data_6UPX
# 
_entry.id   6UPX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.326 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UPX         
WWPDB D_1000244620 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UPX 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Oh, J.'   1 0000-0002-7625-2779 
'Wang, D.' 2 0000-0002-2829-1546 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                9338 
_citation.page_last                 9348 
_citation.title                     
'RNA polymerase II stalls on oxidative DNA damage via a torsion-latch mechanism involving lone pair-pi and CH-pi interactions.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1919904117 
_citation.pdbx_database_id_PubMed   32284409 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Oh, J.'        1 0000-0002-7625-2779 
primary 'Fleming, A.M.' 2 0000-0002-2000-0310 
primary 'Xu, J.'        3 ?                   
primary 'Chong, J.'     4 ?                   
primary 'Burrows, C.J.' 5 0000-0001-7253-8529 
primary 'Wang, D.'      6 0000-0002-2829-1546 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   101.030 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UPX 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     168.988 
_cell.length_a_esd                 ? 
_cell.length_b                     223.314 
_cell.length_b_esd                 ? 
_cell.length_c                     193.102 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UPX 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn RNA                                                          2934.831   1 ?       ? ? ? 
2  polymer     syn 'Template strand DNA'                                        8745.599   1 ?       ? ? ? 
3  polymer     syn 'Non-template strand DNA'                                    5663.694   1 ?       ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                191821.578 1 2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                138937.297 1 2.7.7.6 ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                35330.457  1 ?       ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 25117.094  1 ?       ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 17931.834  1 ?       ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 16525.363  1 ?       ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                14308.161  1 ?       ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8290.732   1 ?       ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'               13633.493  1 ?       ? ? ? 
13 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7729.969   1 ?       ? ? ? 
14 non-polymer syn 'ZINC ION'                                                   65.409     8 ?       ? ? ? 
15 non-polymer syn 'MAGNESIUM ION'                                              24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4  'RNA polymerase II subunit B1,DNA-directed RNA polymerase III largest subunit,RNA polymerase II subunit B220' 
5  'RNA polymerase II subunit 2,B150,DNA-directed RNA polymerase II 140 kDa polypeptide' 
6  'RNA polymerase II subunit B3,B44.5,DNA-directed RNA polymerase II 45 kDa polypeptide' 
7  'RNA polymerases I,II,and III subunit ABC1,ABC27,DNA-directed RNA polymerases I,and III 27 kDa polypeptide' 
8  'RNA polymerases I,II,and III subunit ABC2,ABC23,DNA-directed RNA polymerases I,and III 23 kDa polypeptide' 
9  'RNA polymerases I,II,and III subunit ABC3,ABC14.4,ABC14.5,DNA-directed RNA polymerases I,and III 14.5 kDa polypeptide' 
10 
'RNA polymerase II subunit B9,B12.6,DNA-directed RNA polymerase II 14.2 kDa polypeptide,DNA-directed RNA polymerase II subunit 9' 
11 'RNA polymerases I,II,and III subunit ABC5,ABC10-beta,ABC8,DNA-directed RNA polymerases I,and III 8.3 kDa polypeptide' 
12 'RNA polymerase II subunit B11,B13.6,DNA-directed RNA polymerase II 13.6 kDa polypeptide' 
13 'RNA polymerases I,II,and III subunit ABC4,ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide      no no  AUCGAGAGG AUCGAGAGG R ? 
2  polydeoxyribonucleotide no yes 
;(DC)(DC)(DT)(DT)(DC)(DT)(DC)(DT)(DC)(DT)(DC)(DT)(DC)(DG)(DC)(DT)(DG)(DA)(G35)
(DC)(DC)(DT)(DC)(DT)(DC)(DG)(DA)(DT)(DG)
;
CCTTCTCTCTCTCGCTGAXCCTCTCGATG T ? 
3  polydeoxyribonucleotide no no  '(DT)(DC)(DA)(DG)(DC)(DG)(DA)(DG)(DA)(DG)(DA)(DG)(DA)(DG)(DA)(DA)(DG)(DG)' TCAGCGAGAGAGAGAAGG N 
? 
4  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
5  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
6  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
7  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
8  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
9  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
10 'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
11 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
12 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
13 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    A   n 
1  2    U   n 
1  3    C   n 
1  4    G   n 
1  5    A   n 
1  6    G   n 
1  7    A   n 
1  8    G   n 
1  9    G   n 
2  1    DC  n 
2  2    DC  n 
2  3    DT  n 
2  4    DT  n 
2  5    DC  n 
2  6    DT  n 
2  7    DC  n 
2  8    DT  n 
2  9    DC  n 
2  10   DT  n 
2  11   DC  n 
2  12   DT  n 
2  13   DC  n 
2  14   DG  n 
2  15   DC  n 
2  16   DT  n 
2  17   DG  n 
2  18   DA  n 
2  19   G35 n 
2  20   DC  n 
2  21   DC  n 
2  22   DT  n 
2  23   DC  n 
2  24   DT  n 
2  25   DC  n 
2  26   DG  n 
2  27   DA  n 
2  28   DT  n 
2  29   DG  n 
3  1    DT  n 
3  2    DC  n 
3  3    DA  n 
3  4    DG  n 
3  5    DC  n 
3  6    DG  n 
3  7    DA  n 
3  8    DG  n 
3  9    DA  n 
3  10   DG  n 
3  11   DA  n 
3  12   DG  n 
3  13   DA  n 
3  14   DG  n 
3  15   DA  n 
3  16   DA  n 
3  17   DG  n 
3  18   DG  n 
4  1    MET n 
4  2    VAL n 
4  3    GLY n 
4  4    GLN n 
4  5    GLN n 
4  6    TYR n 
4  7    SER n 
4  8    SER n 
4  9    ALA n 
4  10   PRO n 
4  11   LEU n 
4  12   ARG n 
4  13   THR n 
4  14   VAL n 
4  15   LYS n 
4  16   GLU n 
4  17   VAL n 
4  18   GLN n 
4  19   PHE n 
4  20   GLY n 
4  21   LEU n 
4  22   PHE n 
4  23   SER n 
4  24   PRO n 
4  25   GLU n 
4  26   GLU n 
4  27   VAL n 
4  28   ARG n 
4  29   ALA n 
4  30   ILE n 
4  31   SER n 
4  32   VAL n 
4  33   ALA n 
4  34   LYS n 
4  35   ILE n 
4  36   ARG n 
4  37   PHE n 
4  38   PRO n 
4  39   GLU n 
4  40   THR n 
4  41   MET n 
4  42   ASP n 
4  43   GLU n 
4  44   THR n 
4  45   GLN n 
4  46   THR n 
4  47   ARG n 
4  48   ALA n 
4  49   LYS n 
4  50   ILE n 
4  51   GLY n 
4  52   GLY n 
4  53   LEU n 
4  54   ASN n 
4  55   ASP n 
4  56   PRO n 
4  57   ARG n 
4  58   LEU n 
4  59   GLY n 
4  60   SER n 
4  61   ILE n 
4  62   ASP n 
4  63   ARG n 
4  64   ASN n 
4  65   LEU n 
4  66   LYS n 
4  67   CYS n 
4  68   GLN n 
4  69   THR n 
4  70   CYS n 
4  71   GLN n 
4  72   GLU n 
4  73   GLY n 
4  74   MET n 
4  75   ASN n 
4  76   GLU n 
4  77   CYS n 
4  78   PRO n 
4  79   GLY n 
4  80   HIS n 
4  81   PHE n 
4  82   GLY n 
4  83   HIS n 
4  84   ILE n 
4  85   ASP n 
4  86   LEU n 
4  87   ALA n 
4  88   LYS n 
4  89   PRO n 
4  90   VAL n 
4  91   PHE n 
4  92   HIS n 
4  93   VAL n 
4  94   GLY n 
4  95   PHE n 
4  96   ILE n 
4  97   ALA n 
4  98   LYS n 
4  99   ILE n 
4  100  LYS n 
4  101  LYS n 
4  102  VAL n 
4  103  CYS n 
4  104  GLU n 
4  105  CYS n 
4  106  VAL n 
4  107  CYS n 
4  108  MET n 
4  109  HIS n 
4  110  CYS n 
4  111  GLY n 
4  112  LYS n 
4  113  LEU n 
4  114  LEU n 
4  115  LEU n 
4  116  ASP n 
4  117  GLU n 
4  118  HIS n 
4  119  ASN n 
4  120  GLU n 
4  121  LEU n 
4  122  MET n 
4  123  ARG n 
4  124  GLN n 
4  125  ALA n 
4  126  LEU n 
4  127  ALA n 
4  128  ILE n 
4  129  LYS n 
4  130  ASP n 
4  131  SER n 
4  132  LYS n 
4  133  LYS n 
4  134  ARG n 
4  135  PHE n 
4  136  ALA n 
4  137  ALA n 
4  138  ILE n 
4  139  TRP n 
4  140  THR n 
4  141  LEU n 
4  142  CYS n 
4  143  LYS n 
4  144  THR n 
4  145  LYS n 
4  146  MET n 
4  147  VAL n 
4  148  CYS n 
4  149  GLU n 
4  150  THR n 
4  151  ASP n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  GLU n 
4  156  ASP n 
4  157  ASP n 
4  158  PRO n 
4  159  THR n 
4  160  GLN n 
4  161  LEU n 
4  162  VAL n 
4  163  SER n 
4  164  ARG n 
4  165  GLY n 
4  166  GLY n 
4  167  CYS n 
4  168  GLY n 
4  169  ASN n 
4  170  THR n 
4  171  GLN n 
4  172  PRO n 
4  173  THR n 
4  174  ILE n 
4  175  ARG n 
4  176  LYS n 
4  177  ASP n 
4  178  GLY n 
4  179  LEU n 
4  180  LYS n 
4  181  LEU n 
4  182  VAL n 
4  183  GLY n 
4  184  SER n 
4  185  TRP n 
4  186  LYS n 
4  187  LYS n 
4  188  ASP n 
4  189  ARG n 
4  190  ALA n 
4  191  THR n 
4  192  GLY n 
4  193  ASP n 
4  194  ALA n 
4  195  ASP n 
4  196  GLU n 
4  197  PRO n 
4  198  GLU n 
4  199  LEU n 
4  200  ARG n 
4  201  VAL n 
4  202  LEU n 
4  203  SER n 
4  204  THR n 
4  205  GLU n 
4  206  GLU n 
4  207  ILE n 
4  208  LEU n 
4  209  ASN n 
4  210  ILE n 
4  211  PHE n 
4  212  LYS n 
4  213  HIS n 
4  214  ILE n 
4  215  SER n 
4  216  VAL n 
4  217  LYS n 
4  218  ASP n 
4  219  PHE n 
4  220  THR n 
4  221  SER n 
4  222  LEU n 
4  223  GLY n 
4  224  PHE n 
4  225  ASN n 
4  226  GLU n 
4  227  VAL n 
4  228  PHE n 
4  229  SER n 
4  230  ARG n 
4  231  PRO n 
4  232  GLU n 
4  233  TRP n 
4  234  MET n 
4  235  ILE n 
4  236  LEU n 
4  237  THR n 
4  238  CYS n 
4  239  LEU n 
4  240  PRO n 
4  241  VAL n 
4  242  PRO n 
4  243  PRO n 
4  244  PRO n 
4  245  PRO n 
4  246  VAL n 
4  247  ARG n 
4  248  PRO n 
4  249  SER n 
4  250  ILE n 
4  251  SER n 
4  252  PHE n 
4  253  ASN n 
4  254  GLU n 
4  255  SER n 
4  256  GLN n 
4  257  ARG n 
4  258  GLY n 
4  259  GLU n 
4  260  ASP n 
4  261  ASP n 
4  262  LEU n 
4  263  THR n 
4  264  PHE n 
4  265  LYS n 
4  266  LEU n 
4  267  ALA n 
4  268  ASP n 
4  269  ILE n 
4  270  LEU n 
4  271  LYS n 
4  272  ALA n 
4  273  ASN n 
4  274  ILE n 
4  275  SER n 
4  276  LEU n 
4  277  GLU n 
4  278  THR n 
4  279  LEU n 
4  280  GLU n 
4  281  HIS n 
4  282  ASN n 
4  283  GLY n 
4  284  ALA n 
4  285  PRO n 
4  286  HIS n 
4  287  HIS n 
4  288  ALA n 
4  289  ILE n 
4  290  GLU n 
4  291  GLU n 
4  292  ALA n 
4  293  GLU n 
4  294  SER n 
4  295  LEU n 
4  296  LEU n 
4  297  GLN n 
4  298  PHE n 
4  299  HIS n 
4  300  VAL n 
4  301  ALA n 
4  302  THR n 
4  303  TYR n 
4  304  MET n 
4  305  ASP n 
4  306  ASN n 
4  307  ASP n 
4  308  ILE n 
4  309  ALA n 
4  310  GLY n 
4  311  GLN n 
4  312  PRO n 
4  313  GLN n 
4  314  ALA n 
4  315  LEU n 
4  316  GLN n 
4  317  LYS n 
4  318  SER n 
4  319  GLY n 
4  320  ARG n 
4  321  PRO n 
4  322  VAL n 
4  323  LYS n 
4  324  SER n 
4  325  ILE n 
4  326  ARG n 
4  327  ALA n 
4  328  ARG n 
4  329  LEU n 
4  330  LYS n 
4  331  GLY n 
4  332  LYS n 
4  333  GLU n 
4  334  GLY n 
4  335  ARG n 
4  336  ILE n 
4  337  ARG n 
4  338  GLY n 
4  339  ASN n 
4  340  LEU n 
4  341  MET n 
4  342  GLY n 
4  343  LYS n 
4  344  ARG n 
4  345  VAL n 
4  346  ASP n 
4  347  PHE n 
4  348  SER n 
4  349  ALA n 
4  350  ARG n 
4  351  THR n 
4  352  VAL n 
4  353  ILE n 
4  354  SER n 
4  355  GLY n 
4  356  ASP n 
4  357  PRO n 
4  358  ASN n 
4  359  LEU n 
4  360  GLU n 
4  361  LEU n 
4  362  ASP n 
4  363  GLN n 
4  364  VAL n 
4  365  GLY n 
4  366  VAL n 
4  367  PRO n 
4  368  LYS n 
4  369  SER n 
4  370  ILE n 
4  371  ALA n 
4  372  LYS n 
4  373  THR n 
4  374  LEU n 
4  375  THR n 
4  376  TYR n 
4  377  PRO n 
4  378  GLU n 
4  379  VAL n 
4  380  VAL n 
4  381  THR n 
4  382  PRO n 
4  383  TYR n 
4  384  ASN n 
4  385  ILE n 
4  386  ASP n 
4  387  ARG n 
4  388  LEU n 
4  389  THR n 
4  390  GLN n 
4  391  LEU n 
4  392  VAL n 
4  393  ARG n 
4  394  ASN n 
4  395  GLY n 
4  396  PRO n 
4  397  ASN n 
4  398  GLU n 
4  399  HIS n 
4  400  PRO n 
4  401  GLY n 
4  402  ALA n 
4  403  LYS n 
4  404  TYR n 
4  405  VAL n 
4  406  ILE n 
4  407  ARG n 
4  408  ASP n 
4  409  SER n 
4  410  GLY n 
4  411  ASP n 
4  412  ARG n 
4  413  ILE n 
4  414  ASP n 
4  415  LEU n 
4  416  ARG n 
4  417  TYR n 
4  418  SER n 
4  419  LYS n 
4  420  ARG n 
4  421  ALA n 
4  422  GLY n 
4  423  ASP n 
4  424  ILE n 
4  425  GLN n 
4  426  LEU n 
4  427  GLN n 
4  428  TYR n 
4  429  GLY n 
4  430  TRP n 
4  431  LYS n 
4  432  VAL n 
4  433  GLU n 
4  434  ARG n 
4  435  HIS n 
4  436  ILE n 
4  437  MET n 
4  438  ASP n 
4  439  ASN n 
4  440  ASP n 
4  441  PRO n 
4  442  VAL n 
4  443  LEU n 
4  444  PHE n 
4  445  ASN n 
4  446  ARG n 
4  447  GLN n 
4  448  PRO n 
4  449  SER n 
4  450  LEU n 
4  451  HIS n 
4  452  LYS n 
4  453  MET n 
4  454  SER n 
4  455  MET n 
4  456  MET n 
4  457  ALA n 
4  458  HIS n 
4  459  ARG n 
4  460  VAL n 
4  461  LYS n 
4  462  VAL n 
4  463  ILE n 
4  464  PRO n 
4  465  TYR n 
4  466  SER n 
4  467  THR n 
4  468  PHE n 
4  469  ARG n 
4  470  LEU n 
4  471  ASN n 
4  472  LEU n 
4  473  SER n 
4  474  VAL n 
4  475  THR n 
4  476  SER n 
4  477  PRO n 
4  478  TYR n 
4  479  ASN n 
4  480  ALA n 
4  481  ASP n 
4  482  PHE n 
4  483  ASP n 
4  484  GLY n 
4  485  ASP n 
4  486  GLU n 
4  487  MET n 
4  488  ASN n 
4  489  LEU n 
4  490  HIS n 
4  491  VAL n 
4  492  PRO n 
4  493  GLN n 
4  494  SER n 
4  495  GLU n 
4  496  GLU n 
4  497  THR n 
4  498  ARG n 
4  499  ALA n 
4  500  GLU n 
4  501  LEU n 
4  502  SER n 
4  503  GLN n 
4  504  LEU n 
4  505  CYS n 
4  506  ALA n 
4  507  VAL n 
4  508  PRO n 
4  509  LEU n 
4  510  GLN n 
4  511  ILE n 
4  512  VAL n 
4  513  SER n 
4  514  PRO n 
4  515  GLN n 
4  516  SER n 
4  517  ASN n 
4  518  LYS n 
4  519  PRO n 
4  520  CYS n 
4  521  MET n 
4  522  GLY n 
4  523  ILE n 
4  524  VAL n 
4  525  GLN n 
4  526  ASP n 
4  527  THR n 
4  528  LEU n 
4  529  CYS n 
4  530  GLY n 
4  531  ILE n 
4  532  ARG n 
4  533  LYS n 
4  534  LEU n 
4  535  THR n 
4  536  LEU n 
4  537  ARG n 
4  538  ASP n 
4  539  THR n 
4  540  PHE n 
4  541  ILE n 
4  542  GLU n 
4  543  LEU n 
4  544  ASP n 
4  545  GLN n 
4  546  VAL n 
4  547  LEU n 
4  548  ASN n 
4  549  MET n 
4  550  LEU n 
4  551  TYR n 
4  552  TRP n 
4  553  VAL n 
4  554  PRO n 
4  555  ASP n 
4  556  TRP n 
4  557  ASP n 
4  558  GLY n 
4  559  VAL n 
4  560  ILE n 
4  561  PRO n 
4  562  THR n 
4  563  PRO n 
4  564  ALA n 
4  565  ILE n 
4  566  ILE n 
4  567  LYS n 
4  568  PRO n 
4  569  LYS n 
4  570  PRO n 
4  571  LEU n 
4  572  TRP n 
4  573  SER n 
4  574  GLY n 
4  575  LYS n 
4  576  GLN n 
4  577  ILE n 
4  578  LEU n 
4  579  SER n 
4  580  VAL n 
4  581  ALA n 
4  582  ILE n 
4  583  PRO n 
4  584  ASN n 
4  585  GLY n 
4  586  ILE n 
4  587  HIS n 
4  588  LEU n 
4  589  GLN n 
4  590  ARG n 
4  591  PHE n 
4  592  ASP n 
4  593  GLU n 
4  594  GLY n 
4  595  THR n 
4  596  THR n 
4  597  LEU n 
4  598  LEU n 
4  599  SER n 
4  600  PRO n 
4  601  LYS n 
4  602  ASP n 
4  603  ASN n 
4  604  GLY n 
4  605  MET n 
4  606  LEU n 
4  607  ILE n 
4  608  ILE n 
4  609  ASP n 
4  610  GLY n 
4  611  GLN n 
4  612  ILE n 
4  613  ILE n 
4  614  PHE n 
4  615  GLY n 
4  616  VAL n 
4  617  VAL n 
4  618  GLU n 
4  619  LYS n 
4  620  LYS n 
4  621  THR n 
4  622  VAL n 
4  623  GLY n 
4  624  SER n 
4  625  SER n 
4  626  ASN n 
4  627  GLY n 
4  628  GLY n 
4  629  LEU n 
4  630  ILE n 
4  631  HIS n 
4  632  VAL n 
4  633  VAL n 
4  634  THR n 
4  635  ARG n 
4  636  GLU n 
4  637  LYS n 
4  638  GLY n 
4  639  PRO n 
4  640  GLN n 
4  641  VAL n 
4  642  CYS n 
4  643  ALA n 
4  644  LYS n 
4  645  LEU n 
4  646  PHE n 
4  647  GLY n 
4  648  ASN n 
4  649  ILE n 
4  650  GLN n 
4  651  LYS n 
4  652  VAL n 
4  653  VAL n 
4  654  ASN n 
4  655  PHE n 
4  656  TRP n 
4  657  LEU n 
4  658  LEU n 
4  659  HIS n 
4  660  ASN n 
4  661  GLY n 
4  662  PHE n 
4  663  SER n 
4  664  THR n 
4  665  GLY n 
4  666  ILE n 
4  667  GLY n 
4  668  ASP n 
4  669  THR n 
4  670  ILE n 
4  671  ALA n 
4  672  ASP n 
4  673  GLY n 
4  674  PRO n 
4  675  THR n 
4  676  MET n 
4  677  ARG n 
4  678  GLU n 
4  679  ILE n 
4  680  THR n 
4  681  GLU n 
4  682  THR n 
4  683  ILE n 
4  684  ALA n 
4  685  GLU n 
4  686  ALA n 
4  687  LYS n 
4  688  LYS n 
4  689  LYS n 
4  690  VAL n 
4  691  LEU n 
4  692  ASP n 
4  693  VAL n 
4  694  THR n 
4  695  LYS n 
4  696  GLU n 
4  697  ALA n 
4  698  GLN n 
4  699  ALA n 
4  700  ASN n 
4  701  LEU n 
4  702  LEU n 
4  703  THR n 
4  704  ALA n 
4  705  LYS n 
4  706  HIS n 
4  707  GLY n 
4  708  MET n 
4  709  THR n 
4  710  LEU n 
4  711  ARG n 
4  712  GLU n 
4  713  SER n 
4  714  PHE n 
4  715  GLU n 
4  716  ASP n 
4  717  ASN n 
4  718  VAL n 
4  719  VAL n 
4  720  ARG n 
4  721  PHE n 
4  722  LEU n 
4  723  ASN n 
4  724  GLU n 
4  725  ALA n 
4  726  ARG n 
4  727  ASP n 
4  728  LYS n 
4  729  ALA n 
4  730  GLY n 
4  731  ARG n 
4  732  LEU n 
4  733  ALA n 
4  734  GLU n 
4  735  VAL n 
4  736  ASN n 
4  737  LEU n 
4  738  LYS n 
4  739  ASP n 
4  740  LEU n 
4  741  ASN n 
4  742  ASN n 
4  743  VAL n 
4  744  LYS n 
4  745  GLN n 
4  746  MET n 
4  747  VAL n 
4  748  MET n 
4  749  ALA n 
4  750  GLY n 
4  751  SER n 
4  752  LYS n 
4  753  GLY n 
4  754  SER n 
4  755  PHE n 
4  756  ILE n 
4  757  ASN n 
4  758  ILE n 
4  759  ALA n 
4  760  GLN n 
4  761  MET n 
4  762  SER n 
4  763  ALA n 
4  764  CYS n 
4  765  VAL n 
4  766  GLY n 
4  767  GLN n 
4  768  GLN n 
4  769  SER n 
4  770  VAL n 
4  771  GLU n 
4  772  GLY n 
4  773  LYS n 
4  774  ARG n 
4  775  ILE n 
4  776  ALA n 
4  777  PHE n 
4  778  GLY n 
4  779  PHE n 
4  780  VAL n 
4  781  ASP n 
4  782  ARG n 
4  783  THR n 
4  784  LEU n 
4  785  PRO n 
4  786  HIS n 
4  787  PHE n 
4  788  SER n 
4  789  LYS n 
4  790  ASP n 
4  791  ASP n 
4  792  TYR n 
4  793  SER n 
4  794  PRO n 
4  795  GLU n 
4  796  SER n 
4  797  LYS n 
4  798  GLY n 
4  799  PHE n 
4  800  VAL n 
4  801  GLU n 
4  802  ASN n 
4  803  SER n 
4  804  TYR n 
4  805  LEU n 
4  806  ARG n 
4  807  GLY n 
4  808  LEU n 
4  809  THR n 
4  810  PRO n 
4  811  GLN n 
4  812  GLU n 
4  813  PHE n 
4  814  PHE n 
4  815  PHE n 
4  816  HIS n 
4  817  ALA n 
4  818  MET n 
4  819  GLY n 
4  820  GLY n 
4  821  ARG n 
4  822  GLU n 
4  823  GLY n 
4  824  LEU n 
4  825  ILE n 
4  826  ASP n 
4  827  THR n 
4  828  ALA n 
4  829  VAL n 
4  830  LYS n 
4  831  THR n 
4  832  ALA n 
4  833  GLU n 
4  834  THR n 
4  835  GLY n 
4  836  TYR n 
4  837  ILE n 
4  838  GLN n 
4  839  ARG n 
4  840  ARG n 
4  841  LEU n 
4  842  VAL n 
4  843  LYS n 
4  844  ALA n 
4  845  LEU n 
4  846  GLU n 
4  847  ASP n 
4  848  ILE n 
4  849  MET n 
4  850  VAL n 
4  851  HIS n 
4  852  TYR n 
4  853  ASP n 
4  854  ASN n 
4  855  THR n 
4  856  THR n 
4  857  ARG n 
4  858  ASN n 
4  859  SER n 
4  860  LEU n 
4  861  GLY n 
4  862  ASN n 
4  863  VAL n 
4  864  ILE n 
4  865  GLN n 
4  866  PHE n 
4  867  ILE n 
4  868  TYR n 
4  869  GLY n 
4  870  GLU n 
4  871  ASP n 
4  872  GLY n 
4  873  MET n 
4  874  ASP n 
4  875  ALA n 
4  876  ALA n 
4  877  HIS n 
4  878  ILE n 
4  879  GLU n 
4  880  LYS n 
4  881  GLN n 
4  882  SER n 
4  883  LEU n 
4  884  ASP n 
4  885  THR n 
4  886  ILE n 
4  887  GLY n 
4  888  GLY n 
4  889  SER n 
4  890  ASP n 
4  891  ALA n 
4  892  ALA n 
4  893  PHE n 
4  894  GLU n 
4  895  LYS n 
4  896  ARG n 
4  897  TYR n 
4  898  ARG n 
4  899  VAL n 
4  900  ASP n 
4  901  LEU n 
4  902  LEU n 
4  903  ASN n 
4  904  THR n 
4  905  ASP n 
4  906  HIS n 
4  907  THR n 
4  908  LEU n 
4  909  ASP n 
4  910  PRO n 
4  911  SER n 
4  912  LEU n 
4  913  LEU n 
4  914  GLU n 
4  915  SER n 
4  916  GLY n 
4  917  SER n 
4  918  GLU n 
4  919  ILE n 
4  920  LEU n 
4  921  GLY n 
4  922  ASP n 
4  923  LEU n 
4  924  LYS n 
4  925  LEU n 
4  926  GLN n 
4  927  VAL n 
4  928  LEU n 
4  929  LEU n 
4  930  ASP n 
4  931  GLU n 
4  932  GLU n 
4  933  TYR n 
4  934  LYS n 
4  935  GLN n 
4  936  LEU n 
4  937  VAL n 
4  938  LYS n 
4  939  ASP n 
4  940  ARG n 
4  941  LYS n 
4  942  PHE n 
4  943  LEU n 
4  944  ARG n 
4  945  GLU n 
4  946  VAL n 
4  947  PHE n 
4  948  VAL n 
4  949  ASP n 
4  950  GLY n 
4  951  GLU n 
4  952  ALA n 
4  953  ASN n 
4  954  TRP n 
4  955  PRO n 
4  956  LEU n 
4  957  PRO n 
4  958  VAL n 
4  959  ASN n 
4  960  ILE n 
4  961  ARG n 
4  962  ARG n 
4  963  ILE n 
4  964  ILE n 
4  965  GLN n 
4  966  ASN n 
4  967  ALA n 
4  968  GLN n 
4  969  GLN n 
4  970  THR n 
4  971  PHE n 
4  972  HIS n 
4  973  ILE n 
4  974  ASP n 
4  975  HIS n 
4  976  THR n 
4  977  LYS n 
4  978  PRO n 
4  979  SER n 
4  980  ASP n 
4  981  LEU n 
4  982  THR n 
4  983  ILE n 
4  984  LYS n 
4  985  ASP n 
4  986  ILE n 
4  987  VAL n 
4  988  LEU n 
4  989  GLY n 
4  990  VAL n 
4  991  LYS n 
4  992  ASP n 
4  993  LEU n 
4  994  GLN n 
4  995  GLU n 
4  996  ASN n 
4  997  LEU n 
4  998  LEU n 
4  999  VAL n 
4  1000 LEU n 
4  1001 ARG n 
4  1002 GLY n 
4  1003 LYS n 
4  1004 ASN n 
4  1005 GLU n 
4  1006 ILE n 
4  1007 ILE n 
4  1008 GLN n 
4  1009 ASN n 
4  1010 ALA n 
4  1011 GLN n 
4  1012 ARG n 
4  1013 ASP n 
4  1014 ALA n 
4  1015 VAL n 
4  1016 THR n 
4  1017 LEU n 
4  1018 PHE n 
4  1019 CYS n 
4  1020 CYS n 
4  1021 LEU n 
4  1022 LEU n 
4  1023 ARG n 
4  1024 SER n 
4  1025 ARG n 
4  1026 LEU n 
4  1027 ALA n 
4  1028 THR n 
4  1029 ARG n 
4  1030 ARG n 
4  1031 VAL n 
4  1032 LEU n 
4  1033 GLN n 
4  1034 GLU n 
4  1035 TYR n 
4  1036 ARG n 
4  1037 LEU n 
4  1038 THR n 
4  1039 LYS n 
4  1040 GLN n 
4  1041 ALA n 
4  1042 PHE n 
4  1043 ASP n 
4  1044 TRP n 
4  1045 VAL n 
4  1046 LEU n 
4  1047 SER n 
4  1048 ASN n 
4  1049 ILE n 
4  1050 GLU n 
4  1051 ALA n 
4  1052 GLN n 
4  1053 PHE n 
4  1054 LEU n 
4  1055 ARG n 
4  1056 SER n 
4  1057 VAL n 
4  1058 VAL n 
4  1059 HIS n 
4  1060 PRO n 
4  1061 GLY n 
4  1062 GLU n 
4  1063 MET n 
4  1064 VAL n 
4  1065 GLY n 
4  1066 VAL n 
4  1067 LEU n 
4  1068 ALA n 
4  1069 ALA n 
4  1070 GLN n 
4  1071 SER n 
4  1072 ILE n 
4  1073 GLY n 
4  1074 GLU n 
4  1075 PRO n 
4  1076 ALA n 
4  1077 THR n 
4  1078 GLN n 
4  1079 MET n 
4  1080 THR n 
4  1081 LEU n 
4  1082 ASN n 
4  1083 THR n 
4  1084 PHE n 
4  1085 HIS n 
4  1086 PHE n 
4  1087 ALA n 
4  1088 GLY n 
4  1089 VAL n 
4  1090 ALA n 
4  1091 SER n 
4  1092 LYS n 
4  1093 LYS n 
4  1094 VAL n 
4  1095 THR n 
4  1096 SER n 
4  1097 GLY n 
4  1098 VAL n 
4  1099 PRO n 
4  1100 ARG n 
4  1101 LEU n 
4  1102 LYS n 
4  1103 GLU n 
4  1104 ILE n 
4  1105 LEU n 
4  1106 ASN n 
4  1107 VAL n 
4  1108 ALA n 
4  1109 LYS n 
4  1110 ASN n 
4  1111 MET n 
4  1112 LYS n 
4  1113 THR n 
4  1114 PRO n 
4  1115 SER n 
4  1116 LEU n 
4  1117 THR n 
4  1118 VAL n 
4  1119 TYR n 
4  1120 LEU n 
4  1121 GLU n 
4  1122 PRO n 
4  1123 GLY n 
4  1124 HIS n 
4  1125 ALA n 
4  1126 ALA n 
4  1127 ASP n 
4  1128 GLN n 
4  1129 GLU n 
4  1130 GLN n 
4  1131 ALA n 
4  1132 LYS n 
4  1133 LEU n 
4  1134 ILE n 
4  1135 ARG n 
4  1136 SER n 
4  1137 ALA n 
4  1138 ILE n 
4  1139 GLU n 
4  1140 HIS n 
4  1141 THR n 
4  1142 THR n 
4  1143 LEU n 
4  1144 LYS n 
4  1145 SER n 
4  1146 VAL n 
4  1147 THR n 
4  1148 ILE n 
4  1149 ALA n 
4  1150 SER n 
4  1151 GLU n 
4  1152 ILE n 
4  1153 TYR n 
4  1154 TYR n 
4  1155 ASP n 
4  1156 PRO n 
4  1157 ASP n 
4  1158 PRO n 
4  1159 ARG n 
4  1160 SER n 
4  1161 THR n 
4  1162 VAL n 
4  1163 ILE n 
4  1164 PRO n 
4  1165 GLU n 
4  1166 ASP n 
4  1167 GLU n 
4  1168 GLU n 
4  1169 ILE n 
4  1170 ILE n 
4  1171 GLN n 
4  1172 LEU n 
4  1173 HIS n 
4  1174 PHE n 
4  1175 SER n 
4  1176 LEU n 
4  1177 LEU n 
4  1178 ASP n 
4  1179 GLU n 
4  1180 GLU n 
4  1181 ALA n 
4  1182 GLU n 
4  1183 GLN n 
4  1184 SER n 
4  1185 PHE n 
4  1186 ASP n 
4  1187 GLN n 
4  1188 GLN n 
4  1189 SER n 
4  1190 PRO n 
4  1191 TRP n 
4  1192 LEU n 
4  1193 LEU n 
4  1194 ARG n 
4  1195 LEU n 
4  1196 GLU n 
4  1197 LEU n 
4  1198 ASP n 
4  1199 ARG n 
4  1200 ALA n 
4  1201 ALA n 
4  1202 MET n 
4  1203 ASN n 
4  1204 ASP n 
4  1205 LYS n 
4  1206 ASP n 
4  1207 LEU n 
4  1208 THR n 
4  1209 MET n 
4  1210 GLY n 
4  1211 GLN n 
4  1212 VAL n 
4  1213 GLY n 
4  1214 GLU n 
4  1215 ARG n 
4  1216 ILE n 
4  1217 LYS n 
4  1218 GLN n 
4  1219 THR n 
4  1220 PHE n 
4  1221 LYS n 
4  1222 ASN n 
4  1223 ASP n 
4  1224 LEU n 
4  1225 PHE n 
4  1226 VAL n 
4  1227 ILE n 
4  1228 TRP n 
4  1229 SER n 
4  1230 GLU n 
4  1231 ASP n 
4  1232 ASN n 
4  1233 ASP n 
4  1234 GLU n 
4  1235 LYS n 
4  1236 LEU n 
4  1237 ILE n 
4  1238 ILE n 
4  1239 ARG n 
4  1240 CYS n 
4  1241 ARG n 
4  1242 VAL n 
4  1243 VAL n 
4  1244 ARG n 
4  1245 PRO n 
4  1246 LYS n 
4  1247 SER n 
4  1248 LEU n 
4  1249 ASP n 
4  1250 ALA n 
4  1251 GLU n 
4  1252 THR n 
4  1253 GLU n 
4  1254 ALA n 
4  1255 GLU n 
4  1256 GLU n 
4  1257 ASP n 
4  1258 HIS n 
4  1259 MET n 
4  1260 LEU n 
4  1261 LYS n 
4  1262 LYS n 
4  1263 ILE n 
4  1264 GLU n 
4  1265 ASN n 
4  1266 THR n 
4  1267 MET n 
4  1268 LEU n 
4  1269 GLU n 
4  1270 ASN n 
4  1271 ILE n 
4  1272 THR n 
4  1273 LEU n 
4  1274 ARG n 
4  1275 GLY n 
4  1276 VAL n 
4  1277 GLU n 
4  1278 ASN n 
4  1279 ILE n 
4  1280 GLU n 
4  1281 ARG n 
4  1282 VAL n 
4  1283 VAL n 
4  1284 MET n 
4  1285 MET n 
4  1286 LYS n 
4  1287 TYR n 
4  1288 ASP n 
4  1289 ARG n 
4  1290 LYS n 
4  1291 VAL n 
4  1292 PRO n 
4  1293 SER n 
4  1294 PRO n 
4  1295 THR n 
4  1296 GLY n 
4  1297 GLU n 
4  1298 TYR n 
4  1299 VAL n 
4  1300 LYS n 
4  1301 GLU n 
4  1302 PRO n 
4  1303 GLU n 
4  1304 TRP n 
4  1305 VAL n 
4  1306 LEU n 
4  1307 GLU n 
4  1308 THR n 
4  1309 ASP n 
4  1310 GLY n 
4  1311 VAL n 
4  1312 ASN n 
4  1313 LEU n 
4  1314 SER n 
4  1315 GLU n 
4  1316 VAL n 
4  1317 MET n 
4  1318 THR n 
4  1319 VAL n 
4  1320 PRO n 
4  1321 GLY n 
4  1322 ILE n 
4  1323 ASP n 
4  1324 PRO n 
4  1325 THR n 
4  1326 ARG n 
4  1327 ILE n 
4  1328 TYR n 
4  1329 THR n 
4  1330 ASN n 
4  1331 SER n 
4  1332 PHE n 
4  1333 ILE n 
4  1334 ASP n 
4  1335 ILE n 
4  1336 MET n 
4  1337 GLU n 
4  1338 VAL n 
4  1339 LEU n 
4  1340 GLY n 
4  1341 ILE n 
4  1342 GLU n 
4  1343 ALA n 
4  1344 GLY n 
4  1345 ARG n 
4  1346 ALA n 
4  1347 ALA n 
4  1348 LEU n 
4  1349 TYR n 
4  1350 LYS n 
4  1351 GLU n 
4  1352 VAL n 
4  1353 TYR n 
4  1354 ASN n 
4  1355 VAL n 
4  1356 ILE n 
4  1357 ALA n 
4  1358 SER n 
4  1359 ASP n 
4  1360 GLY n 
4  1361 SER n 
4  1362 TYR n 
4  1363 VAL n 
4  1364 ASN n 
