM   4995 N  N     . THR B 2 69  ? 200.91500 46.21600 134.49000 1.000 93.89000  ?  69  THR B N     1 
ATOM   4996 C  CA    . THR B 2 69  ? 199.80400 45.52300 133.84600 1.000 93.80000  ?  69  THR B CA    1 
ATOM   4997 C  C     . THR B 2 69  ? 198.63000 46.49300 133.79200 1.000 91.27000  ?  69  THR B C     1 
ATOM   4998 O  O     . THR B 2 69  ? 197.46700 46.11100 133.99100 1.000 87.81000  ?  69  THR B O     1 
ATOM   4999 C  CB    . THR B 2 69  ? 199.38900 44.22500 134.58900 1.000 92.44000  ?  69  THR B CB    1 
ATOM   5000 O  OG1   . THR B 2 69  ? 199.46800 44.42700 136.01000 1.000 88.61000  ?  69  THR B OG1   1 
ATOM   5001 C  CG2   . THR B 2 69  ? 200.28200 43.04500 134.16900 1.000 87.30000  ?  69  THR B CG2   1 
ATOM   5002 N  N     . LYS B 2 70  ? 198.95300 47.76200 133.55600 1.000 87.27000  ?  70  LYS B N     1 
ATOM   5003 C  CA    . LYS B 2 70  ? 197.92400 48.76900 133.35400 1.000 80.92000  ?  70  LYS B CA    1 
ATOM   5004 C  C     . LYS B 2 70  ? 197.98500 49.31400 131.94100 1.000 75.68000  ?  70  LYS B C     1 
ATOM   5005 O  O     . LYS B 2 70  ? 199.00800 49.86200 131.51700 1.000 76.70000  ?  70  LYS B O     1 
ATOM   5006 C  CB    . LYS B 2 70  ? 198.05700 49.91700 134.34600 1.000 76.22000  ?  70  LYS B CB    1 
ATOM   5007 C  CG    . LYS B 2 70  ? 197.07800 51.04700 134.06800 1.000 78.36000  ?  70  LYS B CG    1 
ATOM   5008 C  CD    . LYS B 2 70  ? 197.68900 52.41800 134.38000 1.000 83.07000  ?  70  LYS B CD    1 
ATOM   5009 C  CE    . LYS B 2 70  ? 196.86300 53.54700 133.76000 1.000 79.84000  ?  70  LYS B CE    1 
ATOM   5010 N  NZ    . LYS B 2 70  ? 197.54500 54.86400 133.89300 1.000 78.44000  ?  70  LYS B NZ    1 
ATOM   5011 N  N     . TRP B 2 71  ? 196.88000 49.14500 131.22000 1.000 71.23000  ?  71  TRP B N     1 
ATOM   5012 C  CA    . TRP B 2 71  ? 196.67400 49.80700 129.94100 1.000 63.42000  ?  71  TRP B CA    1 
ATOM   5013 C  C     . TRP B 2 71  ? 196.09300 51.18000 130.15100 1.000 62.93000  ?  71  TRP B C     1 
ATOM   5014 O  O     . TRP B 2 71  ? 195.32700 51.41000 131.09700 1.000 64.05000  ?  71  TRP B O     1 
ATOM   5015 C  CB    . TRP B 2 71  ? 195.75300 48.98400 129.06400 1.000 61.49000  ?  71  TRP B CB    1 
ATOM   5016 C  CG    . TRP B 2 71  ? 196.36200 47.69600 128.73200 1.000 61.79000  ?  71  TRP B CG    1 
ATOM   5017 C  CD1   . TRP B 2 71  ? 196.33300 46.56800 129.47900 1.000 58.67000  ?  71  TRP B CD1   1 
ATOM   5018 C  CD2   . TRP B 2 71  ? 197.14100 47.40100 127.57800 1.000 57.46000  ?  71  TRP B CD2   1 
ATOM   5019 N  NE1   . TRP B 2 71  ? 197.03600 45.57400 128.85500 1.000 57.52000  ?  71  TRP B NE1   1 
ATOM   5020 C  CE2   . TRP B 2 71  ? 197.54100 46.06200 127.68200 1.000 58.95000  ?  71  TRP B CE2   1 
ATOM   5021 C  CE3   . TRP B 2 71  ? 197.53500 48.13800 126.46500 1.000 60.66000  ?  71  TRP B CE3   1 
ATOM   5022 C  CZ2   . TRP B 2 71  ? 198.31800 45.44100 126.71100 1.000 63.73000  ?  71  TRP B CZ2   1 
ATOM   5023 C  CZ3   . TRP B 2 71  ? 198.31100 47.52100 125.50000 1.000 59.61000  ?  71  TRP B CZ3   1 
ATOM   5024 C  CH2   . TRP B 2 71  ? 198.69600 46.19000 125.63000 1.000 59.66000  ?  71  TRP B CH2   1 
ATOM   5025 N  N     . ARG B 2 72  ? 196.48700 52.10500 129.28800 1.000 60.39000  ?  72  ARG B N     1 
ATOM   5026 C  CA    . ARG B 2 72  ? 195.87200 53.41900 129.27900 1.000 59.03000  ?  72  ARG B CA    1 
ATOM   5027 C  C     . ARG B 2 72  ? 195.28200 53.62700 127.90300 1.000 59.96000  ?  72  ARG B C     1 
ATOM   5028 O  O     . ARG B 2 72  ? 195.95900 53.40600 126.89900 1.000 61.69000  ?  72  ARG B O     1 
ATOM   5029 C  CB    . ARG B 2 72  ? 196.87700 54.52500 129.61200 1.000 61.26000  ?  72  ARG B CB    1 
ATOM   5030 C  CG    . ARG B 2 72  ? 196.24500 55.90700 129.81000 1.000 60.59000  ?  72  ARG B CG    1 
ATOM   5031 C  CD    . ARG B 2 72  ? 197.19900 56.99200 129.36900 1.000 70.13000  ?  72  ARG B CD    1 
ATOM   5032 N  NE    . ARG B 2 72  ? 196.89900 58.31600 129.91200 1.000 69.96000  ?  72  ARG B NE    1 
ATOM   5033 C  CZ    . ARG B 2 72  ? 196.23600 59.27500 129.26400 1.000 72.08000  ?  72  ARG B CZ    1 
ATOM   5034 N  NH1   . ARG B 2 72  ? 195.76200 59.06500 128.03600 1.000 65.53000  ?  72  ARG B NH1   1 
ATOM   5035 N  NH2   . ARG B 2 72  ? 196.04400 60.45400 129.85200 1.000 69.81000  ?  72  ARG B NH2   1 
ATOM   5036 N  N     . LYS B 2 73  ? 194.01500 54.02100 127.85000 1.000 58.03000  ?  73  LYS B N     1 
ATOM   5037 C  CA    . LYS B 2 73  ? 193.40200 54.36400 126.57900 1.000 51.56000  ?  73  LYS B CA    1 
ATOM   5038 C  C     . LYS B 2 73  ? 193.99900 55.64600 126.03100 1.000 52.85000  ?  73  LYS B C     1 
ATOM   5039 O  O     . LYS B 2 73  ? 194.26600 56.59500 126.76500 1.000 57.23000  ?  73  LYS B O     1 
ATOM   5040 C  CB    . LYS B 2 73  ? 191.89500 54.51400 126.71700 1.000 48.48000  ?  73  LYS B CB    1 
ATOM   5041 C  CG    . LYS B 2 73  ? 191.23400 55.07800 125.48400 1.000 48.57000  ?  73  LYS B CG    1 
ATOM   5042 C  CD    . LYS B 2 73  ? 189.73100 54.97800 125.55900 1.000 48.84000  ?  73  LYS B CD    1 
ATOM   5043 C  CE    . LYS B 2 73  ? 189.17600 55.99600 126.50700 1.000 57.25000  ?  73  LYS B CE    1 
ATOM   5044 N  NZ    . LYS B 2 73  ? 187.91100 56.54400 125.93700 1.000 65.32000  ?  73  LYS B NZ    1 
ATOM   5045 N  N     . LEU B 2 74  ? 194.20600 55.65200 124.72700 1.000 50.20000  ?  74  LEU B N     1 
ATOM   5046 C  CA    . LEU B 2 74  ? 194.67900 56.81500 123.99400 1.000 53.19000  ?  74  LEU B CA    1 
ATOM   5047 C  C     . LEU B 2 74  ? 193.78600 57.07100 122.76800 1.000 51.85000  ?  74  LEU B C     1 
ATOM   5048 O  O     . LEU B 2 74  ? 193.63100 56.20100 121.92600 1.000 53.17000  ?  74  LEU B O     1 
ATOM   5049 C  CB    . LEU B 2 74  ? 196.11200 56.59200 123.54800 1.000 54.32000  ?  74  LEU B CB    1 
ATOM   5050 C  CG    . LEU B 2 74  ? 197.13700 57.67600 123.80500 1.000 56.84000  ?  74  LEU B CG    1 
ATOM   5051 C  CD1   . LEU B 2 74  ? 197.38800 57.76400 125.28600 1.000 63.04000  ?  74  LEU B CD1   1 
ATOM   5052 C  CD2   . LEU B 2 74  ? 198.41000 57.32200 123.07200 1.000 55.37000  ?  74  LEU B CD2   1 
ATOM   5053 N  N     . VAL B 2 75  ? 193.19900 58.25200 122.67900 1.000 46.00000  ?  75  VAL B N     1 
ATOM   5054 C  CA    . VAL B 2 75  ? 192.41800 58.62300 121.52500 1.000 42.76000  ?  75  VAL B CA    1 
ATOM   5055 C  C     . VAL B 2 75  ? 193.25900 59.54100 120.62300 1.000 49.91000  ?  75  VAL B C     1 
ATOM   5056 O  O     . VAL B 2 75  ? 193.77200 60.57500 121.05400 1.000 49.87000  ?  75  VAL B O     1 
ATOM   5057 C  CB    . VAL B 2 75  ? 191.11700 59.34000 121.94800 1.000 48.68000  ?  75  VAL B CB    1 
ATOM   5058 C  CG1   . VAL B 2 75  ? 190.20800 59.55200 120.76500 1.000 45.39000  ?  75  VAL B CG1   1 
ATOM   5059 C  CG2   . VAL B 2 75  ? 190.39700 58.55900 123.04800 1.000 50.41000  ?  75  VAL B CG2   1 
ATOM   5060 N  N     . ASP B 2 76  ? 193.41900 59.15900 119.36700 1.000 48.94000  ?  76  ASP B N     1 
ATOM   5061 C  CA    . ASP B 2 76  ? 194.10800 60.01000 118.42000 1.000 45.68000  ?  76  ASP B CA    1 
ATOM   5062 C  C     . ASP B 2 76  ? 193.20800 61.17800 118.04500 1.000 50.57000  ?  76  ASP B C     1 
ATOM   5063 O  O     . ASP B 2 76  ? 192.48600 61.13000 117.04700 1.000 49.26000  ?  76  ASP B O     1 
ATOM   5064 C  CB    . ASP B 2 76  ? 194.51800 59.22600 117.17500 1.000 44.21000  ?  76  ASP B CB    1 
ATOM   5065 C  CG    . ASP B 2 76  ? 195.31400 60.07100 116.17800 1.000 52.10000  ?  76  ASP B CG    1 
ATOM   5066 O  OD1   . ASP B 2 76  ? 195.69900 61.22500 116.50300 1.000 51.54000  ?  76  ASP B OD1   1 
ATOM   5067 O  OD2   . ASP B 2 76  ? 195.55300 59.57200 115.05800 1.000 54.54000  ?  76  ASP B OD2   1 
ATOM   5068 N  N     . PHE B 2 77  ? 193.27800 62.23200 118.84900 1.000 50.61000  ?  77  PHE B N     1 
ATOM   5069 C  CA    . PHE B 2 77  ? 192.45400 63.42100 118.64900 1.000 52.25000  ?  77  PHE B CA    1 
ATOM   5070 C  C     . PHE B 2 77  ? 193.10600 64.50300 117.77800 1.000 52.02000  ?  77  PHE B C     1 
ATOM   5071 O  O     . PHE B 2 77  ? 192.64900 65.64100 117.77900 1.000 56.26000  ?  77  PHE B O     1 
ATOM   5072 C  CB    . PHE B 2 77  ? 192.08900 64.02500 120.01100 1.000 51.98000  ?  77  PHE B CB    1 
ATOM   5073 C  CG    . PHE B 2 77  ? 190.80900 63.49100 120.59800 1.000 53.84000  ?  77  PHE B CG    1 
ATOM   5074 C  CD1   . PHE B 2 77  ? 189.66100 63.39800 119.83200 1.000 51.09000  ?  77  PHE B CD1   1 
ATOM   5075 C  CD2   . PHE B 2 77  ? 190.75400 63.09200 121.91700 1.000 53.73000  ?  77  PHE B CD2   1 
ATOM   5076 C  CE1   . PHE B 2 77  ? 188.49600 62.92400 120.37500 1.000 49.84000  ?  77  PHE B CE1   1 
ATOM   5077 C  CE2   . PHE B 2 77  ? 189.57800 62.61700 122.46100 1.000 55.26000  ?  77  PHE B CE2   1 
ATOM   5078 C  CZ    . PHE B 2 77  ? 188.45800 62.52600 121.68800 1.000 49.24000  ?  77  PHE B CZ    1 
ATOM   5079 N  N     . ARG B 2 78  ? 194.15700 64.16500 117.03200 1.000 48.60000  ?  78  ARG B N     1 
ATOM   5080 C  CA    . ARG B 2 78  ? 194.89200 65.18700 116.28200 1.000 50.66000  ?  78  ARG B CA    1 
ATOM   5081 C  C     . ARG B 2 78  ? 194.00400 65.94500 115.32000 1.000 53.65000  ?  78  ARG B C     1 
ATOM   5082 O  O     . ARG B 2 78  ? 194.07400 67.17100 115.23000 1.000 58.17000  ?  78  ARG B O     1 
ATOM   5083 C  CB    . ARG B 2 78  ? 196.07000 64.57700 115.52200 1.000 52.32000  ?  78  ARG B CB    1 
ATOM   5084 C  CG    . ARG B 2 78  ? 197.31700 64.40900 116.38800 1.000 51.64000  ?  78  ARG B CG    1 
ATOM   5085 C  CD    . ARG B 2 78  ? 198.40800 63.67500 115.66000 1.000 50.32000  ?  78  ARG B CD    1 
ATOM   5086 N  NE    . ARG B 2 78  ? 198.00500 62.30800 115.35400 1.000 51.62000  ?  78  ARG B NE    1 
ATOM   5087 C  CZ    . ARG B 2 78  ? 198.70500 61.48500 114.58500 1.000 50.77000  ?  78  ARG B CZ    1 
ATOM   5088 N  NH1   . ARG B 2 78  ? 199.84400 61.89100 114.04000 1.000 53.88000  ?  78  ARG B NH1   1 
ATOM   5089 N  NH2   . ARG B 2 78  ? 198.27100 60.26200 114.35800 1.000 48.77000  ?  78  ARG B NH2   1 
ATOM   5090 N  N     . GLU B 2 79  ? 193.16500 65.21700 114.60300 1.000 54.47000  ?  79  GLU B N     1 
ATOM   5091 C  CA    . GLU B 2 79  ? 192.26600 65.83300 113.63800 1.000 55.51000  ?  79  GLU B CA    1 
ATOM   5092 C  C     . GLU B 2 79  ? 191.29100 66.77100 114.35000 1.000 59.31000  ?  79  GLU B C     1 
ATOM   5093 O  O     . GLU B 2 79  ? 191.11200 67.92000 113.95800 1.000 61.63000  ?  79  GLU B O     1 
ATOM   5094 C  CB    . GLU B 2 79  ? 191.51900 64.75800 112.85800 1.000 52.54000  ?  79  GLU B CB    1 
ATOM   5095 C  CG    . GLU B 2 79  ? 191.47500 65.00200 111.37000 1.000 58.97000  ?  79  GLU B CG    1 
ATOM   5096 C  CD    . GLU B 2 79  ? 192.76900 65.59400 110.81400 1.000 67.04000  ?  79  GLU B CD    1 
ATOM   5097 O  OE1   . GLU B 2 79  ? 192.72100 66.72400 110.28100 1.000 71.36000  ?  79  GLU B OE1   1 
ATOM   5098 O  OE2   . GLU B 2 79  ? 193.83400 64.93500 110.89100 1.000 71.24000  ?  79  GLU B OE2   1 
ATOM   5099 N  N     . LEU B 2 80  ? 190.68600 66.29300 115.42400 1.000 53.93000  ?  80  LEU B N     1 
ATOM   5100 C  CA    . LEU B 2 80  ? 189.71100 67.09700 116.13000 1.000 54.53000  ?  80  LEU B CA    1 
ATOM   5101 C  C     . LEU B 2 80  ? 190.35000 68.35000 116.69200 1.000 55.97000  ?  80  LEU B C     1 
ATOM   5102 O  O     . LEU B 2 80  ? 189.78700 69.43500 116.59100 1.000 55.99000  ?  80  LEU B O     1 
ATOM   5103 C  CB    . LEU B 2 80  ? 189.05900 66.28800 117.25200 1.000 55.10000  ?  80  LEU B CB    1 
ATOM   5104 C  CG    . LEU B 2 80  ? 188.17700 67.10300 118.17500 1.000 53.45000  ?  80  LEU B CG    1 
ATOM   5105 C  CD1   . LEU B 2 80  ? 187.08100 67.74900 117.36600 1.000 55.21000  ?  80  LEU B CD1   1 
ATOM   5106 C  CD2   . LEU B 2 80  ? 187.61700 66.21900 119.25900 1.000 57.43000  ?  80  LEU B CD2   1 
ATOM   5107 N  N     . ASN B 2 81  ? 191.52000 68.18600 117.30000 1.000 58.65000  ?  81  ASN B N     1 
ATOM   5108 C  CA    . ASN B 2 81  ? 192.27100 69.31100 117.85400 1.000 59.22000  ?  81  ASN B CA    1 
ATOM   5109 C  C     . ASN B 2 81  ? 192.57400 70.37200 116.79600 1.000 63.06000  ?  81  ASN B C     1 
ATOM   5110 O  O     . ASN B 2 81  ? 192.41400 71.56900 117.05400 1.000 67.05000  ?  81  ASN B O     1 
ATOM   5111 C  CB    . ASN B 2 81  ? 193.56800 68.82200 118.49400 1.000 50.05000  ?  81  ASN B CB    1 
ATOM   5112 C  CG    . ASN B 2 81  ? 193.33400 68.07600 119.79800 1.000 56.12000  ?  81  ASN B CG    1 
ATOM   5113 O  OD1   . ASN B 2 81  ? 192.38000 68.35400 120.52800 1.000 62.40000  ?  81  ASN B OD1   1 
ATOM   5114 N  ND2   . ASN B 2 81  ? 194.21400 67.13700 120.10700 1.000 52.46000  ?  81  ASN B ND2   1 
ATOM   5115 N  N     . LYS B 2 82  ? 192.99200 69.93100 115.60500 1.000 58.38000  ?  82  LYS B N     1 
ATOM   5116 C  CA    . LYS B 2 82  ? 193.22200 70.84600 114.49400 1.000 59.12000  ?  82  LYS B CA    1 
ATOM   5117 C  C     . LYS B 2 82  ? 191.94500 71.59600 114.13400 1.000 59.65000  ?  82  LYS B C     1 
ATOM   5118 O  O     . LYS B 2 82  ? 192.01100 72.68700 113.58200 1.000 67.65000  ?  82  LYS B O     1 
ATOM   5119 C  CB    . LYS B 2 82  ? 193.75300 70.10900 113.25500 1.000 58.17000  ?  82  LYS B CB    1 
ATOM   5120 C  CG    . LYS B 2 82  ? 195.15700 69.55400 113.40100 1.000 66.62000  ?  82  LYS B CG    1 
ATOM   5121 C  CD    . LYS B 2 82  ? 195.33000 68.19300 112.69700 1.000 68.27000  ?  82  LYS B CD    1 
ATOM   5122 C  CE    . LYS B 2 82  ? 195.75500 68.32700 111.23500 1.000 73.99000  ?  82  LYS B CE    1 
ATOM   5123 N  NZ    . LYS B 2 82  ? 196.13800 67.00000 110.64000 1.000 75.02000  ?  82  LYS B NZ    1 
ATOM   5124 N  N     . ARG B 2 83  ? 190.78700 71.02600 114.45700 1.000 59.63000  ?  83  ARG B N     1 
ATOM   5125 C  CA    . ARG B 2 83  ? 189.50900 71.62000 114.05100 1.000 61.76000  ?  83  ARG B CA    1 
ATOM   5126 C  C     . ARG B 2 83  ? 188.71900 72.27400 115.19200 1.000 65.48000  ?  83  ARG B C     1 
ATOM   5127 O  O     . ARG B 2 83  ? 187.68800 72.89100 114.95500 1.000 66.72000  ?  83  ARG B O     1 
ATOM   5128 C  CB    . ARG B 2 83  ? 188.64200 70.56300 113.37400 1.000 58.00000  ?  83  ARG B CB    1 
ATOM   5129 C  CG    . ARG B 2 83  ? 189.29100 69.92500 112.16200 1.000 58.59000  ?  83  ARG B CG    1 
ATOM   5130 C  CD    . ARG B 2 83  ? 188.76600 68.51800 111.96500 1.000 59.28000  ?  83  ARG B CD    1 
ATOM   5131 N  NE    . ARG B 2 83  ? 188.32900 68.27700 110.59500 1.000 63.35000  ?  83  ARG B NE    1 
ATOM   5132 C  CZ    . ARG B 2 83  ? 189.06000 67.64900 109.68500 1.000 64.44000  ?  83  ARG B CZ    1 
ATOM   5133 N  NH1   . ARG B 2 83  ? 190.25600 67.19800 110.00900 1.000 64.30000  ?  83  ARG B NH1   1 
ATOM   5134 N  NH2   . ARG B 2 83  ? 188.59800 67.47000 108.45500 1.000 69.79000  ?  83  ARG B NH2   1 
ATOM   5135 N  N     . THR B 2 84  ? 189.19100 72.13900 116.42700 1.000 70.74000  ?  84  THR B N     1 
ATOM   5136 C  CA    . THR B 2 84  ? 188.55400 72.82600 117.54900 1.000 68.02000  ?  84  THR B CA    1 
ATOM   5137 C  C     . THR B 2 84  ? 188.95000 74.28900 117.54200 1.000 74.80000  ?  84  THR B C     1 
ATOM   5138 O  O     . THR B 2 84  ? 190.05500 74.64100 117.12700 1.000 74.04000  ?  84  THR B O     1 
ATOM   5139 C  CB    . THR B 2 84  ? 188.94700 72.23200 118.91300 1.000 66.94000  ?  84  THR B CB    1 
ATOM   5140 O  OG1   . THR B 2 84  ? 188.75400 70.81600 118.90100 1.000 67.51000  ?  84  THR B OG1   1 
ATOM   5141 C  CG2   . THR B 2 84  ? 188.09800 72.83800 120.01600 1.000 67.97000  ?  84  THR B CG2   1 
ATOM   5142 N  N     . GLN B 2 85  ? 188.03900 75.13800 118.00300 1.000 80.69000  ?  85  GLN B N     1 
ATOM   5143 C  CA    . GLN B 2 85  ? 188.31900 76.55700 118.14500 1.000 80.70000  ?  85  GLN B CA    1 
ATOM   5144 C  C     . GLN B 2 85  ? 189.52500 76.75600 119.05100 1.000 81.69000  ?  85  GLN B C     1 
ATOM   5145 O  O     . GLN B 2 85  ? 189.74900 75.98800 119.98500 1.000 79.76000  ?  85  GLN B O     1 
ATOM   5146 C  CB    . GLN B 2 85  ? 187.11200 77.28300 118.71500 1.000 80.20000  ?  85  GLN B CB    1 
ATOM   5147 C  CG    . GLN B 2 85  ? 186.88300 76.96400 120.17200 1.000 83.61000  ?  85  GLN B CG    1 
ATOM   5148 C  CD    . GLN B 2 85  ? 186.63300 78.20900 120.99500 1.000 95.90000  ?  85  GLN B CD    1 
ATOM   5149 O  OE1   . GLN B 2 85  ? 187.06900 79.31000 120.63000 1.000 100.03000 ?  85  GLN B OE1   1 
ATOM   5150 N  NE2   . GLN B 2 85  ? 185.91500 78.04800 122.11000 1.000 91.01000  ?  85  GLN B NE2   1 
ATOM   5151 N  N     . ASP B 2 86  ? 190.31000 77.78500 118.77100 1.000 85.90000  ?  86  ASP B N     1 
ATOM   5152 C  CA    . ASP B 2 86  ? 191.51600 78.02800 119.54700 1.000 82.85000  ?  86  ASP B CA    1 
ATOM   5153 C  C     . ASP B 2 86  ? 191.23000 79.02600 120.66000 1.000 79.99000  ?  86  ASP B C     1 
ATOM   5154 O  O     . ASP B 2 86  ? 190.26000 78.87200 121.40400 1.000 77.55000  ?  86  ASP B O     1 
ATOM   5155 C  CB    . ASP B 2 86  ? 192.64200 78.51800 118.63500 1.000 82.59000  ?  86  ASP B CB    1 
ATOM   5156 C  CG    . ASP B 2 86  ? 192.12100 79.11400 117.32400 1.000 93.56000  ?  86  ASP B CG    1 
ATOM   5157 O  OD1   . ASP B 2 86  ? 190.89500 79.38200 117.22300 1.000 93.94000  ?  86  ASP B OD1   1 
ATOM   5158 O  OD2   . ASP B 2 86  ? 192.93800 79.32100 116.39700 1.000 87.42000  ?  86  ASP B OD2   1 
ATOM   5159 N  N     . PRO B 2 95  ? 201.22300 82.69400 129.39100 1.000 100.98000 ?  95  PRO B N     1 
ATOM   5160 C  CA    . PRO B 2 95  ? 202.62500 82.59000 128.96000 1.000 103.23000 ?  95  PRO B CA    1 
ATOM   5161 C  C     . PRO B 2 95  ? 203.32100 81.27000 129.36700 1.000 96.49000  ?  95  PRO B C     1 
ATOM   5162 O  O     . PRO B 2 95  ? 202.82400 80.53400 130.22600 1.000 95.09000  ?  95  PRO B O     1 
ATOM   5163 C  CB    . PRO B 2 95  ? 203.27100 83.80900 129.63900 1.000 94.98000  ?  95  PRO B CB    1 
ATOM   5164 C  CG    . PRO B 2 95  ? 202.11500 84.84800 129.72200 1.000 99.48000  ?  95  PRO B CG    1 
ATOM   5165 C  CD    . PRO B 2 95  ? 200.79600 84.10300 129.45500 1.000 99.20000  ?  95  PRO B CD    1 
ATOM   5166 N  N     . HIS B 2 96  ? 204.45400 80.98100 128.72600 1.000 89.11000  ?  96  HIS B N     1 
ATOM   5167 C  CA    . HIS B 2 96  ? 205.15600 79.70500 128.89200 1.000 80.13000  ?  96  HIS B CA    1 
ATOM   5168 C  C     . HIS B 2 96  ? 206.43900 79.88500 129.71300 1.000 79.18000  ?  96  HIS B C     1 
ATOM   5169 O  O     . HIS B 2 96  ? 207.29100 80.71800 129.38700 1.000 79.40000  ?  96  HIS B O     1 
ATOM   5170 C  CB    . HIS B 2 96  ? 205.47100 79.08500 127.51100 1.000 75.35000  ?  96  HIS B CB    1 
ATOM   5171 C  CG    . HIS B 2 96  ? 206.41800 77.92300 127.56000 1.000 68.56000  ?  96  HIS B CG    1 
ATOM   5172 N  ND1   . HIS B 2 96  ? 205.99300 76.62500 127.73900 1.000 63.99000  ?  96  HIS B ND1   1 
ATOM   5173 C  CD2   . HIS B 2 96  ? 207.77000 77.86500 127.46000 1.000 69.07000  ?  96  HIS B CD2   1 
ATOM   5174 C  CE1   . HIS B 2 96  ? 207.04300 75.81800 127.74900 1.000 63.22000  ?  96  HIS B CE1   1 
ATOM   5175 N  NE2   . HIS B 2 96  ? 208.13400 76.54400 127.58600 1.000 59.12000  ?  96  HIS B NE2   1 
ATOM   5176 N  N     . PRO B 2 97  ? 206.57700 79.09400 130.78700 1.000 80.66000  ?  97  PRO B N     1 
ATOM   5177 C  CA    . PRO B 2 97  ? 207.68800 79.15500 131.75100 1.000 75.86000  ?  97  PRO B CA    1 
ATOM   5178 C  C     . PRO B 2 97  ? 209.07500 78.83200 131.18100 1.000 73.51000  ?  97  PRO B C     1 
ATOM   5179 O  O     . PRO B 2 97  ? 209.46400 77.65700 131.11800 1.000 67.77000  ?  97  PRO B O     1 
ATOM   5180 C  CB    . PRO B 2 97  ? 207.28900 78.11100 132.80400 1.000 73.06000  ?  97  PRO B CB    1 
ATOM   5181 C  CG    . PRO B 2 97  ? 206.31300 77.21600 132.12200 1.000 70.99000  ?  97  PRO B CG    1 
ATOM   5182 C  CD    . PRO B 2 97  ? 205.56200 78.10100 131.18000 1.000 75.52000  ?  97  PRO B CD    1 
ATOM   5183 N  N     . ALA B 2 98  ? 209.81700 79.88500 130.82300 1.000 74.60000  ?  98  ALA B N     1 
ATOM   5184 C  CA    . ALA B 2 98  ? 211.17700 79.77100 130.29400 1.000 69.86000  ?  98  ALA B CA    1 
ATOM   5185 C  C     . ALA B 2 98  ? 212.12300 79.10400 131.28200 1.000 74.48000  ?  98  ALA B C     1 
ATOM   5186 O  O     . ALA B 2 98  ? 213.19100 78.61000 130.90800 1.000 73.80000  ?  98  ALA B O     1 
ATOM   5187 C  CB    . ALA B 2 98  ? 211.70000 81.12600 129.91900 1.000 60.07000  ?  98  ALA B CB    1 
ATOM   5188 N  N     . GLY B 2 99  ? 211.72500 79.08800 132.54800 1.000 73.33000  ?  99  GLY B N     1 
ATOM   5189 C  CA    . GLY B 2 99  ? 212.56100 78.52200 133.58300 1.000 72.79000  ?  99  GLY B CA    1 
ATOM   5190 C  C     . GLY B 2 99  ? 212.48900 77.00900 133.63000 1.000 77.92000  ?  99  GLY B C     1 
ATOM   5191 O  O     . GLY B 2 99  ? 213.39900 76.35500 134.14600 1.000 82.82000  ?  99  GLY B O     1 
ATOM   5192 N  N     . LEU B 2 100 ? 211.40700 76.44900 133.09500 1.000 75.73000  ?  100 LEU B N     1 
ATOM   5193 C  CA    . LEU B 2 100 ? 211.18500 75.00400 133.14700 1.000 73.60000  ?  100 LEU B CA    1 
ATOM   5194 C  C     . LEU B 2 100 ? 212.31100 74.18600 132.47300 1.000 76.07000  ?  100 LEU B C     1 
ATOM   5195 O  O     . LEU B 2 100 ? 212.63700 73.07600 132.91700 1.000 69.15000  ?  100 LEU B O     1 
ATOM   5196 C  CB    . LEU B 2 100 ? 209.83700 74.67300 132.51300 1.000 64.89000  ?  100 LEU B CB    1 
ATOM   5197 C  CG    . LEU B 2 100 ? 209.52800 73.19300 132.35700 1.000 61.00000  ?  100 LEU B CG    1 
ATOM   5198 C  CD1   . LEU B 2 100 ? 209.62400 72.47300 133.68500 1.000 63.15000  ?  100 LEU B CD1   1 
ATOM   5199 C  CD2   . LEU B 2 100 ? 208.14600 73.03200 131.76300 1.000 69.71000  ?  100 LEU B CD2   1 
ATOM   5200 N  N     . LYS B 2 101 ? 212.89900 74.74500 131.41100 1.000 81.17000  ?  101 LYS B N     1 
ATOM   5201 C  CA    . LYS B 2 101 ? 213.98500 74.09300 130.66500 1.000 82.17000  ?  101 LYS B CA    1 
ATOM   5202 C  C     . LYS B 2 101 ? 215.31600 74.13600 131.40900 1.000 82.51000  ?  101 LYS B C     1 
ATOM   5203 O  O     . LYS B 2 101 ? 216.29800 73.53700 130.96200 1.000 83.40000  ?  101 LYS B O     1 
ATOM   5204 C  CB    . LYS B 2 101 ? 214.16000 74.74100 129.28100 1.000 78.04000  ?  101 LYS B CB    1 
ATOM   5205 C  CG    . LYS B 2 101 ? 214.21100 76.25400 129.29400 1.000 76.28000  ?  101 LYS B CG    1 
ATOM   5206 C  CD    . LYS B 2 101 ? 214.62400 76.79800 127.94100 1.000 77.16000  ?  101 LYS B CD    1 
ATOM   5207 C  CE    . LYS B 2 101 ? 214.38000 78.29600 127.83900 1.000 72.65000  ?  101 LYS B CE    1 
ATOM   5208 N  NZ    . LYS B 2 101 ? 212.94200 78.62200 127.61800 1.000 73.66000  ?  101 LYS B NZ    1 
ATOM   5209 N  N     . LYS B 2 102 ? 215.33700 74.84200 132.54100 1.000 85.18000  ?  102 LYS B N     1 
ATOM   5210 C  CA    . LYS B 2 102 ? 216.57300 75.10600 133.28600 1.000 85.58000  ?  102 LYS B CA    1 
ATOM   5211 C  C     . LYS B 2 102 ? 216.63700 74.43200 134.65100 1.000 83.47000  ?  102 LYS B C     1 
ATOM   5212 O  O     . LYS B 2 102 ? 217.57800 74.65300 135.40500 1.000 88.33000  ?  102 LYS B O     1 
ATOM   5213 C  CB    . LYS B 2 102 ? 216.76600 76.61700 133.45400 1.000 77.69000  ?  102 LYS B CB    1 
ATOM   5214 C  CG    . LYS B 2 102 ? 217.38800 77.25500 132.23000 1.000 86.81000  ?  102 LYS B CG    1 
ATOM   5215 C  CD    . LYS B 2 102 ? 217.29100 78.76300 132.25900 1.000 87.30000  ?  102 LYS B CD    1 
ATOM   5216 C  CE    . LYS B 2 102 ? 215.85200 79.20500 132.32500 1.000 83.62000  ?  102 LYS B CE    1 
ATOM   5217 N  NZ    . LYS B 2 102 ? 215.73400 80.60100 131.83700 1.000 81.64000  ?  102 LYS B NZ    1 
ATOM   5218 N  N     . LYS B 2 103 ? 215.64000 73.61500 134.97000 1.000 81.79000  ?  103 LYS B N     1 
ATOM   5219 C  CA    . LYS B 2 103 ? 215.61900 72.89200 136.23300 1.000 78.18000  ?  103 LYS B CA    1 
ATOM   5220 C  C     . LYS B 2 103 ? 216.41700 71.60000 136.09100 1.000 77.23000  ?  103 LYS B C     1 
ATOM   5221 O  O     . LYS B 2 103 ? 216.51800 71.06600 134.99600 1.000 81.60000  ?  103 LYS B O     1 
ATOM   5222 C  CB    . LYS B 2 103 ? 214.17600 72.63200 136.65700 1.000 74.12000  ?  103 LYS B CB    1 
ATOM   5223 C  CG    . LYS B 2 103 ? 213.46800 73.89400 137.17000 1.000 77.08000  ?  103 LYS B CG    1 
ATOM   5224 C  CD    . LYS B 2 103 ? 213.94500 74.24500 138.58700 1.000 79.69000  ?  103 LYS B CD    1 
ATOM   5225 C  CE    . LYS B 2 103 ? 213.81100 75.73100 138.90500 1.000 82.49000  ?  103 LYS B CE    1 
ATOM   5226 N  NZ    . LYS B 2 103 ? 212.40500 76.18300 139.02600 1.000 83.22000  ?  103 LYS B NZ    1 
ATOM   5227 N  N     . LYS B 2 104 ? 217.00700 71.10700 137.17700 1.000 76.23000  ?  104 LYS B N     1 
ATOM   5228 C  CA    . LYS B 2 104 ? 217.88900 69.93800 137.07200 1.000 84.20000  ?  104 LYS B CA    1 
ATOM   5229 C  C     . LYS B 2 104 ? 217.09100 68.64900 136.98700 1.000 83.93000  ?  104 LYS B C     1 
ATOM   5230 O  O     . LYS B 2 104 ? 217.54800 67.64500 136.42800 1.000 81.08000  ?  104 LYS B O     1 
ATOM   5231 C  CB    . LYS B 2 104 ? 218.87700 69.87400 138.24700 1.000 84.76000  ?  104 LYS B CB    1 
ATOM   5232 C  CG    . LYS B 2 104 ? 220.08500 70.79700 138.06000 1.000 96.19000  ?  104 LYS B CG    1 
ATOM   5233 C  CD    . LYS B 2 104 ? 221.41900 70.14700 138.44500 1.000 99.43000  ?  104 LYS B CD    1 
ATOM   5234 C  CE    . LYS B 2 104 ? 222.59800 70.99000 137.93400 1.000 96.65000  ?  104 LYS B CE    1 
ATOM   5235 N  NZ    . LYS B 2 104 ? 223.92200 70.62100 138.52500 1.000 92.45000  ?  104 LYS B NZ    1 
ATOM   5236 N  N     . SER B 2 105 ? 215.89400 68.68100 137.55400 1.000 79.13000  ?  105 SER B N     1 
ATOM   5237 C  CA    . SER B 2 105 ? 214.96800 67.58100 137.40700 1.000 74.60000  ?  105 SER B CA    1 
ATOM   5238 C  C     . SER B 2 105 ? 213.61600 68.13400 137.00300 1.000 74.42000  ?  105 SER B C     1 
ATOM   5239 O  O     . SER B 2 105 ? 213.21600 69.20300 137.46300 1.000 71.95000  ?  105 SER B O     1 
ATOM   5240 C  CB    . SER B 2 105 ? 214.85800 66.77300 138.70200 1.000 77.52000  ?  105 SER B CB    1 
ATOM   5241 O  OG    . SER B 2 105 ? 215.98400 65.93200 138.88900 1.000 78.26000  ?  105 SER B OG    1 
ATOM   5242 N  N     . VAL B 2 106 ? 212.93800 67.42200 136.10700 1.000 77.68000  ?  106 VAL B N     1 
ATOM   5243 C  CA    . VAL B 2 106 ? 211.52500 67.66600 135.83900 1.000 75.37000  ?  106 VAL B CA    1 
ATOM   5244 C  C     . VAL B 2 106 ? 210.81800 66.31900 135.78800 1.000 72.67000  ?  106 VAL B C     1 
ATOM   5245 O  O     . VAL B 2 106 ? 211.30200 65.38000 135.15600 1.000 71.45000  ?  106 VAL B O     1 
ATOM   5246 C  CB    . VAL B 2 106 ? 211.28600 68.43800 134.52600 1.000 65.42000  ?  106 VAL B CB    1 
ATOM   5247 C  CG1   . VAL B 2 106 ? 209.79600 68.60000 134.29500 1.000 65.17000  ?  106 VAL B CG1   1 
ATOM   5248 C  CG2   . VAL B 2 106 ? 211.95300 69.79900 134.57100 1.000 60.64000  ?  106 VAL B CG2   1 
ATOM   5249 N  N     . THR B 2 107 ? 209.69800 66.20800 136.49100 1.000 73.83000  ?  107 THR B N     1 
ATOM   5250 C  CA    . THR B 2 107 ? 208.91100 64.98400 136.43400 1.000 74.05000  ?  107 THR B CA    1 
ATOM   5251 C  C     . THR B 2 107 ? 207.66700 65.25200 135.62200 1.000 67.10000  ?  107 THR B C     1 
ATOM   5252 O  O     . THR B 2 107 ? 207.17300 66.37200 135.59900 1.000 64.43000  ?  107 THR B O     1 
ATOM   5253 C  CB    . THR B 2 107 ? 208.51600 64.46100 137.82700 1.000 71.91000  ?  107 THR B CB    1 
ATOM   5254 O  OG1   . THR B 2 107 ? 209.69200 64.13100 138.56700 1.000 70.62000  ?  107 THR B OG1   1 
ATOM   5255 C  CG2   . THR B 2 107 ? 207.66800 63.21100 137.69700 1.000 75.62000  ?  107 THR B CG2   1 
ATOM   5256 N  N     . VAL B 2 108 ? 207.18100 64.22000 134.94300 1.000 71.63000  ?  108 VAL B N     1 
ATOM   5257 C  CA    . VAL B 2 108 ? 205.97000 64.32600 134.14800 1.000 65.29000  ?  108 VAL B CA    1 
ATOM   5258 C  C     . VAL B 2 108 ? 204.87800 63.47100 134.75800 1.000 68.59000  ?  108 VAL B C     1 
ATOM   5259 O  O     . VAL B 2 108 ? 204.96700 62.23800 134.71400 1.000 64.79000  ?  108 VAL B O     1 
ATOM   5260 C  CB    . VAL B 2 108 ? 206.19700 63.88000 132.69700 1.000 70.16000  ?  108 VAL B CB    1 
ATOM   5261 C  CG1   . VAL B 2 108 ? 204.94600 64.16800 131.84800 1.000 65.45000  ?  108 VAL B CG1   1 
ATOM   5262 C  CG2   . VAL B 2 108 ? 207.43300 64.56700 132.11400 1.000 67.43000  ?  108 VAL B CG2   1 
ATOM   5263 N  N     . LEU B 2 109 ? 203.86000 64.13500 135.31900 1.000 70.52000  ?  109 LEU B N     1 
ATOM   5264 C  CA    . LEU B 2 109 ? 202.69100 63.47800 135.91700 1.000 61.33000  ?  109 LEU B CA    1 
ATOM   5265 C  C     . LEU B 2 109 ? 201.52700 63.42000 134.94700 1.000 63.23000  ?  109 LEU B C     1 
ATOM   5266 O  O     . LEU B 2 109 ? 201.25800 64.38200 134.23400 1.000 69.12000  ?  109 LEU B O     1 
ATOM   5267 C  CB    . LEU B 2 109 ? 202.24900 64.20900 137.18100 1.000 59.24000  ?  109 LEU B CB    1 
ATOM   5268 C  CG    . LEU B 2 109 ? 203.31400 64.36300 138.26100 1.000 66.53000  ?  109 LEU B CG    1 
ATOM   5269 C  CD1   . LEU B 2 109 ? 202.80300 65.24100 139.39200 1.000 71.56000  ?  109 LEU B CD1   1 
ATOM   5270 C  CD2   . LEU B 2 109 ? 203.75100 63.00500 138.78500 1.000 66.73000  ?  109 LEU B CD2   1 
ATOM   5271 N  N     . ASP B 2 110 ? 200.82000 62.30100 134.93100 1.000 60.80000  ?  110 ASP B N     1 
ATOM   5272 C  CA    . ASP B 2 110 ? 199.67200 62.15500 134.05100 1.000 59.68000  ?  110 ASP B CA    1 
ATOM   5273 C  C     . ASP B 2 110 ? 198.40700 62.57900 134.77900 1.000 64.46000  ?  110 ASP B C     1 
ATOM   5274 O  O     . ASP B 2 110 ? 197.85100 61.80800 135.55600 1.000 63.61000  ?  110 ASP B O     1 
ATOM   5275 C  CB    . ASP B 2 110 ? 199.56300 60.70900 133.56400 1.000 56.56000  ?  110 ASP B CB    1 
ATOM   5276 C  CG    . ASP B 2 110 ? 198.41100 60.49900 132.61800 1.000 63.51000  ?  110 ASP B CG    1 
ATOM   5277 O  OD1   . ASP B 2 110 ? 197.79600 61.50400 132.21300 1.000 70.54000  ?  110 ASP B OD1   1 
ATOM   5278 O  OD2   . ASP B 2 110 ? 198.12200 59.33100 132.26500 1.000 65.22000  ?  110 ASP B OD2   1 
ATOM   5279 N  N     . VAL B 2 111 ? 197.94000 63.79800 134.53600 1.000 63.30000  ?  111 VAL B N     1 
ATOM   5280 C  CA    . VAL B 2 111 ? 196.78400 64.26700 135.28500 1.000 59.33000  ?  111 VAL B CA    1 
ATOM   5281 C  C     . VAL B 2 111 ? 195.51400 64.14700 134.46200 1.000 62.22000  ?  111 VAL B C     1 
ATOM   5282 O  O     . VAL B 2 111 ? 194.58400 64.92100 134.64500 1.000 61.86000  ?  111 VAL B O     1 
ATOM   5283 C  CB    . VAL B 2 111 ? 196.96100 65.72000 135.75700 1.000 58.75000  ?  111 VAL B CB    1 
ATOM   5284 C  CG1   . VAL B 2 111 ? 198.19800 65.83300 136.61900 1.000 62.74000  ?  111 VAL B CG1   1 
ATOM   5285 C  CG2   . VAL B 2 111 ? 197.05900 66.65700 134.57800 1.000 63.72000  ?  111 VAL B CG2   1 
ATOM   5286 N  N     . GLY B 2 112 ? 195.47900 63.15900 133.57200 1.000 63.40000  ?  112 GLY B N     1 
ATOM   5287 C  CA    . GLY B 2 112 ? 194.32100 62.91000 132.72200 1.000 66.03000  ?  112 GLY B CA    1 
ATOM   5288 C  C     . GLY B 2 112 ? 192.98000 62.70500 133.42800 1.000 68.44000  ?  112 GLY B C     1 
ATOM   5289 O  O     . GLY B 2 112 ? 191.98500 63.34700 133.07000 1.000 66.51000  ?  112 GLY B O     1 
ATOM   5290 N  N     . ASP B 2 113 ? 192.94800 61.81700 134.42300 1.000 69.21000  ?  113 ASP B N     1 
ATOM   5291 C  CA    . ASP B 2 113 ? 191.71500 61.51000 135.16000 1.000 72.69000  ?  113 ASP B CA    1 
ATOM   5292 C  C     . ASP B 2 113 ? 190.93300 62.75200 135.58900 1.000 72.87000  ?  113 ASP B C     1 
ATOM   5293 O  O     . ASP B 2 113 ? 189.70300 62.73900 135.58400 1.000 71.94000  ?  113 ASP B O     1 
ATOM   5294 C  CB    . ASP B 2 113 ? 192.02000 60.66400 136.39700 1.000 69.57000  ?  113 ASP B CB    1 
ATOM   5295 C  CG    . ASP B 2 113 ? 192.51200 59.27900 136.04300 1.000 77.35000  ?  113 ASP B CG    1 
ATOM   5296 O  OD1   . ASP B 2 113 ? 192.43100 58.91300 134.85500 1.000 79.84000  ?  113 ASP B OD1   1 
ATOM   5297 O  OD2   . ASP B 2 113 ? 192.96900 58.54900 136.94800 1.000 84.11000  ?  113 ASP B OD2   1 
ATOM   5298 N  N     . ALA B 2 114 ? 191.64900 63.81500 135.95200 1.000 70.31000  ?  114 ALA B N     1 
ATOM   5299 C  CA    . ALA B 2 114 ? 191.03300 65.08800 136.32500 1.000 66.57000  ?  114 ALA B CA    1 
ATOM   5300 C  C     . ALA B 2 114 ? 189.90900 65.50500 135.38600 1.000 66.85000  ?  114 ALA B C     1 
ATOM   5301 O  O     . ALA B 2 114 ? 188.86400 65.96100 135.83200 1.000 72.51000  ?  114 ALA B O     1 
ATOM   5302 C  CB    . ALA B 2 114 ? 192.09100 66.19200 136.37600 1.000 65.90000  ?  114 ALA B CB    1 
ATOM   5303 N  N     . TYR B 2 115 ? 190.11700 65.35100 134.08500 1.000 65.98000  ?  115 TYR B N     1 
ATOM   5304 C  CA    . TYR B 2 115 ? 189.16200 65.87300 133.10400 1.000 68.71000  ?  115 TYR B CA    1 
ATOM   5305 C  C     . TYR B 2 115 ? 187.78000 65.19400 133.15300 1.000 66.49000  ?  115 TYR B C     1 
ATOM   5306 O  O     . TYR B 2 115 ? 186.77200 65.78700 132.77800 1.000 64.85000  ?  115 TYR B O     1 
ATOM   5307 C  CB    . TYR B 2 115 ? 189.75600 65.74400 131.70000 1.000 65.35000  ?  115 TYR B CB    1 
ATOM   5308 C  CG    . TYR B 2 115 ? 191.03200 66.52600 131.51500 1.000 64.40000  ?  115 TYR B CG    1 
ATOM   5309 C  CD1   . TYR B 2 115 ? 191.20000 67.74900 132.11900 1.000 63.86000  ?  115 TYR B CD1   1 
ATOM   5310 C  CD2   . TYR B 2 115 ? 192.07300 66.03400 130.73500 1.000 69.35000  ?  115 TYR B CD2   1 
ATOM   5311 C  CE1   . TYR B 2 115 ? 192.35100 68.47200 131.95200 1.000 66.12000  ?  115 TYR B CE1   1 
ATOM   5312 C  CE2   . TYR B 2 115 ? 193.23900 66.75700 130.55900 1.000 64.43000  ?  115 TYR B CE2   1 
ATOM   5313 C  CZ    . TYR B 2 115 ? 193.36500 67.97400 131.17000 1.000 66.60000  ?  115 TYR B CZ    1 
ATOM   5314 O  OH    . TYR B 2 115 ? 194.51200 68.70800 131.01800 1.000 65.55000  ?  115 TYR B OH    1 
ATOM   5315 N  N     . PHE B 2 116 ? 187.73900 63.95100 133.61600 1.000 67.60000  ?  116 PHE B N     1 
ATOM   5316 C  CA    . PHE B 2 116 ? 186.48800 63.20500 133.66100 1.000 69.18000  ?  116 PHE B CA    1 
ATOM   5317 C  C     . PHE B 2 116 ? 185.51500 63.81700 134.66600 1.000 69.52000  ?  116 PHE B C     1 
ATOM   5318 O  O     . PHE B 2 116 ? 184.32800 63.48400 134.69200 1.000 72.01000  ?  116 PHE B O     1 
ATOM   5319 C  CB    . PHE B 2 116 ? 186.76100 61.73300 133.99200 1.000 68.88000  ?  116 PHE B CB    1 
ATOM   5320 C  CG    . PHE B 2 116 ? 187.54700 61.00900 132.92500 1.000 70.54000  ?  116 PHE B CG    1 
ATOM   5321 C  CD1   . PHE B 2 116 ? 187.64600 61.53500 131.64500 1.000 70.94000  ?  116 PHE B CD1   1 
ATOM   5322 C  CD2   . PHE B 2 116 ? 188.18400 59.81200 133.20300 1.000 69.88000  ?  116 PHE B CD2   1 
ATOM   5323 C  CE1   . PHE B 2 116 ? 188.36900 60.88200 130.66400 1.000 76.94000  ?  116 PHE B CE1   1 
ATOM   5324 C  CE2   . PHE B 2 116 ? 188.90000 59.15300 132.23500 1.000 75.03000  ?  116 PHE B CE2   1 
ATOM   5325 C  CZ    . PHE B 2 116 ? 189.00100 59.68800 130.95800 1.000 77.99000  ?  116 PHE B CZ    1 
ATOM   5326 N  N     . SER B 2 117 ? 186.02300 64.73400 135.47700 1.000 68.36000  ?  117 SER B N     1 
ATOM   5327 C  CA    . SER B 2 117 ? 185.22100 65.36100 136.50800 1.000 67.02000  ?  117 SER B CA    1 
ATOM   5328 C  C     . SER B 2 117 ? 184.35100 66.45900 135.94200 1.000 64.31000  ?  117 SER B C     1 
ATOM   5329 O  O     . SER B 2 117 ? 183.44400 66.92800 136.61500 1.000 69.29000  ?  117 SER B O     1 
ATOM   5330 C  CB    . SER B 2 117 ? 186.11700 65.94000 137.59400 1.000 69.94000  ?  117 SER B CB    1 
ATOM   5331 O  OG    . SER B 2 117 ? 186.74900 67.12300 137.13000 1.000 72.06000  ?  117 SER B OG    1 
ATOM   5332 N  N     . VAL B 2 118 ? 184.63700 66.87900 134.71600 1.000 61.66000  ?  118 VAL B N     1 
ATOM   5333 C  CA    . VAL B 2 118 ? 183.91100 67.98500 134.09900 1.000 60.38000  ?  118 VAL B CA    1 
ATOM   5334 C  C     . VAL B 2 118 ? 183.00500 67.49200 132.98800 1.000 65.80000  ?  118 VAL B C     1 
ATOM   5335 O  O     . VAL B 2 118 ? 183.42900 66.71100 132.14300 1.000 71.83000  ?  118 VAL B O     1 
ATOM   5336 C  CB    . VAL B 2 118 ? 184.87100 69.03300 133.52100 1.000 58.73000  ?  118 VAL B CB    1 
ATOM   5337 C  CG1   . VAL B 2 118 ? 184.09900 70.14900 132.83300 1.000 58.60000  ?  118 VAL B CG1   1 
ATOM   5338 C  CG2   . VAL B 2 118 ? 185.74600 69.58400 134.60700 1.000 61.07000  ?  118 VAL B CG2   1 
ATOM   5339 N  N     . PRO B 2 119 ? 181.74500 67.92900 132.98200 1.000 64.27000  ?  119 PRO B N     1 
ATOM   5340 C  CA    . PRO B 2 119 ? 180.92400 67.52100 131.84100 1.000 65.86000  ?  119 PRO B CA    1 
ATOM   5341 C  C     . PRO B 2 119 ? 181.36100 68.23200 130.57600 1.000 62.21000  ?  119 PRO B C     1 
ATOM   5342 O  O     . PRO B 2 119 ? 182.00000 69.27000 130.65700 1.000 64.79000  ?  119 PRO B O     1 
ATOM   5343 C  CB    . PRO B 2 119 ? 179.51000 67.93700 132.25300 1.000 65.05000  ?  119 PRO B CB    1 
ATOM   5344 C  CG    . PRO B 2 119 ? 179.56000 67.98000 133.72500 1.000 60.81000  ?  119 PRO B CG    1 
ATOM   5345 C  CD    . PRO B 2 119 ? 180.93200 68.47900 134.07100 1.000 61.68000  ?  119 PRO B CD    1 
ATOM   5346 N  N     . LEU B 2 120 ? 181.01300 67.66400 129.42900 1.000 69.55000  ?  120 LEU B N     1 
ATOM   5347 C  CA    . LEU B 2 120 ? 181.38900 68.20100 128.12900 1.000 64.93000  ?  120 LEU B CA    1 
ATOM   5348 C  C     . LEU B 2 120 ? 180.15600 68.73900 127.42800 1.000 63.09000  ?  120 LEU B C     1 
ATOM   5349 O  O     . LEU B 2 120 ? 179.13300 68.06700 127.38400 1.000 68.36000  ?  120 LEU B O     1 
ATOM   5350 C  CB    . LEU B 2 120 ? 182.06500 67.11600 127.27500 1.000 63.68000  ?  120 LEU B CB    1 
ATOM   5351 C  CG    . LEU B 2 120 ? 182.31500 67.44300 125.79500 1.000 66.60000  ?  120 LEU B CG    1 
ATOM   5352 C  CD1   . LEU B 2 120 ? 183.33700 68.57700 125.63800 1.000 62.95000  ?  120 LEU B CD1   1 
ATOM   5353 C  CD2   . LEU B 2 120 ? 182.75300 66.20300 125.01100 1.000 63.24000  ?  120 LEU B CD2   1 
ATOM   5354 N  N     . ASP B 2 121 ? 180.25300 69.94800 126.89300 1.000 67.36000  ?  121 ASP B N     1 
ATOM   5355 C  CA    . ASP B 2 121 ? 179.15300 70.56600 126.16000 1.000 70.79000  ?  121 ASP B CA    1 
ATOM   5356 C  C     . ASP B 2 121 ? 178.43700 69.55500 125.28100 1.000 70.15000  ?  121 ASP B C     1 
ATOM   5357 O  O     . ASP B 2 121 ? 179.04000 68.92600 124.41900 1.000 72.84000  ?  121 ASP B O     1 
ATOM   5358 C  CB    . ASP B 2 121 ? 179.66900 71.73700 125.32000 1.000 75.34000  ?  121 ASP B CB    1 
ATOM   5359 C  CG    . ASP B 2 121 ? 178.69800 72.16000 124.21300 1.000 80.17000  ?  121 ASP B CG    1 
ATOM   5360 O  OD1   . ASP B 2 121 ? 177.49400 71.81700 124.25900 1.000 77.92000  ?  121 ASP B OD1   1 
ATOM   5361 O  OD2   . ASP B 2 121 ? 179.15200 72.86400 123.28200 1.000 84.97000  ?  121 ASP B OD2   1 
ATOM   5362 N  N     . GLU B 2 122 ? 177.13700 69.42600 125.50900 1.000 70.84000  ?  122 GLU B N     1 
ATOM   5363 C  CA    . GLU B 2 122 ? 176.31100 68.45600 124.80500 1.000 70.24000  ?  122 GLU B CA    1 
ATOM   5364 C  C     . GLU B 2 122 ? 176.40400 68.54700 123.28800 1.000 70.15000  ?  122 GLU B C     1 
ATOM   5365 O  O     . GLU B 2 122 ? 176.43200 67.52400 122.61700 1.000 73.98000  ?  122 GLU B O     1 
ATOM   5366 C  CB    . GLU B 2 122 ? 174.85200 68.60800 125.23700 1.000 73.76000  ?  122 GLU B CB    1 
ATOM   5367 C  CG    . GLU B 2 122 ? 173.84100 67.97200 124.28500 1.000 79.15000  ?  122 GLU B CG    1 
ATOM   5368 C  CD    . GLU B 2 122 ? 174.02200 66.46200 124.12200 1.000 87.32000  ?  122 GLU B CD    1 
ATOM   5369 O  OE1   . GLU B 2 122 ? 174.64300 65.81300 125.01200 1.000 81.56000  ?  122 GLU B OE1   1 
ATOM   5370 O  OE2   . GLU B 2 122 ? 173.53900 65.93300 123.08900 1.000 84.13000  ?  122 GLU B OE2   1 
ATOM   5371 N  N     . ASP B 2 123 ? 176.45600 69.74900 122.73100 1.000 72.36000  ?  123 ASP B N     1 
ATOM   5372 C  CA    . ASP B 2 123 ? 176.46900 69.85100 121.27500 1.000 71.91000  ?  123 ASP B CA    1 
ATOM   5373 C  C     . ASP B 2 123 ? 177.83600 69.56800 120.68100 1.000 72.35000  ?  123 ASP B C     1 
ATOM   5374 O  O     . ASP B 2 123 ? 177.99600 69.57600 119.46300 1.000 70.25000  ?  123 ASP B O     1 
ATOM   5375 C  CB    . ASP B 2 123 ? 175.99400 71.22200 120.81800 1.000 74.71000  ?  123 ASP B CB    1 
ATOM   5376 C  CG    . ASP B 2 123 ? 174.53100 71.21500 120.42300 1.000 90.96000  ?  123 ASP B CG    1 
ATOM   5377 O  OD1   . ASP B 2 123 ? 174.00100 70.11700 120.13700 1.000 93.22000  ?  123 ASP B OD1   1 
ATOM   5378 O  OD2   . ASP B 2 123 ? 173.91000 72.29900 120.39400 1.000 99.47000  ?  123 ASP B OD2   1 
ATOM   5379 N  N     . PHE B 2 124 ? 178.82000 69.30900 121.53500 1.000 65.07000  ?  124 PHE B N     1 
ATOM   5380 C  CA    . PHE B 2 124 ? 180.15700 69.02800 121.04600 1.000 65.35000  ?  124 PHE B CA    1 
ATOM   5381 C  C     . PHE B 2 124 ? 180.43900 67.53700 121.07700 1.000 65.78000  ?  124 PHE B C     1 
ATOM   5382 O  O     . PHE B 2 124 ? 181.33200 67.05500 120.38000 1.000 61.51000  ?  124 PHE B O     1 
ATOM   5383 C  CB    . PHE B 2 124 ? 181.21300 69.76600 121.86600 1.000 62.16000  ?  124 PHE B CB    1 
ATOM   5384 C  CG    . PHE B 2 124 ? 182.53400 69.85000 121.18400 1.000 60.13000  ?  124 PHE B CG    1 
ATOM   5385 C  CD1   . PHE B 2 124 ? 182.75100 70.79200 120.19500 1.000 62.84000  ?  124 PHE B CD1   1 
ATOM   5386 C  CD2   . PHE B 2 124 ? 183.55500 68.97700 121.50700 1.000 60.03000  ?  124 PHE B CD2   1 
ATOM   5387 C  CE1   . PHE B 2 124 ? 183.95800 70.87100 119.54700 1.000 60.14000  ?  124 PHE B CE1   1 
ATOM   5388 C  CE2   . PHE B 2 124 ? 184.77300 69.05400 120.86200 1.000 54.45000  ?  124 PHE B CE2   1 
ATOM   5389 C  CZ    . PHE B 2 124 ? 184.97000 70.00400 119.88400 1.000 56.89000  ?  124 PHE B CZ    1 
ATOM   5390 N  N     . ARG B 2 125 ? 179.66100 66.81100 121.87200 1.000 60.41000  ?  125 ARG B N     1 
ATOM   5391 C  CA    . ARG B 2 125 ? 179.94500 65.41400 122.15000 1.000 56.72000  ?  125 ARG B CA    1 
ATOM   5392 C  C     . ARG B 2 125 ? 180.06300 64.54000 120.91400 1.000 53.75000  ?  125 ARG B C     1 
ATOM   5393 O  O     . ARG B 2 125 ? 180.92100 63.66100 120.84600 1.000 54.48000  ?  125 ARG B O     1 
ATOM   5394 C  CB    . ARG B 2 125 ? 178.87400 64.86800 123.07000 1.000 56.77000  ?  125 ARG B CB    1 
ATOM   5395 C  CG    . ARG B 2 125 ? 178.77400 65.68100 124.33300 1.000 63.25000  ?  125 ARG B CG    1 
ATOM   5396 C  CD    . ARG B 2 125 ? 177.78600 65.09700 125.30100 1.000 65.18000  ?  125 ARG B CD    1 
ATOM   5397 N  NE    . ARG B 2 125 ? 178.05200 65.54200 126.66300 1.000 68.23000  ?  125 ARG B NE    1 
ATOM   5398 C  CZ    . ARG B 2 125 ? 177.26800 65.25700 127.69300 1.000 69.23000  ?  125 ARG B CZ    1 
ATOM   5399 N  NH1   . ARG B 2 125 ? 176.17800 64.52900 127.49800 1.000 67.17000  ?  125 ARG B NH1   1 
ATOM   5400 N  NH2   . ARG B 2 125 ? 177.57300 65.69500 128.91100 1.000 70.03000  ?  125 ARG B NH2   1 
ATOM   5401 N  N     . LYS B 2 126 ? 179.22200 64.79800 119.93000 1.000 53.62000  ?  126 LYS B N     1 
ATOM   5402 C  CA    . LYS B 2 126 ? 179.19700 63.98000 118.73900 1.000 53.09000  ?  126 LYS B CA    1 
ATOM   5403 C  C     . LYS B 2 126 ? 180.56400 63.94500 118.02800 1.000 52.90000  ?  126 LYS B C     1 
ATOM   5404 O  O     . LYS B 2 126 ? 180.91000 62.96300 117.39600 1.000 51.67000  ?  126 LYS B O     1 
ATOM   5405 C  CB    . LYS B 2 126 ? 178.09700 64.48200 117.80500 1.000 48.92000  ?  126 LYS B CB    1 
ATOM   5406 C  CG    . LYS B 2 126 ? 178.18100 65.94800 117.49500 1.000 52.85000  ?  126 LYS B CG    1 
ATOM   5407 C  CD    . LYS B 2 126 ? 177.40200 66.27500 116.23400 1.000 51.22000  ?  126 LYS B CD    1 
ATOM   5408 C  CE    . LYS B 2 126 ? 176.13800 67.04400 116.53800 1.000 63.51000  ?  126 LYS B CE    1 
ATOM   5409 N  NZ    . LYS B 2 126 ? 176.39200 68.29900 117.31300 1.000 71.99000  ?  126 LYS B NZ    1 
ATOM   5410 N  N     . TYR B 2 127 ? 181.34700 65.00800 118.16200 1.000 53.89000  ?  127 TYR B N     1 
ATOM   5411 C  CA    . TYR B 2 127 ? 182.66500 65.08000 117.53400 1.000 52.73000  ?  127 TYR B CA    1 
ATOM   5412 C  C     . TYR B 2 127 ? 183.70900 64.21100 118.23000 1.000 52.71000  ?  127 TYR B C     1 
ATOM   5413 O  O     . TYR B 2 127 ? 184.82600 64.07400 117.74100 1.000 51.05000  ?  127 TYR B O     1 
ATOM   5414 C  CB    . TYR B 2 127 ? 183.17200 66.52700 117.50600 1.000 53.06000  ?  127 TYR B CB    1 
ATOM   5415 C  CG    . TYR B 2 127 ? 182.22300 67.48000 116.84000 1.000 60.82000  ?  127 TYR B CG    1 
ATOM   5416 C  CD1   . TYR B 2 127 ? 181.75700 67.23700 115.54500 1.000 59.01000  ?  127 TYR B CD1   1 
ATOM   5417 C  CD2   . TYR B 2 127 ? 181.76300 68.61300 117.51200 1.000 59.99000  ?  127 TYR B CD2   1 
ATOM   5418 C  CE1   . TYR B 2 127 ? 180.87100 68.10700 114.93500 1.000 61.51000  ?  127 TYR B CE1   1 
ATOM   5419 C  CE2   . TYR B 2 127 ? 180.88300 69.47700 116.91600 1.000 58.09000  ?  127 TYR B CE2   1 
ATOM   5420 C  CZ    . TYR B 2 127 ? 180.44100 69.22500 115.63200 1.000 61.73000  ?  127 TYR B CZ    1 
ATOM   5421 O  OH    . TYR B 2 127 ? 179.56700 70.09300 115.04200 1.000 65.17000  ?  127 TYR B OH    1 
ATOM   5422 N  N     . THR B 2 128 ? 183.36100 63.64600 119.37800 1.000 50.18000  ?  128 THR B N     1 
ATOM   5423 C  CA    . THR B 2 128 ? 184.30200 62.79900 120.08700 1.000 51.59000  ?  128 THR B CA    1 
ATOM   5424 C  C     . THR B 2 128 ? 183.99100 61.31800 119.91400 1.000 51.66000  ?  128 THR B C     1 
ATOM   5425 O  O     . THR B 2 128 ? 184.53100 60.49500 120.63700 1.000 48.11000  ?  128 THR B O     1 
ATOM   5426 C  CB    . THR B 2 128 ? 184.31700 63.11800 121.56900 1.000 55.43000  ?  128 THR B CB    1 
ATOM   5427 O  OG1   . THR B 2 128 ? 183.08300 62.66300 122.15800 1.000 56.94000  ?  128 THR B OG1   1 
ATOM   5428 C  CG2   . THR B 2 128 ? 184.47600 64.62000 121.76000 1.000 49.49000  ?  128 THR B CG2   1 
ATOM   5429 N  N     . ALA B 2 129 ? 183.12700 60.98500 118.95700 1.000 45.87000  ?  129 ALA B N     1 
ATOM   5430 C  CA    . ALA B 2 129 ? 182.89600 59.59200 118.58100 1.000 47.13000  ?  129 ALA B CA    1 
ATOM   5431 C  C     . ALA B 2 129 ? 184.18400 58.78400 118.25800 1.000 48.39000  ?  129 ALA B C     1 
ATOM   5432 O  O     . ALA B 2 129 ? 185.12800 59.28600 117.63400 1.000 41.86000  ?  129 ALA B O     1 
ATOM   5433 C  CB    . ALA B 2 129 ? 181.95000 59.54000 117.39700 1.000 42.74000  ?  129 ALA B CB    1 
ATOM   5434 N  N     . PHE B 2 130 ? 184.19000 57.52800 118.70400 1.000 48.76000  ?  130 PHE B N     1 
ATOM   5435 C  CA    . PHE B 2 130 ? 185.23100 56.56200 118.35400 1.000 49.46000  ?  130 PHE B CA    1 
ATOM   5436 C  C     . PHE B 2 130 ? 184.64300 55.15100 118.31000 1.000 46.10000  ?  130 PHE B C     1 
ATOM   5437 O  O     . PHE B 2 130 ? 183.54700 54.92200 118.81600 1.000 47.11000  ?  130 PHE B O     1 
ATOM   5438 C  CB    . PHE B 2 130 ? 186.42000 56.62000 119.33400 1.000 42.64000  ?  130 PHE B CB    1 
ATOM   5439 C  CG    . PHE B 2 130 ? 186.07300 56.27100 120.74300 1.000 44.48000  ?  130 PHE B CG    1 
ATOM   5440 C  CD1   . PHE B 2 130 ? 186.11300 54.96000 121.17500 1.000 49.50000  ?  130 PHE B CD1   1 
ATOM   5441 C  CD2   . PHE B 2 130 ? 185.71800 57.24600 121.64100 1.000 45.81000  ?  130 PHE B CD2   1 
ATOM   5442 C  CE1   . PHE B 2 130 ? 185.78400 54.63000 122.47000 1.000 45.70000  ?  130 PHE B CE1   1 
ATOM   5443 C  CE2   . PHE B 2 130 ? 185.38700 56.91700 122.94100 1.000 50.94000  ?  130 PHE B CE2   1 
ATOM   5444 C  CZ    . PHE B 2 130 ? 185.42900 55.60800 123.35600 1.000 48.94000  ?  130 PHE B CZ    1 
ATOM   5445 N  N     . THR B 2 131 ? 185.38900 54.21600 117.72100 1.000 47.55000  ?  131 THR B N     1 
ATOM   5446 C  CA    . THR B 2 131 ? 184.89200 52.87400 117.42700 1.000 44.33000  ?  131 THR B CA    1 
ATOM   5447 C  C     . THR B 2 131 ? 185.86500 51.76200 117.84300 1.000 45.65000  ?  131 THR B C     1 
ATOM   5448 O  O     . THR B 2 131 ? 187.03500 51.76100 117.44900 1.000 41.02000  ?  131 THR B O     1 
ATOM   5449 C  CB    . THR B 2 131 ? 184.60200 52.72700 115.91600 1.000 39.48000  ?  131 THR B CB    1 
ATOM   5450 O  OG1   . THR B 2 131 ? 183.84000 53.84300 115.47500 1.000 48.18000  ?  131 THR B OG1   1 
ATOM   5451 C  CG2   . THR B 2 131 ? 183.81100 51.47600 115.62600 1.000 44.95000  ?  131 THR B CG2   1 
ATOM   5452 N  N     . ILE B 2 132 ? 185.37100 50.79000 118.60400 1.000 43.00000  ?  132 ILE B N     1 
ATOM   5453 C  CA    . ILE B 2 132 ? 186.20400 49.65900 118.98700 1.000 39.78000  ?  132 ILE B CA    1 
ATOM   5454 C  C     . ILE B 2 132 ? 185.99700 48.50800 118.02600 1.000 43.34000  ?  132 ILE B C     1 
ATOM   5455 O  O     . ILE B 2 132 ? 184.87100 48.10000 117.78300 1.000 46.39000  ?  132 ILE B O     1 
ATOM   5456 C  CB    . ILE B 2 132 ? 185.90800 49.20100 120.40100 1.000 44.12000  ?  132 ILE B CB    1 
ATOM   5457 C  CG1   . ILE B 2 132 ? 185.85400 50.40400 121.34300 1.000 44.71000  ?  132 ILE B CG1   1 
ATOM   5458 C  CG2   . ILE B 2 132 ? 186.97000 48.22600 120.88300 1.000 42.90000  ?  132 ILE B CG2   1 
ATOM   5459 C  CD1   . ILE B 2 132 ? 185.80700 50.00800 122.80500 1.000 46.94000  ?  132 ILE B CD1   1 
ATOM   5460 N  N     . PRO B 2 133 ? 187.09200 48.00500 117.44600 1.000 43.59000  ?  133 PRO B N     1 
ATOM   5461 C  CA    . PRO B 2 133 ? 187.08800 46.89900 116.48000 1.000 41.78000  ?  133 PRO B CA    1 
ATOM   5462 C  C     . PRO B 2 133 ? 186.98700 45.57700 117.16800 1.000 40.28000  ?  133 PRO B C     1 
ATOM   5463 O  O     . PRO B 2 133 ? 187.23300 45.53500 118.35800 1.000 48.85000  ?  133 PRO B O     1 
ATOM   5464 C  CB    . PRO B 2 133 ? 188.44800 47.02300 115.79600 1.000 44.66000  ?  133 PRO B CB    1 
ATOM   5465 C  CG    . PRO B 2 133 ? 189.32600 47.57800 116.88400 1.000 44.95000  ?  133 PRO B CG    1 
ATOM   5466 C  CD    . PRO B 2 133 ? 188.44600 48.54800 117.65700 1.000 44.31000  ?  133 PRO B CD    1 
ATOM   5467 N  N     . SER B 2 134 ? 186.64200 44.51900 116.44900 1.000 41.58000  ?  134 SER B N     1 
ATOM   5468 C  CA    . SER B 2 134 ? 186.68200 43.18500 117.02100 1.000 41.53000  ?  134 SER B CA    1 
ATOM   5469 C  C     . SER B 2 134 ? 187.70700 42.32800 116.29000 1.000 41.33000  ?  134 SER B C     1 
ATOM   5470 O  O     . SER B 2 134 ? 188.00400 42.54600 115.13100 1.000 43.88000  ?  134 SER B O     1 
ATOM   5471 C  CB    . SER B 2 134 ? 185.31600 42.51900 116.97200 1.000 39.11000  ?  134 SER B CB    1 
ATOM   5472 O  OG    . SER B 2 134 ? 184.90000 42.36500 115.64100 1.000 45.80000  ?  134 SER B OG    1 
ATOM   5473 N  N     . ILE B 2 135 ? 188.26500 41.35600 116.98600 1.000 40.63000  ?  135 ILE B N     1 
ATOM   5474 C  CA    . ILE B 2 135 ? 189.15300 40.42200 116.34400 1.000 41.14000  ?  135 ILE B CA    1 
ATOM   5475 C  C     . ILE B 2 135 ? 188.41500 39.65800 115.24900 1.000 41.35000  ?  135 ILE B C     1 
ATOM   5476 O  O     . ILE B 2 135 ? 187.37600 39.06900 115.49800 1.000 42.08000  ?  135 ILE B O     1 
ATOM   5477 C  CB    . ILE B 2 135 ? 189.73900 39.43900 117.36800 1.000 46.93000  ?  135 ILE B CB    1 
ATOM   5478 C  CG1   . ILE B 2 135 ? 190.69900 40.15900 118.30700 1.000 47.87000  ?  135 ILE B CG1   1 
ATOM   5479 C  CG2   . ILE B 2 135 ? 190.47600 38.31900 116.69300 1.000 43.67000  ?  135 ILE B CG2   1 
ATOM   5480 C  CD1   . ILE B 2 135 ? 190.61500 39.62700 119.71300 1.000 52.00000  ?  135 ILE B CD1   1 
ATOM   5481 N  N     . ASN B 2 136 ? 188.97000 39.67200 114.04100 1.000 41.05000  ?  136 ASN B N     1 
ATOM   5482 C  CA    . ASN B 2 136 ? 188.45200 38.89200 112.92000 1.000 37.21000  ?  136 ASN B CA    1 
ATOM   5483 C  C     . ASN B 2 136 ? 187.03900 39.33100 112.56800 1.000 39.71000  ?  136 ASN B C     1 
ATOM   5484 O  O     . ASN B 2 136 ? 186.27000 38.59000 111.92100 1.000 40.88000  ?  136 ASN B O     1 
ATOM   5485 C  CB    . ASN B 2 136 ? 188.50300 37.38900 113.22900 1.000 35.18000  ?  136 ASN B CB    1 
ATOM   5486 C  CG    . ASN B 2 136 ? 188.33400 36.51400 111.98000 1.000 38.89000  ?  136 ASN B CG    1 
ATOM   5487 O  OD1   . ASN B 2 136 ? 188.59600 36.94400 110.86200 1.000 38.89000  ?  136 ASN B OD1   1 
ATOM   5488 N  ND2   . ASN B 2 136 ? 187.87300 35.28300 112.17800 1.000 39.44000  ?  136 ASN B ND2   1 
ATOM   5489 N  N     . ASN B 2 137 ? 186.70500 40.55400 112.96900 1.000 38.71000  ?  137 ASN B N     1 
ATOM   5490 C  CA    . ASN B 2 137 ? 185.42700 41.13500 112.61200 1.000 37.22000  ?  137 ASN B CA    1 
ATOM   5491 C  C     . ASN B 2 137 ? 184.28000 40.23200 113.06300 1.000 40.40000  ?  137 ASN B C     1 
ATOM   5492 O  O     . ASN B 2 137 ? 183.35400 39.95600 112.32900 1.000 38.18000  ?  137 ASN B O     1 
ATOM   5493 C  CB    . ASN B 2 137 ? 185.37000 41.38600 111.10300 1.000 36.53000  ?  137 ASN B CB    1 
ATOM   5494 C  CG    . ASN B 2 137 ? 186.34300 42.49000 110.65200 1.000 42.33000  ?  137 ASN B CG    1 
ATOM   5495 O  OD1   . ASN B 2 137 ? 186.07600 43.68400 110.83300 1.000 42.32000  ?  137 ASN B OD1   1 
ATOM   5496 N  ND2   . ASN B 2 137 ? 187.48000 42.08900 110.07300 1.000 36.80000  ?  137 ASN B ND2   1 
ATOM   5497 N  N     . GLU B 2 138 ? 184.38000 39.72900 114.27700 1.000 42.04000  ?  138 GLU B N     1 
ATOM   5498 C  CA    . GLU B 2 138 ? 183.34100 38.87700 114.79600 1.000 40.93000  ?  138 GLU B CA    1 
ATOM   5499 C  C     . GLU B 2 138 ? 182.06700 39.69600 114.90800 1.000 41.54000  ?  138 GLU B C     1 
ATOM   5500 O  O     . GLU B 2 138 ? 180.97000 39.18200 114.72700 1.000 41.47000  ?  138 GLU B O     1 
ATOM   5501 C  CB    . GLU B 2 138 ? 183.76200 38.30800 116.14900 1.000 41.08000  ?  138 GLU B CB    1 
ATOM   5502 C  CG    . GLU B 2 138 ? 182.65000 37.69800 116.95000 1.000 44.30000  ?  138 GLU B CG    1 
ATOM   5503 C  CD    . GLU B 2 138 ? 183.09000 37.26100 118.33800 1.000 50.19000  ?  138 GLU B CD    1 
ATOM   5504 O  OE1   . GLU B 2 138 ? 182.20900 37.18800 119.24100 1.000 54.78000  ?  138 GLU B OE1   1 
ATOM   5505 O  OE2   . GLU B 2 138 ? 184.30800 36.97700 118.51100 1.000 52.14000  ?  138 GLU B OE2   1 
ATOM   5506 N  N     . THR B 2 139 ? 182.22100 40.98100 115.20700 1.000 40.41000  ?  139 THR B N     1 
ATOM   5507 C  CA    . THR B 2 139 ? 181.08100 41.87500 115.28200 1.000 43.95000  ?  139 THR B CA    1 
ATOM   5508 C  C     . THR B 2 139 ? 181.39000 43.14700 114.51300 1.000 44.43000  ?  139 THR B C     1 
ATOM   5509 O  O     . THR B 2 139 ? 182.54500 43.41700 114.22300 1.000 45.96000  ?  139 THR B O     1 
ATOM   5510 C  CB    . THR B 2 139 ? 180.71500 42.23700 116.74200 1.000 43.90000  ?  139 THR B CB    1 
ATOM   5511 O  OG1   . THR B 2 139 ? 181.55400 43.29600 117.20200 1.000 40.76000  ?  139 THR B OG1   1 
ATOM   5512 C  CG2   . THR B 2 139 ? 180.88900 41.03100 117.64900 1.000 41.79000  ?  139 THR B CG2   1 
ATOM   5513 N  N     . PRO B 2 140 ? 180.35000 43.91100 114.14700 1.000 42.07000  ?  140 PRO B N     1 
ATOM   5514 C  CA    . PRO B 2 140 ? 180.59500 45.28500 113.71400 1.000 37.16000  ?  140 PRO B CA    1 
ATOM   5515 C  C     . PRO B 2 140 ? 181.32400 46.03900 114.82300 1.000 42.12000  ?  140 PRO B C     1 
ATOM   5516 O  O     . PRO B 2 140 ? 181.24100 45.62300 115.97300 1.000 42.26000  ?  140 PRO B O     1 
ATOM   5517 C  CB    . PRO B 2 140 ? 179.18500 45.85700 113.52300 1.000 40.82000  ?  140 PRO B CB    1 
ATOM   5518 C  CG    . PRO B 2 140 ? 178.28000 44.67200 113.42400 1.000 37.01000  ?  140 PRO B CG    1 