4  1365 TYR n 
4  1366 ARG n 
4  1367 HIS n 
4  1368 MET n 
4  1369 ALA n 
4  1370 LEU n 
4  1371 LEU n 
4  1372 VAL n 
4  1373 ASP n 
4  1374 VAL n 
4  1375 MET n 
4  1376 THR n 
4  1377 THR n 
4  1378 GLN n 
4  1379 GLY n 
4  1380 GLY n 
4  1381 LEU n 
4  1382 THR n 
4  1383 SER n 
4  1384 VAL n 
4  1385 THR n 
4  1386 ARG n 
4  1387 HIS n 
4  1388 GLY n 
4  1389 PHE n 
4  1390 ASN n 
4  1391 ARG n 
4  1392 SER n 
4  1393 ASN n 
4  1394 THR n 
4  1395 GLY n 
4  1396 ALA n 
4  1397 LEU n 
4  1398 MET n 
4  1399 ARG n 
4  1400 CYS n 
4  1401 SER n 
4  1402 PHE n 
4  1403 GLU n 
4  1404 GLU n 
4  1405 THR n 
4  1406 VAL n 
4  1407 GLU n 
4  1408 ILE n 
4  1409 LEU n 
4  1410 PHE n 
4  1411 GLU n 
4  1412 ALA n 
4  1413 GLY n 
4  1414 ALA n 
4  1415 SER n 
4  1416 ALA n 
4  1417 GLU n 
4  1418 LEU n 
4  1419 ASP n 
4  1420 ASP n 
4  1421 CYS n 
4  1422 ARG n 
4  1423 GLY n 
4  1424 VAL n 
4  1425 SER n 
4  1426 GLU n 
4  1427 ASN n 
4  1428 VAL n 
4  1429 ILE n 
4  1430 LEU n 
4  1431 GLY n 
4  1432 GLN n 
4  1433 MET n 
4  1434 ALA n 
4  1435 PRO n 
4  1436 ILE n 
4  1437 GLY n 
4  1438 THR n 
4  1439 GLY n 
4  1440 ALA n 
4  1441 PHE n 
4  1442 ASP n 
4  1443 VAL n 
4  1444 MET n 
4  1445 ILE n 
4  1446 ASP n 
4  1447 GLU n 
4  1448 GLU n 
4  1449 SER n 
4  1450 LEU n 
4  1451 VAL n 
4  1452 LYS n 
4  1453 TYR n 
4  1454 MET n 
4  1455 PRO n 
4  1456 GLU n 
4  1457 GLN n 
4  1458 LYS n 
4  1459 ILE n 
4  1460 THR n 
4  1461 GLU n 
4  1462 ILE n 
4  1463 GLU n 
4  1464 ASP n 
4  1465 GLY n 
4  1466 GLN n 
4  1467 ASP n 
4  1468 GLY n 
4  1469 GLY n 
4  1470 VAL n 
4  1471 THR n 
4  1472 PRO n 
4  1473 TYR n 
4  1474 SER n 
4  1475 ASN n 
4  1476 GLU n 
4  1477 SER n 
4  1478 GLY n 
4  1479 LEU n 
4  1480 VAL n 
4  1481 ASN n 
4  1482 ALA n 
4  1483 ASP n 
4  1484 LEU n 
4  1485 ASP n 
4  1486 VAL n 
4  1487 LYS n 
4  1488 ASP n 
4  1489 GLU n 
4  1490 LEU n 
4  1491 MET n 
4  1492 PHE n 
4  1493 SER n 
4  1494 PRO n 
4  1495 LEU n 
4  1496 VAL n 
4  1497 ASP n 
4  1498 SER n 
4  1499 GLY n 
4  1500 SER n 
4  1501 ASN n 
4  1502 ASP n 
4  1503 ALA n 
4  1504 MET n 
4  1505 ALA n 
4  1506 GLY n 
4  1507 GLY n 
4  1508 PHE n 
4  1509 THR n 
4  1510 ALA n 
4  1511 TYR n 
4  1512 GLY n 
4  1513 GLY n 
4  1514 ALA n 
4  1515 ASP n 
4  1516 TYR n 
4  1517 GLY n 
4  1518 GLU n 
4  1519 ALA n 
4  1520 THR n 
4  1521 SER n 
4  1522 PRO n 
4  1523 PHE n 
4  1524 GLY n 
4  1525 ALA n 
4  1526 TYR n 
4  1527 GLY n 
4  1528 GLU n 
4  1529 ALA n 
4  1530 PRO n 
4  1531 THR n 
4  1532 SER n 
4  1533 PRO n 
4  1534 GLY n 
4  1535 PHE n 
4  1536 GLY n 
4  1537 VAL n 
4  1538 SER n 
4  1539 SER n 
4  1540 PRO n 
4  1541 GLY n 
4  1542 PHE n 
4  1543 SER n 
4  1544 PRO n 
4  1545 THR n 
4  1546 SER n 
4  1547 PRO n 
4  1548 THR n 
4  1549 TYR n 
4  1550 SER n 
4  1551 PRO n 
4  1552 THR n 
4  1553 SER n 
4  1554 PRO n 
4  1555 ALA n 
4  1556 TYR n 
4  1557 SER n 
4  1558 PRO n 
4  1559 THR n 
4  1560 SER n 
4  1561 PRO n 
4  1562 SER n 
4  1563 TYR n 
4  1564 SER n 
4  1565 PRO n 
4  1566 THR n 
4  1567 SER n 
4  1568 PRO n 
4  1569 SER n 
4  1570 TYR n 
4  1571 SER n 
4  1572 PRO n 
4  1573 THR n 
4  1574 SER n 
4  1575 PRO n 
4  1576 SER n 
4  1577 TYR n 
4  1578 SER n 
4  1579 PRO n 
4  1580 THR n 
4  1581 SER n 
4  1582 PRO n 
4  1583 SER n 
4  1584 TYR n 
4  1585 SER n 
4  1586 PRO n 
4  1587 THR n 
4  1588 SER n 
4  1589 PRO n 
4  1590 SER n 
4  1591 TYR n 
4  1592 SER n 
4  1593 PRO n 
4  1594 THR n 
4  1595 SER n 
4  1596 PRO n 
4  1597 SER n 
4  1598 TYR n 
4  1599 SER n 
4  1600 PRO n 
4  1601 THR n 
4  1602 SER n 
4  1603 PRO n 
4  1604 SER n 
4  1605 TYR n 
4  1606 SER n 
4  1607 PRO n 
4  1608 THR n 
4  1609 SER n 
4  1610 PRO n 
4  1611 SER n 
4  1612 TYR n 
4  1613 SER n 
4  1614 PRO n 
4  1615 THR n 
4  1616 SER n 
4  1617 PRO n 
4  1618 SER n 
4  1619 TYR n 
4  1620 SER n 
4  1621 PRO n 
4  1622 THR n 
4  1623 SER n 
4  1624 PRO n 
4  1625 SER n 
4  1626 TYR n 
4  1627 SER n 
4  1628 PRO n 
4  1629 THR n 
4  1630 SER n 
4  1631 PRO n 
4  1632 SER n 
4  1633 TYR n 
4  1634 SER n 
4  1635 PRO n 
4  1636 THR n 
4  1637 SER n 
4  1638 PRO n 
4  1639 SER n 
4  1640 TYR n 
4  1641 SER n 
4  1642 PRO n 
4  1643 THR n 
4  1644 SER n 
4  1645 PRO n 
4  1646 SER n 
4  1647 TYR n 
4  1648 SER n 
4  1649 PRO n 
4  1650 THR n 
4  1651 SER n 
4  1652 PRO n 
4  1653 SER n 
4  1654 TYR n 
4  1655 SER n 
4  1656 PRO n 
4  1657 THR n 
4  1658 SER n 
4  1659 PRO n 
4  1660 ALA n 
4  1661 TYR n 
4  1662 SER n 
4  1663 PRO n 
4  1664 THR n 
4  1665 SER n 
4  1666 PRO n 
4  1667 SER n 
4  1668 TYR n 
4  1669 SER n 
4  1670 PRO n 
4  1671 THR n 
4  1672 SER n 
4  1673 PRO n 
4  1674 SER n 
4  1675 TYR n 
4  1676 SER n 
4  1677 PRO n 
4  1678 THR n 
4  1679 SER n 
4  1680 PRO n 
4  1681 SER n 
4  1682 TYR n 
4  1683 SER n 
4  1684 PRO n 
4  1685 THR n 
4  1686 SER n 
4  1687 PRO n 
4  1688 SER n 
4  1689 TYR n 
4  1690 SER n 
4  1691 PRO n 
4  1692 THR n 
4  1693 SER n 
4  1694 PRO n 
4  1695 ASN n 
4  1696 TYR n 
4  1697 SER n 
4  1698 PRO n 
4  1699 THR n 
4  1700 SER n 
4  1701 PRO n 
4  1702 SER n 
4  1703 TYR n 
4  1704 SER n 
4  1705 PRO n 
4  1706 THR n 
4  1707 SER n 
4  1708 PRO n 
4  1709 GLY n 
4  1710 TYR n 
4  1711 SER n 
4  1712 PRO n 
4  1713 GLY n 
4  1714 SER n 
4  1715 PRO n 
4  1716 ALA n 
4  1717 TYR n 
4  1718 SER n 
4  1719 PRO n 
4  1720 LYS n 
4  1721 GLN n 
4  1722 ASP n 
4  1723 GLU n 
4  1724 GLN n 
4  1725 LYS n 
4  1726 HIS n 
4  1727 ASN n 
4  1728 GLU n 
4  1729 ASN n 
4  1730 GLU n 
4  1731 ASN n 
4  1732 SER n 
4  1733 ARG n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    LEU n 
5  5    ALA n 
5  6    ASN n 
5  7    SER n 
5  8    GLU n 
5  9    LYS n 
5  10   TYR n 
5  11   TYR n 
5  12   ASP n 
5  13   GLU n 
5  14   ASP n 
5  15   PRO n 
5  16   TYR n 
5  17   GLY n 
5  18   PHE n 
5  19   GLU n 
5  20   ASP n 
5  21   GLU n 
5  22   SER n 
5  23   ALA n 
5  24   PRO n 
5  25   ILE n 
5  26   THR n 
5  27   ALA n 
5  28   GLU n 
5  29   ASP n 
5  30   SER n 
5  31   TRP n 
5  32   ALA n 
5  33   VAL n 
5  34   ILE n 
5  35   SER n 
5  36   ALA n 
5  37   PHE n 
5  38   PHE n 
5  39   ARG n 
5  40   GLU n 
5  41   LYS n 
5  42   GLY n 
5  43   LEU n 
5  44   VAL n 
5  45   SER n 
5  46   GLN n 
5  47   GLN n 
5  48   LEU n 
5  49   ASP n 
5  50   SER n 
5  51   PHE n 
5  52   ASN n 
5  53   GLN n 
5  54   PHE n 
5  55   VAL n 
5  56   ASP n 
5  57   TYR n 
5  58   THR n 
5  59   LEU n 
5  60   GLN n 
5  61   ASP n 
5  62   ILE n 
5  63   ILE n 
5  64   CYS n 
5  65   GLU n 
5  66   ASP n 
5  67   SER n 
5  68   THR n 
5  69   LEU n 
5  70   ILE n 
5  71   LEU n 
5  72   GLU n 
5  73   GLN n 
5  74   LEU n 
5  75   ALA n 
5  76   GLN n 
5  77   HIS n 
5  78   THR n 
5  79   THR n 
5  80   GLU n 
5  81   SER n 
5  82   ASP n 
5  83   ASN n 
5  84   ILE n 
5  85   SER n 
5  86   ARG n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ILE n 
5  91   SER n 
5  92   PHE n 
5  93   GLY n 
5  94   LYS n 
5  95   ILE n 
5  96   TYR n 
5  97   VAL n 
5  98   THR n 
5  99   LYS n 
5  100  PRO n 
5  101  MET n 
5  102  VAL n 
5  103  ASN n 
5  104  GLU n 
5  105  SER n 
5  106  ASP n 
5  107  GLY n 
5  108  VAL n 
5  109  THR n 
5  110  HIS n 
5  111  ALA n 
5  112  LEU n 
5  113  TYR n 
5  114  PRO n 
5  115  GLN n 
5  116  GLU n 
5  117  ALA n 
5  118  ARG n 
5  119  LEU n 
5  120  ARG n 
5  121  ASN n 
5  122  LEU n 
5  123  THR n 
5  124  TYR n 
5  125  SER n 
5  126  SER n 
5  127  GLY n 
5  128  LEU n 
5  129  PHE n 
5  130  VAL n 
5  131  ASP n 
5  132  VAL n 
5  133  LYS n 
5  134  LYS n 
5  135  ARG n 
5  136  THR n 
5  137  TYR n 
5  138  GLU n 
5  139  ALA n 
5  140  ILE n 
5  141  ASP n 
5  142  VAL n 
5  143  PRO n 
5  144  GLY n 
5  145  ARG n 
5  146  GLU n 
5  147  LEU n 
5  148  LYS n 
5  149  TYR n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  ALA n 
5  154  GLU n 
5  155  GLU n 
5  156  SER n 
5  157  GLU n 
5  158  ASP n 
5  159  ASP n 
5  160  SER n 
5  161  GLU n 
5  162  SER n 
5  163  GLY n 
5  164  LYS n 
5  165  VAL n 
5  166  PHE n 
5  167  ILE n 
5  168  GLY n 
5  169  ARG n 
5  170  LEU n 
5  171  PRO n 
5  172  ILE n 
5  173  MET n 
5  174  LEU n 
5  175  ARG n 
5  176  SER n 
5  177  LYS n 
5  178  ASN n 
5  179  CYS n 
5  180  TYR n 
5  181  LEU n 
5  182  SER n 
5  183  GLU n 
5  184  ALA n 
5  185  THR n 
5  186  GLU n 
5  187  SER n 
5  188  ASP n 
5  189  LEU n 
5  190  TYR n 
5  191  LYS n 
5  192  LEU n 
5  193  LYS n 
5  194  GLU n 
5  195  CYS n 
5  196  PRO n 
5  197  PHE n 
5  198  ASP n 
5  199  MET n 
5  200  GLY n 
5  201  GLY n 
5  202  TYR n 
5  203  PHE n 
5  204  ILE n 
5  205  ILE n 
5  206  ASN n 
5  207  GLY n 
5  208  SER n 
5  209  GLU n 
5  210  LYS n 
5  211  VAL n 
5  212  LEU n 
5  213  ILE n 
5  214  ALA n 
5  215  GLN n 
5  216  GLU n 
5  217  ARG n 
5  218  SER n 
5  219  ALA n 
5  220  GLY n 
5  221  ASN n 
5  222  ILE n 
5  223  VAL n 
5  224  GLN n 
5  225  VAL n 
5  226  PHE n 
5  227  LYS n 
5  228  LYS n 
5  229  ALA n 
5  230  ALA n 
5  231  PRO n 
5  232  SER n 
5  233  PRO n 
5  234  ILE n 
5  235  SER n 
5  236  HIS n 
5  237  VAL n 
5  238  ALA n 
5  239  GLU n 
5  240  ILE n 
5  241  ARG n 
5  242  SER n 
5  243  ALA n 
5  244  LEU n 
5  245  GLU n 
5  246  LYS n 
5  247  GLY n 
5  248  SER n 
5  249  ARG n 
5  250  PHE n 
5  251  ILE n 
5  252  SER n 
5  253  THR n 
5  254  LEU n 
5  255  GLN n 
5  256  VAL n 
5  257  LYS n 
5  258  LEU n 
5  259  TYR n 
5  260  GLY n 
5  261  ARG n 
5  262  GLU n 
5  263  GLY n 
5  264  SER n 
5  265  SER n 
5  266  ALA n 
5  267  ARG n 
5  268  THR n 
5  269  ILE n 
5  270  LYS n 
5  271  ALA n 
5  272  THR n 
5  273  LEU n 
5  274  PRO n 
5  275  TYR n 
5  276  ILE n 
5  277  LYS n 
5  278  GLN n 
5  279  ASP n 
5  280  ILE n 
5  281  PRO n 
5  282  ILE n 
5  283  VAL n 
5  284  ILE n 
5  285  ILE n 
5  286  PHE n 
5  287  ARG n 
5  288  ALA n 
5  289  LEU n 
5  290  GLY n 
5  291  ILE n 
5  292  ILE n 
5  293  PRO n 
5  294  ASP n 
5  295  GLY n 
5  296  GLU n 
5  297  ILE n 
5  298  LEU n 
5  299  GLU n 
5  300  HIS n 
5  301  ILE n 
5  302  CYS n 
5  303  TYR n 
5  304  ASP n 
5  305  VAL n 
5  306  ASN n 
5  307  ASP n 
5  308  TRP n 
5  309  GLN n 
5  310  MET n 
5  311  LEU n 
5  312  GLU n 
5  313  MET n 
5  314  LEU n 
5  315  LYS n 
5  316  PRO n 
5  317  CYS n 
5  318  VAL n 
5  319  GLU n 
5  320  ASP n 
5  321  GLY n 
5  322  PHE n 
5  323  VAL n 
5  324  ILE n 
5  325  GLN n 
5  326  ASP n 
5  327  ARG n 
5  328  GLU n 
5  329  THR n 
5  330  ALA n 
5  331  LEU n 
5  332  ASP n 
5  333  PHE n 
5  334  ILE n 
5  335  GLY n 
5  336  ARG n 
5  337  ARG n 
5  338  GLY n 
5  339  THR n 
5  340  ALA n 
5  341  LEU n 
5  342  GLY n 
5  343  ILE n 
5  344  LYS n 
5  345  LYS n 
5  346  GLU n 
5  347  LYS n 
5  348  ARG n 
5  349  ILE n 
5  350  GLN n 
5  351  TYR n 
5  352  ALA n 
5  353  LYS n 
5  354  ASP n 
5  355  ILE n 
5  356  LEU n 
5  357  GLN n 
5  358  LYS n 
5  359  GLU n 
5  360  PHE n 
5  361  LEU n 
5  362  PRO n 
5  363  HIS n 
5  364  ILE n 
5  365  THR n 
5  366  GLN n 
5  367  LEU n 
5  368  GLU n 
5  369  GLY n 
5  370  PHE n 
5  371  GLU n 
5  372  SER n 
5  373  ARG n 
5  374  LYS n 
5  375  ALA n 
5  376  PHE n 
5  377  PHE n 
5  378  LEU n 
5  379  GLY n 
5  380  TYR n 
5  381  MET n 
5  382  ILE n 
5  383  ASN n 
5  384  ARG n 
5  385  LEU n 
5  386  LEU n 
5  387  LEU n 
5  388  CYS n 
5  389  ALA n 
5  390  LEU n 
5  391  ASP n 
5  392  ARG n 
5  393  LYS n 
5  394  ASP n 
5  395  GLN n 
5  396  ASP n 
5  397  ASP n 
5  398  ARG n 
5  399  ASP n 
5  400  HIS n 
5  401  PHE n 
5  402  GLY n 
5  403  LYS n 
5  404  LYS n 
5  405  ARG n 
5  406  LEU n 
5  407  ASP n 
5  408  LEU n 
5  409  ALA n 
5  410  GLY n 
5  411  PRO n 
5  412  LEU n 
5  413  LEU n 
5  414  ALA n 
5  415  GLN n 
5  416  LEU n 
5  417  PHE n 
5  418  LYS n 
5  419  THR n 
5  420  LEU n 
5  421  PHE n 
5  422  LYS n 
5  423  LYS n 
5  424  LEU n 
5  425  THR n 
5  426  LYS n 
5  427  ASP n 
5  428  ILE n 
5  429  PHE n 
5  430  ARG n 
5  431  TYR n 
5  432  MET n 
5  433  GLN n 
5  434  ARG n 
5  435  THR n 
5  436  VAL n 
5  437  GLU n 
5  438  GLU n 
5  439  ALA n 
5  440  HIS n 
5  441  ASP n 
5  442  PHE n 
5  443  ASN n 
5  444  MET n 
5  445  LYS n 
5  446  LEU n 
5  447  ALA n 
5  448  ILE n 
5  449  ASN n 
5  450  ALA n 
5  451  LYS n 
5  452  THR n 
5  453  ILE n 
5  454  THR n 
5  455  SER n 
5  456  GLY n 
5  457  LEU n 
5  458  LYS n 
5  459  TYR n 
5  460  ALA n 
5  461  LEU n 
5  462  ALA n 
5  463  THR n 
5  464  GLY n 
5  465  ASN n 
5  466  TRP n 
5  467  GLY n 
5  468  GLU n 
5  469  GLN n 
5  470  LYS n 
5  471  LYS n 
5  472  ALA n 
5  473  MET n 
5  474  SER n 
5  475  SER n 
5  476  ARG n 
5  477  ALA n 
5  478  GLY n 
5  479  VAL n 
5  480  SER n 
5  481  GLN n 
5  482  VAL n 
5  483  LEU n 
5  484  ASN n 
5  485  ARG n 
5  486  TYR n 
5  487  THR n 
5  488  TYR n 
5  489  SER n 
5  490  SER n 
5  491  THR n 
5  492  LEU n 
5  493  SER n 
5  494  HIS n 
5  495  LEU n 
5  496  ARG n 
5  497  ARG n 
5  498  THR n 
5  499  ASN n 
5  500  THR n 
5  501  PRO n 
5  502  ILE n 
5  503  GLY n 
5  504  ARG n 
5  505  ASP n 
5  506  GLY n 
5  507  LYS n 
5  508  LEU n 
5  509  ALA n 
5  510  LYS n 
5  511  PRO n 
5  512  ARG n 
5  513  GLN n 
5  514  LEU n 
5  515  HIS n 
5  516  ASN n 
5  517  THR n 
5  518  HIS n 
5  519  TRP n 
5  520  GLY n 
5  521  LEU n 
5  522  VAL n 
5  523  CYS n 
5  524  PRO n 
5  525  ALA n 
5  526  GLU n 
5  527  THR n 
5  528  PRO n 
5  529  GLU n 
5  530  GLY n 
5  531  GLN n 
5  532  ALA n 
5  533  CYS n 
5  534  GLY n 
5  535  LEU n 
5  536  VAL n 
5  537  LYS n 
5  538  ASN n 
5  539  LEU n 
5  540  SER n 
5  541  LEU n 
5  542  MET n 
5  543  SER n 
5  544  CYS n 
5  545  ILE n 
5  546  SER n 
5  547  VAL n 
5  548  GLY n 
5  549  THR n 
5  550  ASP n 
5  551  PRO n 
5  552  MET n 
5  553  PRO n 
5  554  ILE n 
5  555  ILE n 
5  556  THR n 
5  557  PHE n 
5  558  LEU n 
5  559  SER n 
5  560  GLU n 
5  561  TRP n 
5  562  GLY n 
5  563  MET n 
5  564  GLU n 
5  565  PRO n 
5  566  LEU n 
5  567  GLU n 
5  568  ASP n 
5  569  TYR n 
5  570  VAL n 
5  571  PRO n 
5  572  HIS n 
5  573  GLN n 
5  574  SER n 
5  575  PRO n 
5  576  ASP n 
5  577  ALA n 
5  578  THR n 
5  579  ARG n 
5  580  VAL n 
5  581  PHE n 
5  582  VAL n 
5  583  ASN n 
5  584  GLY n 
5  585  VAL n 
5  586  TRP n 
5  587  HIS n 
5  588  GLY n 
5  589  VAL n 
5  590  HIS n 
5  591  ARG n 
5  592  ASN n 
5  593  PRO n 
5  594  ALA n 
5  595  ARG n 
5  596  LEU n 
5  597  MET n 
5  598  GLU n 
5  599  THR n 
5  600  LEU n 
5  601  ARG n 
5  602  THR n 
5  603  LEU n 
5  604  ARG n 
5  605  ARG n 
5  606  LYS n 
5  607  GLY n 
5  608  ASP n 
5  609  ILE n 
5  610  ASN n 
5  611  PRO n 
5  612  GLU n 
5  613  VAL n 
5  614  SER n 
5  615  MET n 
5  616  ILE n 
5  617  ARG n 
5  618  ASP n 
5  619  ILE n 
5  620  ARG n 
5  621  GLU n 
5  622  LYS n 
5  623  GLU n 
5  624  LEU n 
5  625  LYS n 
5  626  ILE n 
5  627  PHE n 
5  628  THR n 
5  629  ASP n 
5  630  ALA n 
5  631  GLY n 
5  632  ARG n 
5  633  VAL n 
5  634  TYR n 
5  635  ARG n 
5  636  PRO n 
5  637  LEU n 
5  638  PHE n 
5  639  ILE n 
5  640  VAL n 
5  641  GLU n 
5  642  ASP n 
5  643  ASP n 
5  644  GLU n 
5  645  SER n 
5  646  LEU n 
5  647  GLY n 
5  648  HIS n 
5  649  LYS n 
5  650  GLU n 
5  651  LEU n 
5  652  LYS n 
5  653  VAL n 
5  654  ARG n 
5  655  LYS n 
5  656  GLY n 
5  657  HIS n 
5  658  ILE n 
5  659  ALA n 
5  660  LYS n 
5  661  LEU n 
5  662  MET n 
5  663  ALA n 
5  664  THR n 
5  665  GLU n 
5  666  TYR n 
5  667  GLN n 
5  668  ASP n 
5  669  ILE n 
5  670  GLU n 
5  671  GLY n 
5  672  GLY n 
5  673  PHE n 
5  674  GLU n 
5  675  ASP n 
5  676  VAL n 
5  677  GLU n 
5  678  GLU n 
5  679  TYR n 
5  680  THR n 
5  681  TRP n 
5  682  SER n 
5  683  SER n 
5  684  LEU n 
5  685  LEU n 
5  686  ASN n 
5  687  GLU n 
5  688  GLY n 
5  689  LEU n 
5  690  VAL n 
5  691  GLU n 
5  692  TYR n 
5  693  ILE n 
5  694  ASP n 
5  695  ALA n 
5  696  GLU n 
5  697  GLU n 
5  698  GLU n 
5  699  GLU n 
5  700  SER n 
5  701  ILE n 
5  702  LEU n 
5  703  ILE n 
5  704  ALA n 
5  705  MET n 
5  706  GLN n 
5  707  PRO n 
5  708  GLU n 
5  709  ASP n 
5  710  LEU n 
5  711  GLU n 
5  712  PRO n 
5  713  ALA n 
5  714  GLU n 
5  715  ALA n 
5  716  ASN n 
5  717  GLU n 
5  718  GLU n 
5  719  ASN n 
5  720  ASP n 
5  721  LEU n 
5  722  ASP n 
5  723  VAL n 
5  724  ASP n 
5  725  PRO n 
5  726  ALA n 
5  727  LYS n 
5  728  ARG n 
5  729  ILE n 
5  730  ARG n 
5  731  VAL n 
5  732  SER n 
5  733  HIS n 
5  734  HIS n 
5  735  ALA n 
5  736  THR n 
5  737  THR n 
5  738  PHE n 
5  739  THR n 
5  740  HIS n 
5  741  CYS n 
5  742  GLU n 
5  743  ILE n 
5  744  HIS n 
5  745  PRO n 
5  746  SER n 
5  747  MET n 
5  748  ILE n 
5  749  LEU n 
5  750  GLY n 
5  751  VAL n 
5  752  ALA n 
5  753  ALA n 
5  754  SER n 
5  755  ILE n 
5  756  ILE n 
5  757  PRO n 
5  758  PHE n 
5  759  PRO n 
5  760  ASP n 
5  761  HIS n 
5  762  ASN n 
5  763  GLN n 
5  764  SER n 
5  765  PRO n 
5  766  ARG n 
5  767  ASN n 
5  768  THR n 
5  769  TYR n 
5  770  GLN n 
5  771  SER n 
5  772  ALA n 
5  773  MET n 
5  774  GLY n 
5  775  LYS n 
5  776  GLN n 
5  777  ALA n 
5  778  MET n 
5  779  GLY n 
5  780  VAL n 
5  781  PHE n 
5  782  LEU n 
5  783  THR n 
5  784  ASN n 
5  785  TYR n 
5  786  ASN n 
5  787  VAL n 
5  788  ARG n 
5  789  MET n 
5  790  ASP n 
5  791  THR n 
5  792  MET n 
5  793  ALA n 
5  794  ASN n 
5  795  ILE n 
5  796  LEU n 
5  797  TYR n 
5  798  TYR n 
5  799  PRO n 
5  800  GLN n 
5  801  LYS n 
5  802  PRO n 
5  803  LEU n 
5  804  GLY n 
5  805  THR n 
5  806  THR n 
5  807  ARG n 
5  808  ALA n 
5  809  MET n 
5  810  GLU n 
5  811  TYR n 
5  812  LEU n 
5  813  LYS n 
5  814  PHE n 
5  815  ARG n 
5  816  GLU n 
5  817  LEU n 
5  818  PRO n 
5  819  ALA n 
5  820  GLY n 
5  821  GLN n 
5  822  ASN n 
5  823  ALA n 
5  824  ILE n 
5  825  VAL n 
5  826  ALA n 
5  827  ILE n 
5  828  ALA n 
5  829  CYS n 
5  830  TYR n 
5  831  SER n 
5  832  GLY n 
5  833  TYR n 
5  834  ASN n 
5  835  GLN n 
5  836  GLU n 
5  837  ASP n 
5  838  SER n 
5  839  MET n 
5  840  ILE n 
5  841  MET n 
5  842  ASN n 
5  843  GLN n 
5  844  SER n 
5  845  SER n 
5  846  ILE n 
5  847  ASP n 
5  848  ARG n 
5  849  GLY n 
5  850  LEU n 
5  851  PHE n 
5  852  ARG n 
5  853  SER n 
5  854  LEU n 
5  855  PHE n 
5  856  PHE n 
5  857  ARG n 
5  858  SER n 
5  859  TYR n 
5  860  MET n 
5  861  ASP n 
5  862  GLN n 
5  863  GLU n 
5  864  LYS n 
5  865  LYS n 
5  866  TYR n 
5  867  GLY n 
5  868  MET n 
5  869  SER n 
5  870  ILE n 
5  871  THR n 
5  872  GLU n 
5  873  THR n 
5  874  PHE n 
5  875  GLU n 
5  876  LYS n 
5  877  PRO n 
5  878  GLN n 
5  879  ARG n 
5  880  THR n 
5  881  ASN n 
5  882  THR n 
5  883  LEU n 
5  884  ARG n 
5  885  MET n 
5  886  LYS n 
5  887  HIS n 
5  888  GLY n 
5  889  THR n 
5  890  TYR n 
5  891  ASP n 
5  892  LYS n 
5  893  LEU n 
5  894  ASP n 
5  895  ASP n 
5  896  ASP n 
5  897  GLY n 
5  898  LEU n 
5  899  ILE n 
5  900  ALA n 
5  901  PRO n 
5  902  GLY n 
5  903  VAL n 
5  904  ARG n 
5  905  VAL n 
5  906  SER n 
5  907  GLY n 
5  908  GLU n 
5  909  ASP n 
5  910  VAL n 
5  911  ILE n 
5  912  ILE n 
5  913  GLY n 
5  914  LYS n 
5  915  THR n 
5  916  THR n 
5  917  PRO n 
5  918  ILE n 
5  919  SER n 
5  920  PRO n 
5  921  ASP n 
5  922  GLU n 
5  923  GLU n 
5  924  GLU n 
5  925  LEU n 
5  926  GLY n 
5  927  GLN n 
5  928  ARG n 
5  929  THR n 
5  930  ALA n 
5  931  TYR n 
5  932  HIS n 
5  933  SER n 
5  934  LYS n 
5  935  ARG n 
5  936  ASP n 
5  937  ALA n 
5  938  SER n 
5  939  THR n 
5  940  PRO n 
5  941  LEU n 
5  942  ARG n 
5  943  SER n 
5  944  THR n 
5  945  GLU n 
5  946  ASN n 
5  947  GLY n 
5  948  ILE n 
5  949  VAL n 
5  950  ASP n 
5  951  GLN n 
5  952  VAL n 
5  953  LEU n 
5  954  VAL n 
5  955  THR n 
5  956  THR n 
5  957  ASN n 
5  958  GLN n 
5  959  ASP n 
5  960  GLY n 
5  961  LEU n 
5  962  LYS n 
5  963  PHE n 
5  964  VAL n 
5  965  LYS n 
5  966  VAL n 
5  967  ARG n 
5  968  VAL n 
5  969  ARG n 
5  970  THR n 
5  971  THR n 
5  972  LYS n 
5  973  ILE n 
5  974  PRO n 
5  975  GLN n 
5  976  ILE n 
5  977  GLY n 
5  978  ASP n 
5  979  LYS n 
5  980  PHE n 
5  981  ALA n 
5  982  SER n 
5  983  ARG n 
5  984  HIS n 
5  985  GLY n 
5  986  GLN n 
5  987  LYS n 
5  988  GLY n 
5  989  THR n 
5  990  ILE n 
5  991  GLY n 
5  992  ILE n 
5  993  THR n 
5  994  TYR n 
5  995  ARG n 
5  996  ARG n 
5  997  GLU n 
5  998  ASP n 
5  999  MET n 
5  1000 PRO n 
5  1001 PHE n 
5  1002 THR n 
5  1003 ALA n 
5  1004 GLU n 
5  1005 GLY n 
5  1006 ILE n 
5  1007 VAL n 
5  1008 PRO n 
5  1009 ASP n 
5  1010 LEU n 
5  1011 ILE n 
5  1012 ILE n 
5  1013 ASN n 
5  1014 PRO n 
5  1015 HIS n 
5  1016 ALA n 
5  1017 ILE n 
5  1018 PRO n 
5  1019 SER n 
5  1020 ARG n 
5  1021 MET n 
5  1022 THR n 
5  1023 VAL n 
5  1024 ALA n 
5  1025 HIS n 
5  1026 LEU n 
5  1027 ILE n 
5  1028 GLU n 
5  1029 CYS n 
5  1030 LEU n 
5  1031 LEU n 
5  1032 SER n 
5  1033 LYS n 
5  1034 VAL n 
5  1035 ALA n 
5  1036 ALA n 
5  1037 LEU n 
5  1038 SER n 
5  1039 GLY n 
5  1040 ASN n 
5  1041 GLU n 
5  1042 GLY n 
5  1043 ASP n 
5  1044 ALA n 
5  1045 SER n 
5  1046 PRO n 
5  1047 PHE n 
5  1048 THR n 
5  1049 ASP n 
5  1050 ILE n 
5  1051 THR n 
5  1052 VAL n 
5  1053 GLU n 
5  1054 GLY n 
5  1055 ILE n 
5  1056 SER n 
5  1057 LYS n 
5  1058 LEU n 
5  1059 LEU n 
5  1060 ARG n 
5  1061 GLU n 
5  1062 HIS n 
5  1063 GLY n 
5  1064 TYR n 
5  1065 GLN n 
5  1066 SER n 
5  1067 ARG n 
5  1068 GLY n 
5  1069 PHE n 
5  1070 GLU n 
5  1071 VAL n 
5  1072 MET n 
5  1073 TYR n 
5  1074 ASN n 
5  1075 GLY n 
5  1076 HIS n 
5  1077 THR n 
5  1078 GLY n 
5  1079 LYS n 
5  1080 LYS n 
5  1081 LEU n 
5  1082 MET n 
5  1083 ALA n 
5  1084 GLN n 
5  1085 ILE n 
5  1086 PHE n 
5  1087 PHE n 
5  1088 GLY n 
5  1089 PRO n 
5  1090 THR n 
5  1091 TYR n 
5  1092 TYR n 
5  1093 GLN n 
5  1094 ARG n 
5  1095 LEU n 
5  1096 ARG n 
5  1097 HIS n 
5  1098 MET n 
5  1099 VAL n 
5  1100 ASP n 
5  1101 ASP n 
5  1102 LYS n 
5  1103 ILE n 
5  1104 HIS n 
5  1105 ALA n 
5  1106 ARG n 
5  1107 ALA n 
5  1108 ARG n 
5  1109 GLY n 
5  1110 PRO n 
5  1111 MET n 
5  1112 GLN n 
5  1113 VAL n 
5  1114 LEU n 
5  1115 THR n 
5  1116 ARG n 
5  1117 GLN n 
5  1118 PRO n 
5  1119 VAL n 
5  1120 GLU n 
5  1121 GLY n 
5  1122 ARG n 
5  1123 SER n 
5  1124 ARG n 
5  1125 ASP n 
5  1126 GLY n 
5  1127 GLY n 
5  1128 LEU n 
5  1129 ARG n 
5  1130 PHE n 
5  1131 GLY n 
5  1132 GLU n 
5  1133 MET n 
5  1134 GLU n 
5  1135 ARG n 
5  1136 ASP n 
5  1137 CYS n 
5  1138 MET n 
5  1139 ILE n 
5  1140 ALA n 
5  1141 HIS n 
5  1142 GLY n 
5  1143 ALA n 
5  1144 ALA n 
5  1145 SER n 
5  1146 PHE n 
5  1147 LEU n 
5  1148 LYS n 
5  1149 GLU n 
5  1150 ARG n 
5  1151 LEU n 
5  1152 MET n 
5  1153 GLU n 
5  1154 ALA n 
5  1155 SER n 
5  1156 ASP n 
5  1157 ALA n 
5  1158 PHE n 
5  1159 ARG n 
5  1160 VAL n 
5  1161 HIS n 
5  1162 ILE n 
5  1163 CYS n 
5  1164 GLY n 
5  1165 ILE n 
5  1166 CYS n 
5  1167 GLY n 
5  1168 LEU n 
5  1169 MET n 
5  1170 THR n 
5  1171 VAL n 
5  1172 ILE n 
5  1173 ALA n 
5  1174 LYS n 
5  1175 LEU n 
5  1176 ASN n 
5  1177 HIS n 
5  1178 ASN n 
5  1179 GLN n 
5  1180 PHE n 
5  1181 GLU n 
5  1182 CYS n 
5  1183 LYS n 
5  1184 GLY n 
5  1185 CYS n 
5  1186 ASP n 
5  1187 ASN n 
5  1188 LYS n 
5  1189 ILE n 
5  1190 ASP n 
5  1191 ILE n 
5  1192 TYR n 
5  1193 GLN n 
5  1194 ILE n 
5  1195 HIS n 
5  1196 ILE n 
5  1197 PRO n 
5  1198 TYR n 
5  1199 ALA n 
5  1200 ALA n 
5  1201 LYS n 
5  1202 LEU n 
5  1203 LEU n 
5  1204 PHE n 
5  1205 GLN n 
5  1206 GLU n 
5  1207 LEU n 
5  1208 MET n 
5  1209 ALA n 
5  1210 MET n 
5  1211 ASN n 
5  1212 ILE n 
5  1213 THR n 
5  1214 PRO n 
5  1215 ARG n 
5  1216 LEU n 
5  1217 TYR n 
5  1218 THR n 
5  1219 ASP n 
5  1220 ARG n 
5  1221 SER n 
5  1222 ARG n 
5  1223 ASP n 
5  1224 PHE n 
6  1    MET n 
6  2    SER n 
6  3    GLU n 
6  4    GLU n 
6  5    GLY n 
6  6    PRO n 
6  7    GLN n 
6  8    VAL n 
6  9    LYS n 
6  10   ILE n 
6  11   ARG n 
6  12   GLU n 
6  13   ALA n 
6  14   SER n 
6  15   LYS n 
6  16   ASP n 
6  17   ASN n 
6  18   VAL n 
6  19   ASP n 
6  20   PHE n 
6  21   ILE n 
6  22   LEU n 
6  23   SER n 
6  24   ASN n 
6  25   VAL n 
6  26   ASP n 
6  27   LEU n 
6  28   ALA n 
6  29   MET n 
6  30   ALA n 
6  31   ASN n 
6  32   SER n 
6  33   LEU n 
6  34   ARG n 
6  35   ARG n 
6  36   VAL n 
6  37   MET n 
6  38   ILE n 
6  39   ALA n 
6  40   GLU n 
6  41   ILE n 
6  42   PRO n 
6  43   THR n 
6  44   LEU n 
6  45   ALA n 
6  46   ILE n 
6  47   ASP n 
6  48   SER n 
6  49   VAL n 
6  50   GLU n 
6  51   VAL n 
6  52   GLU n 
6  53   THR n 
6  54   ASN n 
6  55   THR n 
6  56   THR n 
6  57   VAL n 
6  58   LEU n 
6  59   ALA n 
6  60   ASP n 
6  61   GLU n 
6  62   PHE n 
6  63   ILE n 
6  64   ALA n 
6  65   HIS n 
6  66   ARG n 
6  67   LEU n 
6  68   GLY n 
6  69   LEU n 
6  70   ILE n 
6  71   PRO n 
6  72   LEU n 
6  73   GLN n 
6  74   SER n 
6  75   MET n 
6  76   ASP n 
6  77   ILE n 
6  78   GLU n 
6  79   GLN n 
6  80   LEU n 
6  81   GLU n 
6  82   TYR n 
6  83   SER n 
6  84   ARG n 
6  85   ASP n 
6  86   CYS n 
6  87   PHE n 
6  88   CYS n 
6  89   GLU n 
6  90   ASP n 
6  91   HIS n 
6  92   CYS n 
6  93   ASP n 
6  94   LYS n 
6  95   CYS n 
6  96   SER n 
6  97   VAL n 
6  98   VAL n 
6  99   LEU n 
6  100  THR n 
6  101  LEU n 
6  102  GLN n 
6  103  ALA n 
6  104  PHE n 
6  105  GLY n 
6  106  GLU n 
6  107  SER n 
6  108  GLU n 
6  109  SER n 
6  110  THR n 
6  111  THR n 
6  112  ASN n 
6  113  VAL n 
6  114  TYR n 
6  115  SER n 
6  116  LYS n 
6  117  ASP n 
6  118  LEU n 
6  119  VAL n 
6  120  ILE n 
6  121  VAL n 
6  122  SER n 
6  123  ASN n 
6  124  LEU n 
6  125  MET n 
6  126  GLY n 
6  127  ARG n 
6  128  ASN n 
6  129  ILE n 
6  130  GLY n 
6  131  HIS n 
6  132  PRO n 
6  133  ILE n 
6  134  ILE n 
6  135  GLN n 
6  136  ASP n 
6  137  LYS n 
6  138  GLU n 
6  139  GLY n 
6  140  ASN n 
6  141  GLY n 
6  142  VAL n 
6  143  LEU n 
6  144  ILE n 
6  145  CYS n 
6  146  LYS n 
6  147  LEU n 
6  148  ARG n 
6  149  LYS n 
6  150  GLY n 
6  151  GLN n 
6  152  GLU n 
6  153  LEU n 
6  154  LYS n 
6  155  LEU n 