ATOM   5519 C  CD    . PRO B 2 140 ? 178.91500 43.57000 114.19300 1.000 37.46000  ?  140 PRO B CD    1 
ATOM   5520 N  N     . GLY B 2 141 ? 181.99900 47.13400 114.50100 1.000 41.17000  ?  141 GLY B N     1 
ATOM   5521 C  CA    . GLY B 2 141 ? 182.57000 47.99600 115.51700 1.000 41.81000  ?  141 GLY B CA    1 
ATOM   5522 C  C     . GLY B 2 141 ? 181.54700 48.55400 116.49600 1.000 46.15000  ?  141 GLY B C     1 
ATOM   5523 O  O     . GLY B 2 141 ? 180.39900 48.80100 116.14000 1.000 50.39000  ?  141 GLY B O     1 
ATOM   5524 N  N     . ILE B 2 142 ? 181.98100 48.76400 117.73400 1.000 46.92000  ?  142 ILE B N     1 
ATOM   5525 C  CA    . ILE B 2 142 ? 181.15400 49.34500 118.78300 1.000 47.02000  ?  142 ILE B CA    1 
ATOM   5526 C  C     . ILE B 2 142 ? 181.49500 50.82700 119.00500 1.000 47.04000  ?  142 ILE B C     1 
ATOM   5527 O  O     . ILE B 2 142 ? 182.61000 51.15700 119.37600 1.000 48.71000  ?  142 ILE B O     1 
ATOM   5528 C  CB    . ILE B 2 142 ? 181.34600 48.58300 120.09600 1.000 48.79000  ?  142 ILE B CB    1 
ATOM   5529 C  CG1   . ILE B 2 142 ? 181.26000 47.06800 119.86100 1.000 47.97000  ?  142 ILE B CG1   1 
ATOM   5530 C  CG2   . ILE B 2 142 ? 180.34800 49.03900 121.11600 1.000 49.90000  ?  142 ILE B CG2   1 
ATOM   5531 C  CD1   . ILE B 2 142 ? 179.91600 46.57100 119.42400 1.000 43.09000  ?  142 ILE B CD1   1 
ATOM   5532 N  N     . ARG B 2 143 ? 180.54100 51.72000 118.77400 1.000 50.21000  ?  143 ARG B N     1 
ATOM   5533 C  CA    . ARG B 2 143 ? 180.82900 53.15500 118.80000 1.000 48.44000  ?  143 ARG B CA    1 
ATOM   5534 C  C     . ARG B 2 143 ? 180.43800 53.81300 120.09800 1.000 51.55000  ?  143 ARG B C     1 
ATOM   5535 O  O     . ARG B 2 143 ? 179.41800 53.47200 120.69000 1.000 52.81000  ?  143 ARG B O     1 
ATOM   5536 C  CB    . ARG B 2 143 ? 180.09900 53.87800 117.68100 1.000 53.67000  ?  143 ARG B CB    1 
ATOM   5537 C  CG    . ARG B 2 143 ? 180.08700 53.15700 116.38700 1.000 52.79000  ?  143 ARG B CG    1 
ATOM   5538 C  CD    . ARG B 2 143 ? 180.64000 54.05000 115.34700 1.000 51.09000  ?  143 ARG B CD    1 
ATOM   5539 N  NE    . ARG B 2 143 ? 179.94700 55.32200 115.21200 1.000 43.88000  ?  143 ARG B NE    1 
ATOM   5540 C  CZ    . ARG B 2 143 ? 180.62700 56.45200 115.07600 1.000 49.56000  ?  143 ARG B CZ    1 
ATOM   5541 N  NH1   . ARG B 2 143 ? 181.94100 56.37500 115.09800 1.000 46.75000  ?  143 ARG B NH1   1 
ATOM   5542 N  NH2   . ARG B 2 143 ? 180.03600 57.63200 114.91000 1.000 48.79000  ?  143 ARG B NH2   1 
ATOM   5543 N  N     . TYR B 2 144 ? 181.24000 54.79300 120.50200 1.000 52.09000  ?  144 TYR B N     1 
ATOM   5544 C  CA    . TYR B 2 144 ? 181.05400 55.50100 121.75400 1.000 48.93000  ?  144 TYR B CA    1 
ATOM   5545 C  C     . TYR B 2 144 ? 181.16000 56.99000 121.54200 1.000 51.70000  ?  144 TYR B C     1 
ATOM   5546 O  O     . TYR B 2 144 ? 181.53700 57.45600 120.47400 1.000 54.74000  ?  144 TYR B O     1 
ATOM   5547 C  CB    . TYR B 2 144 ? 182.09000 55.08100 122.78400 1.000 45.91000  ?  144 TYR B CB    1 
ATOM   5548 C  CG    . TYR B 2 144 ? 181.85200 53.72800 123.39900 1.000 52.55000  ?  144 TYR B CG    1 
ATOM   5549 C  CD1   . TYR B 2 144 ? 181.01200 53.58500 124.50000 1.000 55.53000  ?  144 TYR B CD1   1 
ATOM   5550 C  CD2   . TYR B 2 144 ? 182.48500 52.59600 122.90200 1.000 47.62000  ?  144 TYR B CD2   1 
ATOM   5551 C  CE1   . TYR B 2 144 ? 180.80500 52.35900 125.08000 1.000 55.05000  ?  144 TYR B CE1   1 
ATOM   5552 C  CE2   . TYR B 2 144 ? 182.29100 51.36500 123.47300 1.000 48.53000  ?  144 TYR B CE2   1 
ATOM   5553 C  CZ    . TYR B 2 144 ? 181.44700 51.24800 124.56700 1.000 58.67000  ?  144 TYR B CZ    1 
ATOM   5554 O  OH    . TYR B 2 144 ? 181.23000 50.01800 125.15800 1.000 61.43000  ?  144 TYR B OH    1 
ATOM   5555 N  N     . GLN B 2 145 ? 180.87500 57.72400 122.60600 1.000 54.39000  ?  145 GLN B N     1 
ATOM   5556 C  CA    . GLN B 2 145 ? 180.87800 59.17300 122.59600 1.000 51.34000  ?  145 GLN B CA    1 
ATOM   5557 C  C     . GLN B 2 145 ? 181.24600 59.64400 124.00100 1.000 55.76000  ?  145 GLN B C     1 
ATOM   5558 O  O     . GLN B 2 145 ? 180.97500 58.95000 124.98400 1.000 56.72000  ?  145 GLN B O     1 
ATOM   5559 C  CB    . GLN B 2 145 ? 179.51900 59.67600 122.19100 1.000 50.82000  ?  145 GLN B CB    1 
ATOM   5560 C  CG    . GLN B 2 145 ? 179.50600 61.01200 121.60200 1.000 54.08000  ?  145 GLN B CG    1 
ATOM   5561 C  CD    . GLN B 2 145 ? 178.08400 61.46100 121.36200 1.000 55.18000  ?  145 GLN B CD    1 
ATOM   5562 O  OE1   . GLN B 2 145 ? 177.64300 61.61300 120.21300 1.000 55.69000  ?  145 GLN B OE1   1 
ATOM   5563 N  NE2   . GLN B 2 145 ? 177.34200 61.64900 122.45000 1.000 50.83000  ?  145 GLN B NE2   1 
ATOM   5564 N  N     . TYR B 2 146 ? 181.87100 60.80800 124.10600 1.000 56.88000  ?  146 TYR B N     1 
ATOM   5565 C  CA    . TYR B 2 146 ? 182.28900 61.30600 125.40700 1.000 56.52000  ?  146 TYR B CA    1 
ATOM   5566 C  C     . TYR B 2 146 ? 181.22800 62.19600 126.06000 1.000 58.35000  ?  146 TYR B C     1 
ATOM   5567 O  O     . TYR B 2 146 ? 180.55700 62.97300 125.37600 1.000 61.12000  ?  146 TYR B O     1 
ATOM   5568 C  CB    . TYR B 2 146 ? 183.59600 62.07600 125.26300 1.000 55.55000  ?  146 TYR B CB    1 
ATOM   5569 C  CG    . TYR B 2 146 ? 184.78500 61.22300 125.54600 1.000 57.16000  ?  146 TYR B CG    1 
ATOM   5570 C  CD1   . TYR B 2 146 ? 185.11400 60.89600 126.84700 1.000 57.86000  ?  146 TYR B CD1   1 
ATOM   5571 C  CD2   . TYR B 2 146 ? 185.56900 60.72600 124.51700 1.000 51.20000  ?  146 TYR B CD2   1 
ATOM   5572 C  CE1   . TYR B 2 146 ? 186.18600 60.11300 127.11900 1.000 58.19000  ?  146 TYR B CE1   1 
ATOM   5573 C  CE2   . TYR B 2 146 ? 186.63500 59.93400 124.77800 1.000 48.46000  ?  146 TYR B CE2   1 
ATOM   5574 C  CZ    . TYR B 2 146 ? 186.94200 59.63500 126.08400 1.000 55.43000  ?  146 TYR B CZ    1 
ATOM   5575 O  OH    . TYR B 2 146 ? 188.01000 58.84100 126.38000 1.000 60.17000  ?  146 TYR B OH    1 
ATOM   5576 N  N     . ASN B 2 147 ? 181.09100 62.10000 127.37900 1.000 57.90000  ?  147 ASN B N     1 
ATOM   5577 C  CA    . ASN B 2 147 ? 180.18300 62.98300 128.12800 1.000 63.38000  ?  147 ASN B CA    1 
ATOM   5578 C  C     . ASN B 2 147 ? 180.92700 63.89400 129.10500 1.000 68.34000  ?  147 ASN B C     1 
ATOM   5579 O  O     . ASN B 2 147 ? 180.35400 64.83800 129.66100 1.000 64.93000  ?  147 ASN B O     1 
ATOM   5580 C  CB    . ASN B 2 147 ? 179.15000 62.16800 128.90100 1.000 57.26000  ?  147 ASN B CB    1 
ATOM   5581 C  CG    . ASN B 2 147 ? 178.33600 61.26700 128.00700 1.000 58.28000  ?  147 ASN B CG    1 
ATOM   5582 O  OD1   . ASN B 2 147 ? 177.88200 61.67000 126.92200 1.000 55.95000  ?  147 ASN B OD1   1 
ATOM   5583 N  ND2   . ASN B 2 147 ? 178.15700 60.02000 128.45000 1.000 54.17000  ?  147 ASN B ND2   1 
ATOM   5584 N  N     . VAL B 2 148 ? 182.20100 63.58200 129.31900 1.000 64.55000  ?  148 VAL B N     1 
ATOM   5585 C  CA    . VAL B 2 148 ? 183.07200 64.40800 130.12600 1.000 62.72000  ?  148 VAL B CA    1 
ATOM   5586 C  C     . VAL B 2 148 ? 184.16600 64.97100 129.23000 1.000 64.26000  ?  148 VAL B C     1 
ATOM   5587 O  O     . VAL B 2 148 ? 184.08900 64.83500 128.00600 1.000 65.55000  ?  148 VAL B O     1 
ATOM   5588 C  CB    . VAL B 2 148 ? 183.65400 63.60800 131.27100 1.000 67.71000  ?  148 VAL B CB    1 
ATOM   5589 C  CG1   . VAL B 2 148 ? 182.51500 63.14800 132.18700 1.000 64.34000  ?  148 VAL B CG1   1 
ATOM   5590 C  CG2   . VAL B 2 148 ? 184.43400 62.41300 130.73100 1.000 64.49000  ?  148 VAL B CG2   1 
ATOM   5591 N  N     . LEU B 2 149 ? 185.15800 65.64000 129.81200 1.000 64.84000  ?  149 LEU B N     1 
ATOM   5592 C  CA    . LEU B 2 149 ? 186.25600 66.15800 128.99800 1.000 60.93000  ?  149 LEU B CA    1 
ATOM   5593 C  C     . LEU B 2 149 ? 187.15000 64.99600 128.67300 1.000 60.37000  ?  149 LEU B C     1 
ATOM   5594 O  O     . LEU B 2 149 ? 187.70900 64.36400 129.57600 1.000 60.95000  ?  149 LEU B O     1 
ATOM   5595 C  CB    . LEU B 2 149 ? 187.06100 67.24300 129.71200 1.000 61.97000  ?  149 LEU B CB    1 
ATOM   5596 C  CG    . LEU B 2 149 ? 186.44700 68.58600 130.09100 1.000 62.69000  ?  149 LEU B CG    1 
ATOM   5597 C  CD1   . LEU B 2 149 ? 187.44700 69.31400 130.97000 1.000 60.31000  ?  149 LEU B CD1   1 
ATOM   5598 C  CD2   . LEU B 2 149 ? 186.06900 69.41900 128.86500 1.000 57.59000  ?  149 LEU B CD2   1 
ATOM   5599 N  N     . PRO B 2 150 ? 187.28600 64.69800 127.38200 1.000 61.08000  ?  150 PRO B N     1 
ATOM   5600 C  CA    . PRO B 2 150 ? 188.12800 63.56000 126.99700 1.000 59.72000  ?  150 PRO B CA    1 
ATOM   5601 C  C     . PRO B 2 150 ? 189.60800 63.91500 127.09600 1.000 56.50000  ?  150 PRO B C     1 
ATOM   5602 O  O     . PRO B 2 150 ? 189.98100 65.03100 126.74300 1.000 56.19000  ?  150 PRO B O     1 
ATOM   5603 C  CB    . PRO B 2 150 ? 187.70900 63.28900 125.55200 1.000 55.84000  ?  150 PRO B CB    1 
ATOM   5604 C  CG    . PRO B 2 150 ? 187.24000 64.64500 125.04600 1.000 59.51000  ?  150 PRO B CG    1 
ATOM   5605 C  CD    . PRO B 2 150 ? 186.70200 65.40700 126.22700 1.000 56.90000  ?  150 PRO B CD    1 
ATOM   5606 N  N     . GLN B 2 151 ? 190.42700 62.99500 127.60200 1.000 57.92000  ?  151 GLN B N     1 
ATOM   5607 C  CA    . GLN B 2 151 ? 191.88500 63.13800 127.53600 1.000 57.56000  ?  151 GLN B CA    1 
ATOM   5608 C  C     . GLN B 2 151 ? 192.34000 63.21100 126.08200 1.000 57.84000  ?  151 GLN B C     1 
ATOM   5609 O  O     . GLN B 2 151 ? 191.70200 62.64900 125.18700 1.000 60.81000  ?  151 GLN B O     1 
ATOM   5610 C  CB    . GLN B 2 151 ? 192.57500 61.97300 128.24700 1.000 57.28000  ?  151 GLN B CB    1 
ATOM   5611 C  CG    . GLN B 2 151 ? 192.11500 61.82300 129.66700 1.000 62.83000  ?  151 GLN B CG    1 
ATOM   5612 C  CD    . GLN B 2 151 ? 192.61900 60.57600 130.33500 1.000 70.61000  ?  151 GLN B CD    1 
ATOM   5613 O  OE1   . GLN B 2 151 ? 193.59100 60.61500 131.09700 1.000 71.51000  ?  151 GLN B OE1   1 
ATOM   5614 N  NE2   . GLN B 2 151 ? 191.94500 59.45700 130.08300 1.000 71.65000  ?  151 GLN B NE2   1 
ATOM   5615 N  N     . GLY B 2 152 ? 193.43100 63.91300 125.82200 1.000 54.86000  ?  152 GLY B N     1 
ATOM   5616 C  CA    . GLY B 2 152 ? 193.91800 63.99800 124.45600 1.000 49.78000  ?  152 GLY B CA    1 
ATOM   5617 C  C     . GLY B 2 152 ? 193.35500 65.17000 123.68500 1.000 51.31000  ?  152 GLY B C     1 
ATOM   5618 O  O     . GLY B 2 152 ? 193.91700 65.57000 122.67200 1.000 58.42000  ?  152 GLY B O     1 
ATOM   5619 N  N     . TRP B 2 153 ? 192.25100 65.73400 124.16000 1.000 52.10000  ?  153 TRP B N     1 
ATOM   5620 C  CA    . TRP B 2 153 ? 191.64300 66.88600 123.49100 1.000 55.89000  ?  153 TRP B CA    1 
ATOM   5621 C  C     . TRP B 2 153 ? 192.21600 68.20200 123.98900 1.000 57.64000  ?  153 TRP B C     1 
ATOM   5622 O  O     . TRP B 2 153 ? 192.38400 68.38800 125.18700 1.000 54.74000  ?  153 TRP B O     1 
ATOM   5623 C  CB    . TRP B 2 153 ? 190.14000 66.88300 123.70200 1.000 51.84000  ?  153 TRP B CB    1 
ATOM   5624 C  CG    . TRP B 2 153 ? 189.43500 68.00400 123.01500 1.000 59.66000  ?  153 TRP B CG    1 
ATOM   5625 C  CD1   . TRP B 2 153 ? 189.57800 68.39400 121.71300 1.000 61.73000  ?  153 TRP B CD1   1 
ATOM   5626 C  CD2   . TRP B 2 153 ? 188.43200 68.85500 123.57900 1.000 60.63000  ?  153 TRP B CD2   1 
ATOM   5627 N  NE1   . TRP B 2 153 ? 188.73600 69.43900 121.43500 1.000 60.13000  ?  153 TRP B NE1   1 
ATOM   5628 C  CE2   . TRP B 2 153 ? 188.02100 69.74400 122.56500 1.000 61.43000  ?  153 TRP B CE2   1 
ATOM   5629 C  CE3   . TRP B 2 153 ? 187.84400 68.95300 124.84500 1.000 59.06000  ?  153 TRP B CE3   1 
ATOM   5630 C  CZ2   . TRP B 2 153 ? 187.05200 70.72400 122.77800 1.000 59.18000  ?  153 TRP B CZ2   1 
ATOM   5631 C  CZ3   . TRP B 2 153 ? 186.88500 69.92200 125.05300 1.000 60.96000  ?  153 TRP B CZ3   1 
ATOM   5632 C  CH2   . TRP B 2 153 ? 186.49900 70.80000 124.02300 1.000 59.95000  ?  153 TRP B CH2   1 
ATOM   5633 N  N     . LYS B 2 154 ? 192.49400 69.13200 123.08100 1.000 61.65000  ?  154 LYS B N     1 
ATOM   5634 C  CA    . LYS B 2 154 ? 193.13600 70.37600 123.49300 1.000 62.15000  ?  154 LYS B CA    1 
ATOM   5635 C  C     . LYS B 2 154 ? 192.14300 71.25300 124.26700 1.000 63.82000  ?  154 LYS B C     1 
ATOM   5636 O  O     . LYS B 2 154 ? 192.54000 72.17300 124.98200 1.000 67.43000  ?  154 LYS B O     1 
ATOM   5637 C  CB    . LYS B 2 154 ? 193.70900 71.13200 122.28900 1.000 59.87000  ?  154 LYS B CB    1 
ATOM   5638 C  CG    . LYS B 2 154 ? 192.67400 71.85800 121.45000 1.000 59.49000  ?  154 LYS B CG    1 
ATOM   5639 C  CD    . LYS B 2 154 ? 193.33600 72.70000 120.37900 1.000 59.04000  ?  154 LYS B CD    1 
ATOM   5640 C  CE    . LYS B 2 154 ? 192.72200 74.08800 120.32500 1.000 68.83000  ?  154 LYS B CE    1 
ATOM   5641 N  NZ    . LYS B 2 154 ? 192.89400 74.77200 119.00300 1.000 73.03000  ?  154 LYS B NZ    1 
ATOM   5642 N  N     . GLY B 2 155 ? 190.85400 70.95400 124.14100 1.000 59.48000  ?  155 GLY B N     1 
ATOM   5643 C  CA    . GLY B 2 155 ? 189.84600 71.69400 124.87100 1.000 58.68000  ?  155 GLY B CA    1 
ATOM   5644 C  C     . GLY B 2 155 ? 189.84700 71.35800 126.34800 1.000 61.19000  ?  155 GLY B C     1 
ATOM   5645 O  O     . GLY B 2 155 ? 189.47800 72.18000 127.17600 1.000 61.89000  ?  155 GLY B O     1 
ATOM   5646 N  N     . SER B 2 156 ? 190.26900 70.14200 126.67400 1.000 63.41000  ?  156 SER B N     1 
ATOM   5647 C  CA    . SER B 2 156 ? 190.24800 69.65200 128.05100 1.000 63.50000  ?  156 SER B CA    1 
ATOM   5648 C  C     . SER B 2 156 ? 191.12200 70.46200 129.00300 1.000 67.16000  ?  156 SER B C     1 
ATOM   5649 O  O     . SER B 2 156 ? 190.66100 70.86600 130.07300 1.000 68.17000  ?  156 SER B O     1 
ATOM   5650 C  CB    . SER B 2 156 ? 190.68000 68.18600 128.09800 1.000 60.95000  ?  156 SER B CB    1 
ATOM   5651 O  OG    . SER B 2 156 ? 189.67700 67.35700 127.54800 1.000 63.51000  ?  156 SER B OG    1 
ATOM   5652 N  N     . PRO B 2 157 ? 192.39500 70.68600 128.63800 1.000 67.70000  ?  157 PRO B N     1 
ATOM   5653 C  CA    . PRO B 2 157 ? 193.22800 71.44100 129.57800 1.000 63.54000  ?  157 PRO B CA    1 
ATOM   5654 C  C     . PRO B 2 157 ? 192.74300 72.88200 129.67400 1.000 64.86000  ?  157 PRO B C     1 
ATOM   5655 O  O     . PRO B 2 157 ? 192.77000 73.45800 130.75200 1.000 65.83000  ?  157 PRO B O     1 
ATOM   5656 C  CB    . PRO B 2 157 ? 194.61900 71.36000 128.95800 1.000 57.03000  ?  157 PRO B CB    1 
ATOM   5657 C  CG    . PRO B 2 157 ? 194.34500 71.22800 127.48900 1.000 62.70000  ?  157 PRO B CG    1 
ATOM   5658 C  CD    . PRO B 2 157 ? 193.09400 70.41100 127.36900 1.000 62.23000  ?  157 PRO B CD    1 
ATOM   5659 N  N     . ALA B 2 158 ? 192.29200 73.44100 128.55500 1.000 65.69000  ?  158 ALA B N     1 
ATOM   5660 C  CA    . ALA B 2 158 ? 191.77300 74.80200 128.53200 1.000 62.84000  ?  158 ALA B CA    1 
ATOM   5661 C  C     . ALA B 2 158 ? 190.62700 74.95600 129.52200 1.000 66.50000  ?  158 ALA B C     1 
ATOM   5662 O  O     . ALA B 2 158 ? 190.69100 75.75400 130.45200 1.000 71.24000  ?  158 ALA B O     1 
ATOM   5663 C  CB    . ALA B 2 158 ? 191.31500 75.17400 127.13100 1.000 54.15000  ?  158 ALA B CB    1 
ATOM   5664 N  N     . ILE B 2 159 ? 189.58300 74.17000 129.33100 1.000 61.52000  ?  159 ILE B N     1 
ATOM   5665 C  CA    . ILE B 2 159 ? 188.36900 74.34900 130.09400 1.000 63.83000  ?  159 ILE B CA    1 
ATOM   5666 C  C     . ILE B 2 159 ? 188.62200 74.08700 131.57900 1.000 66.79000  ?  159 ILE B C     1 
ATOM   5667 O  O     . ILE B 2 159 ? 188.03700 74.73600 132.45400 1.000 70.13000  ?  159 ILE B O     1 
ATOM   5668 C  CB    . ILE B 2 159 ? 187.24300 73.44300 129.52700 1.000 63.95000  ?  159 ILE B CB    1 
ATOM   5669 C  CG1   . ILE B 2 159 ? 186.81600 73.97000 128.15900 1.000 59.07000  ?  159 ILE B CG1   1 
ATOM   5670 C  CG2   . ILE B 2 159 ? 186.03800 73.39700 130.44600 1.000 61.01000  ?  159 ILE B CG2   1 
ATOM   5671 C  CD1   . ILE B 2 159 ? 185.73500 73.15500 127.51700 1.000 69.61000  ?  159 ILE B CD1   1 
ATOM   5672 N  N     . PHE B 2 160 ? 189.53300 73.17000 131.86600 1.000 65.05000  ?  160 PHE B N     1 
ATOM   5673 C  CA    . PHE B 2 160 ? 189.80800 72.78200 133.25000 1.000 64.07000  ?  160 PHE B CA    1 
ATOM   5674 C  C     . PHE B 2 160 ? 190.84400 73.70500 133.89000 1.000 68.32000  ?  160 PHE B C     1 
ATOM   5675 O  O     . PHE B 2 160 ? 191.17300 73.55100 135.05600 1.000 71.84000  ?  160 PHE B O     1 
ATOM   5676 C  CB    . PHE B 2 160 ? 190.28000 71.33600 133.26400 1.000 62.34000  ?  160 PHE B CB    1 
ATOM   5677 C  CG    . PHE B 2 160 ? 190.39700 70.72600 134.61400 1.000 59.42000  ?  160 PHE B CG    1 
ATOM   5678 C  CD1   . PHE B 2 160 ? 189.32200 70.08800 135.18500 1.000 64.51000  ?  160 PHE B CD1   1 
ATOM   5679 C  CD2   . PHE B 2 160 ? 191.61000 70.71800 135.28000 1.000 66.36000  ?  160 PHE B CD2   1 
ATOM   5680 C  CE1   . PHE B 2 160 ? 189.43900 69.48000 136.41700 1.000 68.13000  ?  160 PHE B CE1   1 
ATOM   5681 C  CE2   . PHE B 2 160 ? 191.73900 70.12600 136.51500 1.000 62.35000  ?  160 PHE B CE2   1 
ATOM   5682 C  CZ    . PHE B 2 160 ? 190.65100 69.49700 137.08200 1.000 66.54000  ?  160 PHE B CZ    1 
ATOM   5683 N  N     . GLN B 2 161 ? 191.34600 74.66300 133.11200 1.000 68.44000  ?  161 GLN B N     1 
ATOM   5684 C  CA    . GLN B 2 161 ? 192.38800 75.59800 133.54300 1.000 68.43000  ?  161 GLN B CA    1 
ATOM   5685 C  C     . GLN B 2 161 ? 192.04800 76.25500 134.87700 1.000 72.27000  ?  161 GLN B C     1 
ATOM   5686 O  O     . GLN B 2 161 ? 192.80000 76.11900 135.85000 1.000 75.47000  ?  161 GLN B O     1 
ATOM   5687 C  CB    . GLN B 2 161 ? 192.60400 76.66600 132.46000 1.000 69.01000  ?  161 GLN B CB    1 
ATOM   5688 C  CG    . GLN B 2 161 ? 193.69100 77.69000 132.73000 1.000 69.42000  ?  161 GLN B CG    1 
ATOM   5689 C  CD    . GLN B 2 161 ? 195.08100 77.09900 132.65400 1.000 82.04000  ?  161 GLN B CD    1 
ATOM   5690 O  OE1   . GLN B 2 161 ? 195.50400 76.37200 133.55400 1.000 84.99000  ?  161 GLN B OE1   1 
ATOM   5691 N  NE2   . GLN B 2 161 ? 195.80600 77.40700 131.57900 1.000 87.25000  ?  161 GLN B NE2   1 
ATOM   5692 N  N     . SER B 2 162 ? 190.91500 76.95500 134.91900 1.000 70.06000  ?  162 SER B N     1 
ATOM   5693 C  CA    . SER B 2 162 ? 190.46000 77.64500 136.13000 1.000 75.33000  ?  162 SER B CA    1 
ATOM   5694 C  C     . SER B 2 162 ? 190.53100 76.74600 137.37500 1.000 75.02000  ?  162 SER B C     1 
ATOM   5695 O  O     . SER B 2 162 ? 191.16900 77.09000 138.37800 1.000 79.57000  ?  162 SER B O     1 
ATOM   5696 C  CB    . SER B 2 162 ? 189.03300 78.15900 135.93900 1.000 69.91000  ?  162 SER B CB    1 
ATOM   5697 O  OG    . SER B 2 162 ? 188.12400 77.08100 135.76800 1.000 74.07000  ?  162 SER B OG    1 
ATOM   5698 N  N     . SER B 2 163 ? 189.88300 75.59100 137.29300 1.000 69.16000  ?  163 SER B N     1 
ATOM   5699 C  CA    . SER B 2 163 ? 189.92100 74.57900 138.34500 1.000 72.53000  ?  163 SER B CA    1 
ATOM   5700 C  C     . SER B 2 163 ? 191.33900 74.03800 138.63600 1.000 75.04000  ?  163 SER B C     1 
ATOM   5701 O  O     . SER B 2 163 ? 191.66500 73.67400 139.77100 1.000 73.28000  ?  163 SER B O     1 
ATOM   5702 C  CB    . SER B 2 163 ? 188.99200 73.42700 137.95900 1.000 69.47000  ?  163 SER B CB    1 
ATOM   5703 O  OG    . SER B 2 163 ? 187.98500 73.87700 137.05100 1.000 74.15000  ?  163 SER B OG    1 
ATOM   5704 N  N     . MET B 2 164 ? 192.18100 73.98400 137.60800 1.000 76.14000  ?  164 MET B N     1 
ATOM   5705 C  CA    . MET B 2 164 ? 193.53200 73.44300 137.76700 1.000 77.13000  ?  164 MET B CA    1 
ATOM   5706 C  C     . MET B 2 164 ? 194.38900 74.39100 138.59200 1.000 78.93000  ?  164 MET B C     1 
ATOM   5707 O  O     . MET B 2 164 ? 195.23700 73.94900 139.37400 1.000 74.55000  ?  164 MET B O     1 
ATOM   5708 C  CB    . MET B 2 164 ? 194.18300 73.18100 136.40000 1.000 72.10000  ?  164 MET B CB    1 
ATOM   5709 C  CG    . MET B 2 164 ? 195.61300 72.65700 136.46100 1.000 68.22000  ?  164 MET B CG    1 
ATOM   5710 S  SD    . MET B 2 164 ? 195.86300 71.17100 137.46300 1.000 69.44000  ?  164 MET B SD    1 
ATOM   5711 C  CE    . MET B 2 164 ? 195.08200 69.90200 136.45500 1.000 70.78000  ?  164 MET B CE    1 
ATOM   5712 N  N     . THR B 2 165 ? 194.15400 75.69300 138.42100 1.000 77.18000  ?  165 THR B N     1 
ATOM   5713 C  CA    . THR B 2 165 ? 194.91900 76.70800 139.13900 1.000 78.07000  ?  165 THR B CA    1 
ATOM   5714 C  C     . THR B 2 165 ? 194.61300 76.69800 140.63100 1.000 82.09000  ?  165 THR B C     1 
ATOM   5715 O  O     . THR B 2 165 ? 195.51300 76.91000 141.46300 1.000 81.64000  ?  165 THR B O     1 
ATOM   5716 C  CB    . THR B 2 165 ? 194.64500 78.10400 138.60500 1.000 71.67000  ?  165 THR B CB    1 
ATOM   5717 O  OG1   . THR B 2 165 ? 194.76000 78.09900 137.17900 1.000 73.33000  ?  165 THR B OG1   1 
ATOM   5718 C  CG2   . THR B 2 165 ? 195.64600 79.06600 139.17900 1.000 69.91000  ?  165 THR B CG2   1 
ATOM   5719 N  N     . LYS B 2 166 ? 193.34300 76.45300 140.95500 1.000 80.04000  ?  166 LYS B N     1 
ATOM   5720 C  CA    . LYS B 2 166 ? 192.89300 76.39200 142.33900 1.000 79.05000  ?  166 LYS B CA    1 
ATOM   5721 C  C     . LYS B 2 166 ? 193.53900 75.21100 143.04200 1.000 84.08000  ?  166 LYS B C     1 
ATOM   5722 O  O     . LYS B 2 166 ? 193.90800 75.30300 144.21500 1.000 88.23000  ?  166 LYS B O     1 
ATOM   5723 C  CB    . LYS B 2 166 ? 191.36800 76.29400 142.41300 1.000 78.60000  ?  166 LYS B CB    1 
ATOM   5724 C  CG    . LYS B 2 166 ? 190.66100 77.60900 142.15400 1.000 82.57000  ?  166 LYS B CG    1 
ATOM   5725 C  CD    . LYS B 2 166 ? 189.20900 77.41400 141.73100 1.000 87.12000  ?  166 LYS B CD    1 
ATOM   5726 C  CE    . LYS B 2 166 ? 188.34600 76.85400 142.84800 1.000 90.94000  ?  166 LYS B CE    1 
ATOM   5727 N  NZ    . LYS B 2 166 ? 186.91200 76.74400 142.42100 1.000 96.66000  ?  166 LYS B NZ    1 
ATOM   5728 N  N     . ILE B 2 167 ? 193.68700 74.10500 142.32100 1.000 80.37000  ?  167 ILE B N     1 
ATOM   5729 C  CA    . ILE B 2 167 ? 194.34000 72.93500 142.88600 1.000 82.47000  ?  167 ILE B CA    1 
ATOM   5730 C  C     . ILE B 2 167 ? 195.79500 73.23700 143.26000 1.000 82.05000  ?  167 ILE B C     1 
ATOM   5731 O  O     . ILE B 2 167 ? 196.21300 73.03700 144.39500 1.000 85.57000  ?  167 ILE B O     1 
ATOM   5732 C  CB    . ILE B 2 167 ? 194.30000 71.74600 141.91000 1.000 85.14000  ?  167 ILE B CB    1 
ATOM   5733 C  CG1   . ILE B 2 167 ? 192.85600 71.39800 141.54200 1.000 84.39000  ?  167 ILE B CG1   1 
ATOM   5734 C  CG2   . ILE B 2 167 ? 194.98600 70.52300 142.52500 1.000 85.38000  ?  167 ILE B CG2   1 
ATOM   5735 C  CD1   . ILE B 2 167 ? 192.15500 70.55800 142.58300 1.000 85.47000  ?  167 ILE B CD1   1 
ATOM   5736 N  N     . LEU B 2 168 ? 196.57000 73.73300 142.30600 1.000 81.68000  ?  168 LEU B N     1 
ATOM   5737 C  CA    . LEU B 2 168 ? 197.99800 73.90000 142.53700 1.000 83.69000  ?  168 LEU B CA    1 
ATOM   5738 C  C     . LEU B 2 168 ? 198.30100 75.08700 143.43400 1.000 85.45000  ?  168 LEU B C     1 
ATOM   5739 O  O     . LEU B 2 168 ? 199.26100 75.04400 144.19800 1.000 84.87000  ?  168 LEU B O     1 
ATOM   5740 C  CB    . LEU B 2 168 ? 198.75600 74.05300 141.21500 1.000 82.62000  ?  168 LEU B CB    1 
ATOM   5741 C  CG    . LEU B 2 168 ? 198.99500 72.80800 140.35800 1.000 76.54000  ?  168 LEU B CG    1 
ATOM   5742 C  CD1   . LEU B 2 168 ? 199.18000 71.55300 141.20800 1.000 70.10000  ?  168 LEU B CD1   1 
ATOM   5743 C  CD2   . LEU B 2 168 ? 197.86600 72.65000 139.39600 1.000 74.08000  ?  168 LEU B CD2   1 
ATOM   5744 N  N     . GLU B 2 169 ? 197.47900 76.13000 143.33600 1.000 87.29000  ?  169 GLU B N     1 
ATOM   5745 C  CA    . GLU B 2 169 ? 197.71500 77.39900 144.02600 1.000 88.74000  ?  169 GLU B CA    1 
ATOM   5746 C  C     . GLU B 2 169 ? 198.37800 77.26100 145.40400 1.000 88.80000  ?  169 GLU B C     1 
ATOM   5747 O  O     . GLU B 2 169 ? 199.43300 77.85300 145.64100 1.000 87.45000  ?  169 GLU B O     1 
ATOM   5748 C  CB    . GLU B 2 169 ? 196.39800 78.16300 144.16100 1.000 91.59000  ?  169 GLU B CB    1 
ATOM   5749 C  CG    . GLU B 2 169 ? 196.53100 79.50000 144.86800 1.000 94.17000  ?  169 GLU B CG    1 
ATOM   5750 C  CD    . GLU B 2 169 ? 196.14800 79.42100 146.33000 1.000 99.50000  ?  169 GLU B CD    1 
ATOM   5751 O  OE1   . GLU B 2 169 ? 197.01700 79.68100 147.19600 1.000 98.10000  ?  169 GLU B OE1   1 
ATOM   5752 O  OE2   . GLU B 2 169 ? 194.97000 79.10300 146.61200 1.000 101.12000 ?  169 GLU B OE2   1 
ATOM   5753 N  N     . PRO B 2 170 ? 197.77300 76.46600 146.30900 1.000 90.67000  ?  170 PRO B N     1 
ATOM   5754 C  CA    . PRO B 2 170 ? 198.37800 76.22600 147.62700 1.000 90.43000  ?  170 PRO B CA    1 
ATOM   5755 C  C     . PRO B 2 170 ? 199.78600 75.64900 147.52000 1.000 89.91000  ?  170 PRO B C     1 
ATOM   5756 O  O     . PRO B 2 170 ? 200.71800 76.16100 148.14500 1.000 90.58000  ?  170 PRO B O     1 
ATOM   5757 C  CB    . PRO B 2 170 ? 197.42900 75.21200 148.27900 1.000 88.33000  ?  170 PRO B CB    1 
ATOM   5758 C  CG    . PRO B 2 170 ? 196.12600 75.41000 147.58200 1.000 93.90000  ?  170 PRO B CG    1 
ATOM   5759 C  CD    . PRO B 2 170 ? 196.47400 75.78300 146.16700 1.000 92.90000  ?  170 PRO B CD    1 
ATOM   5760 N  N     . PHE B 2 171 ? 199.93300 74.59300 146.72600 1.000 88.70000  ?  171 PHE B N     1 
ATOM   5761 C  CA    . PHE B 2 171 ? 201.21100 73.90400 146.60200 1.000 85.48000  ?  171 PHE B CA    1 
ATOM   5762 C  C     . PHE B 2 171 ? 202.29700 74.81300 146.02300 1.000 85.57000  ?  171 PHE B C     1 
ATOM   5763 O  O     . PHE B 2 171 ? 203.48000 74.69200 146.37200 1.000 86.43000  ?  171 PHE B O     1 
ATOM   5764 C  CB    . PHE B 2 171 ? 201.06000 72.65200 145.73900 1.000 81.71000  ?  171 PHE B CB    1 
ATOM   5765 C  CG    . PHE B 2 171 ? 202.29800 71.81300 145.68300 1.000 78.03000  ?  171 PHE B CG    1 
ATOM   5766 C  CD1   . PHE B 2 171 ? 203.30300 72.09900 144.77700 1.000 77.11000  ?  171 PHE B CD1   1 
ATOM   5767 C  CD2   . PHE B 2 171 ? 202.46100 70.74000 146.54400 1.000 79.27000  ?  171 PHE B CD2   1 
ATOM   5768 C  CE1   . PHE B 2 171 ? 204.44800 71.33400 144.73300 1.000 78.99000  ?  171 PHE B CE1   1 
ATOM   5769 C  CE2   . PHE B 2 171 ? 203.60300 69.96600 146.50600 1.000 77.17000  ?  171 PHE B CE2   1 
ATOM   5770 C  CZ    . PHE B 2 171 ? 204.60000 70.26100 145.60200 1.000 78.97000  ?  171 PHE B CZ    1 
ATOM   5771 N  N     . ARG B 2 172 ? 201.89000 75.71900 145.14200 1.000 80.52000  ?  172 ARG B N     1 
ATOM   5772 C  CA    . ARG B 2 172 ? 202.81900 76.66000 144.53300 1.000 80.42000  ?  172 ARG B CA    1 
ATOM   5773 C  C     . ARG B 2 172 ? 203.31900 77.69000 145.52900 1.000 82.21000  ?  172 ARG B C     1 
ATOM   5774 O  O     . ARG B 2 172 ? 204.51900 77.91900 145.63800 1.000 82.31000  ?  172 ARG B O     1 
ATOM   5775 C  CB    . ARG B 2 172 ? 202.16500 77.37800 143.36800 1.000 79.52000  ?  172 ARG B CB    1 
ATOM   5776 C  CG    . ARG B 2 172 ? 201.90000 76.52100 142.17700 1.000 76.11000  ?  172 ARG B CG    1 
ATOM   5777 C  CD    . ARG B 2 172 ? 201.64600 77.41200 140.99900 1.000 77.74000  ?  172 ARG B CD    1 
ATOM   5778 N  NE    . ARG B 2 172 ? 201.75000 76.67700 139.75400 1.000 78.51000  ?  172 ARG B NE    1 
ATOM   5779 C  CZ    . ARG B 2 172 ? 200.70500 76.25600 139.05700 1.000 78.76000  ?  172 ARG B CZ    1 
ATOM   5780 N  NH1   . ARG B 2 172 ? 199.47000 76.51000 139.48500 1.000 77.47000  ?  172 ARG B NH1   1 
ATOM   5781 N  NH2   . ARG B 2 172 ? 200.90300 75.59200 137.93000 1.000 74.48000  ?  172 ARG B NH2   1 
ATOM   5782 N  N     . LYS B 2 173 ? 202.38400 78.32500 146.23000 1.000 85.11000  ?  173 LYS B N     1 
ATOM   5783 C  CA    . LYS B 2 173 ? 202.70800 79.28400 147.28000 1.000 86.07000  ?  173 LYS B CA    1 
ATOM   5784 C  C     . LYS B 2 173 ? 203.78000 78.71600 148.19700 1.000 86.10000  ?  173 LYS B C     1 
ATOM   5785 O  O     . LYS B 2 173 ? 204.81600 79.34000 148.43300 1.000 83.36000  ?  173 LYS B O     1 
ATOM   5786 C  CB    . LYS B 2 173 ? 201.45600 79.64000 148.08800 1.000 86.67000  ?  173 LYS B CB    1 
ATOM   5787 C  CG    . LYS B 2 173 ? 201.74700 80.29700 149.42900 1.000 88.74000  ?  173 LYS B CG    1 
ATOM   5788 C  CD    . LYS B 2 173 ? 200.64500 80.01700 150.44600 1.000 94.49000  ?  173 LYS B CD    1 
ATOM   5789 C  CE    . LYS B 2 173 ? 200.43900 78.51200 150.67600 1.000 96.33000  ?  173 LYS B CE    1 
ATOM   5790 N  NZ    . LYS B 2 173 ? 201.59700 77.84400 151.35000 1.000 92.79000  ?  173 LYS B NZ    1 
ATOM   5791 N  N     . GLN B 2 174 ? 203.52700 77.50200 148.67600 1.000 86.61000  ?  174 GLN B N     1 
ATOM   5792 C  CA    . GLN B 2 174 ? 204.40900 76.82900 149.61500 1.000 89.14000  ?  174 GLN B CA    1 
ATOM   5793 C  C     . GLN B 2 174 ? 205.73100 76.36600 148.97400 1.000 91.24000  ?  174 GLN B C     1 
ATOM   5794 O  O     . GLN B 2 174 ? 206.71000 76.09900 149.67300 1.000 91.77000  ?  174 GLN B O     1 
ATOM   5795 C  CB    . GLN B 2 174 ? 203.67600 75.64100 150.23600 1.000 88.65000  ?  174 GLN B CB    1 
ATOM   5796 C  CG    . GLN B 2 174 ? 203.92000 75.46700 151.72700 1.000 96.51000  ?  174 GLN B CG    1 
ATOM   5797 C  CD    . GLN B 2 174 ? 203.72500 74.02300 152.18200 1.000 108.33000 ?  174 GLN B CD    1 
ATOM   5798 O  OE1   . GLN B 2 174 ? 204.38200 73.10700 151.67300 1.000 106.50000 ?  174 GLN B OE1   1 
ATOM   5799 N  NE2   . GLN B 2 174 ? 202.81800 73.81300 153.13800 1.000 104.10000 ?  174 GLN B NE2   1 
ATOM   5800 N  N     . ASN B 2 175 ? 205.76000 76.27300 147.65000 1.000 87.41000  ?  175 ASN B N     1 
ATOM   5801 C  CA    . ASN B 2 175 ? 206.96300 75.84000 146.94700 1.000 86.53000  ?  175 ASN B CA    1 
ATOM   5802 C  C     . ASN B 2 175 ? 207.26000 76.71300 145.73300 1.000 87.93000  ?  175 ASN B C     1 
ATOM   5803 O  O     . ASN B 2 175 ? 207.18500 76.24600 144.59700 1.000 84.77000  ?  175 ASN B O     1 
ATOM   5804 C  CB    . ASN B 2 175 ? 206.82700 74.38200 146.50600 1.000 87.29000  ?  175 ASN B CB    1 
ATOM   5805 C  CG    . ASN B 2 175 ? 207.08500 73.39800 147.63200 1.000 87.62000  ?  175 ASN B CG    1 
ATOM   5806 O  OD1   . ASN B 2 175 ? 208.23500 73.10300 147.96100 1.000 89.27000  ?  175 ASN B OD1   1 
ATOM   5807 N  ND2   . ASN B 2 175 ? 206.01600 72.86300 148.20800 1.000 86.79000  ?  175 ASN B ND2   1 
ATOM   5808 N  N     . PRO B 2 176 ? 207.60400 77.98700 145.97100 1.000 90.30000  ?  176 PRO B N     1 
ATOM   5809 C  CA    . PRO B 2 176 ? 207.78300 78.99200 144.91000 1.000 88.49000  ?  176 PRO B CA    1 
ATOM   5810 C  C     . PRO B 2 176 ? 209.00200 78.75700 144.01500 1.000 89.60000  ?  176 PRO B C     1 
ATOM   5811 O  O     . PRO B 2 176 ? 209.13000 79.43100 142.98300 1.000 88.08000  ?  176 PRO B O     1 
ATOM   5812 C  CB    . PRO B 2 176 ? 207.94000 80.29600 145.69200 1.000 87.61000  ?  176 PRO B CB    1 
ATOM   5813 C  CG    . PRO B 2 176 ? 208.47900 79.86800 147.01000 1.000 88.00000  ?  176 PRO B CG    1 
ATOM   5814 C  CD    . PRO B 2 176 ? 207.81600 78.55700 147.31200 1.000 86.95000  ?  176 PRO B CD    1 
ATOM   5815 N  N     . ASP B 2 177 ? 209.87700 77.82900 144.40300 1.000 87.40000  ?  177 ASP B N     1 
ATOM   5816 C  CA    . ASP B 2 177 ? 211.03500 77.47700 143.57800 1.000 88.42000  ?  177 ASP B CA    1 
ATOM   5817 C  C     . ASP B 2 177 ? 210.76800 76.24500 142.71100 1.000 87.79000  ?  177 ASP B C     1 
ATOM   5818 O  O     . ASP B 2 177 ? 211.63700 75.79300 141.95700 1.000 85.97000  ?  177 ASP B O     1 
ATOM   5819 C  CB    . ASP B 2 177 ? 212.26800 77.24900 144.45000 1.000 91.27000  ?  177 ASP B CB    1 
ATOM   5820 C  CG    . ASP B 2 177 ? 213.10300 78.50800 144.60900 1.000 97.67000  ?  177 ASP B CG    1 
ATOM   5821 O  OD1   . ASP B 2 177 ? 213.07000 79.37100 143.70000 1.000 99.31000  ?  177 ASP B OD1   1 
ATOM   5822 O  OD2   . ASP B 2 177 ? 213.79400 78.63400 145.64000 1.000 93.19000  ?  177 ASP B OD2   1 
ATOM   5823 N  N     . ILE B 2 178 ? 209.55300 75.71700 142.82700 1.000 84.50000  ?  178 ILE B N     1 
ATOM   5824 C  CA    . ILE B 2 178 ? 209.08300 74.62400 141.98700 1.000 78.16000  ?  178 ILE B CA    1 
ATOM   5825 C  C     . ILE B 2 178 ? 208.19200 75.16900 140.87200 1.000 76.16000  ?  178 ILE B C     1 
ATOM   5826 O  O     . ILE B 2 178 ? 207.19200 75.84300 141.14700 1.000 77.16000  ?  178 ILE B O     1 
ATOM   5827 C  CB    . ILE B 2 178 ? 208.31200 73.57800 142.81700 1.000 77.71000  ?  178 ILE B CB    1 
ATOM   5828 C  CG1   . ILE B 2 178 ? 209.27800 72.75200 143.66600 1.000 76.48000  ?  178 ILE B CG1   1 
ATOM   5829 C  CG2   . ILE B 2 178 ? 207.50800 72.66700 141.92900 1.000 71.56000  ?  178 ILE B CG2   1 
ATOM   5830 C  CD1   . ILE B 2 178 ? 208.62900 71.57900 144.34700 1.000 74.65000  ?  178 ILE B CD1   1 
ATOM   5831 N  N     . VAL B 2 179 ? 208.57200 74.90400 139.62000 1.000 75.13000  ?  179 VAL B N     1 
ATOM   5832 C  CA    . VAL B 2 179 ? 207.76800 75.32200 138.46800 1.000 70.01000  ?  179 VAL B CA    1 
ATOM   5833 C  C     . VAL B 2 179 ? 206.85100 74.20000 137.99200 1.000 68.72000  ?  179 VAL B C     1 
ATOM   5834 O  O     . VAL B 2 179 ? 207.29000 73.08400 137.68600 1.000 65.52000  ?  179 VAL B O     1 
ATOM   5835 C  CB    . VAL B 2 179 ? 208.62100 75.76600 137.28800 1.000 66.60000  ?  179 VAL B CB    1 
ATOM   5836 C  CG1   . VAL B 2 179 ? 207.73300 76.39400 136.24800 1.000 63.01000  ?  179 VAL B CG1   1 
ATOM   5837 C  CG2   . VAL B 2 179 ? 209.68800 76.74000 137.73600 1.000 68.28000  ?  179 VAL B CG2   1 
ATOM   5838 N  N     . ILE B 2 180 ? 205.56500 74.50100 137.94700 1.000 65.75000  ?  180 ILE B N     1 
ATOM   5839 C  CA    . ILE B 2 180 ? 204.59000 73.51300 137.54300 1.000 65.80000  ?  180 ILE B CA    1 
ATOM   5840 C  C     . ILE B 2 180 ? 203.99000 73.95100 136.21800 1.000 68.15000  ?  180 ILE B C     1 
ATOM   5841 O  O     . ILE B 2 180 ? 203.42900 75.04600 136.10600 1.000 67.20000  ?  180 ILE B O     1 
ATOM   5842 C  CB    . ILE B 2 180 ? 203.49400 73.32400 138.60500 1.000 69.41000  ?  180 ILE B CB    1 
ATOM   5843 C  CG1   . ILE B 2 180 ? 204.11000 72.91700 139.94900 1.000 68.19000  ?  180 ILE B CG1   1 
ATOM   5844 C  CG2   . ILE B 2 180 ? 202.49100 72.26800 138.15800 1.000 71.61000  ?  180 ILE B CG2   1 
ATOM   5845 C  CD1   . ILE B 2 180 ? 203.16900 72.11000 140.84100 1.000 66.26000  ?  180 ILE B CD1   1 
ATOM   5846 N  N     . TYR B 2 181 ? 204.14300 73.10300 135.20500 1.000 66.60000  ?  181 TYR B N     1 
ATOM   5847 C  CA    . TYR B 2 181 ? 203.61900 73.39800 133.87600 1.000 63.82000  ?  181 TYR B CA    1 
ATOM   5848 C  C     . TYR B 2 181 ? 202.67400 72.31500 133.33600 1.000 62.69000  ?  181 TYR B C     1 
ATOM   5849 O  O     . TYR B 2 181 ? 202.87500 71.11200 133.53700 1.000 61.89000  ?  181 TYR B O     1 
ATOM   5850 C  CB    . TYR B 2 181 ? 204.76300 73.60400 132.89400 1.000 63.40000  ?  181 TYR B CB    1 
ATOM   5851 C  CG    . TYR B 2 181 ? 204.28200 73.82700 131.48900 1.000 63.76000  ?  181 TYR B CG    1 
ATOM   5852 C  CD1   . TYR B 2 181 ? 203.63900 74.99800 131.14200 1.000 59.84000  ?  181 TYR B CD1   1 
ATOM   5853 C  CD2   . TYR B 2 181 ? 204.45400 72.85700 130.51400 1.000 64.55000  ?  181 TYR B CD2   1 
ATOM   5854 C  CE1   . TYR B 2 181 ? 203.19800 75.21200 129.86500 1.000 61.49000  ?  181 TYR B CE1   1 
ATOM   5855 C  CE2   . TYR B 2 181 ? 204.01800 73.06200 129.22700 1.000 61.77000  ?  181 TYR B CE2   1 
ATOM   5856 C  CZ    . TYR B 2 181 ? 203.38800 74.24400 128.90500 1.000 64.42000  ?  181 TYR B CZ    1 
ATOM   5857 O  OH    . TYR B 2 181 ? 202.93700 74.46400 127.61500 1.000 68.21000  ?  181 TYR B OH    1 
ATOM   5858 N  N     . GLN B 2 182 ? 201.63900 72.74900 132.63300 1.000 58.51000  ?  182 GLN B N     1 
ATOM   5859 C  CA    . GLN B 2 182 ? 200.67700 71.80000 132.11100 1.000 59.60000  ?  182 GLN B CA    1 
ATOM   5860 C  C     . GLN B 2 182 ? 200.63200 71.82700 130.58300 1.000 62.07000  ?  182 GLN B C     1 
ATOM   5861 O  O     . GLN B 2 182 ? 200.68700 72.88800 129.95900 1.000 64.43000  ?  182 GLN B O     1 
ATOM   5862 C  CB    . GLN B 2 182 ? 199.29700 72.08100 132.69400 1.000 55.79000  ?  182 GLN B CB    1 
ATOM   5863 C  CG    . GLN B 2 182 ? 198.21700 71.19300 132.15200 1.000 62.64000  ?  182 GLN B CG    1 
ATOM   5864 C  CD    . GLN B 2 182 ? 196.91600 71.33000 132.91400 1.000 67.88000  ?  182 GLN B CD    1 
ATOM   5865 O  OE1   . GLN B 2 182 ? 196.66900 72.34200 133.57800 1.000 70.00000  ?  182 GLN B OE1   1 
ATOM   5866 N  NE2   . GLN B 2 182 ? 196.07500 70.30200 132.82800 1.000 65.50000  ?  182 GLN B NE2   1 
ATOM   5867 N  N     . TYR B 2 183 ? 200.56000 70.64600 129.98200 1.000 60.35000  ?  183 TYR B N     1 
ATOM   5868 C  CA    . TYR B 2 183 ? 200.34100 70.53000 128.54700 1.000 60.16000  ?  183 TYR B CA    1 
ATOM   5869 C  C     . TYR B 2 183 ? 199.44400 69.33200 128.29900 1.000 54.03000  ?  183 TYR B C     1 
ATOM   5870 O  O     . TYR B 2 183 ? 199.84500 68.20200 128.56300 1.000 58.37000  ?  183 TYR B O     1 
ATOM   5871 C  CB    . TYR B 2 183 ? 201.66300 70.38100 127.78700 1.000 57.82000  ?  183 TYR B CB    1 
ATOM   5872 C  CG    . TYR B 2 183 ? 201.44700 70.27000 126.30700 1.000 57.68000  ?  183 TYR B CG    1 
ATOM   5873 C  CD1   . TYR B 2 183 ? 201.38600 71.40500 125.51600 1.000 57.25000  ?  183 TYR B CD1   1 
ATOM   5874 C  CD2   . TYR B 2 183 ? 201.25600 69.03600 125.70600 1.000 56.57000  ?  183 TYR B CD2   1 
ATOM   5875 C  CE1   . TYR B 2 183 ? 201.15600 71.32100 124.16800 1.000 59.36000  ?  183 TYR B CE1   1 
ATOM   5876 C  CE2   . TYR B 2 183 ? 201.01600 68.93600 124.34800 1.000 60.68000  ?  183 TYR B CE2   1 
ATOM   5877 C  CZ    . TYR B 2 183 ? 200.96800 70.08500 123.57700 1.000 63.13000  ?  183 TYR B CZ    1 
ATOM   5878 O  OH    . TYR B 2 183 ? 200.73500 70.00700 122.21100 1.000 62.83000  ?  183 TYR B OH    1 
ATOM   5879 N  N     . MET B 2 184 ? 198.22600 69.57200 127.82700 1.000 55.17000  ?  184 MET B N     1 
ATOM   5880 C  CA    . MET B 2 184 ? 197.28400 68.47800 127.58300 1.000 56.21000  ?  184 MET B CA    1 
ATOM   5881 C  C     . MET B 2 184 ? 197.11500 67.61700 128.84300 1.000 55.56000  ?  184 MET B C     1 
ATOM   5882 O  O     . MET B 2 184 ? 196.99900 68.13400 129.94100 1.000 60.15000  ?  184 MET B O     1 
ATOM   5883 C  CB    . MET B 2 184 ? 197.76600 67.62600 126.40100 1.000 59.43000  ?  184 MET B CB    1 
ATOM   5884 C  CG    . MET B 2 184 ? 197.98400 68.41000 125.09600 1.000 59.37000  ?  184 MET B CG    1 
ATOM   5885 S  SD    . MET B 2 184 ? 196.46100 68.74000 124.14700 1.000 81.79000  ?  184 MET B SD    1 
ATOM   5886 C  CE    . MET B 2 184 ? 197.08700 69.71100 122.75900 1.000 76.72000  ?  184 MET B CE    1 
ATOM   5887 N  N     . ASP B 2 185 ? 197.13600 66.30100 128.69400 1.000 58.84000  ?  185 ASP B N     1 
ATOM   5888 C  CA    . ASP B 2 185 ? 197.01500 65.41100 129.84400 1.000 58.47000  ?  185 ASP B CA    1 
ATOM   5889 C  C     . ASP B 2 185 ? 198.23600 65.45200 130.77100 1.000 60.23000  ?  185 ASP B C     1 
ATOM   5890 O  O     . ASP B 2 185 ? 198.40000 64.55900 131.60100 1.000 64.70000  ?  185 ASP B O     1 
ATOM   5891 C  CB    . ASP B 2 185 ? 196.82200 63.94400 129.40400 1.000 60.64000  ?  185 ASP B CB    1 
ATOM   5892 C  CG    . ASP B 2 185 ? 195.72000 63.75400 128.37400 1.000 60.94000  ?  185 ASP B CG    1 
ATOM   5893 O  OD1   . ASP B 2 185 ? 194.92000 64.68600 128.14700 1.000 61.82000  ?  185 ASP B OD1   1 
ATOM   5894 O  OD2   . ASP B 2 185 ? 195.64900 62.64000 127.79800 1.000 66.08000  ?  185 ASP B OD2   1 
ATOM   5895 N  N     . ASP B 2 186 ? 199.10700 66.44700 130.64200 1.000 56.66000  ?  186 ASP B N     1 
ATOM   5896 C  CA    . ASP B 2 186 ? 200.40300 66.33400 131.31100 1.000 57.86000  ?  186 ASP B CA    1 
ATOM   5897 C  C     . ASP B 2 186 ? 200.78300 67.47200 132.26600 1.000 60.31000  ?  186 ASP B C     1 
ATOM   5898 O  O     . ASP B 2 186 ? 200.50200 68.64000 132.02200 1.000 60.80000  ?  186 ASP B O     1 
ATOM   5899 C  CB    . ASP B 2 186 ? 201.50200 66.18400 130.25900 1.000 64.08000  ?  186 ASP B CB    1 
ATOM   5900 C  CG    . ASP B 2 186 ? 201.66000 64.74800 129.76200 1.000 66.43000  ?  186 ASP B CG    1 
ATOM   5901 O  OD1   . ASP B 2 186 ? 201.06500 63.81000 130.35900 1.000 65.93000  ?  186 ASP B OD1   1 
ATOM   5902 O  OD2   . ASP B 2 186 ? 202.41000 64.56400 128.77700 1.000 64.25000  ?  186 ASP B OD2   1 
ATOM   5903 N  N     . LEU B 2 187 ? 201.44600 67.10700 133.35600 1.000 62.57000  ?  187 LEU B N     1 
ATOM   5904 C  CA    . LEU B 2 187 ? 201.92800 68.07900 134.32900 1.000 63.62000  ?  187 LEU B CA    1 
ATOM   5905 C  C     . LEU B 2 187 ? 203.43000 67.94500 134.46000 1.000 61.84000  ?  187 LEU B C     1 
ATOM   5906 O  O     . LEU B 2 187 ? 203.93000 66.91100 134.89900 1.000 60.22000  ?  187 LEU B O     1 
ATOM   5907 C  CB    . LEU B 2 187 ? 201.26600 67.87000 135.69300 1.000 64.90000  ?  187 LEU B CB    1 
ATOM   5908 C  CG    . LEU B 2 187 ? 200.74500 69.07600 136.47800 1.000 64.69000  ?  187 LEU B CG    1 
ATOM   5909 C  CD1   . LEU B 2 187 ? 199.51600 69.67600 135.82800 1.000 57.19000  ?  187 LEU B CD1   1 
ATOM   5910 C  CD2   . LEU B 2 187 ? 200.42800 68.64200 137.88900 1.000 67.09000  ?  187 LEU B CD2   1 
ATOM   5911 N  N     . TYR B 2 188 ? 204.14200 68.98700 134.05800 1.000 59.84000  ?  188 TYR B N     1 
ATOM   5912 C  CA    . TYR B 2 188 ? 205.58400 69.02800 134.21600 1.000 63.48000  ?  188 TYR B CA    1 
ATOM   5913 C  C     . TYR B 2 188 ? 205.93500 69.77600 135.49100 1.000 64.57000  ?  188 TYR B C     1 
ATOM   5914 O  O     . TYR B 2 188 ? 205.47300 70.90200 135.71000 1.000 64.27000  ?  188 TYR B O     1 
ATOM   5915 C  CB    . TYR B 2 188 ? 206.24500 69.68100 133.00300 1.000 63.14000  ?  188 TYR B CB    1 
ATOM   5916 C  CG    . TYR B 2 188 ? 205.98600 68.91400 131.73900 1.000 63.91000  ?  188 TYR B CG    1 
ATOM   5917 C  CD1   . TYR B 2 188 ? 204.82200 69.12500 131.00600 1.000 67.72000  ?  188 TYR B CD1   1 
ATOM   5918 C  CD2   . TYR B 2 188 ? 206.88200 67.96100 131.29000 1.000 61.10000  ?  188 TYR B CD2   1 
ATOM   5919 C  CE1   . TYR B 2 188 ? 204.56600 68.41300 129.85700 1.000 65.83000  ?  188 TYR B CE1   1 
ATOM   5920 C  CE2   . TYR B 2 188 ? 206.63900 67.25100 130.14200 1.000 62.92000  ?  188 TYR B CE2   1 
ATOM   5921 C  CZ    . TYR B 2 188 ? 205.47900 67.47600 129.43000 1.000 63.57000  ?  188 TYR B CZ    1 
ATOM   5922 O  OH    . TYR B 2 188 ? 205.21900 66.76100 128.29000 1.000 62.28000  ?  188 TYR B OH    1 
ATOM   5923 N  N     . VAL B 2 189 ? 206.74500 69.13900 136.33100 1.000 62.64000  ?  189 VAL B N     1 
ATOM   5924 C  CA    . VAL B 2 189 ? 207.12900 69.71100 137.61600 1.000 72.14000  ?  189 VAL B CA    1 
ATOM   5925 C  C     . VAL B 2 189 ? 208.65300 69.77100 137.72200 1.000 69.71000  ?  189 VAL B C     1 
ATOM   5926 O  O     . VAL B 2 189 ? 209.32500 68.73600 137.81200 1.000 71.11000  ?  189 VAL B O     1 
ATOM   5927 C  CB    . VAL B 2 189 ? 206.53800 68.89400 138.80500 1.000 71.27000  ?  189 VAL B CB    1 
ATOM   5928 C  CG1   . VAL B 2 189 ? 206.64200 69.67400 140.10100 1.000 65.57000  ?  189 VAL B CG1   1 
ATOM   5929 C  CG2   . VAL B 2 189 ? 205.08900 68.53000 138.52900 1.000 62.23000  ?  189 VAL B CG2   1 
ATOM   5930 N  N     . GLY B 2 190 ? 209.19300 70.98700 137.70200 1.000 69.69000  ?  190 GLY B N     1 
ATOM   5931 C  CA    . GLY B 2 190 ? 210.63300 71.17900 137.76000 1.000 70.28000  ?  190 GLY B CA    1 
ATOM   5932 C  C     . GLY B 2 190 ? 211.15300 71.67300 139.10200 1.000 75.40000  ?  190 GLY B C     1 
ATOM   5933 O  O     . GLY B 2 190 ? 210.53700 72.53200 139.74900 1.000 71.73000  ?  190 GLY B O     1 
ATOM   5934 N  N     . SER B 2 191 ? 212.30100 71.12800 139.50600 1.000 76.40000  ?  191 SER B N     1 
ATOM   5935 C  CA    . SER B 2 191 ? 213.00300 71.55300 140.71600 1.000 74.60000  ?  191 SER B CA    1 
ATOM   5936 C  C     . SER B 2 191 ? 214.53400 71.51900 140.57700 1.000 79.94000  ?  191 SER B C     1 
ATOM   5937 O  O     . SER B 2 191 ? 215.08900 70.85300 139.69000 1.000 79.11000  ?  191 SER B O     1 
ATOM   5938 C  CB    . SER B 2 191 ? 212.60500 70.66800 141.88800 1.000 71.32000  ?  191 SER B CB    1 
ATOM   5939 O  OG    . SER B 2 191 ? 213.31400 69.44300 141.83600 1.000 69.11000  ?  191 SER B OG    1 
ATOM   5940 N  N     . ASP B 2 192 ? 215.20800 72.22700 141.48000 1.000 80.37000  ?  192 ASP B N     1 
ATOM   5941 C  CA    . ASP B 2 192 ? 216.66100 72.14500 141.61800 1.000 78.74000  ?  192 ASP B CA    1 
ATOM   5942 C  C     . ASP B 2 192 ? 217.02800 71.32200 142.86200 1.000 80.94000  ?  192 ASP B C     1 
ATOM   5943 O  O     . ASP B 2 192 ? 218.16300 71.35900 143.34100 1.000 82.56000  ?  192 ASP B O     1 
ATOM   5944 C  CB    . ASP B 2 192 ? 217.27200 73.55000 141.69100 1.000 77.00000  ?  192 ASP B CB    1 
ATOM   5945 C  CG    . ASP B 2 192 ? 217.07400 74.33700 140.40400 1.000 81.80000  ?  192 ASP B CG    1 
ATOM   5946 O  OD1   . ASP B 2 192 ? 217.21000 73.71500 139.32800 1.000 87.01000  ?  192 ASP B OD1   1 
ATOM   5947 O  OD2   . ASP B 2 192 ? 216.78500 75.56000 140.45700 1.000 72.74000  ?  192 ASP B OD2   1 
ATOM   5948 N  N     . LEU B 2 193 ? 216.05200 70.58000 143.38000 1.000 82.40000  ?  193 LEU B N     1 
ATOM   5949 C  CA    . LEU B 2 193 ? 216.27500 69.69600 144.52100 1.000 81.61000  ?  193 LEU B CA    1 
ATOM   5950 C  C     . LEU B 2 193 ? 217.22000 68.55500 144.19000 1.000 81.46000  ?  193 LEU B C     1 
ATOM   5951 O  O     . LEU B 2 193 ? 217.31700 68.11800 143.04500 1.000 81.99000  ?  193 LEU B O     1 
ATOM   5952 C  CB    . LEU B 2 193 ? 214.95600 69.11400 145.02500 1.000 76.19000  ?  193 LEU B CB    1 
ATOM   5953 C  CG    . LEU B 2 193 ? 213.97900 70.09800 145.66100 1.000 80.75000  ?  193 LEU B CG    1 
ATOM   5954 C  CD1   . LEU B 2 193 ? 212.78200 69.34900 146.22500 1.000 78.50000  ?  193 LEU B CD1   1 
ATOM   5955 C  CD2   . LEU B 2 193 ? 214.65800 70.91500 146.74700 1.000 80.39000  ?  193 LEU B CD2   1 
ATOM   5956 N  N     . GLU B 2 194 ? 217.92200 68.07600 145.20800 1.000 83.96000  ?  194 GLU B N     1 
ATOM   5957 C  CA    . GLU B 2 194 ? 218.62900 66.82200 145.08200 1.000 87.74000  ?  194 GLU B CA    1 
ATOM   5958 C  C     . GLU B 2 194 ? 217.57600 65.80400 144.68400 1.000 85.96000  ?  194 GLU B C     1 
ATOM   5959 O  O     . GLU B 2 194 ? 216.41600 65.94000 145.06300 1.000 86.03000  ?  194 GLU B O     1 
ATOM   5960 C  CB    . GLU B 2 194 ? 219.32600 66.44400 146.39000 1.000 88.78000  ?  194 GLU B CB    1 
ATOM   5961 C  CG    . GLU B 2 194 ? 220.01900 65.08600 146.36200 1.000 95.41000  ?  194 GLU B CG    1 
ATOM   5962 C  CD    . GLU B 2 194 ? 219.23500 64.02000 147.11200 1.000 95.78000  ?  194 GLU B CD    1 
ATOM   5963 O  OE1   . GLU B 2 194 ? 218.44600 64.40200 148.00700 1.000 93.38000  ?  194 GLU B OE1   1 
ATOM   5964 O  OE2   . GLU B 2 194 ? 219.40300 62.81000 146.80700 1.000 92.61000  ?  194 GLU B OE2   1 
ATOM   5965 N  N     . ILE B 2 195 ? 217.96400 64.79300 143.91800 1.000 85.94000  ?  195 ILE B N     1 
ATOM   5966 C  CA    . ILE B 2 195 ? 216.98800 63.85700 143.36700 1.000 87.91000  ?  195 ILE B CA    1 
ATOM   5967 C  C     . ILE B 2 195 ? 216.13900 63.16200 144.44600 1.000 89.30000  ?  195 ILE B C     1 
ATOM   5968 O  O     . ILE B 2 195 ? 215.20300 62.45100 144.12400 1.000 87.71000  ?  195 ILE B O     1 
ATOM   5969 C  CB    . ILE B 2 195 ? 217.68100 62.78000 142.49200 1.000 83.26000  ?  195 ILE B CB    1 
ATOM   5970 C  CG1   . ILE B 2 195 ? 216.65400 61.97400 141.69700 1.000 76.83000  ?  195 ILE B CG1   1 
ATOM   5971 C  CG2   . ILE B 2 195 ? 218.54700 61.86800 143.34100 1.000 82.47000  ?  195 ILE B CG2   1 
ATOM   5972 C  CD1   . ILE B 2 195 ? 216.02800 62.73000 140.55500 1.000 83.86000  ?  195 ILE B CD1   1 
ATOM   5973 N  N     . GLY B 2 196 ? 216.44900 63.37500 145.72100 1.000 87.95000  ?  196 GLY B N     1 
ATOM   5974 C  CA    . GLY B 2 196 ? 215.70600 62.73100 146.79500 1.000 84.08000  ?  196 GLY B CA    1 
ATOM   5975 C  C     . GLY B 2 196 ? 214.56200 63.58600 147.31200 1.000 83.71000  ?  196 GLY B C     1 
ATOM   5976 O  O     . GLY B 2 196 ? 213.42700 63.11900 147.43700 1.000 79.78000  ?  196 GLY B O     1 
ATOM   5977 N  N     . GLN B 2 197 ? 214.87000 64.84400 147.61700 1.000 86.02000  ?  197 GLN B N     1 
ATOM   5978 C  CA    . GLN B 2 197 ? 213.86800 65.80800 148.05600 1.000 87.66000  ?  197 GLN B CA    1 
ATOM   5979 C  C     . GLN B 2 197 ? 212.88500 66.12500 146.92300 1.000 83.45000  ?  197 GLN B C     1 
ATOM   5980 O  O     . GLN B 2 197 ? 211.71500 66.42800 147.18300 1.000 77.68000  ?  197 GLN B O     1 
ATOM   5981 C  CB    . GLN B 2 197 ? 214.55000 67.08000 148.56400 1.000 89.46000  ?  197 GLN B CB    1 
ATOM   5982 C  CG    . GLN B 2 197 ? 215.50000 66.82800 149.73600 1.000 90.49000  ?  197 GLN B CG    1 
ATOM   5983 C  CD    . GLN B 2 197 ? 216.28200 68.06500 150.15500 1.000 97.07000  ?  197 GLN B CD    1 
ATOM   5984 O  OE1   . GLN B 2 197 ? 215.91800 69.19700 149.82000 1.000 101.42000 ?  197 GLN B OE1   1 
ATOM   5985 N  NE2   . GLN B 2 197 ? 217.36800 67.85100 150.89100 1.000 89.87000  ?  197 GLN B NE2   1 
ATOM   5986 N  N     . HIS B 2 198 ? 213.37400 66.03600 145.67900 1.000 80.56000  ?  198 HIS B N     1 
ATOM   5987 C  CA    . HIS B 2 198 ? 212.55000 66.17300 144.47600 1.000 79.25000  ?  198 HIS B CA    1 
ATOM   5988 C  C     . HIS B 2 198 ? 211.45700 65.11300 144.41200 1.000 79.27000  ?  198 HIS B C     1 
ATOM   5989 O  O     . HIS B 2 198 ? 210.27000 65.44000 144.35000 1.000 76.27000  ?  198 HIS B O     1 
ATOM   5990 C  CB    . HIS B 2 198 ? 213.41200 66.08400 143.21400 1.000 81.90000  ?  198 HIS B CB    1 
ATOM   5991 C  CG    . HIS B 2 198 ? 212.63600 66.20300 141.93200 1.000 80.01000  ?  198 HIS B CG    1 
ATOM   5992 N  ND1   . HIS B 2 198 ? 212.45400 67.40400 141.27500 1.000 74.31000  ?  198 HIS B ND1   1 
ATOM   5993 C  CD2   . HIS B 2 198 ? 212.00800 65.26700 141.18000 1.000 75.83000  ?  198 HIS B CD2   1 
ATOM   5994 C  CE1   . HIS B 2 198 ? 211.74200 67.20400 140.18100 1.000 72.34000  ?  198 HIS B CE1   1 
ATOM   5995 N  NE2   . HIS B 2 198 ? 211.46000 65.91600 140.09900 1.000 75.57000  ?  198 HIS B NE2   1 
ATOM   5996 N  N     . ARG B 2 199 ? 211.86400 63.84400 144.43200 1.000 80.15000  ?  199 ARG B N     1 
ATOM   5997 C  CA    . ARG B 2 199 ? 210.91600 62.72900 144.38200 1.000 79.19000  ?  199 ARG B CA    1 
ATOM   5998 C  C     . ARG B 2 199 ? 209.96900 62.73500 145.58400 1.000 82.27000  ?  199 ARG B C     1 
ATOM   5999 O  O     . ARG B 2 199 ? 208.83200 62.25300 145.50800 1.000 76.73000  ?  199 ARG B O     1 
ATOM   6000 C  CB    . ARG B 2 199 ? 211.66000 61.39400 144.30700 1.000 78.26000  ?  199 ARG B CB    1 
ATOM   6001 C  CG    . ARG B 2 199 ? 212.89200 61.44700 143.42800 1.000 84.19000  ?  199 ARG B CG    1 
ATOM   6002 C  CD    . ARG B 2 199 ? 212.77600 60.65000 142.14100 1.000 85.87000  ?  199 ARG B CD    1 
ATOM   6003 N  NE    . ARG B 2 199 ? 213.16500 59.25600 142.31200 1.000 85.31000  ?  199 ARG B NE    1 
ATOM   6004 C  CZ    . ARG B 2 199 ? 214.37200 58.77100 142.04200 1.000 90.86000  ?  199 ARG B CZ    1 
ATOM   6005 N  NH1   . ARG B 2 199 ? 215.32000 59.56600 141.57100 1.000 85.12000  ?  199 ARG B NH1   1 
ATOM   6006 N  NH2   . ARG B 2 199 ? 214.62700 57.48200 142.23800 1.000 98.16000  ?  199 ARG B NH2   1 
ATOM   6007 N  N     . THR B 2 200 ? 210.44200 63.28600 146.69600 1.000 83.77000  ?  200 THR B N     1 
ATOM   6008 C  CA    . THR B 2 200 ? 209.59800 63.41200 147.86900 1.000 79.98000  ?  200 THR B CA    1 
ATOM   6009 C  C     . THR B 2 200 ? 208.63200 64.58400 147.65300 1.000 79.59000  ?  200 THR B C     1 
ATOM   6010 O  O     . THR B 2 200 ? 207.47800 64.54500 148.09200 1.000 78.52000  ?  200 THR B O     1 
ATOM   6011 C  CB    . THR B 2 200 ? 210.43700 63.59800 149.15200 1.000 78.75000  ?  200 THR B CB    1 
ATOM   6012 O  OG1   . THR B 2 200 ? 211.46300 62.59800 149.20600 1.000 79.19000  ?  200 THR B OG1   1 
ATOM   6013 C  CG2   . THR B 2 200 ? 209.56400 63.46300 150.38500 1.000 76.80000  ?  200 THR B CG2   1 
ATOM   6014 N  N     . LYS B 2 201 ? 209.10600 65.61600 146.96100 1.000 76.80000  ?  201 LYS B N     1 
ATOM   6015 C  CA    . LYS B 2 201 ? 208.25700 66.74300 146.60700 1.000 78.71000  ?  201 LYS B CA    1 
ATOM   6016 C  C     . LYS B 2 201 ? 207.14700 66.32100 145.66200 1.000 79.80000  ?  201 LYS B C     1 
ATOM   6017 O  O     . LYS B 2 201 ? 205.99400 66.70400 145.83800 1.000 79.74000  ?  201 LYS B O     1 
ATOM   6018 C  CB    . LYS B 2 201 ? 209.07200 67.85700 145.96700 1.000 75.94000  ?  201 LYS B CB    1 
ATOM   6019 C  CG    . LYS B 2 201 ? 209.53700 68.90100 146.94200 1.000 78.40000  ?  201 LYS B CG    1 
ATOM   6020 C  CD    . LYS B 2 201 ? 208.37200 69.50400 147.70200 1.000 79.75000  ?  201 LYS B CD    1 
ATOM   6021 C  CE    . LYS B 2 201 ? 208.87600 70.31200 148.89500 1.000 80.23000  ?  201 LYS B CE    1 
ATOM   6022 N  NZ    . LYS B 2 201 ? 207.87600 70.35300 149.99900 1.000 80.32000  ?  201 LYS B NZ    1 
ATOM   6023 N  N     . ILE B 2 202 ? 207.50100 65.53200 144.65300 1.000 76.93000  ?  202 ILE B N     1 
ATOM   6024 C  CA    . ILE B 2 202 ? 206.52200 65.09300 143.66800 1.000 79.38000  ?  202 ILE B CA    1 
ATOM   6025 C  C     . ILE B 2 202 ? 205.44400 64.24300 144.32400 1.000 78.48000  ?  202 ILE B C     1 
ATOM   6026 O  O     . ILE B 2 202 ? 204.24800 64.42700 144.06600 1.000 78.00000  ?  202 ILE B O     1 
ATOM   6027 C  CB    . ILE B 2 202 ? 207.18400 64.29900 142.52100 1.000 75.75000  ?  202 ILE B CB    1 
ATOM   6028 C  CG1   . ILE B 2 202 ? 208.05500 65.22500 141.67400 1.000 65.48000  ?  202 ILE B CG1   1 
ATOM   6029 C  CG2   . ILE B 2 202 ? 206.13200 63.59800 141.66200 1.000 71.41000  ?  202 ILE B CG2   1 
ATOM   6030 C  CD1   . ILE B 2 202 ? 207.32000 66.39800 141.13400 1.000 69.87000  ?  202 ILE B CD1   1 
ATOM   6031 N  N     . GLU B 2 203 ? 205.87400 63.32100 145.18100 1.000 81.12000  ?  203 GLU B N     1 
ATOM   6032 C  CA    . GLU B 2 203 ? 204.94500 62.45200 145.89300 1.000 80.64000  ?  203 GLU B CA    1 
ATOM   6033 C  C     . GLU B 2 203 ? 204.09000 63.28100 146.84800 1.000 83.16000  ?  203 GLU B C     1 
ATOM   6034 O  O     . GLU B 2 203 ? 202.95700 62.91500 147.16600 1.000 84.91000  ?  203 GLU B O     1 
ATOM   6035 C  CB    . GLU B 2 203 ? 205.69300 61.34800 146.64400 1.000 75.41000  ?  203 GLU B CB    1 
ATOM   6036 C  CG    . GLU B 2 203 ? 204.79200 60.45800 147.50500 1.000 85.29000  ?  203 GLU B CG    1 
ATOM   6037 C  CD    . GLU B 2 203 ? 203.64800 59.78400 146.72600 1.000 87.20000  ?  203 GLU B CD    1 
ATOM   6038 O  OE1   . GLU B 2 203 ? 203.75800 59.63400 145.48300 1.000 82.38000  ?  203 GLU B OE1   1 
ATOM   6039 O  OE2   . GLU B 2 203 ? 202.63300 59.40500 147.36700 1.000 82.75000  ?  203 GLU B OE2   1 
ATOM   6040 N  N     . GLU B 2 204 ? 204.62800 64.40800 147.29400 1.000 83.35000  ?  204 GLU B N     1 
ATOM   6041 C  CA    . GLU B 2 204 ? 203.83800 65.36200 148.06000 1.000 82.95000  ?  204 GLU B CA    1 
ATOM   6042 C  C     . GLU B 2 204 ? 202.72900 65.91800 147.17400 1.000 84.26000  ?  204 GLU B C     1 
ATOM   6043 O  O     . GLU B 2 204 ? 201.54400 65.86800 147.53800 1.000 85.23000  ?  204 GLU B O     1 
ATOM   6044 C  CB    . GLU B 2 204 ? 204.72600 66.47800 148.59900 1.000 80.25000  ?  204 GLU B CB    1 
ATOM   6045 C  CG    . GLU B 2 204 ? 204.00100 67.63100 149.24800 1.000 83.15000  ?  204 GLU B CG    1 
ATOM   6046 C  CD    . GLU B 2 204 ? 204.97100 68.70600 149.72000 1.000 89.63000  ?  204 GLU B CD    1 
ATOM   6047 O  OE1   . GLU B 2 204 ? 206.16300 68.37400 149.94900 1.000 81.48000  ?  204 GLU B OE1   1 
ATOM   6048 O  OE2   . GLU B 2 204 ? 204.54500 69.87900 149.85000 1.000 90.77000  ?  204 GLU B OE2   1 
ATOM   6049 N  N     . LEU B 2 205 ? 203.12000 66.41700 146.00000 1.000 81.57000  ?  205 LEU B N     1 
ATOM   6050 C  CA    . LEU B 2 205 ? 202.17900 66.99800 145.04800 1.000 76.87000  ?  205 LEU B CA    1 
ATOM   6051 C  C     . LEU B 2 205 ? 201.13300 65.99900 144.57400 1.000 81.15000  ?  205 LEU B C     1 
ATOM   6052 O  O     . LEU B 2 205 ? 200.02200 66.38100 144.22500 1.000 81.59000  ?  205 LEU B O     1 
ATOM   6053 C  CB    . LEU B 2 205 ? 202.91400 67.56300 143.84300 1.000 75.56000  ?  205 LEU B CB    1 
ATOM   6054 C  CG    . LEU B 2 205 ? 201.97500 67.97200 142.70300 1.000 78.12000  ?  205 LEU B CG    1 
ATOM   6055 C  CD1   . LEU B 2 205 ? 201.03400 69.07200 143.14200 1.000 73.88000  ?  205 LEU B CD1   1 
ATOM   6056 C  CD2   . LEU B 2 205 ? 202.74400 68.39200 141.44800 1.000 76.61000  ?  205 LEU B CD2   1 
ATOM   6057 N  N     . ARG B 2 206 ? 201.48600 64.72000 144.55800 1.000 81.75000  ?  206 ARG B N     1 
ATOM   6058 C  CA    . ARG B 2 206 ? 200.54200 63.68900 144.14600 1.000 83.01000  ?  206 ARG B CA    1 
ATOM   6059 C  C     . ARG B 2 206 ? 199.52500 63.41700 145.25200 1.000 86.78000  ?  206 ARG B C     1 
ATOM   6060 O  O     . ARG B 2 206 ? 198.35900 63.12500 144.97100 1.000 85.09000  ?  206 ARG B O     1 
ATOM   6061 C  CB    . ARG B 2 206 ? 201.28900 62.41000 143.76000 1.000 85.42000  ?  206 ARG B CB    1 
ATOM   6062 C  CG    . ARG B 2 206 ? 200.40300 61.27200 143.28800 1.000 87.41000  ?  206 ARG B CG    1 
ATOM   6063 C  CD    . ARG B 2 206 ? 201.24700 60.21500 142.60900 1.000 88.81000  ?  206 ARG B CD    1 
ATOM   6064 N  NE    . ARG B 2 206 ? 202.64700 60.63100 142.55100 1.000 91.82000  ?  206 ARG B NE    1 
ATOM   6065 C  CZ    . ARG B 2 206 ? 203.52200 60.22400 141.63200 1.000 97.44000  ?  206 ARG B CZ    1 
ATOM   6066 N  NH1   . ARG B 2 206 ? 203.14800 59.38700 140.66800 1.000 100.93000 ?  206 ARG B NH1   1 
ATOM   6067 N  NH2   . ARG B 2 206 ? 204.77700 60.66000 141.67300 1.000 92.50000  ?  206 ARG B NH2   1 
ATOM   6068 N  N     . GLN B 2 207 ? 199.97700 63.50900 146.50600 1.000 90.22000  ?  207 GLN B N     1 
ATOM   6069 C  CA    . GLN B 2 207 ? 199.09200 63.41800 147.66900 1.000 90.48000  ?  207 GLN B CA    1 
ATOM   6070 C  C     . GLN B 2 207 ? 198.14300 64.59700 147.62600 1.000 91.37000  ?  207 GLN B C     1 
ATOM   6071 O  O     . GLN B 2 207 ? 196.95600 64.49000 147.93300 1.000 91.28000  ?  207 GLN B O     1 
ATOM   6072 C  CB    . GLN B 2 207 ? 199.87100 63.44400 148.98700 1.000 91.15000  ?  207 GLN B CB    1 
ATOM   6073 C  CG    . GLN B 2 207 ? 200.89500 62.33800 149.20300 1.000 90.39000  ?  207 GLN B CG    1 
ATOM   6074 C  CD    . GLN B 2 207 ? 201.79600 62.63100 150.41400 1.000 99.40000  ?  207 GLN B CD    1 
ATOM   6075 O  OE1   . GLN B 2 207 ? 201.46900 63.48200 151.25300 1.000 99.98000  ?  207 GLN B OE1   1 
ATOM   6076 N  NE2   . GLN B 2 207 ? 202.93600 61.93800 150.50000 1.000 93.77000  ?  207 GLN B NE2   1 
ATOM   6077 N  N     . HIS B 2 208 ? 198.69900 65.73200 147.23200 1.000 89.93000  ?  208 HIS B N     1 
ATOM   6078 C  CA    . HIS B 2 208 ? 197.94900 66.96900 147.11900 1.000 91.40000  ?  208 HIS B CA    1 
ATOM   6079 C  C     . HIS B 2 208 ? 196.86000 66.92200 146.04400 1.000 90.48000  ?  208 HIS B C     1 
ATOM   6080 O  O     . HIS B 2 208 ? 195.88300 67.67000 146.11200 1.000 91.34000  ?  208 HIS B O     1 
ATOM   6081 C  CB    . HIS B 2 208 ? 198.91100 68.11000 146.82800 1.000 89.04000  ?  208 HIS B CB    1 
ATOM   6082 C  CG    . HIS B 2 208 ? 198.38800 69.44400 147.22700 1.000 91.69000  ?  208 HIS B CG    1 
ATOM   6083 N  ND1   . HIS B 2 208 ? 198.87300 70.13300 148.31700 1.000 93.91000  ?  208 HIS B ND1   1 
ATOM   6084 C  CD2   . HIS B 2 208 ? 197.40600 70.20800 146.69800 1.000 93.69000  ?  208 HIS B CD2   1 
ATOM   6085 C  CE1   . HIS B 2 208 ? 198.22000 71.27400 148.43300 1.000 99.32000  ?  208 HIS B CE1   1 
ATOM   6086 N  NE2   . HIS B 2 208 ? 197.32400 71.34400 147.46300 1.000 99.59000  ?  208 HIS B NE2   1 
ATOM   6087 N  N     . LEU B 2 209 ? 197.04200 66.05400 145.04800 1.000 88.90000  ?  209 LEU B N     1 
ATOM   6088 C  CA    . LEU B 2 209 ? 196.06500 65.89800 143.97000 1.000 87.59000  ?  209 LEU B CA    1 
ATOM   6089 C  C     . LEU B 2 209 ? 195.04200 64.80500 144.29800 1.000 91.37000  ?  209 LEU B C     1 
ATOM   6090 O  O     . LEU B 2 209 ? 193.86600 64.92000 143.94700 1.000 93.74000  ?  209 LEU B O     1 
ATOM   6091 C  CB    . LEU B 2 209 ? 196.75700 65.58700 142.63600 1.000 84.80000  ?  209 LEU B CB    1 
ATOM   6092 C  CG    . LEU B 2 209 ? 197.57500 66.67800 141.92800 1.000 84.51000  ?  209 LEU B CG    1 
ATOM   6093 C  CD1   . LEU B 2 209 ? 198.28800 66.09900 140.71000 1.000 74.08000  ?  209 LEU B CD1   1 
ATOM   6094 C  CD2   . LEU B 2 209 ? 196.72100 67.87800 141.52300 1.000 81.68000  ?  209 LEU B CD2   1 
ATOM   6095 N  N     . LEU B 2 210 ? 195.48200 63.74700 144.97300 1.000 90.90000  ?  210 LEU B N     1 
ATOM   6096 C  CA    . LEU B 2 210 ? 194.56100 62.70500 145.42400 1.000 88.76000  ?  210 LEU B CA    1 
ATOM   6097 C  C     . LEU B 2 210 ? 193.43900 63.29400 146.28300 1.000 91.16000  ?  210 LEU B C     1 
ATOM   6098 O  O     . LEU B 2 210 ? 192.37300 62.69700 146.43900 1.000 90.97000  ?  210 LEU B O     1 
ATOM   6099 C  CB    . LEU B 2 210 ? 195.30900 61.63600 146.21900 1.000 88.90000  ?  210 LEU B CB    1 
ATOM   6100 C  CG    . LEU B 2 210 ? 196.37300 60.81900 145.49700 1.000 90.54000  ?  210 LEU B CG    1 
ATOM   6101 C  CD1   . LEU B 2 210 ? 197.13300 59.95400 146.48800 1.000 91.11000  ?  210 LEU B CD1   1 
ATOM   6102 C  CD2   . LEU B 2 210 ? 195.71900 59.96400 144.43200 1.000 97.74000  ?  210 LEU B CD2   1 
ATOM   6103 N  N     . ARG B 2 211 ? 193.69300 64.47300 146.83600 1.000 92.17000  ?  211 ARG B N     1 
ATOM   6104 C  CA    . ARG B 2 211 ? 192.75100 65.12900 147.72600 1.000 92.58000  ?  211 ARG B CA    1 
ATOM   6105 C  C     . ARG B 2 211 ? 191.58500 65.78800 146.98500 1.000 101.44000 ?  211 ARG B C     1 
ATOM   6106 O  O     . ARG B 2 211 ? 190.49400 65.91400 147.53900 1.000 102.57000 ?  211 ARG B O     1 
ATOM   6107 C  CB    . ARG B 2 211 ? 193.47700 66.17600 148.57600 1.000 95.87000  ?  211 ARG B CB    1 
ATOM   6108 C  CG    . ARG B 2 211 ? 194.50300 65.60700 149.54200 1.000 93.34000  ?  211 ARG B CG    1 
ATOM   6109 C  CD    . ARG B 2 211 ? 195.27500 66.72000 150.21700 1.000 95.79000  ?  211 ARG B CD    1 
ATOM   6110 N  NE    . ARG B 2 211 ? 196.30500 66.21000 151.11300 1.000 106.32000 ?  211 ARG B NE    1 
ATOM   6111 C  CZ    . ARG B 2 211 ? 197.14900 66.98300 151.79100 1.000 116.08000 ?  211 ARG B CZ    1 
ATOM   6112 N  NH1   . ARG B 2 211 ? 197.08600 68.30600 151.66400 1.000 118.32000 ?  211 ARG B NH1   1 
ATOM   6113 N  NH2   . ARG B 2 211 ? 198.05500 66.43800 152.59500 1.000 116.31000 ?  211 ARG B NH2   1 
ATOM   6114 N  N     . TRP B 2 212 ? 191.80100 66.20800 145.73900 1.000 101.52000 ?  212 TRP B N     1 
ATOM   6115 C  CA    . TRP B 2 212 ? 190.78100 66.98800 145.04400 1.000 97.26000  ?  212 TRP B CA    1 
ATOM   6116 C  C     . TRP B 2 212 ? 190.26400 66.32300 143.77600 1.000 102.50000 ?  212 TRP B C     1 
ATOM   6117 O  O     . TRP B 2 212 ? 189.87800 67.00900 142.82800 1.000 106.48000 ?  212 TRP B O     1 
ATOM   6118 C  CB    . TRP B 2 212 ? 191.32500 68.38700 144.73800 1.000 94.64000  ?  212 TRP B CB    1 
ATOM   6119 C  CG    . TRP B 2 212 ? 191.59700 69.13400 146.00600 1.000 103.93000 ?  212 TRP B CG    1 
ATOM   6120 C  CD1   . TRP B 2 212 ? 190.93600 68.98300 147.19700 1.000 111.98000 ?  212 TRP B CD1   1 
ATOM   6121 C  CD2   . TRP B 2 212 ? 192.61800 70.11100 146.24100 1.000 105.48000 ?  212 TRP B CD2   1 
ATOM   6122 N  NE1   . TRP B 2 212 ? 191.47000 69.81700 148.15200 1.000 113.48000 ?  212 TRP B NE1   1 
ATOM   6123 C  CE2   . TRP B 2 212 ? 192.50600 70.51900 147.59200 1.000 111.51000 ?  212 TRP B CE2   1 
ATOM   6124 C  CE3   . TRP B 2 212 ? 193.61100 70.68900 145.44600 1.000 103.29000 ?  212 TRP B CE3   1 
ATOM   6125 C  CZ2   . TRP B 2 212 ? 193.35200 71.47600 148.15900 1.000 109.24000 ?  212 TRP B CZ2   1 
ATOM   6126 C  CZ3   . TRP B 2 212 ? 194.45100 71.63900 146.01600 1.000 98.77000  ?  212 TRP B CZ3   1 
ATOM   6127 C  CH2   . TRP B 2 212 ? 194.31400 72.02400 147.35400 1.000 101.46000 ?  212 TRP B CH2   1 
ATOM   6128 N  N     . GLY B 2 213 ? 190.23900 64.99100 143.77200 1.000 101.71000 ?  213 GLY B N     1 
ATOM   6129 C  CA    . GLY B 2 213 ? 189.63700 64.22700 142.68600 1.000 99.26000  ?  213 GLY B CA    1 
ATOM   6130 C  C     . GLY B 2 213 ? 190.42800 64.20400 141.39100 1.000 91.98000  ?  213 GLY B C     1 
ATOM   6131 O  O     . GLY B 2 213 ? 190.69300 65.24700 140.78800 1.000 83.34000  ?  213 GLY B O     1 
ATOM   6132 N  N     . GLY B 2 231 ? 206.14500 58.83100 133.59200 1.000 90.05000  ?  231 GLY B N     1 
ATOM   6133 C  CA    . GLY B 2 231 ? 207.02600 59.30100 132.53300 1.000 94.00000  ?  231 GLY B CA    1 
ATOM   6134 C  C     . GLY B 2 231 ? 208.34600 59.88000 133.02100 1.000 91.70000  ?  231 GLY B C     1 
ATOM   6135 O  O     . GLY B 2 231 ? 209.04200 60.55700 132.26100 1.000 83.82000  ?  231 GLY B O     1 
ATOM   6136 N  N     . TYR B 2 232 ? 208.67400 59.58900 134.28400 1.000 94.73000  ?  232 TYR B N     1 
ATOM   6137 C  CA    . TYR B 2 232 ? 209.86800 60.08500 134.99500 1.000 94.19000  ?  232 TYR B CA    1 
ATOM   6138 C  C     . TYR B 2 232 ? 211.20400 59.46800 134.51200 1.000 92.96000  ?  232 TYR B C     1 
ATOM   6139 O  O     . TYR B 2 232 ? 211.24700 58.27000 134.21700 1.000 93.15000  ?  232 TYR B O     1 
ATOM   6140 C  CB    . TYR B 2 232 ? 209.71000 59.81200 136.50700 1.000 99.04000  ?  232 TYR B CB    1 
ATOM   6141 C  CG    . TYR B 2 232 ? 208.35100 59.26800 136.97600 1.000 102.90000 ?  232 TYR B CG    1 
ATOM   6142 C  CD1   . TYR B 2 232 ? 207.31900 60.13400 137.32900 1.000 96.84000  ?  232 TYR B CD1   1 
ATOM   6143 C  CD2   . TYR B 2 232 ? 208.11900 57.89100 137.10400 1.000 105.51000 ?  232 TYR B CD2   1 
ATOM   6144 C  CE1   . TYR B 2 232 ? 206.08600 59.65400 137.77100 1.000 101.12000 ?  232 TYR B CE1   1 
ATOM   6145 C  CE2   . TYR B 2 232 ? 206.88300 57.40000 137.54700 1.000 105.44000 ?  232 TYR B CE2   1 
ATOM   6146 C  CZ    . TYR B 2 232 ? 205.87300 58.29000 137.87800 1.000 106.39000 ?  232 TYR B CZ    1 
ATOM   6147 O  OH    . TYR B 2 232 ? 204.65000 57.82600 138.32000 1.000 104.53000 ?  232 TYR B OH    1 
ATOM   6148 N  N     . GLU B 2 233 ? 212.30700 60.23000 134.46600 1.000 89.41000  ?  233 GLU B N     1 
ATOM   6149 C  CA    . GLU B 2 233 ? 212.44300 61.60900 134.95300 1.000 83.38000  ?  233 GLU B CA    1 
ATOM   6150 C  C     . GLU B 2 233 ? 213.36000 62.46600 134.06400 1.000 81.59000  ?  233 GLU B C     1 
ATOM   6151 O  O     . GLU B 2 233 ? 214.45400 62.03800 133.69500 1.000 86.41000  ?  233 GLU B O     1 
ATOM   6152 C  CB    . GLU B 2 233 ? 213.00200 61.60700 136.37700 1.000 85.17000  ?  233 GLU B CB    1 
ATOM   6153 C  CG    . GLU B 2 233 ? 211.93300 61.72900 137.45400 1.000 93.29000  ?  233 GLU B CG    1 
ATOM   6154 C  CD    . GLU B 2 233 ? 212.33800 61.11100 138.78100 1.000 92.40000  ?  233 GLU B CD    1 
ATOM   6155 O  OE1   . GLU B 2 233 ? 213.55900 60.94000 139.02000 1.000 89.71000  ?  233 GLU B OE1   1 
ATOM   6156 O  OE2   . GLU B 2 233 ? 211.42000 60.79500 139.57500 1.000 91.47000  ?  233 GLU B OE2   1 
ATOM   6157 N  N     . LEU B 2 234 ? 212.93200 63.68700 133.76000 1.000 75.44000  ?  234 LEU B N     1 
ATOM   6158 C  CA    . LEU B 2 234 ? 213.68900 64.59000 132.88700 1.000 72.86000  ?  234 LEU B CA    1 
ATOM   6159 C  C     . LEU B 2 234 ? 214.77400 65.40700 133.57400 1.000 76.69000  ?  234 LEU B C     1 
ATOM   6160 O  O     . LEU B 2 234 ? 214.74200 65.61400 134.78500 1.000 78.55000  ?  234 LEU B O     1 
ATOM   6161 C  CB    . LEU B 2 234 ? 212.74500 65.56800 132.19300 1.000 71.90000  ?  234 LEU B CB    1 
ATOM   6162 C  CG    . LEU B 2 234 ? 212.08700 65.08300 130.91000 1.000 66.80000  ?  234 LEU B CG    1 
ATOM   6163 C  CD1   . LEU B 2 234 ? 211.47800 63.70500 131.11600 1.000 70.46000  ?  234 LEU B CD1   1 
ATOM   6164 C  CD2   . LEU B 2 234 ? 211.03800 66.08600 130.48200 1.000 66.77000  ?  234 LEU B CD2   1 
ATOM   6165 N  N     . HIS B 2 235 ? 215.70600 65.90300 132.76400 1.000 75.24000  ?  235 HIS B N     1 
ATOM   6166 C  CA    . HIS B 2 235 ? 216.80900 66.74200 133.22000 1.000 77.52000  ?  235 HIS B CA    1 
ATOM   6167 C  C     . HIS B 2 235 ? 217.22600 67.72400 132.12600 1.000 75.64000  ?  235 HIS B C     1 
ATOM   6168 O  O     . HIS B 2 235 ? 218.28000 67.56400 131.52400 1.000 77.09000  ?  235 HIS B O     1 
ATOM   6169 C  CB    . HIS B 2 235 ? 218.02400 65.89000 133.62400 1.000 79.17000  ?  235 HIS B CB    1 
ATOM   6170 C  CG    . HIS B 2 235 ? 217.74200 64.90000 134.70900 1.000 80.49000  ?  235 HIS B CG    1 
ATOM   6171 N  ND1   . HIS B 2 235 ? 217.68800 65.25100 136.04200 1.000 80.15000  ?  235 HIS B ND1   1 
ATOM   6172 C  CD2   . HIS B 2 235 ? 217.48800 63.56900 134.65800 1.000 80.64000  ?  235 HIS B CD2   1 
ATOM   6173 C  CE1   . HIS B 2 235 ? 217.41500 64.17800 136.76600 1.000 81.79000  ?  235 HIS B CE1   1 
ATOM   6174 N  NE2   . HIS B 2 235 ? 217.28900 63.14500 135.94900 1.000 85.39000  ?  235 HIS B NE2   1 
ATOM   6175 N  N     . PRO B 2 236 ? 216.41000 68.75400 131.87900 1.000 76.00000  ?  236 PRO B N     1 
ATOM   6176 C  CA    . PRO B 2 236 ? 216.64200 69.74100 130.81100 1.000 74.76000  ?  236 PRO B CA    1 
ATOM   6177 C  C     . PRO B 2 236 ? 217.97600 70.46700 130.92700 1.000 78.17000  ?  236 PRO B C     1 
ATOM   6178 O  O     . PRO B 2 236 ? 218.35200 71.20700 130.01700 1.000 81.62000  ?  236 PRO B O     1 
ATOM   6179 C  CB    . PRO B 2 236 ? 215.49100 70.73800 130.98800 1.000 76.09000  ?  236 PRO B CB    1 
ATOM   6180 C  CG    . PRO B 2 236 ? 214.47100 70.02600 131.80100 1.000 77.61000  ?  236 PRO B CG    1 
ATOM   6181 C  CD    . PRO B 2 236 ? 215.20100 69.04600 132.66300 1.000 75.06000  ?  236 PRO B CD    1 
ATOM   6182 N  N     . ASP B 2 237 ? 218.67100 70.27400 132.04200 1.000 83.69000  ?  237 ASP B N     1 
ATOM   6183 C  CA    . ASP B 2 237 ? 219.96600 70.92600 132.26000 1.000 92.51000  ?  237 ASP B CA    1 
ATOM   6184 C  C     . ASP B 2 237 ? 221.12900 70.16400 131.64400 1.000 87.04000  ?  237 ASP B C     1 
ATOM   6185 O  O     . ASP B 2 237 ? 222.29300 70.50200 131.85500 1.000 87.54000  ?  237 ASP B O     1 
ATOM   6186 C  CB    . ASP B 2 237 ? 220.22300 71.12200 133.75500 1.000 88.49000  ?  237 ASP B CB    1 
ATOM   6187 C  CG    . ASP B 2 237 ? 219.76500 72.47400 134.23100 1.000 97.31000  ?  237 ASP B CG    1 
ATOM   6188 O  OD1   . ASP B 2 237 ? 219.71500 73.40700 133.38500 1.000 99.34000  ?  237 ASP B OD1   1 
ATOM   6189 O  OD2   . ASP B 2 237 ? 219.45000 72.60300 135.43700 1.000 98.79000  ?  237 ASP B OD2   1 
ATOM   6190 N  N     . LYS B 2 238 ? 220.81100 69.13000 130.88300 1.000 83.18000  ?  238 LYS B N     1 
ATOM   6191 C  CA    . LYS B 2 238 ? 221.84500 68.34800 130.24500 1.000 86.86000  ?  238 LYS B CA    1 
ATOM   6192 C  C     . LYS B 2 238 ? 221.39500 67.99300 128.83400 1.000 90.03000  ?  238 LYS B C     1 
ATOM   6193 O  O     . LYS B 2 238 ? 221.92900 67.07600 128.20300 1.000 94.83000  ?  238 LYS B O     1 
ATOM   6194 C  CB    . LYS B 2 238 ? 222.17100 67.11300 131.09100 1.000 91.16000  ?  238 LYS B CB    1 
ATOM   6195 C  CG    . LYS B 2 238 ? 222.93100 67.45300 132.39400 1.000 87.37000  ?  238 LYS B CG    1 
ATOM   6196 C  CD    . LYS B 2 238 ? 222.32800 66.78000 133.62500 1.000 84.59000  ?  238 LYS B CD    1 
ATOM   6197 C  CE    . LYS B 2 238 ? 221.29100 67.66600 134.32800 1.000 86.72000  ?  238 LYS B CE    1 
ATOM   6198 N  NZ    . LYS B 2 238 ? 220.62900 66.96400 135.47800 1.000 87.12000  ?  238 LYS B NZ    1 
ATOM   6199 N  N     . TRP B 2 239 ? 220.41200 68.74500 128.34000 1.000 88.36000  ?  239 TRP B N     1 
ATOM   6200 C  CA    . TRP B 2 239 ? 220.01800 68.66200 126.93900 1.000 87.36000  ?  239 TRP B CA    1 
ATOM   6201 C  C     . TRP B 2 239 ? 221.12500 69.30100 126.10300 1.000 92.20000  ?  239 TRP B C     1 
ATOM   6202 O  O     . TRP B 2 239 ? 221.74500 70.28300 126.52800 1.000 90.37000  ?  239 TRP B O     1 
ATOM   6203 C  CB    . TRP B 2 239 ? 218.65800 69.33400 126.69700 1.000 80.43000  ?  239 TRP B CB    1 
ATOM   6204 C  CG    . TRP B 2 239 ? 217.52100 68.54600 127.28300 1.000 73.71000  ?  239 TRP B CG    1 
ATOM   6205 C  CD1   . TRP B 2 239 ? 217.61100 67.34500 127.90800 1.000 73.24000  ?  239 TRP B CD1   1 
ATOM   6206 C  CD2   . TRP B 2 239 ? 216.13500 68.90700 127.31000 1.000 69.30000  ?  239 TRP B CD2   1 
ATOM   6207 N  NE1   . TRP B 2 239 ? 216.37300 66.92600 128.31900 1.000 67.85000  ?  239 TRP B NE1   1 
ATOM   6208 C  CE2   . TRP B 2 239 ? 215.44700 67.86900 127.96700 1.000 69.17000  ?  239 TRP B CE2   1 
ATOM   6209 C  CE3   . TRP B 2 239 ? 215.41000 70.00100 126.84300 1.000 69.50000  ?  239 TRP B CE3   1 
ATOM   6210 C  CZ2   . TRP B 2 239 ? 214.06600 67.89000 128.16800 1.000 67.40000  ?  239 TRP B CZ2   1 
ATOM   6211 C  CZ3   . TRP B 2 239 ? 214.03900 70.02300 127.04100 1.000 68.37000  ?  239 TRP B CZ3   1 
ATOM   6212 C  CH2   . TRP B 2 239 ? 213.38000 68.97100 127.69800 1.000 64.86000  ?  239 TRP B CH2   1 
ATOM   6213 N  N     . THR B 2 240 ? 221.36000 68.72800 124.92200 1.000 90.66000  ?  240 THR B N     1 
ATOM   6214 C  CA    . THR B 2 240 ? 222.56900 68.97700 124.13900 1.000 86.84000  ?  240 THR B CA    1 
ATOM   6215 C  C     . THR B 2 240 ? 222.27800 69.54600 122.74800 1.000 83.95000  ?  240 THR B C     1 
ATOM   6216 O  O     . THR B 2 240 ? 221.41200 69.04300 122.03300 1.000 84.41000  ?  240 THR B O     1 
ATOM   6217 C  CB    . THR B 2 240 ? 223.39100 67.65500 123.98400 1.000 92.40000  ?  240 THR B CB    1 
ATOM   6218 O  OG1   . THR B 2 240 ? 224.75500 67.95400 123.66300 1.000 95.16000  ?  240 THR B OG1   1 
ATOM   6219 C  CG2   . THR B 2 240 ? 222.78700 66.72900 122.90300 1.000 84.78000  ?  240 THR B CG2   1 
ATOM   6220 N  N     . VAL B 2 241 ? 223.00300 70.59700 122.36900 1.000 84.83000  ?  241 VAL B N     1 
ATOM   6221 C  CA    . VAL B 2 241 ? 222.99600 71.07900 120.98600 1.000 75.90000  ?  241 VAL B CA    1 
ATOM   6222 C  C     . VAL B 2 241 ? 224.07400 70.36500 120.15800 1.000 76.31000  ?  241 VAL B C     1 
ATOM   6223 O  O     . VAL B 2 241 ? 225.21500 70.19500 120.61000 1.000 73.57000  ?  241 VAL B O     1 
ATOM   6224 C  CB    . VAL B 2 241 ? 223.23700 72.58100 120.90400 1.000 72.64000  ?  241 VAL B CB    1 
ATOM   6225 C  CG1   . VAL B 2 241 ? 222.60700 73.14300 119.63400 1.000 69.19000  ?  241 VAL B CG1   1 
ATOM   6226 C  CG2   . VAL B 2 241 ? 222.69800 73.27400 122.15700 1.000 82.50000  ?  241 VAL B CG2   1 
ATOM   6227 N  N     . GLN B 2 242 ? 223.71300 69.95500 118.94500 1.000 70.00000  ?  242 GLN B N     1 
ATOM   6228 C  CA    . GLN B 2 242 ? 224.62300 69.19400 118.09200 1.000 72.07000  ?  242 GLN B CA    1 
ATOM   6229 C  C     . GLN B 2 242 ? 225.17700 70.03500 116.94000 1.000 70.17000  ?  242 GLN B C     1 
ATOM   6230 O  O     . GLN B 2 242 ? 224.53400 70.15100 115.91000 1.000 72.64000  ?  242 GLN B O     1 
ATOM   6231 C  CB    . GLN B 2 242 ? 223.91600 67.95300 117.54000 1.000 65.47000  ?  242 GLN B CB    1 
ATOM   6232 C  CG    . GLN B 2 242 ? 224.77200 67.13500 116.60900 1.000 70.38000  ?  242 GLN B CG    1 
ATOM   6233 C  CD    . GLN B 2 242 ? 226.12000 66.77200 117.21300 1.000 75.66000  ?  242 GLN B CD    1 
ATOM   6234 O  OE1   . GLN B 2 242 ? 226.24500 65.76200 117.90800 1.000 82.20000  ?  242 GLN B OE1   1 
ATOM   6235 N  NE2   . GLN B 2 242 ? 227.14000 67.59000 116.94200 1.000 73.23000  ?  242 GLN B NE2   1 
ATOM   6236 N  N     . PRO B 2 243 ? 226.38300 70.60800 117.10700 1.000 71.21000  ?  243 PRO B N     1 
ATOM   6237 C  CA    . PRO B 2 243 ? 226.93500 71.48400 116.07000 1.000 67.42000  ?  243 PRO B CA    1 
ATOM   6238 C  C     . PRO B 2 243 ? 227.32200 70.73700 114.81000 1.000 67.05000  ?  243 PRO B C     1 
ATOM   6239 O  O     . PRO B 2 243 ? 227.70100 69.56800 114.88200 1.000 66.22000  ?  243 PRO B O     1 
ATOM   6240 C  CB    . PRO B 2 243 ? 228.18300 72.06000 116.73300 1.000 66.57000  ?  243 PRO B CB    1 
ATOM   6241 C  CG    . PRO B 2 243 ? 228.63100 70.96500 117.65800 1.000 66.16000  ?  243 PRO B CG    1 
ATOM   6242 C  CD    . PRO B 2 243 ? 227.34500 70.39100 118.20600 1.000 70.03000  ?  243 PRO B CD    1 
ATOM   6243 N  N     . ILE B 2 244 ? 227.22000 71.41300 113.67100 1.000 69.35000  ?  244 ILE B N     1 
ATOM   6244 C  CA    . ILE B 2 244 ? 227.83300 70.93300 112.44200 1.000 69.66000  ?  244 ILE B CA    1 
ATOM   6245 C  C     . ILE B 2 244 ? 229.34700 70.94900 112.59600 1.000 70.00000  ?  244 ILE B C     1 
ATOM   6246 O  O     . ILE B 2 244 ? 229.91500 71.86200 113.18900 1.000 68.05000  ?  244 ILE B O     1 
ATOM   6247 C  CB    . ILE B 2 244 ? 227.44800 71.78100 111.24300 1.000 68.48000  ?  244 ILE B CB    1 
ATOM   6248 C  CG1   . ILE B 2 244 ? 225.92600 71.86100 111.13600 1.000 71.17000  ?  244 ILE B CG1   1 
ATOM   6249 C  CG2   . ILE B 2 244 ? 228.04900 71.19200 109.99100 1.000 68.74000  ?  244 ILE B CG2   1 
ATOM   6250 C  CD1   . ILE B 2 244 ? 225.43600 72.49400 109.86400 1.000 72.22000  ?  244 ILE B CD1   1 
ATOM   6251 N  N     . VAL B 2 245 ? 230.00600 69.93400 112.06600 1.000 68.97000  ?  245 VAL B N     1 
ATOM   6252 C  CA    . VAL B 2 245 ? 231.42600 69.79200 112.32000 1.000 69.92000  ?  245 VAL B CA    1 
ATOM   6253 C  C     . VAL B 2 245 ? 232.16200 69.37700 111.05100 1.000 66.18000  ?  245 VAL B C     1 
ATOM   6254 O  O     . VAL B 2 245 ? 231.55600 68.83500 110.12900 1.000 67.42000  ?  245 VAL B O     1 
ATOM   6255 C  CB    . VAL B 2 245 ? 231.66400 68.78300 113.45800 1.000 73.89000  ?  245 VAL B CB    1 
ATOM   6256 C  CG1   . VAL B 2 245 ? 231.85000 69.52100 114.78700 1.000 61.93000  ?  245 VAL B CG1   1 
ATOM   6257 C  CG2   . VAL B 2 245 ? 230.48900 67.79200 113.53700 1.000 68.58000  ?  245 VAL B CG2   1 
ATOM   6258 N  N     . LEU B 2 246 ? 233.45800 69.66500 110.98600 1.000 65.18000  ?  246 LEU B N     1 
ATOM   6259 C  CA    . LEU B 2 246 ? 234.22200 69.39000 109.77000 1.000 62.87000  ?  246 LEU B CA    1 
ATOM   6260 C  C     . LEU B 2 246 ? 235.31500 68.37100 110.04600 1.000 67.70000  ?  246 LEU B C     1 
ATOM   6261 O  O     . LEU B 2 246 ? 235.90400 68.36300 111.12700 1.000 70.71000  ?  246 LEU B O     1 
ATOM   6262 C  CB    . LEU B 2 246 ? 234.82300 70.67300 109.19300 1.000 59.14000  ?  246 LEU B CB    1 
ATOM   6263 C  CG    . LEU B 2 246 ? 233.82300 71.74000 108.75100 1.000 56.34000  ?  246 LEU B CG    1 
ATOM   6264 C  CD1   . LEU B 2 246 ? 234.51300 72.82900 107.94900 1.000 56.74000  ?  246 LEU B CD1   1 
ATOM   6265 C  CD2   . LEU B 2 246 ? 232.69300 71.12000 107.95600 1.000 56.06000  ?  246 LEU B CD2   1 
ATOM   6266 N  N     . PRO B 2 247 ? 235.59200 67.50500 109.06100 1.000 69.26000  ?  247 PRO B N     1 
ATOM   6267 C  CA    . PRO B 2 247 ? 236.53900 66.42400 109.31500 1.000 65.32000  ?  247 PRO B CA    1 
ATOM   6268 C  C     . PRO B 2 247 ? 237.88500 67.01100 109.65500 1.000 68.44000  ?  247 PRO B C     1 
ATOM   6269 O  O     . PRO B 2 247 ? 238.15000 68.15100 109.28100 1.000 68.98000  ?  247 PRO B O     1 
ATOM   6270 C  CB    . PRO B 2 247 ? 236.59700 65.66200 107.98200 1.000 65.70000  ?  247 PRO B CB    1 
ATOM   6271 C  CG    . PRO B 2 247 ? 235.53600 66.24500 107.12100 1.000 62.22000  ?  247 PRO B CG    1 
ATOM   6272 C  CD    . PRO B 2 247 ? 235.25400 67.61500 107.63100 1.000 64.80000  ?  247 PRO B CD    1 
ATOM   6273 N  N     . GLU B 2 248 ? 238.70500 66.26100 110.37700 1.000 71.62000  ?  248 GLU B N     1 
ATOM   6274 C  CA    . GLU B 2 248 ? 240.09900 66.62100 110.54900 1.000 74.46000  ?  248 GLU B CA    1 
ATOM   6275 C  C     . GLU B 2 248 ? 240.95200 65.53600 109.94700 1.000 73.24000  ?  248 GLU B C     1 
ATOM   6276 O  O     . GLU B 2 248 ? 240.72600 64.35100 110.18100 1.000 75.29000  ?  248 GLU B O     1 
ATOM   6277 C  CB    . GLU B 2 248 ? 240.44000 66.82900 112.01300 1.000 75.33000  ?  248 GLU B CB    1 
ATOM   6278 C  CG    . GLU B 2 248 ? 240.13700 68.23300 112.45200 1.000 86.90000  ?  248 GLU B CG    1 
ATOM   6279 C  CD    . GLU B 2 248 ? 240.88300 68.62500 113.69900 1.000 100.33000 ?  248 GLU B CD    1 
ATOM   6280 O  OE1   . GLU B 2 248 ? 240.50000 68.13500 114.78500 1.000 111.06000 ?  248 GLU B OE1   1 
ATOM   6281 O  OE2   . GLU B 2 248 ? 241.84700 69.42100 113.59000 1.000 101.96000 ?  248 GLU B OE2   1 
ATOM   6282 N  N     . LYS B 2 249 ? 241.92800 65.94300 109.15300 1.000 71.96000  ?  249 LYS B N     1 
ATOM   6283 C  CA    . LYS B 2 249 ? 242.71400 64.97800 108.41000 1.000 69.96000  ?  249 LYS B CA    1 
ATOM   6284 C  C     . LYS B 2 249 ? 244.14300 65.44800 108.26600 1.000 75.49000  ?  249 LYS B C     1 
ATOM   6285 O  O     . LYS B 2 249 ? 244.42700 66.64600 108.37700 1.000 73.19000  ?  249 LYS B O     1 
ATOM   6286 C  CB    . LYS B 2 249 ? 242.11000 64.74300 107.02300 1.000 65.86000  ?  249 LYS B CB    1 
ATOM   6287 C  CG    . LYS B 2 249 ? 240.79900 64.01900 107.02200 1.000 63.55000  ?  249 LYS B CG    1 
ATOM   6288 C  CD    . LYS B 2 249 ? 240.52800 63.48300 105.63400 1.000 64.16000  ?  249 LYS B CD    1 
ATOM   6289 C  CE    . LYS B 2 249 ? 239.53800 62.33300 105.67600 1.000 61.06000  ?  249 LYS B CE    1 
ATOM   6290 N  NZ    . LYS B 2 249 ? 238.14300 62.81200 105.60900 1.000 54.18000  ?  249 LYS B NZ    1 
ATOM   6291 N  N     . ASP B 2 250 ? 245.03500 64.49600 108.01000 1.000 78.32000  ?  250 ASP B N     1 
ATOM   6292 C  CA    . ASP B 2 250 ? 246.39700 64.81500 107.64100 1.000 73.65000  ?  250 ASP B CA    1 
ATOM   6293 C  C     . ASP B 2 250 ? 246.54700 64.78900 106.13500 1.000 75.36000  ?  250 ASP B C     1 
ATOM   6294 O  O     . ASP B 2 250 ? 247.12400 65.70500 105.55300 1.000 78.22000  ?  250 ASP B O     1 
ATOM   6295 C  CB    . ASP B 2 250 ? 247.36000 63.85400 108.30300 1.000 84.04000  ?  250 ASP B CB    1 
ATOM   6296 C  CG    . ASP B 2 250 ? 247.73300 64.30800 109.69200 1.000 97.87000  ?  250 ASP B CG    1 
ATOM   6297 O  OD1   . ASP B 2 250 ? 247.06100 65.25300 110.17700 1.000 90.28000  ?  250 ASP B OD1   1 
ATOM   6298 O  OD2   . ASP B 2 250 ? 248.68400 63.73900 110.28800 1.000 107.28000 ?  250 ASP B OD2   1 
ATOM   6299 N  N     . SER B 2 251 ? 246.01600 63.74400 105.50400 1.000 76.84000  ?  251 SER B N     1 
ATOM   6300 C  CA    . SER B 2 251 ? 245.96700 63.66200 104.04200 1.000 68.62000  ?  251 SER B CA    1 
ATOM   6301 C  C     . SER B 2 251 ? 244.56400 63.96800 103.56400 1.000 63.65000  ?  251 SER B C     1 
ATOM   6302 O  O     . SER B 2 251 ? 243.60200 63.37300 104.04800 1.000 67.58000  ?  251 SER B O     1 
ATOM   6303 C  CB    . SER B 2 251 ? 246.37400 62.27400 103.54000 1.000 63.38000  ?  251 SER B CB    1 
ATOM   6304 O  OG    . SER B 2 251 ? 247.74800 62.01600 103.73300 1.000 85.02000  ?  251 SER B OG    1 
ATOM   6305 N  N     . TRP B 2 252 ? 244.44100 64.88500 102.61400 1.000 60.79000  ?  252 TRP B N     1 
ATOM   6306 C  CA    . TRP B 2 252 ? 243.15600 65.12000 101.96800 1.000 56.24000  ?  252 TRP B CA    1 
ATOM   6307 C  C     . TRP B 2 252 ? 243.22400 64.64200 100.52900 1.000 57.62000  ?  252 TRP B C     1 
ATOM   6308 O  O     . TRP B 2 252 ? 244.17300 64.98100 99.81800  1.000 58.23000  ?  252 TRP B O     1 
ATOM   6309 C  CB    . TRP B 2 252 ? 242.78000 66.59900 102.01500 1.000 56.45000  ?  252 TRP B CB    1 
ATOM   6310 C  CG    . TRP B 2 252 ? 242.49200 67.10900 103.40600 1.000 63.19000  ?  252 TRP B CG    1 
ATOM   6311 C  CD1   . TRP B 2 252 ? 243.40600 67.44200 104.36200 1.000 60.54000  ?  252 TRP B CD1   1 
ATOM   6312 C  CD2   . TRP B 2 252 ? 241.20300 67.34400 103.98600 1.000 60.31000  ?  252 TRP B CD2   1 
ATOM   6313 N  NE1   . TRP B 2 252 ? 242.77000 67.86000 105.49900 1.000 60.84000  ?  252 TRP B NE1   1 
ATOM   6314 C  CE2   . TRP B 2 252 ? 241.41500 67.80400 105.30000 1.000 62.70000  ?  252 TRP B CE2   1 
ATOM   6315 C  CE3   . TRP B 2 252 ? 239.88700 67.19700 103.52600 1.000 58.40000  ?  252 TRP B CE3   1 
ATOM   6316 C  CZ2   . TRP B 2 252 ? 240.36600 68.13400 106.15800 1.000 65.96000  ?  252 TRP B CZ2   1 
ATOM   6317 C  CZ3   . TRP B 2 252 ? 238.83600 67.52700 104.38200 1.000 59.09000  ?  252 TRP B CZ3   1 
ATOM   6318 C  CH2   . TRP B 2 252 ? 239.08600 67.99000 105.68200 1.000 63.73000  ?  252 TRP B CH2   1 
ATOM   6319 N  N     . THR B 2 253 ? 242.23400 63.85700 100.10100 1.000 51.55000  ?  253 THR B N     1 
ATOM   6320 C  CA    . THR B 2 253 ? 242.11600 63.48000 98.69100  1.000 47.88000  ?  253 THR B CA    1 
ATOM   6321 C  C     . THR B 2 253 ? 241.13300 64.36200 97.94200  1.000 45.88000  ?  253 THR B C     1 
ATOM   6322 O  O     . THR B 2 253 ? 240.40300 65.12900 98.53600  1.000 47.22000  ?  253 THR B O     1 
ATOM   6323 C  CB    . THR B 2 253 ? 241.66400 62.03700 98.53000  1.000 49.07000  ?  253 THR B CB    1 
ATOM   6324 O  OG1   . THR B 2 253 ? 240.26300 61.93500 98.83300  1.000 48.35000  ?  253 THR B OG1   1 
ATOM   6325 C  CG2   . THR B 2 253 ? 242.43600 61.16400 99.46400  1.000 51.21000  ?  253 THR B CG2   1 
ATOM   6326 N  N     . VAL B 2 254 ? 241.10600 64.24100 96.62700  1.000 46.72000  ?  254 VAL B N     1 
ATOM   6327 C  CA    . VAL B 2 254 ? 240.17600 65.02700 95.83200  1.000 49.41000  ?  254 VAL B CA    1 
ATOM   6328 C  C     . VAL B 2 254 ? 238.75200 64.75400 96.28800  1.000 50.39000  ?  254 VAL B C     1 
ATOM   6329 O  O     . VAL B 2 254 ? 237.93100 65.65600 96.41500  1.000 53.39000  ?  254 VAL B O     1 
ATOM   6330 C  CB    . VAL B 2 254 ? 240.29100 64.71800 94.33800  1.000 42.77000  ?  254 VAL B CB    1 
ATOM   6331 C  CG1   . VAL B 2 254 ? 239.13300 65.36100 93.57700  1.000 37.58000  ?  254 VAL B CG1   1 
ATOM   6332 C  CG2   . VAL B 2 254 ? 241.63700 65.17000 93.81100  1.000 44.87000  ?  254 VAL B CG2   1 
ATOM   6333 N  N     . ASN B 2 255 ? 238.46600 63.49300 96.54700  1.000 47.39000  ?  255 ASN B N     1 
ATOM   6334 C  CA    . ASN B 2 255 ? 237.15100 63.13300 96.99900  1.000 49.16000  ?  255 ASN B CA    1 
ATOM   6335 C  C     . ASN B 2 255 ? 236.81300 63.74800 98.36200  1.000 53.49000  ?  255 ASN B C     1 
ATOM   6336 O  O     . ASN B 2 255 ? 235.72600 64.28300 98.54200  1.000 55.62000  ?  255 ASN B O     1 
ATOM   6337 C  CB    . ASN B 2 255 ? 237.01700 61.62500 97.06000  1.000 51.14000  ?  255 ASN B CB    1 
ATOM   6338 C  CG    . ASN B 2 255 ? 235.63800 61.20200 97.44100  1.000 52.61000  ?  255 ASN B CG    1 
ATOM   6339 O  OD1   . ASN B 2 255 ? 234.66600 61.51700 96.73100  1.000 56.27000  ?  255 ASN B OD1   1 
ATOM   6340 N  ND2   . ASN B 2 255 ? 235.52400 60.49400 98.56400  1.000 44.71000  ?  255 ASN B ND2   1 
ATOM   6341 N  N     . ASP B 2 256 ? 237.73600 63.65400 99.31400  1.000 50.89000  ?  256 ASP B N     1 
ATOM   6342 C  CA    . ASP B 2 256 ? 237.59200 64.30900 100.60900 1.000 47.03000  ?  256 ASP B CA    1 
ATOM   6343 C  C     . ASP B 2 256 ? 237.23800 65.78800 100.44600 1.000 51.25000  ?  256 ASP B C     1 
ATOM   6344 O  O     . ASP B 2 256 ? 236.21100 66.24800 100.94400 1.000 54.33000  ?  256 ASP B O     1 
ATOM   6345 C  CB    . ASP B 2 256 ? 238.87900 64.16800 101.41900 1.000 50.51000  ?  256 ASP B CB    1 
ATOM   6346 C  CG    . ASP B 2 256 ? 239.07000 62.76000 102.01200 1.000 56.59000  ?  256 ASP B CG    1 
ATOM   6347 O  OD1   . ASP B 2 256 ? 238.05600 62.07900 102.31500 1.000 55.70000  ?  256 ASP B OD1   1 
ATOM   6348 O  OD2   . ASP B 2 256 ? 240.24700 62.34500 102.19600 1.000 58.25000  ?  256 ASP B OD2   1 
ATOM   6349 N  N     . ILE B 2 257 ? 238.07200 66.52600 99.72600  1.000 51.88000  ?  257 ILE B N     1 
ATOM   6350 C  CA    . ILE B 2 257 ? 237.84200 67.94900 99.51900  1.000 50.59000  ?  257 ILE B CA    1 
ATOM   6351 C  C     . ILE B 2 257 ? 236.51400 68.22500 98.81200  1.000 50.58000  ?  257 ILE B C     1 
ATOM   6352 O  O     . ILE B 2 257 ? 235.79000 69.14500 99.20600  1.000 54.47000  ?  257 ILE B O     1 
ATOM   6353 C  CB    . ILE B 2 257 ? 238.99800 68.58300 98.73000  1.000 49.29000  ?  257 ILE B CB    1 
ATOM   6354 C  CG1   . ILE B 2 257 ? 240.27300 68.52500 99.55300  1.000 46.26000  ?  257 ILE B CG1   1 
ATOM   6355 C  CG2   . ILE B 2 257 ? 238.71100 70.02500 98.39800  1.000 49.44000  ?  257 ILE B CG2   1 
ATOM   6356 C  CD1   . ILE B 2 257 ? 241.46500 69.06400 98.81400  1.000 54.37000  ?  257 ILE B CD1   1 
ATOM   6357 N  N     . GLN B 2 258 ? 236.18100 67.43300 97.79300  1.000 52.02000  ?  258 GLN B N     1 
ATOM   6358 C  CA    . GLN B 2 258 ? 234.86700 67.53500 97.13400  1.000 50.19000  ?  258 GLN B CA    1 
ATOM   6359 C  C     . GLN B 2 258 ? 233.70000 67.35500 98.11000  1.000 49.28000  ?  258 GLN B C     1 
ATOM   6360 O  O     . GLN B 2 258 ? 232.71700 68.09600 98.07700  1.000 48.76000  ?  258 GLN B O     1 
ATOM   6361 C  CB    . GLN B 2 258 ? 234.74900 66.51700 96.00200  1.000 50.08000  ?  258 GLN B CB    1 
ATOM   6362 C  CG    . GLN B 2 258 ? 235.41600 66.96600 94.68900  1.000 52.01000  ?  258 GLN B CG    1 
ATOM   6363 C  CD    . GLN B 2 258 ? 235.26800 65.95600 93.56500  1.000 47.28000  ?  258 GLN B CD    1 
ATOM   6364 O  OE1   . GLN B 2 258 ? 234.67300 64.89600 93.74900  1.000 48.76000  ?  258 GLN B OE1   1 
ATOM   6365 N  NE2   . GLN B 2 258 ? 235.81800 66.27800 92.39600  1.000 52.86000  ?  258 GLN B NE2   1 
ATOM   6366 N  N     . LYS B 2 259 ? 233.81400 66.37400 98.99100  1.000 51.25000  ?  259 LYS B N     1 
ATOM   6367 C  CA    . LYS B 2 259 ? 232.77800 66.13600 99.97500  1.000 50.41000  ?  259 LYS B CA    1 
ATOM   6368 C  C     . LYS B 2 259 ? 232.71200 67.31600 100.93900 1.000 55.53000  ?  259 LYS B C     1 
ATOM   6369 O  O     . LYS B 2 259 ? 231.62800 67.78300 101.30300 1.000 53.39000  ?  259 LYS B O     1 
ATOM   6370 C  CB    . LYS B 2 259 ? 233.03500 64.82500 100.70400 1.000 45.36000  ?  259 LYS B CB    1 
ATOM   6371 C  CG    . LYS B 2 259 ? 232.35000 63.64300 100.04700 1.000 52.06000  ?  259 LYS B CG    1 
ATOM   6372 C  CD    . LYS B 2 259 ? 232.84300 62.32300 100.61500 1.000 59.02000  ?  259 LYS B CD    1 
ATOM   6373 C  CE    . LYS B 2 259 ? 232.58800 62.22400 102.10900 1.000 65.45000  ?  259 LYS B CE    1 
ATOM   6374 N  NZ    . LYS B 2 259 ? 233.32100 61.08500 102.73100 1.000 72.96000  ?  259 LYS B NZ    1 
ATOM   6375 N  N     . LEU B 2 260 ? 233.87900 67.81500 101.32700 1.000 53.50000  ?  260 LEU B N     1 
ATOM   6376 C  CA    . LEU B 2 260 ? 233.95800 69.00000 102.16700 1.000 50.74000  ?  260 LEU B CA    1 
ATOM   6377 C  C     . LEU B 2 260 ? 233.33200 70.23000 101.50300 1.000 56.63000  ?  260 LEU B C     1 
ATOM   6378 O  O     . LEU B 2 260 ? 232.47400 70.89400 102.08900 1.000 56.51000  ?  260 LEU B O     1 
ATOM   6379 C  CB    . LEU B 2 260 ? 235.40500 69.28600 102.50400 1.000 56.22000  ?  260 LEU B CB    1 
ATOM   6380 C  CG    . LEU B 2 260 ? 235.68600 70.44600 103.43700 1.000 56.28000  ?  260 LEU B CG    1 
ATOM   6381 C  CD1   . LEU B 2 260 ? 235.14000 70.11700 104.81400 1.000 52.51000  ?  260 LEU B CD1   1 
ATOM   6382 C  CD2   . LEU B 2 260 ? 237.19600 70.69100 103.46000 1.000 56.69000  ?  260 LEU B CD2   1 
ATOM   6383 N  N     . VAL B 2 261 ? 233.75200 70.54000 100.28200 1.000 52.90000  ?  261 VAL B N     1 
ATOM   6384 C  CA    . VAL B 2 261 ? 233.21300 71.71700 99.61600  1.000 52.81000  ?  261 VAL B CA    1 
ATOM   6385 C  C     . VAL B 2 261 ? 231.69100 71.66700 99.47700  1.000 56.84000  ?  261 VAL B C     1 
ATOM   6386 O  O     . VAL B 2 261 ? 231.03200 72.68500 99.62200  1.000 58.65000  ?  261 VAL B O     1 
ATOM   6387 C  CB    . VAL B 2 261 ? 233.84100 71.92400 98.23300  1.000 49.07000  ?  261 VAL B CB    1 
ATOM   6388 C  CG1   . VAL B 2 261 ? 232.90700 72.68900 97.33500  1.000 47.74000  ?  261 VAL B CG1   1 
ATOM   6389 C  CG2   . VAL B 2 261 ? 235.13200 72.69300 98.37300  1.000 57.69000  ?  261 VAL B CG2   1 
ATOM   6390 N  N     . GLY B 2 262 ? 231.11700 70.49700 99.22100  1.000 55.95000  ?  262 GLY B N     1 
ATOM   6391 C  CA    . GLY B 2 262 ? 229.67100 70.40900 99.08400  1.000 51.70000  ?  262 GLY B CA    1 
ATOM   6392 C  C     . GLY B 2 262 ? 228.95300 70.60300 100.41000 1.000 54.14000  ?  262 GLY B C     1 
ATOM   6393 O  O     . GLY B 2 262 ? 227.91200 71.24800 100.48500 1.000 52.64000  ?  262 GLY B O     1 
ATOM   6394 N  N     . LYS B 2 263 ? 229.52600 70.04800 101.46600 1.000 52.18000  ?  263 LYS B N     1 
ATOM   6395 C  CA    . LYS B 2 263 ? 228.99500 70.23500 102.80900 1.000 56.24000  ?  263 LYS B CA    1 
ATOM   6396 C  C     . LYS B 2 263 ? 229.05000 71.70000 103.27100 1.000 58.82000  ?  263 LYS B C     1 
ATOM   6397 O  O     . LYS B 2 263 ? 228.08900 72.19900 103.85600 1.000 57.40000  ?  263 LYS B O     1 
ATOM   6398 C  CB    . LYS B 2 263 ? 229.74700 69.35300 103.80200 1.000 53.71000  ?  263 LYS B CB    1 
ATOM   6399 C  CG    . LYS B 2 263 ? 229.13900 69.35400 105.16800 1.000 57.58000  ?  263 LYS B CG    1 
ATOM   6400 C  CD    . LYS B 2 263 ? 230.03600 68.62300 106.13300 1.000 61.33000  ?  263 LYS B CD    1 
ATOM   6401 C  CE    . LYS B 2 263 ? 229.43400 68.56800 107.51800 1.000 60.97000  ?  263 LYS B CE    1 
ATOM   6402 N  NZ    . LYS B 2 263 ? 229.56800 67.20200 108.08300 1.000 66.90000  ?  263 LYS B NZ    1 
ATOM   6403 N  N     . LEU B 2 264 ? 230.16500 72.38400 103.01400 1.000 56.03000  ?  264 LEU B N     1 
ATOM   6404 C  CA    . LEU B 2 264 ? 230.28000 73.80400 103.34600 1.000 54.34000  ?  264 LEU B CA    1 
ATOM   6405 C  C     . LEU B 2 264 ? 229.37800 74.68300 102.47400 1.000 53.26000  ?  264 LEU B C     1 
ATOM   6406 O  O     . LEU B 2 264 ? 228.89500 75.72000 102.90600 1.000 56.07000  ?  264 LEU B O     1 
ATOM   6407 C  CB    . LEU B 2 264 ? 231.72500 74.26300 103.21200 1.000 54.12000  ?  264 LEU B CB    1 
ATOM   6408 C  CG    . LEU B 2 264 ? 232.69300 73.71500 104.25000 1.000 52.94000  ?  264 LEU B CG    1 
ATOM   6409 C  CD1   . LEU B 2 264 ? 234.08200 74.13000 103.84200 1.000 54.03000  ?  264 LEU B CD1   1 
ATOM   6410 C  CD2   . LEU B 2 264 ? 232.35000 74.20500 105.65600 1.000 52.70000  ?  264 LEU B CD2   1 
ATOM   6411 N  N     . ASN B 2 265 ? 229.15800 74.26400 101.24200 1.000 53.20000  ?  265 ASN B N     1 
ATOM   6412 C  CA    . ASN B 2 265 ? 228.26300 74.98500 100.36300 1.000 53.61000  ?  265 ASN B CA    1 
ATOM   6413 C  C     . ASN B 2 265 ? 226.89000 75.06400 100.99100 1.000 56.96000  ?  265 ASN B C     1 
ATOM   6414 O  O     . ASN B 2 265 ? 226.23500 76.09700 100.98700 1.000 56.24000  ?  265 ASN B O     1 
ATOM   6415 C  CB    . ASN B 2 265 ? 228.16500 74.30000 99.01400  1.000 49.93000  ?  265 ASN B CB    1 
ATOM   6416 C  CG    . ASN B 2 265 ? 227.44300 75.14200 98.00100  1.000 58.66000  ?  265 ASN B CG    1 
ATOM   6417 O  OD1   . ASN B 2 265 ? 227.70600 76.34000 97.88500  1.000 61.85000  ?  265 ASN B OD1   1 
ATOM   6418 N  ND2   . ASN B 2 265 ? 226.52200 74.53000 97.25800  1.000 55.58000  ?  265 ASN B ND2   1 
ATOM   6419 N  N     . TRP B 2 266 ? 226.46600 73.94000 101.54300 1.000 58.75000  ?  266 TRP B N     1 
ATOM   6420 C  CA    . TRP B 2 266 ? 225.14400 73.82800 102.11800 1.000 59.35000  ?  266 TRP B CA    1 
ATOM   6421 C  C     . TRP B 2 266 ? 225.09000 74.60000 103.42200 1.000 63.10000  ?  266 TRP B C     1 
ATOM   6422 O  O     . TRP B 2 266 ? 224.13200 75.32800 103.67300 1.000 65.97000  ?  266 TRP B O     1 
ATOM   6423 C  CB    . TRP B 2 266 ? 224.78400 72.35800 102.32500 1.000 60.31000  ?  266 TRP B CB    1 
ATOM   6424 C  CG    . TRP B 2 266 ? 223.68500 72.11000 103.30100 1.000 69.77000  ?  266 TRP B CG    1 
ATOM   6425 C  CD1   . TRP B 2 266 ? 222.34100 72.08800 103.04100 1.000 66.80000  ?  266 TRP B CD1   1 
ATOM   6426 C  CD2   . TRP B 2 266 ? 223.83000 71.81500 104.70100 1.000 68.24000  ?  266 TRP B CD2   1 
ATOM   6427 N  NE1   . TRP B 2 266 ? 221.64500 71.80300 104.19100 1.000 69.60000  ?  266 TRP B NE1   1 
ATOM   6428 C  CE2   . TRP B 2 266 ? 222.53100 71.62900 105.22400 1.000 69.51000  ?  266 TRP B CE2   1 
ATOM   6429 C  CE3   . TRP B 2 266 ? 224.93200 71.69100 105.56000 1.000 65.46000  ?  266 TRP B CE3   1 
ATOM   6430 C  CZ2   . TRP B 2 266 ? 222.30100 71.32700 106.57200 1.000 73.29000  ?  266 TRP B CZ2   1 
ATOM   6431 C  CZ3   . TRP B 2 266 ? 224.70800 71.39100 106.90300 1.000 70.20000  ?  266 TRP B CZ3   1 
ATOM   6432 C  CH2   . TRP B 2 266 ? 223.40000 71.21400 107.39600 1.000 74.47000  ?  266 TRP B CH2   1 
ATOM   6433 N  N     . ALA B 2 267 ? 226.13200 74.47300 104.23600 1.000 55.96000  ?  267 ALA B N     1 
ATOM   6434 C  CA    . ALA B 2 267 ? 226.10700 75.09500 105.54400 1.000 59.39000  ?  267 ALA B CA    1 
ATOM   6435 C  C     . ALA B 2 267 ? 226.09500 76.60600 105.39500 1.000 61.73000  ?  267 ALA B C     1 
ATOM   6436 O  O     . ALA B 2 267 ? 225.62200 77.31700 106.27600 1.000 64.30000  ?  267 ALA B O     1 
ATOM   6437 C  CB    . ALA B 2 267 ? 227.28800 74.63500 106.39600 1.000 54.22000  ?  267 ALA B CB    1 
ATOM   6438 N  N     . SER B 2 268 ? 226.58500 77.10100 104.26600 1.000 61.35000  ?  268 SER B N     1 
ATOM   6439 C  CA    . SER B 2 268 ? 226.66900 78.54700 104.08400 1.000 65.16000  ?  268 SER B CA    1 
ATOM   6440 C  C     . SER B 2 268 ? 225.28400 79.15700 103.85200 1.000 64.71000  ?  268 SER B C     1 
ATOM   6441 O  O     . SER B 2 268 ? 225.14200 80.37200 103.73200 1.000 66.86000  ?  268 SER B O     1 
ATOM   6442 C  CB    . SER B 2 268 ? 227.60400 78.88400 102.93000 1.000 60.24000  ?  268 SER B CB    1 
ATOM   6443 O  OG    . SER B 2 268 ? 227.04400 78.45600 101.71000 1.000 59.97000  ?  268 SER B OG    1 
ATOM   6444 N  N     . GLN B 2 269 ? 224.27300 78.29700 103.78300 1.000 61.90000  ?  269 GLN B N     1 
ATOM   6445 C  CA    . GLN B 2 269 ? 222.88800 78.73200 103.77800 1.000 66.78000  ?  269 GLN B CA    1 
ATOM   6446 C  C     . GLN B 2 269 ? 222.39400 78.95600 105.19800 1.000 65.47000  ?  269 GLN B C     1 
ATOM   6447 O  O     . GLN B 2 269 ? 221.47100 79.72700 105.43200 1.000 69.46000  ?  269 GLN B O     1 
ATOM   6448 C  CB    . GLN B 2 269 ? 221.99100 77.70700 103.11300 1.000 66.65000  ?  269 GLN B CB    1 
ATOM   6449 C  CG    . GLN B 2 269 ? 222.40400 77.27800 101.75400 1.000 65.62000  ?  269 GLN B CG    1 
ATOM   6450 C  CD    . GLN B 2 269 ? 221.50600 76.17500 101.26700 1.000 70.52000  ?  269 GLN B CD    1 
ATOM   6451 O  OE1   . GLN B 2 269 ? 221.63100 75.02600 101.70000 1.000 69.18000  ?  269 GLN B OE1   1 
ATOM   6452 N  NE2   . GLN B 2 269 ? 220.55900 76.51800 100.39200 1.000 73.26000  ?  269 GLN B NE2   1 
ATOM   6453 N  N     . ILE B 2 270 ? 222.99800 78.24600 106.13700 1.000 62.63000  ?  270 ILE B N     1 
ATOM   6454 C  CA    . ILE B 2 270 ? 222.71700 78.43700 107.54900 1.000 65.12000  ?  270 ILE B CA    1 
ATOM   6455 C  C     . ILE B 2 270 ? 223.64100 79.48900 108.16900 1.000 68.73000  ?  270 ILE B C     1 
ATOM   6456 O  O     . ILE B 2 270 ? 223.23500 80.23500 109.05400 1.000 72.04000  ?  270 ILE B O     1 
ATOM   6457 C  CB    . ILE B 2 270 ? 222.86600 77.11500 108.30900 1.000 71.04000  ?  270 ILE B CB    1 
ATOM   6458 C  CG1   . ILE B 2 270 ? 221.73200 76.16200 107.92800 1.000 65.52000  ?  270 ILE B CG1   1 
ATOM   6459 C  CG2   . ILE B 2 270 ? 222.94000 77.35100 109.81400 1.000 68.28000  ?  270 ILE B CG2   1 
ATOM   6460 C  CD1   . ILE B 2 270 ? 221.99000 74.75000 108.35500 1.000 65.55000  ?  270 ILE B CD1   1 
ATOM   6461 N  N     . TYR B 2 271 ? 224.88600 79.53700 107.70100 1.000 70.73000  ?  271 TYR B N     1 
ATOM   6462 C  CA    . TYR B 2 271 ? 225.86900 80.50600 108.17900 1.000 67.09000  ?  271 TYR B CA    1 
ATOM   6463 C  C     . TYR B 2 271 ? 226.52200 81.22200 107.01700 1.000 69.21000  ?  271 TYR B C     1 
ATOM   6464 O  O     . TYR B 2 271 ? 227.47000 80.70700 106.41800 1.000 69.09000  ?  271 TYR B O     1 
ATOM   6465 C  CB    . TYR B 2 271 ? 226.95800 79.83600 109.00200 1.000 70.61000  ?  271 TYR B CB    1 
ATOM   6466 C  CG    . TYR B 2 271 ? 226.47000 78.94400 110.09500 1.000 71.50000  ?  271 TYR B CG    1 
ATOM   6467 C  CD1   . TYR B 2 271 ? 226.21700 79.44800 111.35900 1.000 73.93000  ?  271 TYR B CD1   1 
ATOM   6468 C  CD2   . TYR B 2 271 ? 226.28400 77.58500 109.87600 1.000 74.78000  ?  271 TYR B CD2   1 
ATOM   6469 C  CE1   . TYR B 2 271 ? 225.78200 78.62700 112.37900 1.000 77.21000  ?  271 TYR B CE1   1 
ATOM   6470 C  CE2   . TYR B 2 271 ? 225.84800 76.75200 110.89100 1.000 77.73000  ?  271 TYR B CE2   1 
ATOM   6471 C  CZ    . TYR B 2 271 ? 225.60200 77.28400 112.14000 1.000 76.74000  ?  271 TYR B CZ    1 
ATOM   6472 O  OH    . TYR B 2 271 ? 225.17000 76.47700 113.15500 1.000 82.00000  ?  271 TYR B OH    1 
ATOM   6473 N  N     . PRO B 2 272 ? 226.02900 82.42000 106.70200 1.000 70.05000  ?  272 PRO B N     1 
ATOM   6474 C  CA    . PRO B 2 272 ? 226.51200 83.20300 105.56500 1.000 70.28000  ?  272 PRO B CA    1 
ATOM   6475 C  C     . PRO B 2 272 ? 228.02200 83.39300 105.59700 1.000 71.53000  ?  272 PRO B C     1 
ATOM   6476 O  O     . PRO B 2 272 ? 228.62300 83.66600 104.56000 1.000 72.80000  ?  272 PRO B O     1 
ATOM   6477 C  CB    . PRO B 2 272 ? 225.78800 84.53700 105.73400 1.000 74.35000  ?  272 PRO B CB    1 
ATOM   6478 C  CG    . PRO B 2 272 ? 224.54800 84.19400 106.51000 1.000 72.02000  ?  272 PRO B CG    1 
ATOM   6479 C  CD    . PRO B 2 272 ? 224.96200 83.11200 107.44500 1.000 68.73000  ?  272 PRO B CD    1 
ATOM   6480 N  N     . GLY B 2 273 ? 228.62100 83.24100 106.77500 1.000 72.53000  ?  273 GLY B N     1 
ATOM   6481 C  CA    . GLY B 2 273 ? 230.05600 83.41100 106.94000 1.000 72.95000  ?  273 GLY B CA    1 
ATOM   6482 C  C     . GLY B 2 273 ? 230.94700 82.36100 106.28700 1.000 74.31000  ?  273 GLY B C     1 
ATOM   6483 O  O     . GLY B 2 273 ? 232.15500 82.57200 106.14300 1.000 74.53000  ?  273 GLY B O     1 
ATOM   6484 N  N     . ILE B 2 274 ? 230.36600 81.22900 105.89500 1.000 71.75000  ?  274 ILE B N     1 
ATOM   6485 C  CA    . ILE B 2 274 ? 231.14600 80.14200 105.30900 1.000 70.87000  ?  274 ILE B CA    1 
ATOM   6486 C  C     . ILE B 2 274 ? 231.69000 80.52300 103.94200 1.000 66.90000  ?  274 ILE B C     1 
ATOM   6487 O  O     . ILE B 2 274 ? 230.97000 81.06500 103.12200 1.000 66.83000  ?  274 ILE B O     1 
ATOM   6488 C  CB    . ILE B 2 274 ? 230.32100 78.85900 105.15900 1.000 69.17000  ?  274 ILE B CB    1 
ATOM   6489 C  CG1   . ILE B 2 274 ? 229.81900 78.38000 106.51900 1.000 67.83000  ?  274 ILE B CG1   1 
ATOM   6490 C  CG2   . ILE B 2 274 ? 231.16200 77.78000 104.49000 1.000 66.29000  ?  274 ILE B CG2   1 
ATOM   6491 C  CD1   . ILE B 2 274 ? 230.90700 77.87200 107.41100 1.000 63.57000  ?  274 ILE B CD1   1 
ATOM   6492 N  N     . LYS B 2 275 ? 232.96000 80.21700 103.70400 1.000 66.90000  ?  275 LYS B N     1 
ATOM   6493 C  CA    . LYS B 2 275 ? 233.63200 80.55500 102.44900 1.000 72.18000  ?  275 LYS B CA    1 
ATOM   6494 C  C     . LYS B 2 275 ? 234.21000 79.28700 101.79700 1.000 70.56000  ?  275 LYS B C     1 
ATOM   6495 O  O     . LYS B 2 275 ? 234.55800 78.33300 102.48500 1.000 70.66000  ?  275 LYS B O     1 
ATOM   6496 C  CB    . LYS B 2 275 ? 234.72800 81.59200 102.71000 1.000 74.74000  ?  275 LYS B CB    1 
ATOM   6497 C  CG    . LYS B 2 275 ? 235.54500 81.30100 103.99600 1.000 82.41000  ?  275 LYS B CG    1 
ATOM   6498 C  CD    . LYS B 2 275 ? 236.46800 82.46000 104.41200 1.000 85.15000  ?  275 LYS B CD    1 
ATOM   6499 C  CE    . LYS B 2 275 ? 236.82200 82.39600 105.90000 1.000 84.03000  ?  275 LYS B CE    1 
ATOM   6500 N  NZ    . LYS B 2 275 ? 235.62600 82.58500 106.79100 1.000 86.23000  ?  275 LYS B NZ    1 
ATOM   6501 N  N     . VAL B 2 276 ? 234.31500 79.26500 100.47700 1.000 70.14000  ?  276 VAL B N     1 
ATOM   6502 C  CA    . VAL B 2 276 ? 234.66100 78.01400 99.79600  1.000 75.59000  ?  276 VAL B CA    1 
ATOM   6503 C  C     . VAL B 2 276 ? 235.75000 78.20300 98.72400  1.000 71.66000  ?  276 VAL B C     1 
ATOM   6504 O  O     . VAL B 2 276 ? 236.34200 77.23500 98.25000  1.000 71.23000  ?  276 VAL B O     1 
ATOM   6505 C  CB    . VAL B 2 276 ? 233.37800 77.36500 99.17000  1.000 67.31000  ?  276 VAL B CB    1 
ATOM   6506 C  CG1   . VAL B 2 276 ? 233.72800 76.24000 98.29100  1.000 65.75000  ?  276 VAL B CG1   1 
ATOM   6507 C  CG2   . VAL B 2 276 ? 232.48200 76.83500 100.25700 1.000 65.13000  ?  276 VAL B CG2   1 
ATOM   6508 N  N     . ARG B 2 277 ? 236.03700 79.45700 98.38600  1.000 74.07000  ?  277 ARG B N     1 
ATOM   6509 C  CA    . ARG B 2 277 ? 236.92500 79.79500 97.27600  1.000 70.49000  ?  277 ARG B CA    1 
ATOM   6510 C  C     . ARG B 2 277 ? 238.27400 79.11600 97.30200  1.000 65.52000  ?  277 ARG B C     1 
ATOM   6511 O  O     . ARG B 2 277 ? 238.67600 78.53600 96.31500  1.000 66.04000  ?  277 ARG B O     1 
ATOM   6512 C  CB    . ARG B 2 277 ? 237.13400 81.30500 97.21600  1.000 78.27000  ?  277 ARG B CB    1 
ATOM   6513 C  CG    . ARG B 2 277 ? 236.01700 82.03100 96.47000  1.000 86.49000  ?  277 ARG B CG    1 
ATOM   6514 C  CD    . ARG B 2 277 ? 236.32100 83.51200 96.31600  1.000 89.53000  ?  277 ARG B CD    1 
ATOM   6515 N  NE    . ARG B 2 277 ? 235.59000 84.12100 95.20600  1.000 95.20000  ?  277 ARG B NE    1 
ATOM   6516 C  CZ    . ARG B 2 277 ? 236.16200 84.59200 94.09800  1.000 92.06000  ?  277 ARG B CZ    1 
ATOM   6517 N  NH1   . ARG B 2 277 ? 237.48200 84.52400 93.95400  1.000 92.31000  ?  277 ARG B NH1   1 
ATOM   6518 N  NH2   . ARG B 2 277 ? 235.41800 85.13400 93.13600  1.000 82.12000  ?  277 ARG B NH2   1 
ATOM   6519 N  N     . GLN B 2 278 ? 238.98600 79.17800 98.41600  1.000 69.05000  ?  278 GLN B N     1 
ATOM   6520 C  CA    . GLN B 2 278 ? 240.33100 78.60000 98.42300  1.000 73.68000  ?  278 GLN B CA    1 
ATOM   6521 C  C     . GLN B 2 278 ? 240.31700 77.06700 98.33900  1.000 71.78000  ?  278 GLN B C     1 
ATOM   6522 O  O     . GLN B 2 278 ? 241.10100 76.47500 97.59100  1.000 68.50000  ?  278 GLN B O     1 
ATOM   6523 C  CB    . GLN B 2 278 ? 241.11700 79.05600 99.66200  1.000 74.00000  ?  278 GLN B CB    1 
ATOM   6524 C  CG    . GLN B 2 278 ? 241.45500 80.55200 99.66500  1.000 77.02000  ?  278 GLN B CG    1 
ATOM   6525 C  CD    . GLN B 2 278 ? 242.10600 81.02900 98.36600  1.000 79.48000  ?  278 GLN B CD    1 
ATOM   6526 O  OE1   . GLN B 2 278 ? 243.29100 80.79600 98.12500  1.000 80.48000  ?  278 GLN B OE1   1 
ATOM   6527 N  NE2   . GLN B 2 278 ? 241.32600 81.70200 97.52600  1.000 81.40000  ?  278 GLN B NE2   1 
ATOM   6528 N  N     . LEU B 2 279 ? 239.42900 76.43200 99.10300  1.000 72.04000  ?  279 LEU B N     1 
ATOM   6529 C  CA    . LEU B 2 279 ? 239.30800 74.97700 99.10400  1.000 66.21000  ?  279 LEU B CA    1 
ATOM   6530 C  C     . LEU B 2 279 ? 238.94400 74.47600 97.72200  1.000 63.51000  ?  279 LEU B C     1 
ATOM   6531 O  O     . LEU B 2 279 ? 239.43300 73.44600 97.25400  1.000 64.67000  ?  279 LEU B O     1 
ATOM   6532 C  CB    . LEU B 2 279 ? 238.26200 74.53000 100.11900 1.000 65.40000  ?  279 LEU B CB    1 
ATOM   6533 C  CG    . LEU B 2 279 ? 238.76100 74.43200 101.55600 1.000 61.85000  ?  279 LEU B CG    1 
ATOM   6534 C  CD1   . LEU B 2 279 ? 237.61200 74.48700 102.53100 1.000 64.78000  ?  279 LEU B CD1   1 
ATOM   6535 C  CD2   . LEU B 2 279 ? 239.53400 73.14900 101.72000 1.000 61.62000  ?  279 LEU B CD2   1 
ATOM   6536 N  N     . SER B 2 280 ? 238.08900 75.23200 97.05800  1.000 62.87000  ?  280 SER B N     1 
ATOM   6537 C  CA    . SER B 2 280 ? 237.63500 74.86500 95.73900  1.000 63.18000  ?  280 SER B CA    1 
ATOM   6538 C  C     . SER B 2 280 ? 238.75200 75.03300 94.69800  1.000 66.88000  ?  280 SER B C     1 
ATOM   6539 O  O     . SER B 2 280 ? 238.78500 74.32800 93.69100  1.000 69.06000  ?  280 SER B O     1 
ATOM   6540 C  CB    . SER B 2 280 ? 236.41400 75.69800 95.37900  1.000 63.83000  ?  280 SER B CB    1 
ATOM   6541 O  OG    . SER B 2 280 ? 235.76100 75.15400 94.24900  1.000 76.03000  ?  280 SER B OG    1 
ATOM   6542 N  N     . LYS B 2 281 ? 239.67900 75.95300 94.95700  1.000 70.44000  ?  281 LYS B N     1 
ATOM   6543 C  CA    . LYS B 2 281 ? 240.84000 76.17000 94.08300  1.000 71.07000  ?  281 LYS B CA    1 
ATOM   6544 C  C     . LYS B 2 281 ? 241.67200 74.90600 93.88400  1.000 65.77000  ?  281 LYS B C     1 
ATOM   6545 O  O     . LYS B 2 281 ? 242.16200 74.65200 92.78900  1.000 68.91000  ?  281 LYS B O     1 
ATOM   6546 C  CB    . LYS B 2 281 ? 241.73700 77.27300 94.65100  1.000 73.00000  ?  281 LYS B CB    1 
ATOM   6547 C  CG    . LYS B 2 281 ? 241.94000 78.46600 93.75100  1.000 74.10000  ?  281 LYS B CG    1 
ATOM   6548 C  CD    . LYS B 2 281 ? 242.76000 79.51400 94.47500  1.000 83.00000  ?  281 LYS B CD    1 
ATOM   6549 C  CE    . LYS B 2 281 ? 242.76900 80.83100 93.71600  1.000 96.79000  ?  281 LYS B CE    1 
ATOM   6550 N  NZ    . LYS B 2 281 ? 243.47900 81.88700 94.49800  1.000 96.91000  ?  281 LYS B NZ    1 
ATOM   6551 N  N     . LEU B 2 282 ? 241.83200 74.13200 94.95500  1.000 63.48000  ?  282 LEU B N     1 
ATOM   6552 C  CA    . LEU B 2 282 ? 242.57600 72.87500 94.92900  1.000 62.94000  ?  282 LEU B CA    1 
ATOM   6553 C  C     . LEU B 2 282 ? 241.95500 71.83700 93.97900  1.000 69.83000  ?  282 LEU B C     1 
ATOM   6554 O  O     . LEU B 2 282 ? 242.61300 70.88900 93.55200  1.000 69.75000  ?  282 LEU B O     1 
ATOM   6555 C  CB    . LEU B 2 282 ? 242.66000 72.30100 96.34200  1.000 63.48000  ?  282 LEU B CB    1 
ATOM   6556 C  CG    . LEU B 2 282 ? 243.13600 73.25900 97.44400  1.000 67.27000  ?  282 LEU B CG    1 
ATOM   6557 C  CD1   . LEU B 2 282 ? 242.86900 72.67200 98.82100  1.000 62.70000  ?  282 LEU B CD1   1 
ATOM   6558 C  CD2   . LEU B 2 282 ? 244.62000 73.58400 97.29100  1.000 65.61000  ?  282 LEU B CD2   1 
ATOM   6559 N  N     . LEU B 2 283 ? 240.68400 72.02300 93.64500  1.000 71.18000  ?  283 LEU B N     1 
ATOM   6560 C  CA    . LEU B 2 283 ? 239.99500 71.11500 92.73900  1.000 66.98000  ?  283 LEU B CA    1 
ATOM   6561 C  C     . LEU B 2 283 ? 240.00500 71.62800 91.31800  1.000 70.83000  ?  283 LEU B C     1 
ATOM   6562 O  O     . LEU B 2 283 ? 239.09400 71.32300 90.54100  1.000 76.15000  ?  283 LEU B O     1 
ATOM   6563 C  CB    . LEU B 2 283 ? 238.54800 70.91200 93.18100  1.000 65.81000  ?  283 LEU B CB    1 
ATOM   6564 C  CG    . LEU B 2 283 ? 238.42800 70.27200 94.55100  1.000 63.60000  ?  283 LEU B CG    1 
ATOM   6565 C  CD1   . LEU B 2 283 ? 236.97700 70.24400 95.00000  1.000 57.01000  ?  283 LEU B CD1   1 
ATOM   6566 C  CD2   . LEU B 2 283 ? 239.01500 68.89000 94.44900  1.000 55.55000  ?  283 LEU B CD2   1 