6  156  THR n 
6  157  CYS n 
6  158  VAL n 
6  159  ALA n 
6  160  LYS n 
6  161  LYS n 
6  162  GLY n 
6  163  ILE n 
6  164  ALA n 
6  165  LYS n 
6  166  GLU n 
6  167  HIS n 
6  168  ALA n 
6  169  LYS n 
6  170  TRP n 
6  171  GLY n 
6  172  PRO n 
6  173  ALA n 
6  174  ALA n 
6  175  ALA n 
6  176  ILE n 
6  177  GLU n 
6  178  PHE n 
6  179  GLU n 
6  180  TYR n 
6  181  ASP n 
6  182  PRO n 
6  183  TRP n 
6  184  ASN n 
6  185  LYS n 
6  186  LEU n 
6  187  LYS n 
6  188  HIS n 
6  189  THR n 
6  190  ASP n 
6  191  TYR n 
6  192  TRP n 
6  193  TYR n 
6  194  GLU n 
6  195  GLN n 
6  196  ASP n 
6  197  SER n 
6  198  ALA n 
6  199  LYS n 
6  200  GLU n 
6  201  TRP n 
6  202  PRO n 
6  203  GLN n 
6  204  SER n 
6  205  LYS n 
6  206  ASN n 
6  207  CYS n 
6  208  GLU n 
6  209  TYR n 
6  210  GLU n 
6  211  ASP n 
6  212  PRO n 
6  213  PRO n 
6  214  ASN n 
6  215  GLU n 
6  216  GLY n 
6  217  ASP n 
6  218  PRO n 
6  219  PHE n 
6  220  ASP n 
6  221  TYR n 
6  222  LYS n 
6  223  ALA n 
6  224  GLN n 
6  225  ALA n 
6  226  ASP n 
6  227  THR n 
6  228  PHE n 
6  229  TYR n 
6  230  MET n 
6  231  ASN n 
6  232  VAL n 
6  233  GLU n 
6  234  SER n 
6  235  VAL n 
6  236  GLY n 
6  237  SER n 
6  238  ILE n 
6  239  PRO n 
6  240  VAL n 
6  241  ASP n 
6  242  GLN n 
6  243  VAL n 
6  244  VAL n 
6  245  VAL n 
6  246  ARG n 
6  247  GLY n 
6  248  ILE n 
6  249  ASP n 
6  250  THR n 
6  251  LEU n 
6  252  GLN n 
6  253  LYS n 
6  254  LYS n 
6  255  VAL n 
6  256  ALA n 
6  257  SER n 
6  258  ILE n 
6  259  LEU n 
6  260  LEU n 
6  261  ALA n 
6  262  LEU n 
6  263  THR n 
6  264  GLN n 
6  265  MET n 
6  266  ASP n 
6  267  GLN n 
6  268  ASP n 
6  269  LYS n 
6  270  VAL n 
6  271  ASN n 
6  272  PHE n 
6  273  ALA n 
6  274  SER n 
6  275  GLY n 
6  276  ASP n 
6  277  ASN n 
6  278  ASN n 
6  279  THR n 
6  280  ALA n 
6  281  SER n 
6  282  ASN n 
6  283  MET n 
6  284  LEU n 
6  285  GLY n 
6  286  SER n 
6  287  ASN n 
6  288  GLU n 
6  289  ASP n 
6  290  VAL n 
6  291  MET n 
6  292  MET n 
6  293  THR n 
6  294  GLY n 
6  295  ALA n 
6  296  GLU n 
6  297  GLN n 
6  298  ASP n 
6  299  PRO n 
6  300  TYR n 
6  301  SER n 
6  302  ASN n 
6  303  ALA n 
6  304  SER n 
6  305  GLN n 
6  306  MET n 
6  307  GLY n 
6  308  ASN n 
6  309  THR n 
6  310  GLY n 
6  311  SER n 
6  312  GLY n 
6  313  GLY n 
6  314  TYR n 
6  315  ASP n 
6  316  ASN n 
6  317  ALA n 
6  318  TRP n 
7  1    MET n 
7  2    ASP n 
7  3    GLN n 
7  4    GLU n 
7  5    ASN n 
7  6    GLU n 
7  7    ARG n 
7  8    ASN n 
7  9    ILE n 
7  10   SER n 
7  11   ARG n 
7  12   LEU n 
7  13   TRP n 
7  14   ARG n 
7  15   ALA n 
7  16   PHE n 
7  17   ARG n 
7  18   THR n 
7  19   VAL n 
7  20   LYS n 
7  21   GLU n 
7  22   MET n 
7  23   VAL n 
7  24   LYS n 
7  25   ASP n 
7  26   ARG n 
7  27   GLY n 
7  28   TYR n 
7  29   PHE n 
7  30   ILE n 
7  31   THR n 
7  32   GLN n 
7  33   GLU n 
7  34   GLU n 
7  35   VAL n 
7  36   GLU n 
7  37   LEU n 
7  38   PRO n 
7  39   LEU n 
7  40   GLU n 
7  41   ASP n 
7  42   PHE n 
7  43   LYS n 
7  44   ALA n 
7  45   LYS n 
7  46   TYR n 
7  47   CYS n 
7  48   ASP n 
7  49   SER n 
7  50   MET n 
7  51   GLY n 
7  52   ARG n 
7  53   PRO n 
7  54   GLN n 
7  55   ARG n 
7  56   LYS n 
7  57   MET n 
7  58   MET n 
7  59   SER n 
7  60   PHE n 
7  61   GLN n 
7  62   ALA n 
7  63   ASN n 
7  64   PRO n 
7  65   THR n 
7  66   GLU n 
7  67   GLU n 
7  68   SER n 
7  69   ILE n 
7  70   SER n 
7  71   LYS n 
7  72   PHE n 
7  73   PRO n 
7  74   ASP n 
7  75   MET n 
7  76   GLY n 
7  77   SER n 
7  78   LEU n 
7  79   TRP n 
7  80   VAL n 
7  81   GLU n 
7  82   PHE n 
7  83   CYS n 
7  84   ASP n 
7  85   GLU n 
7  86   PRO n 
7  87   SER n 
7  88   VAL n 
7  89   GLY n 
7  90   VAL n 
7  91   LYS n 
7  92   THR n 
7  93   MET n 
7  94   LYS n 
7  95   THR n 
7  96   PHE n 
7  97   VAL n 
7  98   ILE n 
7  99   HIS n 
7  100  ILE n 
7  101  GLN n 
7  102  GLU n 
7  103  LYS n 
7  104  ASN n 
7  105  PHE n 
7  106  GLN n 
7  107  THR n 
7  108  GLY n 
7  109  ILE n 
7  110  PHE n 
7  111  VAL n 
7  112  TYR n 
7  113  GLN n 
7  114  ASN n 
7  115  ASN n 
7  116  ILE n 
7  117  THR n 
7  118  PRO n 
7  119  SER n 
7  120  ALA n 
7  121  MET n 
7  122  LYS n 
7  123  LEU n 
7  124  VAL n 
7  125  PRO n 
7  126  SER n 
7  127  ILE n 
7  128  PRO n 
7  129  PRO n 
7  130  ALA n 
7  131  THR n 
7  132  ILE n 
7  133  GLU n 
7  134  THR n 
7  135  PHE n 
7  136  ASN n 
7  137  GLU n 
7  138  ALA n 
7  139  ALA n 
7  140  LEU n 
7  141  VAL n 
7  142  VAL n 
7  143  ASN n 
7  144  ILE n 
7  145  THR n 
7  146  HIS n 
7  147  HIS n 
7  148  GLU n 
7  149  LEU n 
7  150  VAL n 
7  151  PRO n 
7  152  LYS n 
7  153  HIS n 
7  154  ILE n 
7  155  ARG n 
7  156  LEU n 
7  157  SER n 
7  158  SER n 
7  159  ASP n 
7  160  GLU n 
7  161  LYS n 
7  162  ARG n 
7  163  GLU n 
7  164  LEU n 
7  165  LEU n 
7  166  LYS n 
7  167  ARG n 
7  168  TYR n 
7  169  ARG n 
7  170  LEU n 
7  171  LYS n 
7  172  GLU n 
7  173  SER n 
7  174  GLN n 
7  175  LEU n 
7  176  PRO n 
7  177  ARG n 
7  178  ILE n 
7  179  GLN n 
7  180  ARG n 
7  181  ALA n 
7  182  ASP n 
7  183  PRO n 
7  184  VAL n 
7  185  ALA n 
7  186  LEU n 
7  187  TYR n 
7  188  LEU n 
7  189  GLY n 
7  190  LEU n 
7  191  LYS n 
7  192  ARG n 
7  193  GLY n 
7  194  GLU n 
7  195  VAL n 
7  196  VAL n 
7  197  LYS n 
7  198  ILE n 
7  199  ILE n 
7  200  ARG n 
7  201  LYS n 
7  202  SER n 
7  203  GLU n 
7  204  THR n 
7  205  SER n 
7  206  GLY n 
7  207  ARG n 
7  208  TYR n 
7  209  ALA n 
7  210  SER n 
7  211  TYR n 
7  212  ARG n 
7  213  ILE n 
7  214  CYS n 
7  215  MET n 
8  1    MET n 
8  2    SER n 
8  3    ASP n 
8  4    TYR n 
8  5    GLU n 
8  6    GLU n 
8  7    ALA n 
8  8    PHE n 
8  9    ASN n 
8  10   ASP n 
8  11   GLY n 
8  12   ASN n 
8  13   GLU n 
8  14   ASN n 
8  15   PHE n 
8  16   GLU n 
8  17   ASP n 
8  18   PHE n 
8  19   ASP n 
8  20   VAL n 
8  21   GLU n 
8  22   HIS n 
8  23   PHE n 
8  24   SER n 
8  25   ASP n 
8  26   GLU n 
8  27   GLU n 
8  28   THR n 
8  29   TYR n 
8  30   GLU n 
8  31   GLU n 
8  32   LYS n 
8  33   PRO n 
8  34   GLN n 
8  35   PHE n 
8  36   LYS n 
8  37   ASP n 
8  38   GLY n 
8  39   GLU n 
8  40   THR n 
8  41   THR n 
8  42   ASP n 
8  43   ALA n 
8  44   ASN n 
8  45   GLY n 
8  46   LYS n 
8  47   THR n 
8  48   ILE n 
8  49   VAL n 
8  50   THR n 
8  51   GLY n 
8  52   GLY n 
8  53   ASN n 
8  54   GLY n 
8  55   PRO n 
8  56   GLU n 
8  57   ASP n 
8  58   PHE n 
8  59   GLN n 
8  60   GLN n 
8  61   HIS n 
8  62   GLU n 
8  63   GLN n 
8  64   ILE n 
8  65   ARG n 
8  66   ARG n 
8  67   LYS n 
8  68   THR n 
8  69   LEU n 
8  70   LYS n 
8  71   GLU n 
8  72   LYS n 
8  73   ALA n 
8  74   ILE n 
8  75   PRO n 
8  76   LYS n 
8  77   ASP n 
8  78   GLN n 
8  79   ARG n 
8  80   ALA n 
8  81   THR n 
8  82   THR n 
8  83   PRO n 
8  84   TYR n 
8  85   MET n 
8  86   THR n 
8  87   LYS n 
8  88   TYR n 
8  89   GLU n 
8  90   ARG n 
8  91   ALA n 
8  92   ARG n 
8  93   ILE n 
8  94   LEU n 
8  95   GLY n 
8  96   THR n 
8  97   ARG n 
8  98   ALA n 
8  99   LEU n 
8  100  GLN n 
8  101  ILE n 
8  102  SER n 
8  103  MET n 
8  104  ASN n 
8  105  ALA n 
8  106  PRO n 
8  107  VAL n 
8  108  PHE n 
8  109  VAL n 
8  110  ASP n 
8  111  LEU n 
8  112  GLU n 
8  113  GLY n 
8  114  GLU n 
8  115  THR n 
8  116  ASP n 
8  117  PRO n 
8  118  LEU n 
8  119  ARG n 
8  120  ILE n 
8  121  ALA n 
8  122  MET n 
8  123  LYS n 
8  124  GLU n 
8  125  LEU n 
8  126  ALA n 
8  127  GLU n 
8  128  LYS n 
8  129  LYS n 
8  130  ILE n 
8  131  PRO n 
8  132  LEU n 
8  133  VAL n 
8  134  ILE n 
8  135  ARG n 
8  136  ARG n 
8  137  TYR n 
8  138  LEU n 
8  139  PRO n 
8  140  ASP n 
8  141  GLY n 
8  142  SER n 
8  143  PHE n 
8  144  GLU n 
8  145  ASP n 
8  146  TRP n 
8  147  SER n 
8  148  VAL n 
8  149  GLU n 
8  150  GLU n 
8  151  LEU n 
8  152  ILE n 
8  153  VAL n 
8  154  ASP n 
8  155  LEU n 
9  1    MET n 
9  2    SER n 
9  3    ASN n 
9  4    THR n 
9  5    LEU n 
9  6    PHE n 
9  7    ASP n 
9  8    ASP n 
9  9    ILE n 
9  10   PHE n 
9  11   GLN n 
9  12   VAL n 
9  13   SER n 
9  14   GLU n 
9  15   VAL n 
9  16   ASP n 
9  17   PRO n 
9  18   GLY n 
9  19   ARG n 
9  20   TYR n 
9  21   ASN n 
9  22   LYS n 
9  23   VAL n 
9  24   CYS n 
9  25   ARG n 
9  26   ILE n 
9  27   GLU n 
9  28   ALA n 
9  29   ALA n 
9  30   SER n 
9  31   THR n 
9  32   THR n 
9  33   GLN n 
9  34   ASP n 
9  35   GLN n 
9  36   CYS n 
9  37   LYS n 
9  38   LEU n 
9  39   THR n 
9  40   LEU n 
9  41   ASP n 
9  42   ILE n 
9  43   ASN n 
9  44   VAL n 
9  45   GLU n 
9  46   LEU n 
9  47   PHE n 
9  48   PRO n 
9  49   VAL n 
9  50   ALA n 
9  51   ALA n 
9  52   GLN n 
9  53   ASP n 
9  54   SER n 
9  55   LEU n 
9  56   THR n 
9  57   VAL n 
9  58   THR n 
9  59   ILE n 
9  60   ALA n 
9  61   SER n 
9  62   SER n 
9  63   LEU n 
9  64   ASN n 
9  65   LEU n 
9  66   GLU n 
9  67   ASP n 
9  68   THR n 
9  69   PRO n 
9  70   ALA n 
9  71   ASN n 
9  72   ASP n 
9  73   SER n 
9  74   SER n 
9  75   ALA n 
9  76   THR n 
9  77   ARG n 
9  78   SER n 
9  79   TRP n 
9  80   ARG n 
9  81   PRO n 
9  82   PRO n 
9  83   GLN n 
9  84   ALA n 
9  85   GLY n 
9  86   ASP n 
9  87   ARG n 
9  88   SER n 
9  89   LEU n 
9  90   ALA n 
9  91   ASP n 
9  92   ASP n 
9  93   TYR n 
9  94   ASP n 
9  95   TYR n 
9  96   VAL n 
9  97   MET n 
9  98   TYR n 
9  99   GLY n 
9  100  THR n 
9  101  ALA n 
9  102  TYR n 
9  103  LYS n 
9  104  PHE n 
9  105  GLU n 
9  106  GLU n 
9  107  VAL n 
9  108  SER n 
9  109  LYS n 
9  110  ASP n 
9  111  LEU n 
9  112  ILE n 
9  113  ALA n 
9  114  VAL n 
9  115  TYR n 
9  116  TYR n 
9  117  SER n 
9  118  PHE n 
9  119  GLY n 
9  120  GLY n 
9  121  LEU n 
9  122  LEU n 
9  123  MET n 
9  124  ARG n 
9  125  LEU n 
9  126  GLU n 
9  127  GLY n 
9  128  ASN n 
9  129  TYR n 
9  130  ARG n 
9  131  ASN n 
9  132  LEU n 
9  133  ASN n 
9  134  ASN n 
9  135  LEU n 
9  136  LYS n 
9  137  GLN n 
9  138  GLU n 
9  139  ASN n 
9  140  ALA n 
9  141  TYR n 
9  142  LEU n 
9  143  LEU n 
9  144  ILE n 
9  145  ARG n 
9  146  ARG n 
10 1    MET n 
10 2    THR n 
10 3    THR n 
10 4    PHE n 
10 5    ARG n 
10 6    PHE n 
10 7    CYS n 
10 8    ARG n 
10 9    ASP n 
10 10   CYS n 
10 11   ASN n 
10 12   ASN n 
10 13   MET n 
10 14   LEU n 
10 15   TYR n 
10 16   PRO n 
10 17   ARG n 
10 18   GLU n 
10 19   ASP n 
10 20   LYS n 
10 21   GLU n 
10 22   ASN n 
10 23   ASN n 
10 24   ARG n 
10 25   LEU n 
10 26   LEU n 
10 27   PHE n 
10 28   GLU n 
10 29   CYS n 
10 30   ARG n 
10 31   THR n 
10 32   CYS n 
10 33   SER n 
10 34   TYR n 
10 35   VAL n 
10 36   GLU n 
10 37   GLU n 
10 38   ALA n 
10 39   GLY n 
10 40   SER n 
10 41   PRO n 
10 42   LEU n 
10 43   VAL n 
10 44   TYR n 
10 45   ARG n 
10 46   HIS n 
10 47   GLU n 
10 48   LEU n 
10 49   ILE n 
10 50   THR n 
10 51   ASN n 
10 52   ILE n 
10 53   GLY n 
10 54   GLU n 
10 55   THR n 
10 56   ALA n 
10 57   GLY n 
10 58   VAL n 
10 59   VAL n 
10 60   GLN n 
10 61   ASP n 
10 62   ILE n 
10 63   GLY n 
10 64   SER n 
10 65   ASP n 
10 66   PRO n 
10 67   THR n 
10 68   LEU n 
10 69   PRO n 
10 70   ARG n 
10 71   SER n 
10 72   ASP n 
10 73   ARG n 
10 74   GLU n 
10 75   CYS n 
10 76   PRO n 
10 77   LYS n 
10 78   CYS n 
10 79   HIS n 
10 80   SER n 
10 81   ARG n 
10 82   GLU n 
10 83   ASN n 
10 84   VAL n 
10 85   PHE n 
10 86   PHE n 
10 87   GLN n 
10 88   SER n 
10 89   GLN n 
10 90   GLN n 
10 91   ARG n 
10 92   ARG n 
10 93   LYS n 
10 94   ASP n 
10 95   THR n 
10 96   SER n 
10 97   MET n 
10 98   VAL n 
10 99   LEU n 
10 100  PHE n 
10 101  PHE n 
10 102  VAL n 
10 103  CYS n 
10 104  LEU n 
10 105  SER n 
10 106  CYS n 
10 107  SER n 
10 108  HIS n 
10 109  ILE n 
10 110  PHE n 
10 111  THR n 
10 112  SER n 
10 113  ASP n 
10 114  GLN n 
10 115  LYS n 
10 116  ASN n 
10 117  LYS n 
10 118  ARG n 
10 119  THR n 
10 120  GLN n 
10 121  PHE n 
10 122  SER n 
11 1    MET n 
11 2    ILE n 
11 3    VAL n 
11 4    PRO n 
11 5    VAL n 
11 6    ARG n 
11 7    CYS n 
11 8    PHE n 
11 9    SER n 
11 10   CYS n 
11 11   GLY n 
11 12   LYS n 
11 13   VAL n 
11 14   VAL n 
11 15   GLY n 
11 16   ASP n 
11 17   LYS n 
11 18   TRP n 
11 19   GLU n 
11 20   SER n 
11 21   TYR n 
11 22   LEU n 
11 23   ASN n 
11 24   LEU n 
11 25   LEU n 
11 26   GLN n 
11 27   GLU n 
11 28   ASP n 
11 29   GLU n 
11 30   LEU n 
11 31   ASP n 
11 32   GLU n 
11 33   GLY n 
11 34   THR n 
11 35   ALA n 
11 36   LEU n 
11 37   SER n 
11 38   ARG n 
11 39   LEU n 
11 40   GLY n 
11 41   LEU n 
11 42   LYS n 
11 43   ARG n 
11 44   TYR n 
11 45   CYS n 
11 46   CYS n 
11 47   ARG n 
11 48   ARG n 
11 49   MET n 
11 50   ILE n 
11 51   LEU n 
11 52   THR n 
11 53   HIS n 
11 54   VAL n 
11 55   ASP n 
11 56   LEU n 
11 57   ILE n 
11 58   GLU n 
11 59   LYS n 
11 60   PHE n 
11 61   LEU n 
11 62   ARG n 
11 63   TYR n 
11 64   ASN n 
11 65   PRO n 
11 66   LEU n 
11 67   GLU n 
11 68   LYS n 
11 69   ARG n 
11 70   ASP n 
12 1    MET n 
12 2    ASN n 
12 3    ALA n 
12 4    PRO n 
12 5    ASP n 
12 6    ARG n 
12 7    PHE n 
12 8    GLU n 
12 9    LEU n 
12 10   PHE n 
12 11   LEU n 
12 12   LEU n 
12 13   GLY n 
12 14   GLU n 
12 15   GLY n 
12 16   GLU n 
12 17   SER n 
12 18   LYS n 
12 19   LEU n 
12 20   LYS n 
12 21   ILE n 
12 22   ASP n 
12 23   PRO n 
12 24   ASP n 
12 25   THR n 
12 26   LYS n 
12 27   ALA n 
12 28   PRO n 
12 29   ASN n 
12 30   ALA n 
12 31   VAL n 
12 32   VAL n 
12 33   ILE n 
12 34   THR n 
12 35   PHE n 
12 36   GLU n 
12 37   LYS n 
12 38   GLU n 
12 39   ASP n 
12 40   HIS n 
12 41   THR n 
12 42   LEU n 
12 43   GLY n 
12 44   ASN n 
12 45   LEU n 
12 46   ILE n 
12 47   ARG n 
12 48   ALA n 
12 49   GLU n 
12 50   LEU n 
12 51   LEU n 
12 52   ASN n 
12 53   ASP n 
12 54   ARG n 
12 55   LYS n 
12 56   VAL n 
12 57   LEU n 
12 58   PHE n 
12 59   ALA n 
12 60   ALA n 
12 61   TYR n 
12 62   LYS n 
12 63   VAL n 
12 64   GLU n 
12 65   HIS n 
12 66   PRO n 
12 67   PHE n 
12 68   PHE n 
12 69   ALA n 
12 70   ARG n 
12 71   PHE n 
12 72   LYS n 
12 73   LEU n 
12 74   ARG n 
12 75   ILE n 
12 76   GLN n 
12 77   THR n 
12 78   THR n 
12 79   GLU n 
12 80   GLY n 
12 81   TYR n 
12 82   ASP n 
12 83   PRO n 
12 84   LYS n 
12 85   ASP n 
12 86   ALA n 
12 87   LEU n 
12 88   LYS n 
12 89   ASN n 
12 90   ALA n 
12 91   CYS n 
12 92   ASN n 
12 93   SER n 
12 94   ILE n 
12 95   ILE n 
12 96   ASN n 
12 97   LYS n 
12 98   LEU n 
12 99   GLY n 
12 100  ALA n 
12 101  LEU n 
12 102  LYS n 
12 103  THR n 
12 104  ASN n 
12 105  PHE n 
12 106  GLU n 
12 107  THR n 
12 108  GLU n 
12 109  TRP n 
12 110  ASN n 
12 111  LEU n 
12 112  GLN n 
12 113  THR n 
12 114  LEU n 
12 115  ALA n 
12 116  ALA n 
12 117  ASP n 
12 118  ASP n 
12 119  ALA n 
12 120  PHE n 
13 1    MET n 
13 2    SER n 
13 3    ARG n 
13 4    GLU n 
13 5    GLY n 
13 6    PHE n 
13 7    GLN n 
13 8    ILE n 
13 9    PRO n 
13 10   THR n 
13 11   ASN n 
13 12   LEU n 
13 13   ASP n 
13 14   ALA n 
13 15   ALA n 
13 16   ALA n 
13 17   ALA n 
13 18   GLY n 
13 19   THR n 
13 20   SER n 
13 21   GLN n 
13 22   ALA n 
13 23   ARG n 
13 24   THR n 
13 25   ALA n 
13 26   THR n 
13 27   LEU n 
13 28   LYS n 
13 29   TYR n 
13 30   ILE n 
13 31   CYS n 
13 32   ALA n 
13 33   GLU n 
13 34   CYS n 
13 35   SER n 
13 36   SER n 
13 37   LYS n 
13 38   LEU n 
13 39   SER n 
13 40   LEU n 
13 41   SER n 
13 42   ARG n 
13 43   THR n 
13 44   ASP n 
13 45   ALA n 
13 46   VAL n 
13 47   ARG n 
13 48   CYS n 
13 49   LYS n 
13 50   ASP n 
13 51   CYS n 
13 52   GLY n 
13 53   HIS n 
13 54   ARG n 
13 55   ILE n 
13 56   LEU n 
13 57   LEU n 
13 58   LYS n 
13 59   ALA n 
13 60   ARG n 
13 61   THR n 
13 62   LYS n 
13 63   ARG n 
13 64   LEU n 
13 65   VAL n 
13 66   GLN n 
13 67   PHE n 
13 68   GLU n 
13 69   ALA n 
13 70   ARG n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4  1 sample 1 1733 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
5  1 sample 1 1224 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
6  1 sample 1 318  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
7  1 sample 1 215  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
8  1 sample 1 155  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
9  1 sample 1 146  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
10 1 sample 1 122  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
11 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
12 1 sample 1 120  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
13 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? 204508 ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 9  'synthetic construct' ? 32630 ? 
2 1 sample 1 29 'synthetic construct' ? 32630 ? 
3 1 sample 1 18 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  PDB 6UPX        6UPX   ? 1  ? 1 
2  PDB 6UPX        6UPX   ? 2  ? 1 
3  PDB 6UPX        6UPX   ? 3  ? 1 
4  UNP RPB1_YEAST  P04050 ? 4  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 
5  UNP RPB2_YEAST  P08518 ? 5  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 
6  UNP RPB3_YEAST  P16370 ? 6  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 
7  UNP RPAB1_YEAST P20434 ? 7  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 
8  UNP RPAB2_YEAST P20435 ? 8  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 
9  UNP RPAB3_YEAST P20436 ? 9  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 
10 UNP RPB9_YEAST  P27999 ? 10 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 
11 UNP RPAB5_YEAST P22139 ? 11 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 
12 UNP RPB11_YEAST P38902 ? 12 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 
13 UNP RPAB4_YEAST P40422 ? 13 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6UPX R 1 ? 9    ? 6UPX   1 ? 9    ? 1 9    
2  2  6UPX T 1 ? 29   ? 6UPX   1 ? 29   ? 1 29   
3  3  6UPX N 1 ? 18   ? 6UPX   1 ? 18   ? 1 18   
4  4  6UPX A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
5  5  6UPX B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
6  6  6UPX C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
7  7  6UPX E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
8  8  6UPX F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
9  9  6UPX H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
10 10 6UPX I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
11 11 6UPX J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
12 12 6UPX K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
13 13 6UPX L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                                                                            
? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                                                                                 
? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                
? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                                                                             
? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                                                                                                
? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                                    
? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                                     
? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                                    
? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                            
? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                                                                            
? 'C10 H14 N5 O8 P' 363.221 
G35 'DNA linking'       . '(5R)-5-carbamimidamido-1-(2-deoxy-5-O-phosphono-beta-D-erythro-pentofuranosyl)imidazolidine-2,4-dione' 
? 'C9 H16 N5 O8 P'  353.226 
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                               
? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                 
? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                  
? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                                         
? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                 
? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                              
? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                
? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                                                                              
? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                                                                                                  
? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                                                                                              
? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UPX 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.28 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.26 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '390mM (NH4)2HPO4/NaH2PO4, pH 6.5, 5mM dioxane, 5mM DTT, 10-12% PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-09-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00003 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00003 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            86.130 
_reflns.entry_id                         6UPX 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.300 
_reflns.d_resolution_low                 49.300 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       105382 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.700 
_reflns.pdbx_Rmerge_I_obs                0.428 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             14 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.459 
_reflns.pdbx_Rpim_I_all                  0.165 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         811001 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.984 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.300 
_reflns_shell.d_res_low                   3.360 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         40721 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5266 
_reflns_shell.percent_possible_all        100.000 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                3.818 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.700 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   0.600 
_reflns_shell.pdbx_Rrim_I_all             4.092 
_reflns_shell.pdbx_Rpim_I_all             1.468 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.245 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                295.360 
_refine.B_iso_mean                               112.4971 
_refine.B_iso_min                                26.220 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6UPX 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.4000 
_refine.ls_d_res_low                             49.2950 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     96266 
_refine.ls_number_reflns_R_free                  1829 
_refine.ls_number_reflns_R_work                  94437 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9100 
_refine.ls_percent_reflns_R_free                 1.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2206 
_refine.ls_R_factor_R_free                       0.2662 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2198 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2E2J 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.4500 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.4000 
_refine_hist.d_res_low                        49.2950 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29074 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       3597 
_refine_hist.pdbx_B_iso_mean_ligand           151.72 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        28029 
_refine_hist.pdbx_number_atoms_nucleic_acid   1036 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.4000 3.4919 . . 141 7236 100.0000 . . . 0.3525 0.0000 0.3409 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4919 3.5946 . . 141 7255 100.0000 . . . 0.3538 0.0000 0.3123 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5946 3.7106 . . 139 7202 100.0000 . . . 0.3342 0.0000 0.2898 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7106 3.8432 . . 140 7240 100.0000 . . . 0.3325 0.0000 0.2730 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8432 3.9970 . . 141 7274 100.0000 . . . 0.2902 0.0000 0.2563 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9970 4.1788 . . 140 7204 100.0000 . . . 0.2753 0.0000 0.2206 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1788 4.3990 . . 141 7297 100.0000 . . . 0.2364 0.0000 0.1970 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3990 4.6744 . . 140 7262 100.0000 . . . 0.2474 0.0000 0.1874 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6744 5.0350 . . 140 7242 100.0000 . . . 0.2863 0.0000 0.1901 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0350 5.5411 . . 140 7280 100.0000 . . . 0.2681 0.0000 0.2024 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5411 6.3415 . . 142 7293 100.0000 . . . 0.2716 0.0000 0.2194 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3415 7.9841 . . 141 7286 100.0000 . . . 0.2595 0.0000 0.2039 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.9841 49.295 . . 143 7366 100.0000 . . . 0.1946 0.0000 0.1810 . . . . . . . . . . . 
# 
_struct.entry_id                     6UPX 
_struct.title                        'RNA polymerase II elongation complex with 5-guanidinohydantoin lesion in state 1' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase II subunit RPB2, DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4/RNA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UPX 
_struct_keywords.text            
'RNA polymerase II, 5-guanidinohydantoin, elongation complex, DNA lesion, TRANSCRIPTION, TRANSCRIPTION-RNA-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/RNA/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 14 ? 
P N N 15 ? 
Q N N 14 ? 
R N N 14 ? 
S N N 14 ? 
T N N 14 ? 
U N N 14 ? 