ATOM   6567 N  N     . ARG B 2 284 ? 240.99400 72.43700 90.96900  1.000 66.25000  ?  284 ARG B N     1 
ATOM   6568 C  CA    . ARG B 2 284 ? 241.04000 72.93700 89.60800  1.000 67.02000  ?  284 ARG B CA    1 
ATOM   6569 C  C     . ARG B 2 284 ? 241.58000 71.84100 88.71800  1.000 65.54000  ?  284 ARG B C     1 
ATOM   6570 O  O     . ARG B 2 284 ? 242.44000 71.06700 89.12500  1.000 66.10000  ?  284 ARG B O     1 
ATOM   6571 C  CB    . ARG B 2 284 ? 241.87900 74.20300 89.49800  1.000 67.12000  ?  284 ARG B CB    1 
ATOM   6572 C  CG    . ARG B 2 284 ? 241.06000 75.41900 89.13500  1.000 69.74000  ?  284 ARG B CG    1 
ATOM   6573 C  CD    . ARG B 2 284 ? 241.88400 76.69300 89.17100  1.000 74.13000  ?  284 ARG B CD    1 
ATOM   6574 N  NE    . ARG B 2 284 ? 241.02800 77.83300 89.48000  1.000 88.44000  ?  284 ARG B NE    1 
ATOM   6575 C  CZ    . ARG B 2 284 ? 241.46300 79.01700 89.90400  1.000 95.04000  ?  284 ARG B CZ    1 
ATOM   6576 N  NH1   . ARG B 2 284 ? 242.76300 79.23200 90.06500  1.000 99.63000  ?  284 ARG B NH1   1 
ATOM   6577 N  NH2   . ARG B 2 284 ? 240.59500 79.99100 90.16700  1.000 94.72000  ?  284 ARG B NH2   1 
ATOM   6578 N  N     . GLY B 2 285 ? 241.05400 71.76200 87.50400  1.000 67.35000  ?  285 GLY B N     1 
ATOM   6579 C  CA    . GLY B 2 285 ? 241.42900 70.69100 86.60600  1.000 56.76000  ?  285 GLY B CA    1 
ATOM   6580 C  C     . GLY B 2 285 ? 240.39200 69.58800 86.70500  1.000 63.40000  ?  285 GLY B C     1 
ATOM   6581 O  O     . GLY B 2 285 ? 239.23100 69.82800 87.05900  1.000 65.93000  ?  285 GLY B O     1 
ATOM   6582 N  N     . THR B 2 286 ? 240.81500 68.37000 86.40600  1.000 57.57000  ?  286 THR B N     1 
ATOM   6583 C  CA    . THR B 2 286 ? 239.90400 67.25700 86.32800  1.000 51.47000  ?  286 THR B CA    1 
ATOM   6584 C  C     . THR B 2 286 ? 240.65600 66.00400 86.78900  1.000 49.27000  ?  286 THR B C     1 
ATOM   6585 O  O     . THR B 2 286 ? 241.29000 65.32800 86.00300  1.000 51.87000  ?  286 THR B O     1 
ATOM   6586 C  CB    . THR B 2 286 ? 239.33700 67.14400 84.88500  1.000 54.36000  ?  286 THR B CB    1 
ATOM   6587 O  OG1   . THR B 2 286 ? 238.70400 65.87600 84.68800  1.000 53.22000  ?  286 THR B OG1   1 
ATOM   6588 C  CG2   . THR B 2 286 ? 240.44400 67.29900 83.87600  1.000 64.64000  ?  286 THR B CG2   1 
ATOM   6589 N  N     . LYS B 2 287 ? 240.57300 65.70900 88.08500  1.000 53.83000  ?  287 LYS B N     1 
ATOM   6590 C  CA    . LYS B 2 287 ? 241.49700 64.78000 88.75000  1.000 50.64000  ?  287 LYS B CA    1 
ATOM   6591 C  C     . LYS B 2 287 ? 240.89300 63.44900 89.24700  1.000 51.46000  ?  287 LYS B C     1 
ATOM   6592 O  O     . LYS B 2 287 ? 239.67600 63.31000 89.41100  1.000 49.51000  ?  287 LYS B O     1 
ATOM   6593 C  CB    . LYS B 2 287 ? 242.14700 65.50300 89.94000  1.000 49.80000  ?  287 LYS B CB    1 
ATOM   6594 C  CG    . LYS B 2 287 ? 242.89100 66.79000 89.55300  1.000 53.90000  ?  287 LYS B CG    1 
ATOM   6595 C  CD    . LYS B 2 287 ? 243.21000 67.67100 90.76800  1.000 62.17000  ?  287 LYS B CD    1 
ATOM   6596 C  CE    . LYS B 2 287 ? 244.71000 67.78100 91.01600  1.000 68.27000  ?  287 LYS B CE    1 
ATOM   6597 N  NZ    . LYS B 2 287 ? 245.46400 68.33100 89.84600  1.000 61.78000  ?  287 LYS B NZ    1 
ATOM   6598 N  N     . ALA B 2 288 ? 241.76100 62.47700 89.51200  1.000 50.27000  ?  288 ALA B N     1 
ATOM   6599 C  CA    . ALA B 2 288 ? 241.32700 61.22100 90.11500  1.000 49.53000  ?  288 ALA B CA    1 
ATOM   6600 C  C     . ALA B 2 288 ? 240.73700 61.47100 91.49100  1.000 46.50000  ?  288 ALA B C     1 
ATOM   6601 O  O     . ALA B 2 288 ? 241.25900 62.27600 92.24600  1.000 49.52000  ?  288 ALA B O     1 
ATOM   6602 C  CB    . ALA B 2 288 ? 242.48900 60.23900 90.21900  1.000 41.99000  ?  288 ALA B CB    1 
ATOM   6603 N  N     . LEU B 2 289 ? 239.66700 60.77100 91.83400  1.000 44.70000  ?  289 LEU B N     1 
ATOM   6604 C  CA    . LEU B 2 289 ? 239.08300 60.95100 93.14700  1.000 42.85000  ?  289 LEU B CA    1 
ATOM   6605 C  C     . LEU B 2 289 ? 240.07700 60.62200 94.25700  1.000 45.75000  ?  289 LEU B C     1 
ATOM   6606 O  O     . LEU B 2 289 ? 240.00400 61.20600 95.32400  1.000 48.02000  ?  289 LEU B O     1 
ATOM   6607 C  CB    . LEU B 2 289 ? 237.82500 60.10900 93.30200  1.000 41.18000  ?  289 LEU B CB    1 
ATOM   6608 C  CG    . LEU B 2 289 ? 236.52300 60.87600 93.04100  1.000 43.65000  ?  289 LEU B CG    1 
ATOM   6609 C  CD1   . LEU B 2 289 ? 236.56400 61.48800 91.70700  1.000 47.81000  ?  289 LEU B CD1   1 
ATOM   6610 C  CD2   . LEU B 2 289 ? 235.38400 59.92200 93.06600  1.000 41.07000  ?  289 LEU B CD2   1 
ATOM   6611 N  N     . THR B 2 290 ? 241.02000 59.71700 94.02300  1.000 45.32000  ?  290 THR B N     1 
ATOM   6612 C  CA    . THR B 2 290 ? 241.88100 59.28500 95.12100  1.000 44.66000  ?  290 THR B CA    1 
ATOM   6613 C  C     . THR B 2 290 ? 243.23500 59.94600 95.06700  1.000 46.54000  ?  290 THR B C     1 
ATOM   6614 O  O     . THR B 2 290 ? 244.15700 59.55200 95.77500  1.000 48.82000  ?  290 THR B O     1 
ATOM   6615 C  CB    . THR B 2 290 ? 242.10400 57.79300 95.11200  1.000 43.38000  ?  290 THR B CB    1 
ATOM   6616 O  OG1   . THR B 2 290 ? 242.61000 57.43000 93.82300  1.000 47.43000  ?  290 THR B OG1   1 
ATOM   6617 C  CG2   . THR B 2 290 ? 240.81600 57.05400 95.39200  1.000 41.42000  ?  290 THR B CG2   1 
ATOM   6618 N  N     . GLU B 2 291 ? 243.37300 60.94300 94.21700  1.000 43.15000  ?  291 GLU B N     1 
ATOM   6619 C  CA    . GLU B 2 291 ? 244.59900 61.71500 94.24500  1.000 52.96000  ?  291 GLU B CA    1 
ATOM   6620 C  C     . GLU B 2 291 ? 244.69400 62.52600 95.54800  1.000 54.03000  ?  291 GLU B C     1 
ATOM   6621 O  O     . GLU B 2 291 ? 243.73800 63.18600 95.96300  1.000 53.53000  ?  291 GLU B O     1 
ATOM   6622 C  CB    . GLU B 2 291 ? 244.69200 62.63800 93.02900  1.000 52.08000  ?  291 GLU B CB    1 
ATOM   6623 C  CG    . GLU B 2 291 ? 245.68700 63.75500 93.19600  1.000 49.65000  ?  291 GLU B CG    1 
ATOM   6624 C  CD    . GLU B 2 291 ? 245.92900 64.50400 91.89800  1.000 65.02000  ?  291 GLU B CD    1 
ATOM   6625 O  OE1   . GLU B 2 291 ? 246.73000 65.47900 91.91300  1.000 66.70000  ?  291 GLU B OE1   1 
ATOM   6626 O  OE2   . GLU B 2 291 ? 245.31900 64.10800 90.86700  1.000 63.76000  ?  291 GLU B OE2   1 
ATOM   6627 N  N     . VAL B 2 292 ? 245.85100 62.45400 96.19300  1.000 49.86000  ?  292 VAL B N     1 
ATOM   6628 C  CA    . VAL B 2 292 ? 246.12300 63.26300 97.35500  1.000 51.15000  ?  292 VAL B CA    1 
ATOM   6629 C  C     . VAL B 2 292 ? 246.44500 64.70300 96.97200  1.000 58.50000  ?  292 VAL B C     1 
ATOM   6630 O  O     . VAL B 2 292 ? 247.24300 64.96300 96.07400  1.000 56.64000  ?  292 VAL B O     1 
ATOM   6631 C  CB    . VAL B 2 292 ? 247.27600 62.69800 98.16200  1.000 51.19000  ?  292 VAL B CB    1 
ATOM   6632 C  CG1   . VAL B 2 292 ? 247.56600 63.60600 99.32800  1.000 51.76000  ?  292 VAL B CG1   1 
ATOM   6633 C  CG2   . VAL B 2 292 ? 246.91600 61.31700 98.64300  1.000 50.68000  ?  292 VAL B CG2   1 
ATOM   6634 N  N     . ILE B 2 293 ? 245.80600 65.64000 97.66400  1.000 61.03000  ?  293 ILE B N     1 
ATOM   6635 C  CA    . ILE B 2 293 ? 245.98900 67.05700 97.38600  1.000 62.32000  ?  293 ILE B CA    1 
ATOM   6636 C  C     . ILE B 2 293 ? 246.42400 67.78500 98.64000  1.000 64.76000  ?  293 ILE B C     1 
ATOM   6637 O  O     . ILE B 2 293 ? 245.69100 67.84100 99.61800  1.000 63.26000  ?  293 ILE B O     1 
ATOM   6638 C  CB    . ILE B 2 293 ? 244.71100 67.68700 96.84200  1.000 58.95000  ?  293 ILE B CB    1 
ATOM   6639 C  CG1   . ILE B 2 293 ? 244.44400 67.14200 95.44900  1.000 55.92000  ?  293 ILE B CG1   1 
ATOM   6640 C  CG2   . ILE B 2 293 ? 244.83000 69.19500 96.79700  1.000 57.19000  ?  293 ILE B CG2   1 
ATOM   6641 C  CD1   . ILE B 2 293 ? 243.13000 67.54800 94.92800  1.000 68.68000  ?  293 ILE B CD1   1 
ATOM   6642 N  N     . PRO B 2 294 ? 247.64300 68.33000 98.61300  1.000 68.91000  ?  294 PRO B N     1 
ATOM   6643 C  CA    . PRO B 2 294 ? 248.19800 69.06900 99.74300  1.000 67.86000  ?  294 PRO B CA    1 
ATOM   6644 C  C     . PRO B 2 294 ? 247.47400 70.39700 99.89600  1.000 67.24000  ?  294 PRO B C     1 
ATOM   6645 O  O     . PRO B 2 294 ? 247.29100 71.09400 98.89600  1.000 69.95000  ?  294 PRO B O     1 
ATOM   6646 C  CB    . PRO B 2 294 ? 249.64100 69.27700 99.33100  1.000 64.38000  ?  294 PRO B CB    1 
ATOM   6647 C  CG    . PRO B 2 294 ? 249.54400 69.41900 97.83200  1.000 64.45000  ?  294 PRO B CG    1 
ATOM   6648 C  CD    . PRO B 2 294 ? 248.49700 68.42800 97.41800  1.000 62.46000  ?  294 PRO B CD    1 
ATOM   6649 N  N     . LEU B 2 295 ? 247.06300 70.73500 101.11500 1.000 67.63000  ?  295 LEU B N     1 
ATOM   6650 C  CA    . LEU B 2 295 ? 246.34300 71.97600 101.35100 1.000 66.57000  ?  295 LEU B CA    1 
ATOM   6651 C  C     . LEU B 2 295 ? 247.27800 73.18600 101.29300 1.000 71.74000  ?  295 LEU B C     1 
ATOM   6652 O  O     . LEU B 2 295 ? 248.28100 73.22700 102.01000 1.000 70.82000  ?  295 LEU B O     1 
ATOM   6653 C  CB    . LEU B 2 295 ? 245.62200 71.91500 102.69900 1.000 68.05000  ?  295 LEU B CB    1 
ATOM   6654 C  CG    . LEU B 2 295 ? 244.38400 71.01500 102.74500 1.000 66.44000  ?  295 LEU B CG    1 
ATOM   6655 C  CD1   . LEU B 2 295 ? 243.62300 71.15300 104.04700 1.000 62.02000  ?  295 LEU B CD1   1 
ATOM   6656 C  CD2   . LEU B 2 295 ? 243.47400 71.33300 101.57800 1.000 71.09000  ?  295 LEU B CD2   1 
ATOM   6657 N  N     . THR B 2 296 ? 246.95000 74.15800 100.43300 1.000 71.32000  ?  296 THR B N     1 
ATOM   6658 C  CA    . THR B 2 296 ? 247.66300 75.43900 100.39200 1.000 70.82000  ?  296 THR B CA    1 
ATOM   6659 C  C     . THR B 2 296 ? 247.52000 76.15700 101.73000 1.000 77.91000  ?  296 THR B C     1 
ATOM   6660 O  O     . THR B 2 296 ? 246.80900 75.69000 102.62800 1.000 77.63000  ?  296 THR B O     1 
ATOM   6661 C  CB    . THR B 2 296 ? 247.15400 76.38400 99.26600  1.000 64.40000  ?  296 THR B CB    1 
ATOM   6662 O  OG1   . THR B 2 296 ? 245.77700 76.71900 99.48100  1.000 71.45000  ?  296 THR B OG1   1 
ATOM   6663 C  CG2   . THR B 2 296 ? 247.29600 75.73500 97.91900  1.000 58.70000  ?  296 THR B CG2   1 
ATOM   6664 N  N     . GLU B 2 297 ? 248.19500 77.29400 101.86900 1.000 85.14000  ?  297 GLU B N     1 
ATOM   6665 C  CA    . GLU B 2 297 ? 248.12500 78.04900 103.11700 1.000 84.46000  ?  297 GLU B CA    1 
ATOM   6666 C  C     . GLU B 2 297 ? 246.76200 78.72900 103.22600 1.000 79.49000  ?  297 GLU B C     1 
ATOM   6667 O  O     . GLU B 2 297 ? 246.11400 78.65600 104.26600 1.000 78.55000  ?  297 GLU B O     1 
ATOM   6668 C  CB    . GLU B 2 297 ? 249.27000 79.07100 103.21200 1.000 93.89000  ?  297 GLU B CB    1 
ATOM   6669 C  CG    . GLU B 2 297 ? 249.44500 79.95700 101.97600 1.000 101.00000 ?  297 GLU B CG    1 
ATOM   6670 C  CD    . GLU B 2 297 ? 250.70700 80.81700 102.03100 1.000 111.44000 ?  297 GLU B CD    1 
ATOM   6671 O  OE1   . GLU B 2 297 ? 251.81500 80.25100 101.89100 1.000 112.98000 ?  297 GLU B OE1   1 
ATOM   6672 O  OE2   . GLU B 2 297 ? 250.58900 82.05500 102.20900 1.000 114.48000 ?  297 GLU B OE2   1 
ATOM   6673 N  N     . GLU B 2 298 ? 246.31800 79.36000 102.14300 1.000 76.71000  ?  298 GLU B N     1 
ATOM   6674 C  CA    . GLU B 2 298 ? 245.01600 80.01900 102.13100 1.000 76.82000  ?  298 GLU B CA    1 
ATOM   6675 C  C     . GLU B 2 298 ? 243.89500 79.06700 102.54400 1.000 81.07000  ?  298 GLU B C     1 
ATOM   6676 O  O     . GLU B 2 298 ? 243.15100 79.32400 103.50500 1.000 78.70000  ?  298 GLU B O     1 
ATOM   6677 C  CB    . GLU B 2 298 ? 244.71100 80.58900 100.74300 1.000 83.84000  ?  298 GLU B CB    1 
ATOM   6678 C  CG    . GLU B 2 298 ? 245.48600 81.85000 100.37200 1.000 90.59000  ?  298 GLU B CG    1 
ATOM   6679 C  CD    . GLU B 2 298 ? 246.95300 81.58400 100.10200 1.000 93.34000  ?  298 GLU B CD    1 
ATOM   6680 O  OE1   . GLU B 2 298 ? 247.33800 80.39400 100.04900 1.000 90.16000  ?  298 GLU B OE1   1 
ATOM   6681 O  OE2   . GLU B 2 298 ? 247.71500 82.56700 99.94400  1.000 96.52000  ?  298 GLU B OE2   1 
ATOM   6682 N  N     . ALA B 2 299 ? 243.78200 77.97100 101.79800 1.000 79.79000  ?  299 ALA B N     1 
ATOM   6683 C  CA    . ALA B 2 299 ? 242.75200 76.97400 102.02600 1.000 73.48000  ?  299 ALA B CA    1 
ATOM   6684 C  C     . ALA B 2 299 ? 242.88500 76.37000 103.41000 1.000 73.12000  ?  299 ALA B C     1 
ATOM   6685 O  O     . ALA B 2 299 ? 241.90000 75.97100 104.02600 1.000 73.48000  ?  299 ALA B O     1 
ATOM   6686 C  CB    . ALA B 2 299 ? 242.82500 75.90000 100.97600 1.000 70.61000  ?  299 ALA B CB    1 
ATOM   6687 N  N     . GLU B 2 300 ? 244.10800 76.30400 103.90900 1.000 74.68000  ?  300 GLU B N     1 
ATOM   6688 C  CA    . GLU B 2 300 ? 244.30400 75.78500 105.24500 1.000 75.15000  ?  300 GLU B CA    1 
ATOM   6689 C  C     . GLU B 2 300 ? 243.64500 76.71300 106.24800 1.000 75.35000  ?  300 GLU B C     1 
ATOM   6690 O  O     . GLU B 2 300 ? 242.99900 76.26600 107.19400 1.000 73.68000  ?  300 GLU B O     1 
ATOM   6691 C  CB    . GLU B 2 300 ? 245.78100 75.62700 105.55300 1.000 74.68000  ?  300 GLU B CB    1 
ATOM   6692 C  CG    . GLU B 2 300 ? 246.03400 74.81500 106.78400 1.000 79.05000  ?  300 GLU B CG    1 
ATOM   6693 C  CD    . GLU B 2 300 ? 245.59300 73.36900 106.63400 1.000 83.76000  ?  300 GLU B CD    1 
ATOM   6694 O  OE1   . GLU B 2 300 ? 246.29900 72.60400 105.93500 1.000 81.55000  ?  300 GLU B OE1   1 
ATOM   6695 O  OE2   . GLU B 2 300 ? 244.55100 72.99700 107.22600 1.000 84.17000  ?  300 GLU B OE2   1 
ATOM   6696 N  N     . LEU B 2 301 ? 243.78300 78.01300 106.02100 1.000 74.15000  ?  301 LEU B N     1 
ATOM   6697 C  CA    . LEU B 2 301 ? 243.24700 78.99100 106.95700 1.000 78.47000  ?  301 LEU B CA    1 
ATOM   6698 C  C     . LEU B 2 301 ? 241.73800 79.13000 106.79600 1.000 77.00000  ?  301 LEU B C     1 
ATOM   6699 O  O     . LEU B 2 301 ? 241.00100 79.20300 107.78500 1.000 74.42000  ?  301 LEU B O     1 
ATOM   6700 C  CB    . LEU B 2 301 ? 243.92700 80.35400 106.77200 1.000 84.96000  ?  301 LEU B CB    1 
ATOM   6701 C  CG    . LEU B 2 301 ? 245.45500 80.40100 106.57000 1.000 86.85000  ?  301 LEU B CG    1 
ATOM   6702 C  CD1   . LEU B 2 301 ? 245.93600 81.84100 106.36800 1.000 82.50000  ?  301 LEU B CD1   1 
ATOM   6703 C  CD2   . LEU B 2 301 ? 246.23400 79.71000 107.70500 1.000 84.17000  ?  301 LEU B CD2   1 
ATOM   6704 N  N     . GLU B 2 302 ? 241.27600 79.15600 105.54900 1.000 75.72000  ?  302 GLU B N     1 
ATOM   6705 C  CA    . GLU B 2 302 ? 239.85900 79.36000 105.29600 1.000 74.32000  ?  302 GLU B CA    1 
ATOM   6706 C  C     . GLU B 2 302 ? 239.05200 78.17000 105.80300 1.000 72.60000  ?  302 GLU B C     1 
ATOM   6707 O  O     . GLU B 2 302 ? 237.85700 78.29600 106.05900 1.000 73.57000  ?  302 GLU B O     1 
ATOM   6708 C  CB    . GLU B 2 302 ? 239.59800 79.61400 103.80900 1.000 74.78000  ?  302 GLU B CB    1 
ATOM   6709 C  CG    . GLU B 2 302 ? 239.27000 78.38300 102.98700 1.000 76.77000  ?  302 GLU B CG    1 
ATOM   6710 C  CD    . GLU B 2 302 ? 238.18500 78.65900 101.94200 1.000 79.27000  ?  302 GLU B CD    1 
ATOM   6711 O  OE1   . GLU B 2 302 ? 237.94400 77.79600 101.05800 1.000 75.04000  ?  302 GLU B OE1   1 
ATOM   6712 O  OE2   . GLU B 2 302 ? 237.56700 79.74500 102.01600 1.000 79.30000  ?  302 GLU B OE2   1 
ATOM   6713 N  N     . LEU B 2 303 ? 239.71200 77.02600 105.97200 1.000 72.82000  ?  303 LEU B N     1 
ATOM   6714 C  CA    . LEU B 2 303 ? 239.09900 75.85700 106.61500 1.000 70.62000  ?  303 LEU B CA    1 
ATOM   6715 C  C     . LEU B 2 303 ? 239.10200 75.97600 108.14100 1.000 70.04000  ?  303 LEU B C     1 
ATOM   6716 O  O     . LEU B 2 303 ? 238.25100 75.40600 108.82800 1.000 73.46000  ?  303 LEU B O     1 
ATOM   6717 C  CB    . LEU B 2 303 ? 239.81900 74.56800 106.20700 1.000 66.55000  ?  303 LEU B CB    1 
ATOM   6718 C  CG    . LEU B 2 303 ? 239.54600 73.37100 107.12900 1.000 65.02000  ?  303 LEU B CG    1 
ATOM   6719 C  CD1   . LEU B 2 303 ? 238.10500 72.90100 107.04600 1.000 61.91000  ?  303 LEU B CD1   1 
ATOM   6720 C  CD2   . LEU B 2 303 ? 240.50000 72.23300 106.85800 1.000 65.59000  ?  303 LEU B CD2   1 
ATOM   6721 N  N     . ALA B 2 304 ? 240.07200 76.69800 108.68100 1.000 68.34000  ?  304 ALA B N     1 
ATOM   6722 C  CA    . ALA B 2 304 ? 240.12000 76.88900 110.12000 1.000 74.13000  ?  304 ALA B CA    1 
ATOM   6723 C  C     . ALA B 2 304 ? 239.05400 77.91300 110.53100 1.000 77.46000  ?  304 ALA B C     1 
ATOM   6724 O  O     . ALA B 2 304 ? 238.38200 77.77300 111.56500 1.000 70.94000  ?  304 ALA B O     1 
ATOM   6725 C  CB    . ALA B 2 304 ? 241.50400 77.33400 110.55200 1.000 68.65000  ?  304 ALA B CB    1 
ATOM   6726 N  N     . GLU B 2 305 ? 238.89800 78.93900 109.70000 1.000 73.20000  ?  305 GLU B N     1 
ATOM   6727 C  CA    . GLU B 2 305 ? 237.91600 79.97500 109.97200 1.000 77.26000  ?  305 GLU B CA    1 
ATOM   6728 C  C     . GLU B 2 305 ? 236.53900 79.34500 109.97200 1.000 78.06000  ?  305 GLU B C     1 
ATOM   6729 O  O     . GLU B 2 305 ? 235.79700 79.44400 110.95700 1.000 79.23000  ?  305 GLU B O     1 
ATOM   6730 C  CB    . GLU B 2 305 ? 238.01700 81.11300 108.94900 1.000 79.12000  ?  305 GLU B CB    1 
ATOM   6731 C  CG    . GLU B 2 305 ? 239.36100 81.84700 109.02500 1.000 86.72000  ?  305 GLU B CG    1 
ATOM   6732 C  CD    . GLU B 2 305 ? 239.26400 83.34800 108.76400 1.000 97.75000  ?  305 GLU B CD    1 
ATOM   6733 O  OE1   . GLU B 2 305 ? 238.62800 83.73500 107.75500 1.000 97.89000  ?  305 GLU B OE1   1 
ATOM   6734 O  OE2   . GLU B 2 305 ? 239.83600 84.13600 109.56400 1.000 96.22000  ?  305 GLU B OE2   1 
ATOM   6735 N  N     . ASN B 2 306 ? 236.22500 78.67000 108.87100 1.000 74.17000  ?  306 ASN B N     1 
ATOM   6736 C  CA    . ASN B 2 306 ? 234.98900 77.91500 108.74500 1.000 70.04000  ?  306 ASN B CA    1 
ATOM   6737 C  C     . ASN B 2 306 ? 234.70000 77.03400 109.95500 1.000 68.75000  ?  306 ASN B C     1 
ATOM   6738 O  O     . ASN B 2 306 ? 233.55000 76.87700 110.34800 1.000 69.45000  ?  306 ASN B O     1 
ATOM   6739 C  CB    . ASN B 2 306 ? 235.03400 77.04800 107.49000 1.000 66.55000  ?  306 ASN B CB    1 
ATOM   6740 C  CG    . ASN B 2 306 ? 234.85100 77.83800 106.23100 1.000 65.26000  ?  306 ASN B CG    1 
ATOM   6741 O  OD1   . ASN B 2 306 ? 234.09500 78.80800 106.19100 1.000 67.60000  ?  306 ASN B OD1   1 
ATOM   6742 N  ND2   . ASN B 2 306 ? 235.53900 77.42300 105.17800 1.000 68.26000  ?  306 ASN B ND2   1 
ATOM   6743 N  N     . ARG B 2 307 ? 235.74100 76.44800 110.53800 1.000 72.34000  ?  307 ARG B N     1 
ATOM   6744 C  CA    . ARG B 2 307 ? 235.54500 75.57200 111.69100 1.000 74.48000  ?  307 ARG B CA    1 
ATOM   6745 C  C     . ARG B 2 307 ? 234.92000 76.34100 112.83700 1.000 78.48000  ?  307 ARG B C     1 
ATOM   6746 O  O     . ARG B 2 307 ? 234.15100 75.78500 113.62100 1.000 76.59000  ?  307 ARG B O     1 
ATOM   6747 C  CB    . ARG B 2 307 ? 236.86000 74.94900 112.15200 1.000 75.07000  ?  307 ARG B CB    1 
ATOM   6748 C  CG    . ARG B 2 307 ? 237.30500 73.74600 111.34800 1.000 80.05000  ?  307 ARG B CG    1 
ATOM   6749 C  CD    . ARG B 2 307 ? 238.04700 72.72600 112.20700 1.000 76.64000  ?  307 ARG B CD    1 
ATOM   6750 N  NE    . ARG B 2 307 ? 238.16500 71.44000 111.52300 1.000 76.97000  ?  307 ARG B NE    1 
ATOM   6751 C  CZ    . ARG B 2 307 ? 239.10600 71.15700 110.62700 1.000 78.94000  ?  307 ARG B CZ    1 
ATOM   6752 N  NH1   . ARG B 2 307 ? 240.01700 72.06900 110.30700 1.000 78.02000  ?  307 ARG B NH1   1 
ATOM   6753 N  NH2   . ARG B 2 307 ? 239.13800 69.96300 110.05300 1.000 76.09000  ?  307 ARG B NH2   1 
ATOM   6754 N  N     . GLU B 2 308 ? 235.25700 77.62600 112.92300 1.000 80.64000  ?  308 GLU B N     1 
ATOM   6755 C  CA    . GLU B 2 308 ? 234.78500 78.46500 114.02000 1.000 84.25000  ?  308 GLU B CA    1 
ATOM   6756 C  C     . GLU B 2 308 ? 233.45700 79.14200 113.68000 1.000 83.29000  ?  308 GLU B C     1 
ATOM   6757 O  O     . GLU B 2 308 ? 232.54900 79.16900 114.50900 1.000 86.80000  ?  308 GLU B O     1 
ATOM   6758 C  CB    . GLU B 2 308 ? 235.84900 79.50500 114.39100 1.000 84.00000  ?  308 GLU B CB    1 
ATOM   6759 C  CG    . GLU B 2 308 ? 237.13900 78.89600 114.96800 1.000 88.74000  ?  308 GLU B CG    1 
ATOM   6760 C  CD    . GLU B 2 308 ? 237.18100 78.85800 116.50800 1.000 100.14000 ?  308 GLU B CD    1 
ATOM   6761 O  OE1   . GLU B 2 308 ? 236.40500 79.58600 117.17600 1.000 97.12000  ?  308 GLU B OE1   1 
ATOM   6762 O  OE2   . GLU B 2 308 ? 238.01000 78.09600 117.05400 1.000 101.42000 ?  308 GLU B OE2   1 
ATOM   6763 N  N     . ILE B 2 309 ? 233.33700 79.67600 112.46800 1.000 76.91000  ?  309 ILE B N     1 
ATOM   6764 C  CA    . ILE B 2 309 ? 232.05600 80.18900 112.00200 1.000 75.50000  ?  309 ILE B CA    1 
ATOM   6765 C  C     . ILE B 2 309 ? 230.94000 79.18100 112.25100 1.000 82.48000  ?  309 ILE B C     1 
ATOM   6766 O  O     . ILE B 2 309 ? 229.79500 79.55600 112.48700 1.000 85.92000  ?  309 ILE B O     1 
ATOM   6767 C  CB    . ILE B 2 309 ? 232.07900 80.52300 110.50700 1.000 77.07000  ?  309 ILE B CB    1 
ATOM   6768 C  CG1   . ILE B 2 309 ? 233.22500 81.47400 110.18200 1.000 77.11000  ?  309 ILE B CG1   1 
ATOM   6769 C  CG2   . ILE B 2 309 ? 230.75400 81.12700 110.07300 1.000 76.00000  ?  309 ILE B CG2   1 
ATOM   6770 C  CD1   . ILE B 2 309 ? 233.21800 81.95200 108.74900 1.000 77.66000  ?  309 ILE B CD1   1 
ATOM   6771 N  N     . LEU B 2 310 ? 231.27200 77.89600 112.21200 1.000 80.25000  ?  310 LEU B N     1 
ATOM   6772 C  CA    . LEU B 2 310 ? 230.27300 76.86500 112.46000 1.000 78.06000  ?  310 LEU B CA    1 
ATOM   6773 C  C     . LEU B 2 310 ? 229.85800 76.81600 113.92600 1.000 81.70000  ?  310 LEU B C     1 
ATOM   6774 O  O     . LEU B 2 310 ? 228.75600 76.37200 114.25300 1.000 82.53000  ?  310 LEU B O     1 
ATOM   6775 C  CB    . LEU B 2 310 ? 230.79100 75.50200 112.00900 1.000 74.77000  ?  310 LEU B CB    1 
ATOM   6776 C  CG    . LEU B 2 310 ? 230.63700 75.32300 110.50300 1.000 76.35000  ?  310 LEU B CG    1 
ATOM   6777 C  CD1   . LEU B 2 310 ? 231.25800 74.03000 110.01500 1.000 71.84000  ?  310 LEU B CD1   1 
ATOM   6778 C  CD2   . LEU B 2 310 ? 229.15800 75.37500 110.15400 1.000 78.33000  ?  310 LEU B CD2   1 
ATOM   6779 N  N     . LYS B 2 311 ? 230.73500 77.27000 114.81500 1.000 84.46000  ?  311 LYS B N     1 
ATOM   6780 C  CA    . LYS B 2 311 ? 230.37200 77.33000 116.22800 1.000 90.98000  ?  311 LYS B CA    1 
ATOM   6781 C  C     . LYS B 2 311 ? 230.07100 78.77100 116.64900 1.000 91.97000  ?  311 LYS B C     1 
ATOM   6782 O  O     . LYS B 2 311 ? 230.92200 79.49800 117.16800 1.000 90.96000  ?  311 LYS B O     1 
ATOM   6783 C  CB    . LYS B 2 311 ? 231.45700 76.70200 117.11400 1.000 88.62000  ?  311 LYS B CB    1 
ATOM   6784 C  CG    . LYS B 2 311 ? 232.88300 77.10600 116.82400 1.000 87.43000  ?  311 LYS B CG    1 
ATOM   6785 C  CD    . LYS B 2 311 ? 233.81200 76.28700 117.70300 1.000 88.23000  ?  311 LYS B CD    1 
ATOM   6786 C  CE    . LYS B 2 311 ? 235.25300 76.40400 117.25900 1.000 91.16000  ?  311 LYS B CE    1 
ATOM   6787 N  NZ    . LYS B 2 311 ? 236.08800 75.35600 117.89700 1.000 95.81000  ?  311 LYS B NZ    1 
ATOM   6788 N  N     . GLU B 2 312 ? 228.82800 79.16000 116.39400 1.000 93.65000  ?  312 GLU B N     1 
ATOM   6789 C  CA    . GLU B 2 312 ? 228.30100 80.46400 116.73700 1.000 87.08000  ?  312 GLU B CA    1 
ATOM   6790 C  C     . GLU B 2 312 ? 226.80300 80.32700 116.79300 1.000 90.55000  ?  312 GLU B C     1 
ATOM   6791 O  O     . GLU B 2 312 ? 226.23800 79.39100 116.22100 1.000 86.31000  ?  312 GLU B O     1 
ATOM   6792 C  CB    . GLU B 2 312 ? 228.68600 81.52300 115.71000 1.000 82.91000  ?  312 GLU B CB    1 
ATOM   6793 C  CG    . GLU B 2 312 ? 230.06100 82.10600 115.89200 1.000 87.62000  ?  312 GLU B CG    1 
ATOM   6794 C  CD    . GLU B 2 312 ? 230.51100 82.88300 114.67100 1.000 94.25000  ?  312 GLU B CD    1 
ATOM   6795 O  OE1   . GLU B 2 312 ? 229.76100 82.89000 113.66300 1.000 95.73000  ?  312 GLU B OE1   1 
ATOM   6796 O  OE2   . GLU B 2 312 ? 231.61100 83.48100 114.71500 1.000 96.67000  ?  312 GLU B OE2   1 
ATOM   6797 N  N     . PRO B 2 313 ? 226.14400 81.25400 117.48600 1.000 91.58000  ?  313 PRO B N     1 
ATOM   6798 C  CA    . PRO B 2 313 ? 224.69200 81.25000 117.34000 1.000 90.50000  ?  313 PRO B CA    1 
ATOM   6799 C  C     . PRO B 2 313 ? 224.31700 81.56700 115.89100 1.000 84.54000  ?  313 PRO B C     1 
ATOM   6800 O  O     . PRO B 2 313 ? 224.88700 82.47500 115.27500 1.000 83.32000  ?  313 PRO B O     1 
ATOM   6801 C  CB    . PRO B 2 313 ? 224.22900 82.34900 118.31200 1.000 91.91000  ?  313 PRO B CB    1 
ATOM   6802 C  CG    . PRO B 2 313 ? 225.44600 83.20700 118.55000 1.000 93.32000  ?  313 PRO B CG    1 
ATOM   6803 C  CD    . PRO B 2 313 ? 226.63300 82.30100 118.40000 1.000 87.24000  ?  313 PRO B CD    1 
ATOM   6804 N  N     . VAL B 2 314 ? 223.39400 80.79100 115.34000 1.000 79.78000  ?  314 VAL B N     1 
ATOM   6805 C  CA    . VAL B 2 314 ? 222.79000 81.14300 114.06500 1.000 82.79000  ?  314 VAL B CA    1 
ATOM   6806 C  C     . VAL B 2 314 ? 221.96700 82.42400 114.25700 1.000 85.49000  ?  314 VAL B C     1 
ATOM   6807 O  O     . VAL B 2 314 ? 221.19900 82.54400 115.21300 1.000 83.65000  ?  314 VAL B O     1 
ATOM   6808 C  CB    . VAL B 2 314 ? 221.91300 79.99700 113.52500 1.000 82.01000  ?  314 VAL B CB    1 
ATOM   6809 C  CG1   . VAL B 2 314 ? 221.01200 79.44900 114.63300 1.000 83.20000  ?  314 VAL B CG1   1 
ATOM   6810 C  CG2   . VAL B 2 314 ? 221.10900 80.44500 112.30100 1.000 76.80000  ?  314 VAL B CG2   1 
ATOM   6811 N  N     . HIS B 2 315 ? 222.13700 83.38700 113.35900 1.000 83.28000  ?  315 HIS B N     1 
ATOM   6812 C  CA    . HIS B 2 315 ? 221.55500 84.70600 113.57500 1.000 88.02000  ?  315 HIS B CA    1 
ATOM   6813 C  C     . HIS B 2 315 ? 220.10400 84.83300 113.13500 1.000 84.90000  ?  315 HIS B C     1 
ATOM   6814 O  O     . HIS B 2 315 ? 219.68300 84.21900 112.15100 1.000 80.85000  ?  315 HIS B O     1 
ATOM   6815 C  CB    . HIS B 2 315 ? 222.38200 85.77600 112.86300 1.000 90.17000  ?  315 HIS B CB    1 
ATOM   6816 C  CG    . HIS B 2 315 ? 222.76700 86.90700 113.75700 1.000 99.51000  ?  315 HIS B CG    1 
ATOM   6817 N  ND1   . HIS B 2 315 ? 221.93100 87.97400 114.00900 1.000 100.58000 ?  315 HIS B ND1   1 
ATOM   6818 C  CD2   . HIS B 2 315 ? 223.88100 87.11500 114.49800 1.000 107.04000 ?  315 HIS B CD2   1 
ATOM   6819 C  CE1   . HIS B 2 315 ? 222.52200 88.80100 114.85300 1.000 107.26000 ?  315 HIS B CE1   1 
ATOM   6820 N  NE2   . HIS B 2 315 ? 223.70700 88.30500 115.16300 1.000 113.50000 ?  315 HIS B NE2   1 
ATOM   6821 N  N     . GLY B 2 316 ? 219.34500 85.64300 113.87000 1.000 81.13000  ?  316 GLY B N     1 
ATOM   6822 C  CA    . GLY B 2 316 ? 218.01200 86.02900 113.44800 1.000 78.66000  ?  316 GLY B CA    1 
ATOM   6823 C  C     . GLY B 2 316 ? 217.01700 84.89100 113.50500 1.000 73.63000  ?  316 GLY B C     1 
ATOM   6824 O  O     . GLY B 2 316 ? 216.22200 84.69800 112.58800 1.000 75.32000  ?  316 GLY B O     1 
ATOM   6825 N  N     . VAL B 2 317 ? 217.07000 84.13700 114.59200 1.000 70.32000  ?  317 VAL B N     1 
ATOM   6826 C  CA    . VAL B 2 317 ? 216.15100 83.03800 114.79400 1.000 71.89000  ?  317 VAL B CA    1 
ATOM   6827 C  C     . VAL B 2 317 ? 215.18600 83.35200 115.94600 1.000 67.05000  ?  317 VAL B C     1 
ATOM   6828 O  O     . VAL B 2 317 ? 215.48100 83.09700 117.11200 1.000 66.59000  ?  317 VAL B O     1 
ATOM   6829 C  CB    . VAL B 2 317 ? 216.92500 81.73100 115.06600 1.000 75.01000  ?  317 VAL B CB    1 
ATOM   6830 C  CG1   . VAL B 2 317 ? 215.97800 80.55200 115.22700 1.000 64.68000  ?  317 VAL B CG1   1 
ATOM   6831 C  CG2   . VAL B 2 317 ? 217.90000 81.47000 113.93400 1.000 75.65000  ?  317 VAL B CG2   1 
ATOM   6832 N  N     . TYR B 2 318 ? 214.02500 83.89600 115.60100 1.000 66.05000  ?  318 TYR B N     1 
ATOM   6833 C  CA    . TYR B 2 318 ? 213.01400 84.26300 116.59400 1.000 64.73000  ?  318 TYR B CA    1 
ATOM   6834 C  C     . TYR B 2 318 ? 211.84400 83.28800 116.63100 1.000 54.99000  ?  318 TYR B C     1 
ATOM   6835 O  O     . TYR B 2 318 ? 211.13500 83.12700 115.65000 1.000 63.39000  ?  318 TYR B O     1 
ATOM   6836 C  CB    . TYR B 2 318 ? 212.52100 85.69000 116.31300 1.000 63.76000  ?  318 TYR B CB    1 
ATOM   6837 C  CG    . TYR B 2 318 ? 213.65400 86.67900 116.41300 1.000 68.55000  ?  318 TYR B CG    1 
ATOM   6838 C  CD1   . TYR B 2 318 ? 214.10200 87.13200 117.65700 1.000 70.38000  ?  318 TYR B CD1   1 
ATOM   6839 C  CD2   . TYR B 2 318 ? 214.31800 87.11500 115.27900 1.000 70.95000  ?  318 TYR B CD2   1 
ATOM   6840 C  CE1   . TYR B 2 318 ? 215.15900 88.01600 117.76200 1.000 71.38000  ?  318 TYR B CE1   1 
ATOM   6841 C  CE2   . TYR B 2 318 ? 215.38200 87.99900 115.37000 1.000 72.71000  ?  318 TYR B CE2   1 
ATOM   6842 C  CZ    . TYR B 2 318 ? 215.79400 88.44200 116.61300 1.000 73.45000  ?  318 TYR B CZ    1 
ATOM   6843 O  OH    . TYR B 2 318 ? 216.84900 89.31200 116.69900 1.000 78.79000  ?  318 TYR B OH    1 
ATOM   6844 N  N     . TYR B 2 319 ? 211.63800 82.62800 117.76100 1.000 56.77000  ?  319 TYR B N     1 
ATOM   6845 C  CA    . TYR B 2 319 ? 210.53000 81.69200 117.85200 1.000 53.71000  ?  319 TYR B CA    1 
ATOM   6846 C  C     . TYR B 2 319 ? 209.20800 82.43300 117.66100 1.000 60.37000  ?  319 TYR B C     1 
ATOM   6847 O  O     . TYR B 2 319 ? 208.95300 83.42500 118.31800 1.000 61.75000  ?  319 TYR B O     1 
ATOM   6848 C  CB    . TYR B 2 319 ? 210.55200 80.93800 119.18700 1.000 57.35000  ?  319 TYR B CB    1 
ATOM   6849 C  CG    . TYR B 2 319 ? 209.28000 80.16800 119.43900 1.000 65.20000  ?  319 TYR B CG    1 
ATOM   6850 C  CD1   . TYR B 2 319 ? 208.89700 79.13300 118.59700 1.000 64.79000  ?  319 TYR B CD1   1 
ATOM   6851 C  CD2   . TYR B 2 319 ? 208.44300 80.49500 120.50000 1.000 62.56000  ?  319 TYR B CD2   1 
ATOM   6852 C  CE1   . TYR B 2 319 ? 207.71500 78.44200 118.80600 1.000 65.72000  ?  319 TYR B CE1   1 
ATOM   6853 C  CE2   . TYR B 2 319 ? 207.26100 79.80800 120.72100 1.000 61.46000  ?  319 TYR B CE2   1 
ATOM   6854 C  CZ    . TYR B 2 319 ? 206.90100 78.78300 119.86900 1.000 66.29000  ?  319 TYR B CZ    1 
ATOM   6855 O  OH    . TYR B 2 319 ? 205.72700 78.09300 120.07200 1.000 66.60000  ?  319 TYR B OH    1 
ATOM   6856 N  N     . ASP B 2 320 ? 208.38700 81.95100 116.73600 1.000 62.43000  ?  320 ASP B N     1 
ATOM   6857 C  CA    . ASP B 2 320 ? 207.09200 82.54500 116.43100 1.000 64.56000  ?  320 ASP B CA    1 
ATOM   6858 C  C     . ASP B 2 320 ? 205.96300 81.55800 116.77300 1.000 68.62000  ?  320 ASP B C     1 
ATOM   6859 O  O     . ASP B 2 320 ? 205.72500 80.60400 116.03600 1.000 67.08000  ?  320 ASP B O     1 
ATOM   6860 C  CB    . ASP B 2 320 ? 207.05300 82.96400 114.95000 1.000 65.35000  ?  320 ASP B CB    1 
ATOM   6861 C  CG    . ASP B 2 320 ? 205.64700 83.27500 114.43300 1.000 68.83000  ?  320 ASP B CG    1 
ATOM   6862 O  OD1   . ASP B 2 320 ? 204.69700 83.43300 115.21900 1.000 71.61000  ?  320 ASP B OD1   1 
ATOM   6863 O  OD2   . ASP B 2 320 ? 205.49100 83.38100 113.20400 1.000 76.07000  ?  320 ASP B OD2   1 
ATOM   6864 N  N     . PRO B 2 321 ? 205.24200 81.81000 117.88200 1.000 69.86000  ?  321 PRO B N     1 
ATOM   6865 C  CA    . PRO B 2 321 ? 204.21300 80.89800 118.40000 1.000 65.85000  ?  321 PRO B CA    1 
ATOM   6866 C  C     . PRO B 2 321 ? 203.08800 80.64200 117.40200 1.000 66.97000  ?  321 PRO B C     1 
ATOM   6867 O  O     . PRO B 2 321 ? 202.48400 79.58000 117.43100 1.000 70.78000  ?  321 PRO B O     1 
ATOM   6868 C  CB    . PRO B 2 321 ? 203.68300 81.62800 119.62800 1.000 59.56000  ?  321 PRO B CB    1 
ATOM   6869 C  CG    . PRO B 2 321 ? 204.71100 82.62800 119.95800 1.000 62.84000  ?  321 PRO B CG    1 
ATOM   6870 C  CD    . PRO B 2 321 ? 205.30100 83.05200 118.66400 1.000 64.91000  ?  321 PRO B CD    1 
ATOM   6871 N  N     . SER B 2 322 ? 202.83100 81.59000 116.51400 1.000 66.86000  ?  322 SER B N     1 
ATOM   6872 C  CA    . SER B 2 322 ? 201.78900 81.41600 115.51000 1.000 70.62000  ?  322 SER B CA    1 
ATOM   6873 C  C     . SER B 2 322 ? 202.17100 80.43000 114.38500 1.000 70.41000  ?  322 SER B C     1 
ATOM   6874 O  O     . SER B 2 322 ? 201.33500 80.08300 113.55900 1.000 77.37000  ?  322 SER B O     1 
ATOM   6875 C  CB    . SER B 2 322 ? 201.41500 82.78100 114.90300 1.000 75.08000  ?  322 SER B CB    1 
ATOM   6876 O  OG    . SER B 2 322 ? 202.49200 83.34500 114.16300 1.000 79.13000  ?  322 SER B OG    1 
ATOM   6877 N  N     . LYS B 2 323 ? 203.42200 79.98600 114.33500 1.000 70.50000  ?  323 LYS B N     1 
ATOM   6878 C  CA    . LYS B 2 323 ? 203.83900 79.02700 113.30700 1.000 70.06000  ?  323 LYS B CA    1 
ATOM   6879 C  C     . LYS B 2 323 ? 204.12700 77.65600 113.91800 1.000 72.17000  ?  323 LYS B C     1 
ATOM   6880 O  O     . LYS B 2 323 ? 204.43400 77.55500 115.10400 1.000 71.64000  ?  323 LYS B O     1 
ATOM   6881 C  CB    . LYS B 2 323 ? 205.07700 79.52400 112.55800 1.000 72.52000  ?  323 LYS B CB    1 
ATOM   6882 C  CG    . LYS B 2 323 ? 204.88000 80.79300 111.72300 1.000 74.83000  ?  323 LYS B CG    1 
ATOM   6883 C  CD    . LYS B 2 323 ? 205.82400 80.77800 110.51100 1.000 79.30000  ?  323 LYS B CD    1 
ATOM   6884 C  CE    . LYS B 2 323 ? 206.27400 82.17000 110.08600 1.000 81.20000  ?  323 LYS B CE    1 
ATOM   6885 N  NZ    . LYS B 2 323 ? 207.70000 82.14000 109.62900 1.000 88.06000  ?  323 LYS B NZ    1 
ATOM   6886 N  N     . ASP B 2 324 ? 204.02700 76.59900 113.11700 1.000 69.55000  ?  324 ASP B N     1 
ATOM   6887 C  CA    . ASP B 2 324 ? 204.31200 75.26500 113.62900 1.000 66.65000  ?  324 ASP B CA    1 
ATOM   6888 C  C     . ASP B 2 324 ? 205.79400 75.03000 113.74400 1.000 61.52000  ?  324 ASP B C     1 
ATOM   6889 O  O     . ASP B 2 324 ? 206.57500 75.51500 112.93200 1.000 64.85000  ?  324 ASP B O     1 
ATOM   6890 C  CB    . ASP B 2 324 ? 203.72600 74.18600 112.72700 1.000 73.37000  ?  324 ASP B CB    1 
ATOM   6891 C  CG    . ASP B 2 324 ? 202.25600 74.36700 112.48200 1.000 79.13000  ?  324 ASP B CG    1 
ATOM   6892 O  OD1   . ASP B 2 324 ? 201.51600 74.63600 113.46600 1.000 82.72000  ?  324 ASP B OD1   1 
ATOM   6893 O  OD2   . ASP B 2 324 ? 201.85400 74.24200 111.30100 1.000 74.51000  ?  324 ASP B OD2   1 
ATOM   6894 N  N     . LEU B 2 325 ? 206.17800 74.26200 114.74300 1.000 57.75000  ?  325 LEU B N     1 
ATOM   6895 C  CA    . LEU B 2 325 ? 207.52400 73.73400 114.78700 1.000 59.10000  ?  325 LEU B CA    1 
ATOM   6896 C  C     . LEU B 2 325 ? 207.64400 72.56000 113.81700 1.000 58.44000  ?  325 LEU B C     1 
ATOM   6897 O  O     . LEU B 2 325 ? 206.86600 71.61400 113.88800 1.000 57.63000  ?  325 LEU B O     1 
ATOM   6898 C  CB    . LEU B 2 325 ? 207.87900 73.28900 116.20500 1.000 59.41000  ?  325 LEU B CB    1 
ATOM   6899 C  CG    . LEU B 2 325 ? 207.95100 74.40000 117.24100 1.000 61.30000  ?  325 LEU B CG    1 
ATOM   6900 C  CD1   . LEU B 2 325 ? 207.87900 73.82000 118.64000 1.000 64.04000  ?  325 LEU B CD1   1 
ATOM   6901 C  CD2   . LEU B 2 325 ? 209.24600 75.16300 117.04100 1.000 63.02000  ?  325 LEU B CD2   1 
ATOM   6902 N  N     . ILE B 2 326 ? 208.61400 72.63700 112.90900 1.000 58.09000  ?  326 ILE B N     1 
ATOM   6903 C  CA    . ILE B 2 326 ? 208.95200 71.53800 112.01300 1.000 49.70000  ?  326 ILE B CA    1 
ATOM   6904 C  C     . ILE B 2 326 ? 210.09900 70.74200 112.59300 1.000 52.49000  ?  326 ILE B C     1 
ATOM   6905 O  O     . ILE B 2 326 ? 211.17600 71.28700 112.82200 1.000 56.24000  ?  326 ILE B O     1 
ATOM   6906 C  CB    . ILE B 2 326 ? 209.39000 72.03700 110.62400 1.000 51.68000  ?  326 ILE B CB    1 
ATOM   6907 C  CG1   . ILE B 2 326 ? 208.39300 73.04400 110.06000 1.000 49.62000  ?  326 ILE B CG1   1 
ATOM   6908 C  CG2   . ILE B 2 326 ? 209.61000 70.87600 109.68700 1.000 50.14000  ?  326 ILE B CG2   1 
ATOM   6909 C  CD1   . ILE B 2 326 ? 207.06600 72.47200 109.81100 1.000 51.99000  ?  326 ILE B CD1   1 
ATOM   6910 N  N     . ALA B 2 327 ? 209.90200 69.45900 112.84400 1.000 52.77000  ?  327 ALA B N     1 
ATOM   6911 C  CA    . ALA B 2 327 ? 211.04400 68.64600 113.25000 1.000 52.33000  ?  327 ALA B CA    1 
ATOM   6912 C  C     . ALA B 2 327 ? 211.46200 67.75100 112.08800 1.000 51.24000  ?  327 ALA B C     1 
ATOM   6913 O  O     . ALA B 2 327 ? 210.63800 67.17300 111.38300 1.000 53.66000  ?  327 ALA B O     1 
ATOM   6914 C  CB    . ALA B 2 327 ? 210.73100 67.81400 114.50800 1.000 45.70000  ?  327 ALA B CB    1 
ATOM   6915 N  N     . GLU B 2 328 ? 212.75500 67.64100 111.88800 1.000 50.40000  ?  328 GLU B N     1 
ATOM   6916 C  CA    . GLU B 2 328 ? 213.25200 66.83700 110.80600 1.000 51.97000  ?  328 GLU B CA    1 
ATOM   6917 C  C     . GLU B 2 328 ? 214.25800 65.83300 111.38200 1.000 54.18000  ?  328 GLU B C     1 
ATOM   6918 O  O     . GLU B 2 328 ? 215.12200 66.21100 112.18300 1.000 51.91000  ?  328 GLU B O     1 
ATOM   6919 C  CB    . GLU B 2 328 ? 213.86500 67.74400 109.75500 1.000 51.26000  ?  328 GLU B CB    1 
ATOM   6920 C  CG    . GLU B 2 328 ? 214.03400 67.13100 108.39500 1.000 59.05000  ?  328 GLU B CG    1 
ATOM   6921 C  CD    . GLU B 2 328 ? 214.37900 68.17900 107.36500 1.000 66.22000  ?  328 GLU B CD    1 
ATOM   6922 O  OE1   . GLU B 2 328 ? 213.83300 69.30000 107.46700 1.000 63.45000  ?  328 GLU B OE1   1 
ATOM   6923 O  OE2   . GLU B 2 328 ? 215.20000 67.88800 106.46600 1.000 74.18000  ?  328 GLU B OE2   1 
ATOM   6924 N  N     . ILE B 2 329 ? 214.13000 64.55800 111.01200 1.000 48.39000  ?  329 ILE B N     1 
ATOM   6925 C  CA    . ILE B 2 329 ? 214.99600 63.53200 111.58600 1.000 53.53000  ?  329 ILE B CA    1 
ATOM   6926 C  C     . ILE B 2 329 ? 215.76300 62.76200 110.51000 1.000 52.37000  ?  329 ILE B C     1 
ATOM   6927 O  O     . ILE B 2 329 ? 215.21200 62.41800 109.47300 1.000 57.97000  ?  329 ILE B O     1 
ATOM   6928 C  CB    . ILE B 2 329 ? 214.18600 62.54600 112.44600 1.000 47.82000  ?  329 ILE B CB    1 
ATOM   6929 C  CG1   . ILE B 2 329 ? 213.35800 63.31300 113.47100 1.000 42.62000  ?  329 ILE B CG1   1 
ATOM   6930 C  CG2   . ILE B 2 329 ? 215.10400 61.56500 113.14400 1.000 43.33000  ?  329 ILE B CG2   1 
ATOM   6931 C  CD1   . ILE B 2 329 ? 212.52700 62.41300 114.31800 1.000 44.56000  ?  329 ILE B CD1   1 
ATOM   6932 N  N     . GLN B 2 330 ? 217.04000 62.49600 110.75200 1.000 52.29000  ?  330 GLN B N     1 
ATOM   6933 C  CA    . GLN B 2 330 ? 217.81400 61.68900 109.81200 1.000 52.90000  ?  330 GLN B CA    1 
ATOM   6934 C  C     . GLN B 2 330 ? 218.42000 60.48300 110.48800 1.000 53.90000  ?  330 GLN B C     1 
ATOM   6935 O  O     . GLN B 2 330 ? 218.97300 60.59600 111.57500 1.000 56.81000  ?  330 GLN B O     1 
ATOM   6936 C  CB    . GLN B 2 330 ? 218.91400 62.51800 109.16600 1.000 52.12000  ?  330 GLN B CB    1 
ATOM   6937 C  CG    . GLN B 2 330 ? 218.39400 63.76200 108.49800 1.000 56.62000  ?  330 GLN B CG    1 
ATOM   6938 C  CD    . GLN B 2 330 ? 218.48600 64.94200 109.40800 1.000 55.15000  ?  330 GLN B CD    1 
ATOM   6939 O  OE1   . GLN B 2 330 ? 219.40900 65.03200 110.21000 1.000 57.58000  ?  330 GLN B OE1   1 
ATOM   6940 N  NE2   . GLN B 2 330 ? 217.53100 65.85800 109.30200 1.000 52.74000  ?  330 GLN B NE2   1 
ATOM   6941 N  N     . LYS B 2 331 ? 218.31100 59.32700 109.84400 1.000 59.34000  ?  331 LYS B N     1 
ATOM   6942 C  CA    . LYS B 2 331 ? 218.96100 58.11800 110.33700 1.000 59.38000  ?  331 LYS B CA    1 
ATOM   6943 C  C     . LYS B 2 331 ? 220.44700 58.15200 110.00800 1.000 59.21000  ?  331 LYS B C     1 
ATOM   6944 O  O     . LYS B 2 331 ? 220.82700 58.17600 108.84000 1.000 64.89000  ?  331 LYS B O     1 
ATOM   6945 C  CB    . LYS B 2 331 ? 218.31100 56.87700 109.74000 1.000 57.94000  ?  331 LYS B CB    1 
ATOM   6946 C  CG    . LYS B 2 331 ? 219.04900 55.59700 110.05000 1.000 57.77000  ?  331 LYS B CG    1 
ATOM   6947 C  CD    . LYS B 2 331 ? 218.26300 54.42800 109.54500 1.000 56.11000  ?  331 LYS B CD    1 
ATOM   6948 C  CE    . LYS B 2 331 ? 219.16300 53.35300 109.02900 1.000 56.57000  ?  331 LYS B CE    1 
ATOM   6949 N  NZ    . LYS B 2 331 ? 218.35800 52.17000 108.66100 1.000 58.43000  ?  331 LYS B NZ    1 
ATOM   6950 N  N     . GLN B 2 332 ? 221.28300 58.18400 111.03700 1.000 58.27000  ?  332 GLN B N     1 
ATOM   6951 C  CA    . GLN B 2 332 ? 222.72400 58.26900 110.83100 1.000 62.42000  ?  332 GLN B CA    1 
ATOM   6952 C  C     . GLN B 2 332 ? 223.36200 56.89300 110.88100 1.000 66.18000  ?  332 GLN B C     1 
ATOM   6953 O  O     . GLN B 2 332 ? 224.55000 56.75100 110.59900 1.000 70.16000  ?  332 GLN B O     1 
ATOM   6954 C  CB    . GLN B 2 332 ? 223.38700 59.18200 111.87200 1.000 61.66000  ?  332 GLN B CB    1 
ATOM   6955 C  CG    . GLN B 2 332 ? 223.12200 60.67300 111.71700 1.000 59.92000  ?  332 GLN B CG    1 
ATOM   6956 C  CD    . GLN B 2 332 ? 223.38000 61.17500 110.31600 1.000 65.50000  ?  332 GLN B CD    1 
ATOM   6957 O  OE1   . GLN B 2 332 ? 223.90700 60.45600 109.47400 1.000 72.18000  ?  332 GLN B OE1   1 
ATOM   6958 N  NE2   . GLN B 2 332 ? 222.99100 62.41500 110.05400 1.000 69.34000  ?  332 GLN B NE2   1 
ATOM   6959 N  N     . GLY B 2 333 ? 222.56700 55.89100 111.25400 1.000 66.92000  ?  333 GLY B N     1 
ATOM   6960 C  CA    . GLY B 2 333 ? 223.03500 54.52400 111.37600 1.000 59.37000  ?  333 GLY B CA    1 
ATOM   6961 C  C     . GLY B 2 333 ? 223.67100 54.22700 112.71700 1.000 67.53000  ?  333 GLY B C     1 
ATOM   6962 O  O     . GLY B 2 333 ? 224.11600 55.13100 113.42800 1.000 66.60000  ?  333 GLY B O     1 
ATOM   6963 N  N     . GLN B 2 334 ? 223.71400 52.94500 113.06100 1.000 72.65000  ?  334 GLN B N     1 
ATOM   6964 C  CA    . GLN B 2 334 ? 224.41600 52.48300 114.25200 1.000 72.41000  ?  334 GLN B CA    1 
ATOM   6965 C  C     . GLN B 2 334 ? 223.75200 53.00100 115.50900 1.000 77.17000  ?  334 GLN B C     1 
ATOM   6966 O  O     . GLN B 2 334 ? 224.43300 53.28400 116.50400 1.000 80.38000  ?  334 GLN B O     1 
ATOM   6967 C  CB    . GLN B 2 334 ? 225.87600 52.92900 114.21300 1.000 75.89000  ?  334 GLN B CB    1 
ATOM   6968 C  CG    . GLN B 2 334 ? 226.53100 52.76700 112.84400 1.000 83.95000  ?  334 GLN B CG    1 
ATOM   6969 C  CD    . GLN B 2 334 ? 227.02300 51.34800 112.56400 1.000 94.54000  ?  334 GLN B CD    1 
ATOM   6970 O  OE1   . GLN B 2 334 ? 226.24000 50.45100 112.21500 1.000 92.66000  ?  334 GLN B OE1   1 
ATOM   6971 N  NE2   . GLN B 2 334 ? 228.33600 51.14400 112.70100 1.000 96.41000  ?  334 GLN B NE2   1 
ATOM   6972 N  N     . GLY B 2 335 ? 222.42400 53.12800 115.45500 1.000 70.58000  ?  335 GLY B N     1 
ATOM   6973 C  CA    . GLY B 2 335 ? 221.65400 53.70200 116.54300 1.000 64.42000  ?  335 GLY B CA    1 
ATOM   6974 C  C     . GLY B 2 335 ? 221.78800 55.21600 116.69200 1.000 66.60000  ?  335 GLY B C     1 
ATOM   6975 O  O     . GLY B 2 335 ? 221.35300 55.77700 117.69300 1.000 71.05000  ?  335 GLY B O     1 
ATOM   6976 N  N     . GLN B 2 336 ? 222.38600 55.88300 115.70800 1.000 65.31000  ?  336 GLN B N     1 
ATOM   6977 C  CA    . GLN B 2 336 ? 222.55100 57.33900 115.75000 1.000 66.38000  ?  336 GLN B CA    1 
ATOM   6978 C  C     . GLN B 2 336 ? 221.48800 58.07900 114.92300 1.000 61.29000  ?  336 GLN B C     1 
ATOM   6979 O  O     . GLN B 2 336 ? 221.32100 57.82800 113.73100 1.000 59.38000  ?  336 GLN B O     1 
ATOM   6980 C  CB    . GLN B 2 336 ? 223.94400 57.74300 115.24100 1.000 70.10000  ?  336 GLN B CB    1 
ATOM   6981 C  CG    . GLN B 2 336 ? 225.12300 57.03600 115.89000 1.000 73.42000  ?  336 GLN B CG    1 
ATOM   6982 C  CD    . GLN B 2 336 ? 225.21300 57.30600 117.37700 1.000 79.52000  ?  336 GLN B CD    1 
ATOM   6983 O  OE1   . GLN B 2 336 ? 225.04100 56.39400 118.19800 1.000 82.38000  ?  336 GLN B OE1   1 
ATOM   6984 N  NE2   . GLN B 2 336 ? 225.47900 58.56300 117.73700 1.000 74.78000  ?  336 GLN B NE2   1 
ATOM   6985 N  N     . TRP B 2 337 ? 220.78400 59.00600 115.55400 1.000 59.91000  ?  337 TRP B N     1 
ATOM   6986 C  CA    . TRP B 2 337 ? 219.77300 59.79300 114.84900 1.000 61.65000  ?  337 TRP B CA    1 
ATOM   6987 C  C     . TRP B 2 337 ? 219.98500 61.27000 115.10500 1.000 58.18000  ?  337 TRP B C     1 
ATOM   6988 O  O     . TRP B 2 337 ? 220.18100 61.69000 116.24300 1.000 63.72000  ?  337 TRP B O     1 
ATOM   6989 C  CB    . TRP B 2 337 ? 218.35900 59.39300 115.28200 1.000 58.23000  ?  337 TRP B CB    1 
ATOM   6990 C  CG    . TRP B 2 337 ? 218.10700 57.93000 115.21200 1.000 56.39000  ?  337 TRP B CG    1 
ATOM   6991 C  CD1   . TRP B 2 337 ? 218.60000 56.96700 116.04500 1.000 57.02000  ?  337 TRP B CD1   1 
ATOM   6992 C  CD2   . TRP B 2 337 ? 217.30400 57.25800 114.25300 1.000 55.21000  ?  337 TRP B CD2   1 
ATOM   6993 N  NE1   . TRP B 2 337 ? 218.14200 55.73100 115.66400 1.000 57.17000  ?  337 TRP B NE1   1 
ATOM   6994 C  CE2   . TRP B 2 337 ? 217.34200 55.88600 114.56100 1.000 57.20000  ?  337 TRP B CE2   1 
ATOM   6995 C  CE3   . TRP B 2 337 ? 216.54100 57.68300 113.16800 1.000 56.15000  ?  337 TRP B CE3   1 
ATOM   6996 C  CZ2   . TRP B 2 337 ? 216.65600 54.94200 113.81900 1.000 55.35000  ?  337 TRP B CZ2   1 
ATOM   6997 C  CZ3   . TRP B 2 337 ? 215.86300 56.74800 112.43900 1.000 54.67000  ?  337 TRP B CZ3   1 
ATOM   6998 C  CH2   . TRP B 2 337 ? 215.92600 55.39200 112.76200 1.000 56.88000  ?  337 TRP B CH2   1 
ATOM   6999 N  N     . THR B 2 338 ? 219.93900 62.05800 114.04700 1.000 52.62000  ?  338 THR B N     1 
ATOM   7000 C  CA    . THR B 2 338 ? 220.04700 63.49600 114.17700 1.000 52.55000  ?  338 THR B CA    1 
ATOM   7001 C  C     . THR B 2 338 ? 218.70900 64.14700 113.87200 1.000 53.40000  ?  338 THR B C     1 
ATOM   7002 O  O     . THR B 2 338 ? 217.85000 63.56000 113.19700 1.000 57.00000  ?  338 THR B O     1 
ATOM   7003 C  CB    . THR B 2 338 ? 221.11000 64.05300 113.24200 1.000 50.56000  ?  338 THR B CB    1 
ATOM   7004 O  OG1   . THR B 2 338 ? 220.80200 63.67600 111.89900 1.000 51.58000  ?  338 THR B OG1   1 
ATOM   7005 C  CG2   . THR B 2 338 ? 222.44800 63.47600 113.60900 1.000 51.11000  ?  338 THR B CG2   1 
ATOM   7006 N  N     . TYR B 2 339 ? 218.52800 65.36100 114.36700 1.000 49.75000  ?  339 TYR B N     1 
ATOM   7007 C  CA    . TYR B 2 339 ? 217.28800 66.07500 114.14900 1.000 51.95000  ?  339 TYR B CA    1 
ATOM   7008 C  C     . TYR B 2 339 ? 217.49500 67.56400 114.26800 1.000 50.88000  ?  339 TYR B C     1 
ATOM   7009 O  O     . TYR B 2 339 ? 218.41300 68.03100 114.93600 1.000 54.07000  ?  339 TYR B O     1 
ATOM   7010 C  CB    . TYR B 2 339 ? 216.21500 65.61500 115.14900 1.000 51.31000  ?  339 TYR B CB    1 
ATOM   7011 C  CG    . TYR B 2 339 ? 216.53800 65.92700 116.59700 1.000 51.04000  ?  339 TYR B CG    1 
ATOM   7012 C  CD1   . TYR B 2 339 ? 217.28300 65.04500 117.37000 1.000 54.10000  ?  339 TYR B CD1   1 
ATOM   7013 C  CD2   . TYR B 2 339 ? 216.09200 67.09900 117.18700 1.000 49.87000  ?  339 TYR B CD2   1 
ATOM   7014 C  CE1   . TYR B 2 339 ? 217.57300 65.32100 118.68200 1.000 52.33000  ?  339 TYR B CE1   1 
ATOM   7015 C  CE2   . TYR B 2 339 ? 216.37600 67.38400 118.49000 1.000 54.08000  ?  339 TYR B CE2   1 
ATOM   7016 C  CZ    . TYR B 2 339 ? 217.11400 66.49500 119.23900 1.000 58.13000  ?  339 TYR B CZ    1 
ATOM   7017 O  OH    . TYR B 2 339 ? 217.39500 66.79800 120.55300 1.000 63.42000  ?  339 TYR B OH    1 
ATOM   7018 N  N     . GLN B 2 340 ? 216.61700 68.31000 113.62700 1.000 49.07000  ?  340 GLN B N     1 
ATOM   7019 C  CA    . GLN B 2 340 ? 216.65000 69.75000 113.72300 1.000 52.01000  ?  340 GLN B CA    1 
ATOM   7020 C  C     . GLN B 2 340 ? 215.22700 70.24600 113.91000 1.000 56.23000  ?  340 GLN B C     1 
ATOM   7021 O  O     . GLN B 2 340 ? 214.28100 69.63000 113.41700 1.000 57.66000  ?  340 GLN B O     1 
ATOM   7022 C  CB    . GLN B 2 340 ? 217.28200 70.36800 112.47600 1.000 53.41000  ?  340 GLN B CB    1 
ATOM   7023 C  CG    . GLN B 2 340 ? 218.63500 69.80200 112.12900 1.000 52.25000  ?  340 GLN B CG    1 
ATOM   7024 C  CD    . GLN B 2 340 ? 218.52700 68.51500 111.38600 1.000 48.70000  ?  340 GLN B CD    1 
ATOM   7025 O  OE1   . GLN B 2 340 ? 217.81500 68.43100 110.39700 1.000 55.11000  ?  340 GLN B OE1   1 
ATOM   7026 N  NE2   . GLN B 2 340 ? 219.21100 67.49300 111.86200 1.000 47.64000  ?  340 GLN B NE2   1 
ATOM   7027 N  N     . ILE B 2 341 ? 215.08300 71.35100 114.62900 1.000 55.73000  ?  341 ILE B N     1 
ATOM   7028 C  CA    . ILE B 2 341 ? 213.79100 71.97600 114.85000 1.000 55.28000  ?  341 ILE B CA    1 
ATOM   7029 C  C     . ILE B 2 341 ? 213.86400 73.38800 114.31200 1.000 56.45000  ?  341 ILE B C     1 
ATOM   7030 O  O     . ILE B 2 341 ? 214.71800 74.16200 114.72900 1.000 60.42000  ?  341 ILE B O     1 
ATOM   7031 C  CB    . ILE B 2 341 ? 213.42100 72.00300 116.34200 1.000 55.77000  ?  341 ILE B CB    1 
ATOM   7032 C  CG1   . ILE B 2 341 ? 213.32000 70.57500 116.89600 1.000 53.38000  ?  341 ILE B CG1   1 
ATOM   7033 C  CG2   . ILE B 2 341 ? 212.15300 72.82100 116.57600 1.000 53.13000  ?  341 ILE B CG2   1 
ATOM   7034 C  CD1   . ILE B 2 341 ? 212.93900 70.50700 118.37000 1.000 54.29000  ?  341 ILE B CD1   1 
ATOM   7035 N  N     . TYR B 2 342 ? 212.98800 73.72100 113.37900 1.000 51.33000  ?  342 TYR B N     1 
ATOM   7036 C  CA    . TYR B 2 342 ? 212.98600 75.04800 112.80000 1.000 54.62000  ?  342 TYR B CA    1 
ATOM   7037 C  C     . TYR B 2 342 ? 211.55700 75.42900 112.46600 1.000 56.83000  ?  342 TYR B C     1 
ATOM   7038 O  O     . TYR B 2 342 ? 210.68000 74.57400 112.41200 1.000 59.73000  ?  342 TYR B O     1 
ATOM   7039 C  CB    . TYR B 2 342 ? 213.85700 75.09300 111.54400 1.000 56.15000  ?  342 TYR B CB    1 
ATOM   7040 C  CG    . TYR B 2 342 ? 213.37000 74.15000 110.46400 1.000 55.91000  ?  342 TYR B CG    1 
ATOM   7041 C  CD1   . TYR B 2 342 ? 212.33100 74.50800 109.62900 1.000 56.51000  ?  342 TYR B CD1   1 
ATOM   7042 C  CD2   . TYR B 2 342 ? 213.93700 72.89300 110.29400 1.000 57.80000  ?  342 TYR B CD2   1 
ATOM   7043 C  CE1   . TYR B 2 342 ? 211.87300 73.66500 108.66400 1.000 56.07000  ?  342 TYR B CE1   1 
ATOM   7044 C  CE2   . TYR B 2 342 ? 213.48300 72.03300 109.31600 1.000 54.36000  ?  342 TYR B CE2   1 
ATOM   7045 C  CZ    . TYR B 2 342 ? 212.44700 72.42800 108.50400 1.000 58.53000  ?  342 TYR B CZ    1 
ATOM   7046 O  OH    . TYR B 2 342 ? 211.96400 71.59100 107.52300 1.000 60.94000  ?  342 TYR B OH    1 
ATOM   7047 N  N     . GLN B 2 343 ? 211.31300 76.71000 112.23800 1.000 56.51000  ?  343 GLN B N     1 
ATOM   7048 C  CA    . GLN B 2 343 ? 210.01800 77.13300 111.74200 1.000 56.65000  ?  343 GLN B CA    1 
ATOM   7049 C  C     . GLN B 2 343 ? 210.15300 77.63600 110.31600 1.000 56.84000  ?  343 GLN B C     1 
ATOM   7050 O  O     . GLN B 2 343 ? 209.18500 77.72000 109.57700 1.000 56.25000  ?  343 GLN B O     1 
ATOM   7051 C  CB    . GLN B 2 343 ? 209.42800 78.21300 112.62900 1.000 57.60000  ?  343 GLN B CB    1 
ATOM   7052 C  CG    . GLN B 2 343 ? 209.12100 77.75400 114.01000 1.000 61.07000  ?  343 GLN B CG    1 
ATOM   7053 C  CD    . GLN B 2 343 ? 208.47700 78.84400 114.83000 1.000 66.60000  ?  343 GLN B CD    1 
ATOM   7054 O  OE1   . GLN B 2 343 ? 209.10500 79.86000 115.14500 1.000 65.05000  ?  343 GLN B OE1   1 
ATOM   7055 N  NE2   . GLN B 2 343 ? 207.21000 78.64600 115.17500 1.000 67.20000  ?  343 GLN B NE2   1 
ATOM   7056 N  N     . GLU B 2 344 ? 211.37500 77.98700 109.95000 1.000 58.23000  ?  344 GLU B N     1 
ATOM   7057 C  CA    . GLU B 2 344 ? 211.70400 78.35100 108.58600 1.000 63.27000  ?  344 GLU B CA    1 
ATOM   7058 C  C     . GLU B 2 344 ? 213.08600 77.81200 108.26200 1.000 63.50000  ?  344 GLU B C     1 
ATOM   7059 O  O     . GLU B 2 344 ? 213.98800 77.87200 109.09700 1.000 61.37000  ?  344 GLU B O     1 
ATOM   7060 C  CB    . GLU B 2 344 ? 211.65900 79.86500 108.39200 1.000 68.12000  ?  344 GLU B CB    1 
ATOM   7061 C  CG    . GLU B 2 344 ? 210.26700 80.41800 108.15900 1.000 75.42000  ?  344 GLU B CG    1 
ATOM   7062 C  CD    . GLU B 2 344 ? 210.29600 81.77500 107.49400 1.000 93.25000  ?  344 GLU B CD    1 
ATOM   7063 O  OE1   . GLU B 2 344 ? 210.95800 82.69500 108.02900 1.000 98.90000  ?  344 GLU B OE1   1 
ATOM   7064 O  OE2   . GLU B 2 344 ? 209.67100 81.91300 106.42000 1.000 106.26000 ?  344 GLU B OE2   1 
ATOM   7065 N  N     . PRO B 2 345 ? 213.25200 77.28400 107.04600 1.000 64.51000  ?  345 PRO B N     1 
ATOM   7066 C  CA    . PRO B 2 345 ? 214.47200 76.66800 106.50900 1.000 64.17000  ?  345 PRO B CA    1 
ATOM   7067 C  C     . PRO B 2 345 ? 215.77500 77.38400 106.88600 1.000 63.84000  ?  345 PRO B C     1 
ATOM   7068 O  O     . PRO B 2 345 ? 215.92800 78.57200 106.61000 1.000 62.88000  ?  345 PRO B O     1 
ATOM   7069 C  CB    . PRO B 2 345 ? 214.24900 76.73000 104.99500 1.000 69.92000  ?  345 PRO B CB    1 
ATOM   7070 C  CG    . PRO B 2 345 ? 212.98200 77.55300 104.79600 1.000 68.86000  ?  345 PRO B CG    1 
ATOM   7071 C  CD    . PRO B 2 345 ? 212.19600 77.34000 106.03200 1.000 64.60000  ?  345 PRO B CD    1 
ATOM   7072 N  N     . PHE B 2 346 ? 216.68500 76.64100 107.51500 1.000 61.59000  ?  346 PHE B N     1 
ATOM   7073 C  CA    . PHE B 2 346 ? 218.03100 77.10100 107.86700 1.000 63.31000  ?  346 PHE B CA    1 
ATOM   7074 C  C     . PHE B 2 346 ? 218.03300 78.03100 109.06800 1.000 63.62000  ?  346 PHE B C     1 
ATOM   7075 O  O     . PHE B 2 346 ? 219.08500 78.51800 109.48900 1.000 65.86000  ?  346 PHE B O     1 
ATOM   7076 C  CB    . PHE B 2 346 ? 218.70100 77.77900 106.67400 1.000 67.39000  ?  346 PHE B CB    1 
ATOM   7077 C  CG    . PHE B 2 346 ? 218.59300 76.98700 105.40400 1.000 68.53000  ?  346 PHE B CG    1 
ATOM   7078 C  CD1   . PHE B 2 346 ? 219.17800 75.72400 105.30700 1.000 70.25000  ?  346 PHE B CD1   1 
ATOM   7079 C  CD2   . PHE B 2 346 ? 217.89800 77.49000 104.31700 1.000 62.85000  ?  346 PHE B CD2   1 
ATOM   7080 C  CE1   . PHE B 2 346 ? 219.08100 74.98100 104.14700 1.000 67.00000  ?  346 PHE B CE1   1 
ATOM   7081 C  CE2   . PHE B 2 346 ? 217.79200 76.75600 103.14500 1.000 67.15000  ?  346 PHE B CE2   1 
ATOM   7082 C  CZ    . PHE B 2 346 ? 218.38100 75.49900 103.05900 1.000 71.88000  ?  346 PHE B CZ    1 
ATOM   7083 N  N     . LYS B 2 347 ? 216.85300 78.25300 109.63100 1.000 62.34000  ?  347 LYS B N     1 
ATOM   7084 C  CA    . LYS B 2 347 ? 216.72500 78.97700 110.88400 1.000 59.92000  ?  347 LYS B CA    1 
ATOM   7085 C  C     . LYS B 2 347 ? 216.44000 78.02300 112.03800 1.000 59.33000  ?  347 LYS B C     1 
ATOM   7086 O  O     . LYS B 2 347 ? 215.36700 78.05500 112.63400 1.000 66.45000  ?  347 LYS B O     1 
ATOM   7087 C  CB    . LYS B 2 347 ? 215.62200 80.01100 110.76200 1.000 63.91000  ?  347 LYS B CB    1 
ATOM   7088 C  CG    . LYS B 2 347 ? 215.85400 80.99400 109.63500 1.000 67.61000  ?  347 LYS B CG    1 
ATOM   7089 C  CD    . LYS B 2 347 ? 216.99100 81.93700 109.97700 1.000 70.74000  ?  347 LYS B CD    1 
ATOM   7090 C  CE    . LYS B 2 347 ? 217.14500 83.03800 108.94000 1.000 72.66000  ?  347 LYS B CE    1 