V N N 14 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER D 23   ? SER D 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   AA2 PHE D 95   ? GLU D 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P3   AA3 ASN D 119  ? ILE D 128  ? ASN A 119  ILE A 128  1 ? 10 
HELX_P HELX_P4   AA4 ASP D 130  ? CYS D 142  ? ASP A 130  CYS A 142  1 ? 13 
HELX_P HELX_P5   AA5 SER D 203  ? HIS D 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   AA6 SER D 215  ? GLY D 223  ? SER A 215  GLY A 223  1 ? 9  
HELX_P HELX_P7   AA7 ARG D 230  ? ILE D 235  ? ARG A 230  ILE A 235  1 ? 6  
HELX_P HELX_P8   AA8 PRO D 243  ? ARG D 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   AA9 ASP D 260  ? ASN D 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P10  AB1 PRO D 285  ? ASP D 305  ? PRO A 285  ASP A 305  1 ? 21 
HELX_P HELX_P11  AB2 SER D 324  ? LYS D 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P12  AB3 LYS D 368  ? LYS D 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P13  AB4 ASN D 384  ? GLY D 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P14  AB5 HIS D 451  ? MET D 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P15  AB6 VAL D 474  ? ASN D 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P16  AB7 SER D 494  ? LEU D 504  ? SER A 494  LEU A 504  1 ? 11 
HELX_P HELX_P17  AB8 PRO D 514  ? ASN D 517  ? PRO A 514  ASN A 517  5 ? 4  
HELX_P HELX_P18  AB9 VAL D 524  ? THR D 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P19  AC1 GLU D 542  ? VAL D 553  ? GLU A 542  VAL A 553  1 ? 12 
HELX_P HELX_P20  AC2 GLY D 574  ? SER D 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P21  AC3 SER D 599  ? ASN D 603  ? SER A 599  ASN A 603  5 ? 5  
HELX_P HELX_P22  AC4 GLU D 618  ? GLY D 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P23  AC5 GLY D 628  ? LYS D 637  ? GLY A 628  LYS A 637  1 ? 10 
HELX_P HELX_P24  AC6 GLY D 638  ? GLY D 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P25  AC7 GLY D 665  ? ILE D 670  ? GLY A 665  ILE A 670  5 ? 6  
HELX_P HELX_P26  AC8 ASP D 672  ? ALA D 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P27  AC9 THR D 709  ? LEU D 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P28  AD1 ASN D 741  ? ALA D 749  ? ASN A 741  ALA A 749  1 ? 9  
HELX_P HELX_P29  AD2 SER D 754  ? ALA D 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P30  AD3 THR D 809  ? GLU D 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P31  AD4 ILE D 867  ? ASP D 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P32  AD5 ASP D 874  ? ILE D 878  ? ASP A 874  ILE A 878  5 ? 5  
HELX_P HELX_P33  AD6 SER D 889  ? ARG D 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P34  AD7 ASP D 909  ? LEU D 913  ? ASP A 909  LEU A 913  5 ? 5  
HELX_P HELX_P35  AD8 ASP D 922  ? PHE D 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P36  AD9 ASN D 959  ? PHE D 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P37  AE1 THR D 982  ? LEU D 997  ? THR A 982  LEU A 997  1 ? 16 
HELX_P HELX_P38  AE2 ASN D 1004 ? VAL D 1015 ? ASN A 1004 VAL A 1015 1 ? 12 
HELX_P HELX_P39  AE3 VAL D 1015 ? LEU D 1026 ? VAL A 1015 LEU A 1026 1 ? 12 
HELX_P HELX_P40  AE4 ALA D 1027 ? GLU D 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P41  AE5 THR D 1038 ? VAL D 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P42  AE6 MET D 1063 ? GLN D 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P43  AE7 SER D 1096 ? ASN D 1106 ? SER A 1096 ASN A 1106 1 ? 11 
HELX_P HELX_P44  AE8 ASP D 1127 ? GLU D 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P45  AE9 ASP D 1166 ? LEU D 1172 ? ASP A 1166 LEU A 1172 1 ? 7  
HELX_P HELX_P46  AF1 ASP D 1198 ? LYS D 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P47  AF2 THR D 1208 ? PHE D 1220 ? THR A 1208 PHE A 1220 1 ? 13 
HELX_P HELX_P48  AF3 HIS D 1258 ? ASN D 1270 ? HIS A 1258 ASN A 1270 1 ? 13 
HELX_P HELX_P49  AF4 ASN D 1312 ? MET D 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P50  AF5 SER D 1331 ? LEU D 1339 ? SER A 1331 LEU A 1339 1 ? 9  
HELX_P HELX_P51  AF6 GLY D 1340 ? GLY D 1360 ? GLY A 1340 GLY A 1360 1 ? 21 
HELX_P HELX_P52  AF7 ASN D 1364 ? GLN D 1378 ? ASN A 1364 GLN A 1378 1 ? 15 
HELX_P HELX_P53  AF8 GLY D 1388 ? SER D 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P54  AF9 MET D 1398 ? PHE D 1402 ? MET A 1398 PHE A 1402 5 ? 5  
HELX_P HELX_P55  AG1 GLU D 1404 ? SER D 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P56  AG2 GLY D 1423 ? GLY D 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P57  AG3 ASP E 29   ? GLY E 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P58  AG4 VAL E 44   ? TYR E 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P59  AG5 TYR E 57   ? CYS E 64   ? TYR B 57   CYS B 64   1 ? 8  
HELX_P HELX_P60  AG6 TYR E 113  ? ARG E 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P61  AG7 CYS E 179  ? GLU E 183  ? CYS B 179  GLU B 183  5 ? 5  
HELX_P HELX_P62  AG8 THR E 185  ? LEU E 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P63  AG9 ILE E 282  ? GLY E 290  ? ILE B 282  GLY B 290  1 ? 9  
HELX_P HELX_P64  AH1 PRO E 293  ? CYS E 302  ? PRO B 293  CYS B 302  1 ? 10 
HELX_P HELX_P65  AH2 ASP E 307  ? GLY E 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P66  AH3 ASP E 326  ? LEU E 331  ? ASP B 326  LEU B 331  1 ? 6  
HELX_P HELX_P67  AH4 GLU E 346  ? GLU E 359  ? GLU B 346  GLU B 359  1 ? 14 
HELX_P HELX_P68  AH5 PHE E 370  ? LEU E 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P69  AH6 HIS E 400  ? GLY E 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P70  AH7 LEU E 408  ? THR E 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P71  AH8 ALA E 450  ? THR E 463  ? ALA B 450  THR B 463  1 ? 14 
HELX_P HELX_P72  AH9 THR E 487  ? ARG E 496  ? THR B 487  ARG B 496  1 ? 10 
HELX_P HELX_P73  AI1 HIS E 515  ? TRP E 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P74  AI2 PRO E 551  ? TRP E 561  ? PRO B 551  TRP B 561  1 ? 11 
HELX_P HELX_P75  AI3 ASN E 592  ? LYS E 606  ? ASN B 592  LYS B 606  1 ? 15 
HELX_P HELX_P76  AI4 ARG E 654  ? GLN E 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P77  AI5 THR E 680  ? GLU E 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P78  AI6 GLU E 696  ? ILE E 701  ? GLU B 696  ILE B 701  5 ? 6  
HELX_P HELX_P79  AI7 GLN E 706  ? GLU E 711  ? GLN B 706  GLU B 711  5 ? 6  
HELX_P HELX_P80  AI8 HIS E 744  ? LEU E 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P81  AI9 ALA E 752  ? ILE E 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P82  AJ1 PHE E 758  ? ASN E 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P83  AJ2 GLN E 763  ? GLY E 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P84  AJ3 ALA E 808  ? LYS E 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P85  AJ4 GLN E 843  ? ARG E 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P86  AJ5 PRO E 1014 ? ILE E 1017 ? PRO B 1014 ILE B 1017 5 ? 4  
HELX_P HELX_P87  AJ6 THR E 1022 ? GLY E 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P88  AJ7 THR E 1051 ? HIS E 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P89  AJ8 GLY E 1121 ? ASP E 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P90  AJ9 GLY E 1131 ? GLY E 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P91  AK1 ALA E 1143 ? MET E 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P92  AK2 TYR E 1198 ? MET E 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P93  AK3 ASP F 26   ? GLU F 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P94  AK4 ALA F 59   ? LEU F 69   ? ALA C 59   LEU C 69   1 ? 11 
HELX_P HELX_P95  AK5 ASP F 76   ? LEU F 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P96  AK6 TYR F 114  ? LEU F 118  ? TYR C 114  LEU C 118  5 ? 5  
HELX_P HELX_P97  AK7 HIS F 167  ? GLY F 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P98  AK8 ASP F 196  ? TRP F 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P99  AK9 SER F 204  ? GLU F 208  ? SER C 204  GLU C 208  5 ? 5  
HELX_P HELX_P100 AL1 PRO F 239  ? ASP F 266  ? PRO C 239  ASP C 266  1 ? 28 
HELX_P HELX_P101 AL2 GLU G 6    ? GLY G 27   ? GLU E 6    GLY E 27   1 ? 22 
HELX_P HELX_P102 AL3 THR G 31   ? GLU G 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P103 AL4 PRO G 38   ? CYS G 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P104 AL5 GLN G 54   ? SER G 59   ? GLN E 54   SER E 59   5 ? 6  
HELX_P HELX_P105 AL6 THR G 65   ? PHE G 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P106 AL7 GLY G 89   ? ASN G 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P107 AL8 SER G 119  ? ILE G 127  ? SER E 119  ILE E 127  5 ? 9  
HELX_P HELX_P108 AL9 ASN G 143  ? HIS G 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P109 AM1 SER G 157  ? ARG G 169  ? SER E 157  ARG E 169  1 ? 13 
HELX_P HELX_P110 AM2 ASP G 182  ? GLY G 189  ? ASP E 182  GLY E 189  1 ? 8  
HELX_P HELX_P111 AM3 THR H 86   ? MET H 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P112 AM4 ASP H 116  ? GLU H 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P113 AM5 VAL J 59   ? ASP J 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P114 AM6 LYS K 17   ? GLU K 27   ? LYS J 17   GLU J 27   1 ? 11 
HELX_P HELX_P115 AM7 ASP K 31   ? LEU K 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P116 AM8 ARG K 43   ? THR K 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P117 AM9 LEU K 56   ? TYR K 63   ? LEU J 56   TYR J 63   1 ? 8  
HELX_P HELX_P118 AN1 ASP L 5    ? PHE L 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P119 AN2 ASP L 39   ? LEU L 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P120 AN3 ASP L 82   ? GLN L 112  ? ASP K 82   GLN K 112  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A G   9    "O3'" ? ? ? 1_555 P MG  .  MG ? ? R G   9    A MG  1803 1_555 ? ? ? ? ? ? ?            2.114 ? 
covale1  covale both ? B DA  18   "O3'" ? ? ? 1_555 B G35 19 P  ? ? T DA  18   T G35 19   1_555 ? ? ? ? ? ? ?            1.605 ? 
covale2  covale one  ? B G35 19   "O3'" ? ? ? 1_555 B DC  20 P  ? ? T G35 19   T DC  20   1_555 ? ? ? ? ? ? ?            1.609 ? 
metalc2  metalc ?    ? D CYS 67   SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 67   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.488 ? 
metalc3  metalc ?    ? D CYS 70   SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 70   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.610 ? 
metalc4  metalc ?    ? D CYS 77   SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 77   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.614 ? 
metalc5  metalc ?    ? D HIS 80   NE2   ? ? ? 1_555 O ZN  .  ZN ? ? A HIS 80   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.032 ? 
metalc6  metalc ?    ? D CYS 107  SG    ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 107  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.457 ? 
metalc7  metalc ?    ? D CYS 110  N     ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 110  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.184 ? 
metalc8  metalc ?    ? D CYS 110  SG    ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 110  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.466 ? 
metalc9  metalc ?    ? D CYS 167  SG    ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 167  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.641 ? 
metalc10 metalc ?    ? D ASP 483  OD1   ? ? ? 1_555 P MG  .  MG ? ? A ASP 483  A MG  1803 1_555 ? ? ? ? ? ? ?            2.973 ? 
metalc11 metalc ?    ? D ASP 483  OD2   ? ? ? 1_555 P MG  .  MG ? ? A ASP 483  A MG  1803 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc12 metalc ?    ? D ASP 485  OD1   ? ? ? 1_555 P MG  .  MG ? ? A ASP 485  A MG  1803 1_555 ? ? ? ? ? ? ?            2.166 ? 
metalc13 metalc ?    ? E CYS 1163 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? B CYS 1163 B ZN  1301 1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc14 metalc ?    ? E CYS 1166 N     ? ? ? 1_555 Q ZN  .  ZN ? ? B CYS 1166 B ZN  1301 1_555 ? ? ? ? ? ? ?            2.575 ? 
metalc15 metalc ?    ? E CYS 1166 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? B CYS 1166 B ZN  1301 1_555 ? ? ? ? ? ? ?            2.996 ? 
metalc16 metalc ?    ? E CYS 1182 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? B CYS 1182 B ZN  1301 1_555 ? ? ? ? ? ? ?            2.513 ? 
metalc17 metalc ?    ? E CYS 1185 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? B CYS 1185 B ZN  1301 1_555 ? ? ? ? ? ? ?            2.559 ? 
metalc18 metalc ?    ? F CYS 86   SG    ? ? ? 1_555 R ZN  .  ZN ? ? C CYS 86   C ZN  401  1_555 ? ? ? ? ? ? ?            2.411 ? 
metalc19 metalc ?    ? F CYS 88   SG    ? ? ? 1_555 R ZN  .  ZN ? ? C CYS 88   C ZN  401  1_555 ? ? ? ? ? ? ?            2.365 ? 
metalc20 metalc ?    ? F CYS 92   SG    ? ? ? 1_555 R ZN  .  ZN ? ? C CYS 92   C ZN  401  1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc21 metalc ?    ? F CYS 95   SG    ? ? ? 1_555 R ZN  .  ZN ? ? C CYS 95   C ZN  401  1_555 ? ? ? ? ? ? ?            2.420 ? 
metalc22 metalc ?    ? J CYS 7    SG    ? ? ? 1_555 S ZN  .  ZN ? ? I CYS 7    I ZN  201  1_555 ? ? ? ? ? ? ?            2.531 ? 
metalc23 metalc ?    ? J CYS 10   SG    ? ? ? 1_555 S ZN  .  ZN ? ? I CYS 10   I ZN  201  1_555 ? ? ? ? ? ? ?            2.461 ? 
metalc24 metalc ?    ? J CYS 29   SG    ? ? ? 1_555 S ZN  .  ZN ? ? I CYS 29   I ZN  201  1_555 ? ? ? ? ? ? ?            2.434 ? 
metalc25 metalc ?    ? J CYS 32   SG    ? ? ? 1_555 S ZN  .  ZN ? ? I CYS 32   I ZN  201  1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc26 metalc ?    ? J CYS 75   SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 75   I ZN  202  1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc27 metalc ?    ? J CYS 78   SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 78   I ZN  202  1_555 ? ? ? ? ? ? ?            2.433 ? 
metalc28 metalc ?    ? J CYS 103  SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 103  I ZN  202  1_555 ? ? ? ? ? ? ?            2.501 ? 
metalc29 metalc ?    ? J CYS 106  SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 106  I ZN  202  1_555 ? ? ? ? ? ? ?            2.376 ? 
metalc30 metalc ?    ? K CYS 7    SG    ? ? ? 1_555 U ZN  .  ZN ? ? J CYS 7    J ZN  101  1_555 ? ? ? ? ? ? ?            2.245 ? 
metalc31 metalc ?    ? K CYS 45   SG    ? ? ? 1_555 U ZN  .  ZN ? ? J CYS 45   J ZN  101  1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc32 metalc ?    ? K CYS 46   SG    ? ? ? 1_555 U ZN  .  ZN ? ? J CYS 46   J ZN  101  1_555 ? ? ? ? ? ? ?            2.246 ? 
metalc33 metalc ?    ? M CYS 31   SG    ? ? ? 1_555 V ZN  .  ZN ? ? L CYS 31   L ZN  101  1_555 ? ? ? ? ? ? ?            2.400 ? 
metalc34 metalc ?    ? M CYS 48   SG    ? ? ? 1_555 V ZN  .  ZN ? ? L CYS 48   L ZN  101  1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc35 metalc ?    ? M CYS 51   SG    ? ? ? 1_555 V ZN  .  ZN ? ? L CYS 51   L ZN  101  1_555 ? ? ? ? ? ? ?            2.528 ? 
hydrog1  hydrog ?    ? A A   1    N6    ? ? ? 1_555 B DT  28 O4 ? ? R A   1    T DT  28   1_555 ? ? ? ? ? ? 'A-DT PAIR'  ?     ? 
hydrog2  hydrog ?    ? A U   2    N3    ? ? ? 1_555 B DA  27 N1 ? ? R U   2    T DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? A U   2    O4    ? ? ? 1_555 B DA  27 N6 ? ? R U   2    T DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? A C   3    N3    ? ? ? 1_555 B DG  26 N1 ? ? R C   3    T DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? A C   3    N4    ? ? ? 1_555 B DG  26 O6 ? ? R C   3    T DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? A C   3    O2    ? ? ? 1_555 B DG  26 N2 ? ? R C   3    T DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? A G   4    N1    ? ? ? 1_555 B DC  25 N3 ? ? R G   4    T DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? A G   4    N2    ? ? ? 1_555 B DC  25 O2 ? ? R G   4    T DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? A G   4    O6    ? ? ? 1_555 B DC  25 N4 ? ? R G   4    T DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? A A   5    N1    ? ? ? 1_555 B DT  24 N3 ? ? R A   5    T DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? A A   5    N6    ? ? ? 1_555 B DT  24 O4 ? ? R A   5    T DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? A G   6    N1    ? ? ? 1_555 B DC  23 N3 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? A G   6    N2    ? ? ? 1_555 B DC  23 O2 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? A G   6    O6    ? ? ? 1_555 B DC  23 N4 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? A A   7    N1    ? ? ? 1_555 B DT  22 N3 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? A A   7    N6    ? ? ? 1_555 B DT  22 O4 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? A G   8    N1    ? ? ? 1_555 B DC  21 N3 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? A G   8    N2    ? ? ? 1_555 B DC  21 O2 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? A G   8    O6    ? ? ? 1_555 B DC  21 N4 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? A G   9    N1    ? ? ? 1_555 B DC  20 N3 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? A G   9    N2    ? ? ? 1_555 B DC  20 O2 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? A G   9    O6    ? ? ? 1_555 B DC  20 N4 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DC  5    N3    ? ? ? 1_555 C DG  14 N1 ? ? T DC  5    N DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DC  5    N4    ? ? ? 1_555 C DG  14 O6 ? ? T DC  5    N DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DC  5    O2    ? ? ? 1_555 C DG  14 N2 ? ? T DC  5    N DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DT  6    N3    ? ? ? 1_555 C DA  13 N1 ? ? T DT  6    N DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DT  6    O4    ? ? ? 1_555 C DA  13 N6 ? ? T DT  6    N DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DC  7    N3    ? ? ? 1_555 C DG  12 N1 ? ? T DC  7    N DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DC  7    N4    ? ? ? 1_555 C DG  12 O6 ? ? T DC  7    N DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? B DC  7    O2    ? ? ? 1_555 C DG  12 N2 ? ? T DC  7    N DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? B DT  8    N3    ? ? ? 1_555 C DA  11 N1 ? ? T DT  8    N DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? B DT  8    O4    ? ? ? 1_555 C DA  11 N6 ? ? T DT  8    N DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? B DC  9    N3    ? ? ? 1_555 C DG  10 N1 ? ? T DC  9    N DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? B DC  9    N4    ? ? ? 1_555 C DG  10 O6 ? ? T DC  9    N DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? B DC  9    O2    ? ? ? 1_555 C DG  10 N2 ? ? T DC  9    N DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? B DT  10   N3    ? ? ? 1_555 C DA  9  N1 ? ? T DT  10   N DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? B DT  10   O4    ? ? ? 1_555 C DA  9  N6 ? ? T DT  10   N DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? B DC  11   N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  11   N DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? B DC  11   N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  11   N DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? B DC  11   O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  11   N DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? B DT  12   N3    ? ? ? 1_555 C DA  7  N1 ? ? T DT  12   N DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? B DT  12   O4    ? ? ? 1_555 C DA  7  N6 ? ? T DT  12   N DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? B DC  13   N3    ? ? ? 1_555 C DG  6  N1 ? ? T DC  13   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? B DC  13   N4    ? ? ? 1_555 C DG  6  O6 ? ? T DC  13   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? B DC  13   O2    ? ? ? 1_555 C DG  6  N2 ? ? T DC  13   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? B DG  14   N1    ? ? ? 1_555 C DC  5  N3 ? ? T DG  14   N DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? B DG  14   N2    ? ? ? 1_555 C DC  5  O2 ? ? T DG  14   N DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? B DG  14   O6    ? ? ? 1_555 C DC  5  N4 ? ? T DG  14   N DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? B DC  15   N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  15   N DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? B DC  15   N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  15   N DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? B DC  15   O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  15   N DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? B DT  16   O4    ? ? ? 1_555 C DA  3  N6 ? ? T DT  16   N DA  3    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog53 hydrog ?    ? B DG  17   N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  17   N DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? B DG  17   N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  17   N DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? B DG  17   O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  17   N DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 2 ? 
AA5 ? 8 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 3 ? 
AC1 ? 4 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 5 ? 
AC5 ? 3 ? 
AC6 ? 4 ? 
AC7 ? 5 ? 
AC8 ? 5 ? 
AC9 ? 7 ? 
AD1 ? 2 ? 
AD2 ? 8 ? 
AD3 ? 2 ? 
AD4 ? 4 ? 
AD5 ? 2 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 4 ? 
AE1 ? 5 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 4 ? 
AE5 ? 4 ? 
AE6 ? 9 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA5 6 7 ? anti-parallel 
AA5 7 8 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? parallel      
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? parallel      
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AC9 5 6 ? anti-parallel 
AC9 6 7 ? anti-parallel 
AD1 1 2 ? parallel      
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? parallel      
AD2 5 6 ? anti-parallel 
AD2 6 7 ? parallel      
AD2 7 8 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? parallel      
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE1 4 5 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? parallel      
AE4 3 4 ? parallel      
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? parallel      
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE6 4 5 ? anti-parallel 
AE6 5 6 ? anti-parallel 
AE6 6 7 ? anti-parallel 
AE6 7 8 ? anti-parallel 
AE6 8 9 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU D 1418 ? ASP D 1419 ? LEU A 1418 ASP A 1419 
AA1 2 GLU D 16   ? GLN D 18   ? GLU A 16   GLN A 18   
AA1 3 ARG E 1215 ? TYR E 1217 ? ARG B 1215 TYR B 1217 
AA2 1 GLY D 82   ? VAL D 90   ? GLY A 82   VAL A 90   
AA2 2 LEU D 236  ? VAL D 241  ? LEU A 236  VAL A 241  
AA3 1 ILE D 174  ? ASP D 177  ? ILE A 174  ASP A 177  
AA3 2 LYS D 180  ? GLY D 183  ? LYS A 180  GLY A 183  
AA3 3 ARG D 200  ? VAL D 201  ? ARG A 200  VAL A 201  
AA4 1 LYS D 343  ? VAL D 345  ? LYS A 343  VAL A 345  
AA4 2 LEU E 1128 ? PHE E 1130 ? LEU B 1128 PHE B 1130 
AA5 1 HIS E 1104 ? ALA E 1105 ? HIS B 1104 ALA B 1105 
AA5 2 SER D 348  ? GLY D 355  ? SER A 348  GLY A 355  
AA5 3 GLU D 486  ? HIS D 490  ? GLU A 486  HIS A 490  
AA5 4 PRO D 441  ? ASN D 445  ? PRO A 441  ASN A 445  
AA5 5 MET D 455  ? ILE D 463  ? MET A 455  ILE A 463  
AA5 6 GLN D 363  ? PRO D 367  ? GLN A 363  PRO A 367  
AA5 7 PHE D 468  ? LEU D 470  ? PHE A 468  LEU A 470  
AA5 8 SER D 348  ? GLY D 355  ? SER A 348  GLY A 355  
AA6 1 THR D 375  ? VAL D 379  ? THR A 375  VAL A 379  
AA6 2 LYS D 431  ? HIS D 435  ? LYS A 431  HIS A 435  
AA6 3 ALA D 402  ? ILE D 406  ? ALA A 402  ILE A 406  
AA6 4 ARG D 412  ? ASP D 414  ? ARG A 412  ASP A 414  
AA7 1 VAL D 512  ? SER D 513  ? VAL A 512  SER A 513  
AA7 2 LYS D 518  ? PRO D 519  ? LYS A 518  PRO A 519  
AA8 1 PHE D 540  ? ILE D 541  ? PHE A 540  ILE A 541  
AA8 2 TRP D 572  ? SER D 573  ? TRP A 572  SER A 573  
AA9 1 HIS D 587  ? ARG D 590  ? HIS A 587  ARG A 590  
AA9 2 MET D 605  ? ILE D 608  ? MET A 605  ILE A 608  
AA9 3 ILE D 612  ? PHE D 614  ? ILE A 612  PHE A 614  
AB1 1 GLY D 766  ? GLN D 767  ? GLY A 766  GLN A 767  
AB1 2 PHE D 799  ? VAL D 800  ? PHE A 799  VAL A 800  
AB2 1 MET D 849  ? VAL D 850  ? MET A 849  VAL A 850  
AB2 2 THR D 856  ? ARG D 857  ? THR A 856  ARG A 857  
AB2 3 VAL D 863  ? GLN D 865  ? VAL A 863  GLN A 865  
AB3 1 GLU D 879  ? GLN D 881  ? GLU A 879  GLN A 881  
AB3 2 TRP D 954  ? LEU D 956  ? TRP A 954  LEU A 956  
AB4 1 VAL D 1282 ? TYR D 1287 ? VAL A 1282 TYR A 1287 
AB4 2 GLU D 1303 ? THR D 1308 ? GLU A 1303 THR A 1308 
AB4 3 LEU D 1116 ? TYR D 1119 ? LEU A 1116 TYR A 1119 
AB4 4 TYR D 1328 ? THR D 1329 ? TYR A 1328 THR A 1329 
AB5 1 THR D 1141 ? THR D 1142 ? THR A 1141 THR A 1142 
AB5 2 THR D 1272 ? ARG D 1274 ? THR A 1272 ARG A 1274 
AB6 1 LEU D 1224 ? TRP D 1228 ? LEU A 1224 TRP A 1228 
AB6 2 ILE D 1237 ? VAL D 1242 ? ILE A 1237 VAL A 1242 
AB6 3 TRP D 1191 ? LEU D 1197 ? TRP A 1191 LEU A 1197 
AB6 4 THR D 1147 ? TYR D 1154 ? THR A 1147 TYR A 1154 
AB6 5 LEU J 42   ? GLU J 47   ? LEU I 42   GLU I 47   
AB7 1 LYS D 1290 ? PRO D 1292 ? LYS A 1290 PRO A 1292 
AB7 2 TYR D 1298 ? LYS D 1300 ? TYR A 1298 LYS A 1300 
AB8 1 PHE D 1441 ? ILE D 1445 ? PHE A 1441 ILE A 1445 
AB8 2 LEU H 132  ? TYR H 137  ? LEU F 132  TYR F 137  
AB8 3 PHE H 143  ? SER H 147  ? PHE F 143  SER F 147  
AB9 1 LEU E 69   ? GLU E 72   ? LEU B 69   GLU B 72   
AB9 2 LYS E 87   ? ASN E 103  ? LYS B 87   ASN B 103  
AB9 3 THR E 109  ? ALA E 111  ? THR B 109  ALA B 111  
AC1 1 LEU E 69   ? GLU E 72   ? LEU B 69   GLU B 72   
AC1 2 LYS E 87   ? ASN E 103  ? LYS B 87   ASN B 103  
AC1 3 SER E 125  ? ARG E 135  ? SER B 125  ARG B 135  
AC1 4 GLY E 163  ? PRO E 171  ? GLY B 163  PRO B 171  
AC2 1 PHE E 203  ? ILE E 205  ? PHE B 203  ILE B 205  
AC2 2 SER E 208  ? LEU E 212  ? SER B 208  LEU B 212  
AC2 3 SER E 480  ? VAL E 482  ? SER B 480  VAL B 482  
AC3 1 LYS E 404  ? ASP E 407  ? LYS B 404  ASP B 407  
AC3 2 ALA E 214  ? SER E 218  ? ALA B 214  SER B 218  
AC3 3 ARG E 497  ? ASN E 499  ? ARG B 497  ASN B 499  
AC3 4 LYS E 537  ? ASN E 538  ? LYS B 537  ASN B 538  
AC4 1 VAL E 223  ? LYS E 227  ? VAL B 223  LYS B 227  
AC4 2 HIS E 236  ? SER E 242  ? HIS B 236  SER B 242  
AC4 3 SER E 252  ? LEU E 258  ? SER B 252  LEU B 258  
AC4 4 ILE E 269  ? ALA E 271  ? ILE B 269  ALA B 271  
AC4 5 ILE E 280  ? PRO E 281  ? ILE B 280  PRO B 281  
AC5 1 CYS E 544  ? ILE E 545  ? CYS B 544  ILE B 545  
AC5 2 VAL E 633  ? ASP E 642  ? VAL B 633  ASP B 642  
AC5 3 VAL E 690  ? ASP E 694  ? VAL B 690  ASP B 694  
AC6 1 LYS E 649  ? LEU E 651  ? LYS B 649  LEU B 651  
AC6 2 VAL E 633  ? ASP E 642  ? VAL B 633  ASP B 642  
AC6 3 HIS E 740  ? CYS E 741  ? HIS B 740  CYS B 741  
AC6 4 ILE E 703  ? ALA E 704  ? ILE B 703  ALA B 704  
AC7 1 GLU E 564  ? PRO E 565  ? GLU B 564  PRO B 565  
AC7 2 VAL E 585  ? HIS E 590  ? VAL B 585  HIS B 590  
AC7 3 THR E 578  ? VAL E 582  ? THR B 578  VAL B 582  
AC7 4 GLU E 623  ? PHE E 627  ? GLU B 623  PHE B 627  
AC7 5 SER E 614  ? ASP E 618  ? SER B 614  ASP B 618  
AC8 1 MET E 792  ? LEU E 796  ? MET B 792  LEU B 796  
AC8 2 SER E 853  ? GLN E 862  ? SER B 853  GLN B 862  
AC8 3 LYS E 962  ? LYS E 972  ? LYS B 962  LYS B 972  
AC8 4 ASN E 946  ? THR E 956  ? ASN B 946  THR B 956  
AC8 5 ARG E 904  ? SER E 906  ? ARG B 904  SER B 906  
AC9 1 MET E 792  ? LEU E 796  ? MET B 792  LEU B 796  
AC9 2 SER E 853  ? GLN E 862  ? SER B 853  GLN B 862  
AC9 3 LYS E 962  ? LYS E 972  ? LYS B 962  LYS B 972  
AC9 4 ASN E 946  ? THR E 956  ? ASN B 946  THR B 956  
AC9 5 LEU M 56   ? LYS M 58   ? LEU L 56   LYS L 58   
AC9 6 TYR M 29   ? CYS M 31   ? TYR L 29   CYS L 31   
AC9 7 LYS M 37   ? LEU M 38   ? LYS L 37   LEU L 38   
AD1 1 GLY E 804  ? THR E 805  ? GLY B 804  THR B 805  
AD1 2 GLY E 1042 ? ASP E 1043 ? GLY B 1042 ASP B 1043 
AD2 1 PHE E 1069 ? GLU E 1070 ? PHE B 1069 GLU B 1070 
AD2 2 ILE E 1085 ? ARG E 1094 ? ILE B 1085 ARG B 1094 
AD2 3 LYS E 979  ? SER E 982  ? LYS B 979  SER B 982  
AD2 4 GLY E 988  ? TYR E 994  ? GLY B 988  TYR B 994  
AD2 5 MET E 839  ? ASN E 842  ? MET B 839  ASN B 842  
AD2 6 LEU E 1010 ? ILE E 1012 ? LEU B 1010 ILE B 1012 
AD2 7 GLN E 821  ? ILE E 827  ? GLN B 821  ILE B 827  
AD2 8 ILE E 1085 ? ARG E 1094 ? ILE B 1085 ARG B 1094 
AD3 1 LYS E 865  ? TYR E 866  ? LYS B 865  TYR B 866  
AD3 2 ILE E 870  ? THR E 871  ? ILE B 870  THR B 871  
AD4 1 THR E 873  ? PHE E 874  ? THR B 873  PHE B 874  
AD4 2 LYS E 914  ? PRO E 917  ? LYS B 914  PRO B 917  
AD4 3 LYS E 934  ? ASP E 936  ? LYS B 934  ASP B 936  
AD4 4 THR E 882  ? LEU E 883  ? THR B 882  LEU B 883  
AD5 1 VAL E 910  ? ILE E 912  ? VAL B 910  ILE B 912  
AD5 2 THR E 939  ? PRO E 940  ? THR B 939  PRO B 940  
AD6 1 PHE E 1001 ? THR E 1002 ? PHE B 1001 THR B 1002 
AD6 2 MET E 1072 ? TYR E 1073 ? MET B 1072 TYR B 1073 
AD7 1 ALA E 1157 ? CYS E 1163 ? ALA B 1157 CYS B 1163 
AD7 2 ILE E 1191 ? PRO E 1197 ? ILE B 1191 PRO B 1197 
AD8 1 VAL E 1171 ? LYS E 1174 ? VAL B 1171 LYS B 1174 
AD8 2 GLN E 1179 ? CYS E 1182 ? GLN B 1179 CYS B 1182 
AD9 1 GLN F 7    ? ALA F 13   ? GLN C 7    ALA C 13   
AD9 2 ASN F 17   ? SER F 23   ? ASN C 17   SER C 23   
AD9 3 PHE F 228  ? SER F 234  ? PHE C 228  SER C 234  
AD9 4 ALA F 173  ? GLU F 179  ? ALA C 173  GLU C 179  
AE1 1 VAL F 119  ? ILE F 120  ? VAL C 119  ILE C 120  
AE1 2 VAL F 97   ? PHE F 104  ? VAL C 97   PHE C 104  
AE1 3 GLU F 152  ? ILE F 163  ? GLU C 152  ILE C 163  
AE1 4 PRO F 42   ? ASN F 54   ? PRO C 42   ASN C 54   
AE1 5 GLN M 66   ? PHE M 67   ? GLN L 66   PHE L 67   
AE2 1 LEU F 72   ? SER F 74   ? LEU C 72   SER C 74   
AE2 2 ILE F 129  ? PRO F 132  ? ILE C 129  PRO C 132  
AE3 1 THR F 111  ? VAL F 113  ? THR C 111  VAL C 113  
AE3 2 CYS F 145  ? LEU F 147  ? CYS C 145  LEU C 147  
AE4 1 PHE G 60   ? ALA G 62   ? PHE E 60   ALA E 62   
AE4 2 LEU G 78   ? GLU G 81   ? LEU E 78   GLU E 81   
AE4 3 THR G 107  ? TYR G 112  ? THR E 107  TYR E 112  
AE4 4 THR G 131  ? ASN G 136  ? THR E 131  ASN E 136  
AE5 1 LYS G 152  ? ARG G 155  ? LYS E 152  ARG E 155  
AE5 2 VAL G 195  ? SER G 202  ? VAL E 195  SER E 202  
AE5 3 GLY G 206  ? CYS G 214  ? GLY E 206  CYS E 214  
AE5 4 ARG G 177  ? ILE G 178  ? ARG E 177  ILE E 178  
AE6 1 TYR I 95   ? TYR I 98   ? TYR H 95   TYR H 98   
AE6 2 TYR I 141  ? ARG I 145  ? TYR H 141  ARG H 145  
AE6 3 SER I 54   ? ALA I 60   ? SER H 54   ALA H 60   
AE6 4 THR I 4    ? ASP I 16   ? THR H 4    ASP H 16   
AE6 5 VAL I 23   ? SER I 30   ? VAL H 23   SER H 30   
AE6 6 LYS I 37   ? ASN I 43   ? LYS H 37   ASN H 43   
AE6 7 LEU I 121  ? GLY I 127  ? LEU H 121  GLY H 127  
AE6 8 ILE I 112  ? PHE I 118  ? ILE H 112  PHE H 118  
AE6 9 THR I 100  ? GLU I 105  ? THR H 100  GLU H 105  
AE7 1 TYR J 15   ? ASP J 19   ? TYR I 15   ASP I 19   
AE7 2 ARG J 24   ? GLU J 28   ? ARG I 24   GLU I 28   
AE7 3 VAL J 35   ? GLU J 37   ? VAL I 35   GLU I 37   
AE8 1 ASN J 83   ? GLN J 87   ? ASN I 83   GLN I 87   
AE8 2 LEU J 99   ? CYS J 103  ? LEU I 99   CYS I 103  
AE8 3 ILE J 109  ? THR J 111  ? ILE I 109  THR I 111  
AE9 1 LEU L 19   ? PRO L 23   ? LEU K 19   PRO K 23   
AE9 2 ALA L 30   ? GLU L 36   ? ALA K 30   GLU K 36   
AE9 3 ARG L 70   ? THR L 77   ? ARG K 70   THR K 77   
AE9 4 VAL L 56   ? LYS L 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASP D 1419 ? O ASP A 1419 N VAL D 17   ? N VAL A 17   
AA1 2 3 N GLN D 18   ? N GLN A 18   O ARG E 1215 ? O ARG B 1215 
AA2 1 2 N VAL D 90   ? N VAL A 90   O LEU D 236  ? O LEU A 236  
AA3 1 2 N ASP D 177  ? N ASP A 177  O LYS D 180  ? O LYS A 180  
AA3 2 3 N GLY D 183  ? N GLY A 183  O ARG D 200  ? O ARG A 200  
AA4 1 2 N LYS D 343  ? N LYS A 343  O PHE E 1130 ? O PHE B 1130 
AA5 1 2 O HIS E 1104 ? O HIS B 1104 N ARG D 350  ? N ARG A 350  
AA5 2 3 N THR D 351  ? N THR A 351  O MET D 487  ? O MET A 487  
AA5 3 4 O ASN D 488  ? O ASN A 488  N ASN D 445  ? N ASN A 445  
AA5 4 5 N PHE D 444  ? N PHE A 444  O MET D 456  ? O MET A 456  
AA5 5 6 O LYS D 461  ? O LYS A 461  N VAL D 364  ? N VAL A 364  
AA5 6 7 N GLY D 365  ? N GLY A 365  O ARG D 469  ? O ARG A 469  
AA5 7 8 O PHE D 468  ? O PHE A 468  N SER D 354  ? N SER A 354  
AA6 1 2 N GLU D 378  ? N GLU A 378  O VAL D 432  ? O VAL A 432  
AA6 2 3 O LYS D 431  ? O LYS A 431  N ILE D 406  ? N ILE A 406  
AA6 3 4 N VAL D 405  ? N VAL A 405  O ILE D 413  ? O ILE A 413  
AA7 1 2 N SER D 513  ? N SER A 513  O LYS D 518  ? O LYS A 518  
AA8 1 2 N ILE D 541  ? N ILE A 541  O TRP D 572  ? O TRP A 572  
AA9 1 2 N ARG D 590  ? N ARG A 590  O MET D 605  ? O MET A 605  
AA9 2 3 N LEU D 606  ? N LEU A 606  O ILE D 613  ? O ILE A 613  
AB1 1 2 N GLY D 766  ? N GLY A 766  O VAL D 800  ? O VAL A 800  
AB2 1 2 N MET D 849  ? N MET A 849  O ARG D 857  ? O ARG A 857  
AB2 2 3 N THR D 856  ? N THR A 856  O ILE D 864  ? O ILE A 864  
AB3 1 2 N GLU D 879  ? N GLU A 879  O LEU D 956  ? O LEU A 956  
AB4 1 2 N VAL D 1283 ? N VAL A 1283 O GLU D 1307 ? O GLU A 1307 
AB4 2 3 O LEU D 1306 ? O LEU A 1306 N VAL D 1118 ? N VAL A 1118 
AB4 3 4 N THR D 1117 ? N THR A 1117 O TYR D 1328 ? O TYR A 1328 
AB5 1 2 N THR D 1141 ? N THR A 1141 O LEU D 1273 ? O LEU A 1273 
AB6 1 2 N PHE D 1225 ? N PHE A 1225 O ARG D 1241 ? O ARG A 1241 
AB6 2 3 O CYS D 1240 ? O CYS A 1240 N LEU D 1193 ? N LEU A 1193 
AB6 3 4 O GLU D 1196 ? O GLU A 1196 N ILE D 1148 ? N ILE A 1148 
AB6 4 5 N ILE D 1152 ? N ILE A 1152 O VAL J 43   ? O VAL I 43   
AB7 1 2 N VAL D 1291 ? N VAL A 1291 O VAL D 1299 ? O VAL A 1299 
AB8 1 2 N MET D 1444 ? N MET A 1444 O VAL H 133  ? O VAL F 133  
AB8 2 3 N ARG H 136  ? N ARG F 136  O GLU H 144  ? O GLU F 144  
AB9 1 2 N LEU E 69   ? N LEU B 69   O ILE E 90   ? O ILE B 90   
AB9 2 3 N VAL E 102  ? N VAL B 102  O HIS E 110  ? O HIS B 110  
AC1 1 2 N LEU E 69   ? N LEU B 69   O ILE E 90   ? O ILE B 90   
AC1 2 3 N THR E 98   ? N THR B 98   O GLY E 127  ? O GLY B 127  
AC1 3 4 N LEU E 128  ? N LEU B 128  O ILE E 167  ? O ILE B 167  
AC2 1 2 N PHE E 203  ? N PHE B 203  O LYS E 210  ? O LYS B 210  
AC2 2 3 N VAL E 211  ? N VAL B 211  O GLN E 481  ? O GLN B 481  
AC3 1 2 O ASP E 407  ? O ASP B 407  N GLN E 215  ? N GLN B 215  
AC3 2 3 N ALA E 214  ? N ALA B 214  O ASN E 499  ? O ASN B 499  
AC3 3 4 N THR E 498  ? N THR B 498  O LYS E 537  ? O LYS B 537  
AC4 1 2 N PHE E 226  ? N PHE B 226  O VAL E 237  ? O VAL B 237  
AC4 2 3 N HIS E 236  ? N HIS B 236  O LEU E 258  ? O LEU B 258  
AC4 3 4 N LYS E 257  ? N LYS B 257  O LYS E 270  ? O LYS B 270  
AC4 4 5 N ALA E 271  ? N ALA B 271  O ILE E 280  ? O ILE B 280  
AC5 1 2 N CYS E 544  ? N CYS B 544  O TYR E 634  ? O TYR B 634  
AC5 2 3 N LEU E 637  ? N LEU B 637  O GLU E 691  ? O GLU B 691  
AC6 1 2 O GLU E 650  ? O GLU B 650  N GLU E 641  ? N GLU B 641  
AC6 2 3 N PHE E 638  ? N PHE B 638  O CYS E 741  ? O CYS B 741  
AC6 3 4 O HIS E 740  ? O HIS B 740  N ALA E 704  ? N ALA B 704  
AC7 1 2 N GLU E 564  ? N GLU B 564  O VAL E 589  ? O VAL B 589  
AC7 2 3 O HIS E 590  ? O HIS B 590  N THR E 578  ? N THR B 578  
AC7 3 4 N PHE E 581  ? N PHE B 581  O ILE E 626  ? O ILE B 626  
AC7 4 5 O LYS E 625  ? O LYS B 625  N ILE E 616  ? N ILE B 616  
AC8 1 2 N ILE E 795  ? N ILE B 795  O LEU E 854  ? O LEU B 854  
AC8 2 3 N ARG E 857  ? N ARG B 857  O VAL E 968  ? O VAL B 968  
AC8 3 4 O ARG E 969  ? O ARG B 969  N ILE E 948  ? N ILE B 948  
AC8 4 5 O GLY E 947  ? O GLY B 947  N VAL E 905  ? N VAL B 905  
AC9 1 2 N ILE E 795  ? N ILE B 795  O LEU E 854  ? O LEU B 854  
AC9 2 3 N ARG E 857  ? N ARG B 857  O VAL E 968  ? O VAL B 968  
AC9 3 4 O ARG E 969  ? O ARG B 969  N ILE E 948  ? N ILE B 948  
AC9 4 5 N VAL E 954  ? N VAL B 954  O LEU M 56   ? O LEU L 56   
AC9 5 6 O LEU M 57   ? O LEU L 57   N ILE M 30   ? N ILE L 30   
AC9 6 7 N TYR M 29   ? N TYR L 29   O LEU M 38   ? O LEU L 38   
AD1 1 2 N THR E 805  ? N THR B 805  O GLY E 1042 ? O GLY B 1042 
AD2 1 2 N GLU E 1070 ? N GLU B 1070 O ILE E 1085 ? O ILE B 1085 
AD2 2 3 O GLN E 1093 ? O GLN B 1093 N ALA E 981  ? N ALA B 981  
AD2 3 4 N PHE E 980  ? N PHE B 980  O GLY E 988  ? O GLY B 988  
AD2 4 5 O GLY E 991  ? O GLY B 991  N MET E 839  ? N MET B 839  
AD2 5 6 N ILE E 840  ? N ILE B 840  O ILE E 1011 ? O ILE B 1011 
AD2 6 7 O LEU E 1010 ? O LEU B 1010 N ALA E 826  ? N ALA B 826  
AD2 7 8 N GLN E 821  ? N GLN B 821  O TYR E 1092 ? O TYR B 1092 
AD3 1 2 N TYR E 866  ? N TYR B 866  O ILE E 870  ? O ILE B 870  
AD4 1 2 N THR E 873  ? N THR B 873  O THR E 915  ? O THR B 915  
AD4 2 3 N THR E 916  ? N THR B 916  O ARG E 935  ? O ARG B 935  
AD4 3 4 O ASP E 936  ? O ASP B 936  N LEU E 883  ? N LEU B 883  
AD5 1 2 N ILE E 912  ? N ILE B 912  O THR E 939  ? O THR B 939  
AD6 1 2 N PHE E 1001 ? N PHE B 1001 O TYR E 1073 ? O TYR B 1073 
AD7 1 2 N ILE E 1162 ? N ILE B 1162 O TYR E 1192 ? O TYR B 1192 
AD8 1 2 N LYS E 1174 ? N LYS B 1174 O GLN E 1179 ? O GLN B 1179 
AD9 1 2 N GLN F 7    ? N GLN C 7    O SER F 23   ? O SER C 23   
AD9 2 3 N PHE F 20   ? N PHE C 20   O MET F 230  ? O MET C 230  
AD9 3 4 O ASN F 231  ? O ASN C 231  N GLU F 177  ? N GLU C 177  
AE1 1 2 O VAL F 119  ? O VAL C 119  N THR F 100  ? N THR C 100  
AE1 2 3 N VAL F 97   ? N VAL C 97   O ALA F 159  ? O ALA C 159  
AE1 3 4 O THR F 156  ? O THR C 156  N GLU F 50   ? N GLU C 50   
AE1 4 5 N VAL F 49   ? N VAL C 49   O PHE M 67   ? O PHE L 67   
AE2 1 2 N GLN F 73   ? N GLN C 73   O GLY F 130  ? O GLY C 130  
AE3 1 2 N VAL F 113  ? N VAL C 113  O CYS F 145  ? O CYS C 145  
AE4 1 2 N ALA G 62   ? N ALA E 62   O LEU G 78   ? O LEU E 78   
AE4 2 3 N GLU G 81   ? N GLU E 81   O ILE G 109  ? O ILE E 109  
AE4 3 4 N GLY G 108  ? N GLY E 108  O THR G 131  ? O THR E 131  
AE5 1 2 N LYS G 152  ? N LYS E 152  O ILE G 199  ? O ILE E 199  
AE5 2 3 N ILE G 198  ? N ILE E 198  O SER G 210  ? O SER E 210  
AE5 3 4 O ILE G 213  ? O ILE E 213  N ILE G 178  ? N ILE E 178  
AE6 1 2 N MET I 97   ? N MET H 97   O LEU I 142  ? O LEU H 142  
AE6 2 3 O LEU I 143  ? O LEU H 143  N THR I 58   ? N THR H 58   
AE6 3 4 O LEU I 55   ? O LEU H 55   N PHE I 10   ? N PHE H 10   
AE6 4 5 N SER I 13   ? N SER H 13   O GLU I 27   ? O GLU H 27   
AE6 5 6 N ALA I 28   ? N ALA H 28   O LEU I 38   ? O LEU H 38   
AE6 6 7 N THR I 39   ? N THR H 39   O ARG I 124  ? O ARG H 124  
AE6 7 8 O LEU I 121  ? O LEU H 121  N PHE I 118  ? N PHE H 118  
AE6 8 9 O ALA I 113  ? O ALA H 113  N GLU I 105  ? N GLU H 105  
AE7 1 2 N ARG J 17   ? N ARG I 17   O LEU J 26   ? O LEU I 26   
AE7 2 3 N PHE J 27   ? N PHE I 27   O GLU J 36   ? O GLU I 36   
AE8 1 2 N PHE J 86   ? N PHE I 86   O PHE J 100  ? O PHE I 100  
AE8 2 3 N PHE J 101  ? N PHE I 101  O PHE J 110  ? O PHE I 110  
AE9 1 2 N ASP L 22   ? N ASP K 22   O VAL L 32   ? O VAL K 32   
AE9 2 3 N PHE L 35   ? N PHE K 35   O PHE L 71   ? O PHE K 71   
AE9 3 4 O GLN L 76   ? O GLN K 76   N LEU L 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1801 ? 4 'binding site for residue ZN A 1801' 
AC2 Software A ZN 1802 ? 4 'binding site for residue ZN A 1802' 
AC3 Software A MG 1803 ? 3 'binding site for residue MG A 1803' 
AC4 Software B ZN 1301 ? 4 'binding site for residue ZN B 1301' 
AC5 Software C ZN 401  ? 4 'binding site for residue ZN C 401'  
AC6 Software I ZN 201  ? 4 'binding site for residue ZN I 201'  
AC7 Software I ZN 202  ? 4 'binding site for residue ZN I 202'  
AC8 Software J ZN 101  ? 4 'binding site for residue ZN J 101'  
AC9 Software L ZN 101  ? 5 'binding site for residue ZN L 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS D 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4 HIS D 109  ? HIS A 109  . ? 1_555 ? 
3  AC1 4 CYS D 110  ? CYS A 110  . ? 1_555 ? 
4  AC1 4 CYS D 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 4 CYS D 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 4 CYS D 70   ? CYS A 70   . ? 1_555 ? 
7  AC2 4 CYS D 77   ? CYS A 77   . ? 1_555 ? 
8  AC2 4 HIS D 80   ? HIS A 80   . ? 1_555 ? 
9  AC3 3 ASP D 483  ? ASP A 483  . ? 1_555 ? 
10 AC3 3 ASP D 485  ? ASP A 485  . ? 1_555 ? 
11 AC3 3 G   A 9    ? G   R 9    . ? 1_555 ? 
12 AC4 4 CYS E 1163 ? CYS B 1163 . ? 1_555 ? 
13 AC4 4 CYS E 1166 ? CYS B 1166 . ? 1_555 ? 
14 AC4 4 CYS E 1182 ? CYS B 1182 . ? 1_555 ? 
15 AC4 4 CYS E 1185 ? CYS B 1185 . ? 1_555 ? 
16 AC5 4 CYS F 86   ? CYS C 86   . ? 1_555 ? 
17 AC5 4 CYS F 88   ? CYS C 88   . ? 1_555 ? 
18 AC5 4 CYS F 92   ? CYS C 92   . ? 1_555 ? 
19 AC5 4 CYS F 95   ? CYS C 95   . ? 1_555 ? 
20 AC6 4 CYS J 7    ? CYS I 7    . ? 1_555 ? 
21 AC6 4 CYS J 10   ? CYS I 10   . ? 1_555 ? 
22 AC6 4 CYS J 29   ? CYS I 29   . ? 1_555 ? 
23 AC6 4 CYS J 32   ? CYS I 32   . ? 1_555 ? 
24 AC7 4 CYS J 75   ? CYS I 75   . ? 1_555 ? 
25 AC7 4 CYS J 78   ? CYS I 78   . ? 1_555 ? 
26 AC7 4 CYS J 103  ? CYS I 103  . ? 1_555 ? 
27 AC7 4 CYS J 106  ? CYS I 106  . ? 1_555 ? 
28 AC8 4 CYS K 7    ? CYS J 7    . ? 1_555 ? 
29 AC8 4 CYS K 10   ? CYS J 10   . ? 1_555 ? 
30 AC8 4 CYS K 45   ? CYS J 45   . ? 1_555 ? 
31 AC8 4 CYS K 46   ? CYS J 46   . ? 1_555 ? 
32 AC9 5 CYS M 31   ? CYS L 31   . ? 1_555 ? 
33 AC9 5 CYS M 34   ? CYS L 34   . ? 1_555 ? 
34 AC9 5 SER M 36   ? SER L 36   . ? 1_555 ? 
35 AC9 5 CYS M 48   ? CYS L 48   . ? 1_555 ? 
36 AC9 5 CYS M 51   ? CYS L 51   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UPX 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005918 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001153 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004478 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005276 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  OP3   . A   A 1  1    ? 25.255  8.534   27.322  1.00 237.56 ? 1    A   R OP3   1 
ATOM   2     P  P     . A   A 1  1    ? 24.067  9.367   27.029  1.00 238.60 ? 1    A   R P     1 
ATOM   3     O  OP1   . A   A 1  1    ? 22.913  8.820   27.787  1.00 236.91 ? 1    A   R OP1   1 
ATOM   4     O  OP2   . A   A 1  1    ? 23.962  9.483   25.552  1.00 243.01 ? 1    A   R OP2   1 
ATOM   5     O  "O5'" . A   A 1  1    ? 24.347  10.829  27.597  1.00 231.28 ? 1    A   R "O5'" 1 
ATOM   6     C  "C5'" . A   A 1  1    ? 24.209  11.116  28.982  1.00 215.52 ? 1    A   R "C5'" 1 
ATOM   7     C  "C4'" . A   A 1  1    ? 24.840  12.441  29.336  1.00 199.60 ? 1    A   R "C4'" 1 
ATOM   8     O  "O4'" . A   A 1  1    ? 24.477  13.431  28.341  1.00 194.42 ? 1    A   R "O4'" 1 
ATOM   9     C  "C3'" . A   A 1  1    ? 24.404  13.055  30.660  1.00 186.65 ? 1    A   R "C3'" 1 
ATOM   10    O  "O3'" . A   A 1  1    ? 25.123  12.532  31.766  1.00 172.29 ? 1    A   R "O3'" 1 
ATOM   11    C  "C2'" . A   A 1  1    ? 24.633  14.547  30.438  1.00 189.88 ? 1    A   R "C2'" 1 
ATOM   12    O  "O2'" . A   A 1  1    ? 25.999  14.886  30.640  1.00 190.45 ? 1    A   R "O2'" 1 
ATOM   13    C  "C1'" . A   A 1  1    ? 24.314  14.694  28.948  1.00 191.12 ? 1    A   R "C1'" 1 
ATOM   14    N  N9    . A   A 1  1    ? 22.938  15.169  28.686  1.00 185.62 ? 1    A   R N9    1 
ATOM   15    C  C8    . A   A 1  1    ? 21.918  14.469  28.087  1.00 183.21 ? 1    A   R C8    1 
ATOM   16    N  N7    . A   A 1  1    ? 20.803  15.147  27.962  1.00 180.85 ? 1    A   R N7    1 
ATOM   17    C  C5    . A   A 1  1    ? 21.105  16.387  28.506  1.00 180.99 ? 1    A   R C5    1 
ATOM   18    C  C6    . A   A 1  1    ? 20.346  17.561  28.675  1.00 179.01 ? 1    A   R C6    1 
ATOM   19    N  N6    . A   A 1  1    ? 19.069  17.682  28.298  1.00 170.99 ? 1    A   R N6    1 
ATOM   20    N  N1    . A   A 1  1    ? 20.950  18.624  29.254  1.00 182.15 ? 1    A   R N1    1 
ATOM   21    C  C2    . A   A 1  1    ? 22.230  18.510  29.635  1.00 183.77 ? 1    A   R C2    1 
ATOM   22    N  N3    . A   A 1  1    ? 23.044  17.460  29.528  1.00 184.69 ? 1    A   R N3    1 
ATOM   23    C  C4    . A   A 1  1    ? 22.418  16.419  28.948  1.00 183.49 ? 1    A   R C4    1 
ATOM   24    P  P     . U   A 1  2    ? 24.477  12.521  33.240  1.00 158.26 ? 2    U   R P     1 
ATOM   25    O  OP1   . U   A 1  2    ? 25.366  11.712  34.110  1.00 169.99 ? 2    U   R OP1   1 
ATOM   26    O  OP2   . U   A 1  2    ? 23.046  12.140  33.121  1.00 145.72 ? 2    U   R OP2   1 
ATOM   27    O  "O5'" . U   A 1  2    ? 24.573  14.038  33.731  1.00 159.84 ? 2    U   R "O5'" 1 
ATOM   28    C  "C5'" . U   A 1  2    ? 25.827  14.637  34.037  1.00 161.60 ? 2    U   R "C5'" 1 
ATOM   29    C  "C4'" . U   A 1  2    ? 25.665  16.075  34.474  1.00 163.38 ? 2    U   R "C4'" 1 
ATOM   30    O  "O4'" . U   A 1  2    ? 25.109  16.856  33.380  1.00 163.57 ? 2    U   R "O4'" 1 
ATOM   31    C  "C3'" . U   A 1  2    ? 24.703  16.317  35.630  1.00 161.10 ? 2    U   R "C3'" 1 
ATOM   32    O  "O3'" . U   A 1  2    ? 25.287  16.088  36.904  1.00 162.40 ? 2    U   R "O3'" 1 
ATOM   33    C  "C2'" . U   A 1  2    ? 24.261  17.761  35.407  1.00 152.17 ? 2    U   R "C2'" 1 
ATOM   34    O  "O2'" . U   A 1  2    ? 25.234  18.676  35.889  1.00 139.75 ? 2    U   R "O2'" 1 
ATOM   35    C  "C1'" . U   A 1  2    ? 24.232  17.846  33.883  1.00 160.53 ? 2    U   R "C1'" 1 
ATOM   36    N  N1    . U   A 1  2    ? 22.877  17.625  33.312  1.00 166.22 ? 2    U   R N1    1 
ATOM   37    C  C2    . U   A 1  2    ? 21.921  18.637  33.334  1.00 160.56 ? 2    U   R C2    1 
ATOM   38    O  O2    . U   A 1  2    ? 22.111  19.737  33.829  1.00 151.26 ? 2    U   R O2    1 
ATOM   39    N  N3    . U   A 1  2    ? 20.713  18.297  32.753  1.00 166.33 ? 2    U   R N3    1 
ATOM   40    C  C4    . U   A 1  2    ? 20.370  17.092  32.159  1.00 173.99 ? 2    U   R C4    1 
ATOM   41    O  O4    . U   A 1  2    ? 19.255  16.904  31.672  1.00 179.57 ? 2    U   R O4    1 
ATOM   42    C  C5    . U   A 1  2    ? 21.405  16.115  32.173  1.00 172.85 ? 2    U   R C5    1 
ATOM   43    C  C6    . U   A 1  2    ? 22.579  16.416  32.726  1.00 172.55 ? 2    U   R C6    1 
ATOM   44    P  P     . C   A 1  3    ? 24.383  15.583  38.139  1.00 158.16 ? 3    C   R P     1 
ATOM   45    O  OP1   . C   A 1  3    ? 25.279  15.377  39.304  1.00 163.99 ? 3    C   R OP1   1 
ATOM   46    O  OP2   . C   A 1  3    ? 23.526  14.464  37.668  1.00 159.77 ? 3    C   R OP2   1 
ATOM   47    O  "O5'" . C   A 1  3    ? 23.446  16.827  38.482  1.00 141.96 ? 3    C   R "O5'" 1 
ATOM   48    C  "C5'" . C   A 1  3    ? 23.992  18.022  39.023  1.00 131.46 ? 3    C   R "C5'" 1 
ATOM   49    C  "C4'" . C   A 1  3    ? 22.999  19.158  38.995  1.00 131.39 ? 3    C   R "C4'" 1 
ATOM   50    O  "O4'" . C   A 1  3    ? 22.582  19.432  37.627  1.00 139.53 ? 3    C   R "O4'" 1 
ATOM   51    C  "C3'" . C   A 1  3    ? 21.690  18.924  39.727  1.00 131.32 ? 3    C   R "C3'" 1 
ATOM   52    O  "O3'" . C   A 1  3    ? 21.793  19.058  41.135  1.00 128.73 ? 3    C   R "O3'" 1 
ATOM   53    C  "C2'" . C   A 1  3    ? 20.764  19.940  39.068  1.00 133.36 ? 3    C   R "C2'" 1 
ATOM   54    O  "O2'" . C   A 1  3    ? 20.997  21.249  39.569  1.00 124.35 ? 3    C   R "O2'" 1 
ATOM   55    C  "C1'" . C   A 1  3    ? 21.239  19.884  37.615  1.00 141.24 ? 3    C   R "C1'" 1 
ATOM   56    N  N1    . C   A 1  3    ? 20.412  18.959  36.794  1.00 146.31 ? 3    C   R N1    1 
ATOM   57    C  C2    . C   A 1  3    ? 19.143  19.351  36.329  1.00 149.19 ? 3    C   R C2    1 
ATOM   58    O  O2    . C   A 1  3    ? 18.712  20.479  36.609  1.00 153.12 ? 3    C   R O2    1 
ATOM   59    N  N3    . C   A 1  3    ? 18.408  18.477  35.588  1.00 150.98 ? 3    C   R N3    1 
ATOM   60    C  C4    . C   A 1  3    ? 18.885  17.263  35.295  1.00 146.90 ? 3    C   R C4    1 
ATOM   61    N  N4    . C   A 1  3    ? 18.150  16.419  34.566  1.00 139.90 ? 3    C   R N4    1 
ATOM   62    C  C5    . C   A 1  3    ? 20.162  16.842  35.750  1.00 148.74 ? 3    C   R C5    1 
ATOM   63    C  C6    . C   A 1  3    ? 20.870  17.709  36.480  1.00 149.46 ? 3    C   R C6    1 
ATOM   64    P  P     . G   A 1  4    ? 20.932  18.096  42.099  1.00 127.93 ? 4    G   R P     1 
ATOM   65    O  OP1   . G   A 1  4    ? 21.343  18.355  43.501  1.00 141.37 ? 4    G   R OP1   1 
ATOM   66    O  OP2   . G   A 1  4    ? 21.018  16.708  41.575  1.00 129.02 ? 4    G   R OP2   1 
ATOM   67    O  "O5'" . G   A 1  4    ? 19.435  18.625  41.934  1.00 124.42 ? 4    G   R "O5'" 1 
ATOM   68    C  "C5'" . G   A 1  4    ? 19.102  19.964  42.277  1.00 122.80 ? 4    G   R "C5'" 1 
ATOM   69    C  "C4'" . G   A 1  4    ? 17.781  20.394  41.684  1.00 119.46 ? 4    G   R "C4'" 1 
ATOM   70    O  "O4'" . G   A 1  4    ? 17.821  20.336  40.233  1.00 111.49 ? 4    G   R "O4'" 1 
ATOM   71    C  "C3'" . G   A 1  4    ? 16.574  19.548  42.045  1.00 121.32 ? 4    G   R "C3'" 1 
ATOM   72    O  "O3'" . G   A 1  4    ? 16.083  19.815  43.347  1.00 127.44 ? 4    G   R "O3'" 1 
ATOM   73    C  "C2'" . G   A 1  4    ? 15.591  19.891  40.929  1.00 118.28 ? 4    G   R "C2'" 1 
ATOM   74    O  "O2'" . G   A 1  4    ? 14.966  21.144  41.163  1.00 127.70 ? 4    G   R "O2'" 1 
ATOM   75    C  "C1'" . G   A 1  4    ? 16.532  20.039  39.729  1.00 110.14 ? 4    G   R "C1'" 1 
ATOM   76    N  N9    . G   A 1  4    ? 16.583  18.800  38.924  1.00 109.10 ? 4    G   R N9    1 
ATOM   77    C  C8    . G   A 1  4    ? 17.600  17.882  38.814  1.00 119.85 ? 4    G   R C8    1 
ATOM   78    N  N7    . G   A 1  4    ? 17.307  16.883  38.020  1.00 126.79 ? 4    G   R N7    1 
ATOM   79    C  C5    . G   A 1  4    ? 16.015  17.146  37.577  1.00 122.75 ? 4    G   R C5    1 
ATOM   80    C  C6    . G   A 1  4    ? 15.154  16.426  36.698  1.00 113.03 ? 4    G   R C6    1 
ATOM   81    O  O6    . G   A 1  4    ? 15.360  15.361  36.100  1.00 104.45 ? 4    G   R O6    1 
ATOM   82    N  N1    . G   A 1  4    ? 13.928  17.071  36.535  1.00 115.02 ? 4    G   R N1    1 
ATOM   83    C  C2    . G   A 1  4    ? 13.567  18.253  37.134  1.00 118.81 ? 4    G   R C2    1 
ATOM   84    N  N2    . G   A 1  4    ? 12.341  18.737  36.872  1.00 112.26 ? 4    G   R N2    1 
ATOM   85    N  N3    . G   A 1  4    ? 14.362  18.922  37.952  1.00 124.04 ? 4    G   R N3    1 
ATOM   86    C  C4    . G   A 1  4    ? 15.559  18.324  38.131  1.00 118.54 ? 4    G   R C4    1 
ATOM   87    P  P     . A   A 1  5    ? 15.354  18.654  44.187  1.00 123.78 ? 5    A   R P     1 
ATOM   88    O  OP1   . A   A 1  5    ? 15.336  19.076  45.614  1.00 126.66 ? 5    A   R OP1   1 
ATOM   89    O  OP2   . A   A 1  5    ? 15.971  17.354  43.812  1.00 137.12 ? 5    A   R OP2   1 
ATOM   90    O  "O5'" . A   A 1  5    ? 13.851  18.685  43.653  1.00 101.01 ? 5    A   R "O5'" 1 
ATOM   91    C  "C5'" . A   A 1  5    ? 13.127  19.904  43.649  1.00 100.00 ? 5    A   R "C5'" 1 
ATOM   92    C  "C4'" . A   A 1  5    ? 11.909  19.842  42.764  1.00 100.19 ? 5    A   R "C4'" 1 
ATOM   93    O  "O4'" . A   A 1  5    ? 12.295  19.666  41.376  1.00 98.54  ? 5    A   R "O4'" 1 
ATOM   94    C  "C3'" . A   A 1  5    ? 10.953  18.696  43.035  1.00 91.05  ? 5    A   R "C3'" 1 
ATOM   95    O  "O3'" . A   A 1  5    ? 10.097  18.965  44.126  1.00 90.62  ? 5    A   R "O3'" 1 
ATOM   96    C  "C2'" . A   A 1  5    ? 10.223  18.539  41.705  1.00 95.60  ? 5    A   R "C2'" 1 
ATOM   97    O  "O2'" . A   A 1  5    ? 9.181   19.497  41.574  1.00 84.32  ? 5    A   R "O2'" 1 
ATOM   98    C  "C1'" . A   A 1  5    ? 11.331  18.880  40.704  1.00 108.80 ? 5    A   R "C1'" 1 
ATOM   99    N  N9    . A   A 1  5    ? 11.998  17.677  40.169  1.00 119.42 ? 5    A   R N9    1 
ATOM   100   C  C8    . A   A 1  5    ? 13.282  17.255  40.415  1.00 117.54 ? 5    A   R C8    1 
ATOM   101   N  N7    . A   A 1  5    ? 13.612  16.148  39.796  1.00 116.48 ? 5    A   R N7    1 
ATOM   102   C  C5    . A   A 1  5    ? 12.465  15.812  39.093  1.00 117.58 ? 5    A   R C5    1 
ATOM   103   C  C6    . A   A 1  5    ? 12.167  14.742  38.236  1.00 116.55 ? 5    A   R C6    1 
ATOM   104   N  N6    . A   A 1  5    ? 13.038  13.776  37.942  1.00 110.97 ? 5    A   R N6    1 
ATOM   105   N  N1    . A   A 1  5    ? 10.932  14.698  37.692  1.00 120.57 ? 5    A   R N1    1 
ATOM   106   C  C2    . A   A 1  5    ? 10.055  15.672  37.983  1.00 113.37 ? 5    A   R C2    1 
ATOM   107   N  N3    . A   A 1  5    ? 10.223  16.729  38.778  1.00 102.47 ? 5    A   R N3    1 
ATOM   108   C  C4    . A   A 1  5    ? 11.463  16.744  39.306  1.00 115.29 ? 5    A   R C4    1 
ATOM   109   P  P     . G   A 1  6    ? 9.700   17.785  45.132  1.00 106.31 ? 6    G   R P     1 
ATOM   110   O  OP1   . G   A 1  6    ? 9.153   18.403  46.369  1.00 114.58 ? 6    G   R OP1   1 
ATOM   111   O  OP2   . G   A 1  6    ? 10.857  16.851  45.214  1.00 128.08 ? 6    G   R OP2   1 
ATOM   112   O  "O5'" . G   A 1  6    ? 8.501   17.046  44.387  1.00 107.56 ? 6    G   R "O5'" 1 
ATOM   113   C  "C5'" . G   A 1  6    ? 7.336   17.768  44.018  1.00 92.88  ? 6    G   R "C5'" 1 
ATOM   114   C  "C4'" . G   A 1  6    ? 6.530   17.031  42.980  1.00 89.61  ? 6    G   R "C4'" 1 
ATOM   115   O  "O4'" . G   A 1  6    ? 7.295   16.908  41.753  1.00 98.23  ? 6    G   R "O4'" 1 
ATOM   116   C  "C3'" . G   A 1  6    ? 6.134   15.599  43.309  1.00 71.90  ? 6    G   R "C3'" 1 
ATOM   117   O  "O3'" . G   A 1  6    ? 5.008   15.517  44.168  1.00 87.06  ? 6    G   R "O3'" 1 
ATOM   118   C  "C2'" . G   A 1  6    ? 5.876   15.007  41.931  1.00 74.41  ? 6    G   R "C2'" 1 
ATOM   119   O  "O2'" . G   A 1  6    ? 4.596   15.392  41.452  1.00 86.90  ? 6    G   R "O2'" 1 
ATOM   120   C  "C1'" . G   A 1  6    ? 6.941   15.714  41.086  1.00 91.86  ? 6    G   R "C1'" 1 
ATOM   121   N  N9    . G   A 1  6    ? 8.147   14.884  40.906  1.00 113.62 ? 6    G   R N9    1 
ATOM   122   C  C8    . G   A 1  6    ? 9.400   15.085  41.430  1.00 126.46 ? 6    G   R C8    1 
ATOM   123   N  N7    . G   A 1  6    ? 10.259  14.163  41.082  1.00 133.57 ? 6    G   R N7    1 
ATOM   124   C  C5    . G   A 1  6    ? 9.526   13.295  40.282  1.00 127.99 ? 6    G   R C5    1 
ATOM   125   C  C6    . G   A 1  6    ? 9.911   12.109  39.607  1.00 133.35 ? 6    G   R C6    1 
ATOM   126   O  O6    . G   A 1  6    ? 11.022  11.565  39.591  1.00 130.90 ? 6    G   R O6    1 
ATOM   127   N  N1    . G   A 1  6    ? 8.845   11.549  38.905  1.00 140.34 ? 6    G   R N1    1 
ATOM   128   C  C2    . G   A 1  6    ? 7.569   12.062  38.848  1.00 137.66 ? 6    G   R C2    1 
ATOM   129   N  N2    . G   A 1  6    ? 6.658   11.395  38.120  1.00 141.24 ? 6    G   R N2    1 
ATOM   130   N  N3    . G   A 1  6    ? 7.210   13.169  39.471  1.00 131.89 ? 6    G   R N3    1 
ATOM   131   C  C4    . G   A 1  6    ? 8.225   13.730  40.160  1.00 124.75 ? 6    G   R C4    1 
ATOM   132   P  P     . A   A 1  7    ? 4.872   14.305  45.219  1.00 118.85 ? 7    A   R P     1 
ATOM   133   O  OP1   . A   A 1  7    ? 3.655   14.540  46.040  1.00 120.93 ? 7    A   R OP1   1 
ATOM   134   O  OP2   . A   A 1  7    ? 6.183   14.134  45.900  1.00 128.33 ? 7    A   R OP2   1 
ATOM   135   O  "O5'" . A   A 1  7    ? 4.601   13.021  44.309  1.00 118.49 ? 7    A   R "O5'" 1 
ATOM   136   C  "C5'" . A   A 1  7    ? 3.372   12.868  43.610  1.00 107.41 ? 7    A   R "C5'" 1 
ATOM   137   C  "C4'" . A   A 1  7    ? 3.438   11.766  42.577  1.00 100.97 ? 7    A   R "C4'" 1 
ATOM   138   O  "O4'" . A   A 1  7    ? 4.577   11.968  41.703  1.00 93.50  ? 7    A   R "O4'" 1 
ATOM   139   C  "C3'" . A   A 1  7    ? 3.627   10.349  43.096  1.00 97.79  ? 7    A   R "C3'" 1 
ATOM   140   O  "O3'" . A   A 1  7    ? 2.431   9.774   43.594  1.00 105.96 ? 7    A   R "O3'" 1 
ATOM   141   C  "C2'" . A   A 1  7    ? 4.204   9.621   41.880  1.00 83.54  ? 7    A   R "C2'" 1 
ATOM   142   O  "O2'" . A   A 1  7    ? 3.189   9.255   40.954  1.00 90.01  ? 7    A   R "O2'" 1 
ATOM   143   C  "C1'" . A   A 1  7    ? 5.051   10.719  41.236  1.00 79.53  ? 7    A   R "C1'" 1 
ATOM   144   N  N9    . A   A 1  7    ? 6.485   10.582  41.546  1.00 87.66  ? 7    A   R N9    1 
ATOM   145   C  C8    . A   A 1  7    ? 7.297   11.388  42.302  1.00 105.32 ? 7    A   R C8    1 
ATOM   146   N  N7    . A   A 1  7    ? 8.541   10.973  42.365  1.00 115.12 ? 7    A   R N7    1 
ATOM   147   C  C5    . A   A 1  7    ? 8.549   9.818   41.599  1.00 106.74 ? 7    A   R C5    1 
ATOM   148   C  C6    . A   A 1  7    ? 9.559   8.900   41.260  1.00 107.70 ? 7    A   R C6    1 
ATOM   149   N  N6    . A   A 1  7    ? 10.826  8.997   41.672  1.00 120.26 ? 7    A   R N6    1 
ATOM   150   N  N1    . A   A 1  7    ? 9.219   7.856   40.472  1.00 104.74 ? 7    A   R N1    1 
ATOM   151   C  C2    . A   A 1  7    ? 7.952   7.749   40.056  1.00 110.85 ? 7    A   R C2    1 
ATOM   152   N  N3    . A   A 1  7    ? 6.923   8.549   40.302  1.00 113.36 ? 7    A   R N3    1 
ATOM   153   C  C4    . A   A 1  7    ? 7.291   9.572   41.088  1.00 102.35 ? 7    A   R C4    1 
ATOM   154   P  P     . G   A 1  8    ? 2.491   8.565   44.652  1.00 103.52 ? 8    G   R P     1 
ATOM   155   O  OP1   . G   A 1  8    ? 1.125   8.414   45.222  1.00 100.44 ? 8    G   R OP1   1 
ATOM   156   O  OP2   . G   A 1  8    ? 3.667   8.760   45.547  1.00 120.43 ? 8    G   R OP2   1 
ATOM   157   O  "O5'" . G   A 1  8    ? 2.786   7.279   43.761  1.00 110.17 ? 8    G   R "O5'" 1 
ATOM   158   C  "C5'" . G   A 1  8    ? 1.886   6.875   42.741  1.00 95.96  ? 8    G   R "C5'" 1 
ATOM   159   C  "C4'" . G   A 1  8    ? 2.403   5.658   42.029  1.00 75.35  ? 8    G   R "C4'" 1 
ATOM   160   O  "O4'" . G   A 1  8    ? 3.636   5.980   41.345  1.00 71.66  ? 8    G   R "O4'" 1 
ATOM   161   C  "C3'" . G   A 1  8    ? 2.765   4.497   42.934  1.00 75.26  ? 8    G   R "C3'" 1 
ATOM   162   O  "O3'" . G   A 1  8    ? 1.638   3.712   43.245  1.00 90.10  ? 8    G   R "O3'" 1 
ATOM   163   C  "C2'" . G   A 1  8    ? 3.833   3.745   42.144  1.00 72.84  ? 8    G   R "C2'" 1 
ATOM   164   O  "O2'" . G   A 1  8    ? 3.242   2.859   41.202  1.00 73.76  ? 8    G   R "O2'" 1 
ATOM   165   C  "C1'" . G   A 1  8    ? 4.520   4.879   41.386  1.00 72.74  ? 8    G   R "C1'" 1 
ATOM   166   N  N9    . G   A 1  8    ? 5.786   5.316   42.004  1.00 82.96  ? 8    G   R N9    1 
ATOM   167   C  C8    . G   A 1  8    ? 6.006   6.447   42.755  1.00 89.72  ? 8    G   R C8    1 
ATOM   168   N  N7    . G   A 1  8    ? 7.249   6.576   43.137  1.00 95.81  ? 8    G   R N7    1 
ATOM   169   C  C5    . G   A 1  8    ? 7.891   5.469   42.596  1.00 90.36  ? 8    G   R C5    1 
ATOM   170   C  C6    . G   A 1  8    ? 9.246   5.061   42.664  1.00 89.98  ? 8    G   R C6    1 
ATOM   171   O  O6    . G   A 1  8    ? 10.192  5.611   43.239  1.00 96.21  ? 8    G   R O6    1 
ATOM   172   N  N1    . G   A 1  8    ? 9.450   3.874   41.967  1.00 83.93  ? 8    G   R N1    1 
ATOM   173   C  C2    . G   A 1  8    ? 8.483   3.161   41.294  1.00 100.36 ? 8    G   R C2    1 
ATOM   174   N  N2    . G   A 1  8    ? 8.867   2.036   40.667  1.00 109.85 ? 8    G   R N2    1 
ATOM   175   N  N3    . G   A 1  8    ? 7.220   3.543   41.219  1.00 100.79 ? 8    G   R N3    1 
ATOM   176   C  C4    . G   A 1  8    ? 7.001   4.689   41.889  1.00 91.66  ? 8    G   R C4    1 
ATOM   177   P  P     . G   A 1  9    ? 1.387   3.264   44.758  1.00 91.83  ? 9    G   R P     1 
ATOM   178   O  OP1   . G   A 1  9    ? 0.106   3.901   45.187  1.00 88.85  ? 9    G   R OP1   1 
ATOM   179   O  OP2   . G   A 1  9    ? 2.638   3.552   45.518  1.00 119.91 ? 9    G   R OP2   1 
ATOM   180   O  "O5'" . G   A 1  9    ? 1.225   1.677   44.651  1.00 102.82 ? 9    G   R "O5'" 1 
ATOM   181   C  "C5'" . G   A 1  9    ? 1.985   0.805   45.480  1.00 97.59  ? 9    G   R "C5'" 1 
ATOM   182   C  "C4'" . G   A 1  9    ? 3.045   0.063   44.700  1.00 84.13  ? 9    G   R "C4'" 1 
ATOM   183   O  "O4'" . G   A 1  9    ? 3.862   1.011   43.959  1.00 74.13  ? 9    G   R "O4'" 1 
ATOM   184   C  "C3'" . G   A 1  9    ? 4.053   -0.710  45.539  1.00 94.22  ? 9    G   R "C3'" 1 
ATOM   185   O  "O3'" . G   A 1  9    ? 3.578   -1.969  45.985  1.00 130.99 ? 9    G   R "O3'" 1 
ATOM   186   C  "C2'" . G   A 1  9    ? 5.261   -0.799  44.617  1.00 91.28  ? 9    G   R "C2'" 1 
ATOM   187   O  "O2'" . G   A 1  9    ? 5.103   -1.823  43.648  1.00 97.60  ? 9    G   R "O2'" 1 
ATOM   188   C  "C1'" . G   A 1  9    ? 5.203   0.554   43.904  1.00 93.88  ? 9    G   R "C1'" 1 
ATOM   189   N  N9    . G   A 1  9    ? 6.097   1.547   44.542  1.00 95.87  ? 9    G   R N9    1 
ATOM   190   C  C8    . G   A 1  9    ? 5.764   2.724   45.176  1.00 96.18  ? 9    G   R C8    1 
ATOM   191   N  N7    . G   A 1  9    ? 6.800   3.376   45.641  1.00 92.10  ? 9    G   R N7    1 
ATOM   192   C  C5    . G   A 1  9    ? 7.887   2.583   45.294  1.00 95.53  ? 9    G   R C5    1 
ATOM   193   C  C6    . G   A 1  9    ? 9.277   2.762   45.524  1.00 94.39  ? 9    G   R C6    1 
ATOM   194   O  O6    . G   A 1  9    ? 9.842   3.698   46.103  1.00 92.42  ? 9    G   R O6    1 
ATOM   195   N  N1    . G   A 1  9    ? 10.030  1.710   45.001  1.00 91.11  ? 9    G   R N1    1 
ATOM   196   C  C2    . G   A 1  9    ? 9.524   0.617   44.339  1.00 90.87  ? 9    G   R C2    1 
ATOM   197   N  N2    . G   A 1  9    ? 10.398  -0.307  43.899  1.00 79.36  ? 9    G   R N2    1 
ATOM   198   N  N3    . G   A 1  9    ? 8.233   0.452   44.123  1.00 89.96  ? 9    G   R N3    1 
ATOM   199   C  C4    . G   A 1  9    ? 7.474   1.454   44.619  1.00 94.43  ? 9    G   R C4    1 
ATOM   200   P  P     . DT  B 2  3    ? 59.944  20.148  93.285  1.00 221.26 ? 3    DT  T P     1 
ATOM   201   O  OP1   . DT  B 2  3    ? 58.475  20.130  93.101  1.00 216.05 ? 3    DT  T OP1   1 
ATOM   202   O  OP2   . DT  B 2  3    ? 60.578  19.272  94.297  1.00 217.47 ? 3    DT  T OP2   1 
ATOM   203   O  "O5'" . DT  B 2  3    ? 60.648  19.864  91.876  1.00 230.93 ? 3    DT  T "O5'" 1 
ATOM   204   C  "C5'" . DT  B 2  3    ? 61.235  20.936  91.143  1.00 238.62 ? 3    DT  T "C5'" 1 
ATOM   205   C  "C4'" . DT  B 2  3    ? 62.379  20.438  90.274  1.00 247.16 ? 3    DT  T "C4'" 1 
ATOM   206   O  "O4'" . DT  B 2  3    ? 63.342  19.728  91.099  1.00 251.34 ? 3    DT  T "O4'" 1 
ATOM   207   C  "C3'" . DT  B 2  3    ? 61.973  19.474  89.156  1.00 249.85 ? 3    DT  T "C3'" 1 
ATOM   208   O  "O3'" . DT  B 2  3    ? 62.657  19.803  87.942  1.00 250.05 ? 3    DT  T "O3'" 1 
ATOM   209   C  "C2'" . DT  B 2  3    ? 62.402  18.108  89.694  1.00 250.38 ? 3    DT  T "C2'" 1 
ATOM   210   C  "C1'" . DT  B 2  3    ? 63.622  18.469  90.531  1.00 251.65 ? 3    DT  T "C1'" 1 
ATOM   211   N  N1    . DT  B 2  3    ? 63.897  17.497  91.640  1.00 246.91 ? 3    DT  T N1    1 
ATOM   212   C  C2    . DT  B 2  3    ? 64.607  16.347  91.373  1.00 242.70 ? 3    DT  T C2    1 
ATOM   213   O  O2    . DT  B 2  3    ? 65.033  16.067  90.267  1.00 241.79 ? 3    DT  T O2    1 
ATOM   214   N  N3    . DT  B 2  3    ? 64.801  15.528  92.456  1.00 236.20 ? 3    DT  T N3    1 
ATOM   215   C  C4    . DT  B 2  3    ? 64.365  15.739  93.753  1.00 229.29 ? 3    DT  T C4    1 
ATOM   216   O  O4    . DT  B 2  3    ? 64.588  14.943  94.659  1.00 223.33 ? 3    DT  T O4    1 
ATOM   217   C  C5    . DT  B 2  3    ? 63.628  16.963  93.964  1.00 229.57 ? 3    DT  T C5    1 
ATOM   218   C  C7    . DT  B 2  3    ? 63.105  17.301  95.329  1.00 220.66 ? 3    DT  T C7    1 
ATOM   219   C  C6    . DT  B 2  3    ? 63.432  17.772  92.912  1.00 239.51 ? 3    DT  T C6    1 
ATOM   220   P  P     . DT  B 2  4    ? 62.014  20.854  86.906  1.00 244.95 ? 4    DT  T P     1 
ATOM   221   O  OP1   . DT  B 2  4    ? 62.307  22.216  87.406  1.00 241.39 ? 4    DT  T OP1   1 
ATOM   222   O  OP2   . DT  B 2  4    ? 60.614  20.443  86.665  1.00 243.70 ? 4    DT  T OP2   1 
ATOM   223   O  "O5'" . DT  B 2  4    ? 62.852  20.640  85.558  1.00 244.56 ? 4    DT  T "O5'" 1 
ATOM   224   C  "C5'" . DT  B 2  4    ? 62.274  19.927  84.465  1.00 249.50 ? 4    DT  T "C5'" 1 
ATOM   225   C  "C4'" . DT  B 2  4    ? 62.955  18.583  84.268  1.00 258.67 ? 4    DT  T "C4'" 1 
ATOM   226   O  "O4'" . DT  B 2  4    ? 62.861  17.801  85.490  1.00 263.32 ? 4    DT  T "O4'" 1 
ATOM   227   C  "C3'" . DT  B 2  4    ? 62.358  17.712  83.157  1.00 260.47 ? 4    DT  T "C3'" 1 
ATOM   228   O  "O3'" . DT  B 2  4    ? 63.399  17.168  82.352  1.00 264.12 ? 4    DT  T "O3'" 1 
ATOM   229   C  "C2'" . DT  B 2  4    ? 61.614  16.619  83.924  1.00 258.66 ? 4    DT  T "C2'" 1 
ATOM   230   C  "C1'" . DT  B 2  4    ? 62.476  16.486  85.167  1.00 259.85 ? 4    DT  T "C1'" 1 
ATOM   231   N  N1    . DT  B 2  4    ? 61.763  15.886  86.343  1.00 252.93 ? 4    DT  T N1    1 