ATOM   7091 N  NZ    . LYS B 2 347 ? 218.24300 83.97200 109.32600 1.000 77.15000  ?  347 LYS B NZ    1 
ATOM   7092 N  N     . ASN B 2 348 ? 217.40100 77.16200 112.34700 1.000 60.61000  ?  348 ASN B N     1 
ATOM   7093 C  CA    . ASN B 2 348 ? 217.19400 76.12900 113.35100 1.000 57.96000  ?  348 ASN B CA    1 
ATOM   7094 C  C     . ASN B 2 348 ? 217.10900 76.69600 114.75100 1.000 61.33000  ?  348 ASN B C     1 
ATOM   7095 O  O     . ASN B 2 348 ? 217.98900 77.43800 115.17300 1.000 65.77000  ?  348 ASN B O     1 
ATOM   7096 C  CB    . ASN B 2 348 ? 218.30700 75.09300 113.29100 1.000 51.67000  ?  348 ASN B CB    1 
ATOM   7097 C  CG    . ASN B 2 348 ? 218.30300 74.30400 111.99700 1.000 61.78000  ?  348 ASN B CG    1 
ATOM   7098 O  OD1   . ASN B 2 348 ? 217.24500 74.08600 111.38400 1.000 53.99000  ?  348 ASN B OD1   1 
ATOM   7099 N  ND2   . ASN B 2 348 ? 219.49600 73.86300 111.56900 1.000 59.19000  ?  348 ASN B ND2   1 
ATOM   7100 N  N     . LEU B 2 349 ? 216.04200 76.34700 115.46600 1.000 60.94000  ?  349 LEU B N     1 
ATOM   7101 C  CA    . LEU B 2 349 ? 215.88200 76.75500 116.85900 1.000 60.74000  ?  349 LEU B CA    1 
ATOM   7102 C  C     . LEU B 2 349 ? 216.69800 75.82200 117.73000 1.000 60.08000  ?  349 LEU B C     1 
ATOM   7103 O  O     . LEU B 2 349 ? 217.15000 76.18600 118.81500 1.000 64.19000  ?  349 LEU B O     1 
ATOM   7104 C  CB    . LEU B 2 349 ? 214.40900 76.73700 117.29000 1.000 61.38000  ?  349 LEU B CB    1 
ATOM   7105 C  CG    . LEU B 2 349 ? 213.43600 77.78000 116.73700 1.000 59.96000  ?  349 LEU B CG    1 
ATOM   7106 C  CD1   . LEU B 2 349 ? 213.36900 77.73400 115.21900 1.000 65.36000  ?  349 LEU B CD1   1 
ATOM   7107 C  CD2   . LEU B 2 349 ? 212.07200 77.52300 117.31300 1.000 60.98000  ?  349 LEU B CD2   1 
ATOM   7108 N  N     . LYS B 2 350 ? 216.85600 74.59700 117.25600 1.000 59.33000  ?  350 LYS B N     1 
ATOM   7109 C  CA    . LYS B 2 350 ? 217.69900 73.62100 117.92800 1.000 62.24000  ?  350 LYS B CA    1 
ATOM   7110 C  C     . LYS B 2 350 ? 218.03300 72.51300 116.96300 1.000 61.62000  ?  350 LYS B C     1 
ATOM   7111 O  O     . LYS B 2 350 ? 217.22700 72.15700 116.10400 1.000 61.23000  ?  350 LYS B O     1 
ATOM   7112 C  CB    . LYS B 2 350 ? 217.04200 73.02100 119.17100 1.000 64.04000  ?  350 LYS B CB    1 
ATOM   7113 C  CG    . LYS B 2 350 ? 217.85700 71.84600 119.71600 1.000 62.85000  ?  350 LYS B CG    1 
ATOM   7114 C  CD    . LYS B 2 350 ? 217.31900 71.30600 121.03100 1.000 72.15000  ?  350 LYS B CD    1 
ATOM   7115 C  CE    . LYS B 2 350 ? 218.30300 70.31100 121.63900 1.000 70.90000  ?  350 LYS B CE    1 
ATOM   7116 N  NZ    . LYS B 2 350 ? 217.83100 69.83700 122.96100 1.000 77.71000  ?  350 LYS B NZ    1 
ATOM   7117 N  N     . THR B 2 351 ? 219.23900 71.98900 117.10900 1.000 60.30000  ?  351 THR B N     1 
ATOM   7118 C  CA    . THR B 2 351 ? 219.69800 70.85600 116.33900 1.000 59.62000  ?  351 THR B CA    1 
ATOM   7119 C  C     . THR B 2 351 ? 220.30700 69.90200 117.33500 1.000 60.09000  ?  351 THR B C     1 
ATOM   7120 O  O     . THR B 2 351 ? 221.07700 70.31800 118.18500 1.000 64.57000  ?  351 THR B O     1 
ATOM   7121 C  CB    . THR B 2 351 ? 220.72500 71.25800 115.30600 1.000 56.09000  ?  351 THR B CB    1 
ATOM   7122 O  OG1   . THR B 2 351 ? 221.87000 71.77200 115.98700 1.000 60.68000  ?  351 THR B OG1   1 
ATOM   7123 C  CG2   . THR B 2 351 ? 220.16500 72.33200 114.39100 1.000 55.41000  ?  351 THR B CG2   1 
ATOM   7124 N  N     . GLY B 2 352 ? 219.95500 68.63100 117.25700 1.000 57.37000  ?  352 GLY B N     1 
ATOM   7125 C  CA    . GLY B 2 352 ? 220.36600 67.72000 118.29800 1.000 58.13000  ?  352 GLY B CA    1 
ATOM   7126 C  C     . GLY B 2 352 ? 220.67100 66.34200 117.78400 1.000 58.77000  ?  352 GLY B C     1 
ATOM   7127 O  O     . GLY B 2 352 ? 220.60400 66.08000 116.59300 1.000 59.69000  ?  352 GLY B O     1 
ATOM   7128 N  N     . LYS B 2 353 ? 221.00100 65.45500 118.70500 1.000 63.16000  ?  353 LYS B N     1 
ATOM   7129 C  CA    . LYS B 2 353 ? 221.34000 64.09700 118.36100 1.000 64.14000  ?  353 LYS B CA    1 
ATOM   7130 C  C     . LYS B 2 353 ? 220.56400 63.16100 119.27100 1.000 69.51000  ?  353 LYS B C     1 
ATOM   7131 O  O     . LYS B 2 353 ? 220.02700 63.58400 120.29100 1.000 73.85000  ?  353 LYS B O     1 
ATOM   7132 C  CB    . LYS B 2 353 ? 222.84300 63.87900 118.50000 1.000 63.43000  ?  353 LYS B CB    1 
ATOM   7133 C  CG    . LYS B 2 353 ? 223.38700 62.77300 117.64900 1.000 64.70000  ?  353 LYS B CG    1 
ATOM   7134 C  CD    . LYS B 2 353 ? 224.84800 62.52700 117.96800 1.000 81.43000  ?  353 LYS B CD    1 
ATOM   7135 C  CE    . LYS B 2 353 ? 225.05000 62.28500 119.45900 1.000 80.91000  ?  353 LYS B CE    1 
ATOM   7136 N  NZ    . LYS B 2 353 ? 226.44200 61.83500 119.76000 1.000 89.07000  ?  353 LYS B NZ    1 
ATOM   7137 N  N     . TYR B 2 354 ? 220.49100 61.89200 118.90200 1.000 68.28000  ?  354 TYR B N     1 
ATOM   7138 C  CA    . TYR B 2 354 ? 219.88200 60.89800 119.76400 1.000 68.27000  ?  354 TYR B CA    1 
ATOM   7139 C  C     . TYR B 2 354 ? 220.61600 59.58200 119.52900 1.000 67.81000  ?  354 TYR B C     1 
ATOM   7140 O  O     . TYR B 2 354 ? 220.53400 59.00300 118.45400 1.000 68.77000  ?  354 TYR B O     1 
ATOM   7141 C  CB    . TYR B 2 354 ? 218.37800 60.79400 119.48700 1.000 69.01000  ?  354 TYR B CB    1 
ATOM   7142 C  CG    . TYR B 2 354 ? 217.62200 59.76600 120.31000 1.000 75.54000  ?  354 TYR B CG    1 
ATOM   7143 C  CD1   . TYR B 2 354 ? 217.48100 59.90900 121.69200 1.000 80.15000  ?  354 TYR B CD1   1 
ATOM   7144 C  CD2   . TYR B 2 354 ? 217.02100 58.66000 119.70100 1.000 68.19000  ?  354 TYR B CD2   1 
ATOM   7145 C  CE1   . TYR B 2 354 ? 216.77000 58.96600 122.45300 1.000 78.43000  ?  354 TYR B CE1   1 
ATOM   7146 C  CE2   . TYR B 2 354 ? 216.31500 57.71300 120.45200 1.000 71.28000  ?  354 TYR B CE2   1 
ATOM   7147 C  CZ    . TYR B 2 354 ? 216.19100 57.87400 121.82400 1.000 75.95000  ?  354 TYR B CZ    1 
ATOM   7148 O  OH    . TYR B 2 354 ? 215.49400 56.94400 122.56200 1.000 77.19000  ?  354 TYR B OH    1 
ATOM   7149 N  N     . ALA B 2 355 ? 221.37300 59.15000 120.53300 1.000 73.74000  ?  355 ALA B N     1 
ATOM   7150 C  CA    . ALA B 2 355 ? 222.14700 57.92000 120.45900 1.000 75.71000  ?  355 ALA B CA    1 
ATOM   7151 C  C     . ALA B 2 355 ? 221.34800 56.77900 121.04600 1.000 77.28000  ?  355 ALA B C     1 
ATOM   7152 O  O     . ALA B 2 355 ? 220.51100 56.98800 121.92200 1.000 76.82000  ?  355 ALA B O     1 
ATOM   7153 C  CB    . ALA B 2 355 ? 223.47000 58.07100 121.19200 1.000 71.54000  ?  355 ALA B CB    1 
ATOM   7154 N  N     . ARG B 2 356 ? 221.60700 55.57400 120.55400 1.000 79.78000  ?  356 ARG B N     1 
ATOM   7155 C  CA    . ARG B 2 356 ? 220.98200 54.37100 121.09600 1.000 86.90000  ?  356 ARG B CA    1 
ATOM   7156 C  C     . ARG B 2 356 ? 221.93300 53.17900 120.94800 1.000 93.54000  ?  356 ARG B C     1 
ATOM   7157 O  O     . ARG B 2 356 ? 223.07600 53.33000 120.48300 1.000 90.38000  ?  356 ARG B O     1 
ATOM   7158 C  CB    . ARG B 2 356 ? 219.64600 54.08100 120.40300 1.000 83.35000  ?  356 ARG B CB    1 
ATOM   7159 C  CG    . ARG B 2 356 ? 218.58800 55.17200 120.56000 1.000 81.14000  ?  356 ARG B CG    1 
ATOM   7160 C  CD    . ARG B 2 356 ? 217.51100 54.80500 121.59100 1.000 86.07000  ?  356 ARG B CD    1 
ATOM   7161 N  NE    . ARG B 2 356 ? 218.02300 54.80200 122.96200 1.000 93.07000  ?  356 ARG B NE    1 
ATOM   7162 C  CZ    . ARG B 2 356 ? 217.39700 54.24200 123.99200 1.000 95.08000  ?  356 ARG B CZ    1 
ATOM   7163 N  NH1   . ARG B 2 356 ? 216.23400 53.62800 123.81200 1.000 93.95000  ?  356 ARG B NH1   1 
ATOM   7164 N  NH2   . ARG B 2 356 ? 217.93600 54.28700 125.20200 1.000 100.06000 ?  356 ARG B NH2   1 
ATOM   7165 N  N     . MET B 2 357 ? 221.45100 52.00000 121.33700 1.000 96.36000  ?  357 MET B N     1 
ATOM   7166 C  CA    . MET B 2 357 ? 222.29100 50.80800 121.39500 1.000 100.91000 ?  357 MET B CA    1 
ATOM   7167 C  C     . MET B 2 357 ? 222.76400 50.36300 120.01800 1.000 99.55000  ?  357 MET B C     1 
ATOM   7168 O  O     . MET B 2 357 ? 221.95600 50.15300 119.10300 1.000 96.85000  ?  357 MET B O     1 
ATOM   7169 C  CB    . MET B 2 357 ? 221.54600 49.65900 122.08100 1.000 102.37000 ?  357 MET B CB    1 
ATOM   7170 C  CG    . MET B 2 357 ? 220.31200 49.18500 121.34100 1.000 100.88000 ?  357 MET B CG    1 
ATOM   7171 S  SD    . MET B 2 357 ? 219.88200 47.49300 121.79600 1.000 121.21000 ?  357 MET B SD    1 
ATOM   7172 C  CE    . MET B 2 357 ? 221.19700 46.56100 121.01100 1.000 102.73000 ?  357 MET B CE    1 
ATOM   7173 N  N     . ARG B 2 358 ? 224.08000 50.22900 119.87500 1.000 100.43000 ?  358 ARG B N     1 
ATOM   7174 C  CA    . ARG B 2 358 ? 224.66500 49.70900 118.64300 1.000 102.16000 ?  358 ARG B CA    1 
ATOM   7175 C  C     . ARG B 2 358 ? 224.68900 48.17800 118.70700 1.000 103.51000 ?  358 ARG B C     1 
ATOM   7176 O  O     . ARG B 2 358 ? 225.75500 47.56800 118.74500 1.000 108.51000 ?  358 ARG B O     1 
ATOM   7177 C  CB    . ARG B 2 358 ? 226.08300 50.26300 118.42100 1.000 99.72000  ?  358 ARG B CB    1 
ATOM   7178 C  CG    . ARG B 2 358 ? 226.35900 51.61000 119.08600 1.000 105.07000 ?  358 ARG B CG    1 
ATOM   7179 C  CD    . ARG B 2 358 ? 227.86200 51.81000 119.36800 1.000 114.09000 ?  358 ARG B CD    1 
ATOM   7180 N  NE    . ARG B 2 358 ? 228.13300 52.98900 120.20000 1.000 118.70000 ?  358 ARG B NE    1 
ATOM   7181 C  CZ    . ARG B 2 358 ? 228.54400 52.95100 121.46900 1.000 116.62000 ?  358 ARG B CZ    1 
ATOM   7182 N  NH1   . ARG B 2 358 ? 228.75200 51.79100 122.07600 1.000 111.74000 ?  358 ARG B NH1   1 
ATOM   7183 N  NH2   . ARG B 2 358 ? 228.75700 54.07900 122.13700 1.000 115.55000 ?  358 ARG B NH2   1 
ATOM   7184 N  N     . GLY B 2 359 ? 223.51600 47.55500 118.71900 1.000 103.02000 ?  359 GLY B N     1 
ATOM   7185 C  CA    . GLY B 2 359 ? 223.44800 46.12100 118.92700 1.000 105.86000 ?  359 GLY B CA    1 
ATOM   7186 C  C     . GLY B 2 359 ? 222.91700 45.26300 117.79100 1.000 105.13000 ?  359 GLY B C     1 
ATOM   7187 O  O     . GLY B 2 359 ? 222.85500 45.68200 116.62800 1.000 101.91000 ?  359 GLY B O     1 
ATOM   7188 N  N     . ALA B 2 360 ? 222.54900 44.03600 118.15100 1.000 102.57000 ?  360 ALA B N     1 
ATOM   7189 C  CA    . ALA B 2 360 ? 221.94000 43.09000 117.22500 1.000 106.42000 ?  360 ALA B CA    1 
ATOM   7190 C  C     . ALA B 2 360 ? 220.43400 43.33800 117.10100 1.000 107.87000 ?  360 ALA B C     1 
ATOM   7191 O  O     . ALA B 2 360 ? 219.91500 43.55400 116.00200 1.000 105.01000 ?  360 ALA B O     1 
ATOM   7192 C  CB    . ALA B 2 360 ? 222.20400 41.66000 117.67900 1.000 105.15000 ?  360 ALA B CB    1 
ATOM   7193 N  N     . HIS B 2 361 ? 219.73700 43.32400 118.23500 1.000 108.22000 ?  361 HIS B N     1 
ATOM   7194 C  CA    . HIS B 2 361 ? 218.28200 43.46200 118.24100 1.000 104.33000 ?  361 HIS B CA    1 
ATOM   7195 C  C     . HIS B 2 361 ? 217.82600 44.89500 118.00300 1.000 97.76000  ?  361 HIS B C     1 
ATOM   7196 O  O     . HIS B 2 361 ? 216.84100 45.35500 118.59000 1.000 102.12000 ?  361 HIS B O     1 
ATOM   7197 C  CB    . HIS B 2 361 ? 217.71300 42.94600 119.56000 1.000 105.98000 ?  361 HIS B CB    1 
ATOM   7198 C  CG    . HIS B 2 361 ? 217.94600 41.48600 119.76900 1.000 110.72000 ?  361 HIS B CG    1 
ATOM   7199 N  ND1   . HIS B 2 361 ? 218.89300 40.78000 119.05600 1.000 110.92000 ?  361 HIS B ND1   1 
ATOM   7200 C  CD2   . HIS B 2 361 ? 217.35300 40.59600 120.59800 1.000 115.09000 ?  361 HIS B CD2   1 
ATOM   7201 C  CE1   . HIS B 2 361 ? 218.87700 39.51700 119.44200 1.000 115.38000 ?  361 HIS B CE1   1 
ATOM   7202 N  NE2   . HIS B 2 361 ? 217.95200 39.37900 120.37600 1.000 119.91000 ?  361 HIS B NE2   1 
ATOM   7203 N  N     . THR B 2 362 ? 218.54400 45.59600 117.13600 1.000 90.16000  ?  362 THR B N     1 
ATOM   7204 C  CA    . THR B 2 362 ? 218.19200 46.96300 116.82200 1.000 84.22000  ?  362 THR B CA    1 
ATOM   7205 C  C     . THR B 2 362 ? 216.85500 46.95100 116.09800 1.000 75.29000  ?  362 THR B C     1 
ATOM   7206 O  O     . THR B 2 362 ? 216.60500 46.10700 115.23900 1.000 77.14000  ?  362 THR B O     1 
ATOM   7207 C  CB    . THR B 2 362 ? 219.28000 47.65500 115.97000 1.000 83.68000  ?  362 THR B CB    1 
ATOM   7208 O  OG1   . THR B 2 362 ? 220.31400 48.15200 116.82800 1.000 83.99000  ?  362 THR B OG1   1 
ATOM   7209 C  CG2   . THR B 2 362 ? 218.69200 48.82000 115.18800 1.000 78.64000  ?  362 THR B CG2   1 
ATOM   7210 N  N     . ASN B 2 363 ? 215.98200 47.86500 116.48100 1.000 66.24000  ?  363 ASN B N     1 
ATOM   7211 C  CA    . ASN B 2 363 ? 214.72500 48.04400 115.78400 1.000 66.27000  ?  363 ASN B CA    1 
ATOM   7212 C  C     . ASN B 2 363 ? 214.58400 49.51100 115.37600 1.000 62.65000  ?  363 ASN B C     1 
ATOM   7213 O  O     . ASN B 2 363 ? 214.27800 50.35800 116.21500 1.000 62.55000  ?  363 ASN B O     1 
ATOM   7214 C  CB    . ASN B 2 363 ? 213.56300 47.59500 116.67100 1.000 61.18000  ?  363 ASN B CB    1 
ATOM   7215 C  CG    . ASN B 2 363 ? 212.20500 47.82200 116.03200 1.000 58.70000  ?  363 ASN B CG    1 
ATOM   7216 O  OD1   . ASN B 2 363 ? 212.08500 48.50700 115.03100 1.000 59.52000  ?  363 ASN B OD1   1 
ATOM   7217 N  ND2   . ASN B 2 363 ? 211.16900 47.25600 116.63300 1.000 61.01000  ?  363 ASN B ND2   1 
ATOM   7218 N  N     . ASP B 2 364 ? 214.81000 49.80600 114.09600 1.000 56.45000  ?  364 ASP B N     1 
ATOM   7219 C  CA    . ASP B 2 364 ? 214.72600 51.17900 113.60600 1.000 59.13000  ?  364 ASP B CA    1 
ATOM   7220 C  C     . ASP B 2 364 ? 213.42200 51.88600 113.97000 1.000 59.47000  ?  364 ASP B C     1 
ATOM   7221 O  O     . ASP B 2 364 ? 213.43200 52.99100 114.51200 1.000 58.42000  ?  364 ASP B O     1 
ATOM   7222 C  CB    . ASP B 2 364 ? 214.89700 51.21600 112.09900 1.000 58.48000  ?  364 ASP B CB    1 
ATOM   7223 C  CG    . ASP B 2 364 ? 216.34600 51.29600 111.68600 1.000 63.98000  ?  364 ASP B CG    1 
ATOM   7224 O  OD1   . ASP B 2 364 ? 217.19700 51.52600 112.58000 1.000 67.70000  ?  364 ASP B OD1   1 
ATOM   7225 O  OD2   . ASP B 2 364 ? 216.62800 51.15000 110.47200 1.000 57.82000  ?  364 ASP B OD2   1 
ATOM   7226 N  N     . VAL B 2 365 ? 212.29700 51.25800 113.66500 1.000 59.53000  ?  365 VAL B N     1 
ATOM   7227 C  CA    . VAL B 2 365 ? 211.00700 51.88300 113.93600 1.000 57.98000  ?  365 VAL B CA    1 
ATOM   7228 C  C     . VAL B 2 365 ? 210.84500 52.21900 115.41100 1.000 57.00000  ?  365 VAL B C     1 
ATOM   7229 O  O     . VAL B 2 365 ? 210.39600 53.30400 115.75000 1.000 52.35000  ?  365 VAL B O     1 
ATOM   7230 C  CB    . VAL B 2 365 ? 209.86700 50.99000 113.49500 1.000 55.90000  ?  365 VAL B CB    1 
ATOM   7231 C  CG1   . VAL B 2 365 ? 208.55100 51.61500 113.87500 1.000 52.76000  ?  365 VAL B CG1   1 
ATOM   7232 C  CG2   . VAL B 2 365 ? 209.96900 50.76200 112.00000 1.000 54.07000  ?  365 VAL B CG2   1 
ATOM   7233 N  N     . LYS B 2 366 ? 211.23700 51.29600 116.28300 1.000 55.11000  ?  366 LYS B N     1 
ATOM   7234 C  CA    . LYS B 2 366 ? 211.18000 51.56700 117.70100 1.000 53.52000  ?  366 LYS B CA    1 
ATOM   7235 C  C     . LYS B 2 366 ? 212.06400 52.75700 118.03100 1.000 54.64000  ?  366 LYS B C     1 
ATOM   7236 O  O     . LYS B 2 366 ? 211.64400 53.68700 118.71800 1.000 54.96000  ?  366 LYS B O     1 
ATOM   7237 C  CB    . LYS B 2 366 ? 211.59700 50.33400 118.50700 1.000 59.31000  ?  366 LYS B CB    1 
ATOM   7238 C  CG    . LYS B 2 366 ? 211.66700 50.56900 120.01900 1.000 53.89000  ?  366 LYS B CG    1 
ATOM   7239 C  CD    . LYS B 2 366 ? 211.53500 49.25900 120.76600 1.000 56.82000  ?  366 LYS B CD    1 
ATOM   7240 C  CE    . LYS B 2 366 ? 212.22900 49.28900 122.11900 1.000 58.17000  ?  366 LYS B CE    1 
ATOM   7241 N  NZ    . LYS B 2 366 ? 213.67800 49.55600 121.94500 1.000 67.73000  ?  366 LYS B NZ    1 
ATOM   7242 N  N     . GLN B 2 367 ? 213.28800 52.74100 117.52400 1.000 56.58000  ?  367 GLN B N     1 
ATOM   7243 C  CA    . GLN B 2 367 ? 214.22100 53.81100 117.84300 1.000 58.08000  ?  367 GLN B CA    1 
ATOM   7244 C  C     . GLN B 2 367 ? 213.66700 55.13100 117.34900 1.000 54.12000  ?  367 GLN B C     1 
ATOM   7245 O  O     . GLN B 2 367 ? 213.73100 56.13900 118.05800 1.000 53.60000  ?  367 GLN B O     1 
ATOM   7246 C  CB    . GLN B 2 367 ? 215.60200 53.55000 117.24300 1.000 58.02000  ?  367 GLN B CB    1 
ATOM   7247 C  CG    . GLN B 2 367 ? 216.42700 52.55300 118.02400 1.000 59.48000  ?  367 GLN B CG    1 
ATOM   7248 C  CD    . GLN B 2 367 ? 217.82100 52.36500 117.44400 1.000 67.05000  ?  367 GLN B CD    1 
ATOM   7249 O  OE1   . GLN B 2 367 ? 218.18900 52.98600 116.43600 1.000 61.53000  ?  367 GLN B OE1   1 
ATOM   7250 N  NE2   . GLN B 2 367 ? 218.60400 51.50300 118.08000 1.000 71.91000  ?  367 GLN B NE2   1 
ATOM   7251 N  N     . LEU B 2 368 ? 213.10800 55.11400 116.14400 1.000 49.67000  ?  368 LEU B N     1 
ATOM   7252 C  CA    . LEU B 2 368 ? 212.55500 56.31500 115.54000 1.000 49.49000  ?  368 LEU B CA    1 
ATOM   7253 C  C     . LEU B 2 368 ? 211.38500 56.87400 116.34200 1.000 48.38000  ?  368 LEU B C     1 
ATOM   7254 O  O     . LEU B 2 368 ? 211.23800 58.08900 116.45400 1.000 43.68000  ?  368 LEU B O     1 
ATOM   7255 C  CB    . LEU B 2 368 ? 212.11000 56.04100 114.10600 1.000 55.19000  ?  368 LEU B CB    1 
ATOM   7256 C  CG    . LEU B 2 368 ? 211.57700 57.28200 113.40100 1.000 49.65000  ?  368 LEU B CG    1 
ATOM   7257 C  CD1   . LEU B 2 368 ? 212.62100 58.37200 113.50100 1.000 47.19000  ?  368 LEU B CD1   1 
ATOM   7258 C  CD2   . LEU B 2 368 ? 211.25900 56.97500 111.96200 1.000 45.80000  ?  368 LEU B CD2   1 
ATOM   7259 N  N     . THR B 2 369 ? 210.55800 55.99900 116.92000 1.000 52.71000  ?  369 THR B N     1 
ATOM   7260 C  CA    . THR B 2 369 ? 209.41300 56.50800 117.66900 1.000 53.69000  ?  369 THR B CA    1 
ATOM   7261 C  C     . THR B 2 369 ? 209.86700 56.96500 119.05700 1.000 53.90000  ?  369 THR B C     1 
ATOM   7262 O  O     . THR B 2 369 ? 209.29800 57.90900 119.60500 1.000 56.02000  ?  369 THR B O     1 
ATOM   7263 C  CB    . THR B 2 369 ? 208.24000 55.49100 117.76900 1.000 53.08000  ?  369 THR B CB    1 
ATOM   7264 O  OG1   . THR B 2 369 ? 208.38600 54.64600 118.91000 1.000 58.66000  ?  369 THR B OG1   1 
ATOM   7265 C  CG2   . THR B 2 369 ? 208.13400 54.66100 116.52500 1.000 49.57000  ?  369 THR B CG2   1 
ATOM   7266 N  N     . GLU B 2 370 ? 210.91600 56.34600 119.60200 1.000 54.34000  ?  370 GLU B N     1 
ATOM   7267 C  CA    . GLU B 2 370 ? 211.56000 56.87600 120.81600 1.000 55.67000  ?  370 GLU B CA    1 
ATOM   7268 C  C     . GLU B 2 370 ? 212.18300 58.25400 120.56200 1.000 56.77000  ?  370 GLU B C     1 
ATOM   7269 O  O     . GLU B 2 370 ? 212.10900 59.14300 121.40500 1.000 58.81000  ?  370 GLU B O     1 
ATOM   7270 C  CB    . GLU B 2 370 ? 212.63000 55.91800 121.33500 1.000 58.22000  ?  370 GLU B CB    1 
ATOM   7271 C  CG    . GLU B 2 370 ? 212.09000 54.76400 122.16900 1.000 62.40000  ?  370 GLU B CG    1 
ATOM   7272 C  CD    . GLU B 2 370 ? 213.09000 53.61500 122.30100 1.000 74.55000  ?  370 GLU B CD    1 
ATOM   7273 O  OE1   . GLU B 2 370 ? 214.23800 53.76000 121.80700 1.000 74.02000  ?  370 GLU B OE1   1 
ATOM   7274 O  OE2   . GLU B 2 370 ? 212.72700 52.56700 122.89400 1.000 72.64000  ?  370 GLU B OE2   1 
ATOM   7275 N  N     . ALA B 2 371 ? 212.79200 58.43000 119.39300 1.000 58.05000  ?  371 ALA B N     1 
ATOM   7276 C  CA    . ALA B 2 371 ? 213.31800 59.73400 119.00100 1.000 50.96000  ?  371 ALA B CA    1 
ATOM   7277 C  C     . ALA B 2 371 ? 212.22200 60.78700 118.88800 1.000 53.12000  ?  371 ALA B C     1 
ATOM   7278 O  O     . ALA B 2 371 ? 212.39800 61.89200 119.40600 1.000 52.89000  ?  371 ALA B O     1 
ATOM   7279 C  CB    . ALA B 2 371 ? 214.07700 59.63000 117.68600 1.000 49.46000  ?  371 ALA B CB    1 
ATOM   7280 N  N     . VAL B 2 372 ? 211.10100 60.48100 118.21600 1.000 46.26000  ?  372 VAL B N     1 
ATOM   7281 C  CA    . VAL B 2 372 ? 210.07500 61.51700 118.06800 1.000 51.33000  ?  372 VAL B CA    1 
ATOM   7282 C  C     . VAL B 2 372 ? 209.50600 61.86400 119.43700 1.000 53.57000  ?  372 VAL B C     1 
ATOM   7283 O  O     . VAL B 2 372 ? 209.06100 62.99200 119.66300 1.000 57.46000  ?  372 VAL B O     1 
ATOM   7284 C  CB    . VAL B 2 372 ? 208.87300 61.14200 117.10400 1.000 51.79000  ?  372 VAL B CB    1 
ATOM   7285 C  CG1   . VAL B 2 372 ? 209.35500 60.64200 115.73700 1.000 45.54000  ?  372 VAL B CG1   1 
ATOM   7286 C  CG2   . VAL B 2 372 ? 207.95000 60.16200 117.75400 1.000 54.48000  ?  372 VAL B CG2   1 
ATOM   7287 N  N     . GLN B 2 373 ? 209.52500 60.91200 120.35900 1.000 51.74000  ?  373 GLN B N     1 
ATOM   7288 C  CA    . GLN B 2 373 ? 209.00300 61.19700 121.68900 1.000 51.47000  ?  373 GLN B CA    1 
ATOM   7289 C  C     . GLN B 2 373 ? 209.95000 62.05600 122.50000 1.000 54.29000  ?  373 GLN B C     1 
ATOM   7290 O  O     . GLN B 2 373 ? 209.50400 62.91800 123.25400 1.000 57.86000  ?  373 GLN B O     1 
ATOM   7291 C  CB    . GLN B 2 373 ? 208.69300 59.90900 122.42800 1.000 53.11000  ?  373 GLN B CB    1 
ATOM   7292 C  CG    . GLN B 2 373 ? 207.45400 59.20400 121.88100 1.000 55.98000  ?  373 GLN B CG    1 
ATOM   7293 C  CD    . GLN B 2 373 ? 207.17000 57.90200 122.59000 1.000 53.57000  ?  373 GLN B CD    1 
ATOM   7294 O  OE1   . GLN B 2 373 ? 206.45300 57.87300 123.59600 1.000 57.60000  ?  373 GLN B OE1   1 
ATOM   7295 N  NE2   . GLN B 2 373 ? 207.73800 56.81300 122.08000 1.000 50.71000  ?  373 GLN B NE2   1 
ATOM   7296 N  N     . LYS B 2 374 ? 211.25400 61.83600 122.35200 1.000 55.62000  ?  374 LYS B N     1 
ATOM   7297 C  CA    . LYS B 2 374 ? 212.21800 62.67700 123.04500 1.000 52.02000  ?  374 LYS B CA    1 
ATOM   7298 C  C     . LYS B 2 374 ? 212.09200 64.09700 122.52700 1.000 54.63000  ?  374 LYS B C     1 
ATOM   7299 O  O     . LYS B 2 374 ? 212.05100 65.03500 123.31500 1.000 58.32000  ?  374 LYS B O     1 
ATOM   7300 C  CB    . LYS B 2 374 ? 213.64800 62.16100 122.86600 1.000 55.48000  ?  374 LYS B CB    1 
ATOM   7301 C  CG    . LYS B 2 374 ? 214.17300 61.27000 124.00400 1.000 71.66000  ?  374 LYS B CG    1 
ATOM   7302 C  CD    . LYS B 2 374 ? 213.36000 59.95100 124.16700 1.000 81.01000  ?  374 LYS B CD    1 
ATOM   7303 C  CE    . LYS B 2 374 ? 214.02100 58.96100 125.17000 1.000 85.31000  ?  374 LYS B CE    1 
ATOM   7304 N  NZ    . LYS B 2 374 ? 213.35200 57.60900 125.24200 1.000 73.28000  ?  374 LYS B NZ    1 
ATOM   7305 N  N     . ILE B 2 375 ? 211.99800 64.24800 121.20600 1.000 48.14000  ?  375 ILE B N     1 
ATOM   7306 C  CA    . ILE B 2 375 ? 211.97100 65.56400 120.58400 1.000 49.86000  ?  375 ILE B CA    1 
ATOM   7307 C  C     . ILE B 2 375 ? 210.69900 66.34000 120.91600 1.000 51.96000  ?  375 ILE B C     1 
ATOM   7308 O  O     . ILE B 2 375 ? 210.73900 67.53800 121.20300 1.000 55.15000  ?  375 ILE B O     1 
ATOM   7309 C  CB    . ILE B 2 375 ? 212.11100 65.45500 119.05500 1.000 51.64000  ?  375 ILE B CB    1 
ATOM   7310 C  CG1   . ILE B 2 375 ? 213.50400 64.94400 118.68300 1.000 51.73000  ?  375 ILE B CG1   1 
ATOM   7311 C  CG2   . ILE B 2 375 ? 211.88800 66.80100 118.39900 1.000 48.45000  ?  375 ILE B CG2   1 
ATOM   7312 C  CD1   . ILE B 2 375 ? 213.58500 64.41300 117.29300 1.000 47.56000  ?  375 ILE B CD1   1 
ATOM   7313 N  N     . THR B 2 376 ? 209.56700 65.65700 120.86600 1.000 51.43000  ?  376 THR B N     1 
ATOM   7314 C  CA    . THR B 2 376 ? 208.30900 66.27100 121.23700 1.000 55.95000  ?  376 THR B CA    1 
ATOM   7315 C  C     . THR B 2 376 ? 208.43600 66.75100 122.66500 1.000 55.11000  ?  376 THR B C     1 
ATOM   7316 O  O     . THR B 2 376 ? 208.04400 67.86800 122.99800 1.000 57.10000  ?  376 THR B O     1 
ATOM   7317 C  CB    . THR B 2 376 ? 207.12100 65.29100 121.10600 1.000 56.36000  ?  376 THR B CB    1 
ATOM   7318 O  OG1   . THR B 2 376 ? 207.13500 64.70900 119.79700 1.000 52.11000  ?  376 THR B OG1   1 
ATOM   7319 C  CG2   . THR B 2 376 ? 205.78300 66.00900 121.34700 1.000 48.67000  ?  376 THR B CG2   1 
ATOM   7320 N  N     . THR B 2 377 ? 209.02000 65.90800 123.50300 1.000 52.07000  ?  377 THR B N     1 
ATOM   7321 C  CA    . THR B 2 377 ? 209.19800 66.26200 124.89800 1.000 54.82000  ?  377 THR B CA    1 
ATOM   7322 C  C     . THR B 2 377 ? 210.02500 67.53000 125.05300 1.000 57.94000  ?  377 THR B C     1 
ATOM   7323 O  O     . THR B 2 377 ? 209.64200 68.44000 125.78800 1.000 60.08000  ?  377 THR B O     1 
ATOM   7324 C  CB    . THR B 2 377 ? 209.86500 65.14300 125.67500 1.000 52.53000  ?  377 THR B CB    1 
ATOM   7325 O  OG1   . THR B 2 377 ? 208.96300 64.03900 125.77400 1.000 49.78000  ?  377 THR B OG1   1 
ATOM   7326 C  CG2   . THR B 2 377 ? 210.22400 65.62300 127.06900 1.000 54.49000  ?  377 THR B CG2   1 
ATOM   7327 N  N     . GLU B 2 378 ? 211.15800 67.59700 124.36700 1.000 58.07000  ?  378 GLU B N     1 
ATOM   7328 C  CA    . GLU B 2 378 ? 211.99800 68.77700 124.47600 1.000 56.67000  ?  378 GLU B CA    1 
ATOM   7329 C  C     . GLU B 2 378 ? 211.19900 69.96800 124.04100 1.000 56.80000  ?  378 GLU B C     1 
ATOM   7330 O  O     . GLU B 2 378 ? 211.25200 71.00000 124.70200 1.000 59.22000  ?  378 GLU B O     1 
ATOM   7331 C  CB    . GLU B 2 378 ? 213.26800 68.64800 123.64400 1.000 55.84000  ?  378 GLU B CB    1 
ATOM   7332 C  CG    . GLU B 2 378 ? 214.20200 67.56300 124.14000 1.000 62.04000  ?  378 GLU B CG    1 
ATOM   7333 C  CD    . GLU B 2 378 ? 215.48200 67.47500 123.32500 1.000 73.09000  ?  378 GLU B CD    1 
ATOM   7334 O  OE1   . GLU B 2 378 ? 215.75500 68.41500 122.53700 1.000 75.59000  ?  378 GLU B OE1   1 
ATOM   7335 O  OE2   . GLU B 2 378 ? 216.21500 66.46800 123.47200 1.000 74.05000  ?  378 GLU B OE2   1 
ATOM   7336 N  N     . SER B 2 379 ? 210.43000 69.81100 122.95600 1.000 51.12000  ?  379 SER B N     1 
ATOM   7337 C  CA    . SER B 2 379 ? 209.67100 70.92500 122.38700 1.000 51.87000  ?  379 SER B CA    1 
ATOM   7338 C  C     . SER B 2 379 ? 208.62100 71.47400 123.33300 1.000 57.15000  ?  379 SER B C     1 
ATOM   7339 O  O     . SER B 2 379 ? 208.47100 72.68500 123.45100 1.000 58.38000  ?  379 SER B O     1 
ATOM   7340 C  CB    . SER B 2 379 ? 208.98100 70.51300 121.09500 1.000 56.62000  ?  379 SER B CB    1 
ATOM   7341 O  OG    . SER B 2 379 ? 209.93700 70.16100 120.12000 1.000 68.10000  ?  379 SER B OG    1 
ATOM   7342 N  N     . ILE B 2 380 ? 207.86000 70.57800 123.96300 1.000 55.90000  ?  380 ILE B N     1 
ATOM   7343 C  CA    . ILE B 2 380 ? 206.85400 70.97300 124.93500 1.000 55.57000  ?  380 ILE B CA    1 
ATOM   7344 C  C     . ILE B 2 380 ? 207.54900 71.76900 126.04200 1.000 60.63000  ?  380 ILE B C     1 
ATOM   7345 O  O     . ILE B 2 380 ? 207.12200 72.87800 126.38200 1.000 57.68000  ?  380 ILE B O     1 
ATOM   7346 C  CB    . ILE B 2 380 ? 206.10400 69.74400 125.51800 1.000 59.19000  ?  380 ILE B CB    1 
ATOM   7347 C  CG1   . ILE B 2 380 ? 205.04800 69.22300 124.53200 1.000 55.14000  ?  380 ILE B CG1   1 
ATOM   7348 C  CG2   . ILE B 2 380 ? 205.43100 70.09000 126.83100 1.000 58.13000  ?  380 ILE B CG2   1 
ATOM   7349 C  CD1   . ILE B 2 380 ? 204.93000 67.71500 124.50800 1.000 50.15000  ?  380 ILE B CD1   1 
ATOM   7350 N  N     . VAL B 2 381 ? 208.65300 71.21400 126.55100 1.000 54.70000  ?  381 VAL B N     1 
ATOM   7351 C  CA    . VAL B 2 381 ? 209.39800 71.81200 127.65000 1.000 56.59000  ?  381 VAL B CA    1 
ATOM   7352 C  C     . VAL B 2 381 ? 210.03200 73.14800 127.29000 1.000 59.77000  ?  381 VAL B C     1 
ATOM   7353 O  O     . VAL B 2 381 ? 210.09800 74.04000 128.12700 1.000 64.52000  ?  381 VAL B O     1 
ATOM   7354 C  CB    . VAL B 2 381 ? 210.52100 70.87900 128.16500 1.000 58.53000  ?  381 VAL B CB    1 
ATOM   7355 C  CG1   . VAL B 2 381 ? 211.41700 71.63900 129.11500 1.000 61.27000  ?  381 VAL B CG1   1 
ATOM   7356 C  CG2   . VAL B 2 381 ? 209.94500 69.64000 128.85700 1.000 52.49000  ?  381 VAL B CG2   1 
ATOM   7357 N  N     . ILE B 2 382 ? 210.50200 73.29300 126.05500 1.000 58.91000  ?  382 ILE B N     1 
ATOM   7358 C  CA    . ILE B 2 382 ? 211.17300 74.52500 125.65200 1.000 57.87000  ?  382 ILE B CA    1 
ATOM   7359 C  C     . ILE B 2 382 ? 210.19700 75.59900 125.16900 1.000 56.09000  ?  382 ILE B C     1 
ATOM   7360 O  O     . ILE B 2 382 ? 210.29200 76.73600 125.60600 1.000 62.15000  ?  382 ILE B O     1 
ATOM   7361 C  CB    . ILE B 2 382 ? 212.23000 74.25300 124.55900 1.000 57.47000  ?  382 ILE B CB    1 
ATOM   7362 C  CG1   . ILE B 2 382 ? 213.28800 73.29200 125.09100 1.000 59.57000  ?  382 ILE B CG1   1 
ATOM   7363 C  CG2   . ILE B 2 382 ? 212.88200 75.54600 124.08200 1.000 56.65000  ?  382 ILE B CG2   1 
ATOM   7364 C  CD1   . ILE B 2 382 ? 214.32300 72.93500 124.09700 1.000 58.92000  ?  382 ILE B CD1   1 
ATOM   7365 N  N     . TRP B 2 383 ? 209.26800 75.24500 124.28400 1.000 58.40000  ?  383 TRP B N     1 
ATOM   7366 C  CA    . TRP B 2 383 ? 208.35300 76.22300 123.67300 1.000 56.93000  ?  383 TRP B CA    1 
ATOM   7367 C  C     . TRP B 2 383 ? 206.87500 75.96700 123.97000 1.000 59.14000  ?  383 TRP B C     1 
ATOM   7368 O  O     . TRP B 2 383 ? 206.02000 76.72600 123.53600 1.000 62.04000  ?  383 TRP B O     1 
ATOM   7369 C  CB    . TRP B 2 383 ? 208.54000 76.26100 122.15800 1.000 54.90000  ?  383 TRP B CB    1 
ATOM   7370 C  CG    . TRP B 2 383 ? 209.93200 76.60300 121.72100 1.000 62.24000  ?  383 TRP B CG    1 
ATOM   7371 C  CD1   . TRP B 2 383 ? 210.51600 77.83800 121.72600 1.000 62.26000  ?  383 TRP B CD1   1 
ATOM   7372 C  CD2   . TRP B 2 383 ? 210.91200 75.70000 121.19800 1.000 63.05000  ?  383 TRP B CD2   1 
ATOM   7373 N  NE1   . TRP B 2 383 ? 211.80600 77.75500 121.25100 1.000 67.85000  ?  383 TRP B NE1   1 
ATOM   7374 C  CE2   . TRP B 2 383 ? 212.07200 76.45300 120.92300 1.000 65.72000  ?  383 TRP B CE2   1 
ATOM   7375 C  CE3   . TRP B 2 383 ? 210.92300 74.32900 120.94300 1.000 56.46000  ?  383 TRP B CE3   1 
ATOM   7376 C  CZ2   . TRP B 2 383 ? 213.22200 75.88100 120.40200 1.000 59.39000  ?  383 TRP B CZ2   1 
ATOM   7377 C  CZ3   . TRP B 2 383 ? 212.06500 73.76800 120.43000 1.000 59.41000  ?  383 TRP B CZ3   1 
ATOM   7378 C  CH2   . TRP B 2 383 ? 213.20000 74.54100 120.16200 1.000 58.70000  ?  383 TRP B CH2   1 
ATOM   7379 N  N     . GLY B 2 384 ? 206.56800 74.89900 124.69600 1.000 57.49000  ?  384 GLY B N     1 
ATOM   7380 C  CA    . GLY B 2 384 ? 205.19400 74.62600 125.06700 1.000 57.02000  ?  384 GLY B CA    1 
ATOM   7381 C  C     . GLY B 2 384 ? 204.34800 74.19900 123.88900 1.000 62.57000  ?  384 GLY B C     1 
ATOM   7382 O  O     . GLY B 2 384 ? 203.12200 74.25400 123.92400 1.000 68.13000  ?  384 GLY B O     1 
ATOM   7383 N  N     . LYS B 2 385 ? 205.01100 73.75200 122.83600 1.000 64.07000  ?  385 LYS B N     1 
ATOM   7384 C  CA    . LYS B 2 385 ? 204.32900 73.38600 121.60300 1.000 67.07000  ?  385 LYS B CA    1 
ATOM   7385 C  C     . LYS B 2 385 ? 204.80600 72.01300 121.10700 1.000 66.62000  ?  385 LYS B C     1 
ATOM   7386 O  O     . LYS B 2 385 ? 205.85200 71.48900 121.52300 1.000 60.49000  ?  385 LYS B O     1 
ATOM   7387 C  CB    . LYS B 2 385 ? 204.57700 74.46200 120.54400 1.000 61.82000  ?  385 LYS B CB    1 
ATOM   7388 C  CG    . LYS B 2 385 ? 203.51500 74.64800 119.49100 1.000 59.98000  ?  385 LYS B CG    1 
ATOM   7389 C  CD    . LYS B 2 385 ? 203.87300 75.89000 118.66200 1.000 64.58000  ?  385 LYS B CD    1 
ATOM   7390 C  CE    . LYS B 2 385 ? 203.31100 75.84500 117.24800 1.000 73.20000  ?  385 LYS B CE    1 
ATOM   7391 N  NZ    . LYS B 2 385 ? 201.94200 76.45000 117.10300 1.000 76.23000  ?  385 LYS B NZ    1 
ATOM   7392 N  N     . THR B 2 386 ? 204.02600 71.43600 120.20900 1.000 65.40000  ?  386 THR B N     1 
ATOM   7393 C  CA    . THR B 2 386 ? 204.36200 70.15700 119.63200 1.000 55.56000  ?  386 THR B CA    1 
ATOM   7394 C  C     . THR B 2 386 ? 204.91800 70.36200 118.22100 1.000 55.21000  ?  386 THR B C     1 
ATOM   7395 O  O     . THR B 2 386 ? 204.40100 71.16900 117.45100 1.000 55.30000  ?  386 THR B O     1 
ATOM   7396 C  CB    . THR B 2 386 ? 203.13600 69.25200 119.61800 1.000 55.08000  ?  386 THR B CB    1 
ATOM   7397 O  OG1   . THR B 2 386 ? 203.42100 68.08600 120.39600 1.000 51.78000  ?  386 THR B OG1   1 
ATOM   7398 C  CG2   . THR B 2 386 ? 202.72800 68.87800 118.17300 1.000 55.46000  ?  386 THR B CG2   1 
ATOM   7399 N  N     . PRO B 2 387 ? 206.00400 69.66600 117.87900 1.000 57.37000  ?  387 PRO B N     1 
ATOM   7400 C  CA    . PRO B 2 387 ? 206.44200 69.89000 116.50100 1.000 56.84000  ?  387 PRO B CA    1 
ATOM   7401 C  C     . PRO B 2 387 ? 205.60800 69.07900 115.51500 1.000 53.70000  ?  387 PRO B C     1 
ATOM   7402 O  O     . PRO B 2 387 ? 204.86900 68.16900 115.90800 1.000 57.55000  ?  387 PRO B O     1 
ATOM   7403 C  CB    . PRO B 2 387 ? 207.90600 69.41400 116.50200 1.000 51.01000  ?  387 PRO B CB    1 
ATOM   7404 C  CG    . PRO B 2 387 ? 208.16800 68.81400 117.82800 1.000 47.68000  ?  387 PRO B CG    1 
ATOM   7405 C  CD    . PRO B 2 387 ? 206.84700 68.67900 118.56600 1.000 56.03000  ?  387 PRO B CD    1 
ATOM   7406 N  N     . LYS B 2 388 ? 205.71000 69.43400 114.24500 1.000 51.36000  ?  388 LYS B N     1 
ATOM   7407 C  CA    . LYS B 2 388 ? 205.25800 68.57700 113.16400 1.000 49.42000  ?  388 LYS B CA    1 
ATOM   7408 C  C     . LYS B 2 388 ? 206.46500 67.80400 112.59400 1.000 51.38000  ?  388 LYS B C     1 
ATOM   7409 O  O     . LYS B 2 388 ? 207.44000 68.40100 112.13900 1.000 49.93000  ?  388 LYS B O     1 
ATOM   7410 C  CB    . LYS B 2 388 ? 204.57000 69.40900 112.08600 1.000 52.07000  ?  388 LYS B CB    1 
ATOM   7411 C  CG    . LYS B 2 388 ? 204.48600 68.69900 110.76000 1.000 57.63000  ?  388 LYS B CG    1 
ATOM   7412 C  CD    . LYS B 2 388 ? 203.11000 68.82800 110.13100 1.000 61.43000  ?  388 LYS B CD    1 
ATOM   7413 C  CE    . LYS B 2 388 ? 203.00000 67.93900 108.87100 1.000 64.32000  ?  388 LYS B CE    1 
ATOM   7414 N  NZ    . LYS B 2 388 ? 202.37100 68.63800 107.70100 1.000 65.42000  ?  388 LYS B NZ    1 
ATOM   7415 N  N     . PHE B 2 389 ? 206.41300 66.47900 112.63400 1.000 50.61000  ?  389 PHE B N     1 
ATOM   7416 C  CA    . PHE B 2 389 ? 207.55500 65.66800 112.19000 1.000 49.18000  ?  389 PHE B CA    1 
ATOM   7417 C  C     . PHE B 2 389 ? 207.56600 65.31000 110.69400 1.000 48.66000  ?  389 PHE B C     1 
ATOM   7418 O  O     . PHE B 2 389 ? 206.53900 64.95100 110.10200 1.000 49.47000  ?  389 PHE B O     1 
ATOM   7419 C  CB    . PHE B 2 389 ? 207.61800 64.37900 113.01600 1.000 44.84000  ?  389 PHE B CB    1 
ATOM   7420 C  CG    . PHE B 2 389 ? 208.08500 64.59500 114.42300 1.000 45.67000  ?  389 PHE B CG    1 
ATOM   7421 C  CD1   . PHE B 2 389 ? 207.17600 64.91000 115.43400 1.000 48.66000  ?  389 PHE B CD1   1 
ATOM   7422 C  CD2   . PHE B 2 389 ? 209.44300 64.51700 114.74200 1.000 47.41000  ?  389 PHE B CD2   1 
ATOM   7423 C  CE1   . PHE B 2 389 ? 207.61500 65.12300 116.74700 1.000 51.11000  ?  389 PHE B CE1   1 
ATOM   7424 C  CE2   . PHE B 2 389 ? 209.89100 64.73500 116.04900 1.000 46.55000  ?  389 PHE B CE2   1 
ATOM   7425 C  CZ    . PHE B 2 389 ? 208.98300 65.02800 117.05300 1.000 47.32000  ?  389 PHE B CZ    1 
ATOM   7426 N  N     . LYS B 2 390 ? 208.74500 65.43400 110.09200 1.000 50.55000  ?  390 LYS B N     1 
ATOM   7427 C  CA    . LYS B 2 390 ? 209.03700 64.87400 108.76300 1.000 50.35000  ?  390 LYS B CA    1 
ATOM   7428 C  C     . LYS B 2 390 ? 209.80500 63.57400 108.93400 1.000 48.52000  ?  390 LYS B C     1 
ATOM   7429 O  O     . LYS B 2 390 ? 211.02000 63.59600 109.12100 1.000 50.13000  ?  390 LYS B O     1 
ATOM   7430 C  CB    . LYS B 2 390 ? 209.85100 65.85100 107.92100 1.000 51.34000  ?  390 LYS B CB    1 
ATOM   7431 C  CG    . LYS B 2 390 ? 209.04200 67.00700 107.40900 1.000 58.75000  ?  390 LYS B CG    1 
ATOM   7432 C  CD    . LYS B 2 390 ? 209.88900 67.95900 106.62700 1.000 59.00000  ?  390 LYS B CD    1 
ATOM   7433 C  CE    . LYS B 2 390 ? 209.02400 69.04100 106.03700 1.000 65.01000  ?  390 LYS B CE    1 
ATOM   7434 N  NZ    . LYS B 2 390 ? 209.84600 69.90500 105.15200 1.000 80.02000  ?  390 LYS B NZ    1 
ATOM   7435 N  N     . LEU B 2 391 ? 209.09800 62.44900 108.90300 1.000 48.75000  ?  391 LEU B N     1 
ATOM   7436 C  CA    . LEU B 2 391 ? 209.68600 61.16800 109.26600 1.000 46.55000  ?  391 LEU B CA    1 
ATOM   7437 C  C     . LEU B 2 391 ? 210.33000 60.44700 108.09500 1.000 48.44000  ?  391 LEU B C     1 
ATOM   7438 O  O     . LEU B 2 391 ? 209.71400 60.29600 107.03500 1.000 53.41000  ?  391 LEU B O     1 
ATOM   7439 C  CB    . LEU B 2 391 ? 208.62400 60.27700 109.88600 1.000 43.03000  ?  391 LEU B CB    1 
ATOM   7440 C  CG    . LEU B 2 391 ? 207.94400 60.90700 111.08800 1.000 49.94000  ?  391 LEU B CG    1 
ATOM   7441 C  CD1   . LEU B 2 391 ? 206.72100 60.08200 111.51900 1.000 48.98000  ?  391 LEU B CD1   1 
ATOM   7442 C  CD2   . LEU B 2 391 ? 208.94300 61.05200 112.22400 1.000 49.81000  ?  391 LEU B CD2   1 
ATOM   7443 N  N     . PRO B 2 392 ? 211.57600 59.99600 108.29000 1.000 47.02000  ?  392 PRO B N     1 
ATOM   7444 C  CA    . PRO B 2 392 ? 212.39100 59.25500 107.32300 1.000 51.77000  ?  392 PRO B CA    1 
ATOM   7445 C  C     . PRO B 2 392 ? 212.09100 57.76700 107.35900 1.000 52.80000  ?  392 PRO B C     1 
ATOM   7446 O  O     . PRO B 2 392 ? 212.96900 56.92200 107.60000 1.000 51.95000  ?  392 PRO B O     1 
ATOM   7447 C  CB    . PRO B 2 392 ? 213.81200 59.54100 107.78800 1.000 51.22000  ?  392 PRO B CB    1 
ATOM   7448 C  CG    . PRO B 2 392 ? 213.68500 59.67100 109.23400 1.000 44.15000  ?  392 PRO B CG    1 
ATOM   7449 C  CD    . PRO B 2 392 ? 212.37000 60.37200 109.46900 1.000 49.82000  ?  392 PRO B CD    1 
ATOM   7450 N  N     . ILE B 2 393 ? 210.82300 57.46500 107.12100 1.000 49.32000  ?  393 ILE B N     1 
ATOM   7451 C  CA    . ILE B 2 393 ? 210.32700 56.10600 107.14700 1.000 50.67000  ?  393 ILE B CA    1 
ATOM   7452 C  C     . ILE B 2 393 ? 209.20700 55.98400 106.12400 1.000 52.87000  ?  393 ILE B C     1 
ATOM   7453 O  O     . ILE B 2 393 ? 208.57400 56.98000 105.77500 1.000 53.30000  ?  393 ILE B O     1 
ATOM   7454 C  CB    . ILE B 2 393 ? 209.81600 55.72500 108.54300 1.000 51.24000  ?  393 ILE B CB    1 
ATOM   7455 C  CG1   . ILE B 2 393 ? 209.68500 54.20700 108.67600 1.000 52.73000  ?  393 ILE B CG1   1 
ATOM   7456 C  CG2   . ILE B 2 393 ? 208.49000 56.41100 108.81900 1.000 49.54000  ?  393 ILE B CG2   1 
ATOM   7457 C  CD1   . ILE B 2 393 ? 209.13700 53.76600 110.00400 1.000 48.74000  ?  393 ILE B CD1   1 
ATOM   7458 N  N     . GLN B 2 394 ? 208.97200 54.77800 105.62400 1.000 56.40000  ?  394 GLN B N     1 
ATOM   7459 C  CA    . GLN B 2 394 ? 207.82700 54.56400 104.74300 1.000 53.66000  ?  394 GLN B CA    1 
ATOM   7460 C  C     . GLN B 2 394 ? 206.56600 54.73700 105.55000 1.000 54.91000  ?  394 GLN B C     1 
ATOM   7461 O  O     . GLN B 2 394 ? 206.51000 54.31900 106.70100 1.000 56.82000  ?  394 GLN B O     1 
ATOM   7462 C  CB    . GLN B 2 394 ? 207.84100 53.17400 104.10500 1.000 59.01000  ?  394 GLN B CB    1 
ATOM   7463 C  CG    . GLN B 2 394 ? 206.65600 52.95500 103.14800 1.000 68.81000  ?  394 GLN B CG    1 
ATOM   7464 C  CD    . GLN B 2 394 ? 206.49700 51.51100 102.63100 1.000 77.96000  ?  394 GLN B CD    1 
ATOM   7465 O  OE1   . GLN B 2 394 ? 206.74300 50.53000 103.35300 1.000 74.14000  ?  394 GLN B OE1   1 
ATOM   7466 N  NE2   . GLN B 2 394 ? 206.06600 51.38500 101.36900 1.000 80.42000  ?  394 GLN B NE2   1 
ATOM   7467 N  N     . LYS B 2 395 ? 205.56000 55.35600 104.94800 1.000 55.90000  ?  395 LYS B N     1 
ATOM   7468 C  CA    . LYS B 2 395 ? 204.26200 55.51100 105.58100 1.000 54.68000  ?  395 LYS B CA    1 
ATOM   7469 C  C     . LYS B 2 395 ? 203.73300 54.19600 106.14300 1.000 58.42000  ?  395 LYS B C     1 
ATOM   7470 O  O     . LYS B 2 395 ? 203.36200 54.11800 107.31100 1.000 60.97000  ?  395 LYS B O     1 
ATOM   7471 C  CB    . LYS B 2 395 ? 203.25200 56.10000 104.58300 1.000 60.50000  ?  395 LYS B CB    1 
ATOM   7472 C  CG    . LYS B 2 395 ? 201.81300 56.10800 105.08300 1.000 64.36000  ?  395 LYS B CG    1 
ATOM   7473 C  CD    . LYS B 2 395 ? 200.91400 57.01100 104.24200 1.000 69.77000  ?  395 LYS B CD    1 
ATOM   7474 C  CE    . LYS B 2 395 ? 199.45600 56.60700 104.40300 1.000 70.94000  ?  395 LYS B CE    1 
ATOM   7475 N  NZ    . LYS B 2 395 ? 199.28900 55.19100 103.92800 1.000 74.37000  ?  395 LYS B NZ    1 
ATOM   7476 N  N     . GLU B 2 396 ? 203.70200 53.16300 105.31000 1.000 63.31000  ?  396 GLU B N     1 
ATOM   7477 C  CA    . GLU B 2 396 ? 203.12500 51.88200 105.69400 1.000 61.48000  ?  396 GLU B CA    1 
ATOM   7478 C  C     . GLU B 2 396 ? 203.91900 51.22200 106.83000 1.000 65.19000  ?  396 GLU B C     1 
ATOM   7479 O  O     . GLU B 2 396 ? 203.32500 50.71700 107.80000 1.000 64.07000  ?  396 GLU B O     1 
ATOM   7480 C  CB    . GLU B 2 396 ? 203.06100 50.97600 104.47600 1.000 69.02000  ?  396 GLU B CB    1 
ATOM   7481 C  CG    . GLU B 2 396 ? 202.76500 51.74800 103.19200 1.000 72.61000  ?  396 GLU B CG    1 
ATOM   7482 C  CD    . GLU B 2 396 ? 201.28100 51.96600 102.97500 1.000 80.84000  ?  396 GLU B CD    1 
ATOM   7483 O  OE1   . GLU B 2 396 ? 200.48300 51.21400 103.58100 1.000 85.13000  ?  396 GLU B OE1   1 
ATOM   7484 O  OE2   . GLU B 2 396 ? 200.90900 52.87900 102.19800 1.000 79.22000  ?  396 GLU B OE2   1 
ATOM   7485 N  N     . THR B 2 397 ? 205.25200 51.24200 106.72200 1.000 58.74000  ?  397 THR B N     1 
ATOM   7486 C  CA    . THR B 2 397 ? 206.11900 50.73200 107.79200 1.000 57.74000  ?  397 THR B CA    1 
ATOM   7487 C  C     . THR B 2 397 ? 205.78200 51.39600 109.12100 1.000 57.37000  ?  397 THR B C     1 
ATOM   7488 O  O     . THR B 2 397 ? 205.56700 50.73100 110.11900 1.000 60.99000  ?  397 THR B O     1 
ATOM   7489 C  CB    . THR B 2 397 ? 207.63500 50.97300 107.51800 1.000 63.58000  ?  397 THR B CB    1 
ATOM   7490 O  OG1   . THR B 2 397 ? 208.05000 50.33000 106.30500 1.000 57.64000  ?  397 THR B OG1   1 
ATOM   7491 C  CG2   . THR B 2 397 ? 208.46600 50.45500 108.68500 1.000 55.12000  ?  397 THR B CG2   1 
ATOM   7492 N  N     . TRP B 2 398 ? 205.73200 52.72000 109.12500 1.000 56.41000  ?  398 TRP B N     1 
ATOM   7493 C  CA    . TRP B 2 398 ? 205.43200 53.45300 110.34700 1.000 55.20000  ?  398 TRP B CA    1 
ATOM   7494 C  C     . TRP B 2 398 ? 204.07800 53.05600 110.93100 1.000 54.12000  ?  398 TRP B C     1 
ATOM   7495 O  O     . TRP B 2 398 ? 203.98800 52.72300 112.10800 1.000 59.24000  ?  398 TRP B O     1 
ATOM   7496 C  CB    . TRP B 2 398 ? 205.48600 54.96100 110.08700 1.000 51.13000  ?  398 TRP B CB    1 
ATOM   7497 C  CG    . TRP B 2 398 ? 205.12800 55.79500 111.26100 1.000 51.67000  ?  398 TRP B CG    1 
ATOM   7498 C  CD1   . TRP B 2 398 ? 203.92900 56.39800 111.50400 1.000 54.99000  ?  398 TRP B CD1   1 
ATOM   7499 C  CD2   . TRP B 2 398 ? 205.97300 56.14000 112.35300 1.000 52.04000  ?  398 TRP B CD2   1 
ATOM   7500 N  NE1   . TRP B 2 398 ? 203.97400 57.09500 112.68900 1.000 49.86000  ?  398 TRP B NE1   1 
ATOM   7501 C  CE2   . TRP B 2 398 ? 205.22000 56.95100 113.23100 1.000 51.17000  ?  398 TRP B CE2   1 
ATOM   7502 C  CE3   . TRP B 2 398 ? 207.29800 55.85300 112.67600 1.000 52.46000  ?  398 TRP B CE3   1 
ATOM   7503 C  CZ2   . TRP B 2 398 ? 205.74900 57.47400 114.40800 1.000 52.83000  ?  398 TRP B CZ2   1 
ATOM   7504 C  CZ3   . TRP B 2 398 ? 207.82200 56.36100 113.85500 1.000 52.28000  ?  398 TRP B CZ3   1 
ATOM   7505 C  CH2   . TRP B 2 398 ? 207.04800 57.16100 114.70700 1.000 53.18000  ?  398 TRP B CH2   1 
ATOM   7506 N  N     . GLU B 2 399 ? 203.02700 53.07800 110.12200 1.000 56.41000  ?  399 GLU B N     1 
ATOM   7507 C  CA    . GLU B 2 399 ? 201.68500 52.83400 110.65300 1.000 58.36000  ?  399 GLU B CA    1 
ATOM   7508 C  C     . GLU B 2 399 ? 201.49500 51.41100 111.14900 1.000 53.77000  ?  399 GLU B C     1 
ATOM   7509 O  O     . GLU B 2 399 ? 200.73700 51.18700 112.08200 1.000 55.00000  ?  399 GLU B O     1 
ATOM   7510 C  CB    . GLU B 2 399 ? 200.62400 53.15000 109.61100 1.000 59.62000  ?  399 GLU B CB    1 
ATOM   7511 C  CG    . GLU B 2 399 ? 200.35500 54.62300 109.43400 1.000 63.86000  ?  399 GLU B CG    1 
ATOM   7512 C  CD    . GLU B 2 399 ? 199.53500 54.89800 108.19100 1.000 74.22000  ?  399 GLU B CD    1 
ATOM   7513 O  OE1   . GLU B 2 399 ? 199.13600 56.06700 107.97900 1.000 76.30000  ?  399 GLU B OE1   1 
ATOM   7514 O  OE2   . GLU B 2 399 ? 199.29400 53.94000 107.41900 1.000 72.78000  ?  399 GLU B OE2   1 
ATOM   7515 N  N     . THR B 2 400 ? 202.18500 50.45500 110.53100 1.000 56.11000  ?  400 THR B N     1 
ATOM   7516 C  CA    . THR B 2 400 ? 202.14400 49.07000 111.00200 1.000 55.99000  ?  400 THR B CA    1 
ATOM   7517 C  C     . THR B 2 400 ? 202.62200 48.92900 112.46000 1.000 59.67000  ?  400 THR B C     1 
ATOM   7518 O  O     . THR B 2 400 ? 202.06100 48.13600 113.20300 1.000 60.34000  ?  400 THR B O     1 
ATOM   7519 C  CB    . THR B 2 400 ? 203.01800 48.13100 110.11700 1.000 61.41000  ?  400 THR B CB    1 
ATOM   7520 O  OG1   . THR B 2 400 ? 202.57800 48.16000 108.75600 1.000 59.08000  ?  400 THR B OG1   1 
ATOM   7521 C  CG2   . THR B 2 400 ? 202.97100 46.69000 110.62800 1.000 59.23000  ?  400 THR B CG2   1 
ATOM   7522 N  N     . TRP B 2 401 ? 203.64600 49.69300 112.87300 1.000 61.03000  ?  401 TRP B N     1 
ATOM   7523 C  CA    . TRP B 2 401 ? 204.29800 49.42300 114.16200 1.000 57.03000  ?  401 TRP B CA    1 
ATOM   7524 C  C     . TRP B 2 401 ? 204.40800 50.49400 115.22700 1.000 54.01000  ?  401 TRP B C     1 
ATOM   7525 O  O     . TRP B 2 401 ? 204.76200 50.16100 116.35100 1.000 55.42000  ?  401 TRP B O     1 
ATOM   7526 C  CB    . TRP B 2 401 ? 205.70500 48.90400 113.91300 1.000 52.36000  ?  401 TRP B CB    1 
ATOM   7527 C  CG    . TRP B 2 401 ? 205.63200 47.45100 113.63100 1.000 59.03000  ?  401 TRP B CG    1 
ATOM   7528 C  CD1   . TRP B 2 401 ? 205.20400 46.47200 114.48800 1.000 63.24000  ?  401 TRP B CD1   1 
ATOM   7529 C  CD2   . TRP B 2 401 ? 205.93400 46.80300 112.40300 1.000 54.27000  ?  401 TRP B CD2   1 
ATOM   7530 N  NE1   . TRP B 2 401 ? 205.24300 45.24600 113.86800 1.000 59.71000  ?  401 TRP B NE1   1 
ATOM   7531 C  CE2   . TRP B 2 401 ? 205.68400 45.42200 112.58300 1.000 57.34000  ?  401 TRP B CE2   1 
ATOM   7532 C  CE3   . TRP B 2 401 ? 206.40700 47.24700 111.16900 1.000 57.06000  ?  401 TRP B CE3   1 
ATOM   7533 C  CZ2   . TRP B 2 401 ? 205.87900 44.48800 111.57500 1.000 58.37000  ?  401 TRP B CZ2   1 
ATOM   7534 C  CZ3   . TRP B 2 401 ? 206.60500 46.32400 110.16700 1.000 63.12000  ?  401 TRP B CZ3   1 
ATOM   7535 C  CH2   . TRP B 2 401 ? 206.33600 44.95500 110.37500 1.000 62.14000  ?  401 TRP B CH2   1 
ATOM   7536 N  N     . TRP B 2 402 ? 204.09100 51.75000 114.94100 1.000 54.17000  ?  402 TRP B N     1 
ATOM   7537 C  CA    . TRP B 2 402 ? 204.50400 52.77700 115.90000 1.000 53.83000  ?  402 TRP B CA    1 
ATOM   7538 C  C     . TRP B 2 402 ? 203.80200 52.71800 117.25100 1.000 52.04000  ?  402 TRP B C     1 
ATOM   7539 O  O     . TRP B 2 402 ? 204.39200 53.14000 118.25100 1.000 52.47000  ?  402 TRP B O     1 
ATOM   7540 C  CB    . TRP B 2 402 ? 204.34900 54.17400 115.31400 1.000 53.06000  ?  402 TRP B CB    1 
ATOM   7541 C  CG    . TRP B 2 402 ? 202.96400 54.68000 115.22800 1.000 54.87000  ?  402 TRP B CG    1 
ATOM   7542 C  CD1   . TRP B 2 402 ? 202.10500 54.51100 114.18900 1.000 53.98000  ?  402 TRP B CD1   1 
ATOM   7543 C  CD2   . TRP B 2 402 ? 202.28100 55.48900 116.19400 1.000 50.83000  ?  402 TRP B CD2   1 
ATOM   7544 N  NE1   . TRP B 2 402 ? 200.92000 55.14800 114.45100 1.000 55.97000  ?  402 TRP B NE1   1 
ATOM   7545 C  CE2   . TRP B 2 402 ? 200.99800 55.75800 115.67400 1.000 53.32000  ?  402 TRP B CE2   1 
ATOM   7546 C  CE3   . TRP B 2 402 ? 202.62100 55.99500 117.45400 1.000 49.56000  ?  402 TRP B CE3   1 
ATOM   7547 C  CZ2   . TRP B 2 402 ? 200.04700 56.52700 116.36600 1.000 49.48000  ?  402 TRP B CZ2   1 
ATOM   7548 C  CZ3   . TRP B 2 402 ? 201.67700 56.74400 118.14800 1.000 52.89000  ?  402 TRP B CZ3   1 
ATOM   7549 C  CH2   . TRP B 2 402 ? 200.39900 57.00500 117.59800 1.000 49.99000  ?  402 TRP B CH2   1 
ATOM   7550 N  N     . THR B 2 403 ? 202.57600 52.18900 117.30300 1.000 53.98000  ?  403 THR B N     1 
ATOM   7551 C  CA    . THR B 2 403 ? 201.82200 52.16800 118.57100 1.000 54.78000  ?  403 THR B CA    1 
ATOM   7552 C  C     . THR B 2 403 ? 202.28400 51.03500 119.47200 1.000 57.34000  ?  403 THR B C     1 
ATOM   7553 O  O     . THR B 2 403 ? 201.91000 50.97400 120.65000 1.000 58.98000  ?  403 THR B O     1 
ATOM   7554 C  CB    . THR B 2 403 ? 200.28600 52.03200 118.38500 1.000 51.26000  ?  403 THR B CB    1 
ATOM   7555 O  OG1   . THR B 2 403 ? 199.97300 50.80000 117.73100 1.000 53.81000  ?  403 THR B OG1   1 
ATOM   7556 C  CG2   . THR B 2 403 ? 199.74600 53.17300 117.58900 1.000 52.29000  ?  403 THR B CG2   1 
ATOM   7557 N  N     . GLU B 2 404 ? 203.10200 50.14100 118.93100 1.000 55.21000  ?  404 GLU B N     1 
ATOM   7558 C  CA    . GLU B 2 404 ? 203.71400 49.13800 119.77600 1.000 53.04000  ?  404 GLU B CA    1 
ATOM   7559 C  C     . GLU B 2 404 ? 204.76800 49.80500 120.65400 1.000 57.18000  ?  404 GLU B C     1 
ATOM   7560 O  O     . GLU B 2 404 ? 205.08500 49.29600 121.72100 1.000 60.71000  ?  404 GLU B O     1 
ATOM   7561 C  CB    . GLU B 2 404 ? 204.32400 47.99900 118.95000 1.000 57.62000  ?  404 GLU B CB    1 
ATOM   7562 C  CG    . GLU B 2 404 ? 203.30200 47.05600 118.27100 1.000 62.34000  ?  404 GLU B CG    1 
ATOM   7563 C  CD    . GLU B 2 404 ? 202.50100 46.19900 119.26900 1.000 72.11000  ?  404 GLU B CD    1 
ATOM   7564 O  OE1   . GLU B 2 404 ? 201.37700 46.60800 119.67300 1.000 72.37000  ?  404 GLU B OE1   1 
ATOM   7565 O  OE2   . GLU B 2 404 ? 202.99100 45.10800 119.64600 1.000 73.48000  ?  404 GLU B OE2   1 
ATOM   7566 N  N     . TYR B 2 405 ? 205.30400 50.95200 120.23400 1.000 58.17000  ?  405 TYR B N     1 
ATOM   7567 C  CA    . TYR B 2 405 ? 206.38300 51.57200 121.00900 1.000 53.98000  ?  405 TYR B CA    1 
ATOM   7568 C  C     . TYR B 2 405 ? 206.01900 52.92500 121.61500 1.000 55.48000  ?  405 TYR B C     1 
ATOM   7569 O  O     . TYR B 2 405 ? 206.87700 53.60000 122.16300 1.000 57.92000  ?  405 TYR B O     1 
ATOM   7570 C  CB    . TYR B 2 405 ? 207.64400 51.71200 120.14500 1.000 53.90000  ?  405 TYR B CB    1 
ATOM   7571 C  CG    . TYR B 2 405 ? 207.94600 50.45400 119.36900 1.000 54.60000  ?  405 TYR B CG    1 
ATOM   7572 C  CD1   . TYR B 2 405 ? 208.33000 49.29100 120.01700 1.000 54.34000  ?  405 TYR B CD1   1 
ATOM   7573 C  CD2   . TYR B 2 405 ? 207.80300 50.41600 117.99500 1.000 57.14000  ?  405 TYR B CD2   1 
ATOM   7574 C  CE1   . TYR B 2 405 ? 208.57900 48.13100 119.31300 1.000 55.77000  ?  405 TYR B CE1   1 
ATOM   7575 C  CE2   . TYR B 2 405 ? 208.05000 49.25800 117.28300 1.000 58.41000  ?  405 TYR B CE2   1 
ATOM   7576 C  CZ    . TYR B 2 405 ? 208.43400 48.12400 117.94800 1.000 58.63000  ?  405 TYR B CZ    1 
ATOM   7577 O  OH    . TYR B 2 405 ? 208.68400 46.98000 117.23500 1.000 67.25000  ?  405 TYR B OH    1 
ATOM   7578 N  N     . TRP B 2 406 ? 204.74900 53.31400 121.55400 1.000 58.10000  ?  406 TRP B N     1 
ATOM   7579 C  CA    . TRP B 2 406 ? 204.35700 54.62700 122.05900 1.000 53.99000  ?  406 TRP B CA    1 
ATOM   7580 C  C     . TRP B 2 406 ? 204.08200 54.65500 123.57200 1.000 56.91000  ?  406 TRP B C     1 
ATOM   7581 O  O     . TRP B 2 406 ? 203.51700 53.72300 124.14200 1.000 54.38000  ?  406 TRP B O     1 
ATOM   7582 C  CB    . TRP B 2 406 ? 203.14300 55.12300 121.30000 1.000 49.88000  ?  406 TRP B CB    1 
ATOM   7583 C  CG    . TRP B 2 406 ? 202.97700 56.59000 121.35800 1.000 50.20000  ?  406 TRP B CG    1 
ATOM   7584 C  CD1   . TRP B 2 406 ? 202.08800 57.27700 122.11100 1.000 53.89000  ?  406 TRP B CD1   1 
ATOM   7585 C  CD2   . TRP B 2 406 ? 203.71700 57.56600 120.62200 1.000 50.61000  ?  406 TRP B CD2   1 
ATOM   7586 N  NE1   . TRP B 2 406 ? 202.21100 58.62500 121.88600 1.000 52.21000  ?  406 TRP B NE1   1 
ATOM   7587 C  CE2   . TRP B 2 406 ? 203.21300 58.82600 120.97300 1.000 48.83000  ?  406 TRP B CE2   1 
ATOM   7588 C  CE3   . TRP B 2 406 ? 204.75900 57.49300 119.68700 1.000 55.13000  ?  406 TRP B CE3   1 
ATOM   7589 C  CZ2   . TRP B 2 406 ? 203.71200 60.00500 120.43500 1.000 50.65000  ?  406 TRP B CZ2   1 
ATOM   7590 C  CZ3   . TRP B 2 406 ? 205.25500 58.65800 119.15400 1.000 47.95000  ?  406 TRP B CZ3   1 
ATOM   7591 C  CH2   . TRP B 2 406 ? 204.73700 59.89900 119.52900 1.000 51.68000  ?  406 TRP B CH2   1 
ATOM   7592 N  N     . GLN B 2 407 ? 204.48800 55.73800 124.22200 1.000 54.92000  ?  407 GLN B N     1 
ATOM   7593 C  CA    . GLN B 2 407 ? 204.41300 55.80000 125.67200 1.000 54.13000  ?  407 GLN B CA    1 
ATOM   7594 C  C     . GLN B 2 407 ? 203.96700 57.16900 126.14400 1.000 53.96000  ?  407 GLN B C     1 
ATOM   7595 O  O     . GLN B 2 407 ? 203.94600 57.42400 127.32400 1.000 57.69000  ?  407 GLN B O     1 
ATOM   7596 C  CB    . GLN B 2 407 ? 205.76400 55.44500 126.30400 1.000 49.54000  ?  407 GLN B CB    1 
ATOM   7597 C  CG    . GLN B 2 407 ? 206.07200 53.95600 126.32700 1.000 55.52000  ?  407 GLN B CG    1 
ATOM   7598 C  CD    . GLN B 2 407 ? 205.04000 53.15900 127.12200 1.000 72.66000  ?  407 GLN B CD    1 
ATOM   7599 O  OE1   . GLN B 2 407 ? 204.50300 53.64000 128.12400 1.000 77.79000  ?  407 GLN B OE1   1 
ATOM   7600 N  NE2   . GLN B 2 407 ? 204.75600 51.93600 126.67500 1.000 69.52000  ?  407 GLN B NE2   1 
ATOM   7601 N  N     . ALA B 2 408 ? 203.60400 58.04600 125.22300 1.000 52.64000  ?  408 ALA B N     1 
ATOM   7602 C  CA    . ALA B 2 408 ? 203.17800 59.38400 125.59300 1.000 50.90000  ?  408 ALA B CA    1 
ATOM   7603 C  C     . ALA B 2 408 ? 201.64800 59.48900 125.58800 1.000 55.93000  ?  408 ALA B C     1 
ATOM   7604 O  O     . ALA B 2 408 ? 200.97800 58.65800 124.97600 1.000 52.87000  ?  408 ALA B O     1 
ATOM   7605 C  CB    . ALA B 2 408 ? 203.79300 60.40600 124.64500 1.000 50.54000  ?  408 ALA B CB    1 
ATOM   7606 N  N     . THR B 2 409 ? 201.09200 60.49800 126.26100 1.000 48.44000  ?  409 THR B N     1 
ATOM   7607 C  CA    . THR B 2 409 ? 199.64700 60.66400 126.25000 1.000 50.11000  ?  409 THR B CA    1 
ATOM   7608 C  C     . THR B 2 409 ? 199.22200 61.50900 125.07100 1.000 53.28000  ?  409 THR B C     1 
ATOM   7609 O  O     . THR B 2 409 ? 198.04800 61.49900 124.69500 1.000 56.87000  ?  409 THR B O     1 
ATOM   7610 C  CB    . THR B 2 409 ? 199.09000 61.31900 127.55100 1.000 57.60000  ?  409 THR B CB    1 
ATOM   7611 O  OG1   . THR B 2 409 ? 199.54000 62.68300 127.66200 1.000 57.53000  ?  409 THR B OG1   1 
ATOM   7612 C  CG2   . THR B 2 409 ? 199.47700 60.50300 128.79100 1.000 56.64000  ?  409 THR B CG2   1 
ATOM   7613 N  N     . TRP B 2 410 ? 200.17200 62.26100 124.51300 1.000 52.35000  ?  410 TRP B N     1 
ATOM   7614 C  CA    . TRP B 2 410 ? 199.92900 63.09000 123.32900 1.000 50.91000  ?  410 TRP B CA    1 
ATOM   7615 C  C     . TRP B 2 410 ? 200.48200 62.41900 122.05200 1.000 48.98000  ?  410 TRP B C     1 
ATOM   7616 O  O     . TRP B 2 410 ? 201.14900 61.38400 122.09600 1.000 47.67000  ?  410 TRP B O     1 
ATOM   7617 C  CB    . TRP B 2 410 ? 200.52700 64.49600 123.50700 1.000 45.41000  ?  410 TRP B CB    1 
ATOM   7618 C  CG    . TRP B 2 410 ? 201.83800 64.51800 124.25200 1.000 53.17000  ?  410 TRP B CG    1 
ATOM   7619 C  CD1   . TRP B 2 410 ? 202.04700 64.99100 125.51100 1.000 55.13000  ?  410 TRP B CD1   1 
ATOM   7620 C  CD2   . TRP B 2 410 ? 203.11300 64.02500 123.79900 1.000 52.85000  ?  410 TRP B CD2   1 
ATOM   7621 N  NE1   . TRP B 2 410 ? 203.36300 64.82000 125.88400 1.000 51.67000  ?  410 TRP B NE1   1 
ATOM   7622 C  CE2   . TRP B 2 410 ? 204.04300 64.23100 124.85000 1.000 55.86000  ?  410 TRP B CE2   1 
ATOM   7623 C  CE3   . TRP B 2 410 ? 203.55700 63.42500 122.62000 1.000 49.24000  ?  410 TRP B CE3   1 
ATOM   7624 C  CZ2   . TRP B 2 410 ? 205.39300 63.87000 124.74900 1.000 48.37000  ?  410 TRP B CZ2   1 
ATOM   7625 C  CZ3   . TRP B 2 410 ? 204.89500 63.06500 122.52200 1.000 55.38000  ?  410 TRP B CZ3   1 
ATOM   7626 C  CH2   . TRP B 2 410 ? 205.79800 63.29000 123.58700 1.000 53.95000  ?  410 TRP B CH2   1 
ATOM   7627 N  N     . ILE B 2 411 ? 200.14900 62.99700 120.90900 1.000 49.41000  ?  411 ILE B N     1 
ATOM   7628 C  CA    . ILE B 2 411 ? 200.61100 62.48600 119.63000 1.000 47.49000  ?  411 ILE B CA    1 
ATOM   7629 C  C     . ILE B 2 411 ? 200.84000 63.63700 118.67400 1.000 46.25000  ?  411 ILE B C     1 
ATOM   7630 O  O     . ILE B 2 411 ? 199.89700 64.35700 118.33100 1.000 47.59000  ?  411 ILE B O     1 
ATOM   7631 C  CB    . ILE B 2 411 ? 199.61000 61.52500 119.00100 1.000 47.72000  ?  411 ILE B CB    1 
ATOM   7632 C  CG1   . ILE B 2 411 ? 199.28200 60.37500 119.94700 1.000 45.32000  ?  411 ILE B CG1   1 
ATOM   7633 C  CG2   . ILE B 2 411 ? 200.14200 61.00900 117.67700 1.000 48.40000  ?  411 ILE B CG2   1 
ATOM   7634 C  CD1   . ILE B 2 411 ? 197.95900 59.74100 119.61900 1.000 41.88000  ?  411 ILE B CD1   1 
ATOM   7635 N  N     . PRO B 2 412 ? 202.09600 63.82800 118.25800 1.000 43.39000  ?  412 PRO B N     1 
ATOM   7636 C  CA    . PRO B 2 412 ? 202.44500 64.92700 117.36200 1.000 47.37000  ?  412 PRO B CA    1 
ATOM   7637 C  C     . PRO B 2 412 ? 201.91800 64.67700 115.96800 1.000 48.35000  ?  412 PRO B C     1 
ATOM   7638 O  O     . PRO B 2 412 ? 201.68500 63.52000 115.60000 1.000 45.99000  ?  412 PRO B O     1 
ATOM   7639 C  CB    . PRO B 2 412 ? 203.97100 64.90600 117.36200 1.000 45.32000  ?  412 PRO B CB    1 
ATOM   7640 C  CG    . PRO B 2 412 ? 204.29600 63.46200 117.55100 1.000 47.00000  ?  412 PRO B CG    1 
ATOM   7641 C  CD    . PRO B 2 412 ? 203.24700 62.94400 118.50900 1.000 47.35000  ?  412 PRO B CD    1 
ATOM   7642 N  N     . GLU B 2 413 ? 201.74100 65.75000 115.20800 1.000 49.93000  ?  413 GLU B N     1 
ATOM   7643 C  CA    . GLU B 2 413 ? 201.47900 65.62900 113.78800 1.000 50.29000  ?  413 GLU B CA    1 
ATOM   7644 C  C     . GLU B 2 413 ? 202.71300 65.09700 113.12100 1.000 50.13000  ?  413 GLU B C     1 
ATOM   7645 O  O     . GLU B 2 413 ? 203.81600 65.26900 113.64900 1.000 47.79000  ?  413 GLU B O     1 
ATOM   7646 C  CB    . GLU B 2 413 ? 201.13300 66.97000 113.19700 1.000 54.01000  ?  413 GLU B CB    1 
ATOM   7647 C  CG    . GLU B 2 413 ? 200.28200 67.77300 114.10100 1.000 57.67000  ?  413 GLU B CG    1 
ATOM   7648 C  CD    . GLU B 2 413 ? 198.87800 67.80900 113.61600 1.000 66.65000  ?  413 GLU B CD    1 
ATOM   7649 O  OE1   . GLU B 2 413 ? 198.61500 67.12800 112.59600 1.000 72.16000  ?  413 GLU B OE1   1 
ATOM   7650 O  OE2   . GLU B 2 413 ? 198.04600 68.51600 114.23700 1.000 74.06000  ?  413 GLU B OE2   1 
ATOM   7651 N  N     . TRP B 2 414 ? 202.54700 64.47300 111.96000 1.000 47.52000  ?  414 TRP B N     1 
ATOM   7652 C  CA    . TRP B 2 414 ? 203.70500 64.07500 111.18200 1.000 48.45000  ?  414 TRP B CA    1 
ATOM   7653 C  C     . TRP B 2 414 ? 203.38100 63.85200 109.72800 1.000 52.93000  ?  414 TRP B C     1 
ATOM   7654 O  O     . TRP B 2 414 ? 202.22200 63.72800 109.35700 1.000 53.68000  ?  414 TRP B O     1 
ATOM   7655 C  CB    . TRP B 2 414 ? 204.34100 62.81600 111.75800 1.000 48.90000  ?  414 TRP B CB    1 
ATOM   7656 C  CG    . TRP B 2 414 ? 203.43100 61.66600 111.87500 1.000 45.59000  ?  414 TRP B CG    1 
ATOM   7657 C  CD1   . TRP B 2 414 ? 202.71700 61.07500 110.87400 1.000 45.20000  ?  414 TRP B CD1   1 
ATOM   7658 C  CD2   . TRP B 2 414 ? 203.16100 60.91700 113.05900 1.000 45.33000  ?  414 TRP B CD2   1 
ATOM   7659 N  NE1   . TRP B 2 414 ? 201.99100 60.02100 111.37200 1.000 46.02000  ?  414 TRP B NE1   1 
ATOM   7660 C  CE2   . TRP B 2 414 ? 202.24400 59.90300 112.71300 1.000 46.52000  ?  414 TRP B CE2   1 
ATOM   7661 C  CE3   . TRP B 2 414 ? 203.58000 61.02200 114.38300 1.000 42.85000  ?  414 TRP B CE3   1 
ATOM   7662 C  CZ2   . TRP B 2 414 ? 201.75000 59.00100 113.63800 1.000 48.24000  ?  414 TRP B CZ2   1 
ATOM   7663 C  CZ3   . TRP B 2 414 ? 203.10200 60.12700 115.29600 1.000 43.75000  ?  414 TRP B CZ3   1 
ATOM   7664 C  CH2   . TRP B 2 414 ? 202.19900 59.12100 114.92300 1.000 50.72000  ?  414 TRP B CH2   1 
ATOM   7665 N  N     . GLU B 2 415 ? 204.42500 63.82400 108.90800 1.000 49.81000  ?  415 GLU B N     1 
ATOM   7666 C  CA    . GLU B 2 415 ? 204.29500 63.46700 107.51100 1.000 50.99000  ?  415 GLU B CA    1 
ATOM   7667 C  C     . GLU B 2 415 ? 205.51100 62.62600 107.15500 1.000 53.14000  ?  415 GLU B C     1 
ATOM   7668 O  O     . GLU B 2 415 ? 206.47200 62.56600 107.92300 1.000 51.47000  ?  415 GLU B O     1 
ATOM   7669 C  CB    . GLU B 2 415 ? 204.18700 64.70800 106.62900 1.000 56.55000  ?  415 GLU B CB    1 
ATOM   7670 C  CG    . GLU B 2 415 ? 205.46700 65.52600 106.54700 1.000 62.63000  ?  415 GLU B CG    1 
ATOM   7671 C  CD    . GLU B 2 415 ? 205.32600 66.78900 105.70300 1.000 68.51000  ?  415 GLU B CD    1 
ATOM   7672 O  OE1   . GLU B 2 415 ? 206.28000 67.12400 104.96600 1.000 75.93000  ?  415 GLU B OE1   1 
ATOM   7673 O  OE2   . GLU B 2 415 ? 204.27000 67.45400 105.78200 1.000 73.20000  ?  415 GLU B OE2   1 
ATOM   7674 N  N     . PHE B 2 416 ? 205.47600 61.96500 106.00300 1.000 58.49000  ?  416 PHE B N     1 
ATOM   7675 C  CA    . PHE B 2 416 ? 206.55800 61.04600 105.63500 1.000 55.53000  ?  416 PHE B CA    1 
ATOM   7676 C  C     . PHE B 2 416 ? 207.36200 61.58100 104.46400 1.000 58.19000  ?  416 PHE B C     1 
ATOM   7677 O  O     . PHE B 2 416 ? 206.85500 62.30000 103.60500 1.000 62.25000  ?  416 PHE B O     1 
ATOM   7678 C  CB    . PHE B 2 416 ? 205.99000 59.66800 105.34200 1.000 48.59000  ?  416 PHE B CB    1 
ATOM   7679 C  CG    . PHE B 2 416 ? 205.06600 59.18200 106.41800 1.000 55.22000  ?  416 PHE B CG    1 
ATOM   7680 C  CD1   . PHE B 2 416 ? 205.57200 58.62900 107.58800 1.000 51.34000  ?  416 PHE B CD1   1 
ATOM   7681 C  CD2   . PHE B 2 416 ? 203.68200 59.32300 106.28500 1.000 56.36000  ?  416 PHE B CD2   1 
ATOM   7682 C  CE1   . PHE B 2 416 ? 204.71700 58.19600 108.59800 1.000 47.81000  ?  416 PHE B CE1   1 
ATOM   7683 C  CE2   . PHE B 2 416 ? 202.81400 58.89400 107.28300 1.000 49.56000  ?  416 PHE B CE2   1 
ATOM   7684 C  CZ    . PHE B 2 416 ? 203.33400 58.33400 108.44500 1.000 54.15000  ?  416 PHE B CZ    1 
ATOM   7685 N  N     . VAL B 2 417 ? 208.64200 61.24900 104.45600 1.000 63.56000  ?  417 VAL B N     1 
ATOM   7686 C  CA    . VAL B 2 417 ? 209.57200 61.89500 103.55600 1.000 63.72000  ?  417 VAL B CA    1 
ATOM   7687 C  C     . VAL B 2 417 ? 210.77300 61.00900 103.24600 1.000 69.71000  ?  417 VAL B C     1 
ATOM   7688 O  O     . VAL B 2 417 ? 211.46000 60.56900 104.15100 1.000 77.34000  ?  417 VAL B O     1 
ATOM   7689 C  CB    . VAL B 2 417 ? 210.04200 63.21800 104.17500 1.000 63.23000  ?  417 VAL B CB    1 
ATOM   7690 C  CG1   . VAL B 2 417 ? 211.28300 63.70800 103.49900 1.000 71.21000  ?  417 VAL B CG1   1 
ATOM   7691 C  CG2   . VAL B 2 417 ? 208.92000 64.26000 104.10000 1.000 61.89000  ?  417 VAL B CG2   1 
ATOM   7692 N  N     . ASN B 2 418 ? 211.03100 60.73100 101.97600 1.000 77.41000  ?  418 ASN B N     1 
ATOM   7693 C  CA    . ASN B 2 418 ? 212.29800 60.09000 101.60500 1.000 82.97000  ?  418 ASN B CA    1 
ATOM   7694 C  C     . ASN B 2 418 ? 213.41600 61.12500 101.57400 1.000 81.34000  ?  418 ASN B C     1 
ATOM   7695 O  O     . ASN B 2 418 ? 213.57800 61.83300 100.56900 1.000 81.42000  ?  418 ASN B O     1 
ATOM   7696 C  CB    . ASN B 2 418 ? 212.19300 59.40100 100.24100 1.000 84.16000  ?  418 ASN B CB    1 
ATOM   7697 C  CG    . ASN B 2 418 ? 210.81000 59.52200 99.63100  1.000 84.56000  ?  418 ASN B CG    1 
ATOM   7698 O  OD1   . ASN B 2 418 ? 209.80700 59.14600 100.24600 1.000 89.66000  ?  418 ASN B OD1   1 
ATOM   7699 N  ND2   . ASN B 2 418 ? 210.74600 60.06000 98.41900  1.000 87.18000  ?  418 ASN B ND2   1 
ATOM   7700 N  N     . THR B 2 419 ? 214.17800 61.22300 102.66500 1.000 80.68000  ?  419 THR B N     1 
ATOM   7701 C  CA    . THR B 2 419 ? 215.16700 62.30500 102.78300 1.000 86.73000  ?  419 THR B CA    1 
ATOM   7702 C  C     . THR B 2 419 ? 216.27000 62.18200 101.72900 1.000 85.62000  ?  419 THR B C     1 
ATOM   7703 O  O     . THR B 2 419 ? 216.73900 61.08000 101.43100 1.000 87.27000  ?  419 THR B O     1 
ATOM   7704 C  CB    . THR B 2 419 ? 215.82400 62.38200 104.21200 1.000 88.59000  ?  419 THR B CB    1 
ATOM   7705 O  OG1   . THR B 2 419 ? 216.61900 61.22100 104.48800 1.000 82.50000  ?  419 THR B OG1   1 
ATOM   7706 C  CG2   . THR B 2 419 ? 214.76500 62.55800 105.31100 1.000 83.61000  ?  419 THR B CG2   1 
ATOM   7707 N  N     . PRO B 2 420 ? 216.65500 63.31600 101.12700 1.000 88.58000  ?  420 PRO B N     1 
ATOM   7708 C  CA    . PRO B 2 420 ? 217.82800 63.28700 100.24800 1.000 90.69000  ?  420 PRO B CA    1 
ATOM   7709 C  C     . PRO B 2 420 ? 218.99300 62.72900 101.03500 1.000 88.01000  ?  420 PRO B C     1 
ATOM   7710 O  O     . PRO B 2 420 ? 219.27600 63.26900 102.10600 1.000 84.36000  ?  420 PRO B O     1 
ATOM   7711 C  CB    . PRO B 2 420 ? 218.05800 64.76200 99.89400  1.000 92.36000  ?  420 PRO B CB    1 
ATOM   7712 C  CG    . PRO B 2 420 ? 216.72600 65.42600 100.11300 1.000 92.82000  ?  420 PRO B CG    1 
ATOM   7713 C  CD    . PRO B 2 420 ? 216.06200 64.66100 101.23500 1.000 90.28000  ?  420 PRO B CD    1 
ATOM   7714 N  N     . PRO B 2 421 ? 219.63700 61.65700 100.53800 1.000 89.14000  ?  421 PRO B N     1 
ATOM   7715 C  CA    . PRO B 2 421 ? 220.77500 61.06500 101.26200 1.000 86.31000  ?  421 PRO B CA    1 
ATOM   7716 C  C     . PRO B 2 421 ? 221.94400 62.05400 101.37900 1.000 82.75000  ?  421 PRO B C     1 
ATOM   7717 O  O     . PRO B 2 421 ? 222.92600 61.75800 102.06600 1.000 81.93000  ?  421 PRO B O     1 
ATOM   7718 C  CB    . PRO B 2 421 ? 221.14500 59.84500 100.41200 1.000 77.57000  ?  421 PRO B CB    1 
ATOM   7719 C  CG    . PRO B 2 421 ? 220.64600 60.17900 99.04600  1.000 77.43000  ?  421 PRO B CG    1 
ATOM   7720 C  CD    . PRO B 2 421 ? 219.38800 60.99000 99.25000  1.000 82.99000  ?  421 PRO B CD    1 
ATOM   7721 N  N     . LEU B 2 422 ? 221.81500 63.21100 100.72300 1.000 80.06000  ?  422 LEU B N     1 
ATOM   7722 C  CA    . LEU B 2 422 ? 222.72600 64.33700 100.90600 1.000 75.80000  ?  422 LEU B CA    1 
ATOM   7723 C  C     . LEU B 2 422 ? 222.66400 64.90900 102.32400 1.000 77.58000  ?  422 LEU B C     1 
ATOM   7724 O  O     . LEU B 2 422 ? 223.68800 64.96200 103.01500 1.000 75.59000  ?  422 LEU B O     1 
ATOM   7725 C  CB    . LEU B 2 422 ? 222.42400 65.44000 99.89400  1.000 71.95000  ?  422 LEU B CB    1 
ATOM   7726 C  CG    . LEU B 2 422 ? 223.14900 65.28000 98.55500  1.000 67.38000  ?  422 LEU B CG    1 
ATOM   7727 C  CD1   . LEU B 2 422 ? 222.93800 66.51000 97.67900  1.000 60.03000  ?  422 LEU B CD1   1 
ATOM   7728 C  CD2   . LEU B 2 422 ? 224.63700 64.99500 98.75400  1.000 59.58000  ?  422 LEU B CD2   1 
ATOM   7729 N  N     . VAL B 2 423 ? 221.46900 65.32600 102.75400 1.000 80.38000  ?  423 VAL B N     1 
ATOM   7730 C  CA    . VAL B 2 423 ? 221.27200 65.92000 104.09000 1.000 79.72000  ?  423 VAL B CA    1 
ATOM   7731 C  C     . VAL B 2 423 ? 221.69900 64.98700 105.22500 1.000 75.77000  ?  423 VAL B C     1 
ATOM   7732 O  O     . VAL B 2 423 ? 222.10600 65.44500 106.30200 1.000 72.95000  ?  423 VAL B O     1 
ATOM   7733 C  CB    . VAL B 2 423 ? 219.80300 66.32100 104.33700 1.000 77.56000  ?  423 VAL B CB    1 
ATOM   7734 C  CG1   . VAL B 2 423 ? 219.66800 66.98600 105.70000 1.000 66.67000  ?  423 VAL B CG1   1 
ATOM   7735 C  CG2   . VAL B 2 423 ? 219.30100 67.23700 103.22800 1.000 78.64000  ?  423 VAL B CG2   1 
ATOM   7736 N  N     . LYS B 2 424 ? 221.59700 63.68200 104.98300 1.000 75.36000  ?  424 LYS B N     1 
ATOM   7737 C  CA    . LYS B 2 424 ? 222.11600 62.69200 105.92000 1.000 77.46000  ?  424 LYS B CA    1 
ATOM   7738 C  C     . LYS B 2 424 ? 223.59400 62.96100 106.21500 1.000 79.23000  ?  424 LYS B C     1 
ATOM   7739 O  O     . LYS B 2 424 ? 224.03300 62.82000 107.34900 1.000 80.80000  ?  424 LYS B O     1 
ATOM   7740 C  CB    . LYS B 2 424 ? 221.92500 61.27400 105.36600 1.000 81.39000  ?  424 LYS B CB    1 
ATOM   7741 C  CG    . LYS B 2 424 ? 222.66500 60.16600 106.13100 1.000 81.45000  ?  424 LYS B CG    1 
ATOM   7742 C  CD    . LYS B 2 424 ? 222.45200 58.80700 105.44400 1.000 81.30000  ?  424 LYS B CD    1 
ATOM   7743 C  CE    . LYS B 2 424 ? 223.39200 57.72000 105.97100 1.000 79.87000  ?  424 LYS B CE    1 
ATOM   7744 N  NZ    . LYS B 2 424 ? 223.18700 56.41800 105.24700 1.000 81.21000  ?  424 LYS B NZ    1 
ATOM   7745 N  N     . LEU B 2 425 ? 224.34400 63.37500 105.19500 1.000 77.89000  ?  425 LEU B N     1 
ATOM   7746 C  CA    . LEU B 2 425 ? 225.78800 63.57800 105.31400 1.000 77.34000  ?  425 LEU B CA    1 
ATOM   7747 C  C     . LEU B 2 425 ? 226.14600 64.90800 105.99600 1.000 75.97000  ?  425 LEU B C     1 
ATOM   7748 O  O     . LEU B 2 425 ? 227.14500 65.02000 106.72000 1.000 76.10000  ?  425 LEU B O     1 
ATOM   7749 C  CB    . LEU B 2 425 ? 226.42900 63.49800 103.92400 1.000 79.48000  ?  425 LEU B CB    1 
ATOM   7750 C  CG    . LEU B 2 425 ? 227.96100 63.54700 103.84700 1.000 87.53000  ?  425 LEU B CG    1 
ATOM   7751 C  CD1   . LEU B 2 425 ? 228.52700 62.45200 102.91900 1.000 79.09000  ?  425 LEU B CD1   1 
ATOM   7752 C  CD2   . LEU B 2 425 ? 228.44600 64.94000 103.41500 1.000 81.91000  ?  425 LEU B CD2   1 
ATOM   7753 N  N     . TRP B 2 426 ? 225.32000 65.91500 105.75400 1.000 71.81000  ?  426 TRP B N     1 
ATOM   7754 C  CA    . TRP B 2 426 ? 225.50200 67.23000 106.35000 1.000 70.55000  ?  426 TRP B CA    1 
ATOM   7755 C  C     . TRP B 2 426 ? 225.55100 67.21000 107.89200 1.000 71.02000  ?  426 TRP B C     1 
ATOM   7756 O  O     . TRP B 2 426 ? 226.37900 67.87700 108.50700 1.000 68.55000  ?  426 TRP B O     1 
ATOM   7757 C  CB    . TRP B 2 426 ? 224.36800 68.15700 105.90100 1.000 73.38000  ?  426 TRP B CB    1 
ATOM   7758 C  CG    . TRP B 2 426 ? 224.15600 68.31700 104.38800 1.000 74.70000  ?  426 TRP B CG    1 
ATOM   7759 C  CD1   . TRP B 2 426 ? 222.98400 68.67900 103.76100 1.000 74.75000  ?  426 TRP B CD1   1 
ATOM   7760 C  CD2   . TRP B 2 426 ? 225.13000 68.15000 103.33800 1.000 71.93000  ?  426 TRP B CD2   1 
ATOM   7761 N  NE1   . TRP B 2 426 ? 223.16900 68.74500 102.39700 1.000 74.89000  ?  426 TRP B NE1   1 
ATOM   7762 C  CE2   . TRP B 2 426 ? 224.47400 68.42800 102.10800 1.000 74.81000  ?  426 TRP B CE2   1 
ATOM   7763 C  CE3   . TRP B 2 426 ? 226.48300 67.78600 103.31400 1.000 65.04000  ?  426 TRP B CE3   1 
ATOM   7764 C  CZ2   . TRP B 2 426 ? 225.12900 68.35600 100.87100 1.000 66.23000  ?  426 TRP B CZ2   1 
ATOM   7765 C  CZ3   . TRP B 2 426 ? 227.12800 67.71500 102.08700 1.000 67.46000  ?  426 TRP B CZ3   1 
ATOM   7766 C  CH2   . TRP B 2 426 ? 226.45000 68.00200 100.88200 1.000 63.09000  ?  426 TRP B CH2   1 
ATOM   7767 N  N     . TYR B 2 427 ? 224.65400 66.45000 108.51300 1.000 68.80000  ?  427 TYR B N     1 
ATOM   7768 C  CA    . TYR B 2 427 ? 224.54500 66.44800 109.96700 1.000 69.80000  ?  427 TYR B CA    1 
ATOM   7769 C  C     . TYR B 2 427 ? 225.34800 65.36100 110.69300 1.000 75.28000  ?  427 TYR B C     1 
ATOM   7770 O  O     . TYR B 2 427 ? 225.43600 65.39000 111.92500 1.000 74.32000  ?  427 TYR B O     1 
ATOM   7771 C  CB    . TYR B 2 427 ? 223.06900 66.34700 110.36700 1.000 62.22000  ?  427 TYR B CB    1 
ATOM   7772 C  CG    . TYR B 2 427 ? 222.34700 67.65500 110.16600 1.000 60.17000  ?  427 TYR B CG    1 
ATOM   7773 C  CD1   . TYR B 2 427 ? 222.61500 68.73700 110.99300 1.000 59.22000  ?  427 TYR B CD1   1 
ATOM   7774 C  CD2   . TYR B 2 427 ? 221.41900 67.82500 109.13400 1.000 60.23000  ?  427 TYR B CD2   1 
ATOM   7775 C  CE1   . TYR B 2 427 ? 221.97700 69.95400 110.81800 1.000 58.71000  ?  427 TYR B CE1   1 
ATOM   7776 C  CE2   . TYR B 2 427 ? 220.77100 69.04300 108.94900 1.000 56.25000  ?  427 TYR B CE2   1 
ATOM   7777 C  CZ    . TYR B 2 427 ? 221.06100 70.10100 109.80100 1.000 60.82000  ?  427 TYR B CZ    1 
ATOM   7778 O  OH    . TYR B 2 427 ? 220.44100 71.31900 109.65400 1.000 67.56000  ?  427 TYR B OH    1 
ATOM   7779 N  N     . GLN B 2 428 ? 225.93900 64.42700 109.94600 1.000 75.29000  ?  428 GLN B N     1 
ATOM   7780 C  CA    . GLN B 2 428 ? 226.72000 63.32900 110.53500 1.000 81.13000  ?  428 GLN B CA    1 
ATOM   7781 C  C     . GLN B 2 428 ? 227.78600 63.82300 111.50300 1.000 88.53000  ?  428 GLN B C     1 
ATOM   7782 O  O     . GLN B 2 428 ? 228.30600 64.93100 111.35100 1.000 87.73000  ?  428 GLN B O     1 
ATOM   7783 C  CB    . GLN B 2 428 ? 227.38900 62.48500 109.44400 1.000 81.57000  ?  428 GLN B CB    1 
ATOM   7784 C  CG    . GLN B 2 428 ? 226.40000 61.78600 108.51500 1.000 84.15000  ?  428 GLN B CG    1 
ATOM   7785 C  CD    . GLN B 2 428 ? 226.72600 60.31700 108.27100 1.000 89.39000  ?  428 GLN B CD    1 
ATOM   7786 O  OE1   . GLN B 2 428 ? 227.84300 59.97700 107.87100 1.000 100.60000 ?  428 GLN B OE1   1 
ATOM   7787 N  NE2   . GLN B 2 428 ? 225.74600 59.43700 108.50900 1.000 84.80000  ?  428 GLN B NE2   1 
ATOM   7788 N  N     . LEU B 2 429 ? 228.10800 62.99600 112.49800 1.000 92.34000  ?  429 LEU B N     1 
ATOM   7789 C  CA    . LEU B 2 429 ? 229.11400 63.36200 113.49000 1.000 92.38000  ?  429 LEU B CA    1 
ATOM   7790 C  C     . LEU B 2 429 ? 230.41700 62.58500 113.27800 1.000 90.32000  ?  429 LEU B C     1 
ATOM   7791 O  O     . LEU B 2 429 ? 230.61300 61.94700 112.24300 1.000 85.25000  ?  429 LEU B O     1 
ATOM   7792 C  CB    . LEU B 2 429 ? 228.57600 63.13400 114.90800 1.000 88.31000  ?  429 LEU B CB    1 
ATOM   7793 C  CG    . LEU B 2 429 ? 229.30400 63.86800 116.04900 1.000 93.94000  ?  429 LEU B CG    1 
ATOM   7794 C  CD1   . LEU B 2 429 ? 228.53500 63.76400 117.36500 1.000 86.03000  ?  429 LEU B CD1   1 
ATOM   7795 C  CD2   . LEU B 2 429 ? 230.74700 63.37300 116.22600 1.000 95.09000  ?  429 LEU B CD2   1 
ATOM   7796 O  "O5'" . DG  C 3 4   ? 205.32800 81.36500 91.28200  1.000 77.82000  ?  805 DG  P "O5'" 1 
ATOM   7797 C  "C5'" . DG  C 3 4   ? 204.53500 81.64000 90.13300  1.000 73.59000  ?  805 DG  P "C5'" 1 
ATOM   7798 C  "C4'" . DG  C 3 4   ? 205.38800 82.20400 89.01500  1.000 74.46000  ?  805 DG  P "C4'" 1 
ATOM   7799 O  "O4'" . DG  C 3 4   ? 206.62000 82.70600 89.56500  1.000 72.94000  ?  805 DG  P "O4'" 1 
ATOM   7800 C  "C3'" . DG  C 3 4   ? 205.77000 81.20000 87.93800  1.000 78.00000  ?  805 DG  P "C3'" 1 
ATOM   7801 O  "O3'" . DG  C 3 4   ? 204.85800 81.32300 86.84900  1.000 86.58000  ?  805 DG  P "O3'" 1 
ATOM   7802 C  "C2'" . DG  C 3 4   ? 207.17900 81.60800 87.52300  1.000 68.38000  ?  805 DG  P "C2'" 1 
ATOM   7803 C  "C1'" . DG  C 3 4   ? 207.71300 82.34000 88.75200  1.000 71.56000  ?  805 DG  P "C1'" 1 
ATOM   7804 N  N9    . DG  C 3 4   ? 208.63500 81.55600 89.56200  1.000 72.91000  ?  805 DG  P N9    1 
ATOM   7805 C  C8    . DG  C 3 4   ? 208.67800 81.49500 90.93400  1.000 70.82000  ?  805 DG  P C8    1 
ATOM   7806 N  N7    . DG  C 3 4   ? 209.61900 80.71800 91.38900  1.000 70.04000  ?  805 DG  P N7    1 
ATOM   7807 C  C5    . DG  C 3 4   ? 210.24600 80.24300 90.24400  1.000 67.51000  ?  805 DG  P C5    1 
ATOM   7808 C  C6    . DG  C 3 4   ? 211.33900 79.36400 90.11400  1.000 68.87000  ?  805 DG  P C6    1 
ATOM   7809 O  O6    . DG  C 3 4   ? 211.98900 78.81300 91.02300  1.000 66.57000  ?  805 DG  P O6    1 
ATOM   7810 N  N1    . DG  C 3 4   ? 211.65600 79.13600 88.77200  1.000 64.48000  ?  805 DG  P N1    1 
ATOM   7811 C  C2    . DG  C 3 4   ? 210.99100 79.69600 87.70100  1.000 68.72000  ?  805 DG  P C2    1 
ATOM   7812 N  N2    . DG  C 3 4   ? 211.43300 79.36600 86.47800  1.000 71.37000  ?  805 DG  P N2    1 
ATOM   7813 N  N3    . DG  C 3 4   ? 209.96600 80.52400 87.81700  1.000 69.96000  ?  805 DG  P N3    1 
ATOM   7814 C  C4    . DG  C 3 4   ? 209.65000 80.74900 89.11300  1.000 68.88000  ?  805 DG  P C4    1 
ATOM   7815 P  P     . DT  C 3 5   ? 203.92300 80.08300 86.44100  1.000 92.34000  ?  806 DT  P P     1 
ATOM   7816 O  OP1   . DT  C 3 5   ? 202.83200 80.52700 85.53300  1.000 86.29000  ?  806 DT  P OP1   1 
ATOM   7817 O  OP2   . DT  C 3 5   ? 203.61000 79.40600 87.72600  1.000 75.00000  ?  806 DT  P OP2   1 
ATOM   7818 O  "O5'" . DT  C 3 5   ? 204.90100 79.17200 85.56900  1.000 84.85000  ?  806 DT  P "O5'" 1 
ATOM   7819 C  "C5'" . DT  C 3 5   ? 205.85300 79.78400 84.70100  1.000 82.18000  ?  806 DT  P "C5'" 1 
ATOM   7820 C  "C4'" . DT  C 3 5   ? 206.68300 78.72000 84.02500  1.000 80.83000  ?  806 DT  P "C4'" 1 
ATOM   7821 O  "O4'" . DT  C 3 5   ? 207.87400 78.45300 84.81600  1.000 77.66000  ?  806 DT  P "O4'" 1 
ATOM   7822 C  "C3'" . DT  C 3 5   ? 205.95200 77.39500 83.87700  1.000 81.72000  ?  806 DT  P "C3'" 1 
ATOM   7823 O  "O3'" . DT  C 3 5   ? 206.23400 76.81100 82.62900  1.000 88.94000  ?  806 DT  P "O3'" 1 
ATOM   7824 C  "C2'" . DT  C 3 5   ? 206.48300 76.55300 85.02800  1.000 76.98000  ?  806 DT  P "C2'" 1 
ATOM   7825 C  "C1'" . DT  C 3 5   ? 207.88500 77.11100 85.24300  1.000 77.15000  ?  806 DT  P "C1'" 1 
ATOM   7826 N  N1    . DT  C 3 5   ? 208.27400 77.05900 86.66700  1.000 74.70000  ?  806 DT  P N1    1 
ATOM   7827 C  C2    . DT  C 3 5   ? 209.47700 76.49500 87.00900  1.000 68.63000  ?  806 DT  P C2    1 
ATOM   7828 O  O2    . DT  C 3 5   ? 210.26800 76.08100 86.19400  1.000 67.61000  ?  806 DT  P O2    1 
ATOM   7829 N  N3    . DT  C 3 5   ? 209.72800 76.44700 88.34800  1.000 65.42000  ?  806 DT  P N3    1 
ATOM   7830 C  C4    . DT  C 3 5   ? 208.91500 76.88900 89.36100  1.000 64.90000  ?  806 DT  P C4    1 
ATOM   7831 O  O4    . DT  C 3 5   ? 209.24100 76.80800 90.54300  1.000 66.49000  ?  806 DT  P O4    1 
ATOM   7832 C  C5    . DT  C 3 5   ? 207.65400 77.46200 88.93800  1.000 70.60000  ?  806 DT  P C5    1 
ATOM   7833 C  C7    . DT  C 3 5   ? 206.68300 77.97900 89.95800  1.000 70.61000  ?  806 DT  P C7    1 
ATOM   7834 C  C6    . DT  C 3 5   ? 207.39100 77.50900 87.62500  1.000 69.33000  ?  806 DT  P C6    1 
ATOM   7835 P  P     . DC  C 3 6   ? 205.35300 75.57100 82.11800  1.000 90.30000  ?  807 DC  P P     1 
ATOM   7836 O  OP1   . DC  C 3 6   ? 205.00100 75.84100 80.70800  1.000 92.21000  ?  807 DC  P OP1   1 
ATOM   7837 O  OP2   . DC  C 3 6   ? 204.29600 75.26800 83.11700  1.000 76.37000  ?  807 DC  P OP2   1 
ATOM   7838 O  "O5'" . DC  C 3 6   ? 206.38300 74.36000 82.14500  1.000 80.86000  ?  807 DC  P "O5'" 1 
ATOM   7839 C  "C5'" . DC  C 3 6   ? 207.69000 74.53500 81.67100  1.000 72.47000  ?  807 DC  P "C5'" 1 
ATOM   7840 C  "C4'" . DC  C 3 6   ? 208.53800 73.38800 82.15300  1.000 75.45000  ?  807 DC  P "C4'" 1 
ATOM   7841 O  "O4'" . DC  C 3 6   ? 208.88900 73.59800 83.55400  1.000 74.48000  ?  807 DC  P "O4'" 1 
ATOM   7842 C  "C3'" . DC  C 3 6   ? 207.83500 72.02700 82.08900  1.000 70.98000  ?  807 DC  P "C3'" 1 
ATOM   7843 O  "O3'" . DC  C 3 6   ? 208.72900 71.05800 81.56600  1.000 66.62000  ?  807 DC  P "O3'" 1 
ATOM   7844 C  "C2'" . DC  C 3 6   ? 207.47200 71.74600 83.55000  1.000 67.11000  ?  807 DC  P "C2'" 1 
ATOM   7845 C  "C1'" . DC  C 3 6   ? 208.63200 72.41600 84.27100  1.000 68.06000  ?  807 DC  P "C1'" 1 
ATOM   7846 N  N1    . DC  C 3 6   ? 208.33900 72.76600 85.68400  1.000 72.35000  ?  807 DC  P N1    1 
ATOM   7847 C  C2    . DC  C 3 6   ? 209.26300 72.42800 86.67900  1.000 68.90000  ?  807 DC  P C2    1 
ATOM   7848 O  O2    . DC  C 3 6   ? 210.30900 71.85200 86.35400  1.000 67.31000  ?  807 DC  P O2    1 
ATOM   7849 N  N3    . DC  C 3 6   ? 208.98500 72.74600 87.97400  1.000 67.21000  ?  807 DC  P N3    1 
ATOM   7850 C  C4    . DC  C 3 6   ? 207.84300 73.36800 88.27800  1.000 66.46000  ?  807 DC  P C4    1 
ATOM   7851 N  N4    . DC  C 3 6   ? 207.61300 73.65300 89.55900  1.000 63.92000  ?  807 DC  P N4    1 
ATOM   7852 C  C5    . DC  C 3 6   ? 206.88700 73.71800 87.27500  1.000 67.19000  ?  807 DC  P C5    1 
ATOM   7853 C  C6    . DC  C 3 6   ? 207.17000 73.39800 86.00600  1.000 71.55000  ?  807 DC  P C6    1 
ATOM   7854 P  P     . DC  C 3 7   ? 208.21100 69.58900 81.16800  1.000 75.29000  ?  808 DC  P P     1 
ATOM   7855 O  OP1   . DC  C 3 7   ? 208.76800 69.34200 79.81400  1.000 65.29000  ?  808 DC  P OP1   1 
ATOM   7856 O  OP2   . DC  C 3 7   ? 206.77500 69.41600 81.51800  1.000 62.81000  ?  808 DC  P OP2   1 
ATOM   7857 O  "O5'" . DC  C 3 7   ? 208.95400 68.63800 82.20800  1.000 66.49000  ?  808 DC  P "O5'" 1 
ATOM   7858 C  "C5'" . DC  C 3 7   ? 210.28800 68.86200 82.51000  1.000 56.54000  ?  808 DC  P "C5'" 1 
ATOM   7859 C  "C4'" . DC  C 3 7   ? 210.69500 67.99800 83.67000  1.000 64.42000  ?  808 DC  P "C4'" 1 
ATOM   7860 O  "O4'" . DC  C 3 7   ? 210.33300 68.64400 84.90900  1.000 64.47000  ?  808 DC  P "O4'" 1 
ATOM   7861 C  "C3'" . DC  C 3 7   ? 210.06900 66.60000 83.70500  1.000 63.55000  ?  808 DC  P "C3'" 1 
ATOM   7862 O  "O3'" . DC  C 3 7   ? 211.11600 65.64400 83.88900  1.000 61.45000  ?  808 DC  P "O3'" 1 
ATOM   7863 C  "C2'" . DC  C 3 7   ? 209.11100 66.65700 84.91100  1.000 53.50000  ?  808 DC  P "C2'" 1 
ATOM   7864 C  "C1'" . DC  C 3 7   ? 209.76800 67.70900 85.79100  1.000 57.69000  ?  808 DC  P "C1'" 1 
ATOM   7865 N  N1    . DC  C 3 7   ? 208.82300 68.46300 86.66600  1.000 63.58000  ?  808 DC  P N1    1 
ATOM   7866 C  C2    . DC  C 3 7   ? 209.11400 68.63400 88.01700  1.000 63.12000  ?  808 DC  P C2    1 
ATOM   7867 O  O2    . DC  C 3 7   ? 210.13500 68.11900 88.47900  1.000 65.67000  ?  808 DC  P O2    1 
ATOM   7868 N  N3    . DC  C 3 7   ? 208.25500 69.34400 88.78800  1.000 63.05000  ?  808 DC  P N3    1 
ATOM   7869 C  C4    . DC  C 3 7   ? 207.16700 69.88100 88.24700  1.000 60.23000  ?  808 DC  P C4    1 
ATOM   7870 N  N4    . DC  C 3 7   ? 206.35200 70.57700 89.03800  1.000 62.99000  ?  808 DC  P N4    1 
ATOM   7871 C  C5    . DC  C 3 7   ? 206.86900 69.73600 86.87400  1.000 60.67000  ?  808 DC  P C5    1 
ATOM   7872 C  C6    . DC  C 3 7   ? 207.71500 69.03300 86.12600  1.000 63.45000  ?  808 DC  P C6    1 
ATOM   7873 P  P     . DC  C 3 8   ? 210.88400 64.08400 83.63400  1.000 57.78000  ?  809 DC  P P     1 
ATOM   7874 O  OP1   . DC  C 3 8   ? 212.17800 63.55400 83.18200  1.000 64.31000  ?  809 DC  P OP1   1 
ATOM   7875 O  OP2   . DC  C 3 8   ? 209.67600 63.85700 82.80800  1.000 60.50000  ?  809 DC  P OP2   1 
ATOM   7876 O  "O5'" . DC  C 3 8   ? 210.66700 63.51100 85.09500  1.000 55.06000  ?  809 DC  P "O5'" 1 
ATOM   7877 C  "C5'" . DC  C 3 8   ? 211.65400 63.71900 86.05500  1.000 54.56000  ?  809 DC  P "C5'" 1 
ATOM   7878 C  "C4'" . DC  C 3 8   ? 211.15900 63.34000 87.43100  1.000 54.74000  ?  809 DC  P "C4'" 1 
ATOM   7879 O  "O4'" . DC  C 3 8   ? 210.26400 64.36000 87.92600  1.000 61.92000  ?  809 DC  P "O4'" 1 
ATOM   7880 C  "C3'" . DC  C 3 8   ? 210.39200 62.01600 87.52900  1.000 57.34000  ?  809 DC  P "C3'" 1 
ATOM   7881 O  "O3'" . DC  C 3 8   ? 211.01900 61.22800 88.51800  1.000 60.73000  ?  809 DC  P "O3'" 1 
ATOM   7882 C  "C2'" . DC  C 3 8   ? 208.97000 62.44300 87.96300  1.000 57.21000  ?  809 DC  P "C2'" 1 
ATOM   7883 C  "C1'" . DC  C 3 8   ? 209.25400 63.75100 88.68000  1.000 58.43000  ?  809 DC  P "C1'" 1 
ATOM   7884 N  N1    . DC  C 3 8   ? 208.11400 64.70000 88.73900  1.000 61.47000  ?  809 DC  P N1    1 
ATOM   7885 C  C2    . DC  C 3 8   ? 207.82900 65.34700 89.93500  1.000 57.93000  ?  809 DC  P C2    1 
ATOM   7886 O  O2    . DC  C 3 8   ? 208.51000 65.09500 90.91800  1.000 58.06000  ?  809 DC  P O2    1 
ATOM   7887 N  N3    . DC  C 3 8   ? 206.80300 66.22600 89.98300  1.000 60.66000  ?  809 DC  P N3    1 
ATOM   7888 C  C4    . DC  C 3 8   ? 206.09600 66.48500 88.88400  1.000 59.95000  ?  809 DC  P C4    1 
ATOM   7889 N  N4    . DC  C 3 8   ? 205.10200 67.36500 88.97900  1.000 60.23000  ?  809 DC  P N4    1 
ATOM   7890 C  C5    . DC  C 3 8   ? 206.37400 65.84800 87.64500  1.000 56.74000  ?  809 DC  P C5    1 
ATOM   7891 C  C6    . DC  C 3 8   ? 207.38800 64.97100 87.61400  1.000 62.09000  ?  809 DC  P C6    1 
ATOM   7892 P  P     . DT  C 3 9   ? 210.77800 59.65100 88.61500  1.000 57.32000  ?  810 DT  P P     1 
ATOM   7893 O  OP1   . DT  C 3 9   ? 212.07900 59.00100 88.81200  1.000 56.14000  ?  810 DT  P OP1   1 
ATOM   7894 O  OP2   . DT  C 3 9   ? 209.89800 59.23500 87.50100  1.000 60.45000  ?  810 DT  P OP2   1 
ATOM   7895 O  "O5'" . DT  C 3 9   ? 210.03400 59.49300 90.01500  1.000 61.21000  ?  810 DT  P "O5'" 1 
ATOM   7896 C  "C5'" . DT  C 3 9   ? 210.63300 60.04000 91.16900  1.000 60.80000  ?  810 DT  P "C5'" 1 
ATOM   7897 C  "C4'" . DT  C 3 9   ? 209.59000 60.34100 92.21100  1.000 60.76000  ?  810 DT  P "C4'" 1 
ATOM   7898 O  "O4'" . DT  C 3 9   ? 208.77800 61.45500 91.78900  1.000 61.98000  ?  810 DT  P "O4'" 1 
ATOM   7899 C  "C3'" . DT  C 3 9   ? 208.62700 59.19400 92.47800  1.000 59.42000  ?  810 DT  P "C3'" 1 
ATOM   7900 O  "O3'" . DT  C 3 9   ? 208.83900 58.72100 93.75900  1.000 61.94000  ?  810 DT  P "O3'" 1 
ATOM   7901 C  "C2'" . DT  C 3 9   ? 207.23400 59.81400 92.34700  1.000 63.34000  ?  810 DT  P "C2'" 1 
ATOM   7902 C  "C1'" . DT  C 3 9   ? 207.51500 61.30900 92.36800  1.000 62.28000  ?  810 DT  P "C1'" 1 
ATOM   7903 N  N1    . DT  C 3 9   ? 206.52500 62.10600 91.58600  1.000 60.28000  ?  810 DT  P N1    1 
ATOM   7904 C  C2    . DT  C 3 9   ? 205.83600 63.11200 92.21600  1.000 61.67000  ?  810 DT  P C2    1 
ATOM   7905 O  O2    . DT  C 3 9   ? 206.00700 63.40100 93.38700  1.000 63.29000  ?  810 DT  P O2    1 
ATOM   7906 N  N3    . DT  C 3 9   ? 204.94600 63.78200 91.41900  1.000 62.92000  ?  810 DT  P N3    1 
ATOM   7907 C  C4    . DT  C 3 9   ? 204.67400 63.54100 90.07900  1.000 65.05000  ?  810 DT  P C4    1 
ATOM   7908 O  O4    . DT  C 3 9   ? 203.84300 64.19600 89.43600  1.000 65.95000  ?  810 DT  P O4    1 
ATOM   7909 C  C5    . DT  C 3 9   ? 205.42600 62.46300 89.48600  1.000 60.09000  ?  810 DT  P C5    1 
ATOM   7910 C  C7    . DT  C 3 9   ? 205.21500 62.11400 88.04900  1.000 53.72000  ?  810 DT  P C7    1 
ATOM   7911 C  C6    . DT  C 3 9   ? 206.30500 61.80600 90.25700  1.000 60.24000  ?  810 DT  P C6    1 
ATOM   7912 P  P     . DG  C 3 10  ? 208.15600 57.35400 94.22400  1.000 67.76000  ?  811 DG  P P     1 
ATOM   7913 O  OP1   . DG  C 3 10  ? 209.22200 56.56800 94.89800  1.000 67.60000  ?  811 DG  P OP1   1 
ATOM   7914 O  OP2   . DG  C 3 10  ? 207.42300 56.82000 93.05200  1.000 60.82000  ?  811 DG  P OP2   1 
ATOM   7915 O  "O5'" . DG  C 3 10  ? 207.09400 57.82500 95.32400  1.000 68.00000  ?  811 DG  P "O5'" 1 
ATOM   7916 C  "C5'" . DG  C 3 10  ? 207.48100 58.77800 96.29600  1.000 66.16000  ?  811 DG  P "C5'" 1 
ATOM   7917 C  "C4'" . DG  C 3 10  ? 206.26800 59.38300 96.93100  1.000 63.65000  ?  811 DG  P "C4'" 1 
ATOM   7918 O  "O4'" . DG  C 3 10  ? 205.71500 60.35200 96.01800  1.000 64.41000  ?  811 DG  P "O4'" 1 
ATOM   7919 C  "C3'" . DG  C 3 10  ? 205.14900 58.37100 97.21300  1.000 68.17000  ?  811 DG  P "C3'" 1 
ATOM   7920 O  "O3'" . DG  C 3 10  ? 204.57900 58.57400 98.49400  1.000 72.01000  ?  811 DG  P "O3'" 1 
ATOM   7921 C  "C2'" . DG  C 3 10  ? 204.13800 58.66700 96.13500  1.000 71.17000  ?  811 DG  P "C2'" 1 
ATOM   7922 C  "C1'" . DG  C 3 10  ? 204.33200 60.15000 95.93900  1.000 66.83000  ?  811 DG  P "C1'" 1 
ATOM   7923 N  N9    . DG  C 3 10  ? 203.86100 60.56600 94.63800  1.000 68.71000  ?  811 DG  P N9    1 
ATOM   7924 C  C8    . DG  C 3 10  ? 204.21200 60.03100 93.42800  1.000 61.69000  ?  811 DG  P C8    1 
ATOM   7925 N  N7    . DG  C 3 10  ? 203.59300 60.57800 92.42900  1.000 59.54000  ?  811 DG  P N7    1 
ATOM   7926 C  C5    . DG  C 3 10  ? 202.75900 61.51000 93.01800  1.000 62.78000  ?  811 DG  P C5    1 
ATOM   7927 C  C6    . DG  C 3 10  ? 201.83900 62.40100 92.43200  1.000 69.39000  ?  811 DG  P C6    1 
ATOM   7928 O  O6    . DG  C 3 10  ? 201.57900 62.55200 91.22600  1.000 72.24000  ?  811 DG  P O6    1 
ATOM   7929 N  N1    . DG  C 3 10  ? 201.19200 63.17700 93.39200  1.000 69.13000  ?  811 DG  P N1    1 
ATOM   7930 C  C2    . DG  C 3 10  ? 201.41300 63.09400 94.74500  1.000 68.12000  ?  811 DG  P C2    1 
ATOM   7931 N  N2    . DG  C 3 10  ? 200.69700 63.91900 95.52200  1.000 67.35000  ?  811 DG  P N2    1 
ATOM   7932 N  N3    . DG  C 3 10  ? 202.27900 62.26600 95.29800  1.000 68.13000  ?  811 DG  P N3    1 
ATOM   7933 C  C4    . DG  C 3 10  ? 202.91000 61.50900 94.37700  1.000 64.60000  ?  811 DG  P C4    1 
ATOM   7934 P  P     . DT  C 3 11  ? 203.67000 57.42300 99.16600  1.000 77.19000  ?  812 DT  P P     1 
ATOM   7935 O  OP1   . DT  C 3 11  ? 204.22200 57.22100 100.52700 1.000 77.65000  ?  812 DT  P OP1   1 
ATOM   7936 O  OP2   . DT  C 3 11  ? 203.51600 56.27300 98.24800  1.000 74.45000  ?  812 DT  P OP2   1 
ATOM   7937 O  "O5'" . DT  C 3 11  ? 202.23900 58.10900 99.29800  1.000 74.32000  ?  812 DT  P "O5'" 1 
ATOM   7938 C  "C5'" . DT  C 3 11  ? 202.09800 59.23400 100.13200 1.000 72.63000  ?  812 DT  P "C5'" 1 
ATOM   7939 C  "C4'" . DT  C 3 11  ? 200.80200 59.93000 99.83600  1.000 75.11000  ?  812 DT  P "C4'" 1 
ATOM   7940 O  "O4'" . DT  C 3 11  ? 200.79900 60.33300 98.45900  1.000 66.71000  ?  812 DT  P "O4'" 1 
ATOM   7941 C  "C3'" . DT  C 3 11  ? 199.58000 59.04600 100.02400 1.000 77.04000  ?  812 DT  P "C3'" 1 
ATOM   7942 O  "O3'" . DT  C 3 11  ? 198.84600 59.46600 101.16500 1.000 76.24000  ?  812 DT  P "O3'" 1 
ATOM   7943 C  "C2'" . DT  C 3 11  ? 198.76400 59.21000 98.73500  1.000 74.70000  ?  812 DT  P "C2'" 1 
ATOM   7944 C  "C1'" . DT  C 3 11  ? 199.49000 60.31000 97.97800  1.000 69.14000  ?  812 DT  P "C1'" 1 
ATOM   7945 N  N1    . DT  C 3 11  ? 199.56400 60.04000 96.55800  1.000 69.62000  ?  812 DT  P N1    1 
ATOM   7946 C  C2    . DT  C 3 11  ? 198.77600 60.75500 95.69400  1.000 71.55000  ?  812 DT  P C2    1 
ATOM   7947 O  O2    . DT  C 3 11  ? 197.99400 61.62300 96.05900  1.000 72.96000  ?  812 DT  P O2    1 
ATOM   7948 N  N3    . DT  C 3 11  ? 198.93500 60.42300 94.37700  1.000 68.57000  ?  812 DT  P N3    1 
ATOM   7949 C  C4    . DT  C 3 11  ? 199.77800 59.47100 93.85700  1.000 65.75000  ?  812 DT  P C4    1 
ATOM   7950 O  O4    . DT  C 3 11  ? 199.84300 59.25100 92.65700  1.000 66.45000  ?  812 DT  P O4    1 
ATOM   7951 C  C5    . DT  C 3 11  ? 200.58300 58.76000 94.82800  1.000 67.26000  ?  812 DT  P C5    1 
ATOM   7952 C  C7    . DT  C 3 11  ? 201.55200 57.70100 94.39400  1.000 59.33000  ?  812 DT  P C7    1 
ATOM   7953 C  C6    . DT  C 3 11  ? 200.43200 59.07600 96.11300  1.000 69.70000  ?  812 DT  P C6    1 
ATOM   7954 P  P     . DT  C 3 12  ? 197.55200 58.63600 101.63100 1.000 81.45000  ?  813 DT  P P     1 
ATOM   7955 O  OP1   . DT  C 3 12  ? 197.33200 59.02700 103.04400 1.000 85.97000  ?  813 DT  P OP1   1 
ATOM   7956 O  OP2   . DT  C 3 12  ? 197.68500 57.20400 101.24600 1.000 74.04000  ?  813 DT  P OP2   1 
ATOM   7957 O  "O5'" . DT  C 3 12  ? 196.39400 59.23800 100.73200 1.000 72.35000  ?  813 DT  P "O5'" 1 
ATOM   7958 C  "C5'" . DT  C 3 12  ? 196.39600 60.61900 100.44900 1.000 75.70000  ?  813 DT  P "C5'" 1 
ATOM   7959 C  "C4'" . DT  C 3 12  ? 195.12700 60.99600 99.73100  1.000 78.23000  ?  813 DT  P "C4'" 1 
ATOM   7960 O  "O4'" . DT  C 3 12  ? 195.33000 60.88500 98.30100  1.000 73.94000  ?  813 DT  P "O4'" 1 
ATOM   7961 C  "C3'" . DT  C 3 12  ? 193.94300 60.09900 100.04500 1.000 78.42000  ?  813 DT  P "C3'" 1 
ATOM   7962 O  "O3'" . DT  C 3 12  ? 192.75200 60.86000 99.93200  1.000 88.21000  ?  813 DT  P "O3'" 1 
ATOM   7963 C  "C2'" . DT  C 3 12  ? 194.05000 59.04000 98.95300  1.000 72.92000  ?  813 DT  P "C2'" 1 
ATOM   7964 C  "C1'" . DT  C 3 12  ? 194.46700 59.90500 97.77600  1.000 73.87000  ?  813 DT  P "C1'" 1 
ATOM   7965 N  N1    . DT  C 3 12  ? 195.19100 59.18200 96.70800  1.000 75.47000  ?  813 DT  P N1    1 
ATOM   7966 C  C2    . DT  C 3 12  ? 195.01300 59.58400 95.40300  1.000 73.35000  ?  813 DT  P C2    1 
ATOM   7967 O  O2    . DT  C 3 12  ? 194.27400 60.50300 95.07900  1.000 71.50000  ?  813 DT  P O2    1 
ATOM   7968 N  N3    . DT  C 3 12  ? 195.73000 58.86700 94.48000  1.000 73.31000  ?  813 DT  P N3    1 
ATOM   7969 C  C4    . DT  C 3 12  ? 196.58800 57.81100 94.72200  1.000 72.55000  ?  813 DT  P C4    1 
ATOM   7970 O  O4    . DT  C 3 12  ? 197.18000 57.23100 93.81500  1.000 72.13000  ?  813 DT  P O4    1 
ATOM   7971 C  C5    . DT  C 3 12  ? 196.73400 57.43800 96.11600  1.000 71.26000  ?  813 DT  P C5    1 
ATOM   7972 C  C7    . DT  C 3 12  ? 197.63500 56.29900 96.50200  1.000 67.23000  ?  813 DT  P C7    1 
ATOM   7973 C  C6    . DT  C 3 12  ? 196.03800 58.13700 97.03400  1.000 72.40000  ?  813 DT  P C6    1 
ATOM   7974 P  P     . DC  C 3 13  ? 191.36600 60.32500 100.54700 1.000 92.70000  ?  814 DC  P P     1 
ATOM   7975 O  OP1   . DC  C 3 13  ? 191.19000 61.02500 101.83900 1.000 89.28000  ?  814 DC  P OP1   1 
ATOM   7976 O  OP2   . DC  C 3 13  ? 191.33800 58.83600 100.46400 1.000 76.19000  ?  814 DC  P OP2   1 
ATOM   7977 O  "O5'" . DC  C 3 13  ? 190.28300 60.91300 99.53900  1.000 78.85000  ?  814 DC  P "O5'" 1 
ATOM   7978 C  "C5'" . DC  C 3 13  ? 190.71800 61.58600 98.37100  1.000 82.24000  ?  814 DC  P "C5'" 1 
ATOM   7979 C  "C4'" . DC  C 3 13  ? 190.12400 60.94400 97.13200  1.000 82.13000  ?  814 DC  P "C4'" 1 
ATOM   7980 O  "O4'" . DC  C 3 13  ? 191.13500 60.19300 96.40400  1.000 79.99000  ?  814 DC  P "O4'" 1 
ATOM   7981 C  "C3'" . DC  C 3 13  ? 188.97700 59.96400 97.39500  1.000 83.58000  ?  814 DC  P "C3'" 1 
ATOM   7982 O  "O3'" . DC  C 3 13  ? 187.91500 60.27700 96.53700  1.000 90.31000  ?  814 DC  P "O3'" 1 
ATOM   7983 C  "C2'" . DC  C 3 13  ? 189.58400 58.60800 97.03900  1.000 80.50000  ?  814 DC  P "C2'" 1 
ATOM   7984 C  "C1'" . DC  C 3 13  ? 190.54200 59.01300 95.93600  1.000 79.86000  ?  814 DC  P "C1'" 1 
ATOM   7985 N  N1    . DC  C 3 13  ? 191.59500 58.00100 95.64800  1.000 76.61000  ?  814 DC  P N1    1 
ATOM   7986 C  C2    . DC  C 3 13  ? 191.97800 57.77400 94.32800  1.000 75.60000  ?  814 DC  P C2    1 
ATOM   7987 O  O2    . DC  C 3 13  ? 191.45000 58.44100 93.43100  1.000 77.02000  ?  814 DC  P O2    1 
ATOM   7988 N  N3    . DC  C 3 13  ? 192.91800 56.83400 94.06800  1.000 72.11000  ?  814 DC  P N3    1 
ATOM   7989 C  C4    . DC  C 3 13  ? 193.45700 56.13900 95.06900  1.000 72.34000  ?  814 DC  P C4    1 
ATOM   7990 N  N4    . DC  C 3 13  ? 194.39100 55.22300 94.76900  1.000 72.25000  ?  814 DC  P N4    1 
ATOM   7991 C  C5    . DC  C 3 13  ? 193.06900 56.35200 96.42200  1.000 72.77000  ?  814 DC  P C5    1 
ATOM   7992 C  C6    . DC  C 3 13  ? 192.14200 57.27900 96.66300  1.000 74.80000  ?  814 DC  P C6    1 
ATOM   7993 P  P     . DG  C 3 14  ? 186.40300 59.96000 96.95700  1.000 94.96000  ?  815 DG  P P     1 
ATOM   7994 O  OP1   . DG  C 3 14  ? 185.83300 61.23100 97.46300  1.000 87.50000  ?  815 DG  P OP1   1 
ATOM   7995 O  OP2   . DG  C 3 14  ? 186.39900 58.73700 97.79500  1.000 89.81000  ?  815 DG  P OP2   1 
ATOM   7996 O  "O5'" . DG  C 3 14  ? 185.72100 59.58300 95.56700  1.000 85.35000  ?  815 DG  P "O5'" 1 
ATOM   7997 C  "C5'" . DG  C 3 14  ? 186.04200 60.32900 94.40500  1.000 86.95000  ?  815 DG  P "C5'" 1 
ATOM   7998 C  "C4'" . DG  C 3 14  ? 186.07100 59.42800 93.19100  1.000 85.27000  ?  815 DG  P "C4'" 1 
ATOM   7999 O  "O4'" . DG  C 3 14  ? 187.31900 58.69100 93.16800  1.000 90.15000  ?  815 DG  P "O4'" 1 
ATOM   8000 C  "C3'" . DG  C 3 14  ? 184.95700 58.37800 93.15100  1.000 85.99000  ?  815 DG  P "C3'" 1 
ATOM   8001 O  "O3'" . DG  C 3 14  ? 184.30600 58.41100 91.88800  1.000 95.18000  ?  815 DG  P "O3'" 1 
ATOM   8002 C  "C2'" . DG  C 3 14  ? 185.69400 57.05400 93.36800  1.000 83.89000  ?  815 DG  P "C2'" 1 
ATOM   8003 C  "C1'" . DG  C 3 14  ? 187.05400 57.36900 92.77800  1.000 84.67000  ?  815 DG  P "C1'" 1 
ATOM   8004 N  N9    . DG  C 3 14  ? 188.12700 56.50000 93.26400  1.000 77.19000  ?  815 DG  P N9    1 
ATOM   8005 C  C8    . DG  C 3 14  ? 188.43000 56.19700 94.57100  1.000 78.05000  ?  815 DG  P C8    1 
ATOM   8006 N  N7    . DG  C 3 14  ? 189.44300 55.38200 94.69300  1.000 75.44000  ?  815 DG  P N7    1 
ATOM   8007 C  C5    . DG  C 3 14  ? 189.84000 55.14000 93.38000  1.000 75.92000  ?  815 DG  P C5    1 
ATOM   8008 C  C6    . DG  C 3 14  ? 190.89400 54.33900 92.87000  1.000 72.42000  ?  815 DG  P C6    1 
ATOM   8009 O  O6    . DG  C 3 14  ? 191.71400 53.65700 93.49300  1.000 71.07000  ?  815 DG  P O6    1 
ATOM   8010 N  N1    . DG  C 3 14  ? 190.94000 54.37500 91.48500  1.000 72.43000  ?  815 DG  P N1    1 
ATOM   8011 C  C2    . DG  C 3 14  ? 190.08900 55.09600 90.69000  1.000 72.49000  ?  815 DG  P C2    1 
ATOM   8012 N  N2    . DG  C 3 14  ? 190.29000 55.00400 89.37200  1.000 74.76000  ?  815 DG  P N2    1 
ATOM   8013 N  N3    . DG  C 3 14  ? 189.10500 55.84600 91.14900  1.000 73.67000  ?  815 DG  P N3    1 
ATOM   8014 C  C4    . DG  C 3 14  ? 189.03800 55.82100 92.49600  1.000 74.55000  ?  815 DG  P C4    1 
ATOM   8015 P  P     . DG  C 3 15  ? 182.87400 57.70000 91.69200  1.000 102.88000 ?  816 DG  P P     1 
ATOM   8016 O  OP1   . DG  C 3 15  ? 181.98600 58.65900 90.99300  1.000 98.93000  ?  816 DG  P OP1   1 
ATOM   8017 O  OP2   . DG  C 3 15  ? 182.47100 57.12800 93.00200  1.000 92.56000  ?  816 DG  P OP2   1 
ATOM   8018 O  "O5'" . DG  C 3 15  ? 183.18600 56.47200 90.71700  1.000 85.07000  ?  816 DG  P "O5'" 1 
ATOM   8019 C  "C5'" . DG  C 3 15  ? 183.54600 56.70600 89.37400  1.000 80.42000  ?  816 DG  P "C5'" 1 
ATOM   8020 C  "C4'" . DG  C 3 15  ? 184.25200 55.49300 88.82300  1.000 80.40000  ?  816 DG  P "C4'" 1 
ATOM   8021 O  "O4'" . DG  C 3 15  ? 185.49600 55.33800 89.51700  1.000 80.05000  ?  816 DG  P "O4'" 1 
ATOM   8022 C  "C3'" . DG  C 3 15  ? 183.53200 54.17600 89.05800  1.000 77.63000  ?  816 DG  P "C3'" 1 
ATOM   8023 O  "O3'" . DG  C 3 15  ? 182.62200 53.92500 87.99900  1.000 81.45000  ?  816 DG  P "O3'" 1 
ATOM   8024 C  "C2'" . DG  C 3 15  ? 184.67400 53.15900 89.04300  1.000 78.73000  ?  816 DG  P "C2'" 1 
ATOM   8025 C  "C1'" . DG  C 3 15  ? 185.90500 53.99000 89.43800  1.000 79.06000  ?  816 DG  P "C1'" 1 
ATOM   8026 N  N9    . DG  C 3 15  ? 186.48500 53.60500 90.72700  1.000 79.31000  ?  816 DG  P N9    1 
ATOM   8027 C  C8    . DG  C 3 15  ? 186.09300 54.04100 91.97500  1.000 81.13000  ?  816 DG  P C8    1 
ATOM   8028 N  N7    . DG  C 3 15  ? 186.79500 53.53100 92.94800  1.000 76.02000  ?  816 DG  P N7    1 
ATOM   8029 C  C5    . DG  C 3 15  ? 187.71200 52.70100 92.30600  1.000 73.00000  ?  816 DG  P C5    1 
ATOM   8030 C  C6    . DG  C 3 15  ? 188.73200 51.87900 92.85000  1.000 71.62000  ?  816 DG  P C6    1 
ATOM   8031 O  O6    . DG  C 3 15  ? 189.03900 51.71800 94.05300  1.000 67.97000  ?  816 DG  P O6    1 
ATOM   8032 N  N1    . DG  C 3 15  ? 189.43300 51.21000 91.84500  1.000 66.49000  ?  816 DG  P N1    1 
ATOM   8033 C  C2    . DG  C 3 15  ? 189.17400 51.31900 90.49500  1.000 68.22000  ?  816 DG  P C2    1 
ATOM   8034 N  N2    . DG  C 3 15  ? 189.95000 50.59500 89.68200  1.000 68.59000  ?  816 DG  P N2    1 
ATOM   8035 N  N3    . DG  C 3 15  ? 188.22200 52.07500 89.98000  1.000 70.88000  ?  816 DG  P N3    1 
ATOM   8036 C  C4    . DG  C 3 15  ? 187.53300 52.73600 90.94000  1.000 72.12000  ?  816 DG  P C4    1 
ATOM   8037 P  P     . DG  C 3 16  ? 181.57300 52.71400 88.11500  1.000 91.24000  ?  817 DG  P P     1 
ATOM   8038 O  OP1   . DG  C 3 16  ? 180.24600 53.22000 87.68400  1.000 85.30000  ?  817 DG  P OP1   1 
ATOM   8039 O  OP2   . DG  C 3 16  ? 181.74000 52.14500 89.47400  1.000 86.01000  ?  817 DG  P OP2   1 
ATOM   8040 O  "O5'" . DG  C 3 16  ? 182.10700 51.63200 87.06600  1.000 71.40000  ?  817 DG  P "O5'" 1 
ATOM   8041 C  "C5'" . DG  C 3 16  ? 182.14700 50.26100 87.42500  1.000 69.48000  ?  817 DG  P "C5'" 1 
ATOM   8042 C  "C4'" . DG  C 3 16  ? 183.36200 49.57800 86.83200  1.000 66.99000  ?  817 DG  P "C4'" 1 
ATOM   8043 O  "O4'" . DG  C 3 16  ? 184.56800 50.27700 87.23500  1.000 73.57000  ?  817 DG  P "O4'" 1 
ATOM   8044 C  "C3'" . DG  C 3 16  ? 183.56600 48.16700 87.31100  1.000 67.33000  ?  817 DG  P "C3'" 1 
ATOM   8045 O  "O3'" . DG  C 3 16  ? 182.81700 47.30200 86.52600  1.000 67.81000  ?  817 DG  P "O3'" 1 
ATOM   8046 C  "C2'" . DG  C 3 16  ? 185.07000 47.96900 87.14200  1.000 67.06000  ?  817 DG  P "C2'" 1 
ATOM   8047 C  "C1'" . DG  C 3 16  ? 185.58300 49.33700 87.58500  1.000 68.58000  ?  817 DG  P "C1'" 1 
ATOM   8048 N  N9    . DG  C 3 16  ? 185.82000 49.44200 89.02800  1.000 68.03000  ?  817 DG  P N9    1 
ATOM   8049 C  C8    . DG  C 3 16  ? 185.13800 50.23800 89.91800  1.000 65.98000  ?  817 DG  P C8    1 
ATOM   8050 N  N7    . DG  C 3 16  ? 185.55700 50.13300 91.13800  1.000 60.79000  ?  817 DG  P N7    1 
ATOM   8051 C  C5    . DG  C 3 16  ? 186.58900 49.21500 91.05900  1.000 64.50000  ?  817 DG  P C5    1 
ATOM   8052 C  C6    . DG  C 3 16  ? 187.42100 48.70500 92.07200  1.000 61.18000  ?  817 DG  P C6    1 
ATOM   8053 O  O6    . DG  C 3 16  ? 187.40000 48.97300 93.26800  1.000 57.23000  ?  817 DG  P O6    1 
ATOM   8054 N  N1    . DG  C 3 16  ? 188.34600 47.78700 91.57200  1.000 61.78000  ?  817 DG  P N1    1 
ATOM   8055 C  C2    . DG  C 3 16  ? 188.44500 47.41100 90.25600  1.000 60.75000  ?  817 DG  P C2    1 
ATOM   8056 N  N2    . DG  C 3 16  ? 189.40300 46.51900 89.95500  1.000 56.86000  ?  817 DG  P N2    1 
ATOM   8057 N  N3    . DG  C 3 16  ? 187.66200 47.88300 89.29900  1.000 64.63000  ?  817 DG  P N3    1 
ATOM   8058 C  C4    . DG  C 3 16  ? 186.76600 48.78000 89.76900  1.000 62.88000  ?  817 DG  P C4    1 
ATOM   8059 P  P     . DC  C 3 17  ? 181.58700 46.53900 87.21000  1.000 65.79000  ?  818 DC  P P     1 
ATOM   8060 O  OP1   . DC  C 3 17  ? 180.56200 46.15700 86.20500  1.000 72.74000  ?  818 DC  P OP1   1 
ATOM   8061 O  OP2   . DC  C 3 17  ? 181.21100 47.41200 88.35400  1.000 59.32000  ?  818 DC  P OP2   1 
ATOM   8062 O  "O5'" . DC  C 3 17  ? 182.24900 45.19400 87.70900  1.000 56.38000  ?  818 DC  P "O5'" 1 
ATOM   8063 C  "C5'" . DC  C 3 17  ? 182.78800 44.31000 86.76200  1.000 63.43000  ?  818 DC  P "C5'" 1 
ATOM   8064 C  "C4'" . DC  C 3 17  ? 183.97500 43.57000 87.34000  1.000 63.74000  ?  818 DC  P "C4'" 1 
ATOM   8065 O  "O4'" . DC  C 3 17  ? 184.93500 44.53000 87.82900  1.000 67.96000  ?  818 DC  P "O4'" 1 
ATOM   8066 C  "C3'" . DC  C 3 17  ? 183.67700 42.71300 88.55700  1.000 64.76000  ?  818 DC  P "C3'" 1 
ATOM   8067 O  "O3'" . DC  C 3 17  ? 183.13100 41.44500 88.17200  1.000 65.48000  ?  818 DC  P "O3'" 1 
ATOM   8068 C  "C2'" . DC  C 3 17  ? 185.07100 42.57400 89.14800  1.000 60.84000  ?  818 DC  P "C2'" 1 
ATOM   8069 C  "C1'" . DC  C 3 17  ? 185.60900 43.99100 88.95400  1.000 61.98000  ?  818 DC  P "C1'" 1 
ATOM   8070 N  N1    . DC  C 3 17  ? 185.36700 44.86900 90.14400  1.000 61.94000  ?  818 DC  P N1    1 
ATOM   8071 C  C2    . DC  C 3 17  ? 186.16100 44.69400 91.28500  1.000 57.71000  ?  818 DC  P C2    1 
ATOM   8072 O  O2    . DC  C 3 17  ? 187.05300 43.83700 91.27400  1.000 60.36000  ?  818 DC  P O2    1 
ATOM   8073 N  N3    . DC  C 3 17  ? 185.92800 45.46100 92.37200  1.000 57.53000  ?  818 DC  P N3    1 
ATOM   8074 C  C4    . DC  C 3 17  ? 184.96700 46.37200 92.35700  1.000 54.69000  ?  818 DC  P C4    1 
ATOM   8075 N  N4    . DC  C 3 17  ? 184.80600 47.10400 93.45500  1.000 53.77000  ?  818 DC  P N4    1 
ATOM   8076 C  C5    . DC  C 3 17  ? 184.13600 46.57700 91.20800  1.000 56.87000  ?  818 DC  P C5    1 
ATOM   8077 C  C6    . DC  C 3 17  ? 184.36300 45.80200 90.13000  1.000 60.11000  ?  818 DC  P C6    1 
ATOM   8078 P  P     . DG  C 3 18  ? 182.18000 40.65400 89.19200  1.000 60.87000  ?  819 DG  P P     1 
ATOM   8079 O  OP1   . DG  C 3 18  ? 181.63200 39.43800 88.54100  1.000 61.83000  ?  819 DG  P OP1   1 
ATOM   8080 O  OP2   . DG  C 3 18  ? 181.28200 41.67500 89.78100  1.000 52.60000  ?  819 DG  P OP2   1 
ATOM   8081 O  "O5'" . DG  C 3 18  ? 183.19900 40.12400 90.30400  1.000 62.41000  ?  819 DG  P "O5'" 1 
ATOM   8082 C  "C5'" . DG  C 3 18  ? 184.28500 39.30300 89.90400  1.000 59.68000  ?  819 DG  P "C5'" 1 
ATOM   8083 C  "C4'" . DG  C 3 18  ? 185.06100 38.81300 91.10400  1.000 59.32000  ?  819 DG  P "C4'" 1 
ATOM   8084 O  "O4'" . DG  C 3 18  ? 185.83400 39.90600 91.65200  1.000 56.38000  ?  819 DG  P "O4'" 1 
ATOM   8085 C  "C3'" . DG  C 3 18  ? 184.20900 38.30800 92.24000  1.000 50.70000  ?  819 DG  P "C3'" 1 
ATOM   8086 O  "O3'" . DG  C 3 18  ? 184.02500 36.94300 92.08900  1.000 55.45000  ?  819 DG  P "O3'" 1 
ATOM   8087 C  "C2'" . DG  C 3 18  ? 185.08200 38.59000 93.44400  1.000 48.26000  ?  819 DG  P "C2'" 1 
ATOM   8088 C  "C1'" . DG  C 3 18  ? 185.75000 39.89800 93.05100  1.000 51.46000  ?  819 DG  P "C1'" 1 
ATOM   8089 N  N9    . DG  C 3 18  ? 185.04600 41.11100 93.48000  1.000 55.34000  ?  819 DG  P N9    1 
ATOM   8090 C  C8    . DG  C 3 18  ? 184.19400 41.89100 92.72500  1.000 57.23000  ?  819 DG  P C8    1 
ATOM   8091 N  N7    . DG  C 3 18  ? 183.73800 42.93200 93.36400  1.000 53.76000  ?  819 DG  P N7    1 
ATOM   8092 C  C5    . DG  C 3 18  ? 184.32800 42.84600 94.61700  1.000 52.73000  ?  819 DG  P C5    1 
ATOM   8093 C  C6    . DG  C 3 18  ? 184.20200 43.69700 95.73900  1.000 54.63000  ?  819 DG  P C6    1 
ATOM   8094 O  O6    . DG  C 3 18  ? 183.53000 44.71800 95.83600  1.000 54.93000  ?  819 DG  P O6    1 
ATOM   8095 N  N1    . DG  C 3 18  ? 184.96200 43.25400 96.82400  1.000 53.17000  ?  819 DG  P N1    1 
ATOM   8096 C  C2    . DG  C 3 18  ? 185.75800 42.12700 96.81000  1.000 54.40000  ?  819 DG  P C2    1 
ATOM   8097 N  N2    . DG  C 3 18  ? 186.42900 41.86000 97.93600  1.000 52.64000  ?  819 DG  P N2    1 
ATOM   8098 N  N3    . DG  C 3 18  ? 185.88400 41.31600 95.76200  1.000 54.49000  ?  819 DG  P N3    1 
ATOM   8099 C  C4    . DG  C 3 18  ? 185.14000 41.73600 94.70600  1.000 52.49000  ?  819 DG  P C4    1 
ATOM   8100 P  P     . DC  C 3 19  ? 182.66500 36.26300 92.59100  1.000 49.64000  ?  820 DC  P P     1 
ATOM   8101 O  OP1   . DC  C 3 19  ? 182.80100 34.80700 92.37500  1.000 52.55000  ?  820 DC  P OP1   1 
ATOM   8102 O  OP2   . DC  C 3 19  ? 181.60400 37.11200 92.04200  1.000 44.12000  ?  820 DC  P OP2   1 
ATOM   8103 O  "O5'" . DC  C 3 19  ? 182.66200 36.46200 94.16800  1.000 56.11000  ?  820 DC  P "O5'" 1 
ATOM   8104 C  "C5'" . DC  C 3 19  ? 183.47900 35.64400 94.97200  1.000 48.82000  ?  820 DC  P "C5'" 1 
ATOM   8105 C  "C4'" . DC  C 3 19  ? 183.50000 36.14900 96.39800  1.000 51.43000  ?  820 DC  P "C4'" 1 
ATOM   8106 O  "O4'" . DC  C 3 19  ? 184.01300 37.50000 96.44500  1.000 50.37000  ?  820 DC  P "O4'" 1 
ATOM   8107 C  "C3'" . DC  C 3 19  ? 182.15300 36.25100 97.08300  1.000 46.74000  ?  820 DC  P "C3'" 1 
ATOM   8108 O  "O3'" . DC  C 3 19  ? 181.77800 34.98700 97.57100  1.000 49.81000  ?  820 DC  P "O3'" 1 
ATOM   8109 C  "C2'" . DC  C 3 19  ? 182.50600 37.17500 98.24000  1.000 51.33000  ?  820 DC  P "C2'" 1 
ATOM   8110 C  "C1'" . DC  C 3 19  ? 183.46700 38.15400 97.57900  1.000 51.83000  ?  820 DC  P "C1'" 1 
ATOM   8111 N  N1    . DC  C 3 19  ? 182.80000 39.39600 97.13900  1.000 54.73000  ?  820 DC  P N1    1 
ATOM   8112 C  C2    . DC  C 3 19  ? 182.61400 40.41700 98.05900  1.000 53.11000  ?  820 DC  P C2    1 
ATOM   8113 O  O2    . DC  C 3 19  ? 183.01800 40.24900 99.21900  1.000 56.59000  ?  820 DC  P O2    1 
ATOM   8114 N  N3    . DC  C 3 19  ? 182.00900 41.56500 97.65600  1.000 51.65000  ?  820 DC  P N3    1 
ATOM   8115 C  C4    . DC  C 3 19  ? 181.57900 41.68700 96.39700  1.000 51.34000  ?  820 DC  P C4    1 
ATOM   8116 N  N4    . DC  C 3 19  ? 180.97700 42.82500 96.05200  1.000 49.30000  ?  820 DC  P N4    1 
ATOM   8117 C  C5    . DC  C 3 19  ? 181.74700 40.64500 95.44000  1.000 50.09000  ?  820 DC  P C5    1 
ATOM   8118 C  C6    . DC  C 3 19  ? 182.35400 39.52400 95.85000  1.000 55.96000  ?  820 DC  P C6    1 
ATOM   8119 P  P     . DC  C 3 20  ? 180.23500 34.62200 97.77900  1.000 47.49000  ?  821 DC  P P     1 
ATOM   8120 O  OP1   . DC  C 3 20  ? 180.13900 33.17700 98.05400  1.000 47.81000  ?  821 DC  P OP1   1 
ATOM   8121 O  OP2   . DC  C 3 20  ? 179.56000 35.27300 96.64300  1.000 47.37000  ?  821 DC  P OP2   1 
ATOM   8122 O  "O5'" . DC  C 3 20  ? 179.80300 35.42800 99.09700  1.000 49.70000  ?  821 DC  P "O5'" 1 
ATOM   8123 C  "C5'" . DC  C 3 20  ? 180.50100 35.24100 100.31600 1.000 48.44000  ?  821 DC  P "C5'" 1 
ATOM   8124 C  "C4'" . DC  C 3 20  ? 180.03200 36.24100 101.36000 1.000 50.21000  ?  821 DC  P "C4'" 1 
ATOM   8125 O  "O4'" . DC  C 3 20  ? 180.51700 37.56600 101.04200 1.000 46.14000  ?  821 DC  P "O4'" 1 
ATOM   8126 C  "C3'" . DC  C 3 20  ? 178.52400 36.38700 101.47300 1.000 45.12000  ?  821 DC  P "C3'" 1 
ATOM   8127 O  "O3'" . DC  C 3 20  ? 178.03300 35.42400 102.36200 1.000 45.68000  ?  821 DC  P "O3'" 1 
ATOM   8128 C  "C2'" . DC  C 3 20  ? 178.35700 37.78700 102.04100 1.000 45.06000  ?  821 DC  P "C2'" 1 
ATOM   8129 C  "C1'" . DC  C 3 20  ? 179.61200 38.52600 101.55000 1.000 48.62000  ?  821 DC  P "C1'" 1 
ATOM   8130 N  N1    . DC  C 3 20  ? 179.31300 39.48900 100.48400 1.000 51.31000  ?  821 DC  P N1    1 
ATOM   8131 C  C2    . DC  C 3 20  ? 178.95500 40.78900 100.82100 1.000 48.71000  ?  821 DC  P C2    1 
ATOM   8132 O  O2    . DC  C 3 20  ? 178.90000 41.10100 102.00800 1.000 47.63000  ?  821 DC  P O2    1 
ATOM   8133 N  N3    . DC  C 3 20  ? 178.68800 41.67200 99.83400  1.000 50.36000  ?  821 DC  P N3    1 
ATOM   8134 C  C4    . DC  C 3 20  ? 178.73500 41.27600 98.56700  1.000 48.72000  ?  821 DC  P C4    1 
ATOM   8135 N  N4    . DC  C 3 20  ? 178.44900 42.16700 97.62900  1.000 46.89000  ?  821 DC  P N4    1 
ATOM   8136 C  C5    . DC  C 3 20  ? 179.08400 39.94800 98.20800  1.000 48.59000  ?  821 DC  P C5    1 
ATOM   8137 C  C6    . DC  C 3 20  ? 179.35900 39.09400 99.19100  1.000 46.98000  ?  821 DC  P C6    1 
HETATM 8138 N  N1    . DOC C 3 21  ? 174.96300 40.01000 101.96500 1.000 47.03000  ?  822 DOC P N1    1 