ATOM   232   C  C2    . DT  B 2  4    ? 62.497  15.446  87.423  1.00 251.01 ? 4    DT  T C2    1 
ATOM   233   O  O2    . DT  B 2  4    ? 63.712  15.524  87.482  1.00 251.17 ? 4    DT  T O2    1 
ATOM   234   N  N3    . DT  B 2  4    ? 61.753  14.915  88.444  1.00 245.24 ? 4    DT  T N3    1 
ATOM   235   C  C4    . DT  B 2  4    ? 60.377  14.777  88.492  1.00 237.53 ? 4    DT  T C4    1 
ATOM   236   O  O4    . DT  B 2  4    ? 59.800  14.284  89.456  1.00 234.67 ? 4    DT  T O4    1 
ATOM   237   C  C5    . DT  B 2  4    ? 59.667  15.254  87.326  1.00 233.11 ? 4    DT  T C5    1 
ATOM   238   C  C7    . DT  B 2  4    ? 58.172  15.158  87.261  1.00 223.35 ? 4    DT  T C7    1 
ATOM   239   C  C6    . DT  B 2  4    ? 60.386  15.778  86.321  1.00 242.41 ? 4    DT  T C6    1 
ATOM   240   P  P     . DC  B 2  5    ? 63.175  16.950  80.775  1.00 263.15 ? 5    DC  T P     1 
ATOM   241   O  OP1   . DC  B 2  5    ? 64.242  17.683  80.058  1.00 263.79 ? 5    DC  T OP1   1 
ATOM   242   O  OP2   . DC  B 2  5    ? 61.754  17.247  80.483  1.00 265.55 ? 5    DC  T OP2   1 
ATOM   243   O  "O5'" . DC  B 2  5    ? 63.403  15.380  80.566  1.00 253.74 ? 5    DC  T "O5'" 1 
ATOM   244   C  "C5'" . DC  B 2  5    ? 63.431  14.841  79.251  1.00 245.04 ? 5    DC  T "C5'" 1 
ATOM   245   C  "C4'" . DC  B 2  5    ? 63.550  13.328  79.284  1.00 238.99 ? 5    DC  T "C4'" 1 
ATOM   246   O  "O4'" . DC  B 2  5    ? 62.940  12.822  80.501  1.00 235.21 ? 5    DC  T "O4'" 1 
ATOM   247   C  "C3'" . DC  B 2  5    ? 62.813  12.619  78.163  1.00 238.68 ? 5    DC  T "C3'" 1 
ATOM   248   O  "O3'" . DC  B 2  5    ? 63.348  11.312  77.980  1.00 242.50 ? 5    DC  T "O3'" 1 
ATOM   249   C  "C2'" . DC  B 2  5    ? 61.411  12.563  78.740  1.00 235.67 ? 5    DC  T "C2'" 1 
ATOM   250   C  "C1'" . DC  B 2  5    ? 61.711  12.188  80.185  1.00 233.77 ? 5    DC  T "C1'" 1 
ATOM   251   N  N1    . DC  B 2  5    ? 60.678  12.657  81.151  1.00 233.28 ? 5    DC  T N1    1 
ATOM   252   C  C2    . DC  B 2  5    ? 60.006  11.733  81.962  1.00 231.44 ? 5    DC  T C2    1 
ATOM   253   O  O2    . DC  B 2  5    ? 60.279  10.531  81.856  1.00 231.55 ? 5    DC  T O2    1 
ATOM   254   N  N3    . DC  B 2  5    ? 59.072  12.189  82.838  1.00 228.37 ? 5    DC  T N3    1 
ATOM   255   C  C4    . DC  B 2  5    ? 58.812  13.498  82.915  1.00 224.97 ? 5    DC  T C4    1 
ATOM   256   N  N4    . DC  B 2  5    ? 57.888  13.908  83.789  1.00 218.39 ? 5    DC  T N4    1 
ATOM   257   C  C5    . DC  B 2  5    ? 59.487  14.445  82.096  1.00 230.26 ? 5    DC  T C5    1 
ATOM   258   C  C6    . DC  B 2  5    ? 60.402  13.987  81.241  1.00 233.56 ? 5    DC  T C6    1 
ATOM   259   P  P     . DT  B 2  6    ? 63.057  10.488  76.628  1.00 248.50 ? 6    DT  T P     1 
ATOM   260   O  OP1   . DT  B 2  6    ? 64.352  10.336  75.932  1.00 251.65 ? 6    DT  T OP1   1 
ATOM   261   O  OP2   . DT  B 2  6    ? 61.920  11.113  75.914  1.00 250.47 ? 6    DT  T OP2   1 
ATOM   262   O  "O5'" . DT  B 2  6    ? 62.592  9.046   77.147  1.00 243.34 ? 6    DT  T "O5'" 1 
ATOM   263   C  "C5'" . DT  B 2  6    ? 61.903  8.921   78.389  1.00 239.26 ? 6    DT  T "C5'" 1 
ATOM   264   C  "C4'" . DT  B 2  6    ? 60.623  8.122   78.224  1.00 237.71 ? 6    DT  T "C4'" 1 
ATOM   265   O  "O4'" . DT  B 2  6    ? 59.582  8.706   79.057  1.00 234.47 ? 6    DT  T "O4'" 1 
ATOM   266   C  "C3'" . DT  B 2  6    ? 60.042  8.120   76.811  1.00 242.03 ? 6    DT  T "C3'" 1 
ATOM   267   O  "O3'" . DT  B 2  6    ? 59.236  6.967   76.633  1.00 246.80 ? 6    DT  T "O3'" 1 
ATOM   268   C  "C2'" . DT  B 2  6    ? 59.165  9.355   76.863  1.00 239.73 ? 6    DT  T "C2'" 1 
ATOM   269   C  "C1'" . DT  B 2  6    ? 58.526  9.130   78.222  1.00 236.25 ? 6    DT  T "C1'" 1 
ATOM   270   N  N1    . DT  B 2  6    ? 57.885  10.334  78.809  1.00 236.11 ? 6    DT  T N1    1 
ATOM   271   C  C2    . DT  B 2  6    ? 57.021  10.181  79.863  1.00 238.16 ? 6    DT  T C2    1 
ATOM   272   O  O2    . DT  B 2  6    ? 56.751  9.098   80.354  1.00 234.42 ? 6    DT  T O2    1 
ATOM   273   N  N3    . DT  B 2  6    ? 56.481  11.347  80.332  1.00 244.03 ? 6    DT  T N3    1 
ATOM   274   C  C4    . DT  B 2  6    ? 56.713  12.626  79.858  1.00 245.26 ? 6    DT  T C4    1 
ATOM   275   O  O4    . DT  B 2  6    ? 56.178  13.614  80.349  1.00 250.47 ? 6    DT  T O4    1 
ATOM   276   C  C5    . DT  B 2  6    ? 57.625  12.715  78.745  1.00 237.12 ? 6    DT  T C5    1 
ATOM   277   C  C7    . DT  B 2  6    ? 57.956  14.048  78.142  1.00 231.93 ? 6    DT  T C7    1 
ATOM   278   C  C6    . DT  B 2  6    ? 58.151  11.576  78.274  1.00 235.62 ? 6    DT  T C6    1 
ATOM   279   P  P     . DC  B 2  7    ? 59.833  5.609   76.016  1.00 247.35 ? 7    DC  T P     1 
ATOM   280   O  OP1   . DC  B 2  7    ? 61.194  5.383   76.552  1.00 255.97 ? 7    DC  T OP1   1 
ATOM   281   O  OP2   . DC  B 2  7    ? 59.615  5.661   74.552  1.00 240.68 ? 7    DC  T OP2   1 
ATOM   282   O  "O5'" . DC  B 2  7    ? 58.858  4.490   76.613  1.00 240.30 ? 7    DC  T "O5'" 1 
ATOM   283   C  "C5'" . DC  B 2  7    ? 58.151  4.743   77.833  1.00 234.93 ? 7    DC  T "C5'" 1 
ATOM   284   C  "C4'" . DC  B 2  7    ? 56.662  4.902   77.573  1.00 228.71 ? 7    DC  T "C4'" 1 
ATOM   285   O  "O4'" . DC  B 2  7    ? 56.209  6.161   78.101  1.00 225.94 ? 7    DC  T "O4'" 1 
ATOM   286   C  "C3'" . DC  B 2  7    ? 56.274  4.927   76.098  1.00 229.53 ? 7    DC  T "C3'" 1 
ATOM   287   O  "O3'" . DC  B 2  7    ? 55.859  3.586   75.657  1.00 232.51 ? 7    DC  T "O3'" 1 
ATOM   288   C  "C2'" . DC  B 2  7    ? 55.196  6.030   75.984  1.00 229.31 ? 7    DC  T "C2'" 1 
ATOM   289   C  "C1'" . DC  B 2  7    ? 55.030  6.517   77.428  1.00 230.55 ? 7    DC  T "C1'" 1 
ATOM   290   N  N1    . DC  B 2  7    ? 54.839  7.992   77.548  1.00 241.90 ? 7    DC  T N1    1 
ATOM   291   C  C2    . DC  B 2  7    ? 54.043  8.508   78.578  1.00 249.92 ? 7    DC  T C2    1 
ATOM   292   O  O2    . DC  B 2  7    ? 53.510  7.724   79.374  1.00 250.00 ? 7    DC  T O2    1 
ATOM   293   N  N3    . DC  B 2  7    ? 53.878  9.854   78.668  1.00 255.32 ? 7    DC  T N3    1 
ATOM   294   C  C4    . DC  B 2  7    ? 54.473  10.660  77.782  1.00 255.29 ? 7    DC  T C4    1 
ATOM   295   N  N4    . DC  B 2  7    ? 54.287  11.978  77.906  1.00 256.35 ? 7    DC  T N4    1 
ATOM   296   C  C5    . DC  B 2  7    ? 55.287  10.150  76.730  1.00 251.04 ? 7    DC  T C5    1 
ATOM   297   C  C6    . DC  B 2  7    ? 55.442  8.825   76.653  1.00 245.37 ? 7    DC  T C6    1 
ATOM   298   P  P     . DT  B 2  8    ? 54.325  3.088   75.543  1.00 220.22 ? 8    DT  T P     1 
ATOM   299   O  OP1   . DT  B 2  8    ? 54.390  1.611   75.534  1.00 210.98 ? 8    DT  T OP1   1 
ATOM   300   O  OP2   . DT  B 2  8    ? 53.649  3.762   74.410  1.00 224.53 ? 8    DT  T OP2   1 
ATOM   301   O  "O5'" . DT  B 2  8    ? 53.617  3.507   76.915  1.00 217.00 ? 8    DT  T "O5'" 1 
ATOM   302   C  "C5'" . DT  B 2  8    ? 52.293  3.994   76.859  1.00 211.77 ? 8    DT  T "C5'" 1 
ATOM   303   C  "C4'" . DT  B 2  8    ? 51.645  4.073   78.224  1.00 208.78 ? 8    DT  T "C4'" 1 
ATOM   304   O  "O4'" . DT  B 2  8    ? 51.724  5.445   78.703  1.00 209.95 ? 8    DT  T "O4'" 1 
ATOM   305   C  "C3'" . DT  B 2  8    ? 50.161  3.815   78.173  1.00 209.92 ? 8    DT  T "C3'" 1 
ATOM   306   O  "O3'" . DT  B 2  8    ? 49.646  3.652   79.489  1.00 208.03 ? 8    DT  T "O3'" 1 
ATOM   307   C  "C2'" . DT  B 2  8    ? 49.705  5.126   77.562  1.00 214.98 ? 8    DT  T "C2'" 1 
ATOM   308   C  "C1'" . DT  B 2  8    ? 50.495  6.108   78.412  1.00 215.90 ? 8    DT  T "C1'" 1 
ATOM   309   N  N1    . DT  B 2  8    ? 50.802  7.425   77.742  1.00 220.28 ? 8    DT  T N1    1 
ATOM   310   C  C2    . DT  B 2  8    ? 50.373  8.602   78.324  1.00 217.84 ? 8    DT  T C2    1 
ATOM   311   O  O2    . DT  B 2  8    ? 49.725  8.642   79.357  1.00 211.40 ? 8    DT  T O2    1 
ATOM   312   N  N3    . DT  B 2  8    ? 50.733  9.742   77.641  1.00 221.02 ? 8    DT  T N3    1 
ATOM   313   C  C4    . DT  B 2  8    ? 51.468  9.819   76.468  1.00 220.17 ? 8    DT  T C4    1 
ATOM   314   O  O4    . DT  B 2  8    ? 51.737  10.888  75.926  1.00 220.96 ? 8    DT  T O4    1 
ATOM   315   C  C5    . DT  B 2  8    ? 51.883  8.552   75.916  1.00 216.53 ? 8    DT  T C5    1 
ATOM   316   C  C7    . DT  B 2  8    ? 52.670  8.510   74.639  1.00 210.38 ? 8    DT  T C7    1 
ATOM   317   C  C6    . DT  B 2  8    ? 51.538  7.433   76.572  1.00 220.08 ? 8    DT  T C6    1 
ATOM   318   P  P     . DC  B 2  9    ? 48.268  2.855   79.724  1.00 204.90 ? 9    DC  T P     1 
ATOM   319   O  OP1   . DC  B 2  9    ? 47.763  3.224   81.066  1.00 205.05 ? 9    DC  T OP1   1 
ATOM   320   O  OP2   . DC  B 2  9    ? 48.538  1.434   79.409  1.00 200.63 ? 9    DC  T OP2   1 
ATOM   321   O  "O5'" . DC  B 2  9    ? 47.291  3.430   78.588  1.00 205.36 ? 9    DC  T "O5'" 1 
ATOM   322   C  "C5'" . DC  B 2  9    ? 45.906  3.605   78.833  1.00 207.02 ? 9    DC  T "C5'" 1 
ATOM   323   C  "C4'" . DC  B 2  9    ? 45.604  5.010   79.336  1.00 213.52 ? 9    DC  T "C4'" 1 
ATOM   324   O  "O4'" . DC  B 2  9    ? 46.570  5.973   78.811  1.00 215.91 ? 9    DC  T "O4'" 1 
ATOM   325   C  "C3'" . DC  B 2  9    ? 44.224  5.556   78.945  1.00 217.73 ? 9    DC  T "C3'" 1 
ATOM   326   O  "O3'" . DC  B 2  9    ? 43.636  6.201   80.070  1.00 222.21 ? 9    DC  T "O3'" 1 
ATOM   327   C  "C2'" . DC  B 2  9    ? 44.570  6.564   77.852  1.00 218.56 ? 9    DC  T "C2'" 1 
ATOM   328   C  "C1'" . DC  B 2  9    ? 45.850  7.122   78.427  1.00 218.11 ? 9    DC  T "C1'" 1 
ATOM   329   N  N1    . DC  B 2  9    ? 46.658  7.957   77.472  1.00 222.75 ? 9    DC  T N1    1 
ATOM   330   C  C2    . DC  B 2  9    ? 46.631  9.351   77.584  1.00 229.89 ? 9    DC  T C2    1 
ATOM   331   O  O2    . DC  B 2  9    ? 45.946  9.869   78.470  1.00 226.07 ? 9    DC  T O2    1 
ATOM   332   N  N3    . DC  B 2  9    ? 47.365  10.097  76.718  1.00 237.86 ? 9    DC  T N3    1 
ATOM   333   C  C4    . DC  B 2  9    ? 48.097  9.499   75.777  1.00 235.81 ? 9    DC  T C4    1 
ATOM   334   N  N4    . DC  B 2  9    ? 48.800  10.272  74.942  1.00 238.18 ? 9    DC  T N4    1 
ATOM   335   C  C5    . DC  B 2  9    ? 48.136  8.082   75.648  1.00 227.00 ? 9    DC  T C5    1 
ATOM   336   C  C6    . DC  B 2  9    ? 47.403  7.362   76.505  1.00 222.41 ? 9    DC  T C6    1 
ATOM   337   P  P     . DT  B 2  10   ? 42.058  6.511   80.114  1.00 224.84 ? 10   DT  T P     1 
ATOM   338   O  OP1   . DT  B 2  10   ? 41.506  5.740   81.250  1.00 222.35 ? 10   DT  T OP1   1 
ATOM   339   O  OP2   . DT  B 2  10   ? 41.488  6.305   78.764  1.00 227.48 ? 10   DT  T OP2   1 
ATOM   340   O  "O5'" . DT  B 2  10   ? 41.979  8.074   80.479  1.00 223.61 ? 10   DT  T "O5'" 1 
ATOM   341   C  "C5'" . DT  B 2  10   ? 42.977  8.984   79.997  1.00 215.83 ? 10   DT  T "C5'" 1 
ATOM   342   C  "C4'" . DT  B 2  10   ? 42.343  10.124  79.220  1.00 213.20 ? 10   DT  T "C4'" 1 
ATOM   343   O  "O4'" . DT  B 2  10   ? 43.259  10.577  78.179  1.00 212.36 ? 10   DT  T "O4'" 1 
ATOM   344   C  "C3'" . DT  B 2  10   ? 41.058  9.751   78.473  1.00 215.90 ? 10   DT  T "C3'" 1 
ATOM   345   O  "O3'" . DT  B 2  10   ? 40.280  10.921  78.227  1.00 217.73 ? 10   DT  T "O3'" 1 
ATOM   346   C  "C2'" . DT  B 2  10   ? 41.645  9.272   77.160  1.00 216.21 ? 10   DT  T "C2'" 1 
ATOM   347   C  "C1'" . DT  B 2  10   ? 42.606  10.424  76.939  1.00 218.64 ? 10   DT  T "C1'" 1 
ATOM   348   N  N1    . DT  B 2  10   ? 43.601  10.232  75.830  1.00 223.61 ? 10   DT  T N1    1 
ATOM   349   C  C2    . DT  B 2  10   ? 44.169  11.342  75.251  1.00 226.77 ? 10   DT  T C2    1 
ATOM   350   O  O2    . DT  B 2  10   ? 43.922  12.481  75.608  1.00 230.16 ? 10   DT  T O2    1 
ATOM   351   N  N3    . DT  B 2  10   ? 45.050  11.074  74.240  1.00 221.30 ? 10   DT  T N3    1 
ATOM   352   C  C4    . DT  B 2  10   ? 45.408  9.832   73.749  1.00 213.76 ? 10   DT  T C4    1 
ATOM   353   O  O4    . DT  B 2  10   ? 46.214  9.697   72.833  1.00 209.47 ? 10   DT  T O4    1 
ATOM   354   C  C5    . DT  B 2  10   ? 44.768  8.708   74.390  1.00 211.01 ? 10   DT  T C5    1 
ATOM   355   C  C7    . DT  B 2  10   ? 45.069  7.309   73.936  1.00 205.63 ? 10   DT  T C7    1 
ATOM   356   C  C6    . DT  B 2  10   ? 43.897  8.961   75.383  1.00 217.34 ? 10   DT  T C6    1 
ATOM   357   P  P     . DC  B 2  11   ? 39.354  11.621  79.342  1.00 216.26 ? 11   DC  T P     1 
ATOM   358   O  OP1   . DC  B 2  11   ? 39.850  11.391  80.717  1.00 211.52 ? 11   DC  T OP1   1 
ATOM   359   O  OP2   . DC  B 2  11   ? 37.960  11.250  79.018  1.00 211.87 ? 11   DC  T OP2   1 
ATOM   360   O  "O5'" . DC  B 2  11   ? 39.537  13.172  78.993  1.00 225.18 ? 11   DC  T "O5'" 1 
ATOM   361   C  "C5'" . DC  B 2  11   ? 40.671  13.586  78.213  1.00 231.99 ? 11   DC  T "C5'" 1 
ATOM   362   C  "C4'" . DC  B 2  11   ? 40.291  14.677  77.224  1.00 238.69 ? 11   DC  T "C4'" 1 
ATOM   363   O  "O4'" . DC  B 2  11   ? 41.015  14.488  75.974  1.00 240.92 ? 11   DC  T "O4'" 1 
ATOM   364   C  "C3'" . DC  B 2  11   ? 38.828  14.705  76.828  1.00 239.10 ? 11   DC  T "C3'" 1 
ATOM   365   O  "O3'" . DC  B 2  11   ? 38.481  16.029  76.444  1.00 240.61 ? 11   DC  T "O3'" 1 
ATOM   366   C  "C2'" . DC  B 2  11   ? 38.807  13.744  75.640  1.00 237.35 ? 11   DC  T "C2'" 1 
ATOM   367   C  "C1'" . DC  B 2  11   ? 40.113  14.107  74.943  1.00 237.86 ? 11   DC  T "C1'" 1 
ATOM   368   N  N1    . DC  B 2  11   ? 40.737  12.978  74.179  1.00 232.19 ? 11   DC  T N1    1 
ATOM   369   C  C2    . DC  B 2  11   ? 41.663  13.259  73.171  1.00 225.05 ? 11   DC  T C2    1 
ATOM   370   O  O2    . DC  B 2  11   ? 41.933  14.438  72.919  1.00 215.02 ? 11   DC  T O2    1 
ATOM   371   N  N3    . DC  B 2  11   ? 42.236  12.229  72.498  1.00 225.96 ? 11   DC  T N3    1 
ATOM   372   C  C4    . DC  B 2  11   ? 41.918  10.970  72.801  1.00 223.79 ? 11   DC  T C4    1 
ATOM   373   N  N4    . DC  B 2  11   ? 42.511  9.989   72.109  1.00 219.39 ? 11   DC  T N4    1 
ATOM   374   C  C5    . DC  B 2  11   ? 40.976  10.662  73.824  1.00 225.34 ? 11   DC  T C5    1 
ATOM   375   C  C6    . DC  B 2  11   ? 40.419  11.687  74.485  1.00 228.85 ? 11   DC  T C6    1 
ATOM   376   P  P     . DT  B 2  12   ? 36.995  16.389  75.955  1.00 240.63 ? 12   DT  T P     1 
ATOM   377   O  OP1   . DT  B 2  12   ? 36.731  17.779  76.389  1.00 244.65 ? 12   DT  T OP1   1 
ATOM   378   O  OP2   . DT  B 2  12   ? 36.072  15.306  76.367  1.00 240.30 ? 12   DT  T OP2   1 
ATOM   379   O  "O5'" . DT  B 2  12   ? 37.113  16.377  74.361  1.00 239.54 ? 12   DT  T "O5'" 1 
ATOM   380   C  "C5'" . DT  B 2  12   ? 36.579  17.453  73.606  1.00 236.66 ? 12   DT  T "C5'" 1 
ATOM   381   C  "C4'" . DT  B 2  12   ? 37.682  18.249  72.933  1.00 231.02 ? 12   DT  T "C4'" 1 
ATOM   382   O  "O4'" . DT  B 2  12   ? 38.768  17.356  72.557  1.00 230.07 ? 12   DT  T "O4'" 1 
ATOM   383   C  "C3'" . DT  B 2  12   ? 37.272  18.885  71.627  1.00 228.88 ? 12   DT  T "C3'" 1 
ATOM   384   O  "O3'" . DT  B 2  12   ? 38.222  19.874  71.270  1.00 239.96 ? 12   DT  T "O3'" 1 
ATOM   385   C  "C2'" . DT  B 2  12   ? 37.368  17.682  70.710  1.00 224.05 ? 12   DT  T "C2'" 1 
ATOM   386   C  "C1'" . DT  B 2  12   ? 38.713  17.121  71.156  1.00 226.88 ? 12   DT  T "C1'" 1 
ATOM   387   N  N1    . DT  B 2  12   ? 38.908  15.643  70.912  1.00 227.80 ? 12   DT  T N1    1 
ATOM   388   C  C2    . DT  B 2  12   ? 39.794  15.219  69.936  1.00 226.13 ? 12   DT  T C2    1 
ATOM   389   O  O2    . DT  B 2  12   ? 40.420  15.983  69.221  1.00 226.16 ? 12   DT  T O2    1 
ATOM   390   N  N3    . DT  B 2  12   ? 39.906  13.851  69.821  1.00 221.78 ? 12   DT  T N3    1 
ATOM   391   C  C4    . DT  B 2  12   ? 39.249  12.891  70.574  1.00 215.97 ? 12   DT  T C4    1 
ATOM   392   O  O4    . DT  B 2  12   ? 39.412  11.687  70.400  1.00 210.70 ? 12   DT  T O4    1 
ATOM   393   C  C5    . DT  B 2  12   ? 38.351  13.403  71.579  1.00 217.02 ? 12   DT  T C5    1 
ATOM   394   C  C7    . DT  B 2  12   ? 37.582  12.454  72.448  1.00 211.65 ? 12   DT  T C7    1 
ATOM   395   C  C6    . DT  B 2  12   ? 38.230  14.735  71.702  1.00 224.35 ? 12   DT  T C6    1 
ATOM   396   P  P     . DC  B 2  13   ? 37.859  20.983  70.168  1.00 222.00 ? 13   DC  T P     1 
ATOM   397   O  OP1   . DC  B 2  13   ? 38.873  22.057  70.266  1.00 227.82 ? 13   DC  T OP1   1 
ATOM   398   O  OP2   . DC  B 2  13   ? 36.422  21.302  70.320  1.00 224.42 ? 13   DC  T OP2   1 
ATOM   399   O  "O5'" . DC  B 2  13   ? 38.049  20.224  68.774  1.00 221.92 ? 13   DC  T "O5'" 1 
ATOM   400   C  "C5'" . DC  B 2  13   ? 39.325  19.704  68.404  1.00 221.65 ? 13   DC  T "C5'" 1 
ATOM   401   C  "C4'" . DC  B 2  13   ? 39.480  19.690  66.893  1.00 224.96 ? 13   DC  T "C4'" 1 
ATOM   402   O  "O4'" . DC  B 2  13   ? 39.687  18.332  66.429  1.00 225.99 ? 13   DC  T "O4'" 1 
ATOM   403   C  "C3'" . DC  B 2  13   ? 38.284  20.209  66.114  1.00 228.65 ? 13   DC  T "C3'" 1 
ATOM   404   O  "O3'" . DC  B 2  13   ? 38.733  20.791  64.896  1.00 228.28 ? 13   DC  T "O3'" 1 
ATOM   405   C  "C2'" . DC  B 2  13   ? 37.460  18.941  65.878  1.00 231.17 ? 13   DC  T "C2'" 1 
ATOM   406   C  "C1'" . DC  B 2  13   ? 38.529  17.855  65.761  1.00 230.67 ? 13   DC  T "C1'" 1 
ATOM   407   N  N1    . DC  B 2  13   ? 38.138  16.565  66.399  1.00 232.27 ? 13   DC  T N1    1 
ATOM   408   C  C2    . DC  B 2  13   ? 38.665  15.362  65.921  1.00 237.12 ? 13   DC  T C2    1 
ATOM   409   O  O2    . DC  B 2  13   ? 39.438  15.382  64.959  1.00 238.52 ? 13   DC  T O2    1 
ATOM   410   N  N3    . DC  B 2  13   ? 38.306  14.204  66.531  1.00 239.02 ? 13   DC  T N3    1 
ATOM   411   C  C4    . DC  B 2  13   ? 37.470  14.222  67.567  1.00 237.32 ? 13   DC  T C4    1 
ATOM   412   N  N4    . DC  B 2  13   ? 37.147  13.053  68.133  1.00 237.25 ? 13   DC  T N4    1 
ATOM   413   C  C5    . DC  B 2  13   ? 36.926  15.435  68.064  1.00 232.94 ? 13   DC  T C5    1 
ATOM   414   C  C6    . DC  B 2  13   ? 37.284  16.570  67.455  1.00 230.07 ? 13   DC  T C6    1 
ATOM   415   P  P     . DG  B 2  14   ? 37.712  21.511  63.882  1.00 221.34 ? 14   DG  T P     1 
ATOM   416   O  OP1   . DG  B 2  14   ? 38.371  22.756  63.431  1.00 218.02 ? 14   DG  T OP1   1 
ATOM   417   O  OP2   . DG  B 2  14   ? 36.363  21.597  64.487  1.00 218.68 ? 14   DG  T OP2   1 
ATOM   418   O  "O5'" . DG  B 2  14   ? 37.660  20.495  62.650  1.00 231.09 ? 14   DG  T "O5'" 1 
ATOM   419   C  "C5'" . DG  B 2  14   ? 38.840  19.777  62.280  1.00 237.89 ? 14   DG  T "C5'" 1 
ATOM   420   C  "C4'" . DG  B 2  14   ? 38.500  18.487  61.550  1.00 245.76 ? 14   DG  T "C4'" 1 
ATOM   421   O  "O4'" . DG  B 2  14   ? 38.216  17.423  62.506  1.00 248.29 ? 14   DG  T "O4'" 1 
ATOM   422   C  "C3'" . DG  B 2  14   ? 37.270  18.556  60.633  1.00 249.47 ? 14   DG  T "C3'" 1 
ATOM   423   O  "O3'" . DG  B 2  14   ? 37.506  17.780  59.468  1.00 252.34 ? 14   DG  T "O3'" 1 
ATOM   424   C  "C2'" . DG  B 2  14   ? 36.204  17.891  61.493  1.00 248.40 ? 14   DG  T "C2'" 1 
ATOM   425   C  "C1'" . DG  B 2  14   ? 37.046  16.775  62.074  1.00 247.39 ? 14   DG  T "C1'" 1 
ATOM   426   N  N9    . DG  B 2  14   ? 36.425  16.036  63.174  1.00 244.39 ? 14   DG  T N9    1 
ATOM   427   C  C8    . DG  B 2  14   ? 35.659  16.538  64.200  1.00 242.72 ? 14   DG  T C8    1 
ATOM   428   N  N7    . DG  B 2  14   ? 35.235  15.620  65.028  1.00 239.60 ? 14   DG  T N7    1 
ATOM   429   C  C5    . DG  B 2  14   ? 35.738  14.434  64.506  1.00 241.96 ? 14   DG  T C5    1 
ATOM   430   C  C6    . DG  B 2  14   ? 35.606  13.103  64.967  1.00 244.33 ? 14   DG  T C6    1 
ATOM   431   O  O6    . DG  B 2  14   ? 34.997  12.691  65.965  1.00 244.54 ? 14   DG  T O6    1 
ATOM   432   N  N1    . DG  B 2  14   ? 36.277  12.203  64.140  1.00 246.08 ? 14   DG  T N1    1 
ATOM   433   C  C2    . DG  B 2  14   ? 36.983  12.546  63.010  1.00 244.59 ? 14   DG  T C2    1 
ATOM   434   N  N2    . DG  B 2  14   ? 37.563  11.542  62.335  1.00 242.91 ? 14   DG  T N2    1 
ATOM   435   N  N3    . DG  B 2  14   ? 37.112  13.788  62.570  1.00 244.74 ? 14   DG  T N3    1 
ATOM   436   C  C4    . DG  B 2  14   ? 36.467  14.676  63.364  1.00 243.33 ? 14   DG  T C4    1 
ATOM   437   P  P     . DC  B 2  15   ? 38.096  18.441  58.128  1.00 256.00 ? 15   DC  T P     1 
ATOM   438   O  OP1   . DC  B 2  15   ? 39.356  19.143  58.453  1.00 255.59 ? 15   DC  T OP1   1 
ATOM   439   O  OP2   . DC  B 2  15   ? 36.990  19.172  57.471  1.00 256.36 ? 15   DC  T OP2   1 
ATOM   440   O  "O5'" . DC  B 2  15   ? 38.454  17.171  57.226  1.00 258.50 ? 15   DC  T "O5'" 1 
ATOM   441   C  "C5'" . DC  B 2  15   ? 38.970  15.990  57.840  1.00 258.35 ? 15   DC  T "C5'" 1 
ATOM   442   C  "C4'" . DC  B 2  15   ? 38.097  14.790  57.516  1.00 257.85 ? 15   DC  T "C4'" 1 
ATOM   443   O  "O4'" . DC  B 2  15   ? 37.427  14.340  58.705  1.00 257.71 ? 15   DC  T "O4'" 1 
ATOM   444   C  "C3'" . DC  B 2  15   ? 36.989  15.064  56.509  1.00 255.67 ? 15   DC  T "C3'" 1 
ATOM   445   O  "O3'" . DC  B 2  15   ? 37.419  14.699  55.166  1.00 251.23 ? 15   DC  T "O3'" 1 
ATOM   446   C  "C2'" . DC  B 2  15   ? 35.769  14.264  57.016  1.00 258.39 ? 15   DC  T "C2'" 1 
ATOM   447   C  "C1'" . DC  B 2  15   ? 36.243  13.663  58.346  1.00 258.95 ? 15   DC  T "C1'" 1 
ATOM   448   N  N1    . DC  B 2  15   ? 35.270  13.820  59.480  1.00 259.34 ? 15   DC  T N1    1 
ATOM   449   C  C2    . DC  B 2  15   ? 34.837  12.693  60.195  1.00 263.46 ? 15   DC  T C2    1 
ATOM   450   O  O2    . DC  B 2  15   ? 35.243  11.573  59.864  1.00 268.63 ? 15   DC  T O2    1 
ATOM   451   N  N3    . DC  B 2  15   ? 33.972  12.865  61.231  1.00 258.03 ? 15   DC  T N3    1 
ATOM   452   C  C4    . DC  B 2  15   ? 33.556  14.090  61.558  1.00 250.85 ? 15   DC  T C4    1 
ATOM   453   N  N4    . DC  B 2  15   ? 32.704  14.216  62.583  1.00 246.25 ? 15   DC  T N4    1 
ATOM   454   C  C5    . DC  B 2  15   ? 33.990  15.242  60.846  1.00 249.82 ? 15   DC  T C5    1 
ATOM   455   C  C6    . DC  B 2  15   ? 34.844  15.064  59.832  1.00 253.11 ? 15   DC  T C6    1 
ATOM   456   P  P     . DT  B 2  16   ? 37.475  13.175  54.635  1.00 244.76 ? 16   DT  T P     1 
ATOM   457   O  OP1   . DT  B 2  16   ? 37.777  12.188  55.699  1.00 246.42 ? 16   DT  T OP1   1 
ATOM   458   O  OP2   . DT  B 2  16   ? 38.374  13.205  53.461  1.00 244.33 ? 16   DT  T OP2   1 
ATOM   459   O  "O5'" . DT  B 2  16   ? 36.009  12.922  54.061  1.00 238.87 ? 16   DT  T "O5'" 1 
ATOM   460   C  "C5'" . DT  B 2  16   ? 35.771  11.828  53.199  1.00 227.46 ? 16   DT  T "C5'" 1 
ATOM   461   C  "C4'" . DT  B 2  16   ? 35.391  10.591  53.990  1.00 212.47 ? 16   DT  T "C4'" 1 
ATOM   462   O  "O4'" . DT  B 2  16   ? 34.981  10.972  55.314  1.00 202.38 ? 16   DT  T "O4'" 1 
ATOM   463   C  "C3'" . DT  B 2  16   ? 34.209  9.827   53.422  1.00 209.77 ? 16   DT  T "C3'" 1 
ATOM   464   O  "O3'" . DT  B 2  16   ? 34.666  8.786   52.577  1.00 216.07 ? 16   DT  T "O3'" 1 
ATOM   465   C  "C2'" . DT  B 2  16   ? 33.477  9.276   54.657  1.00 200.11 ? 16   DT  T "C2'" 1 
ATOM   466   C  "C1'" . DT  B 2  16   ? 34.168  9.951   55.839  1.00 199.05 ? 16   DT  T "C1'" 1 
ATOM   467   N  N1    . DT  B 2  16   ? 33.232  10.552  56.856  1.00 204.91 ? 16   DT  T N1    1 
ATOM   468   C  C2    . DT  B 2  16   ? 32.566  9.730   57.743  1.00 213.01 ? 16   DT  T C2    1 
ATOM   469   O  O2    . DT  B 2  16   ? 32.669  8.514   57.738  1.00 213.50 ? 16   DT  T O2    1 
ATOM   470   N  N3    . DT  B 2  16   ? 31.761  10.389  58.639  1.00 216.35 ? 16   DT  T N3    1 
ATOM   471   C  C4    . DT  B 2  16   ? 31.565  11.757  58.740  1.00 215.26 ? 16   DT  T C4    1 
ATOM   472   O  O4    . DT  B 2  16   ? 30.821  12.259  59.578  1.00 217.92 ? 16   DT  T O4    1 
ATOM   473   C  C5    . DT  B 2  16   ? 32.297  12.556  57.791  1.00 207.92 ? 16   DT  T C5    1 
ATOM   474   C  C7    . DT  B 2  16   ? 32.158  14.048  57.803  1.00 201.27 ? 16   DT  T C7    1 
ATOM   475   C  C6    . DT  B 2  16   ? 33.087  11.924  56.908  1.00 207.79 ? 16   DT  T C6    1 
ATOM   476   P  P     . DG  B 2  17   ? 33.768  8.329   51.326  1.00 222.36 ? 17   DG  T P     1 
ATOM   477   O  OP1   . DG  B 2  17   ? 34.661  7.740   50.305  1.00 230.47 ? 17   DG  T OP1   1 
ATOM   478   O  OP2   . DG  B 2  17   ? 32.896  9.474   50.971  1.00 229.54 ? 17   DG  T OP2   1 
ATOM   479   O  "O5'" . DG  B 2  17   ? 32.848  7.170   51.924  1.00 203.54 ? 17   DG  T "O5'" 1 
ATOM   480   C  "C5'" . DG  B 2  17   ? 31.486  7.114   51.576  1.00 195.42 ? 17   DG  T "C5'" 1 
ATOM   481   C  "C4'" . DG  B 2  17   ? 30.645  6.706   52.767  1.00 194.59 ? 17   DG  T "C4'" 1 
ATOM   482   O  "O4'" . DG  B 2  17   ? 30.926  7.573   53.879  1.00 198.04 ? 17   DG  T "O4'" 1 
ATOM   483   C  "C3'" . DG  B 2  17   ? 29.157  6.850   52.568  1.00 196.22 ? 17   DG  T "C3'" 1 
ATOM   484   O  "O3'" . DG  B 2  17   ? 28.654  5.711   51.898  1.00 214.70 ? 17   DG  T "O3'" 1 
ATOM   485   C  "C2'" . DG  B 2  17   ? 28.645  6.928   54.009  1.00 198.41 ? 17   DG  T "C2'" 1 
ATOM   486   C  "C1'" . DG  B 2  17   ? 29.830  7.543   54.768  1.00 198.80 ? 17   DG  T "C1'" 1 
ATOM   487   N  N9    . DG  B 2  17   ? 29.572  8.896   55.272  1.00 206.12 ? 17   DG  T N9    1 
ATOM   488   C  C8    . DG  B 2  17   ? 30.106  10.080  54.817  1.00 206.66 ? 17   DG  T C8    1 
ATOM   489   N  N7    . DG  B 2  17   ? 29.683  11.128  55.475  1.00 201.54 ? 17   DG  T N7    1 
ATOM   490   C  C5    . DG  B 2  17   ? 28.811  10.602  56.422  1.00 205.23 ? 17   DG  T C5    1 
ATOM   491   C  C6    . DG  B 2  17   ? 28.044  11.250  57.422  1.00 205.22 ? 17   DG  T C6    1 
ATOM   492   O  O6    . DG  B 2  17   ? 27.979  12.460  57.679  1.00 198.09 ? 17   DG  T O6    1 
ATOM   493   N  N1    . DG  B 2  17   ? 27.295  10.338  58.167  1.00 211.65 ? 17   DG  T N1    1 
ATOM   494   C  C2    . DG  B 2  17   ? 27.292  8.975   57.969  1.00 211.26 ? 17   DG  T C2    1 
ATOM   495   N  N2    . DG  B 2  17   ? 26.509  8.249   58.780  1.00 206.19 ? 17   DG  T N2    1 
ATOM   496   N  N3    . DG  B 2  17   ? 28.003  8.362   57.039  1.00 213.35 ? 17   DG  T N3    1 
ATOM   497   C  C4    . DG  B 2  17   ? 28.735  9.232   56.307  1.00 209.38 ? 17   DG  T C4    1 
ATOM   498   P  P     . DA  B 2  18   ? 28.410  5.752   50.310  1.00 142.55 ? 18   DA  T P     1 
ATOM   499   O  OP1   . DA  B 2  18   ? 29.528  5.032   49.656  1.00 141.88 ? 18   DA  T OP1   1 
ATOM   500   O  OP2   . DA  B 2  18   ? 28.142  7.164   49.944  1.00 164.13 ? 18   DA  T OP2   1 
ATOM   501   O  "O5'" . DA  B 2  18   ? 27.046  4.940   50.120  1.00 132.61 ? 18   DA  T "O5'" 1 
ATOM   502   C  "C5'" . DA  B 2  18   ? 25.819  5.548   50.497  1.00 132.79 ? 18   DA  T "C5'" 1 
ATOM   503   C  "C4'" . DA  B 2  18   ? 25.257  4.935   51.775  1.00 132.86 ? 18   DA  T "C4'" 1 
ATOM   504   O  "O4'" . DA  B 2  18   ? 25.929  5.527   52.915  1.00 142.26 ? 18   DA  T "O4'" 1 
ATOM   505   C  "C3'" . DA  B 2  18   ? 23.764  5.184   52.008  1.00 137.97 ? 18   DA  T "C3'" 1 
ATOM   506   O  "O3'" . DA  B 2  18   ? 22.994  4.104   51.500  1.00 143.84 ? 18   DA  T "O3'" 1 
ATOM   507   C  "C2'" . DA  B 2  18   ? 23.661  5.256   53.526  1.00 141.11 ? 18   DA  T "C2'" 1 
ATOM   508   C  "C1'" . DA  B 2  18   ? 24.989  5.897   53.909  1.00 151.82 ? 18   DA  T "C1'" 1 
ATOM   509   N  N9    . DA  B 2  18   ? 24.934  7.364   54.011  1.00 163.12 ? 18   DA  T N9    1 
ATOM   510   C  C8    . DA  B 2  18   ? 25.504  8.284   53.169  1.00 157.78 ? 18   DA  T C8    1 
ATOM   511   N  N7    . DA  B 2  18   ? 25.286  9.534   53.519  1.00 147.55 ? 18   DA  T N7    1 
ATOM   512   C  C5    . DA  B 2  18   ? 24.520  9.426   54.670  1.00 153.11 ? 18   DA  T C5    1 
ATOM   513   C  C6    . DA  B 2  18   ? 23.956  10.388  55.536  1.00 152.29 ? 18   DA  T C6    1 
ATOM   514   N  N6    . DA  B 2  18   ? 24.086  11.706  55.359  1.00 154.84 ? 18   DA  T N6    1 
ATOM   515   N  N1    . DA  B 2  18   ? 23.248  9.940   56.594  1.00 151.21 ? 18   DA  T N1    1 
ATOM   516   C  C2    . DA  B 2  18   ? 23.117  8.621   56.771  1.00 150.67 ? 18   DA  T C2    1 
ATOM   517   N  N3    . DA  B 2  18   ? 23.598  7.625   56.030  1.00 156.61 ? 18   DA  T N3    1 
ATOM   518   C  C4    . DA  B 2  18   ? 24.296  8.098   54.986  1.00 159.40 ? 18   DA  T C4    1 
HETATM 519   P  P     . G35 B 2  19   ? 22.800  3.928   49.917  1.00 163.16 ? 19   G35 T P     1 
HETATM 520   C  C2    A G35 B 2  19   ? 19.682  6.100   51.101  0.55 154.18 ? 19   G35 T C2    1 
HETATM 521   C  C2    B G35 B 2  19   ? 14.721  5.247   50.409  0.45 160.49 ? 19   G35 T C2    1 
HETATM 522   N  N3    A G35 B 2  19   ? 18.360  6.063   50.423  0.55 164.62 ? 19   G35 T N3    1 
HETATM 523   N  N3    B G35 B 2  19   ? 15.187  3.901   49.970  0.45 160.52 ? 19   G35 T N3    1 
HETATM 524   C  C4    A G35 B 2  19   ? 17.161  5.652   51.175  0.55 166.40 ? 19   G35 T C4    1 
HETATM 525   C  C4    B G35 B 2  19   ? 14.799  2.693   50.730  0.45 146.20 ? 19   G35 T C4    1 
HETATM 526   C  C5    A G35 B 2  19   ? 16.216  6.764   51.107  0.55 156.29 ? 19   G35 T C5    1 
HETATM 527   C  C5    B G35 B 2  19   ? 13.433  2.283   50.388  0.45 118.86 ? 19   G35 T C5    1 
HETATM 528   O  O5    A G35 B 2  19   ? 16.418  7.861   51.482  0.55 143.53 ? 19   G35 T O5    1 
HETATM 529   O  O5    B G35 B 2  19   ? 12.457  2.930   50.512  0.45 113.03 ? 19   G35 T O5    1 
HETATM 530   N  N7    A G35 B 2  19   ? 14.992  6.277   50.487  0.55 163.92 ? 19   G35 T N7    1 
HETATM 531   N  N7    B G35 B 2  19   ? 13.484  0.922   49.872  0.45 101.23 ? 19   G35 T N7    1 
HETATM 532   C  C8    A G35 B 2  19   ? 15.179  4.854   50.173  0.55 165.17 ? 19   G35 T C8    1 
HETATM 533   C  C8    B G35 B 2  19   ? 14.883  0.485   49.886  0.45 108.43 ? 19   G35 T C8    1 
HETATM 534   O  O8    A G35 B 2  19   ? 14.383  4.153   49.669  0.55 158.87 ? 19   G35 T O8    1 
HETATM 535   O  O8    B G35 B 2  19   ? 15.263  -0.570  49.531  0.45 94.05  ? 19   G35 T O8    1 
HETATM 536   N  N9    A G35 B 2  19   ? 16.523  4.470   50.592  0.55 162.93 ? 19   G35 T N9    1 
HETATM 537   N  N9    B G35 B 2  19   ? 15.698  1.578   50.418  0.45 140.26 ? 19   G35 T N9    1 
HETATM 538   C  "C1'" A G35 B 2  19   ? 17.117  3.113   50.470  0.55 154.41 ? 19   G35 T "C1'" 1 
HETATM 539   C  "C1'" B G35 B 2  19   ? 17.175  1.523   50.580  0.45 153.92 ? 19   G35 T "C1'" 1 
HETATM 540   N  N11   A G35 B 2  19   ? 19.782  5.766   52.300  0.55 148.11 ? 19   G35 T N11   1 
HETATM 541   N  N11   B G35 B 2  19   ? 13.996  5.359   51.419  0.45 161.17 ? 19   G35 T N11   1 
HETATM 542   N  N12   A G35 B 2  19   ? 20.884  6.529   50.346  0.55 156.23 ? 19   G35 T N12   1 
HETATM 543   N  N12   B G35 B 2  19   ? 15.112  6.462   49.649  0.45 162.62 ? 19   G35 T N12   1 
HETATM 544   C  "C2'" A G35 B 2  19   ? 17.613  2.819   49.000  0.55 158.74 ? 19   G35 T "C2'" 1 
HETATM 545   C  "C2'" B G35 B 2  19   ? 17.769  1.352   49.134  0.45 158.01 ? 19   G35 T "C2'" 1 
HETATM 546   C  "C3'" A G35 B 2  19   ? 19.126  2.836   49.133  0.55 164.94 ? 19   G35 T "C3'" 1 
HETATM 547   C  "C3'" B G35 B 2  19   ? 18.789  2.457   49.024  0.45 162.51 ? 19   G35 T "C3'" 1 
HETATM 548   O  "O3'" . G35 B 2  19   ? 19.874  2.021   48.104  1.00 174.22 ? 19   G35 T "O3'" 1 
HETATM 549   C  "C4'" A G35 B 2  19   ? 19.317  2.322   50.353  0.55 160.97 ? 19   G35 T "C4'" 1 
HETATM 550   C  "C4'" B G35 B 2  19   ? 19.196  2.517   50.287  0.45 166.46 ? 19   G35 T "C4'" 1 
HETATM 551   O  "O4'" A G35 B 2  19   ? 18.161  3.002   51.250  0.55 156.50 ? 19   G35 T "O4'" 1 
HETATM 552   O  "O4'" B G35 B 2  19   ? 17.764  2.604   51.042  0.45 156.71 ? 19   G35 T "O4'" 1 
HETATM 553   C  "C5'" A G35 B 2  19   ? 20.677  2.705   50.852  0.55 164.52 ? 19   G35 T "C5'" 1 
HETATM 554   C  "C5'" B G35 B 2  19   ? 20.184  3.644   50.463  0.45 164.90 ? 19   G35 T "C5'" 1 
HETATM 555   O  "O5'" A G35 B 2  19   ? 21.328  3.279   49.758  0.55 168.46 ? 19   G35 T "O5'" 1 
HETATM 556   O  "O5'" B G35 B 2  19   ? 21.331  3.230   49.756  0.45 167.38 ? 19   G35 T "O5'" 1 
HETATM 557   O  OP2   . G35 B 2  19   ? 22.820  5.276   49.238  1.00 173.39 ? 19   G35 T OP2   1 
HETATM 558   O  OP1   . G35 B 2  19   ? 23.861  3.019   49.364  1.00 156.34 ? 19   G35 T OP1   1 
ATOM   559   P  P     . DC  B 2  20   ? 19.798  2.384   46.538  1.00 161.72 ? 20   DC  T P     1 
ATOM   560   O  OP1   . DC  B 2  20   ? 21.107  1.998   45.969  1.00 170.91 ? 20   DC  T OP1   1 
ATOM   561   O  OP2   . DC  B 2  20   ? 19.276  3.761   46.360  1.00 157.95 ? 20   DC  T OP2   1 
ATOM   562   O  "O5'" . DC  B 2  20   ? 18.759  1.324   45.952  1.00 143.10 ? 20   DC  T "O5'" 1 
ATOM   563   C  "C5'" . DC  B 2  20   ? 19.061  -0.071  46.009  1.00 123.95 ? 20   DC  T "C5'" 1 
ATOM   564   C  "C4'" . DC  B 2  20   ? 17.975  -0.876  45.330  1.00 103.83 ? 20   DC  T "C4'" 1 
ATOM   565   O  "O4'" . DC  B 2  20   ? 16.791  -0.875  46.162  1.00 99.06  ? 20   DC  T "O4'" 1 
ATOM   566   C  "C3'" . DC  B 2  20   ? 17.521  -0.311  43.998  1.00 94.82  ? 20   DC  T "C3'" 1 
ATOM   567   O  "O3'" . DC  B 2  20   ? 18.323  -0.828  42.954  1.00 107.49 ? 20   DC  T "O3'" 1 
ATOM   568   C  "C2'" . DC  B 2  20   ? 16.087  -0.809  43.895  1.00 82.40  ? 20   DC  T "C2'" 1 
ATOM   569   C  "C1'" . DC  B 2  20   ? 15.630  -0.809  45.351  1.00 96.51  ? 20   DC  T "C1'" 1 
ATOM   570   N  N1    . DC  B 2  20   ? 14.815  0.391   45.775  1.00 115.20 ? 20   DC  T N1    1 
ATOM   571   C  C2    . DC  B 2  20   ? 13.444  0.443   45.491  1.00 120.36 ? 20   DC  T C2    1 
ATOM   572   O  O2    . DC  B 2  20   ? 12.930  -0.486  44.859  1.00 119.47 ? 20   DC  T O2    1 
ATOM   573   N  N3    . DC  B 2  20   ? 12.724  1.520   45.912  1.00 124.72 ? 20   DC  T N3    1 
ATOM   574   C  C4    . DC  B 2  20   ? 13.324  2.499   46.593  1.00 136.00 ? 20   DC  T C4    1 
ATOM   575   N  N4    . DC  B 2  20   ? 12.584  3.541   46.992  1.00 135.97 ? 20   DC  T N4    1 
ATOM   576   C  C5    . DC  B 2  20   ? 14.713  2.452   46.899  1.00 144.79 ? 20   DC  T C5    1 
ATOM   577   C  C6    . DC  B 2  20   ? 15.408  1.391   46.481  1.00 135.14 ? 20   DC  T C6    1 
ATOM   578   P  P     . DC  B 2  21   ? 18.787  0.129   41.750  1.00 108.08 ? 21   DC  T P     1 
ATOM   579   O  OP1   . DC  B 2  21   ? 19.808  -0.626  40.986  1.00 98.01  ? 21   DC  T OP1   1 
ATOM   580   O  OP2   . DC  B 2  21   ? 19.119  1.464   42.308  1.00 134.16 ? 21   DC  T OP2   1 
ATOM   581   O  "O5'" . DC  B 2  21   ? 17.476  0.273   40.847  1.00 92.56  ? 21   DC  T "O5'" 1 
ATOM   582   C  "C5'" . DC  B 2  21   ? 17.151  -0.753  39.935  1.00 94.99  ? 21   DC  T "C5'" 1 
ATOM   583   C  "C4'" . DC  B 2  21   ? 15.661  -0.811  39.680  1.00 91.97  ? 21   DC  T "C4'" 1 
ATOM   584   O  "O4'" . DC  B 2  21   ? 14.938  -0.684  40.928  1.00 81.50  ? 21   DC  T "O4'" 1 
ATOM   585   C  "C3'" . DC  B 2  21   ? 15.092  0.290   38.826  1.00 99.14  ? 21   DC  T "C3'" 1 
ATOM   586   O  "O3'" . DC  B 2  21   ? 15.347  0.031   37.455  1.00 106.91 ? 21   DC  T "O3'" 1 
ATOM   587   C  "C2'" . DC  B 2  21   ? 13.610  0.164   39.162  1.00 81.06  ? 21   DC  T "C2'" 1 
ATOM   588   C  "C1'" . DC  B 2  21   ? 13.650  -0.162  40.658  1.00 80.54  ? 21   DC  T "C1'" 1 
ATOM   589   N  N1    . DC  B 2  21   ? 13.403  1.026   41.532  1.00 111.12 ? 21   DC  T N1    1 
ATOM   590   C  C2    . DC  B 2  21   ? 12.096  1.473   41.716  1.00 121.12 ? 21   DC  T C2    1 
ATOM   591   O  O2    . DC  B 2  21   ? 11.177  0.865   41.158  1.00 111.15 ? 21   DC  T O2    1 
ATOM   592   N  N3    . DC  B 2  21   ? 11.872  2.554   42.502  1.00 118.81 ? 21   DC  T N3    1 
ATOM   593   C  C4    . DC  B 2  21   ? 12.898  3.175   43.089  1.00 103.17 ? 21   DC  T C4    1 
ATOM   594   N  N4    . DC  B 2  21   ? 12.630  4.234   43.852  1.00 100.35 ? 21   DC  T N4    1 
ATOM   595   C  C5    . DC  B 2  21   ? 14.240  2.738   42.911  1.00 102.78 ? 21   DC  T C5    1 
ATOM   596   C  C6    . DC  B 2  21   ? 14.446  1.673   42.127  1.00 113.43 ? 21   DC  T C6    1 
ATOM   597   P  P     . DT  B 2  22   ? 15.505  1.261   36.430  1.00 95.29  ? 22   DT  T P     1 
ATOM   598   O  OP1   . DT  B 2  22   ? 15.916  0.704   35.123  1.00 92.98  ? 22   DT  T OP1   1 
ATOM   599   O  OP2   . DT  B 2  22   ? 16.332  2.304   37.085  1.00 131.14 ? 22   DT  T OP2   1 
ATOM   600   O  "O5'" . DT  B 2  22   ? 14.016  1.819   36.279  1.00 83.63  ? 22   DT  T "O5'" 1 
ATOM   601   C  "C5'" . DT  B 2  22   ? 13.028  0.981   35.724  1.00 82.22  ? 22   DT  T "C5'" 1 
ATOM   602   C  "C4'" . DT  B 2  22   ? 11.635  1.517   35.977  1.00 87.53  ? 22   DT  T "C4'" 1 
ATOM   603   O  "O4'" . DT  B 2  22   ? 11.411  1.704   37.396  1.00 80.61  ? 22   DT  T "O4'" 1 
ATOM   604   C  "C3'" . DT  B 2  22   ? 11.350  2.879   35.394  1.00 98.92  ? 22   DT  T "C3'" 1 
ATOM   605   O  "O3'" . DT  B 2  22   ? 11.110  2.778   34.000  1.00 105.08 ? 22   DT  T "O3'" 1 
ATOM   606   C  "C2'" . DT  B 2  22   ? 10.092  3.241   36.168  1.00 94.25  ? 22   DT  T "C2'" 1 
ATOM   607   C  "C1'" . DT  B 2  22   ? 10.453  2.741   37.570  1.00 82.94  ? 22   DT  T "C1'" 1 
ATOM   608   N  N1    . DT  B 2  22   ? 11.029  3.814   38.470  1.00 86.65  ? 22   DT  T N1    1 
ATOM   609   C  C2    . DT  B 2  22   ? 10.184  4.762   38.996  1.00 93.71  ? 22   DT  T C2    1 
ATOM   610   O  O2    . DT  B 2  22   ? 8.987   4.784   38.771  1.00 91.05  ? 22   DT  T O2    1 
ATOM   611   N  N3    . DT  B 2  22   ? 10.786  5.691   39.802  1.00 107.03 ? 22   DT  T N3    1 
ATOM   612   C  C4    . DT  B 2  22   ? 12.124  5.774   40.132  1.00 116.10 ? 22   DT  T C4    1 
ATOM   613   O  O4    . DT  B 2  22   ? 12.564  6.656   40.868  1.00 115.05 ? 22   DT  T O4    1 
ATOM   614   C  C5    . DT  B 2  22   ? 12.966  4.752   39.548  1.00 111.30 ? 22   DT  T C5    1 
ATOM   615   C  C7    . DT  B 2  22   ? 14.439  4.737   39.834  1.00 115.70 ? 22   DT  T C7    1 
ATOM   616   C  C6    . DT  B 2  22   ? 12.385  3.830   38.754  1.00 94.81  ? 22   DT  T C6    1 
ATOM   617   P  P     . DC  B 2  23   ? 11.442  4.020   33.033  1.00 101.77 ? 23   DC  T P     1 
ATOM   618   O  OP1   . DC  B 2  23   ? 11.534  3.481   31.658  1.00 119.13 ? 23   DC  T OP1   1 
ATOM   619   O  OP2   . DC  B 2  23   ? 12.591  4.765   33.594  1.00 115.02 ? 23   DC  T OP2   1 
ATOM   620   O  "O5'" . DC  B 2  23   ? 10.138  4.936   33.150  1.00 107.87 ? 23   DC  T "O5'" 1 
ATOM   621   C  "C5'" . DC  B 2  23   ? 8.852   4.343   33.005  1.00 115.33 ? 23   DC  T "C5'" 1 
ATOM   622   C  "C4'" . DC  B 2  23   ? 7.773   5.298   33.457  1.00 116.08 ? 23   DC  T "C4'" 1 
ATOM   623   O  "O4'" . DC  B 2  23   ? 7.775   5.403   34.908  1.00 111.11 ? 23   DC  T "O4'" 1 
ATOM   624   C  "C3'" . DC  B 2  23   ? 7.963   6.721   32.988  1.00 120.21 ? 23   DC  T "C3'" 1 
ATOM   625   O  "O3'" . DC  B 2  23   ? 7.516   6.870   31.650  1.00 119.05 ? 23   DC  T "O3'" 1 
ATOM   626   C  "C2'" . DC  B 2  23   ? 7.085   7.469   33.977  1.00 115.85 ? 23   DC  T "C2'" 1 
ATOM   627   C  "C1'" . DC  B 2  23   ? 7.416   6.731   35.279  1.00 105.81 ? 23   DC  T "C1'" 1 
ATOM   628   N  N1    . DC  B 2  23   ? 8.557   7.355   36.075  1.00 92.33  ? 23   DC  T N1    1 
ATOM   629   C  C2    . DC  B 2  23   ? 8.350   8.557   36.773  1.00 95.91  ? 23   DC  T C2    1 
ATOM   630   O  O2    . DC  B 2  23   ? 7.236   9.092   36.727  1.00 96.27  ? 23   DC  T O2    1 
ATOM   631   N  N3    . DC  B 2  23   ? 9.384   9.097   37.478  1.00 99.23  ? 23   DC  T N3    1 
ATOM   632   C  C4    . DC  B 2  23   ? 10.570  8.480   37.505  1.00 92.51  ? 23   DC  T C4    1 
ATOM   633   N  N4    . DC  B 2  23   ? 11.560  9.041   38.209  1.00 87.04  ? 23   DC  T N4    1 
ATOM   634   C  C5    . DC  B 2  23   ? 10.794  7.257   36.809  1.00 85.18  ? 23   DC  T C5    1 
ATOM   635   C  C6    . DC  B 2  23   ? 9.775   6.741   36.112  1.00 85.28  ? 23   DC  T C6    1 
ATOM   636   P  P     . DT  B 2  24   ? 8.364   7.776   30.625  1.00 111.85 ? 24   DT  T P     1 
ATOM   637   O  OP1   . DT  B 2  24   ? 7.868   7.495   29.258  1.00 119.84 ? 24   DT  T OP1   1 
ATOM   638   O  OP2   . DT  B 2  24   ? 9.800   7.578   30.937  1.00 118.10 ? 24   DT  T OP2   1 
ATOM   639   O  "O5'" . DT  B 2  24   ? 7.968   9.277   31.026  1.00 109.35 ? 24   DT  T "O5'" 1 
ATOM   640   C  "C5'" . DT  B 2  24   ? 6.605   9.677   30.975  1.00 104.98 ? 24   DT  T "C5'" 1 
ATOM   641   C  "C4'" . DT  B 2  24   ? 6.328   10.842  31.911  1.00 104.64 ? 24   DT  T "C4'" 1 
ATOM   642   O  "O4'" . DT  B 2  24   ? 6.898   10.581  33.213  1.00 114.29 ? 24   DT  T "O4'" 1 
ATOM   643   C  "C3'" . DT  B 2  24   ? 6.934   12.166  31.503  1.00 105.88 ? 24   DT  T "C3'" 1 
ATOM   644   O  "O3'" . DT  B 2  24   ? 6.101   12.805  30.536  1.00 104.49 ? 24   DT  T "O3'" 1 
ATOM   645   C  "C2'" . DT  B 2  24   ? 6.928   12.923  32.831  1.00 112.38 ? 24   DT  T "C2'" 1 
ATOM   646   C  "C1'" . DT  B 2  24   ? 7.125   11.813  33.874  1.00 118.83 ? 24   DT  T "C1'" 1 
ATOM   647   N  N1    . DT  B 2  24   ? 8.505   11.801  34.486  1.00 132.63 ? 24   DT  T N1    1 
ATOM   648   C  C2    . DT  B 2  24   ? 8.876   12.816  35.348  1.00 140.47 ? 24   DT  T C2    1 
ATOM   649   O  O2    . DT  B 2  24   ? 8.143   13.741  35.653  1.00 140.50 ? 24   DT  T O2    1 
ATOM   650   N  N3    . DT  B 2  24   ? 10.153  12.711  35.840  1.00 142.21 ? 24   DT  T N3    1 
ATOM   651   C  C4    . DT  B 2  24   ? 11.076  11.716  35.567  1.00 135.53 ? 24   DT  T C4    1 
ATOM   652   O  O4    . DT  B 2  24   ? 12.200  11.709  36.058  1.00 123.53 ? 24   DT  T O4    1 
ATOM   653   C  C5    . DT  B 2  24   ? 10.625  10.686  34.662  1.00 140.47 ? 24   DT  T C5    1 
ATOM   654   C  C7    . DT  B 2  24   ? 11.542  9.560   34.289  1.00 146.62 ? 24   DT  T C7    1 
ATOM   655   C  C6    . DT  B 2  24   ? 9.377   10.777  34.171  1.00 138.19 ? 24   DT  T C6    1 
ATOM   656   P  P     . DC  B 2  25   ? 6.722   13.825  29.454  1.00 99.25  ? 25   DC  T P     1 
ATOM   657   O  OP1   . DC  B 2  25   ? 5.618   14.227  28.556  1.00 101.86 ? 25   DC  T OP1   1 
ATOM   658   O  OP2   . DC  B 2  25   ? 7.952   13.214  28.893  1.00 111.55 ? 25   DC  T OP2   1 
ATOM   659   O  "O5'" . DC  B 2  25   ? 7.154   15.107  30.312  1.00 106.35 ? 25   DC  T "O5'" 1 
ATOM   660   C  "C5'" . DC  B 2  25   ? 6.169   15.889  30.977  1.00 95.28  ? 25   DC  T "C5'" 1 
ATOM   661   C  "C4'" . DC  B 2  25   ? 6.820   16.827  31.971  1.00 100.33 ? 25   DC  T "C4'" 1 
ATOM   662   O  "O4'" . DC  B 2  25   ? 7.655   16.079  32.880  1.00 101.22 ? 25   DC  T "O4'" 1 
ATOM   663   C  "C3'" . DC  B 2  25   ? 7.756   17.836  31.347  1.00 118.27 ? 25   DC  T "C3'" 1 
ATOM   664   O  "O3'" . DC  B 2  25   ? 7.024   18.990  30.970  1.00 143.24 ? 25   DC  T "O3'" 1 
ATOM   665   C  "C2'" . DC  B 2  25   ? 8.751   18.144  32.473  1.00 109.25 ? 25   DC  T "C2'" 1 
ATOM   666   C  "C1'" . DC  B 2  25   ? 8.628   16.947  33.426  1.00 104.42 ? 25   DC  T "C1'" 1 
ATOM   667   N  N1    . DC  B 2  25   ? 9.926   16.186  33.628  1.00 106.92 ? 25   DC  T N1    1 
ATOM   668   C  C2    . DC  B 2  25   ? 10.964  16.753  34.388  1.00 123.21 ? 25   DC  T C2    1 
ATOM   669   O  O2    . DC  B 2  25   ? 10.804  17.873  34.884  1.00 137.34 ? 25   DC  T O2    1 
ATOM   670   N  N3    . DC  B 2  25   ? 12.117  16.055  34.554  1.00 119.83 ? 25   DC  T N3    1 
ATOM   671   C  C4    . DC  B 2  25   ? 12.253  14.849  34.003  1.00 102.32 ? 25   DC  T C4    1 
ATOM   672   N  N4    . DC  B 2  25   ? 13.404  14.195  34.195  1.00 102.72 ? 25   DC  T N4    1 
ATOM   673   C  C5    . DC  B 2  25   ? 11.213  14.259  33.229  1.00 104.64 ? 25   DC  T C5    1 
ATOM   674   C  C6    . DC  B 2  25   ? 10.080  14.955  33.070  1.00 105.78 ? 25   DC  T C6    1 
ATOM   675   P  P     . DG  B 2  26   ? 7.579   19.961  29.817  1.00 145.16 ? 26   DG  T P     1 
ATOM   676   O  OP1   . DG  B 2  26   ? 6.426   20.718  29.282  1.00 146.21 ? 26   DG  T OP1   1 
ATOM   677   O  OP2   . DG  B 2  26   ? 8.402   19.139  28.896  1.00 127.83 ? 26   DG  T OP2   1 
ATOM   678   O  "O5'" . DG  B 2  26   ? 8.528   20.981  30.609  1.00 161.67 ? 26   DG  T "O5'" 1 
ATOM   679   C  "C5'" . DG  B 2  26   ? 8.079   21.579  31.829  1.00 153.05 ? 26   DG  T "C5'" 1 
ATOM   680   C  "C4'" . DG  B 2  26   ? 9.249   22.157  32.603  1.00 138.06 ? 26   DG  T "C4'" 1 
ATOM   681   O  "O4'" . DG  B 2  26   ? 10.112  21.093  33.075  1.00 134.16 ? 26   DG  T "O4'" 1 
ATOM   682   C  "C3'" . DG  B 2  26   ? 10.136  23.098  31.791  1.00 128.12 ? 26   DG  T "C3'" 1 
ATOM   683   O  "O3'" . DG  B 2  26   ? 10.128  24.374  32.377  1.00 117.48 ? 26   DG  T "O3'" 1 
ATOM   684   C  "C2'" . DG  B 2  26   ? 11.534  22.458  31.831  1.00 130.77 ? 26   DG  T "C2'" 1 
ATOM   685   C  "C1'" . DG  B 2  26   ? 11.447  21.538  33.039  1.00 138.61 ? 26   DG  T "C1'" 1 
ATOM   686   N  N9    . DG  B 2  26   ? 12.325  20.370  32.948  1.00 146.58 ? 26   DG  T N9    1 
ATOM   687   C  C8    . DG  B 2  26   ? 12.051  19.186  32.310  1.00 149.64 ? 26   DG  T C8    1 
ATOM   688   N  N7    . DG  B 2  26   ? 13.015  18.314  32.388  1.00 150.07 ? 26   DG  T N7    1 
ATOM   689   C  C5    . DG  B 2  26   ? 14.002  18.960  33.121  1.00 146.02 ? 26   DG  T C5    1 
ATOM   690   C  C6    . DG  B 2  26   ? 15.280  18.504  33.517  1.00 143.41 ? 26   DG  T C6    1 
ATOM   691   O  O6    . DG  B 2  26   ? 15.798  17.405  33.286  1.00 140.09 ? 26   DG  T O6    1 
ATOM   692   N  N1    . DG  B 2  26   ? 15.973  19.468  34.247  1.00 152.82 ? 26   DG  T N1    1 
ATOM   693   C  C2    . DG  B 2  26   ? 15.482  20.718  34.558  1.00 166.94 ? 26   DG  T C2    1 
ATOM   694   N  N2    . DG  B 2  26   ? 16.292  21.518  35.269  1.00 175.99 ? 26   DG  T N2    1 
ATOM   695   N  N3    . DG  B 2  26   ? 14.281  21.159  34.187  1.00 167.10 ? 26   DG  T N3    1 
ATOM   696   C  C4    . DG  B 2  26   ? 13.598  20.228  33.474  1.00 151.90 ? 26   DG  T C4    1 
ATOM   697   P  P     . DA  B 2  27   ? 10.644  25.630  31.529  1.00 140.32 ? 27   DA  T P     1 
ATOM   698   O  OP1   . DA  B 2  27   ? 9.970   26.841  32.052  1.00 157.62 ? 27   DA  T OP1   1 
ATOM   699   O  OP2   . DA  B 2  27   ? 10.517  25.250  30.103  1.00 133.29 ? 27   DA  T OP2   1 
ATOM   700   O  "O5'" . DA  B 2  27   ? 12.201  25.716  31.886  1.00 153.53 ? 27   DA  T "O5'" 1 
ATOM   701   C  "C5'" . DA  B 2  27   ? 12.619  25.694  33.249  1.00 147.60 ? 27   DA  T "C5'" 1 
ATOM   702   C  "C4'" . DA  B 2  27   ? 14.118  25.905  33.356  1.00 142.80 ? 27   DA  T "C4'" 1 
ATOM   703   O  "O4'" . DA  B 2  27   ? 14.795  24.620  33.408  1.00 129.44 ? 27   DA  T "O4'" 1 
ATOM   704   C  "C3'" . DA  B 2  27   ? 14.746  26.674  32.194  1.00 148.23 ? 27   DA  T "C3'" 1 
ATOM   705   O  "O3'" . DA  B 2  27   ? 15.682  27.617  32.692  1.00 159.97 ? 27   DA  T "O3'" 1 
ATOM   706   C  "C2'" . DA  B 2  27   ? 15.431  25.580  31.373  1.00 143.44 ? 27   DA  T "C2'" 1 
ATOM   707   C  "C1'" . DA  B 2  27   ? 15.841  24.599  32.459  1.00 141.10 ? 27   DA  T "C1'" 1 
ATOM   708   N  N9    . DA  B 2  27   ? 15.986  23.229  31.981  1.00 155.27 ? 27   DA  T N9    1 
ATOM   709   C  C8    . DA  B 2  27   ? 15.061  22.503  31.286  1.00 157.82 ? 27   DA  T C8    1 
ATOM   710   N  N7    . DA  B 2  27   ? 15.454  21.288  30.990  1.00 156.17 ? 27   DA  T N7    1 
ATOM   711   C  C5    . DA  B 2  27   ? 16.726  21.210  31.532  1.00 158.29 ? 27   DA  T C5    1 
ATOM   712   C  C6    . DA  B 2  27   ? 17.677  20.176  31.562  1.00 158.08 ? 27   DA  T C6    1 
ATOM   713   N  N6    . DA  B 2  27   ? 17.471  18.986  31.004  1.00 163.94 ? 27   DA  T N6    1 
ATOM   714   N  N1    . DA  B 2  27   ? 18.851  20.416  32.185  1.00 152.28 ? 27   DA  T N1    1 
ATOM   715   C  C2    . DA  B 2  27   ? 19.050  21.617  32.742  1.00 159.98 ? 27   DA  T C2    1 
ATOM   716   N  N3    . DA  B 2  27   ? 18.228  22.670  32.779  1.00 167.48 ? 27   DA  T N3    1 
ATOM   717   C  C4    . DA  B 2  27   ? 17.071  22.396  32.150  1.00 162.64 ? 27   DA  T C4    1 
ATOM   718   P  P     . DT  B 2  28   ? 15.940  28.989  31.898  1.00 177.02 ? 28   DT  T P     1 
ATOM   719   O  OP1   . DT  B 2  28   ? 15.464  30.098  32.759  1.00 175.37 ? 28   DT  T OP1   1 
ATOM   720   O  OP2   . DT  B 2  28   ? 15.399  28.817  30.529  1.00 184.76 ? 28   DT  T OP2   1 
ATOM   721   O  "O5'" . DT  B 2  28   ? 17.535  29.067  31.779  1.00 179.51 ? 28   DT  T "O5'" 1 
ATOM   722   C  "C5'" . DT  B 2  28   ? 18.251  27.987  31.188  1.00 169.47 ? 28   DT  T "C5'" 1 
ATOM   723   C  "C4'" . DT  B 2  28   ? 19.648  27.874  31.774  1.00 157.99 ? 28   DT  T "C4'" 1 
ATOM   724   O  "O4'" . DT  B 2  28   ? 19.948  26.475  32.017  1.00 153.05 ? 28   DT  T "O4'" 1 
ATOM   725   C  "C3'" . DT  B 2  28   ? 20.764  28.381  30.869  1.00 156.48 ? 28   DT  T "C3'" 1 
ATOM   726   O  "O3'" . DT  B 2  28   ? 21.869  28.841  31.651  1.00 141.91 ? 28   DT  T "O3'" 1 
ATOM   727   C  "C2'" . DT  B 2  28   ? 21.124  27.134  30.070  1.00 162.68 ? 28   DT  T "C2'" 1 
ATOM   728   C  "C1'" . DT  B 2  28   ? 20.940  26.028  31.110  1.00 162.80 ? 28   DT  T "C1'" 1 
ATOM   729   N  N1    . DT  B 2  28   ? 20.499  24.721  30.519  1.00 169.67 ? 28   DT  T N1    1 
ATOM   730   C  C2    . DT  B 2  28   ? 21.356  23.646  30.551  1.00 166.59 ? 28   DT  T C2    1 
ATOM   731   O  O2    . DT  B 2  28   ? 22.469  23.694  31.047  1.00 154.27 ? 28   DT  T O2    1 