HETATM 8139 C  C2    . DOC C 3 21  ? 174.89800 41.34100 101.61600 1.000 50.94000  ?  822 DOC P C2    1 
HETATM 8140 N  N3    . DOC C 3 21  ? 175.07400 41.72000 100.33300 1.000 52.16000  ?  822 DOC P N3    1 
HETATM 8141 C  C4    . DOC C 3 21  ? 175.33700 40.74600 99.32900  1.000 45.93000  ?  822 DOC P C4    1 
HETATM 8142 C  C5    . DOC C 3 21  ? 175.40400 39.45900 99.66700  1.000 45.57000  ?  822 DOC P C5    1 
HETATM 8143 C  C6    . DOC C 3 21  ? 175.20300 39.06900 100.99900 1.000 49.67000  ?  822 DOC P C6    1 
HETATM 8144 O  O2    . DOC C 3 21  ? 174.70400 42.19700 102.46100 1.000 52.88000  ?  822 DOC P O2    1 
HETATM 8145 N  N4    . DOC C 3 21  ? 175.49700 41.17200 97.98600  1.000 46.14000  ?  822 DOC P N4    1 
HETATM 8146 C  "C1'" . DOC C 3 21  ? 174.65200 39.58500 103.28600 1.000 49.85000  ?  822 DOC P "C1'" 1 
HETATM 8147 C  "C2'" . DOC C 3 21  ? 173.40300 39.00500 103.97300 1.000 51.27000  ?  822 DOC P "C2'" 1 
HETATM 8148 C  "C3'" . DOC C 3 21  ? 173.74700 37.57700 104.14700 1.000 50.09000  ?  822 DOC P "C3'" 1 
HETATM 8149 C  "C4'" . DOC C 3 21  ? 175.24800 37.55500 104.31100 1.000 44.72000  ?  822 DOC P "C4'" 1 
HETATM 8150 O  "O4'" . DOC C 3 21  ? 175.79300 38.86000 103.87900 1.000 44.97000  ?  822 DOC P "O4'" 1 
HETATM 8151 C  "C5'" . DOC C 3 21  ? 175.95500 36.30800 103.92400 1.000 41.19000  ?  822 DOC P "C5'" 1 
HETATM 8152 O  "O5'" . DOC C 3 21  ? 175.72000 35.97700 102.61100 1.000 49.28000  ?  822 DOC P "O5'" 1 
HETATM 8153 P  P     . DOC C 3 21  ? 176.59700 34.89400 101.91000 1.000 45.47000  ?  822 DOC P P     1 
HETATM 8154 O  OP1   . DOC C 3 21  ? 176.58700 33.57600 102.73200 1.000 49.47000  ?  822 DOC P OP1   1 
HETATM 8155 O  OP2   . DOC C 3 21  ? 176.05500 34.62100 100.53700 1.000 55.03000  ?  822 DOC P OP2   1 
ATOM   8156 P  P     . DG  D 4 3   ? 169.51300 38.91700 84.19600  1.000 136.01000 ?  703 DG  T P     1 
ATOM   8157 O  OP1   . DG  D 4 3   ? 168.74500 38.11900 83.21400  1.000 133.94000 ?  703 DG  T OP1   1 
ATOM   8158 O  OP2   . DG  D 4 3   ? 170.88700 38.49900 84.56700  1.000 132.88000 ?  703 DG  T OP2   1 
ATOM   8159 O  "O5'" . DG  D 4 3   ? 169.53700 40.44500 83.70800  1.000 125.81000 ?  703 DG  T "O5'" 1 
ATOM   8160 C  "C5'" . DG  D 4 3   ? 169.47900 41.50500 84.66200  1.000 121.88000 ?  703 DG  T "C5'" 1 
ATOM   8161 C  "C4'" . DG  D 4 3   ? 169.83600 42.83000 84.01400  1.000 117.40000 ?  703 DG  T "C4'" 1 
ATOM   8162 O  "O4'" . DG  D 4 3   ? 168.72800 43.29100 83.22300  1.000 116.58000 ?  703 DG  T "O4'" 1 
ATOM   8163 C  "C3'" . DG  D 4 3   ? 170.09800 43.97200 84.97600  1.000 114.85000 ?  703 DG  T "C3'" 1 
ATOM   8164 O  "O3'" . DG  D 4 3   ? 171.46700 43.93900 85.41800  1.000 122.82000 ?  703 DG  T "O3'" 1 
ATOM   8165 C  "C2'" . DG  D 4 3   ? 169.81500 45.21000 84.11100  1.000 110.93000 ?  703 DG  T "C2'" 1 
ATOM   8166 C  "C1'" . DG  D 4 3   ? 168.85600 44.68300 83.03000  1.000 112.02000 ?  703 DG  T "C1'" 1 
ATOM   8167 N  N9    . DG  D 4 3   ? 167.53000 45.28300 83.08500  1.000 105.59000 ?  703 DG  T N9    1 
ATOM   8168 C  C8    . DG  D 4 3   ? 166.34200 44.63900 83.33000  1.000 103.56000 ?  703 DG  T C8    1 
ATOM   8169 N  N7    . DG  D 4 3   ? 165.30700 45.43400 83.31700  1.000 105.05000 ?  703 DG  T N7    1 
ATOM   8170 C  C5    . DG  D 4 3   ? 165.84300 46.69300 83.04400  1.000 108.18000 ?  703 DG  T C5    1 
ATOM   8171 C  C6    . DG  D 4 3   ? 165.20300 47.96400 82.91500  1.000 108.95000 ?  703 DG  T C6    1 
ATOM   8172 O  O6    . DG  D 4 3   ? 163.99300 48.23800 83.02300  1.000 104.97000 ?  703 DG  T O6    1 
ATOM   8173 N  N1    . DG  D 4 3   ? 166.12300 48.97900 82.63700  1.000 105.89000 ?  703 DG  T N1    1 
ATOM   8174 C  C2    . DG  D 4 3   ? 167.48300 48.79500 82.50800  1.000 103.34000 ?  703 DG  T C2    1 
ATOM   8175 N  N2    . DG  D 4 3   ? 168.20400 49.89300 82.24600  1.000 100.75000 ?  703 DG  T N2    1 
ATOM   8176 N  N3    . DG  D 4 3   ? 168.09400 47.61700 82.63100  1.000 105.54000 ?  703 DG  T N3    1 
ATOM   8177 C  C4    . DG  D 4 3   ? 167.21400 46.61300 82.89800  1.000 106.77000 ?  703 DG  T C4    1 
ATOM   8178 P  P     . DG  D 4 4   ? 171.83200 44.08200 86.98600  1.000 136.32000 ?  704 DG  T P     1 
ATOM   8179 O  OP1   . DG  D 4 4   ? 173.20100 43.52600 87.17500  1.000 114.74000 ?  704 DG  T OP1   1 
ATOM   8180 O  OP2   . DG  D 4 4   ? 170.68900 43.51500 87.75500  1.000 122.83000 ?  704 DG  T OP2   1 
ATOM   8181 O  "O5'" . DG  D 4 4   ? 171.83900 45.67700 87.24900  1.000 119.12000 ?  704 DG  T "O5'" 1 
ATOM   8182 C  "C5'" . DG  D 4 4   ? 170.65300 46.33500 87.75300  1.000 108.43000 ?  704 DG  T "C5'" 1 
ATOM   8183 C  "C4'" . DG  D 4 4   ? 170.63100 47.81900 87.38700  1.000 102.02000 ?  704 DG  T "C4'" 1 
ATOM   8184 O  "O4'" . DG  D 4 4   ? 169.65500 48.07700 86.34500  1.000 103.37000 ?  704 DG  T "O4'" 1 
ATOM   8185 C  "C3'" . DG  D 4 4   ? 170.31500 48.75800 88.54400  1.000 92.86000  ?  704 DG  T "C3'" 1 
ATOM   8186 O  "O3'" . DG  D 4 4   ? 171.34200 49.69800 88.66600  1.000 90.69000  ?  704 DG  T "O3'" 1 
ATOM   8187 C  "C2'" . DG  D 4 4   ? 168.97500 49.43200 88.20500  1.000 90.09000  ?  704 DG  T "C2'" 1 
ATOM   8188 C  "C1'" . DG  D 4 4   ? 168.66900 49.00800 86.77200  1.000 99.09000  ?  704 DG  T "C1'" 1 
ATOM   8189 N  N9    . DG  D 4 4   ? 167.36200 48.37900 86.64200  1.000 93.57000  ?  704 DG  T N9    1 
ATOM   8190 C  C8    . DG  D 4 4   ? 166.18900 48.97500 86.25400  1.000 93.15000  ?  704 DG  T C8    1 
ATOM   8191 N  N7    . DG  D 4 4   ? 165.17400 48.15300 86.22700  1.000 93.89000  ?  704 DG  T N7    1 
ATOM   8192 C  C5    . DG  D 4 4   ? 165.71500 46.93200 86.61900  1.000 93.60000  ?  704 DG  T C5    1 
ATOM   8193 C  C6    . DG  D 4 4   ? 165.10300 45.65800 86.76500  1.000 94.95000  ?  704 DG  T C6    1 
ATOM   8194 O  O6    . DG  D 4 4   ? 163.91200 45.35000 86.58200  1.000 92.89000  ?  704 DG  T O6    1 
ATOM   8195 N  N1    . DG  D 4 4   ? 166.02800 44.68100 87.16900  1.000 101.56000 ?  704 DG  T N1    1 
ATOM   8196 C  C2    . DG  D 4 4   ? 167.37300 44.91400 87.40100  1.000 102.92000 ?  704 DG  T C2    1 
ATOM   8197 N  N2    . DG  D 4 4   ? 168.11600 43.85900 87.79000  1.000 99.10000  ?  704 DG  T N2    1 
ATOM   8198 N  N3    . DG  D 4 4   ? 167.94600 46.10000 87.26400  1.000 100.06000 ?  704 DG  T N3    1 
ATOM   8199 C  C4    . DG  D 4 4   ? 167.06300 47.05700 86.87200  1.000 95.57000  ?  704 DG  T C4    1 
ATOM   8200 P  P     . DG  D 4 5   ? 172.44300 49.47900 89.79800  1.000 71.38000  ?  705 DG  T P     1 
ATOM   8201 O  OP1   . DG  D 4 5   ? 173.43500 50.58400 89.70700  1.000 66.24000  ?  705 DG  T OP1   1 
ATOM   8202 O  OP2   . DG  D 4 5   ? 172.81300 48.04800 89.70000  1.000 76.36000  ?  705 DG  T OP2   1 
ATOM   8203 O  "O5'" . DG  D 4 5   ? 171.60700 49.65400 91.14600  1.000 73.24000  ?  705 DG  T "O5'" 1 
ATOM   8204 C  "C5'" . DG  D 4 5   ? 170.95300 50.87100 91.40900  1.000 66.22000  ?  705 DG  T "C5'" 1 
ATOM   8205 C  "C4'" . DG  D 4 5   ? 170.53000 50.92000 92.85000  1.000 62.30000  ?  705 DG  T "C4'" 1 
ATOM   8206 O  "O4'" . DG  D 4 5   ? 169.60600 49.84100 93.12000  1.000 62.27000  ?  705 DG  T "O4'" 1 
ATOM   8207 C  "C3'" . DG  D 4 5   ? 171.65400 50.69000 93.83500  1.000 58.80000  ?  705 DG  T "C3'" 1 
ATOM   8208 O  "O3'" . DG  D 4 5   ? 172.34600 51.87500 94.02800  1.000 58.49000  ?  705 DG  T "O3'" 1 
ATOM   8209 C  "C2'" . DG  D 4 5   ? 170.86800 50.29000 95.07000  1.000 55.18000  ?  705 DG  T "C2'" 1 
ATOM   8210 C  "C1'" . DG  D 4 5   ? 169.83300 49.36200 94.43900  1.000 58.75000  ?  705 DG  T "C1'" 1 
ATOM   8211 N  N9    . DG  D 4 5   ? 170.29900 47.98700 94.37200  1.000 56.71000  ?  705 DG  T N9    1 
ATOM   8212 C  C8    . DG  D 4 5   ? 170.61500 47.25500 93.25000  1.000 59.70000  ?  705 DG  T C8    1 
ATOM   8213 N  N7    . DG  D 4 5   ? 171.02400 46.04400 93.52800  1.000 61.82000  ?  705 DG  T N7    1 
ATOM   8214 C  C5    . DG  D 4 5   ? 170.98200 45.98300 94.92900  1.000 56.59000  ?  705 DG  T C5    1 
ATOM   8215 C  C6    . DG  D 4 5   ? 171.32400 44.93100 95.82900  1.000 53.90000  ?  705 DG  T C6    1 
ATOM   8216 O  O6    . DG  D 4 5   ? 171.73100 43.78600 95.57300  1.000 51.21000  ?  705 DG  T O6    1 
ATOM   8217 N  N1    . DG  D 4 5   ? 171.14700 45.31500 97.15600  1.000 54.44000  ?  705 DG  T N1    1 
ATOM   8218 C  C2    . DG  D 4 5   ? 170.69500 46.54500 97.56800  1.000 56.49000  ?  705 DG  T C2    1 
ATOM   8219 N  N2    . DG  D 4 5   ? 170.57500 46.73000 98.88200  1.000 53.68000  ?  705 DG  T N2    1 
ATOM   8220 N  N3    . DG  D 4 5   ? 170.38000 47.52800 96.74400  1.000 62.57000  ?  705 DG  T N3    1 
ATOM   8221 C  C4    . DG  D 4 5   ? 170.54500 47.17600 95.44500  1.000 55.63000  ?  705 DG  T C4    1 
ATOM   8222 P  P     . DG  D 4 6   ? 173.83800 51.84800 94.60200  1.000 53.90000  ?  706 DG  T P     1 
ATOM   8223 O  OP1   . DG  D 4 6   ? 174.32800 53.24100 94.67600  1.000 54.45000  ?  706 DG  T OP1   1 
ATOM   8224 O  OP2   . DG  D 4 6   ? 174.56300 50.82100 93.82800  1.000 65.28000  ?  706 DG  T OP2   1 
ATOM   8225 O  "O5'" . DG  D 4 6   ? 173.64700 51.28300 96.09100  1.000 61.59000  ?  706 DG  T "O5'" 1 
ATOM   8226 C  "C5'" . DG  D 4 6   ? 172.84400 52.00400 97.02700  1.000 53.23000  ?  706 DG  T "C5'" 1 
ATOM   8227 C  "C4'" . DG  D 4 6   ? 172.92500 51.38100 98.41100  1.000 53.26000  ?  706 DG  T "C4'" 1 
ATOM   8228 O  "O4'" . DG  D 4 6   ? 172.35500 50.06400 98.38100  1.000 52.13000  ?  706 DG  T "O4'" 1 
ATOM   8229 C  "C3'" . DG  D 4 6   ? 174.32900 51.17400 98.95600  1.000 49.71000  ?  706 DG  T "C3'" 1 
ATOM   8230 O  "O3'" . DG  D 4 6   ? 174.76400 52.33400 99.57900  1.000 47.99000  ?  706 DG  T "O3'" 1 
ATOM   8231 C  "C2'" . DG  D 4 6   ? 174.11100 50.08100 99.97900  1.000 47.66000  ?  706 DG  T "C2'" 1 
ATOM   8232 C  "C1'" . DG  D 4 6   ? 173.03300 49.24300 99.31200  1.000 53.16000  ?  706 DG  T "C1'" 1 
ATOM   8233 N  N9    . DG  D 4 6   ? 173.53700 48.09600 98.59800  1.000 50.85000  ?  706 DG  T N9    1 
ATOM   8234 C  C8    . DG  D 4 6   ? 173.76600 48.01100 97.25200  1.000 53.78000  ?  706 DG  T C8    1 
ATOM   8235 N  N7    . DG  D 4 6   ? 174.19400 46.83600 96.87700  1.000 57.54000  ?  706 DG  T N7    1 
ATOM   8236 C  C5    . DG  D 4 6   ? 174.23400 46.09900 98.05400  1.000 51.42000  ?  706 DG  T C5    1 
ATOM   8237 C  C6    . DG  D 4 6   ? 174.61100 44.76400 98.27100  1.000 51.88000  ?  706 DG  T C6    1 
ATOM   8238 O  O6    . DG  D 4 6   ? 175.00000 43.93200 97.44100  1.000 54.97000  ?  706 DG  T O6    1 
ATOM   8239 N  N1    . DG  D 4 6   ? 174.52100 44.41700 99.61300  1.000 51.00000  ?  706 DG  T N1    1 
ATOM   8240 C  C2    . DG  D 4 6   ? 174.12000 45.24800 100.61500 1.000 47.76000  ?  706 DG  T C2    1 
ATOM   8241 N  N2    . DG  D 4 6   ? 174.11200 44.72200 101.83500 1.000 47.63000  ?  706 DG  T N2    1 
ATOM   8242 N  N3    . DG  D 4 6   ? 173.74600 46.50200 100.43300 1.000 52.66000  ?  706 DG  T N3    1 
ATOM   8243 C  C4    . DG  D 4 6   ? 173.83700 46.86100 99.12400  1.000 51.59000  ?  706 DG  T C4    1 
ATOM   8244 P  P     . DG  D 4 7   ? 176.31100 52.70300 99.54500  1.000 42.77000  ?  707 DG  T P     1 
ATOM   8245 O  OP1   . DG  D 4 7   ? 176.44600 54.12800 99.91900  1.000 53.66000  ?  707 DG  T OP1   1 
ATOM   8246 O  OP2   . DG  D 4 7   ? 176.83600 52.18300 98.28500  1.000 54.75000  ?  707 DG  T OP2   1 
ATOM   8247 O  "O5'" . DG  D 4 7   ? 176.93900 51.78700 100.69000 1.000 54.22000  ?  707 DG  T "O5'" 1 
ATOM   8248 C  "C5'" . DG  D 4 7   ? 176.86600 52.19300 102.05600 1.000 46.17000  ?  707 DG  T "C5'" 1 
ATOM   8249 C  "C4'" . DG  D 4 7   ? 177.29200 51.06100 102.95800 1.000 49.35000  ?  707 DG  T "C4'" 1 
ATOM   8250 O  "O4'" . DG  D 4 7   ? 176.49000 49.90500 102.65100 1.000 43.85000  ?  707 DG  T "O4'" 1 
ATOM   8251 C  "C3'" . DG  D 4 7   ? 178.70900 50.56900 102.73900 1.000 50.91000  ?  707 DG  T "C3'" 1 
ATOM   8252 O  "O3'" . DG  D 4 7   ? 179.63600 51.40500 103.37300 1.000 46.98000  ?  707 DG  T "O3'" 1 
ATOM   8253 C  "C2'" . DG  D 4 7   ? 178.63800 49.19100 103.36200 1.000 43.35000  ?  707 DG  T "C2'" 1 
ATOM   8254 C  "C1'" . DG  D 4 7   ? 177.25800 48.73500 102.85400 1.000 45.54000  ?  707 DG  T "C1'" 1 
ATOM   8255 N  N9    . DG  D 4 7   ? 177.31000 48.00000 101.59900 1.000 46.71000  ?  707 DG  T N9    1 
ATOM   8256 C  C8    . DG  D 4 7   ? 177.21400 48.51200 100.33000 1.000 47.70000  ?  707 DG  T C8    1 
ATOM   8257 N  N7    . DG  D 4 7   ? 177.32300 47.60100 99.39300  1.000 46.62000  ?  707 DG  T N7    1 
ATOM   8258 C  C5    . DG  D 4 7   ? 177.50800 46.41300 100.08900 1.000 47.82000  ?  707 DG  T C5    1 
ATOM   8259 C  C6    . DG  D 4 7   ? 177.68800 45.08100 99.61900  1.000 49.71000  ?  707 DG  T C6    1 
ATOM   8260 O  O6    . DG  D 4 7   ? 177.72400 44.66600 98.45200  1.000 49.33000  ?  707 DG  T O6    1 
ATOM   8261 N  N1    . DG  D 4 7   ? 177.83600 44.18500 100.66800 1.000 49.30000  ?  707 DG  T N1    1 
ATOM   8262 C  C2    . DG  D 4 7   ? 177.82300 44.52000 101.98800 1.000 45.04000  ?  707 DG  T C2    1 
ATOM   8263 N  N2    . DG  D 4 7   ? 177.99000 43.52600 102.83400 1.000 46.80000  ?  707 DG  T N2    1 
ATOM   8264 N  N3    . DG  D 4 7   ? 177.66100 45.74500 102.44900 1.000 48.45000  ?  707 DG  T N3    1 
ATOM   8265 C  C4    . DG  D 4 7   ? 177.50400 46.64200 101.44600 1.000 50.28000  ?  707 DG  T C4    1 
ATOM   8266 P  P     . DG  D 4 8   ? 181.15300 51.43300 102.84000 1.000 47.93000  ?  708 DG  T P     1 
ATOM   8267 O  OP1   . DG  D 4 8   ? 181.82200 52.56900 103.50900 1.000 43.33000  ?  708 DG  T OP1   1 
ATOM   8268 O  OP2   . DG  D 4 8   ? 181.19500 51.37700 101.37100 1.000 53.35000  ?  708 DG  T OP2   1 
ATOM   8269 O  "O5'" . DG  D 4 8   ? 181.71400 50.02100 103.31700 1.000 49.57000  ?  708 DG  T "O5'" 1 
ATOM   8270 C  "C5'" . DG  D 4 8   ? 181.77000 49.74600 104.70100 1.000 47.33000  ?  708 DG  T "C5'" 1 
ATOM   8271 C  "C4'" . DG  D 4 8   ? 182.08700 48.29800 104.96500 1.000 44.69000  ?  708 DG  T "C4'" 1 
ATOM   8272 O  "O4'" . DG  D 4 8   ? 181.03600 47.44700 104.45500 1.000 43.10000  ?  708 DG  T "O4'" 1 
ATOM   8273 C  "C3'" . DG  D 4 8   ? 183.34700 47.78500 104.31100 1.000 44.74000  ?  708 DG  T "C3'" 1 
ATOM   8274 O  "O3'" . DG  D 4 8   ? 184.43600 48.15200 105.09600 1.000 46.56000  ?  708 DG  T "O3'" 1 
ATOM   8275 C  "C2'" . DG  D 4 8   ? 183.09100 46.28400 104.39100 1.000 45.61000  ?  708 DG  T "C2'" 1 
ATOM   8276 C  "C1'" . DG  D 4 8   ? 181.60800 46.22900 104.00100 1.000 44.20000  ?  708 DG  T "C1'" 1 
ATOM   8277 N  N9    . DG  D 4 8   ? 181.42900 46.17500 102.56700 1.000 48.29000  ?  708 DG  T N9    1 
ATOM   8278 C  C8    . DG  D 4 8   ? 181.18300 47.24100 101.73500 1.000 46.22000  ?  708 DG  T C8    1 
ATOM   8279 N  N7    . DG  D 4 8   ? 181.08800 46.90500 100.48100 1.000 46.93000  ?  708 DG  T N7    1 
ATOM   8280 C  C5    . DG  D 4 8   ? 181.30800 45.53900 100.47300 1.000 46.43000  ?  708 DG  T C5    1 
ATOM   8281 C  C6    . DG  D 4 8   ? 181.32900 44.64600 99.40000  1.000 47.39000  ?  708 DG  T C6    1 
ATOM   8282 O  O6    . DG  D 4 8   ? 181.14600 44.89500 98.21000  1.000 55.23000  ?  708 DG  T O6    1 
ATOM   8283 N  N1    . DG  D 4 8   ? 181.56700 43.34400 99.81100  1.000 50.06000  ?  708 DG  T N1    1 
ATOM   8284 C  C2    . DG  D 4 8   ? 181.76000 42.95700 101.11400 1.000 50.68000  ?  708 DG  T C2    1 
ATOM   8285 N  N2    . DG  D 4 8   ? 181.98000 41.64700 101.31300 1.000 52.66000  ?  708 DG  T N2    1 
ATOM   8286 N  N3    . DG  D 4 8   ? 181.74700 43.79200 102.14700 1.000 44.08000  ?  708 DG  T N3    1 
ATOM   8287 C  C4    . DG  D 4 8   ? 181.51700 45.06500 101.75000 1.000 49.06000  ?  708 DG  T C4    1 
ATOM   8288 P  P     . DC  D 4 9   ? 185.64200 49.03600 104.52200 1.000 44.33000  ?  709 DC  T P     1 
ATOM   8289 O  OP1   . DC  D 4 9   ? 186.17800 49.77300 105.67600 1.000 46.61000  ?  709 DC  T OP1   1 
ATOM   8290 O  OP2   . DC  D 4 9   ? 185.21800 49.82100 103.34400 1.000 52.05000  ?  709 DC  T OP2   1 
ATOM   8291 O  "O5'" . DC  D 4 9   ? 186.69800 47.93000 104.08200 1.000 45.15000  ?  709 DC  T "O5'" 1 
ATOM   8292 C  "C5'" . DC  D 4 9   ? 187.18400 47.04500 105.04400 1.000 43.75000  ?  709 DC  T "C5'" 1 
ATOM   8293 C  "C4'" . DC  D 4 9   ? 187.53300 45.73000 104.41000 1.000 46.80000  ?  709 DC  T "C4'" 1 
ATOM   8294 O  "O4'" . DC  D 4 9   ? 186.34600 45.12400 103.86800 1.000 50.33000  ?  709 DC  T "O4'" 1 
ATOM   8295 C  "C3'" . DC  D 4 9   ? 188.47300 45.82200 103.23100 1.000 47.13000  ?  709 DC  T "C3'" 1 
ATOM   8296 O  "O3'" . DC  D 4 9   ? 189.75000 45.88500 103.69700 1.000 47.94000  ?  709 DC  T "O3'" 1 
ATOM   8297 C  "C2'" . DC  D 4 9   ? 188.20600 44.50100 102.52200 1.000 47.38000  ?  709 DC  T "C2'" 1 
ATOM   8298 C  "C1'" . DC  D 4 9   ? 186.69000 44.37500 102.70900 1.000 48.09000  ?  709 DC  T "C1'" 1 
ATOM   8299 N  N1    . DC  D 4 9   ? 185.96000 44.94400 101.60800 1.000 52.17000  ?  709 DC  T N1    1 
ATOM   8300 C  C2    . DC  D 4 9   ? 185.67800 44.15100 100.52200 1.000 49.90000  ?  709 DC  T C2    1 
ATOM   8301 O  O2    . DC  D 4 9   ? 186.05500 42.98100 100.54100 1.000 54.29000  ?  709 DC  T O2    1 
ATOM   8302 N  N3    . DC  D 4 9   ? 185.00400 44.68200 99.48000  1.000 51.85000  ?  709 DC  T N3    1 
ATOM   8303 C  C4    . DC  D 4 9   ? 184.62100 45.96300 99.51200  1.000 49.84000  ?  709 DC  T C4    1 
ATOM   8304 N  N4    . DC  D 4 9   ? 183.96200 46.44700 98.45400  1.000 48.00000  ?  709 DC  T N4    1 
ATOM   8305 C  C5    . DC  D 4 9   ? 184.90800 46.80100 100.62400 1.000 48.32000  ?  709 DC  T C5    1 
ATOM   8306 C  C6    . DC  D 4 9   ? 185.57500 46.25700 101.64600 1.000 50.33000  ?  709 DC  T C6    1 
ATOM   8307 P  P     . DG  D 4 10  ? 190.91600 46.46700 102.77400 1.000 49.73000  ?  710 DG  T P     1 
ATOM   8308 O  OP1   . DG  D 4 10  ? 192.17600 46.22100 103.52400 1.000 46.92000  ?  710 DG  T OP1   1 
ATOM   8309 O  OP2   . DG  D 4 10  ? 190.56100 47.83300 102.35200 1.000 40.36000  ?  710 DG  T OP2   1 
ATOM   8310 O  "O5'" . DG  D 4 10  ? 190.94400 45.44400 101.57200 1.000 47.33000  ?  710 DG  T "O5'" 1 
ATOM   8311 C  "C5'" . DG  D 4 10  ? 191.36100 44.14000 101.84000 1.000 44.90000  ?  710 DG  T "C5'" 1 
ATOM   8312 C  "C4'" . DG  D 4 10  ? 191.33400 43.28700 100.60100 1.000 47.49000  ?  710 DG  T "C4'" 1 
ATOM   8313 O  "O4'" . DG  D 4 10  ? 189.97900 43.09400 100.17000 1.000 49.86000  ?  710 DG  T "O4'" 1 
ATOM   8314 C  "C3'" . DG  D 4 10  ? 192.05600 43.86700 99.40200  1.000 48.35000  ?  710 DG  T "C3'" 1 
ATOM   8315 O  "O3'" . DG  D 4 10  ? 193.39500 43.51000 99.49000  1.000 53.24000  ?  710 DG  T "O3'" 1 
ATOM   8316 C  "C2'" . DG  D 4 10  ? 191.38000 43.13200 98.26600  1.000 48.69000  ?  710 DG  T "C2'" 1 
ATOM   8317 C  "C1'" . DG  D 4 10  ? 189.94000 43.05700 98.76200  1.000 50.55000  ?  710 DG  T "C1'" 1 
ATOM   8318 N  N9    . DG  D 4 10  ? 189.11000 44.16100 98.30300  1.000 52.63000  ?  710 DG  T N9    1 
ATOM   8319 C  C8    . DG  D 4 10  ? 188.71400 45.26300 99.01800  1.000 53.38000  ?  710 DG  T C8    1 
ATOM   8320 N  N7    . DG  D 4 10  ? 187.97000 46.08000 98.32900  1.000 51.38000  ?  710 DG  T N7    1 
ATOM   8321 C  C5    . DG  D 4 10  ? 187.87400 45.47600 97.08900  1.000 47.62000  ?  710 DG  T C5    1 
ATOM   8322 C  C6    . DG  D 4 10  ? 187.18700 45.88500 95.93500  1.000 51.68000  ?  710 DG  T C6    1 
ATOM   8323 O  O6    . DG  D 4 10  ? 186.50100 46.89900 95.77400  1.000 53.54000  ?  710 DG  T O6    1 
ATOM   8324 N  N1    . DG  D 4 10  ? 187.34700 44.97500 94.89900  1.000 54.33000  ?  710 DG  T N1    1 
ATOM   8325 C  C2    . DG  D 4 10  ? 188.08900 43.81600 94.97700  1.000 53.48000  ?  710 DG  T C2    1 
ATOM   8326 N  N2    . DG  D 4 10  ? 188.13600 43.05600 93.88600  1.000 53.34000  ?  710 DG  T N2    1 
ATOM   8327 N  N3    . DG  D 4 10  ? 188.72400 43.42600 96.05000  1.000 53.76000  ?  710 DG  T N3    1 
ATOM   8328 C  C4    . DG  D 4 10  ? 188.56700 44.29800 97.06500  1.000 50.50000  ?  710 DG  T C4    1 
ATOM   8329 P  P     . DC  D 4 11  ? 194.53500 44.36400 98.76800  1.000 56.34000  ?  711 DC  T P     1 
ATOM   8330 O  OP1   . DC  D 4 11  ? 195.79200 43.68600 99.15800  1.000 61.19000  ?  711 DC  T OP1   1 
ATOM   8331 O  OP2   . DC  D 4 11  ? 194.36400 45.81200 99.03200  1.000 49.53000  ?  711 DC  T OP2   1 
ATOM   8332 O  "O5'" . DC  D 4 11  ? 194.26000 44.10700 97.22400  1.000 53.63000  ?  711 DC  T "O5'" 1 
ATOM   8333 C  "C5'" . DC  D 4 11  ? 194.15800 42.78600 96.71600  1.000 51.59000  ?  711 DC  T "C5'" 1 
ATOM   8334 C  "C4'" . DC  D 4 11  ? 193.89100 42.85700 95.22900  1.000 60.71000  ?  711 DC  T "C4'" 1 
ATOM   8335 O  "O4'" . DC  D 4 11  ? 192.49800 43.19300 95.01200  1.000 60.93000  ?  711 DC  T "O4'" 1 
ATOM   8336 C  "C3'" . DC  D 4 11  ? 194.69600 43.92900 94.51800  1.000 55.04000  ?  711 DC  T "C3'" 1 
ATOM   8337 O  "O3'" . DC  D 4 11  ? 195.88600 43.32800 93.99500  1.000 68.89000  ?  711 DC  T "O3'" 1 
ATOM   8338 C  "C2'" . DC  D 4 11  ? 193.76500 44.42100 93.41200  1.000 55.13000  ?  711 DC  T "C2'" 1 
ATOM   8339 C  "C1'" . DC  D 4 11  ? 192.36200 44.06500 93.91500  1.000 58.41000  ?  711 DC  T "C1'" 1 
ATOM   8340 N  N1    . DC  D 4 11  ? 191.58200 45.23100 94.36200  1.000 55.65000  ?  711 DC  T N1    1 
ATOM   8341 C  C2    . DC  D 4 11  ? 190.67700 45.83400 93.48600  1.000 58.99000  ?  711 DC  T C2    1 
ATOM   8342 O  O2    . DC  D 4 11  ? 190.54300 45.37300 92.34700  1.000 61.83000  ?  711 DC  T O2    1 
ATOM   8343 N  N3    . DC  D 4 11  ? 189.97100 46.91300 93.91300  1.000 59.35000  ?  711 DC  T N3    1 
ATOM   8344 C  C4    . DC  D 4 11  ? 190.15200 47.37600 95.15300  1.000 57.18000  ?  711 DC  T C4    1 
ATOM   8345 N  N4    . DC  D 4 11  ? 189.44300 48.44200 95.53800  1.000 54.06000  ?  711 DC  T N4    1 
ATOM   8346 C  C5    . DC  D 4 11  ? 191.07200 46.76800 96.04900  1.000 53.63000  ?  711 DC  T C5    1 
ATOM   8347 C  C6    . DC  D 4 11  ? 191.75600 45.70900 95.61400  1.000 50.80000  ?  711 DC  T C6    1 
ATOM   8348 P  P     . DC  D 4 12  ? 196.94200 44.16700 93.10600  1.000 75.60000  ?  712 DC  T P     1 
ATOM   8349 O  OP1   . DC  D 4 12  ? 198.11200 43.26700 92.94700  1.000 61.22000  ?  712 DC  T OP1   1 
ATOM   8350 O  OP2   . DC  D 4 12  ? 197.11700 45.55500 93.65000  1.000 58.46000  ?  712 DC  T OP2   1 
ATOM   8351 O  "O5'" . DC  D 4 12  ? 196.19600 44.23200 91.69400  1.000 70.94000  ?  712 DC  T "O5'" 1 
ATOM   8352 C  "C5'" . DC  D 4 12  ? 196.77100 44.89400 90.62500  1.000 70.99000  ?  712 DC  T "C5'" 1 
ATOM   8353 C  "C4'" . DC  D 4 12  ? 195.72100 45.64000 89.85100  1.000 66.28000  ?  712 DC  T "C4'" 1 
ATOM   8354 O  "O4'" . DC  D 4 12  ? 194.60400 45.94800 90.69800  1.000 68.49000  ?  712 DC  T "O4'" 1 
ATOM   8355 C  "C3'" . DC  D 4 12  ? 196.18500 46.98000 89.36500  1.000 74.37000  ?  712 DC  T "C3'" 1 
ATOM   8356 O  "O3'" . DC  D 4 12  ? 196.82000 46.80900 88.14000  1.000 79.29000  ?  712 DC  T "O3'" 1 
ATOM   8357 C  "C2'" . DC  D 4 12  ? 194.88300 47.79100 89.23100  1.000 70.48000  ?  712 DC  T "C2'" 1 
ATOM   8358 C  "C1'" . DC  D 4 12  ? 193.90200 47.04300 90.13600  1.000 65.19000  ?  712 DC  T "C1'" 1 
ATOM   8359 N  N1    . DC  D 4 12  ? 193.36900 47.87000 91.22500  1.000 60.89000  ?  712 DC  T N1    1 
ATOM   8360 C  C2    . DC  D 4 12  ? 192.41200 48.85100 90.94300  1.000 67.45000  ?  712 DC  T C2    1 
ATOM   8361 O  O2    . DC  D 4 12  ? 192.02500 49.00300 89.77700  1.000 70.42000  ?  712 DC  T O2    1 
ATOM   8362 N  N3    . DC  D 4 12  ? 191.92600 49.60600 91.95700  1.000 63.50000  ?  712 DC  T N3    1 
ATOM   8363 C  C4    . DC  D 4 12  ? 192.35300 49.39900 93.19900  1.000 63.97000  ?  712 DC  T C4    1 
ATOM   8364 N  N4    . DC  D 4 12  ? 191.84000 50.15900 94.17400  1.000 60.55000  ?  712 DC  T N4    1 
ATOM   8365 C  C5    . DC  D 4 12  ? 193.32900 48.40200 93.50300  1.000 60.43000  ?  712 DC  T C5    1 
ATOM   8366 C  C6    . DC  D 4 12  ? 193.80200 47.66800 92.49400  1.000 61.13000  ?  712 DC  T C6    1 
ATOM   8367 P  P     . DC  D 4 13  ? 197.97200 47.82400 87.71200  1.000 82.23000  ?  713 DC  T P     1 
ATOM   8368 O  OP1   . DC  D 4 13  ? 198.74400 47.08700 86.67200  1.000 74.18000  ?  713 DC  T OP1   1 
ATOM   8369 O  OP2   . DC  D 4 13  ? 198.55500 48.36400 88.96400  1.000 70.22000  ?  713 DC  T OP2   1 
ATOM   8370 O  "O5'" . DC  D 4 13  ? 197.18700 49.07800 87.09000  1.000 76.16000  ?  713 DC  T "O5'" 1 
ATOM   8371 C  "C5'" . DC  D 4 13  ? 196.19200 48.87500 86.09700  1.000 75.58000  ?  713 DC  T "C5'" 1 
ATOM   8372 C  "C4'" . DC  D 4 13  ? 195.25700 50.06300 86.04900  1.000 76.25000  ?  713 DC  T "C4'" 1 
ATOM   8373 O  "O4'" . DC  D 4 13  ? 194.55200 50.15800 87.29100  1.000 76.38000  ?  713 DC  T "O4'" 1 
ATOM   8374 C  "C3'" . DC  D 4 13  ? 195.95200 51.39300 85.89500  1.000 78.53000  ?  713 DC  T "C3'" 1 
ATOM   8375 O  "O3'" . DC  D 4 13  ? 196.01200 51.71300 84.52400  1.000 84.40000  ?  713 DC  T "O3'" 1 
ATOM   8376 C  "C2'" . DC  D 4 13  ? 195.05800 52.38000 86.67100  1.000 77.95000  ?  713 DC  T "C2'" 1 
ATOM   8377 C  "C1'" . DC  D 4 13  ? 194.14000 51.48100 87.49900  1.000 71.98000  ?  713 DC  T "C1'" 1 
ATOM   8378 N  N1    . DC  D 4 13  ? 194.20300 51.72600 88.95100  1.000 72.73000  ?  713 DC  T N1    1 
ATOM   8379 C  C2    . DC  D 4 13  ? 193.26300 52.57300 89.55900  1.000 74.25000  ?  713 DC  T C2    1 
ATOM   8380 O  O2    . DC  D 4 13  ? 192.40700 53.13300 88.85700  1.000 73.95000  ?  713 DC  T O2    1 
ATOM   8381 N  N3    . DC  D 4 13  ? 193.32500 52.76700 90.90300  1.000 72.72000  ?  713 DC  T N3    1 
ATOM   8382 C  C4    . DC  D 4 13  ? 194.26100 52.14500 91.62600  1.000 73.17000  ?  713 DC  T C4    1 
ATOM   8383 N  N4    . DC  D 4 13  ? 194.28300 52.36800 92.94700  1.000 66.13000  ?  713 DC  T N4    1 
ATOM   8384 C  C5    . DC  D 4 13  ? 195.21900 51.26700 91.02200  1.000 72.27000  ?  713 DC  T C5    1 
ATOM   8385 C  C6    . DC  D 4 13  ? 195.15000 51.08600 89.69700  1.000 71.07000  ?  713 DC  T C6    1 
ATOM   8386 P  P     . DG  D 4 14  ? 197.07100 52.79000 83.98500  1.000 90.28000  ?  714 DG  T P     1 
ATOM   8387 O  OP1   . DG  D 4 14  ? 197.20000 52.51300 82.53400  1.000 91.88000  ?  714 DG  T OP1   1 
ATOM   8388 O  OP2   . DG  D 4 14  ? 198.29200 52.73300 84.82500  1.000 88.14000  ?  714 DG  T OP2   1 
ATOM   8389 O  "O5'" . DG  D 4 14  ? 196.30900 54.18400 84.21600  1.000 74.56000  ?  714 DG  T "O5'" 1 
ATOM   8390 C  "C5'" . DG  D 4 14  ? 195.01300 54.34600 83.68400  1.000 74.37000  ?  714 DG  T "C5'" 1 
ATOM   8391 C  "C4'" . DG  D 4 14  ? 194.33900 55.56000 84.27000  1.000 81.52000  ?  714 DG  T "C4'" 1 
ATOM   8392 O  "O4'" . DG  D 4 14  ? 194.11600 55.36900 85.69800  1.000 83.66000  ?  714 DG  T "O4'" 1 
ATOM   8393 C  "C3'" . DG  D 4 14  ? 195.12700 56.86000 84.15200  1.000 83.35000  ?  714 DG  T "C3'" 1 
ATOM   8394 O  "O3'" . DG  D 4 14  ? 194.20300 57.91900 84.02700  1.000 91.50000  ?  714 DG  T "O3'" 1 
ATOM   8395 C  "C2'" . DG  D 4 14  ? 195.83200 56.91900 85.50300  1.000 84.56000  ?  714 DG  T "C2'" 1 
ATOM   8396 C  "C1'" . DG  D 4 14  ? 194.70000 56.45000 86.40100  1.000 82.19000  ?  714 DG  T "C1'" 1 
ATOM   8397 N  N9    . DG  D 4 14  ? 195.11800 55.98100 87.72600  1.000 79.83000  ?  714 DG  T N9    1 
ATOM   8398 C  C8    . DG  D 4 14  ? 196.16000 55.12600 88.02200  1.000 78.53000  ?  714 DG  T C8    1 
ATOM   8399 N  N7    . DG  D 4 14  ? 196.28200 54.87500 89.29800  1.000 75.89000  ?  714 DG  T N7    1 
ATOM   8400 C  C5    . DG  D 4 14  ? 195.24500 55.59800 89.88700  1.000 74.92000  ?  714 DG  T C5    1 
ATOM   8401 C  C6    . DG  D 4 14  ? 194.86700 55.71400 91.25000  1.000 73.57000  ?  714 DG  T C6    1 
ATOM   8402 O  O6    . DG  D 4 14  ? 195.39000 55.18400 92.25100  1.000 73.37000  ?  714 DG  T O6    1 
ATOM   8403 N  N1    . DG  D 4 14  ? 193.76400 56.55000 91.40300  1.000 74.53000  ?  714 DG  T N1    1 
ATOM   8404 C  C2    . DG  D 4 14  ? 193.10900 57.19100 90.37500  1.000 75.39000  ?  714 DG  T C2    1 
ATOM   8405 N  N2    . DG  D 4 14  ? 192.07100 57.95300 90.72100  1.000 74.10000  ?  714 DG  T N2    1 
ATOM   8406 N  N3    . DG  D 4 14  ? 193.44800 57.09100 89.10000  1.000 75.65000  ?  714 DG  T N3    1 
ATOM   8407 C  C4    . DG  D 4 14  ? 194.52200 56.28300 88.93000  1.000 75.96000  ?  714 DG  T C4    1 
ATOM   8408 P  P     . DA  D 4 15  ? 194.56100 59.26800 83.23400  1.000 93.22000  ?  715 DA  T P     1 
ATOM   8409 O  OP1   . DA  D 4 15  ? 193.89200 59.16700 81.91600  1.000 88.13000  ?  715 DA  T OP1   1 
ATOM   8410 O  OP2   . DA  D 4 15  ? 196.02000 59.48300 83.32900  1.000 88.95000  ?  715 DA  T OP2   1 
ATOM   8411 O  "O5'" . DA  D 4 15  ? 193.80800 60.39600 84.09400  1.000 85.92000  ?  715 DA  T "O5'" 1 
ATOM   8412 C  "C5'" . DA  D 4 15  ? 192.44900 60.18100 84.46900  1.000 82.55000  ?  715 DA  T "C5'" 1 
ATOM   8413 C  "C4'" . DA  D 4 15  ? 191.99600 61.15700 85.54100  1.000 88.27000  ?  715 DA  T "C4'" 1 
ATOM   8414 O  "O4'" . DA  D 4 15  ? 192.34800 60.66000 86.86000  1.000 91.23000  ?  715 DA  T "O4'" 1 
ATOM   8415 C  "C3'" . DA  D 4 15  ? 192.59300 62.54600 85.46300  1.000 91.18000  ?  715 DA  T "C3'" 1 
ATOM   8416 O  "O3'" . DA  D 4 15  ? 191.64900 63.46400 85.99900  1.000 91.17000  ?  715 DA  T "O3'" 1 
ATOM   8417 C  "C2'" . DA  D 4 15  ? 193.83700 62.41300 86.35400  1.000 88.72000  ?  715 DA  T "C2'" 1 
ATOM   8418 C  "C1'" . DA  D 4 15  ? 193.31000 61.51100 87.46500  1.000 85.04000  ?  715 DA  T "C1'" 1 
ATOM   8419 N  N9    . DA  D 4 15  ? 194.32400 60.66200 88.10200  1.000 82.69000  ?  715 DA  T N9    1 
ATOM   8420 C  C8    . DA  D 4 15  ? 195.28800 59.91400 87.48400  1.000 79.54000  ?  715 DA  T C8    1 
ATOM   8421 N  N7    . DA  D 4 15  ? 196.03700 59.22400 88.31800  1.000 77.16000  ?  715 DA  T N7    1 
ATOM   8422 C  C5    . DA  D 4 15  ? 195.52300 59.53200 89.56700  1.000 74.34000  ?  715 DA  T C5    1 
ATOM   8423 C  C6    . DA  D 4 15  ? 195.87200 59.12200 90.87500  1.000 74.25000  ?  715 DA  T C6    1 
ATOM   8424 N  N6    . DA  D 4 15  ? 196.87200 58.27800 91.14800  1.000 71.41000  ?  715 DA  T N6    1 
ATOM   8425 N  N1    . DA  D 4 15  ? 195.14500 59.61200 91.89600  1.000 74.18000  ?  715 DA  T N1    1 
ATOM   8426 C  C2    . DA  D 4 15  ? 194.14400 60.45500 91.63000  1.000 73.12000  ?  715 DA  T C2    1 
ATOM   8427 N  N3    . DA  D 4 15  ? 193.72700 60.91400 90.45600  1.000 75.49000  ?  715 DA  T N3    1 
ATOM   8428 C  C4    . DA  D 4 15  ? 194.46100 60.40700 89.45300  1.000 79.02000  ?  715 DA  T C4    1 
ATOM   8429 P  P     . DA  D 4 16  ? 191.87500 65.04900 85.87700  1.000 100.92000 ?  716 DA  T P     1 
ATOM   8430 O  OP1   . DA  D 4 16  ? 190.73600 65.53300 85.06600  1.000 99.47000  ?  716 DA  T OP1   1 
ATOM   8431 O  OP2   . DA  D 4 16  ? 193.27000 65.31900 85.44600  1.000 93.93000  ?  716 DA  T OP2   1 
ATOM   8432 O  "O5'" . DA  D 4 16  ? 191.71600 65.56700 87.39200  1.000 99.94000  ?  716 DA  T "O5'" 1 
ATOM   8433 C  "C5'" . DA  D 4 16  ? 192.39600 66.75300 87.84700  1.000 100.82000 ?  716 DA  T "C5'" 1 
ATOM   8434 C  "C4'" . DA  D 4 16  ? 192.64400 66.67400 89.34500  1.000 98.00000  ?  716 DA  T "C4'" 1 
ATOM   8435 O  "O4'" . DA  D 4 16  ? 192.92900 65.29200 89.67800  1.000 90.03000  ?  716 DA  T "O4'" 1 
ATOM   8436 C  "C3'" . DA  D 4 16  ? 193.85100 67.46600 89.86100  1.000 100.35000 ?  716 DA  T "C3'" 1 
ATOM   8437 O  "O3'" . DA  D 4 16  ? 193.48800 68.86800 90.20700  1.000 107.70000 ?  716 DA  T "O3'" 1 
ATOM   8438 C  "C2'" . DA  D 4 16  ? 194.25600 66.66500 91.09700  1.000 93.24000  ?  716 DA  T "C2'" 1 
ATOM   8439 C  "C1'" . DA  D 4 16  ? 193.83600 65.23000 90.76300  1.000 86.22000  ?  716 DA  T "C1'" 1 
ATOM   8440 N  N9    . DA  D 4 16  ? 194.95100 64.34800 90.41100  1.000 81.84000  ?  716 DA  T N9    1 
ATOM   8441 C  C8    . DA  D 4 16  ? 195.42600 64.07600 89.15700  1.000 83.26000  ?  716 DA  T C8    1 
ATOM   8442 N  N7    . DA  D 4 16  ? 196.43700 63.23900 89.14300  1.000 77.89000  ?  716 DA  T N7    1 
ATOM   8443 C  C5    . DA  D 4 16  ? 196.63600 62.93400 90.48100  1.000 78.27000  ?  716 DA  T C5    1 
ATOM   8444 C  C6    . DA  D 4 16  ? 197.56800 62.09600 91.14500  1.000 75.82000  ?  716 DA  T C6    1 
ATOM   8445 N  N6    . DA  D 4 16  ? 198.50300 61.38200 90.51000  1.000 68.90000  ?  716 DA  T N6    1 
ATOM   8446 N  N1    . DA  D 4 16  ? 197.49400 62.02000 92.49100  1.000 73.62000  ?  716 DA  T N1    1 
ATOM   8447 C  C2    . DA  D 4 16  ? 196.55700 62.73400 93.12600  1.000 74.30000  ?  716 DA  T C2    1 
ATOM   8448 N  N3    . DA  D 4 16  ? 195.63600 63.55600 92.61400  1.000 80.64000  ?  716 DA  T N3    1 
ATOM   8449 C  C4    . DA  D 4 16  ? 195.73000 63.61100 91.27500  1.000 78.27000  ?  716 DA  T C4    1 
ATOM   8450 P  P     . DC  D 4 17  ? 194.61700 70.02600 90.44400  1.000 121.41000 ?  717 DC  T P     1 
ATOM   8451 O  OP1   . DC  D 4 17  ? 193.89400 71.30900 90.62300  1.000 117.47000 ?  717 DC  T OP1   1 
ATOM   8452 O  OP2   . DC  D 4 17  ? 195.68700 69.95800 89.42000  1.000 106.99000 ?  717 DC  T OP2   1 
ATOM   8453 O  "O5'" . DC  D 4 17  ? 195.29400 69.65100 91.84900  1.000 99.65000  ?  717 DC  T "O5'" 1 
ATOM   8454 C  "C5'" . DC  D 4 17  ? 194.46500 69.34200 92.96400  1.000 98.23000  ?  717 DC  T "C5'" 1 
ATOM   8455 C  "C4'" . DC  D 4 17  ? 195.21400 68.49100 93.96200  1.000 90.34000  ?  717 DC  T "C4'" 1 
ATOM   8456 O  "O4'" . DC  D 4 17  ? 195.55500 67.23700 93.35700  1.000 82.92000  ?  717 DC  T "O4'" 1 
ATOM   8457 C  "C3'" . DC  D 4 17  ? 196.52600 69.08600 94.41100  1.000 87.17000  ?  717 DC  T "C3'" 1 
ATOM   8458 O  "O3'" . DC  D 4 17  ? 196.30100 69.85400 95.55100  1.000 86.11000  ?  717 DC  T "O3'" 1 
ATOM   8459 C  "C2'" . DC  D 4 17  ? 197.38100 67.86600 94.73900  1.000 89.26000  ?  717 DC  T "C2'" 1 
ATOM   8460 C  "C1'" . DC  D 4 17  ? 196.75500 66.75000 93.90400  1.000 86.79000  ?  717 DC  T "C1'" 1 
ATOM   8461 N  N1    . DC  D 4 17  ? 197.63700 66.24400 92.79400  1.000 85.59000  ?  717 DC  T N1    1 
ATOM   8462 C  C2    . DC  D 4 17  ? 198.63400 65.31300 93.09100  1.000 78.45000  ?  717 DC  T C2    1 
ATOM   8463 O  O2    . DC  D 4 17  ? 198.77300 64.93600 94.26000  1.000 77.99000  ?  717 DC  T O2    1 
ATOM   8464 N  N3    . DC  D 4 17  ? 199.41700 64.84500 92.09100  1.000 75.14000  ?  717 DC  T N3    1 
ATOM   8465 C  C4    . DC  D 4 17  ? 199.23700 65.27200 90.84800  1.000 73.32000  ?  717 DC  T C4    1 
ATOM   8466 N  N4    . DC  D 4 17  ? 200.04300 64.77900 89.90800  1.000 73.10000  ?  717 DC  T N4    1 
ATOM   8467 C  C5    . DC  D 4 17  ? 198.22700 66.22500 90.51500  1.000 74.32000  ?  717 DC  T C5    1 
ATOM   8468 C  C6    . DC  D 4 17  ? 197.45500 66.68100 91.51000  1.000 83.98000  ?  717 DC  T C6    1 
ATOM   8469 P  P     . DA  D 4 18  ? 197.40600 70.90100 96.03600  1.000 97.30000  ?  718 DA  T P     1 
ATOM   8470 O  OP1   . DA  D 4 18  ? 196.78400 71.74600 97.08500  1.000 97.09000  ?  718 DA  T OP1   1 
ATOM   8471 O  OP2   . DA  D 4 18  ? 198.04500 71.50100 94.83700  1.000 91.57000  ?  718 DA  T OP2   1 
ATOM   8472 O  "O5'" . DA  D 4 18  ? 198.50900 69.98000 96.70800  1.000 87.74000  ?  718 DA  T "O5'" 1 
ATOM   8473 C  "C5'" . DA  D 4 18  ? 198.13600 68.96000 97.60700  1.000 85.67000  ?  718 DA  T "C5'" 1 
ATOM   8474 C  "C4'" . DA  D 4 18  ? 199.37100 68.45600 98.30300  1.000 83.02000  ?  718 DA  T "C4'" 1 
ATOM   8475 O  "O4'" . DA  D 4 18  ? 200.04500 67.50700 97.43400  1.000 85.85000  ?  718 DA  T "O4'" 1 
ATOM   8476 C  "C3'" . DA  D 4 18  ? 200.38000 69.55600 98.59000  1.000 81.79000  ?  718 DA  T "C3'" 1 
ATOM   8477 O  "O3'" . DA  D 4 18  ? 201.08100 69.29700 99.78600  1.000 82.45000  ?  718 DA  T "O3'" 1 
ATOM   8478 C  "C2'" . DA  D 4 18  ? 201.29600 69.52400 97.36700  1.000 82.52000  ?  718 DA  T "C2'" 1 
ATOM   8479 C  "C1'" . DA  D 4 18  ? 201.26800 68.04800 96.96300  1.000 82.89000  ?  718 DA  T "C1'" 1 
ATOM   8480 N  N9    . DA  D 4 18  ? 201.37300 67.83400 95.50700  1.000 79.57000  ?  718 DA  T N9    1 
ATOM   8481 C  C8    . DA  D 4 18  ? 200.66900 68.47300 94.52200  1.000 77.67000  ?  718 DA  T C8    1 
ATOM   8482 N  N7    . DA  D 4 18  ? 200.99100 68.09100 93.30700  1.000 77.30000  ?  718 DA  T N7    1 
ATOM   8483 C  C5    . DA  D 4 18  ? 201.98100 67.13900 93.50500  1.000 72.97000  ?  718 DA  T C5    1 
ATOM   8484 C  C6    . DA  D 4 18  ? 202.73800 66.34300 92.61100  1.000 70.44000  ?  718 DA  T C6    1 
ATOM   8485 N  N6    . DA  D 4 18  ? 202.60500 66.39000 91.27700  1.000 64.31000  ?  718 DA  T N6    1 
ATOM   8486 N  N1    . DA  D 4 18  ? 203.63600 65.49000 93.14400  1.000 67.23000  ?  718 DA  T N1    1 
ATOM   8487 C  C2    . DA  D 4 18  ? 203.76500 65.44000 94.46900  1.000 69.18000  ?  718 DA  T C2    1 
ATOM   8488 N  N3    . DA  D 4 18  ? 203.12000 66.13400 95.40500  1.000 73.96000  ?  718 DA  T N3    1 
ATOM   8489 C  C4    . DA  D 4 18  ? 202.23100 66.97100 94.85200  1.000 74.47000  ?  718 DA  T C4    1 
ATOM   8490 P  P     . DG  D 4 19  ? 202.14900 70.37300 100.32900 1.000 95.63000  ?  719 DG  T P     1 
ATOM   8491 O  OP1   . DG  D 4 19  ? 202.23900 70.23500 101.79800 1.000 91.91000  ?  719 DG  T OP1   1 
ATOM   8492 O  OP2   . DG  D 4 19  ? 201.93200 71.68800 99.67800  1.000 87.12000  ?  719 DG  T OP2   1 
ATOM   8493 O  "O5'" . DG  D 4 19  ? 203.51200 69.85800 99.74200  1.000 84.21000  ?  719 DG  T "O5'" 1 
ATOM   8494 C  "C5'" . DG  D 4 19  ? 203.98500 68.58500 100.08000 1.000 82.76000  ?  719 DG  T "C5'" 1 
ATOM   8495 C  "C4'" . DG  D 4 19  ? 205.34400 68.42100 99.47800  1.000 82.72000  ?  719 DG  T "C4'" 1 
ATOM   8496 O  "O4'" . DG  D 4 19  ? 205.18500 68.15300 98.06500  1.000 80.93000  ?  719 DG  T "O4'" 1 
ATOM   8497 C  "C3'" . DG  D 4 19  ? 206.19000 69.69600 99.55900  1.000 81.14000  ?  719 DG  T "C3'" 1 
ATOM   8498 O  "O3'" . DG  D 4 19  ? 207.52400 69.36900 99.75400  1.000 81.23000  ?  719 DG  T "O3'" 1 
ATOM   8499 C  "C2'" . DG  D 4 19  ? 205.97700 70.32500 98.19100  1.000 80.34000  ?  719 DG  T "C2'" 1 
ATOM   8500 C  "C1'" . DG  D 4 19  ? 205.96500 69.07500 97.34800  1.000 76.36000  ?  719 DG  T "C1'" 1 
ATOM   8501 N  N9    . DG  D 4 19  ? 205.40500 69.23700 96.02400  1.000 72.74000  ?  719 DG  T N9    1 
ATOM   8502 C  C8    . DG  D 4 19  ? 204.41700 70.09500 95.61900  1.000 75.89000  ?  719 DG  T C8    1 
ATOM   8503 N  N7    . DG  D 4 19  ? 204.13500 69.99300 94.34500  1.000 73.79000  ?  719 DG  T N7    1 
ATOM   8504 C  C5    . DG  D 4 19  ? 205.00100 69.01000 93.89300  1.000 71.09000  ?  719 DG  T C5    1 
ATOM   8505 C  C6    . DG  D 4 19  ? 205.17300 68.47200 92.60800  1.000 66.77000  ?  719 DG  T C6    1 
ATOM   8506 O  O6    . DG  D 4 19  ? 204.57100 68.76100 91.56800  1.000 66.09000  ?  719 DG  T O6    1 
ATOM   8507 N  N1    . DG  D 4 19  ? 206.15600 67.49000 92.59800  1.000 66.67000  ?  719 DG  T N1    1 
ATOM   8508 C  C2    . DG  D 4 19  ? 206.88400 67.08800 93.69400  1.000 66.56000  ?  719 DG  T C2    1 
ATOM   8509 N  N2    . DG  D 4 19  ? 207.78900 66.12700 93.49700  1.000 65.87000  ?  719 DG  T N2    1 
ATOM   8510 N  N3    . DG  D 4 19  ? 206.73800 67.59100 94.89400  1.000 69.17000  ?  719 DG  T N3    1 
ATOM   8511 C  C4    . DG  D 4 19  ? 205.78300 68.54100 94.91900  1.000 74.39000  ?  719 DG  T C4    1 
ATOM   8512 P  P     . DG  D 4 20  ? 208.51400 70.45200 100.39400 1.000 89.14000  ?  720 DG  T P     1 
ATOM   8513 O  OP1   . DG  D 4 20  ? 208.70000 70.08100 101.81600 1.000 78.82000  ?  720 DG  T OP1   1 
ATOM   8514 O  OP2   . DG  D 4 20  ? 208.04200 71.79400 99.95900  1.000 79.61000  ?  720 DG  T OP2   1 
ATOM   8515 O  "O5'" . DG  D 4 20  ? 209.89600 70.16300 99.67500  1.000 79.17000  ?  720 DG  T "O5'" 1 
ATOM   8516 C  "C5'" . DG  D 4 20  ? 210.35300 68.84400 99.56200  1.000 78.26000  ?  720 DG  T "C5'" 1 
ATOM   8517 C  "C4'" . DG  D 4 20  ? 211.18100 68.72000 98.31900  1.000 78.65000  ?  720 DG  T "C4'" 1 
ATOM   8518 O  "O4'" . DG  D 4 20  ? 210.30400 68.77700 97.16400  1.000 80.25000  ?  720 DG  T "O4'" 1 
ATOM   8519 C  "C3'" . DG  D 4 20  ? 212.18100 69.86100 98.14100  1.000 75.99000  ?  720 DG  T "C3'" 1 
ATOM   8520 O  "O3'" . DG  D 4 20  ? 213.41500 69.35000 97.72800  1.000 81.32000  ?  720 DG  T "O3'" 1 
ATOM   8521 C  "C2'" . DG  D 4 20  ? 211.54400 70.72700 97.05800  1.000 75.99000  ?  720 DG  T "C2'" 1 
ATOM   8522 C  "C1'" . DG  D 4 20  ? 210.85100 69.66700 96.22700  1.000 76.63000  ?  720 DG  T "C1'" 1 
ATOM   8523 N  N9    . DG  D 4 20  ? 209.78100 70.17800 95.38900  1.000 72.51000  ?  720 DG  T N9    1 
ATOM   8524 C  C8    . DG  D 4 20  ? 208.78700 71.05400 95.75000  1.000 75.32000  ?  720 DG  T C8    1 
ATOM   8525 N  N7    . DG  D 4 20  ? 207.96300 71.33500 94.77500  1.000 74.55000  ?  720 DG  T N7    1 
ATOM   8526 C  C5    . DG  D 4 20  ? 208.44000 70.59400 93.70700  1.000 69.62000  ?  720 DG  T C5    1 
ATOM   8527 C  C6    . DG  D 4 20  ? 207.94900 70.48300 92.39100  1.000 68.47000  ?  720 DG  T C6    1 
ATOM   8528 O  O6    . DG  D 4 20  ? 206.96400 71.04400 91.88800  1.000 68.56000  ?  720 DG  T O6    1 
ATOM   8529 N  N1    . DG  D 4 20  ? 208.73300 69.62500 91.62400  1.000 68.49000  ?  720 DG  T N1    1 
ATOM   8530 C  C2    . DG  D 4 20  ? 209.84000 68.94500 92.08700  1.000 67.89000  ?  720 DG  T C2    1 
ATOM   8531 N  N2    . DG  D 4 20  ? 210.46500 68.15800 91.20200  1.000 64.66000  ?  720 DG  T N2    1 
ATOM   8532 N  N3    . DG  D 4 20  ? 210.30100 69.03300 93.32300  1.000 64.17000  ?  720 DG  T N3    1 
ATOM   8533 C  C4    . DG  D 4 20  ? 209.56000 69.87600 94.07100  1.000 70.15000  ?  720 DG  T C4    1 
ATOM   8534 P  P     . DG  D 4 21  ? 214.72000 70.28100 97.78700  1.000 83.33000  ?  721 DG  T P     1 
ATOM   8535 O  OP1   . DG  D 4 21  ? 215.59600 69.67300 98.81100  1.000 77.96000  ?  721 DG  T OP1   1 
ATOM   8536 O  OP2   . DG  D 4 21  ? 214.31100 71.71200 97.83200  1.000 73.40000  ?  721 DG  T OP2   1 
ATOM   8537 O  "O5'" . DG  D 4 21  ? 215.38600 70.07700 96.35800  1.000 80.45000  ?  721 DG  T "O5'" 1 
ATOM   8538 C  "C5'" . DG  D 4 21  ? 215.53300 68.78800 95.82700  1.000 74.98000  ?  721 DG  T "C5'" 1 
ATOM   8539 C  "C4'" . DG  D 4 21  ? 215.84800 68.90000 94.36100  1.000 77.90000  ?  721 DG  T "C4'" 1 
ATOM   8540 O  "O4'" . DG  D 4 21  ? 214.62800 69.19700 93.65200  1.000 76.42000  ?  721 DG  T "O4'" 1 
ATOM   8541 C  "C3'" . DG  D 4 21  ? 216.82400 70.02500 94.01100  1.000 78.66000  ?  721 DG  T "C3'" 1 
ATOM   8542 O  "O3'" . DG  D 4 21  ? 217.70600 69.59200 93.00100  1.000 84.61000  ?  721 DG  T "O3'" 1 
ATOM   8543 C  "C2'" . DG  D 4 21  ? 215.91000 71.13600 93.50800  1.000 77.46000  ?  721 DG  T "C2'" 1 
ATOM   8544 C  "C1'" . DG  D 4 21  ? 214.81400 70.32800 92.84200  1.000 75.06000  ?  721 DG  T "C1'" 1 
ATOM   8545 N  N9    . DG  D 4 21  ? 213.54200 71.03300 92.75500  1.000 73.26000  ?  721 DG  T N9    1 
ATOM   8546 C  C8    . DG  D 4 21  ? 212.87800 71.66600 93.77700  1.000 71.22000  ?  721 DG  T C8    1 
ATOM   8547 N  N7    . DG  D 4 21  ? 211.75200 72.21000 93.40400  1.000 71.99000  ?  721 DG  T N7    1 
ATOM   8548 C  C5    . DG  D 4 21  ? 211.66400 71.91900 92.04800  1.000 70.47000  ?  721 DG  T C5    1 
ATOM   8549 C  C6    . DG  D 4 21  ? 210.66200 72.25200 91.11200  1.000 67.25000  ?  721 DG  T C6    1 
ATOM   8550 O  O6    . DG  D 4 21  ? 209.62800 72.89200 91.30200  1.000 71.34000  ?  721 DG  T O6    1 
ATOM   8551 N  N1    . DG  D 4 21  ? 210.95200 71.76100 89.84200  1.000 66.71000  ?  721 DG  T N1    1 
ATOM   8552 C  C2    . DG  D 4 21  ? 212.07700 71.03700 89.51600  1.000 69.10000  ?  721 DG  T C2    1 
ATOM   8553 N  N2    . DG  D 4 21  ? 212.18600 70.64800 88.23400  1.000 66.14000  ?  721 DG  T N2    1 
ATOM   8554 N  N3    . DG  D 4 21  ? 213.02700 70.71100 90.38800  1.000 69.44000  ?  721 DG  T N3    1 
ATOM   8555 C  C4    . DG  D 4 21  ? 212.75400 71.18700 91.63300  1.000 70.48000  ?  721 DG  T C4    1 
ATOM   8556 P  P     . DA  D 4 22  ? 218.88700 70.55600 92.48800  1.000 93.10000  ?  722 DA  T P     1 
ATOM   8557 O  OP1   . DA  D 4 22  ? 220.07500 69.68300 92.24300  1.000 78.84000  ?  722 DA  T OP1   1 
ATOM   8558 O  OP2   . DA  D 4 22  ? 218.93800 71.69800 93.43900  1.000 83.93000  ?  722 DA  T OP2   1 
ATOM   8559 O  "O5'" . DA  D 4 22  ? 218.35300 71.09000 91.07600  1.000 78.86000  ?  722 DA  T "O5'" 1 
ATOM   8560 C  "C5'" . DA  D 4 22  ? 217.93900 70.15900 90.10700  1.000 70.93000  ?  722 DA  T "C5'" 1 
ATOM   8561 C  "C4'" . DA  D 4 22  ? 217.81300 70.82400 88.76800  1.000 75.25000  ?  722 DA  T "C4'" 1 
ATOM   8562 O  "O4'" . DA  D 4 22  ? 216.48600 71.38300 88.63400  1.000 72.90000  ?  722 DA  T "O4'" 1 
ATOM   8563 C  "C3'" . DA  D 4 22  ? 218.79500 71.96400 88.53100  1.000 79.67000  ?  722 DA  T "C3'" 1 
ATOM   8564 O  "O3'" . DA  D 4 22  ? 219.22400 71.96600 87.17000  1.000 82.35000  ?  722 DA  T "O3'" 1 
ATOM   8565 C  "C2'" . DA  D 4 22  ? 217.98800 73.21100 88.87800  1.000 78.38000  ?  722 DA  T "C2'" 1 
ATOM   8566 C  "C1'" . DA  D 4 22  ? 216.54600 72.79200 88.57400  1.000 77.42000  ?  722 DA  T "C1'" 1 
ATOM   8567 N  N9    . DA  D 4 22  ? 215.57300 73.35500 89.52500  1.000 74.98000  ?  722 DA  T N9    1 
ATOM   8568 C  C8    . DA  D 4 22  ? 215.72500 73.48800 90.88300  1.000 71.09000  ?  722 DA  T C8    1 
ATOM   8569 N  N7    . DA  D 4 22  ? 214.69900 74.04700 91.47800  1.000 68.28000  ?  722 DA  T N7    1 
ATOM   8570 C  C5    . DA  D 4 22  ? 213.81000 74.30500 90.44000  1.000 70.27000  ?  722 DA  T C5    1 
ATOM   8571 C  C6    . DA  D 4 22  ? 212.52000 74.89100 90.40900  1.000 65.36000  ?  722 DA  T C6    1 
ATOM   8572 N  N6    . DA  D 4 22  ? 211.89600 75.34200 91.49100  1.000 64.42000  ?  722 DA  T N6    1 
ATOM   8573 N  N1    . DA  D 4 22  ? 211.90600 74.99600 89.21500  1.000 66.89000  ?  722 DA  T N1    1 
ATOM   8574 C  C2    . DA  D 4 22  ? 212.54100 74.54400 88.12000  1.000 70.44000  ?  722 DA  T C2    1 
ATOM   8575 N  N3    . DA  D 4 22  ? 213.74700 73.97000 88.02200  1.000 69.28000  ?  722 DA  T N3    1 
ATOM   8576 C  C4    . DA  D 4 22  ? 214.33500 73.88300 89.23100  1.000 68.98000  ?  722 DA  T C4    1 
ATOM   8577 P  P     . DC  D 4 23  ? 220.17000 73.13700 86.61200  1.000 85.79000  ?  723 DC  T P     1 
ATOM   8578 O  OP1   . DC  D 4 23  ? 220.99600 72.53300 85.54500  1.000 80.87000  ?  723 DC  T OP1   1 
ATOM   8579 O  OP2   . DC  D 4 23  ? 220.79400 73.87000 87.73700  1.000 77.37000  ?  723 DC  T OP2   1 
ATOM   8580 O  "O5'" . DC  D 4 23  ? 219.13800 74.13700 85.93900  1.000 84.36000  ?  723 DC  T "O5'" 1 
ATOM   8581 C  "C5'" . DC  D 4 23  ? 218.35700 73.69600 84.85700  1.000 78.46000  ?  723 DC  T "C5'" 1 
ATOM   8582 C  "C4'" . DC  D 4 23  ? 217.36800 74.76900 84.45900  1.000 80.78000  ?  723 DC  T "C4'" 1 
ATOM   8583 O  "O4'" . DC  D 4 23  ? 216.46100 74.99700 85.55500  1.000 84.48000  ?  723 DC  T "O4'" 1 
ATOM   8584 C  "C3'" . DC  D 4 23  ? 217.99900 76.12100 84.13500  1.000 79.99000  ?  723 DC  T "C3'" 1 
ATOM   8585 O  "O3'" . DC  D 4 23  ? 217.68300 76.50100 82.80900  1.000 88.59000  ?  723 DC  T "O3'" 1 
ATOM   8586 C  "C2'" . DC  D 4 23  ? 217.40100 77.08600 85.16200  1.000 77.39000  ?  723 DC  T "C2'" 1 
ATOM   8587 C  "C1'" . DC  D 4 23  ? 216.14600 76.35800 85.61400  1.000 79.33000  ?  723 DC  T "C1'" 1 
ATOM   8588 N  N1    . DC  D 4 23  ? 215.74900 76.68300 87.01300  1.000 72.50000  ?  723 DC  T N1    1 
ATOM   8589 C  C2    . DC  D 4 23  ? 214.47600 77.21800 87.27100  1.000 70.39000  ?  723 DC  T C2    1 
ATOM   8590 O  O2    . DC  D 4 23  ? 213.69200 77.40100 86.32800  1.000 68.19000  ?  723 DC  T O2    1 
ATOM   8591 N  N3    . DC  D 4 23  ? 214.14200 77.51800 88.55200  1.000 70.13000  ?  723 DC  T N3    1 
ATOM   8592 C  C4    . DC  D 4 23  ? 215.01700 77.29500 89.54100  1.000 67.09000  ?  723 DC  T C4    1 
ATOM   8593 N  N4    . DC  D 4 23  ? 214.64600 77.60000 90.78000  1.000 61.40000  ?  723 DC  T N4    1 
ATOM   8594 C  C5    . DC  D 4 23  ? 216.30900 76.75000 89.29600  1.000 68.63000  ?  723 DC  T C5    1 
ATOM   8595 C  C6    . DC  D 4 23  ? 216.63200 76.46300 88.03100  1.000 69.25000  ?  723 DC  T C6    1 
ATOM   8596 P  P     . DT  D 4 24  ? 218.42100 77.77100 82.16300  1.000 102.31000 ?  724 DT  T P     1 
ATOM   8597 O  OP1   . DT  D 4 24  ? 218.35200 77.65600 80.68300  1.000 90.39000  ?  724 DT  T OP1   1 
ATOM   8598 O  OP2   . DT  D 4 24  ? 219.71600 77.97300 82.87600  1.000 86.08000  ?  724 DT  T OP2   1 
ATOM   8599 O  "O5'" . DT  D 4 24  ? 217.48800 78.97400 82.61200  1.000 97.21000  ?  724 DT  T "O5'" 1 
ATOM   8600 C  "C5'" . DT  D 4 24  ? 216.11000 78.94700 82.29900  1.000 90.29000  ?  724 DT  T "C5'" 1 
ATOM   8601 C  "C4'" . DT  D 4 24  ? 215.62800 80.35400 82.05600  1.000 94.34000  ?  724 DT  T "C4'" 1 
ATOM   8602 O  "O4'" . DT  D 4 24  ? 215.56300 81.05200 83.32700  1.000 95.88000  ?  724 DT  T "O4'" 1 
ATOM   8603 C  "C3'" . DT  D 4 24  ? 216.55000 81.18800 81.17200  1.000 97.62000  ?  724 DT  T "C3'" 1 
ATOM   8604 O  "O3'" . DT  D 4 24  ? 215.77300 82.09000 80.37000  1.000 106.17000 ?  724 DT  T "O3'" 1 
ATOM   8605 C  "C2'" . DT  D 4 24  ? 217.42700 81.91300 82.19900  1.000 95.55000  ?  724 DT  T "C2'" 1 
ATOM   8606 C  "C1'" . DT  D 4 24  ? 216.41800 82.17300 83.30600  1.000 91.83000  ?  724 DT  T "C1'" 1 
ATOM   8607 N  N1    . DT  D 4 24  ? 217.00900 82.35000 84.67100  1.000 86.06000  ?  724 DT  T N1    1 
ATOM   8608 C  C2    . DT  D 4 24  ? 216.49300 83.32300 85.48500  1.000 84.80000  ?  724 DT  T C2    1 
ATOM   8609 O  O2    . DT  D 4 24  ? 215.58300 84.05500 85.14900  1.000 85.27000  ?  724 DT  T O2    1 
ATOM   8610 N  N3    . DT  D 4 24  ? 217.08300 83.41800 86.71400  1.000 83.99000  ?  724 DT  T N3    1 
ATOM   8611 C  C4    . DT  D 4 24  ? 218.11800 82.64600 87.20900  1.000 84.29000  ?  724 DT  T C4    1 
ATOM   8612 O  O4    . DT  D 4 24  ? 218.58000 82.81400 88.34000  1.000 83.13000  ?  724 DT  T O4    1 
ATOM   8613 C  C5    . DT  D 4 24  ? 218.61500 81.63000 86.30500  1.000 83.10000  ?  724 DT  T C5    1 
ATOM   8614 C  C7    . DT  D 4 24  ? 219.73400 80.72700 86.72500  1.000 77.01000  ?  724 DT  T C7    1 
ATOM   8615 C  C6    . DT  D 4 24  ? 218.04200 81.53300 85.09100  1.000 86.97000  ?  724 DT  T C6    1 
ATOM   8616 P  P     . DG  D 4 25  ? 216.48700 83.21000 79.46700  1.000 104.09000 ?  725 DG  T P     1 
ATOM   8617 O  OP1   . DG  D 4 25  ? 215.45600 83.79100 78.58800  1.000 105.11000 ?  725 DG  T OP1   1 
ATOM   8618 O  OP2   . DG  D 4 25  ? 217.74100 82.65400 78.89000  1.000 94.06000  ?  725 DG  T OP2   1 
ATOM   8619 O  "O5'" . DG  D 4 25  ? 216.92500 84.32900 80.52200  1.000 108.00000 ?  725 DG  T "O5'" 1 
ATOM   8620 C  "C5'" . DG  D 4 25  ? 215.98800 85.25600 81.04400  1.000 97.17000  ?  725 DG  T "C5'" 1 
ATOM   8621 C  "C4'" . DG  D 4 25  ? 216.73400 86.42500 81.64700  1.000 98.07000  ?  725 DG  T "C4'" 1 
ATOM   8622 O  "O4'" . DG  D 4 25  ? 217.43100 85.98200 82.85100  1.000 98.16000  ?  725 DG  T "O4'" 1 
ATOM   8623 C  "C3'" . DG  D 4 25  ? 217.80900 87.01500 80.72600  1.000 97.45000  ?  725 DG  T "C3'" 1 
ATOM   8624 O  "O3'" . DG  D 4 25  ? 217.82400 88.42500 80.83700  1.000 102.18000 ?  725 DG  T "O3'" 1 
ATOM   8625 C  "C2'" . DG  D 4 25  ? 219.09900 86.40000 81.26000  1.000 96.97000  ?  725 DG  T "C2'" 1 
ATOM   8626 C  "C1'" . DG  D 4 25  ? 218.79800 86.33600 82.75300  1.000 101.31000 ?  725 DG  T "C1'" 1 
ATOM   8627 N  N9    . DG  D 4 25  ? 219.62500 85.35800 83.47400  1.000 95.35000  ?  725 DG  T N9    1 
ATOM   8628 C  C8    . DG  D 4 25  ? 220.30000 84.29300 82.92400  1.000 95.58000  ?  725 DG  T C8    1 
ATOM   8629 N  N7    . DG  D 4 25  ? 220.98100 83.59800 83.79300  1.000 92.20000  ?  725 DG  T N7    1 
ATOM   8630 C  C5    . DG  D 4 25  ? 220.75700 84.24700 85.00300  1.000 91.77000  ?  725 DG  T C5    1 
ATOM   8631 C  C6    . DG  D 4 25  ? 221.24000 83.94400 86.30100  1.000 89.86000  ?  725 DG  T C6    1 
ATOM   8632 O  O6    . DG  D 4 25  ? 221.98200 83.01400 86.64400  1.000 91.84000  ?  725 DG  T O6    1 
ATOM   8633 N  N1    . DG  D 4 25  ? 220.77200 84.84900 87.25300  1.000 88.32000  ?  725 DG  T N1    1 
ATOM   8634 C  C2    . DG  D 4 25  ? 219.94500 85.91600 86.98400  1.000 88.00000  ?  725 DG  T C2    1 
ATOM   8635 N  N2    . DG  D 4 25  ? 219.60200 86.68100 88.03600  1.000 82.34000  ?  725 DG  T N2    1 
ATOM   8636 N  N3    . DG  D 4 25  ? 219.48400 86.21400 85.76800  1.000 91.58000  ?  725 DG  T N3    1 
ATOM   8637 C  C4    . DG  D 4 25  ? 219.92700 85.33800 84.82900  1.000 90.89000  ?  725 DG  T C4    1 
ATOM   8638 P  P     . DT  D 4 26  ? 217.15700 89.34000 79.69500  1.000 107.25000 ?  726 DT  T P     1 
ATOM   8639 O  OP1   . DT  D 4 26  ? 216.70400 90.59100 80.36100  1.000 100.22000 ?  726 DT  T OP1   1 
ATOM   8640 O  OP2   . DT  D 4 26  ? 216.15300 88.50400 78.98600  1.000 105.29000 ?  726 DT  T OP2   1 
ATOM   8641 O  "O5'" . DT  D 4 26  ? 218.38400 89.68700 78.70800  1.000 99.10000  ?  726 DT  T "O5'" 1 
ATOM   8642 C  "C5'" . DT  D 4 26  ? 218.85200 88.71500 77.76700  1.000 97.54000  ?  726 DT  T "C5'" 1 
ATOM   8643 C  "C4'" . DT  D 4 26  ? 219.11300 89.34800 76.40400  1.000 102.59000 ?  726 DT  T "C4'" 1 
ATOM   8644 O  "O4'" . DT  D 4 26  ? 218.34700 90.58400 76.26700  1.000 101.47000 ?  726 DT  T "O4'" 1 
ATOM   8645 C  "C3'" . DT  D 4 26  ? 220.56400 89.73400 76.13300  1.000 103.91000 ?  726 DT  T "C3'" 1 
ATOM   8646 O  "O3'" . DT  D 4 26  ? 220.84600 89.60400 74.73400  1.000 99.96000  ?  726 DT  T "O3'" 1 
ATOM   8647 C  "C2'" . DT  D 4 26  ? 220.60700 91.19600 76.58200  1.000 100.55000 ?  726 DT  T "C2'" 1 
ATOM   8648 C  "C1'" . DT  D 4 26  ? 219.23600 91.69000 76.11800  1.000 103.34000 ?  726 DT  T "C1'" 1 
ATOM   8649 N  N1    . DT  D 4 26  ? 218.69400 92.88700 76.91300  1.000 100.00000 ?  726 DT  T N1    1 
ATOM   8650 C  C2    . DT  D 4 26  ? 218.66900 94.15100 76.32600  1.000 92.39000  ?  726 DT  T C2    1 
ATOM   8651 O  O2    . DT  D 4 26  ? 219.06200 94.37800 75.18200  1.000 87.77000  ?  726 DT  T O2    1 
ATOM   8652 N  N3    . DT  D 4 26  ? 218.15400 95.14500 77.13500  1.000 89.74000  ?  726 DT  T N3    1 
ATOM   8653 C  C4    . DT  D 4 26  ? 217.67400 95.01000 78.44100  1.000 90.95000  ?  726 DT  T C4    1 
ATOM   8654 O  O4    . DT  D 4 26  ? 217.24100 95.96100 79.08600  1.000 88.68000  ?  726 DT  T O4    1 
ATOM   8655 C  C5    . DT  D 4 26  ? 217.72800 93.67700 78.99400  1.000 91.62000  ?  726 DT  T C5    1 
ATOM   8656 C  C7    . DT  D 4 26  ? 217.23700 93.42600 80.39900  1.000 79.83000  ?  726 DT  T C7    1 
ATOM   8657 C  C6    . DT  D 4 26  ? 218.23000 92.68900 78.21500  1.000 96.81000  ?  726 DT  T C6    1 
HETATM 8658 S  S     . SO4 E 5 .   ? 243.73100 56.61000 87.89100  1.000 67.71000  ?  601 SO4 A S     1 
HETATM 8659 O  O1    . SO4 E 5 .   ? 245.05900 57.16100 87.63500  1.000 63.07000  ?  601 SO4 A O1    1 
HETATM 8660 O  O2    . SO4 E 5 .   ? 242.91800 56.52800 86.67300  1.000 58.49000  ?  601 SO4 A O2    1 
HETATM 8661 O  O3    . SO4 E 5 .   ? 243.08800 57.51500 88.83500  1.000 64.01000  ?  601 SO4 A O3    1 
HETATM 8662 O  O4    . SO4 E 5 .   ? 243.86400 55.26200 88.45400  1.000 68.65000  ?  601 SO4 A O4    1 
HETATM 8663 S  S     . SO4 F 5 .   ? 205.41100 24.48800 99.26200  1.000 108.23000 ?  602 SO4 A S     1 
HETATM 8664 O  O1    . SO4 F 5 .   ? 206.22800 25.49300 98.58300  1.000 95.88000  ?  602 SO4 A O1    1 
HETATM 8665 O  O2    . SO4 F 5 .   ? 204.14500 24.33700 98.54300  1.000 99.50000  ?  602 SO4 A O2    1 
HETATM 8666 O  O3    . SO4 F 5 .   ? 206.09900 23.19300 99.26200  1.000 92.03000  ?  602 SO4 A O3    1 
HETATM 8667 O  O4    . SO4 F 5 .   ? 205.16600 24.93500 100.64000 1.000 101.24000 ?  602 SO4 A O4    1 
HETATM 8668 MG MG    . MG  G 6 .   ? 168.03400 36.44100 105.92300 1.000 41.57000  ?  603 MG  A MG    1 
HETATM 8669 O  OAC   . N8G H 7 .   ? 166.59100 35.30000 104.88300 1.000 58.46000  ?  604 N8G A OAC   1 
HETATM 8670 P  PAZ   . N8G H 7 .   ? 165.54500 35.69100 103.89700 1.000 51.44000  ?  604 N8G A PAZ   1 
HETATM 8671 O  OAF   . N8G H 7 .   ? 164.04900 35.75300 104.49900 1.000 62.31000  -1 604 N8G A OAF   1 
HETATM 8672 O  OAG   . N8G H 7 .   ? 165.39400 34.66500 102.65800 1.000 61.68000  -1 604 N8G A OAG   1 
HETATM 8673 O  OAQ   . N8G H 7 .   ? 165.77500 37.13400 103.23100 1.000 49.61000  ?  604 N8G A OAQ   1 
HETATM 8674 P  PBB   . N8G H 7 .   ? 166.44000 38.40100 103.93300 1.000 52.02000  ?  604 N8G A PBB   1 
HETATM 8675 O  OAI   . N8G H 7 .   ? 166.82000 38.12900 105.35400 1.000 51.71000  ?  604 N8G A OAI   1 
HETATM 8676 O  OAE   . N8G H 7 .   ? 165.54000 39.72900 103.77900 1.000 56.91000  -1 604 N8G A OAE   1 
HETATM 8677 O  OAR   . N8G H 7 .   ? 167.66500 38.66700 102.94600 1.000 49.91000  ?  604 N8G A OAR   1 
HETATM 8678 P  PBA   . N8G H 7 .   ? 169.09200 37.88800 102.95900 1.000 48.09000  ?  604 N8G A PBA   1 
HETATM 8679 O  OAH   . N8G H 7 .   ? 169.37600 37.11200 101.70700 1.000 49.48000  ?  604 N8G A OAH   1 
HETATM 8680 O  OAD   . N8G H 7 .   ? 169.08900 36.98000 104.30400 1.000 48.23000  -1 604 N8G A OAD   1 
HETATM 8681 O  OAO   . N8G H 7 .   ? 170.10800 39.10900 103.28500 1.000 48.33000  ?  604 N8G A OAO   1 
HETATM 8682 C  CAL   . N8G H 7 .   ? 169.95300 39.83900 104.49700 1.000 46.49000  ?  604 N8G A CAL   1 
HETATM 8683 C  CAW   . N8G H 7 .   ? 169.87600 41.34800 104.23100 1.000 49.70000  ?  604 N8G A CAW   1 
HETATM 8684 O  OAP   . N8G H 7 .   ? 171.01700 41.84400 103.52100 1.000 47.49000  ?  604 N8G A OAP   1 
HETATM 8685 S  SAS   . N8G H 7 .   ? 168.38400 41.81200 103.34000 1.000 48.01000  ?  604 N8G A SAS   1 
HETATM 8686 C  CAM   . N8G H 7 .   ? 169.17400 43.29000 102.71500 1.000 43.83000  ?  604 N8G A CAM   1 
HETATM 8687 C  CAX   . N8G H 7 .   ? 170.64100 42.89700 102.61800 1.000 44.18000  ?  604 N8G A CAX   1 
HETATM 8688 N  NAY   . N8G H 7 .   ? 171.01000 42.51500 101.25000 1.000 48.86000  ?  604 N8G A NAY   1 
HETATM 8689 C  CAK   . N8G H 7 .   ? 171.29100 41.20300 100.94000 1.000 49.40000  ?  604 N8G A CAK   1 
HETATM 8690 C  CAU   . N8G H 7 .   ? 171.64300 40.86700 99.70300  1.000 51.56000  ?  604 N8G A CAU   1 
HETATM 8691 F  FAJ   . N8G H 7 .   ? 171.94800 39.63800 99.26300  1.000 51.22000  ?  604 N8G A FAJ   1 
HETATM 8692 C  CAV   . N8G H 7 .   ? 171.08000 43.51500 100.25400 1.000 47.54000  ?  604 N8G A CAV   1 
HETATM 8693 O  OAB   . N8G H 7 .   ? 170.82200 44.69300 100.50800 1.000 50.16000  ?  604 N8G A OAB   1 
HETATM 8694 N  NAN   . N8G H 7 .   ? 171.44300 43.15100 98.97700  1.000 48.32000  ?  604 N8G A NAN   1 
HETATM 8695 C  CAT   . N8G H 7 .   ? 171.71300 41.91000 98.68500  1.000 51.29000  ?  604 N8G A CAT   1 
HETATM 8696 N  NAA   . N8G H 7 .   ? 172.06400 41.50600 97.42100  1.000 55.96000  ?  604 N8G A NAA   1 
HETATM 8697 O  O     . HOH I 8 .   ? 240.38000 57.72500 89.28100  1.000 49.12000  ?  701 HOH A O     1 
HETATM 8698 O  O     . HOH I 8 .   ? 158.05500 54.17900 92.07000  1.000 57.86000  ?  702 HOH A O     1 
HETATM 8699 O  O     . HOH I 8 .   ? 195.20400 23.69100 105.18600 1.000 54.47000  ?  703 HOH A O     1 
HETATM 8700 O  O     . HOH I 8 .   ? 231.51000 63.78300 72.03200  1.000 50.54000  ?  704 HOH A O     1 
HETATM 8701 O  O     . HOH I 8 .   ? 238.27700 52.30400 85.32400  1.000 49.73000  ?  705 HOH A O     1 
HETATM 8702 O  O     . HOH I 8 .   ? 188.47700 39.41400 109.51800 1.000 40.29000  ?  706 HOH A O     1 
HETATM 8703 O  O     . HOH I 8 .   ? 162.37200 38.06300 111.30200 1.000 48.45000  ?  707 HOH A O     1 
HETATM 8704 O  O     . HOH I 8 .   ? 211.87900 58.94400 77.33900  1.000 57.19000  ?  708 HOH A O     1 
HETATM 8705 O  O     . HOH I 8 .   ? 214.00200 38.45500 113.42800 1.000 54.83000  ?  709 HOH A O     1 
HETATM 8706 O  O     . HOH I 8 .   ? 174.70400 16.35600 124.66300 1.000 56.68000  ?  710 HOH A O     1 
HETATM 8707 O  O     . HOH I 8 .   ? 198.21300 32.53600 96.35800  1.000 56.31000  ?  711 HOH A O     1 
HETATM 8708 O  O     . HOH I 8 .   ? 201.18500 30.79600 121.02800 1.000 61.43000  ?  712 HOH A O     1 
HETATM 8709 O  O     . HOH I 8 .   ? 203.32600 24.80500 105.34200 1.000 64.93000  ?  713 HOH A O     1 
HETATM 8710 O  O     . HOH I 8 .   ? 193.22900 25.62400 121.73800 1.000 57.52000  ?  714 HOH A O     1 
HETATM 8711 O  O     . HOH I 8 .   ? 239.931   47.880   93.481    1.000 51.27000  ?  715 HOH A O     1 
HETATM 8712 O  O     . HOH I 8 .   ? 236.62100 51.54400 97.39100  1.000 55.61000  ?  716 HOH A O     1 
HETATM 8713 O  O     . HOH I 8 .   ? 154.40100 50.17100 111.46500 1.000 56.76000  ?  717 HOH A O     1 
HETATM 8714 O  O     . HOH I 8 .   ? 161.37200 27.51400 112.35200 1.000 52.91000  ?  718 HOH A O     1 
HETATM 8715 O  O     . HOH I 8 .   ? 218.03200 32.07200 94.15600  1.000 54.19000  ?  719 HOH A O     1 
HETATM 8716 O  O     . HOH I 8 .   ? 178.71900 18.53200 118.21400 1.000 54.61000  ?  720 HOH A O     1 
HETATM 8717 O  O     . HOH I 8 .   ? 184.49400 24.99300 113.75300 1.000 54.47000  ?  721 HOH A O     1 
HETATM 8718 O  O     . HOH I 8 .   ? 157.43800 38.46500 106.63500 1.000 68.07000  ?  722 HOH A O     1 
HETATM 8719 O  O     . HOH I 8 .   ? 157.79600 40.49600 104.83500 1.000 65.44000  ?  723 HOH A O     1 
HETATM 8720 O  O     . HOH J 8 .   ? 183.94900 77.20500 121.07600 1.000 78.99000  ?  501 HOH B O     1 
HETATM 8721 O  O     . HOH J 8 .   ? 180.51700 48.60700 127.12100 1.000 57.86000  ?  502 HOH B O     1 
HETATM 8722 O  O     . HOH J 8 .   ? 177.26200 55.95200 130.09400 1.000 53.86000  ?  503 HOH B O     1 
HETATM 8723 O  O     . HOH J 8 .   ? 186.72400 37.53600 117.48000 1.000 41.19000  ?  504 HOH B O     1 
HETATM 8724 O  O     . HOH J 8 .   ? 246.43700 66.58600 101.78200 1.000 63.59000  ?  505 HOH B O     1 
HETATM 8725 O  O     . HOH J 8 .   ? 199.93500 44.37400 121.19600 1.000 56.15000  ?  506 HOH B O     1 
HETATM 8726 O  O     . HOH J 8 .   ? 203.28500 61.89000 104.35900 1.000 51.46000  ?  507 HOH B O     1 
HETATM 8727 O  O     . HOH J 8 .   ? 232.73200 80.65400 98.50700  1.000 57.90000  ?  508 HOH B O     1 
HETATM 8728 O  O     . HOH J 8 .   ? 197.95200 65.03200 120.65200 1.000 53.00000  ?  509 HOH B O     1 
HETATM 8729 O  O     . HOH J 8 .   ? 197.32500 47.66100 117.03400 1.000 55.35000  ?  510 HOH B O     1 
HETATM 8730 O  O     . HOH J 8 .   ? 198.20200 48.41500 113.42300 1.000 54.95000  ?  511 HOH B O     1 
HETATM 8731 O  O     . HOH J 8 .   ? 195.04500 42.62200 127.68400 1.000 50.78000  ?  512 HOH B O     1 
HETATM 8732 O  O     . HOH J 8 .   ? 199.44700 63.85700 111.15600 1.000 49.53000  ?  513 HOH B O     1 
HETATM 8733 O  O     . HOH J 8 .   ? 217.18700 45.04000 112.15900 1.000 56.44000  ?  514 HOH B O     1 
HETATM 8734 O  O     . HOH J 8 .   ? 196.80300 63.54800 111.47700 1.000 52.68000  ?  515 HOH B O     1 
HETATM 8735 O  O     . HOH J 8 .   ? 216.15700 48.89000 119.64700 1.000 55.19000  ?  516 HOH B O     1 
HETATM 8736 O  O     . HOH J 8 .   ? 214.82700 79.16300 121.35000 1.000 71.82000  ?  517 HOH B O     1 
HETATM 8737 O  O     . HOH J 8 .   ? 248.29900 61.46300 112.73700 1.000 78.69000  ?  518 HOH B O     1 
HETATM 8738 O  O     . HOH J 8 .   ? 250.65200 60.40400 111.54400 1.000 76.49000  ?  519 HOH B O     1 
HETATM 8739 O  O     . HOH K 8 .   ? 189.84200 45.69400 87.83500  1.000 67.27000  ?  901 HOH P O     1 
HETATM 8740 O  O     . HOH K 8 .   ? 183.78200 38.48700 101.15100 1.000 49.53000  ?  902 HOH P O     1 
HETATM 8741 O  O     . HOH K 8 .   ? 209.91300 60.46000 83.86300  1.000 61.19000  ?  903 HOH P O     1 
HETATM 8742 O  O     . HOH L 8 .   ? 184.43800 50.50400 107.73000 1.000 48.04000  ?  801 HOH T O     1 
HETATM 8743 O  O     . HOH L 8 .   ? 178.34200 46.37600 96.09700  1.000 57.41000  ?  802 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -11 ?   ?   ?   A . n 
A 1 2   GLY 2   -10 ?   ?   ?   A . n 
A 1 3   SER 3   -9  ?   ?   ?   A . n 
A 1 4   SER 4   -8  ?   ?   ?   A . n 
A 1 5   HIS 5   -7  ?   ?   ?   A . n 
A 1 6   HIS 6   -6  ?   ?   ?   A . n 
A 1 7   HIS 7   -5  ?   ?   ?   A . n 
A 1 8   HIS 8   -4  ?   ?   ?   A . n 
A 1 9   HIS 9   -3  ?   ?   ?   A . n 
A 1 10  HIS 10  -2  ?   ?   ?   A . n 
A 1 11  SER 11  -1  ?   ?   ?   A . n 
A 1 12  SER 12  0   ?   ?   ?   A . n 
A 1 13  PRO 13  1   1   PRO PRO A . n 
A 1 14  ILE 14  2   2   ILE ILE A . n 
A 1 15  SER 15  3   3   SER SER A . n 
A 1 16  PRO 16  4   4   PRO PRO A . n 
A 1 17  ILE 17  5   5   ILE ILE A . n 
A 1 18  GLU 18  6   6   GLU GLU A . n 
A 1 19  THR 19  7   7   THR THR A . n 
A 1 20  VAL 20  8   8   VAL VAL A . n 
A 1 21  PRO 21  9   9   PRO PRO A . n 
A 1 22  VAL 22  10  10  VAL VAL A . n 
A 1 23  LYS 23  11  11  LYS LYS A . n 
A 1 24  LEU 24  12  12  LEU LEU A . n 
A 1 25  LYS 25  13  13  LYS LYS A . n 
A 1 26  PRO 26  14  14  PRO PRO A . n 
A 1 27  GLY 27  15  15  GLY GLY A . n 
A 1 28  MET 28  16  16  MET MET A . n 
A 1 29  ASP 29  17  17  ASP ASP A . n 
A 1 30  GLY 30  18  18  GLY GLY A . n 
A 1 31  PRO 31  19  19  PRO PRO A . n 
A 1 32  LYS 32  20  20  LYS LYS A . n 
A 1 33  VAL 33  21  21  VAL VAL A . n 
A 1 34  LYS 34  22  22  LYS LYS A . n 
A 1 35  GLN 35  23  23  GLN GLN A . n 
A 1 36  TRP 36  24  24  TRP TRP A . n 
A 1 37  PRO 37  25  25  PRO PRO A . n 
A 1 38  LEU 38  26  26  LEU LEU A . n 
A 1 39  THR 39  27  27  THR THR A . n 
A 1 40  GLU 40  28  28  GLU GLU A . n 
A 1 41  GLU 41  29  29  GLU GLU A . n 
A 1 42  LYS 42  30  30  LYS LYS A . n 
A 1 43  ILE 43  31  31  ILE ILE A . n 
A 1 44  LYS 44  32  32  LYS LYS A . n 
A 1 45  ALA 45  33  33  ALA ALA A . n 
A 1 46  LEU 46  34  34  LEU LEU A . n 
A 1 47  VAL 47  35  35  VAL VAL A . n 
A 1 48  GLU 48  36  36  GLU GLU A . n 
A 1 49  ILE 49  37  37  ILE ILE A . n 
A 1 50  CYS 50  38  38  CYS CYS A . n 
A 1 51  THR 51  39  39  THR THR A . n 
A 1 52  GLU 52  40  40  GLU GLU A . n 
A 1 53  MET 53  41  41  MET MET A . n 
A 1 54  GLU 54  42  42  GLU GLU A . n 
A 1 55  LYS 55  43  43  LYS LYS A . n 
A 1 56  GLU 56  44  44  GLU GLU A . n 
A 1 57  GLY 57  45  45  GLY GLY A . n 
A 1 58  LYS 58  46  46  LYS LYS A . n 
A 1 59  ILE 59  47  47  ILE ILE A . n 
A 1 60  SER 60  48  48  SER SER A . n 
A 1 61  LYS 61  49  49  LYS LYS A . n 
A 1 62  ILE 62  50  50  ILE ILE A . n 
A 1 63  GLY 63  51  51  GLY GLY A . n 
A 1 64  PRO 64  52  52  PRO PRO A . n 
A 1 65  GLU 65  53  53  GLU GLU A . n 
A 1 66  ASN 66  54  54  ASN ASN A . n 
A 1 67  PRO 67  55  55  PRO PRO A . n 
A 1 68  TYR 68  56  56  TYR TYR A . n 
A 1 69  ASN 69  57  57  ASN ASN A . n 
A 1 70  THR 70  58  58  THR THR A . n 
A 1 71  PRO 71  59  59  PRO PRO A . n 
A 1 72  VAL 72  60  60  VAL VAL A . n 
A 1 73  PHE 73  61  61  PHE PHE A . n 
A 1 74  ALA 74  62  62  ALA ALA A . n 
A 1 75  ILE 75  63  63  ILE ILE A . n 
A 1 76  LYS 76  64  64  LYS LYS A . n 
A 1 77  LYS 77  65  65  LYS LYS A . n 
A 1 78  LYS 78  66  66  LYS LYS A . n 
A 1 79  ASP 79  67  67  ASP ASP A . n 
A 1 80  SER 80  68  68  SER SER A . n 
A 1 81  THR 81  69  69  THR THR A . n 
A 1 82  LYS 82  70  70  LYS LYS A . n 
A 1 83  TRP 83  71  71  TRP TRP A . n 
A 1 84  ARG 84  72  72  ARG ARG A . n 
A 1 85  LYS 85  73  73  LYS LYS A . n 
A 1 86  LEU 86  74  74  LEU LEU A . n 
A 1 87  VAL 87  75  75  VAL VAL A . n 
A 1 88  ASP 88  76  76  ASP ASP A . n 
A 1 89  PHE 89  77  77  PHE PHE A . n 
A 1 90  ARG 90  78  78  ARG ARG A . n 
A 1 91  GLU 91  79  79  GLU GLU A . n 
A 1 92  LEU 92  80  80  LEU LEU A . n 
A 1 93  ASN 93  81  81  ASN ASN A . n 
A 1 94  LYS 94  82  82  LYS LYS A . n 
A 1 95  ARG 95  83  83  ARG ARG A . n 
A 1 96  THR 96  84  84  THR THR A . n 
A 1 97  GLN 97  85  85  GLN GLN A . n 
A 1 98  ASP 98  86  86  ASP ASP A . n 
A 1 99  PHE 99  87  87  PHE PHE A . n 
A 1 100 TRP 100 88  88  TRP TRP A . n 
A 1 101 GLU 101 89  89  GLU GLU A . n 
A 1 102 VAL 102 90  90  VAL VAL A . n 
A 1 103 GLN 103 91  91  GLN GLN A . n 
A 1 104 LEU 104 92  92  LEU LEU A . n 
A 1 105 GLY 105 93  93  GLY GLY A . n 
A 1 106 ILE 106 94  94  ILE ILE A . n 
A 1 107 PRO 107 95  95  PRO PRO A . n 
A 1 108 HIS 108 96  96  HIS HIS A . n 
A 1 109 PRO 109 97  97  PRO PRO A . n 
A 1 110 ALA 110 98  98  ALA ALA A . n 
A 1 111 GLY 111 99  99  GLY GLY A . n 
A 1 112 LEU 112 100 100 LEU LEU A . n 
A 1 113 LYS 113 101 101 LYS LYS A . n 
A 1 114 LYS 114 102 102 LYS LYS A . n 
A 1 115 LYS 115 103 103 LYS LYS A . n 
A 1 116 LYS 116 104 104 LYS LYS A . n 
A 1 117 SER 117 105 105 SER SER A . n 
A 1 118 VAL 118 106 106 VAL VAL A . n 
A 1 119 THR 119 107 107 THR THR A . n 
A 1 120 VAL 120 108 108 VAL VAL A . n 
A 1 121 LEU 121 109 109 LEU LEU A . n 
A 1 122 ASP 122 110 110 ASP ASP A . n 
A 1 123 VAL 123 111 111 VAL VAL A . n 
A 1 124 GLY 124 112 112 GLY GLY A . n 
A 1 125 ASP 125 113 113 ASP ASP A . n 
A 1 126 ALA 126 114 114 ALA ALA A . n 
A 1 127 TYR 127 115 115 TYR TYR A . n 
A 1 128 PHE 128 116 116 PHE PHE A . n 
A 1 129 SER 129 117 117 SER SER A . n 
A 1 130 VAL 130 118 118 VAL VAL A . n 
A 1 131 PRO 131 119 119 PRO PRO A . n 
A 1 132 LEU 132 120 120 LEU LEU A . n 
A 1 133 ASP 133 121 121 ASP ASP A . n 
A 1 134 GLU 134 122 122 GLU GLU A . n 
A 1 135 ASP 135 123 123 ASP ASP A . n 
A 1 136 PHE 136 124 124 PHE PHE A . n 
A 1 137 ARG 137 125 125 ARG ARG A . n 
A 1 138 LYS 138 126 126 LYS LYS A . n 
A 1 139 TYR 139 127 127 TYR TYR A . n 
A 1 140 THR 140 128 128 THR THR A . n 
A 1 141 ALA 141 129 129 ALA ALA A . n 
A 1 142 PHE 142 130 130 PHE PHE A . n 
A 1 143 THR 143 131 131 THR THR A . n 
A 1 144 ILE 144 132 132 ILE ILE A . n 
A 1 145 PRO 145 133 133 PRO PRO A . n 
A 1 146 SER 146 134 134 SER SER A . n 
A 1 147 ILE 147 135 ?   ?   ?   A . n 
A 1 148 ASN 148 136 ?   ?   ?   A . n 
A 1 149 ASN 149 137 ?   ?   ?   A . n 
A 1 150 GLU 150 138 ?   ?   ?   A . n 
A 1 151 THR 151 139 139 THR THR A . n 
A 1 152 PRO 152 140 140 PRO PRO A . n 
A 1 153 GLY 153 141 141 GLY GLY A . n 
A 1 154 ILE 154 142 142 ILE ILE A . n 
A 1 155 ARG 155 143 143 ARG ARG A . n 
A 1 156 TYR 156 144 144 TYR TYR A . n 
A 1 157 GLN 157 145 145 GLN GLN A . n 
A 1 158 TYR 158 146 146 TYR TYR A . n 
A 1 159 ASN 159 147 147 ASN ASN A . n 
A 1 160 VAL 160 148 148 VAL VAL A . n 
A 1 161 LEU 161 149 149 LEU LEU A . n 
A 1 162 PRO 162 150 150 PRO PRO A . n 
A 1 163 GLN 163 151 151 GLN GLN A . n 
A 1 164 GLY 164 152 152 GLY GLY A . n 
A 1 165 TRP 165 153 153 TRP TRP A . n 
A 1 166 LYS 166 154 154 LYS LYS A . n 
A 1 167 GLY 167 155 155 GLY GLY A . n 
A 1 168 SER 168 156 156 SER SER A . n 
A 1 169 PRO 169 157 157 PRO PRO A . n 
A 1 170 ALA 170 158 158 ALA ALA A . n 
A 1 171 ILE 171 159 159 ILE ILE A . n 
A 1 172 PHE 172 160 160 PHE PHE A . n 
A 1 173 GLN 173 161 161 GLN GLN A . n 
A 1 174 SER 174 162 162 SER SER A . n 
A 1 175 SER 175 163 163 SER SER A . n 
A 1 176 MET 176 164 164 MET MET A . n 
A 1 177 THR 177 165 165 THR THR A . n 
A 1 178 LYS 178 166 166 LYS LYS A . n 
A 1 179 ILE 179 167 167 ILE ILE A . n 
A 1 180 LEU 180 168 168 LEU LEU A . n 
A 1 181 GLU 181 169 169 GLU GLU A . n 
A 1 182 PRO 182 170 170 PRO PRO A . n 
A 1 183 PHE 183 171 171 PHE PHE A . n 
A 1 184 ARG 184 172 172 ARG ARG A . n 
A 1 185 LYS 185 173 173 LYS LYS A . n 
A 1 186 GLN 186 174 174 GLN GLN A . n 
A 1 187 ASN 187 175 175 ASN ASN A . n 
A 1 188 PRO 188 176 176 PRO PRO A . n 
A 1 189 ASP 189 177 177 ASP ASP A . n 
A 1 190 ILE 190 178 178 ILE ILE A . n 
A 1 191 VAL 191 179 179 VAL VAL A . n 
A 1 192 ILE 192 180 180 ILE ILE A . n 
A 1 193 TYR 193 181 181 TYR TYR A . n 
A 1 194 GLN 194 182 182 GLN GLN A . n 
A 1 195 TYR 195 183 183 TYR TYR A . n 
A 1 196 MET 196 184 184 MET MET A . n 
A 1 197 ASP 197 185 185 ASP ASP A . n 
A 1 198 ASP 198 186 186 ASP ASP A . n 
A 1 199 LEU 199 187 187 LEU LEU A . n 
A 1 200 TYR 200 188 188 TYR TYR A . n 
A 1 201 VAL 201 189 189 VAL VAL A . n 
A 1 202 GLY 202 190 190 GLY GLY A . n 
A 1 203 SER 203 191 191 SER SER A . n 
A 1 204 ASP 204 192 192 ASP ASP A . n 
A 1 205 LEU 205 193 193 LEU LEU A . n 
A 1 206 GLU 206 194 194 GLU GLU A . n 
A 1 207 ILE 207 195 195 ILE ILE A . n 
A 1 208 GLY 208 196 196 GLY GLY A . n 
A 1 209 GLN 209 197 197 GLN GLN A . n 
A 1 210 HIS 210 198 198 HIS HIS A . n 
A 1 211 ARG 211 199 199 ARG ARG A . n 
A 1 212 THR 212 200 200 THR THR A . n 
A 1 213 LYS 213 201 201 LYS LYS A . n 
A 1 214 ILE 214 202 202 ILE ILE A . n 
A 1 215 GLU 215 203 203 GLU GLU A . n 
A 1 216 GLU 216 204 204 GLU GLU A . n 
A 1 217 LEU 217 205 205 LEU LEU A . n 
A 1 218 ARG 218 206 206 ARG ARG A . n 
A 1 219 GLN 219 207 207 GLN GLN A . n 
A 1 220 HIS 220 208 208 HIS HIS A . n 
A 1 221 LEU 221 209 209 LEU LEU A . n 
A 1 222 LEU 222 210 210 LEU LEU A . n 
A 1 223 ARG 223 211 211 ARG ARG A . n 
A 1 224 TRP 224 212 212 TRP TRP A . n 
A 1 225 GLY 225 213 213 GLY GLY A . n 
A 1 226 LEU 226 214 214 LEU LEU A . n 
A 1 227 THR 227 215 215 THR THR A . n 
A 1 228 THR 228 216 216 THR THR A . n 
A 1 229 PRO 229 217 217 PRO PRO A . n 
A 1 230 ASP 230 218 218 ASP ASP A . n 
A 1 231 LYS 231 219 219 LYS LYS A . n 
A 1 232 LYS 232 220 220 LYS LYS A . n 
A 1 233 HIS 233 221 221 HIS HIS A . n 
A 1 234 GLN 234 222 222 GLN GLN A . n 
A 1 235 LYS 235 223 223 LYS LYS A . n 
A 1 236 GLU 236 224 224 GLU GLU A . n 
A 1 237 PRO 237 225 225 PRO PRO A . n 
A 1 238 PRO 238 226 226 PRO PRO A . n 
A 1 239 PHE 239 227 227 PHE PHE A . n 
A 1 240 LEU 240 228 228 LEU LEU A . n 
A 1 241 TRP 241 229 229 TRP TRP A . n 
A 1 242 MET 242 230 230 MET MET A . n 
A 1 243 GLY 243 231 231 GLY GLY A . n 
A 1 244 TYR 244 232 232 TYR TYR A . n 
A 1 245 GLU 245 233 233 GLU GLU A . n 
A 1 246 LEU 246 234 234 LEU LEU A . n 
A 1 247 HIS 247 235 235 HIS HIS A . n 
A 1 248 PRO 248 236 236 PRO PRO A . n 
A 1 249 ASP 249 237 237 ASP ASP A . n 
A 1 250 LYS 250 238 238 LYS LYS A . n 
A 1 251 TRP 251 239 239 TRP TRP A . n 
A 1 252 THR 252 240 240 THR THR A . n 
A 1 253 VAL 253 241 241 VAL VAL A . n 
A 1 254 GLN 254 242 242 GLN GLN A . n 
A 1 255 PRO 255 243 243 PRO PRO A . n 
A 1 256 ILE 256 244 244 ILE ILE A . n 
A 1 257 VAL 257 245 245 VAL VAL A . n 
A 1 258 LEU 258 246 246 LEU LEU A . n 
A 1 259 PRO 259 247 247 PRO PRO A . n 
A 1 260 GLU 260 248 248 GLU GLU A . n 
A 1 261 LYS 261 249 249 LYS LYS A . n 
A 1 262 ASP 262 250 250 ASP ASP A . n 
A 1 263 SER 263 251 251 SER SER A . n 
A 1 264 TRP 264 252 252 TRP TRP A . n 
A 1 265 THR 265 253 253 THR THR A . n 
A 1 266 VAL 266 254 254 VAL VAL A . n 
A 1 267 ASN 267 255 255 ASN ASN A . n 
A 1 268 ASP 268 256 256 ASP ASP A . n 
A 1 269 ILE 269 257 257 ILE ILE A . n 
A 1 270 CYS 270 258 258 CYS CYS A . n 
A 1 271 LYS 271 259 259 LYS LYS A . n 
A 1 272 LEU 272 260 260 LEU LEU A . n 
A 1 273 VAL 273 261 261 VAL VAL A . n 
A 1 274 GLY 274 262 262 GLY GLY A . n 
A 1 275 LYS 275 263 263 LYS LYS A . n 
A 1 276 LEU 276 264 264 LEU LEU A . n 
A 1 277 ASN 277 265 265 ASN ASN A . n 
A 1 278 TRP 278 266 266 TRP TRP A . n 
A 1 279 ALA 279 267 267 ALA ALA A . n 
A 1 280 SER 280 268 268 SER SER A . n 
A 1 281 GLN 281 269 269 GLN GLN A . n 
A 1 282 ILE 282 270 270 ILE ILE A . n 
A 1 283 TYR 283 271 271 TYR TYR A . n 
A 1 284 PRO 284 272 272 PRO PRO A . n 
A 1 285 GLY 285 273 273 GLY GLY A . n 
A 1 286 ILE 286 274 274 ILE ILE A . n 
A 1 287 LYS 287 275 275 LYS LYS A . n 
A 1 288 VAL 288 276 276 VAL VAL A . n 
A 1 289 ARG 289 277 277 ARG ARG A . n 
A 1 290 GLN 290 278 278 GLN GLN A . n 
A 1 291 LEU 291 279 279 LEU LEU A . n 
A 1 292 SER 292 280 280 SER SER A . n 
A 1 293 LYS 293 281 281 LYS LYS A . n 
A 1 294 LEU 294 282 282 LEU LEU A . n 
A 1 295 LEU 295 283 283 LEU LEU A . n 
A 1 296 ARG 296 284 284 ARG ARG A . n 
A 1 297 GLY 297 285 285 GLY GLY A . n 
A 1 298 THR 298 286 286 THR THR A . n 
A 1 299 LYS 299 287 287 LYS LYS A . n 
A 1 300 ALA 300 288 288 ALA ALA A . n 
A 1 301 LEU 301 289 289 LEU LEU A . n 
A 1 302 THR 302 290 290 THR THR A . n 
A 1 303 GLU 303 291 291 GLU GLU A . n 
A 1 304 VAL 304 292 292 VAL VAL A . n 
A 1 305 ILE 305 293 293 ILE ILE A . n 
A 1 306 PRO 306 294 294 PRO PRO A . n 
A 1 307 LEU 307 295 295 LEU LEU A . n 
A 1 308 THR 308 296 296 THR THR A . n 
A 1 309 GLU 309 297 297 GLU GLU A . n 
A 1 310 GLU 310 298 298 GLU GLU A . n 
A 1 311 ALA 311 299 299 ALA ALA A . n 
A 1 312 GLU 312 300 300 GLU GLU A . n 
A 1 313 LEU 313 301 301 LEU LEU A . n 
A 1 314 GLU 314 302 302 GLU GLU A . n 
A 1 315 LEU 315 303 303 LEU LEU A . n 
A 1 316 ALA 316 304 304 ALA ALA A . n 
A 1 317 GLU 317 305 305 GLU GLU A . n 
A 1 318 ASN 318 306 306 ASN ASN A . n 
A 1 319 ARG 319 307 307 ARG ARG A . n 
A 1 320 GLU 320 308 308 GLU GLU A . n 
A 1 321 ILE 321 309 309 ILE ILE A . n 
A 1 322 LEU 322 310 310 LEU LEU A . n 
A 1 323 LYS 323 311 311 LYS LYS A . n 
A 1 324 GLU 324 312 312 GLU GLU A . n 
A 1 325 PRO 325 313 313 PRO PRO A . n 
A 1 326 VAL 326 314 314 VAL VAL A . n 
A 1 327 HIS 327 315 315 HIS HIS A . n 
A 1 328 GLY 328 316 316 GLY GLY A . n 
A 1 329 VAL 329 317 317 VAL VAL A . n 
A 1 330 TYR 330 318 318 TYR TYR A . n 
A 1 331 TYR 331 319 319 TYR TYR A . n 
A 1 332 ASP 332 320 320 ASP ASP A . n 
A 1 333 PRO 333 321 321 PRO PRO A . n 
A 1 334 SER 334 322 322 SER SER A . n 
A 1 335 LYS 335 323 323 LYS LYS A . n 
A 1 336 ASP 336 324 324 ASP ASP A . n 
A 1 337 LEU 337 325 325 LEU LEU A . n 
A 1 338 ILE 338 326 326 ILE ILE A . n 
A 1 339 ALA 339 327 327 ALA ALA A . n 
A 1 340 GLU 340 328 328 GLU GLU A . n 
A 1 341 ILE 341 329 329 ILE ILE A . n 
A 1 342 GLN 342 330 330 GLN GLN A . n 
A 1 343 LYS 343 331 331 LYS LYS A . n 
A 1 344 GLN 344 332 332 GLN GLN A . n 
A 1 345 GLY 345 333 333 GLY GLY A . n 
A 1 346 GLN 346 334 334 GLN GLN A . n 
A 1 347 GLY 347 335 335 GLY GLY A . n 
A 1 348 GLN 348 336 336 GLN GLN A . n 
A 1 349 TRP 349 337 337 TRP TRP A . n 
A 1 350 THR 350 338 338 THR THR A . n 
A 1 351 TYR 351 339 339 TYR TYR A . n 
A 1 352 GLN 352 340 340 GLN GLN A . n 
A 1 353 ILE 353 341 341 ILE ILE A . n 
A 1 354 TYR 354 342 342 TYR TYR A . n 
A 1 355 GLN 355 343 343 GLN GLN A . n 
A 1 356 GLU 356 344 344 GLU GLU A . n 
A 1 357 PRO 357 345 345 PRO PRO A . n 
A 1 358 PHE 358 346 346 PHE PHE A . n 
A 1 359 LYS 359 347 347 LYS LYS A . n 
A 1 360 ASN 360 348 348 ASN ASN A . n 
A 1 361 LEU 361 349 349 LEU LEU A . n 
A 1 362 LYS 362 350 350 LYS LYS A . n 
A 1 363 THR 363 351 351 THR THR A . n 
A 1 364 GLY 364 352 352 GLY GLY A . n 
A 1 365 LYS 365 353 353 LYS LYS A . n 
A 1 366 TYR 366 354 354 TYR TYR A . n 
A 1 367 ALA 367 355 355 ALA ALA A . n 
A 1 368 ARG 368 356 356 ARG ARG A . n 
A 1 369 MET 369 357 357 MET MET A . n 
A 1 370 ARG 370 358 358 ARG ARG A . n 
A 1 371 GLY 371 359 359 GLY GLY A . n 
A 1 372 ALA 372 360 360 ALA ALA A . n 
A 1 373 HIS 373 361 361 HIS HIS A . n 
A 1 374 THR 374 362 362 THR THR A . n 
A 1 375 ASN 375 363 363 ASN ASN A . n 
A 1 376 ASP 376 364 364 ASP ASP A . n 
A 1 377 VAL 377 365 365 VAL VAL A . n 
A 1 378 LYS 378 366 366 LYS LYS A . n 
A 1 379 GLN 379 367 367 GLN GLN A . n 
A 1 380 LEU 380 368 368 LEU LEU A . n 
A 1 381 THR 381 369 369 THR THR A . n 
A 1 382 GLU 382 370 370 GLU GLU A . n 
A 1 383 ALA 383 371 371 ALA ALA A . n 
A 1 384 VAL 384 372 372 VAL VAL A . n 
A 1 385 GLN 385 373 373 GLN GLN A . n 
A 1 386 LYS 386 374 374 LYS LYS A . n 
A 1 387 ILE 387 375 375 ILE ILE A . n 
A 1 388 THR 388 376 376 THR THR A . n 
A 1 389 THR 389 377 377 THR THR A . n 
A 1 390 GLU 390 378 378 GLU GLU A . n 
A 1 391 SER 391 379 379 SER SER A . n 
A 1 392 ILE 392 380 380 ILE ILE A . n 
A 1 393 VAL 393 381 381 VAL VAL A . n 
A 1 394 ILE 394 382 382 ILE ILE A . n 
A 1 395 TRP 395 383 383 TRP TRP A . n 
A 1 396 GLY 396 384 384 GLY GLY A . n 
A 1 397 LYS 397 385 385 LYS LYS A . n 
A 1 398 THR 398 386 386 THR THR A . n 
A 1 399 PRO 399 387 387 PRO PRO A . n 
A 1 400 LYS 400 388 388 LYS LYS A . n 
A 1 401 PHE 401 389 389 PHE PHE A . n 
A 1 402 LYS 402 390 390 LYS LYS A . n 
A 1 403 LEU 403 391 391 LEU LEU A . n 
A 1 404 PRO 404 392 392 PRO PRO A . n 
A 1 405 ILE 405 393 393 ILE ILE A . n 
A 1 406 GLN 406 394 394 GLN GLN A . n 
A 1 407 LYS 407 395 395 LYS LYS A . n 
A 1 408 GLU 408 396 396 GLU GLU A . n 
A 1 409 THR 409 397 397 THR THR A . n 
A 1 410 TRP 410 398 398 TRP TRP A . n 
A 1 411 GLU 411 399 399 GLU GLU A . n 
A 1 412 THR 412 400 400 THR THR A . n 
A 1 413 TRP 413 401 401 TRP TRP A . n 
A 1 414 TRP 414 402 402 TRP TRP A . n 
A 1 415 THR 415 403 403 THR THR A . n 
A 1 416 GLU 416 404 404 GLU GLU A . n 
A 1 417 TYR 417 405 405 TYR TYR A . n 
A 1 418 TRP 418 406 406 TRP TRP A . n 
A 1 419 GLN 419 407 407 GLN GLN A . n 
A 1 420 ALA 420 408 408 ALA ALA A . n 
A 1 421 THR 421 409 409 THR THR A . n 
A 1 422 TRP 422 410 410 TRP TRP A . n 
A 1 423 ILE 423 411 411 ILE ILE A . n 
A 1 424 PRO 424 412 412 PRO PRO A . n 
A 1 425 GLU 425 413 413 GLU GLU A . n 
A 1 426 TRP 426 414 414 TRP TRP A . n 
A 1 427 GLU 427 415 415 GLU GLU A . n 
A 1 428 PHE 428 416 416 PHE PHE A . n 
A 1 429 VAL 429 417 417 VAL VAL A . n 
A 1 430 ASN 430 418 418 ASN ASN A . n 
A 1 431 THR 431 419 419 THR THR A . n 
A 1 432 PRO 432 420 420 PRO PRO A . n 
A 1 433 PRO 433 421 421 PRO PRO A . n 
A 1 434 LEU 434 422 422 LEU LEU A . n 
A 1 435 VAL 435 423 423 VAL VAL A . n 
A 1 436 LYS 436 424 424 LYS LYS A . n 
A 1 437 LEU 437 425 425 LEU LEU A . n 
A 1 438 TRP 438 426 426 TRP TRP A . n 
A 1 439 TYR 439 427 427 TYR TYR A . n 
A 1 440 GLN 440 428 428 GLN GLN A . n 
A 1 441 LEU 441 429 429 LEU LEU A . n 
A 1 442 GLU 442 430 430 GLU GLU A . n 
A 1 443 LYS 443 431 431 LYS LYS A . n 
A 1 444 GLU 444 432 432 GLU GLU A . n 
A 1 445 PRO 445 433 433 PRO PRO A . n 
A 1 446 ILE 446 434 434 ILE ILE A . n 
A 1 447 VAL 447 435 435 VAL VAL A . n 
A 1 448 GLY 448 436 436 GLY GLY A . n 
A 1 449 ALA 449 437 437 ALA ALA A . n 
A 1 450 GLU 450 438 438 GLU GLU A . n 
A 1 451 THR 451 439 439 THR THR A . n 
A 1 452 PHE 452 440 440 PHE PHE A . n 
A 1 453 TYR 453 441 441 TYR TYR A . n 
A 1 454 VAL 454 442 442 VAL VAL A . n 
A 1 455 ASP 455 443 443 ASP ASP A . n 
A 1 456 GLY 456 444 444 GLY GLY A . n 
A 1 457 ALA 457 445 445 ALA ALA A . n 
A 1 458 ALA 458 446 446 ALA ALA A . n 
A 1 459 ASN 459 447 447 ASN ASN A . n 
A 1 460 ARG 460 448 448 ARG ARG A . n 
A 1 461 GLU 461 449 449 GLU GLU A . n 
A 1 462 THR 462 450 450 THR THR A . n 
A 1 463 LYS 463 451 451 LYS LYS A . n 
A 1 464 LEU 464 452 452 LEU LEU A . n 
A 1 465 GLY 465 453 453 GLY GLY A . n 
A 1 466 LYS 466 454 454 LYS LYS A . n 
A 1 467 ALA 467 455 455 ALA ALA A . n 
A 1 468 GLY 468 456 456 GLY GLY A . n 
A 1 469 TYR 469 457 457 TYR TYR A . n 
A 1 470 VAL 470 458 458 VAL VAL A . n 
A 1 471 THR 471 459 459 THR THR A . n 
A 1 472 ASN 472 460 460 ASN ASN A . n 
A 1 473 ARG 473 461 461 ARG ARG A . n 
A 1 474 GLY 474 462 462 GLY GLY A . n 
A 1 475 ARG 475 463 463 ARG ARG A . n 
A 1 476 GLN 476 464 464 GLN GLN A . n 
A 1 477 LYS 477 465 465 LYS LYS A . n 
A 1 478 VAL 478 466 466 VAL VAL A . n 
A 1 479 VAL 479 467 467 VAL VAL A . n 
A 1 480 THR 480 468 468 THR THR A . n 
A 1 481 LEU 481 469 469 LEU LEU A . n 
A 1 482 THR 482 470 470 THR THR A . n 
A 1 483 ASP 483 471 471 ASP ASP A . n 
A 1 484 THR 484 472 472 THR THR A . n 
A 1 485 THR 485 473 473 THR THR A . n 
A 1 486 ASN 486 474 474 ASN ASN A . n 
A 1 487 GLN 487 475 475 GLN GLN A . n 
A 1 488 LYS 488 476 476 LYS LYS A . n 
A 1 489 THR 489 477 477 THR THR A . n 
A 1 490 GLU 490 478 478 GLU GLU A . n 
A 1 491 LEU 491 479 479 LEU LEU A . n 
A 1 492 GLN 492 480 480 GLN GLN A . n 
A 1 493 ALA 493 481 481 ALA ALA A . n 
A 1 494 ILE 494 482 482 ILE ILE A . n 
A 1 495 TYR 495 483 483 TYR TYR A . n 
A 1 496 LEU 496 484 484 LEU LEU A . n 
A 1 497 ALA 497 485 485 ALA ALA A . n 
A 1 498 LEU 498 486 486 LEU LEU A . n 
A 1 499 GLN 499 487 487 GLN GLN A . n 
A 1 500 ASP 500 488 488 ASP ASP A . n 
A 1 501 SER 501 489 489 SER SER A . n 
A 1 502 GLY 502 490 490 GLY GLY A . n 
A 1 503 LEU 503 491 491 LEU LEU A . n 
A 1 504 GLU 504 492 492 GLU GLU A . n 
A 1 505 VAL 505 493 493 VAL VAL A . n 
A 1 506 ASN 506 494 494 ASN ASN A . n 
A 1 507 ILE 507 495 495 ILE ILE A . n 
A 1 508 VAL 508 496 496 VAL VAL A . n 
A 1 509 THR 509 497 497 THR THR A . n 
A 1 510 ASP 510 498 498 ASP ASP A . n 
A 1 511 SER 511 499 499 SER SER A . n 
A 1 512 GLN 512 500 500 GLN GLN A . n 
A 1 513 TYR 513 501 501 TYR TYR A . n 
A 1 514 ALA 514 502 502 ALA ALA A . n 
A 1 515 LEU 515 503 503 LEU LEU A . n 
A 1 516 GLY 516 504 504 GLY GLY A . n 
A 1 517 ILE 517 505 505 ILE ILE A . n 
A 1 518 ILE 518 506 506 ILE ILE A . n 
A 1 519 GLN 519 507 507 GLN GLN A . n 
A 1 520 ALA 520 508 508 ALA ALA A . n 
A 1 521 GLN 521 509 509 GLN GLN A . n 
A 1 522 PRO 522 510 510 PRO PRO A . n 
A 1 523 ASP 523 511 511 ASP ASP A . n 
A 1 524 GLN 524 512 512 GLN GLN A . n 
A 1 525 SER 525 513 513 SER SER A . n 
A 1 526 GLU 526 514 514 GLU GLU A . n 
A 1 527 SER 527 515 515 SER SER A . n 
A 1 528 GLU 528 516 516 GLU GLU A . n 
A 1 529 LEU 529 517 517 LEU LEU A . n 
A 1 530 VAL 530 518 518 VAL VAL A . n 
A 1 531 ASN 531 519 519 ASN ASN A . n 
A 1 532 GLN 532 520 520 GLN GLN A . n 
A 1 533 ILE 533 521 521 ILE ILE A . n 
A 1 534 ILE 534 522 522 ILE ILE A . n 
A 1 535 GLU 535 523 523 GLU GLU A . n 
A 1 536 GLN 536 524 524 GLN GLN A . n 
A 1 537 LEU 537 525 525 LEU LEU A . n 
A 1 538 ILE 538 526 526 ILE ILE A . n 
A 1 539 LYS 539 527 527 LYS LYS A . n 
A 1 540 LYS 540 528 528 LYS LYS A . n 
A 1 541 GLU 541 529 529 GLU GLU A . n 
A 1 542 LYS 542 530 530 LYS LYS A . n 
A 1 543 VAL 543 531 531 VAL VAL A . n 
A 1 544 TYR 544 532 532 TYR TYR A . n 
A 1 545 LEU 545 533 533 LEU LEU A . n 
A 1 546 ALA 546 534 534 ALA ALA A . n 
A 1 547 TRP 547 535 535 TRP TRP A . n 
A 1 548 VAL 548 536 536 VAL VAL A . n 
A 1 549 PRO 549 537 537 PRO PRO A . n 
A 1 550 ALA 550 538 538 ALA ALA A . n 
A 1 551 HIS 551 539 539 HIS HIS A . n 
A 1 552 LYS 552 540 540 LYS LYS A . n 
A 1 553 GLY 553 541 541 GLY GLY A . n 
A 1 554 ILE 554 542 542 ILE ILE A . n 
A 1 555 GLY 555 543 543 GLY GLY A . n 
A 1 556 GLY 556 544 544 GLY GLY A . n 
A 1 557 ASN 557 545 545 ASN ASN A . n 
A 1 558 GLU 558 546 546 GLU GLU A . n 
A 1 559 GLN 559 547 547 GLN GLN A . n 
A 1 560 VAL 560 548 548 VAL VAL A . n 
A 1 561 ASP 561 549 549 ASP ASP A . n 
A 1 562 LYS 562 550 550 LYS LYS A . n 
A 1 563 LEU 563 551 551 LEU LEU A . n 
A 1 564 VAL 564 552 552 VAL VAL A . n 
A 1 565 SER 565 553 553 SER SER A . n 
A 1 566 ALA 566 554 554 ALA ALA A . n 
A 1 567 GLY 567 555 555 GLY GLY A . n 
A 1 568 ILE 568 556 556 ILE ILE A . n 
A 1 569 ARG 569 557 557 ARG ARG A . n 
A 1 570 LYS 570 558 ?   ?   ?   A . n 
A 1 571 VAL 571 559 ?   ?   ?   A . n 
A 1 572 LEU 572 560 ?   ?   ?   A . n 
B 2 1   PRO 1   1   ?   ?   ?   B . n 
B 2 2   ILE 2   2   ?   ?   ?   B . n 
B 2 3   SER 3   3   ?   ?   ?   B . n 
B 2 4   PRO 4   4   ?   ?   ?   B . n 
B 2 5   ILE 5   5   ?   ?   ?   B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  MET 16  16  16  MET MET B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  TRP 24  24  24  TRP TRP B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  45  45  GLY GLY B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  PRO 52  52  52  PRO PRO B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ASN 54  54  54  ASN ASN B . n 
B 2 55  PRO 55  55  55  PRO PRO B . n 
B 2 56  TYR 56  56  56  TYR TYR B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  LYS 64  64  64  LYS LYS B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  ASP 67  67  67  ASP ASP B . n 
B 2 68  SER 68  68  68  SER SER B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  TRP 71  71  71  TRP TRP B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  LEU 74  74  74  LEU LEU B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  ARG 78  78  78  ARG ARG B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  GLN 85  85  85  GLN GLN B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  PHE 87  87  ?   ?   ?   B . n 
B 2 88  TRP 88  88  ?   ?   ?   B . n 
B 2 89  GLU 89  89  ?   ?   ?   B . n 
B 2 90  VAL 90  90  ?   ?   ?   B . n 
B 2 91  GLN 91  91  ?   ?   ?   B . n 
B 2 92  LEU 92  92  ?   ?   ?   B . n 
B 2 93  GLY 93  93  ?   ?   ?   B . n 
B 2 94  ILE 94  94  ?   ?   ?   B . n 
B 2 95  PRO 95  95  95  PRO PRO B . n 
B 2 96  HIS 96  96  96  HIS HIS B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  GLY 99  99  99  GLY GLY B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 LYS 103 103 103 LYS LYS B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 ASP 113 113 113 ASP ASP B . n 
B 2 114 ALA 114 114 114 ALA ALA B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 PHE 116 116 116 PHE PHE B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 GLU 122 122 122 GLU GLU B . n 
B 2 123 ASP 123 123 123 ASP ASP B . n 
B 2 124 PHE 124 124 124 PHE PHE B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 THR 128 128 128 THR THR B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 THR 131 131 131 THR THR B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 ASN 137 137 137 ASN ASN B . n 
B 2 138 GLU 138 138 138 GLU GLU B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 ARG 143 143 143 ARG ARG B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 TYR 146 146 146 TYR TYR B . n 
B 2 147 ASN 147 147 147 ASN ASN B . n 
B 2 148 VAL 148 148 148 VAL VAL B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 PRO 150 150 150 PRO PRO B . n 
B 2 151 GLN 151 151 151 GLN GLN B . n 
B 2 152 GLY 152 152 152 GLY GLY B . n 
B 2 153 TRP 153 153 153 TRP TRP B . n 
B 2 154 LYS 154 154 154 LYS LYS B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 PRO 157 157 157 PRO PRO B . n 
B 2 158 ALA 158 158 158 ALA ALA B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 GLN 161 161 161 GLN GLN B . n 
B 2 162 SER 162 162 162 SER SER B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 MET 164 164 164 MET MET B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 LYS 166 166 166 LYS LYS B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 GLU 169 169 169 GLU GLU B . n 
B 2 170 PRO 170 170 170 PRO PRO B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 ARG 172 172 172 ARG ARG B . n 
B 2 173 LYS 173 173 173 LYS LYS B . n 
B 2 174 GLN 174 174 174 GLN GLN B . n 
B 2 175 ASN 175 175 175 ASN ASN B . n 
B 2 176 PRO 176 176 176 PRO PRO B . n 
B 2 177 ASP 177 177 177 ASP ASP B . n 
B 2 178 ILE 178 178 178 ILE ILE B . n 
B 2 179 VAL 179 179 179 VAL VAL B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 TYR 181 181 181 TYR TYR B . n 
B 2 182 GLN 182 182 182 GLN GLN B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 MET 184 184 184 MET MET B . n 
B 2 185 ASP 185 185 185 ASP ASP B . n 
B 2 186 ASP 186 186 186 ASP ASP B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 TYR 188 188 188 TYR TYR B . n 
B 2 189 VAL 189 189 189 VAL VAL B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 GLU 194 194 194 GLU GLU B . n 
B 2 195 ILE 195 195 195 ILE ILE B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLN 197 197 197 GLN GLN B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 ARG 199 199 199 ARG ARG B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 ARG 206 206 206 ARG ARG B . n 
B 2 207 GLN 207 207 207 GLN GLN B . n 
B 2 208 HIS 208 208 208 HIS HIS B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 LEU 210 210 210 LEU LEU B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 TRP 212 212 212 TRP TRP B . n 
B 2 213 GLY 213 213 213 GLY GLY B . n 
B 2 214 LEU 214 214 ?   ?   ?   B . n 
B 2 215 THR 215 215 ?   ?   ?   B . n 
B 2 216 THR 216 216 ?   ?   ?   B . n 
B 2 217 PRO 217 217 ?   ?   ?   B . n 
B 2 218 ASP 218 218 ?   ?   ?   B . n 
B 2 219 LYS 219 219 ?   ?   ?   B . n 
B 2 220 LYS 220 220 ?   ?   ?   B . n 
B 2 221 HIS 221 221 ?   ?   ?   B . n 
B 2 222 GLN 222 222 ?   ?   ?   B . n 
B 2 223 LYS 223 223 ?   ?   ?   B . n 
B 2 224 GLU 224 224 ?   ?   ?   B . n 
B 2 225 PRO 225 225 ?   ?   ?   B . n 
B 2 226 PRO 226 226 ?   ?   ?   B . n 
B 2 227 PHE 227 227 ?   ?   ?   B . n 
B 2 228 LEU 228 228 ?   ?   ?   B . n 
B 2 229 TRP 229 229 ?   ?   ?   B . n 
B 2 230 MET 230 230 ?   ?   ?   B . n 
B 2 231 GLY 231 231 231 GLY GLY B . n 
B 2 232 TYR 232 232 232 TYR TYR B . n 
B 2 233 GLU 233 233 233 GLU GLU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 HIS 235 235 235 HIS HIS B . n 
B 2 236 PRO 236 236 236 PRO PRO B . n 
B 2 237 ASP 237 237 237 ASP ASP B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 TRP 239 239 239 TRP TRP B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 VAL 241 241 241 VAL VAL B . n 
B 2 242 GLN 242 242 242 GLN GLN B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 VAL 245 245 245 VAL VAL B . n 
B 2 246 LEU 246 246 246 LEU LEU B . n 
B 2 247 PRO 247 247 247 PRO PRO B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 LYS 249 249 249 LYS LYS B . n 
B 2 250 ASP 250 250 250 ASP ASP B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 TRP 252 252 252 TRP TRP B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 VAL 254 254 254 VAL VAL B . n 
B 2 255 ASN 255 255 255 ASN ASN B . n 
B 2 256 ASP 256 256 256 ASP ASP B . n 
B 2 257 ILE 257 257 257 ILE ILE B . n 
B 2 258 GLN 258 258 258 GLN GLN B . n 
B 2 259 LYS 259 259 259 LYS LYS B . n 
B 2 260 LEU 260 260 260 LEU LEU B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 GLY 262 262 262 GLY GLY B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 LEU 264 264 264 LEU LEU B . n 
B 2 265 ASN 265 265 265 ASN ASN B . n 
B 2 266 TRP 266 266 266 TRP TRP B . n 
B 2 267 ALA 267 267 267 ALA ALA B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 ILE 270 270 270 ILE ILE B . n 
B 2 271 TYR 271 271 271 TYR TYR B . n 
B 2 272 PRO 272 272 272 PRO PRO B . n 
B 2 273 GLY 273 273 273 GLY GLY B . n 
B 2 274 ILE 274 274 274 ILE ILE B . n 
B 2 275 LYS 275 275 275 LYS LYS B . n 
B 2 276 VAL 276 276 276 VAL VAL B . n 
B 2 277 ARG 277 277 277 ARG ARG B . n 
B 2 278 GLN 278 278 278 GLN GLN B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 SER 280 280 280 SER SER B . n 
B 2 281 LYS 281 281 281 LYS LYS B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 LEU 283 283 283 LEU LEU B . n 
B 2 284 ARG 284 284 284 ARG ARG B . n 
B 2 285 GLY 285 285 285 GLY GLY B . n 
B 2 286 THR 286 286 286 THR THR B . n 
B 2 287 LYS 287 287 287 LYS LYS B . n 
B 2 288 ALA 288 288 288 ALA ALA B . n 
B 2 289 LEU 289 289 289 LEU LEU B . n 
B 2 290 THR 290 290 290 THR THR B . n 
B 2 291 GLU 291 291 291 GLU GLU B . n 
B 2 292 VAL 292 292 292 VAL VAL B . n 
B 2 293 ILE 293 293 293 ILE ILE B . n 
B 2 294 PRO 294 294 294 PRO PRO B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 THR 296 296 296 THR THR B . n 
B 2 297 GLU 297 297 297 GLU GLU B . n 
B 2 298 GLU 298 298 298 GLU GLU B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 GLU 300 300 300 GLU GLU B . n 
B 2 301 LEU 301 301 301 LEU LEU B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 LEU 303 303 303 LEU LEU B . n 
B 2 304 ALA 304 304 304 ALA ALA B . n 
B 2 305 GLU 305 305 305 GLU GLU B . n 
B 2 306 ASN 306 306 306 ASN ASN B . n 
B 2 307 ARG 307 307 307 ARG ARG B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ILE 309 309 309 ILE ILE B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LYS 311 311 311 LYS LYS B . n 
B 2 312 GLU 312 312 312 GLU GLU B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 HIS 315 315 315 HIS HIS B . n 
B 2 316 GLY 316 316 316 GLY GLY B . n 
B 2 317 VAL 317 317 317 VAL VAL B . n 
B 2 318 TYR 318 318 318 TYR TYR B . n 
B 2 319 TYR 319 319 319 TYR TYR B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 SER 322 322 322 SER SER B . n 
B 2 323 LYS 323 323 323 LYS LYS B . n 
B 2 324 ASP 324 324 324 ASP ASP B . n 
B 2 325 LEU 325 325 325 LEU LEU B . n 
B 2 326 ILE 326 326 326 ILE ILE B . n 
B 2 327 ALA 327 327 327 ALA ALA B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 ILE 329 329 329 ILE ILE B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 LYS 331 331 331 LYS LYS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLY 333 333 333 GLY GLY B . n 
B 2 334 GLN 334 334 334 GLN GLN B . n 
B 2 335 GLY 335 335 335 GLY GLY B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 TRP 337 337 337 TRP TRP B . n 
B 2 338 THR 338 338 338 THR THR B . n 
B 2 339 TYR 339 339 339 TYR TYR B . n 
B 2 340 GLN 340 340 340 GLN GLN B . n 
B 2 341 ILE 341 341 341 ILE ILE B . n 
B 2 342 TYR 342 342 342 TYR TYR B . n 
B 2 343 GLN 343 343 343 GLN GLN B . n 
B 2 344 GLU 344 344 344 GLU GLU B . n 
B 2 345 PRO 345 345 345 PRO PRO B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 ASN 348 348 348 ASN ASN B . n 
B 2 349 LEU 349 349 349 LEU LEU B . n 
B 2 350 LYS 350 350 350 LYS LYS B . n 
B 2 351 THR 351 351 351 THR THR B . n 
B 2 352 GLY 352 352 352 GLY GLY B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 TYR 354 354 354 TYR TYR B . n 
B 2 355 ALA 355 355 355 ALA ALA B . n 
B 2 356 ARG 356 356 356 ARG ARG B . n 
B 2 357 MET 357 357 357 MET MET B . n 
B 2 358 ARG 358 358 358 ARG ARG B . n 
B 2 359 GLY 359 359 359 GLY GLY B . n 
B 2 360 ALA 360 360 360 ALA ALA B . n 
B 2 361 HIS 361 361 361 HIS HIS B . n 
B 2 362 THR 362 362 362 THR THR B . n 
B 2 363 ASN 363 363 363 ASN ASN B . n 
B 2 364 ASP 364 364 364 ASP ASP B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 LYS 366 366 366 LYS LYS B . n 
B 2 367 GLN 367 367 367 GLN GLN B . n 
B 2 368 LEU 368 368 368 LEU LEU B . n 
B 2 369 THR 369 369 369 THR THR B . n 
B 2 370 GLU 370 370 370 GLU GLU B . n 
B 2 371 ALA 371 371 371 ALA ALA B . n 
B 2 372 VAL 372 372 372 VAL VAL B . n 
B 2 373 GLN 373 373 373 GLN GLN B . n 
B 2 374 LYS 374 374 374 LYS LYS B . n 
B 2 375 ILE 375 375 375 ILE ILE B . n 
B 2 376 THR 376 376 376 THR THR B . n 
B 2 377 THR 377 377 377 THR THR B . n 
B 2 378 GLU 378 378 378 GLU GLU B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 ILE 380 380 380 ILE ILE B . n 
B 2 381 VAL 381 381 381 VAL VAL B . n 
B 2 382 ILE 382 382 382 ILE ILE B . n 
B 2 383 TRP 383 383 383 TRP TRP B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 LYS 385 385 385 LYS LYS B . n 
B 2 386 THR 386 386 386 THR THR B . n 
B 2 387 PRO 387 387 387 PRO PRO B . n 
B 2 388 LYS 388 388 388 LYS LYS B . n 
B 2 389 PHE 389 389 389 PHE PHE B . n 
B 2 390 LYS 390 390 390 LYS LYS B . n 
B 2 391 LEU 391 391 391 LEU LEU B . n 
B 2 392 PRO 392 392 392 PRO PRO B . n 
B 2 393 ILE 393 393 393 ILE ILE B . n 
B 2 394 GLN 394 394 394 GLN GLN B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 GLU 396 396 396 GLU GLU B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 TRP 398 398 398 TRP TRP B . n 
B 2 399 GLU 399 399 399 GLU GLU B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 TRP 401 401 401 TRP TRP B . n 
B 2 402 TRP 402 402 402 TRP TRP B . n 
B 2 403 THR 403 403 403 THR THR B . n 
B 2 404 GLU 404 404 404 GLU GLU B . n 
B 2 405 TYR 405 405 405 TYR TYR B . n 
B 2 406 TRP 406 406 406 TRP TRP B . n 
B 2 407 GLN 407 407 407 GLN GLN B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 THR 409 409 409 THR THR B . n 
B 2 410 TRP 410 410 410 TRP TRP B . n 
B 2 411 ILE 411 411 411 ILE ILE B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 GLU 413 413 413 GLU GLU B . n 
B 2 414 TRP 414 414 414 TRP TRP B . n 
B 2 415 GLU 415 415 415 GLU GLU B . n 
B 2 416 PHE 416 416 416 PHE PHE B . n 
B 2 417 VAL 417 417 417 VAL VAL B . n 
B 2 418 ASN 418 418 418 ASN ASN B . n 
B 2 419 THR 419 419 419 THR THR B . n 
B 2 420 PRO 420 420 420 PRO PRO B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 VAL 423 423 423 VAL VAL B . n 
B 2 424 LYS 424 424 424 LYS LYS B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 TRP 426 426 426 TRP TRP B . n 
B 2 427 TYR 427 427 427 TYR TYR B . n 
B 2 428 GLN 428 428 428 GLN GLN B . n 
B 2 429 LEU 429 429 429 LEU LEU B . n 
B 2 430 GLU 430 430 ?   ?   ?   B . n 
B 2 431 LYS 431 431 ?   ?   ?   B . n 
B 2 432 GLU 432 432 ?   ?   ?   B . n 
B 2 433 PRO 433 433 ?   ?   ?   B . n 
B 2 434 ILE 434 434 ?   ?   ?   B . n 
B 2 435 VAL 435 435 ?   ?   ?   B . n 
B 2 436 GLY 436 436 ?   ?   ?   B . n 
B 2 437 ALA 437 437 ?   ?   ?   B . n 
B 2 438 GLU 438 438 ?   ?   ?   B . n 
B 2 439 THR 439 439 ?   ?   ?   B . n 
B 2 440 PHE 440 440 ?   ?   ?   B . n 
C 3 1   DA  1   802 ?   ?   ?   P . n 
C 3 2   DC  2   803 ?   ?   ?   P . n 
C 3 3   DA  3   804 ?   ?   ?   P . n 
C 3 4   DG  4   805 805 DG  DG  P . n 
C 3 5   DT  5   806 806 DT  DT  P . n 
C 3 6   DC  6   807 807 DC  DC  P . n 
C 3 7   DC  7   808 808 DC  DC  P . n 
C 3 8   DC  8   809 809 DC  DC  P . n 
C 3 9   DT  9   810 810 DT  DT  P . n 
C 3 10  DG  10  811 811 DG  DG  P . n 
C 3 11  DT  11  812 812 DT  DT  P . n 
C 3 12  DT  12  813 813 DT  DT  P . n 
C 3 13  DC  13  814 814 DC  DC  P . n 
C 3 14  DG  14  815 815 DG  DG  P . n 
C 3 15  DG  15  816 816 DG  DG  P . n 
C 3 16  DG  16  817 817 DG  DG  P . n 
C 3 17  DC  17  818 818 DC  DC  P . n 
C 3 18  DG  18  819 819 DG  DG  P . n 
C 3 19  DC  19  820 820 DC  DC  P . n 
C 3 20  DC  20  821 821 DC  DC  P . n 
C 3 21  DOC 21  822 822 DOC DOC P . n 
D 4 1   DA  1   701 ?   ?   ?   T . n 
D 4 2   DT  2   702 ?   ?   ?   T . n 
D 4 3   DG  3   703 703 DG  DG  T . n 
D 4 4   DG  4   704 704 DG  DG  T . n 
D 4 5   DG  5   705 705 DG  DG  T . n 
D 4 6   DG  6   706 706 DG  DG  T . n 
D 4 7   DG  7   707 707 DG  DG  T . n 
D 4 8   DG  8   708 708 DG  DG  T . n 
D 4 9   DC  9   709 709 DC  DC  T . n 
D 4 10  DG  10  710 710 DG  DG  T . n 
D 4 11  DC  11  711 711 DC  DC  T . n 
D 4 12  DC  12  712 712 DC  DC  T . n 
D 4 13  DC  13  713 713 DC  DC  T . n 
D 4 14  DG  14  714 714 DG  DG  T . n 
D 4 15  DA  15  715 715 DA  DA  T . n 
D 4 16  DA  16  716 716 DA  DA  T . n 
D 4 17  DC  17  717 717 DC  DC  T . n 
D 4 18  DA  18  718 718 DA  DA  T . n 
D 4 19  DG  19  719 719 DG  DG  T . n 
D 4 20  DG  20  720 720 DG  DG  T . n 
D 4 21  DG  21  721 721 DG  DG  T . n 
D 4 22  DA  22  722 722 DA  DA  T . n 
D 4 23  DC  23  723 723 DC  DC  T . n 
D 4 24  DT  24  724 724 DT  DT  T . n 
D 4 25  DG  25  725 725 DG  DG  T . n 
D 4 26  DT  26  726 726 DT  DT  T . n 
D 4 27  DG  27  727 ?   ?   ?   T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 SO4 1  601 1   SO4 SO4 A . 
F 5 SO4 1  602 2   SO4 SO4 A . 
G 6 MG  1  603 600 MG  MG  A . 
H 7 N8G 1  604 1   N8G IKO A . 
I 8 HOH 1  701 1   HOH HOH A . 
I 8 HOH 2  702 4   HOH HOH A . 
I 8 HOH 3  703 12  HOH HOH A . 
I 8 HOH 4  704 13  HOH HOH A . 
I 8 HOH 5  705 15  HOH HOH A . 
I 8 HOH 6  706 31  HOH HOH A . 
I 8 HOH 7  707 10  HOH HOH A . 
I 8 HOH 8  708 7   HOH HOH A . 
I 8 HOH 9  709 17  HOH HOH A . 
I 8 HOH 10 710 34  HOH HOH A . 
I 8 HOH 11 711 25  HOH HOH A . 
I 8 HOH 12 712 24  HOH HOH A . 
I 8 HOH 13 713 35  HOH HOH A . 
I 8 HOH 14 714 26  HOH HOH A . 
I 8 HOH 15 715 50  HOH HOH A . 
I 8 HOH 16 716 18  HOH HOH A . 
I 8 HOH 17 717 23  HOH HOH A . 
I 8 HOH 18 718 5   HOH HOH A . 
I 8 HOH 19 719 37  HOH HOH A . 
I 8 HOH 20 720 33  HOH HOH A . 
I 8 HOH 21 721 6   HOH HOH A . 
I 8 HOH 22 722 30  HOH HOH A . 
I 8 HOH 23 723 29  HOH HOH A . 
J 8 HOH 1  501 14  HOH HOH B . 
J 8 HOH 2  502 42  HOH HOH B . 
J 8 HOH 3  503 11  HOH HOH B . 
J 8 HOH 4  504 43  HOH HOH B . 
J 8 HOH 5  505 28  HOH HOH B . 
J 8 HOH 6  506 46  HOH HOH B . 
J 8 HOH 7  507 22  HOH HOH B . 
J 8 HOH 8  508 44  HOH HOH B . 
J 8 HOH 9  509 51  HOH HOH B . 
J 8 HOH 10 510 40  HOH HOH B . 
J 8 HOH 11 511 39  HOH HOH B . 
J 8 HOH 12 512 41  HOH HOH B . 
J 8 HOH 13 513 9   HOH HOH B . 
J 8 HOH 14 514 36  HOH HOH B . 
J 8 HOH 15 515 8   HOH HOH B . 
J 8 HOH 16 516 45  HOH HOH B . 
J 8 HOH 17 517 49  HOH HOH B . 
J 8 HOH 18 518 27  HOH HOH B . 
J 8 HOH 19 519 16  HOH HOH B . 
K 8 HOH 1  901 3   HOH HOH P . 
K 8 HOH 2  902 32  HOH HOH P . 
K 8 HOH 3  903 38  HOH HOH P . 
L 8 HOH 1  801 48  HOH HOH T . 
L 8 HOH 2  802 47  HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13050 ? 
1 MORE         -75   ? 
1 'SSA (A^2)'  47050 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 O   ? A VAL 123 ? A VAL 111 ? 1_555 85.2  ? 
2  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD2 ? A ASP 197 ? A ASP 185 ? 1_555 99.6  ? 
3  O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OD2 ? A ASP 197 ? A ASP 185 ? 1_555 76.6  ? 
4  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAC ? H N8G .   ? A N8G 604 ? 1_555 83.5  ? 
5  O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAC ? H N8G .   ? A N8G 604 ? 1_555 94.6  ? 
6  OD2 ? A ASP 197 ? A ASP 185 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAC ? H N8G .   ? A N8G 604 ? 1_555 170.3 ? 
7  OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAI ? H N8G .   ? A N8G 604 ? 1_555 167.1 ? 
8  O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAI ? H N8G .   ? A N8G 604 ? 1_555 90.5  ? 
9  OD2 ? A ASP 197 ? A ASP 185 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAI ? H N8G .   ? A N8G 604 ? 1_555 91.2  ? 
10 OAC ? H N8G .   ? A N8G 604 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAI ? H N8G .   ? A N8G 604 ? 1_555 84.7  ? 
11 OD2 ? A ASP 122 ? A ASP 110 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAD ? H N8G .   ? A N8G 604 ? 1_555 103.8 ? 
12 O   ? A VAL 123 ? A VAL 111 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAD ? H N8G .   ? A N8G 604 ? 1_555 166.7 ? 
13 OD2 ? A ASP 197 ? A ASP 185 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAD ? H N8G .   ? A N8G 604 ? 1_555 92.1  ? 
14 OAC ? H N8G .   ? A N8G 604 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAD ? H N8G .   ? A N8G 604 ? 1_555 96.1  ? 
15 OAI ? H N8G .   ? A N8G 604 ? 1_555 MG ? G MG . ? A MG 603 ? 1_555 OAD ? H N8G .   ? A N8G 604 ? 1_555 82.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-12-25 
2 'Structure model' 1 1 2020-01-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.page_first'              
2 2 'Structure model' '_citation.page_last'               
3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
4 2 'Structure model' '_citation.title'                   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.9_1692 1 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.9_1692 2 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .        5 
# 
_pdbx_entry_details.entry_id                 6UJZ 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    76 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    78 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB    A SER 134 ? ? OG    A SER 134 ? ? 1.501 1.418 0.083  0.013 N 
2 1 "O3'" P DT  810 ? ? "C3'" P DT  810 ? ? 1.382 1.419 -0.037 0.006 N 
3 1 "O3'" T DC  709 ? ? "C3'" T DC  709 ? ? 1.361 1.419 -0.058 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C     A ILE 132 ? ? N     A PRO 133 ? ? CA  A PRO 133 ? ? 131.91 119.30 12.61 1.50 Y 
2 1 "C3'" P DC  821 ? ? "O3'" P DC  821 ? ? P   P DOC 822 ? ? 111.36 119.70 -8.34 1.20 Y 
3 1 "O3'" P DC  821 ? ? P     P DOC 822 ? ? OP2 P DOC 822 ? ? 130.11 110.50 19.61 1.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 4   ? ? -77.45  25.77   
2  1 THR A 27  ? ? -37.97  148.82  
3  1 SER A 68  ? ? 59.98   2.90    
4  1 PRO A 140 ? ? -101.11 -168.90 
5  1 MET A 184 ? ? 52.01   -114.52 
6  1 PRO A 247 ? ? -54.82  176.24  
7  1 GLU A 248 ? ? -153.99 28.22   
8  1 VAL A 276 ? ? -142.56 18.91   
9  1 LEU A 283 ? ? -69.23  2.13    
10 1 THR A 286 ? ? -39.70  122.37  
11 1 PRO A 412 ? ? -61.97  -171.43 
12 1 ASN A 418 ? ? -55.78  -1.37   
13 1 PHE B 61  ? ? -150.22 -155.30 
14 1 LYS B 66  ? ? 51.73   -118.42 
15 1 SER B 68  ? ? -68.82  -179.37 
16 1 PRO B 97  ? ? -63.49  96.27   
17 1 MET B 184 ? ? 53.83   -135.10 
18 1 ASP B 185 ? ? -68.75  14.76   
19 1 ILE B 195 ? ? -57.62  -6.07   
20 1 PRO B 236 ? ? -57.97  -9.03   
21 1 PRO B 345 ? ? -39.96  123.06  
22 1 LYS B 347 ? ? -104.18 65.52   
23 1 HIS B 361 ? ? -76.11  37.17   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 P DG 805 ? P   ? C DG 4 P   
2 1 Y 1 P DG 805 ? OP1 ? C DG 4 OP1 
3 1 Y 1 P DG 805 ? OP2 ? C DG 4 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -11 ? A MET 1   
2  1 Y 1 A GLY -10 ? A GLY 2   
3  1 Y 1 A SER -9  ? A SER 3   
4  1 Y 1 A SER -8  ? A SER 4   
5  1 Y 1 A HIS -7  ? A HIS 5   
6  1 Y 1 A HIS -6  ? A HIS 6   
7  1 Y 1 A HIS -5  ? A HIS 7   
8  1 Y 1 A HIS -4  ? A HIS 8   
9  1 Y 1 A HIS -3  ? A HIS 9   
10 1 Y 1 A HIS -2  ? A HIS 10  
11 1 Y 1 A SER -1  ? A SER 11  
12 1 Y 1 A SER 0   ? A SER 12  
13 1 Y 1 A ILE 135 ? A ILE 147 
14 1 Y 1 A ASN 136 ? A ASN 148 
15 1 Y 1 A ASN 137 ? A ASN 149 
16 1 Y 1 A GLU 138 ? A GLU 150 
17 1 Y 1 A LYS 558 ? A LYS 570 
18 1 Y 1 A VAL 559 ? A VAL 571 
19 1 Y 1 A LEU 560 ? A LEU 572 
20 1 Y 1 B PRO 1   ? B PRO 1   
21 1 Y 1 B ILE 2   ? B ILE 2   
22 1 Y 1 B SER 3   ? B SER 3   
23 1 Y 1 B PRO 4   ? B PRO 4   
24 1 Y 1 B ILE 5   ? B ILE 5   
25 1 Y 1 B PHE 87  ? B PHE 87  
26 1 Y 1 B TRP 88  ? B TRP 88  
27 1 Y 1 B GLU 89  ? B GLU 89  
28 1 Y 1 B VAL 90  ? B VAL 90  
29 1 Y 1 B GLN 91  ? B GLN 91  
30 1 Y 1 B LEU 92  ? B LEU 92  
31 1 Y 1 B GLY 93  ? B GLY 93  
32 1 Y 1 B ILE 94  ? B ILE 94  
33 1 Y 1 B LEU 214 ? B LEU 214 
34 1 Y 1 B THR 215 ? B THR 215 
35 1 Y 1 B THR 216 ? B THR 216 
36 1 Y 1 B PRO 217 ? B PRO 217 
37 1 Y 1 B ASP 218 ? B ASP 218 
38 1 Y 1 B LYS 219 ? B LYS 219 
39 1 Y 1 B LYS 220 ? B LYS 220 
40 1 Y 1 B HIS 221 ? B HIS 221 
41 1 Y 1 B GLN 222 ? B GLN 222 
42 1 Y 1 B LYS 223 ? B LYS 223 
43 1 Y 1 B GLU 224 ? B GLU 224 
44 1 Y 1 B PRO 225 ? B PRO 225 
45 1 Y 1 B PRO 226 ? B PRO 226 
46 1 Y 1 B PHE 227 ? B PHE 227 
47 1 Y 1 B LEU 228 ? B LEU 228 
48 1 Y 1 B TRP 229 ? B TRP 229 
49 1 Y 1 B MET 230 ? B MET 230 
50 1 Y 1 B GLU 430 ? B GLU 430 
51 1 Y 1 B LYS 431 ? B LYS 431 
52 1 Y 1 B GLU 432 ? B GLU 432 
53 1 Y 1 B PRO 433 ? B PRO 433 
54 1 Y 1 B ILE 434 ? B ILE 434 
55 1 Y 1 B VAL 435 ? B VAL 435 
56 1 Y 1 B GLY 436 ? B GLY 436 
57 1 Y 1 B ALA 437 ? B ALA 437 
58 1 Y 1 B GLU 438 ? B GLU 438 
59 1 Y 1 B THR 439 ? B THR 439 
60 1 Y 1 B PHE 440 ? B PHE 440 
61 1 Y 1 P DA  802 ? C DA  1   
62 1 Y 1 P DC  803 ? C DC  2   
63 1 Y 1 P DA  804 ? C DA  3   
64 1 Y 1 T DA  701 ? D DA  1   
65 1 Y 1 T DT  702 ? D DT  2   
66 1 Y 1 T DG  727 ? D DG  27  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6UJZ 'double helix'        
6UJZ 'a-form double helix' 
6UJZ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG  4  1_555 D DC 23 1_555 -0.440 -0.107 -0.219 -13.721 -13.030 -2.326 1  P_DG805:DC723_T  P 805 ? T 723 ? 19 1 
1 C DT  5  1_555 D DA 22 1_555 -0.242 -0.141 -0.390 -2.078  -4.612  8.226  2  P_DT806:DA722_T  P 806 ? T 722 ? 20 1 
1 C DC  6  1_555 D DG 21 1_555 0.405  -0.236 -0.159 -3.061  -5.445  -3.288 3  P_DC807:DG721_T  P 807 ? T 721 ? 19 1 
1 C DC  7  1_555 D DG 20 1_555 0.011  -0.113 -0.083 -4.310  -5.202