ATOM   732   N  N3    . DT  B 2  28   ? 20.858  22.499  29.978  1.00 169.14 ? 28   DT  T N3    1 
ATOM   733   C  C4    . DT  B 2  28   ? 19.613  22.327  29.385  1.00 149.01 ? 28   DT  T C4    1 
ATOM   734   O  O4    . DT  B 2  28   ? 19.255  21.256  28.895  1.00 116.69 ? 28   DT  T O4    1 
ATOM   735   C  C5    . DT  B 2  28   ? 18.765  23.497  29.385  1.00 155.53 ? 28   DT  T C5    1 
ATOM   736   C  C7    . DT  B 2  28   ? 17.396  23.435  28.773  1.00 140.01 ? 28   DT  T C7    1 
ATOM   737   C  C6    . DT  B 2  28   ? 19.244  24.624  29.943  1.00 170.66 ? 28   DT  T C6    1 
ATOM   738   P  P     . DC  C 3  2    ? 21.451  13.691  63.960  1.00 238.57 ? 2    DC  N P     1 
ATOM   739   O  OP1   . DC  C 3  2    ? 20.250  12.866  63.688  1.00 240.23 ? 2    DC  N OP1   1 
ATOM   740   O  OP2   . DC  C 3  2    ? 22.214  14.279  62.834  1.00 231.66 ? 2    DC  N OP2   1 
ATOM   741   O  "O5'" . DC  C 3  2    ? 22.456  12.851  64.884  1.00 240.99 ? 2    DC  N "O5'" 1 
ATOM   742   C  "C5'" . DC  C 3  2    ? 21.973  11.739  65.630  1.00 244.53 ? 2    DC  N "C5'" 1 
ATOM   743   C  "C4'" . DC  C 3  2    ? 22.549  10.431  65.106  1.00 247.23 ? 2    DC  N "C4'" 1 
ATOM   744   O  "O4'" . DC  C 3  2    ? 22.720  10.507  63.674  1.00 249.25 ? 2    DC  N "O4'" 1 
ATOM   745   C  "C3'" . DC  C 3  2    ? 23.909  10.046  65.673  1.00 244.43 ? 2    DC  N "C3'" 1 
ATOM   746   O  "O3'" . DC  C 3  2    ? 23.762  9.209   66.876  1.00 240.24 ? 2    DC  N "O3'" 1 
ATOM   747   C  "C2'" . DC  C 3  2    ? 24.619  9.328   64.520  1.00 244.91 ? 2    DC  N "C2'" 1 
ATOM   748   C  "C1'" . DC  C 3  2    ? 23.920  9.866   63.272  1.00 246.52 ? 2    DC  N "C1'" 1 
ATOM   749   N  N1    . DC  C 3  2    ? 24.705  10.848  62.436  1.00 245.93 ? 2    DC  N N1    1 
ATOM   750   C  C2    . DC  C 3  2    ? 25.482  10.396  61.362  1.00 242.25 ? 2    DC  N C2    1 
ATOM   751   O  O2    . DC  C 3  2    ? 25.566  9.181   61.149  1.00 240.03 ? 2    DC  N O2    1 
ATOM   752   N  N3    . DC  C 3  2    ? 26.140  11.310  60.596  1.00 237.55 ? 2    DC  N N3    1 
ATOM   753   C  C4    . DC  C 3  2    ? 26.021  12.616  60.860  1.00 229.88 ? 2    DC  N C4    1 
ATOM   754   N  N4    . DC  C 3  2    ? 26.683  13.482  60.084  1.00 220.02 ? 2    DC  N N4    1 
ATOM   755   C  C5    . DC  C 3  2    ? 25.218  13.090  61.935  1.00 235.13 ? 2    DC  N C5    1 
ATOM   756   C  C6    . DC  C 3  2    ? 24.581  12.183  62.680  1.00 242.93 ? 2    DC  N C6    1 
ATOM   757   P  P     . DA  C 3  3    ? 23.130  7.716   66.875  1.00 227.76 ? 3    DA  N P     1 
ATOM   758   O  OP1   . DA  C 3  3    ? 21.998  7.495   65.950  1.00 229.39 ? 3    DA  N OP1   1 
ATOM   759   O  OP2   . DA  C 3  3    ? 22.925  7.410   68.305  1.00 226.86 ? 3    DA  N OP2   1 
ATOM   760   O  "O5'" . DA  C 3  3    ? 24.318  6.776   66.394  1.00 216.81 ? 3    DA  N "O5'" 1 
ATOM   761   C  "C5'" . DA  C 3  3    ? 25.407  6.539   67.245  1.00 208.35 ? 3    DA  N "C5'" 1 
ATOM   762   C  "C4'" . DA  C 3  3    ? 26.605  6.096   66.443  1.00 205.80 ? 3    DA  N "C4'" 1 
ATOM   763   O  "O4'" . DA  C 3  3    ? 26.831  7.044   65.359  1.00 206.68 ? 3    DA  N "O4'" 1 
ATOM   764   C  "C3'" . DA  C 3  3    ? 27.911  6.050   67.226  1.00 202.09 ? 3    DA  N "C3'" 1 
ATOM   765   O  "O3'" . DA  C 3  3    ? 28.758  5.060   66.673  1.00 196.25 ? 3    DA  N "O3'" 1 
ATOM   766   C  "C2'" . DA  C 3  3    ? 28.463  7.438   66.969  1.00 202.67 ? 3    DA  N "C2'" 1 
ATOM   767   C  "C1'" . DA  C 3  3    ? 28.124  7.584   65.494  1.00 207.58 ? 3    DA  N "C1'" 1 
ATOM   768   N  N9    . DA  C 3  3    ? 28.143  8.968   65.025  1.00 220.18 ? 3    DA  N N9    1 
ATOM   769   C  C8    . DA  C 3  3    ? 27.701  10.074  65.698  1.00 227.41 ? 3    DA  N C8    1 
ATOM   770   N  N7    . DA  C 3  3    ? 27.862  11.197  65.037  1.00 230.25 ? 3    DA  N N7    1 
ATOM   771   C  C5    . DA  C 3  3    ? 28.477  10.805  63.860  1.00 227.07 ? 3    DA  N C5    1 
ATOM   772   C  C6    . DA  C 3  3    ? 28.922  11.526  62.734  1.00 219.49 ? 3    DA  N C6    1 
ATOM   773   N  N6    . DA  C 3  3    ? 28.804  12.853  62.615  1.00 213.42 ? 3    DA  N N6    1 
ATOM   774   N  N1    . DA  C 3  3    ? 29.492  10.828  61.730  1.00 217.25 ? 3    DA  N N1    1 
ATOM   775   C  C2    . DA  C 3  3    ? 29.610  9.501   61.850  1.00 220.78 ? 3    DA  N C2    1 
ATOM   776   N  N3    . DA  C 3  3    ? 29.230  8.714   62.856  1.00 225.83 ? 3    DA  N N3    1 
ATOM   777   C  C4    . DA  C 3  3    ? 28.666  9.435   63.839  1.00 226.00 ? 3    DA  N C4    1 
ATOM   778   P  P     . DG  C 3  4    ? 29.587  4.061   67.620  1.00 180.85 ? 4    DG  N P     1 
ATOM   779   O  OP1   . DG  C 3  4    ? 28.616  3.247   68.387  1.00 179.70 ? 4    DG  N OP1   1 
ATOM   780   O  OP2   . DG  C 3  4    ? 30.611  4.856   68.333  1.00 179.10 ? 4    DG  N OP2   1 
ATOM   781   O  "O5'" . DG  C 3  4    ? 30.330  3.108   66.576  1.00 178.52 ? 4    DG  N "O5'" 1 
ATOM   782   C  "C5'" . DG  C 3  4    ? 30.167  3.338   65.173  1.00 181.33 ? 4    DG  N "C5'" 1 
ATOM   783   C  "C4'" . DG  C 3  4    ? 31.471  3.796   64.551  1.00 181.73 ? 4    DG  N "C4'" 1 
ATOM   784   O  "O4'" . DG  C 3  4    ? 31.370  5.197   64.154  1.00 179.53 ? 4    DG  N "O4'" 1 
ATOM   785   C  "C3'" . DG  C 3  4    ? 32.678  3.717   65.490  1.00 178.39 ? 4    DG  N "C3'" 1 
ATOM   786   O  "O3'" . DG  C 3  4    ? 33.819  3.262   64.780  1.00 181.42 ? 4    DG  N "O3'" 1 
ATOM   787   C  "C2'" . DG  C 3  4    ? 32.844  5.164   65.926  1.00 177.27 ? 4    DG  N "C2'" 1 
ATOM   788   C  "C1'" . DG  C 3  4    ? 32.515  5.864   64.624  1.00 178.63 ? 4    DG  N "C1'" 1 
ATOM   789   N  N9    . DG  C 3  4    ? 32.241  7.296   64.762  1.00 183.58 ? 4    DG  N N9    1 
ATOM   790   C  C8    . DG  C 3  4    ? 31.628  7.926   65.817  1.00 184.54 ? 4    DG  N C8    1 
ATOM   791   N  N7    . DG  C 3  4    ? 31.531  9.219   65.669  1.00 185.08 ? 4    DG  N N7    1 
ATOM   792   C  C5    . DG  C 3  4    ? 32.131  9.466   64.440  1.00 184.05 ? 4    DG  N C5    1 
ATOM   793   C  C6    . DG  C 3  4    ? 32.327  10.687  63.748  1.00 179.90 ? 4    DG  N C6    1 
ATOM   794   O  O6    . DG  C 3  4    ? 31.997  11.829  64.097  1.00 174.33 ? 4    DG  N O6    1 
ATOM   795   N  N1    . DG  C 3  4    ? 32.979  10.492  62.532  1.00 180.21 ? 4    DG  N N1    1 
ATOM   796   C  C2    . DG  C 3  4    ? 33.391  9.272   62.046  1.00 183.07 ? 4    DG  N C2    1 
ATOM   797   N  N2    . DG  C 3  4    ? 34.004  9.283   60.853  1.00 186.14 ? 4    DG  N N2    1 
ATOM   798   N  N3    . DG  C 3  4    ? 33.213  8.122   62.684  1.00 183.81 ? 4    DG  N N3    1 
ATOM   799   C  C4    . DG  C 3  4    ? 32.578  8.294   63.871  1.00 184.59 ? 4    DG  N C4    1 
ATOM   800   P  P     . DC  C 3  5    ? 34.929  2.373   65.529  1.00 186.56 ? 5    DC  N P     1 
ATOM   801   O  OP1   . DC  C 3  5    ? 34.750  0.976   65.071  1.00 190.36 ? 5    DC  N OP1   1 
ATOM   802   O  OP2   . DC  C 3  5    ? 34.850  2.683   66.974  1.00 194.19 ? 5    DC  N OP2   1 
ATOM   803   O  "O5'" . DC  C 3  5    ? 36.318  2.931   64.961  1.00 173.43 ? 5    DC  N "O5'" 1 
ATOM   804   C  "C5'" . DC  C 3  5    ? 36.692  2.658   63.616  1.00 169.28 ? 5    DC  N "C5'" 1 
ATOM   805   C  "C4'" . DC  C 3  5    ? 37.198  3.912   62.928  1.00 174.12 ? 5    DC  N "C4'" 1 
ATOM   806   O  "O4'" . DC  C 3  5    ? 36.271  4.988   63.152  1.00 176.72 ? 5    DC  N "O4'" 1 
ATOM   807   C  "C3'" . DC  C 3  5    ? 38.524  4.435   63.447  1.00 180.49 ? 5    DC  N "C3'" 1 
ATOM   808   O  "O3'" . DC  C 3  5    ? 39.589  3.827   62.728  1.00 185.37 ? 5    DC  N "O3'" 1 
ATOM   809   C  "C2'" . DC  C 3  5    ? 38.447  5.940   63.155  1.00 185.27 ? 5    DC  N "C2'" 1 
ATOM   810   C  "C1'" . DC  C 3  5    ? 36.952  6.220   63.017  1.00 185.11 ? 5    DC  N "C1'" 1 
ATOM   811   N  N1    . DC  C 3  5    ? 36.389  7.197   64.021  1.00 188.12 ? 5    DC  N N1    1 
ATOM   812   C  C2    . DC  C 3  5    ? 36.333  8.562   63.709  1.00 181.98 ? 5    DC  N C2    1 
ATOM   813   O  O2    . DC  C 3  5    ? 36.782  8.951   62.627  1.00 174.62 ? 5    DC  N O2    1 
ATOM   814   N  N3    . DC  C 3  5    ? 35.796  9.423   64.613  1.00 180.04 ? 5    DC  N N3    1 
ATOM   815   C  C4    . DC  C 3  5    ? 35.323  8.967   65.774  1.00 173.18 ? 5    DC  N C4    1 
ATOM   816   N  N4    . DC  C 3  5    ? 34.802  9.850   66.634  1.00 170.94 ? 5    DC  N N4    1 
ATOM   817   C  C5    . DC  C 3  5    ? 35.365  7.584   66.105  1.00 177.70 ? 5    DC  N C5    1 
ATOM   818   C  C6    . DC  C 3  5    ? 35.900  6.743   65.209  1.00 185.55 ? 5    DC  N C6    1 
ATOM   819   P  P     . DG  C 3  6    ? 41.057  3.728   63.375  1.00 189.48 ? 6    DG  N P     1 
ATOM   820   O  OP1   . DG  C 3  6    ? 41.352  2.289   63.540  1.00 194.95 ? 6    DG  N OP1   1 
ATOM   821   O  OP2   . DG  C 3  6    ? 41.115  4.613   64.561  1.00 193.58 ? 6    DG  N OP2   1 
ATOM   822   O  "O5'" . DG  C 3  6    ? 42.018  4.325   62.239  1.00 180.42 ? 6    DG  N "O5'" 1 
ATOM   823   C  "C5'" . DG  C 3  6    ? 41.488  5.194   61.237  1.00 181.24 ? 6    DG  N "C5'" 1 
ATOM   824   C  "C4'" . DG  C 3  6    ? 42.058  6.597   61.371  1.00 188.47 ? 6    DG  N "C4'" 1 
ATOM   825   O  "O4'" . DG  C 3  6    ? 41.146  7.437   62.130  1.00 191.77 ? 6    DG  N "O4'" 1 
ATOM   826   C  "C3'" . DG  C 3  6    ? 43.408  6.686   62.088  1.00 188.79 ? 6    DG  N "C3'" 1 
ATOM   827   O  "O3'" . DG  C 3  6    ? 44.242  7.610   61.407  1.00 182.24 ? 6    DG  N "O3'" 1 
ATOM   828   C  "C2'" . DG  C 3  6    ? 43.025  7.203   63.477  1.00 192.01 ? 6    DG  N "C2'" 1 
ATOM   829   C  "C1'" . DG  C 3  6    ? 41.877  8.127   63.117  1.00 195.85 ? 6    DG  N "C1'" 1 
ATOM   830   N  N9    . DG  C 3  6    ? 40.982  8.455   64.229  1.00 202.91 ? 6    DG  N N9    1 
ATOM   831   C  C8    . DG  C 3  6    ? 40.493  7.607   65.195  1.00 201.17 ? 6    DG  N C8    1 
ATOM   832   N  N7    . DG  C 3  6    ? 39.696  8.191   66.047  1.00 194.70 ? 6    DG  N N7    1 
ATOM   833   C  C5    . DG  C 3  6    ? 39.668  9.515   65.628  1.00 203.77 ? 6    DG  N C5    1 
ATOM   834   C  C6    . DG  C 3  6    ? 38.983  10.628  66.164  1.00 210.13 ? 6    DG  N C6    1 
ATOM   835   O  O6    . DG  C 3  6    ? 38.237  10.667  67.153  1.00 206.68 ? 6    DG  N O6    1 
ATOM   836   N  N1    . DG  C 3  6    ? 39.232  11.788  65.428  1.00 217.46 ? 6    DG  N N1    1 
ATOM   837   C  C2    . DG  C 3  6    ? 40.044  11.860  64.319  1.00 216.65 ? 6    DG  N C2    1 
ATOM   838   N  N2    . DG  C 3  6    ? 40.166  13.062  63.736  1.00 213.02 ? 6    DG  N N2    1 
ATOM   839   N  N3    . DG  C 3  6    ? 40.687  10.824  63.809  1.00 215.73 ? 6    DG  N N3    1 
ATOM   840   C  C4    . DG  C 3  6    ? 40.455  9.690   64.511  1.00 207.69 ? 6    DG  N C4    1 
ATOM   841   P  P     . DA  C 3  7    ? 45.762  7.227   61.057  1.00 174.67 ? 7    DA  N P     1 
ATOM   842   O  OP1   . DA  C 3  7    ? 45.890  7.246   59.582  1.00 175.31 ? 7    DA  N OP1   1 
ATOM   843   O  OP2   . DA  C 3  7    ? 46.111  6.006   61.816  1.00 170.49 ? 7    DA  N OP2   1 
ATOM   844   O  "O5'" . DA  C 3  7    ? 46.601  8.443   61.666  1.00 178.59 ? 7    DA  N "O5'" 1 
ATOM   845   C  "C5'" . DA  C 3  7    ? 46.060  9.184   62.746  1.00 180.92 ? 7    DA  N "C5'" 1 
ATOM   846   C  "C4'" . DA  C 3  7    ? 46.143  10.674  62.481  1.00 182.41 ? 7    DA  N "C4'" 1 
ATOM   847   O  "O4'" . DA  C 3  7    ? 45.046  11.334  63.157  1.00 181.36 ? 7    DA  N "O4'" 1 
ATOM   848   C  "C3'" . DA  C 3  7    ? 47.374  11.333  63.054  1.00 188.87 ? 7    DA  N "C3'" 1 
ATOM   849   O  "O3'" . DA  C 3  7    ? 47.564  12.616  62.462  1.00 199.59 ? 7    DA  N "O3'" 1 
ATOM   850   C  "C2'" . DA  C 3  7    ? 46.978  11.447  64.517  1.00 187.64 ? 7    DA  N "C2'" 1 
ATOM   851   C  "C1'" . DA  C 3  7    ? 45.500  11.835  64.406  1.00 187.01 ? 7    DA  N "C1'" 1 
ATOM   852   N  N9    . DA  C 3  7    ? 44.651  11.270  65.458  1.00 191.85 ? 7    DA  N N9    1 
ATOM   853   C  C8    . DA  C 3  7    ? 44.589  9.962   65.852  1.00 191.71 ? 7    DA  N C8    1 
ATOM   854   N  N7    . DA  C 3  7    ? 43.725  9.737   66.813  1.00 191.55 ? 7    DA  N N7    1 
ATOM   855   C  C5    . DA  C 3  7    ? 43.176  10.983  67.067  1.00 194.01 ? 7    DA  N C5    1 
ATOM   856   C  C6    . DA  C 3  7    ? 42.194  11.418  67.981  1.00 193.24 ? 7    DA  N C6    1 
ATOM   857   N  N6    . DA  C 3  7    ? 41.579  10.599  68.836  1.00 189.54 ? 7    DA  N N6    1 
ATOM   858   N  N1    . DA  C 3  7    ? 41.872  12.731  67.982  1.00 195.80 ? 7    DA  N N1    1 
ATOM   859   C  C2    . DA  C 3  7    ? 42.494  13.548  67.121  1.00 196.95 ? 7    DA  N C2    1 
ATOM   860   N  N3    . DA  C 3  7    ? 43.433  13.253  66.215  1.00 196.47 ? 7    DA  N N3    1 
ATOM   861   C  C4    . DA  C 3  7    ? 43.731  11.941  66.240  1.00 194.47 ? 7    DA  N C4    1 
ATOM   862   P  P     . DG  C 3  8    ? 48.928  13.434  62.714  1.00 208.57 ? 8    DG  N P     1 
ATOM   863   O  OP1   . DG  C 3  8    ? 49.149  14.297  61.532  1.00 200.83 ? 8    DG  N OP1   1 
ATOM   864   O  OP2   . DG  C 3  8    ? 49.973  12.484  63.146  1.00 210.94 ? 8    DG  N OP2   1 
ATOM   865   O  "O5'" . DG  C 3  8    ? 48.602  14.357  63.979  1.00 211.23 ? 8    DG  N "O5'" 1 
ATOM   866   C  "C5'" . DG  C 3  8    ? 47.948  15.607  63.795  1.00 205.43 ? 8    DG  N "C5'" 1 
ATOM   867   C  "C4'" . DG  C 3  8    ? 47.518  16.210  65.124  1.00 197.19 ? 8    DG  N "C4'" 1 
ATOM   868   O  "O4'" . DG  C 3  8    ? 46.704  15.257  65.866  1.00 187.80 ? 8    DG  N "O4'" 1 
ATOM   869   C  "C3'" . DG  C 3  8    ? 48.656  16.608  66.077  1.00 201.46 ? 8    DG  N "C3'" 1 
ATOM   870   O  "O3'" . DG  C 3  8    ? 48.306  17.828  66.744  1.00 214.63 ? 8    DG  N "O3'" 1 
ATOM   871   C  "C2'" . DG  C 3  8    ? 48.675  15.437  67.053  1.00 191.85 ? 8    DG  N "C2'" 1 
ATOM   872   C  "C1'" . DG  C 3  8    ? 47.185  15.211  67.187  1.00 186.72 ? 8    DG  N "C1'" 1 
ATOM   873   N  N9    . DG  C 3  8    ? 46.805  13.945  67.806  1.00 189.74 ? 8    DG  N N9    1 
ATOM   874   C  C8    . DG  C 3  8    ? 47.363  12.708  67.600  1.00 190.47 ? 8    DG  N C8    1 
ATOM   875   N  N7    . DG  C 3  8    ? 46.801  11.760  68.301  1.00 191.53 ? 8    DG  N N7    1 
ATOM   876   C  C5    . DG  C 3  8    ? 45.814  12.418  69.025  1.00 194.67 ? 8    DG  N C5    1 
ATOM   877   C  C6    . DG  C 3  8    ? 44.877  11.919  69.964  1.00 201.37 ? 8    DG  N C6    1 
ATOM   878   O  O6    . DG  C 3  8    ? 44.726  10.754  70.358  1.00 203.67 ? 8    DG  N O6    1 
ATOM   879   N  N1    . DG  C 3  8    ? 44.060  12.933  70.460  1.00 201.65 ? 8    DG  N N1    1 
ATOM   880   C  C2    . DG  C 3  8    ? 44.137  14.258  70.097  1.00 198.80 ? 8    DG  N C2    1 
ATOM   881   N  N2    . DG  C 3  8    ? 43.265  15.092  70.680  1.00 195.12 ? 8    DG  N N2    1 
ATOM   882   N  N3    . DG  C 3  8    ? 45.006  14.734  69.222  1.00 197.81 ? 8    DG  N N3    1 
ATOM   883   C  C4    . DG  C 3  8    ? 45.807  13.762  68.727  1.00 194.10 ? 8    DG  N C4    1 
ATOM   884   P  P     . DA  C 3  9    ? 49.423  18.744  67.453  1.00 218.84 ? 9    DA  N P     1 
ATOM   885   O  OP1   . DA  C 3  9    ? 50.305  19.269  66.388  1.00 222.66 ? 9    DA  N OP1   1 
ATOM   886   O  OP2   . DA  C 3  9    ? 50.006  17.988  68.585  1.00 224.00 ? 9    DA  N OP2   1 
ATOM   887   O  "O5'" . DA  C 3  9    ? 48.582  19.964  68.067  1.00 214.86 ? 9    DA  N "O5'" 1 
ATOM   888   C  "C5'" . DA  C 3  9    ? 48.905  20.482  69.359  1.00 219.33 ? 9    DA  N "C5'" 1 
ATOM   889   C  "C4'" . DA  C 3  9    ? 47.883  20.039  70.396  1.00 223.59 ? 9    DA  N "C4'" 1 
ATOM   890   O  "O4'" . DA  C 3  9    ? 47.421  18.716  70.076  1.00 223.40 ? 9    DA  N "O4'" 1 
ATOM   891   C  "C3'" . DA  C 3  9    ? 48.417  19.931  71.815  1.00 229.57 ? 9    DA  N "C3'" 1 
ATOM   892   O  "O3'" . DA  C 3  9    ? 48.237  21.168  72.500  1.00 239.79 ? 9    DA  N "O3'" 1 
ATOM   893   C  "C2'" . DA  C 3  9    ? 47.560  18.825  72.442  1.00 226.32 ? 9    DA  N "C2'" 1 
ATOM   894   C  "C1'" . DA  C 3  9    ? 46.969  18.081  71.253  1.00 225.77 ? 9    DA  N "C1'" 1 
ATOM   895   N  N9    . DA  C 3  9    ? 47.339  16.671  71.191  1.00 228.53 ? 9    DA  N N9    1 
ATOM   896   C  C8    . DA  C 3  9    ? 48.301  16.111  70.403  1.00 227.80 ? 9    DA  N C8    1 
ATOM   897   N  N7    . DA  C 3  9    ? 48.405  14.811  70.535  1.00 227.27 ? 9    DA  N N7    1 
ATOM   898   C  C5    . DA  C 3  9    ? 47.447  14.496  71.481  1.00 229.76 ? 9    DA  N C5    1 
ATOM   899   C  C6    . DA  C 3  9    ? 47.054  13.276  72.062  1.00 234.48 ? 9    DA  N C6    1 
ATOM   900   N  N6    . DA  C 3  9    ? 47.612  12.101  71.755  1.00 235.55 ? 9    DA  N N6    1 
ATOM   901   N  N1    . DA  C 3  9    ? 46.060  13.310  72.971  1.00 234.62 ? 9    DA  N N1    1 
ATOM   902   C  C2    . DA  C 3  9    ? 45.500  14.487  73.277  1.00 233.69 ? 9    DA  N C2    1 
ATOM   903   N  N3    . DA  C 3  9    ? 45.784  15.698  72.797  1.00 232.89 ? 9    DA  N N3    1 
ATOM   904   C  C4    . DA  C 3  9    ? 46.775  15.631  71.893  1.00 230.25 ? 9    DA  N C4    1 
ATOM   905   P  P     . DG  C 3  10   ? 49.091  21.498  73.822  1.00 250.85 ? 10   DG  N P     1 
ATOM   906   O  OP1   . DG  C 3  10   ? 49.906  22.694  73.517  1.00 249.17 ? 10   DG  N OP1   1 
ATOM   907   O  OP2   . DG  C 3  10   ? 49.774  20.264  74.273  1.00 252.77 ? 10   DG  N OP2   1 
ATOM   908   O  "O5'" . DG  C 3  10   ? 47.987  21.899  74.916  1.00 258.93 ? 10   DG  N "O5'" 1 
ATOM   909   C  "C5'" . DG  C 3  10   ? 46.709  21.254  74.934  1.00 259.64 ? 10   DG  N "C5'" 1 
ATOM   910   C  "C4'" . DG  C 3  10   ? 46.601  20.275  76.094  1.00 261.52 ? 10   DG  N "C4'" 1 
ATOM   911   O  "O4'" . DG  C 3  10   ? 46.763  18.914  75.615  1.00 260.28 ? 10   DG  N "O4'" 1 
ATOM   912   C  "C3'" . DG  C 3  10   ? 47.637  20.465  77.210  1.00 262.14 ? 10   DG  N "C3'" 1 
ATOM   913   O  "O3'" . DG  C 3  10   ? 46.979  20.589  78.468  1.00 260.37 ? 10   DG  N "O3'" 1 
ATOM   914   C  "C2'" . DG  C 3  10   ? 48.494  19.195  77.141  1.00 261.84 ? 10   DG  N "C2'" 1 
ATOM   915   C  "C1'" . DG  C 3  10   ? 47.519  18.188  76.552  1.00 258.98 ? 10   DG  N "C1'" 1 
ATOM   916   N  N9    . DG  C 3  10   ? 48.169  17.065  75.873  1.00 249.85 ? 10   DG  N N9    1 
ATOM   917   C  C8    . DG  C 3  10   ? 49.148  17.130  74.911  1.00 244.99 ? 10   DG  N C8    1 
ATOM   918   N  N7    . DG  C 3  10   ? 49.535  15.962  74.480  1.00 241.49 ? 10   DG  N N7    1 
ATOM   919   C  C5    . DG  C 3  10   ? 48.770  15.061  75.207  1.00 244.44 ? 10   DG  N C5    1 
ATOM   920   C  C6    . DG  C 3  10   ? 48.752  13.646  75.174  1.00 243.44 ? 10   DG  N C6    1 
ATOM   921   O  O6    . DG  C 3  10   ? 49.435  12.887  74.471  1.00 242.44 ? 10   DG  N O6    1 
ATOM   922   N  N1    . DG  C 3  10   ? 47.826  13.121  76.075  1.00 243.63 ? 10   DG  N N1    1 
ATOM   923   C  C2    . DG  C 3  10   ? 47.021  13.871  76.901  1.00 241.80 ? 10   DG  N C2    1 
ATOM   924   N  N2    . DG  C 3  10   ? 46.189  13.189  77.702  1.00 240.77 ? 10   DG  N N2    1 
ATOM   925   N  N3    . DG  C 3  10   ? 47.028  15.197  76.940  1.00 242.44 ? 10   DG  N N3    1 
ATOM   926   C  C4    . DG  C 3  10   ? 47.924  15.723  76.070  1.00 245.75 ? 10   DG  N C4    1 
ATOM   927   P  P     . DA  C 3  11   ? 47.808  21.002  79.783  1.00 258.46 ? 11   DA  N P     1 
ATOM   928   O  OP1   . DA  C 3  11   ? 46.902  21.781  80.656  1.00 260.44 ? 11   DA  N OP1   1 
ATOM   929   O  OP2   . DA  C 3  11   ? 49.099  21.586  79.357  1.00 255.18 ? 11   DA  N OP2   1 
ATOM   930   O  "O5'" . DA  C 3  11   ? 48.119  19.604  80.490  1.00 264.48 ? 11   DA  N "O5'" 1 
ATOM   931   C  "C5'" . DA  C 3  11   ? 47.770  19.410  81.850  1.00 268.03 ? 11   DA  N "C5'" 1 
ATOM   932   C  "C4'" . DA  C 3  11   ? 46.806  18.249  81.995  1.00 270.42 ? 11   DA  N "C4'" 1 
ATOM   933   O  "O4'" . DA  C 3  11   ? 46.908  17.388  80.827  1.00 269.29 ? 11   DA  N "O4'" 1 
ATOM   934   C  "C3'" . DA  C 3  11   ? 47.097  17.337  83.172  1.00 271.14 ? 11   DA  N "C3'" 1 
ATOM   935   O  "O3'" . DA  C 3  11   ? 45.920  16.617  83.525  1.00 276.11 ? 11   DA  N "O3'" 1 
ATOM   936   C  "C2'" . DA  C 3  11   ? 48.143  16.418  82.567  1.00 266.56 ? 11   DA  N "C2'" 1 
ATOM   937   C  "C1'" . DA  C 3  11   ? 47.524  16.166  81.199  1.00 265.50 ? 11   DA  N "C1'" 1 
ATOM   938   N  N9    . DA  C 3  11   ? 48.491  15.790  80.169  1.00 261.01 ? 11   DA  N N9    1 
ATOM   939   C  C8    . DA  C 3  11   ? 49.254  16.632  79.410  1.00 258.92 ? 11   DA  N C8    1 
ATOM   940   N  N7    . DA  C 3  11   ? 50.039  16.015  78.558  1.00 256.57 ? 11   DA  N N7    1 
ATOM   941   C  C5    . DA  C 3  11   ? 49.774  14.673  78.772  1.00 258.96 ? 11   DA  N C5    1 
ATOM   942   C  C6    . DA  C 3  11   ? 50.285  13.499  78.182  1.00 260.54 ? 11   DA  N C6    1 
ATOM   943   N  N6    . DA  C 3  11   ? 51.209  13.506  77.217  1.00 255.83 ? 11   DA  N N6    1 
ATOM   944   N  N1    . DA  C 3  11   ? 49.808  12.313  78.626  1.00 265.43 ? 11   DA  N N1    1 
ATOM   945   C  C2    . DA  C 3  11   ? 48.881  12.312  79.593  1.00 265.66 ? 11   DA  N C2    1 
ATOM   946   N  N3    . DA  C 3  11   ? 48.327  13.351  80.224  1.00 264.29 ? 11   DA  N N3    1 
ATOM   947   C  C4    . DA  C 3  11   ? 48.821  14.514  79.761  1.00 260.85 ? 11   DA  N C4    1 
ATOM   948   P  P     . DG  C 3  12   ? 45.710  16.091  85.029  1.00 279.67 ? 12   DG  N P     1 
ATOM   949   O  OP1   . DG  C 3  12   ? 44.504  16.758  85.568  1.00 278.38 ? 12   DG  N OP1   1 
ATOM   950   O  OP2   . DG  C 3  12   ? 47.002  16.223  85.739  1.00 284.09 ? 12   DG  N OP2   1 
ATOM   951   O  "O5'" . DG  C 3  12   ? 45.399  14.529  84.855  1.00 275.78 ? 12   DG  N "O5'" 1 
ATOM   952   C  "C5'" . DG  C 3  12   ? 46.244  13.719  84.045  1.00 269.54 ? 12   DG  N "C5'" 1 
ATOM   953   C  "C4'" . DG  C 3  12   ? 46.596  12.425  84.752  1.00 263.42 ? 12   DG  N "C4'" 1 
ATOM   954   O  "O4'" . DG  C 3  12   ? 47.555  11.686  83.955  1.00 261.48 ? 12   DG  N "O4'" 1 
ATOM   955   C  "C3'" . DG  C 3  12   ? 47.238  12.595  86.122  1.00 258.05 ? 12   DG  N "C3'" 1 
ATOM   956   O  "O3'" . DG  C 3  12   ? 46.870  11.500  86.974  1.00 250.07 ? 12   DG  N "O3'" 1 
ATOM   957   C  "C2'" . DG  C 3  12   ? 48.733  12.614  85.801  1.00 259.23 ? 12   DG  N "C2'" 1 
ATOM   958   C  "C1'" . DG  C 3  12   ? 48.843  11.755  84.540  1.00 261.07 ? 12   DG  N "C1'" 1 
ATOM   959   N  N9    . DG  C 3  12   ? 49.772  12.312  83.558  1.00 262.41 ? 12   DG  N N9    1 
ATOM   960   C  C8    . DG  C 3  12   ? 50.005  13.643  83.320  1.00 262.47 ? 12   DG  N C8    1 
ATOM   961   N  N7    . DG  C 3  12   ? 50.889  13.862  82.390  1.00 261.62 ? 12   DG  N N7    1 
ATOM   962   C  C5    . DG  C 3  12   ? 51.278  12.594  81.985  1.00 262.14 ? 12   DG  N C5    1 
ATOM   963   C  C6    . DG  C 3  12   ? 52.213  12.205  80.999  1.00 262.19 ? 12   DG  N C6    1 
ATOM   964   O  O6    . DG  C 3  12   ? 52.908  12.932  80.275  1.00 258.44 ? 12   DG  N O6    1 
ATOM   965   N  N1    . DG  C 3  12   ? 52.313  10.819  80.901  1.00 265.17 ? 12   DG  N N1    1 
ATOM   966   C  C2    . DG  C 3  12   ? 51.591  9.921   81.656  1.00 264.95 ? 12   DG  N C2    1 
ATOM   967   N  N2    . DG  C 3  12   ? 51.821  8.620   81.417  1.00 262.23 ? 12   DG  N N2    1 
ATOM   968   N  N3    . DG  C 3  12   ? 50.706  10.274  82.584  1.00 265.67 ? 12   DG  N N3    1 
ATOM   969   C  C4    . DG  C 3  12   ? 50.601  11.623  82.694  1.00 263.48 ? 12   DG  N C4    1 
ATOM   970   P  P     . DA  C 3  13   ? 47.570  11.271  88.407  1.00 235.81 ? 13   DA  N P     1 
ATOM   971   O  OP1   . DA  C 3  13   ? 46.575  10.576  89.251  1.00 231.76 ? 13   DA  N OP1   1 
ATOM   972   O  OP2   . DA  C 3  13   ? 48.167  12.529  88.914  1.00 230.40 ? 13   DA  N OP2   1 
ATOM   973   O  "O5'" . DA  C 3  13   ? 48.737  10.233  88.077  1.00 238.24 ? 13   DA  N "O5'" 1 
ATOM   974   C  "C5'" . DA  C 3  13   ? 48.472  9.135   87.202  1.00 240.81 ? 13   DA  N "C5'" 1 
ATOM   975   C  "C4'" . DA  C 3  13   ? 49.749  8.400   86.829  1.00 239.74 ? 13   DA  N "C4'" 1 
ATOM   976   O  "O4'" . DA  C 3  13   ? 50.471  9.136   85.802  1.00 234.40 ? 13   DA  N "O4'" 1 
ATOM   977   C  "C3'" . DA  C 3  13   ? 50.741  8.197   87.975  1.00 241.85 ? 13   DA  N "C3'" 1 
ATOM   978   O  "O3'" . DA  C 3  13   ? 51.306  6.897   87.883  1.00 247.42 ? 13   DA  N "O3'" 1 
ATOM   979   C  "C2'" . DA  C 3  13   ? 51.785  9.278   87.705  1.00 235.19 ? 13   DA  N "C2'" 1 
ATOM   980   C  "C1'" . DA  C 3  13   ? 51.821  9.246   86.190  1.00 229.18 ? 13   DA  N "C1'" 1 
ATOM   981   N  N9    . DA  C 3  13   ? 52.396  10.440  85.574  1.00 223.28 ? 13   DA  N N9    1 
ATOM   982   C  C8    . DA  C 3  13   ? 52.091  11.743  85.849  1.00 222.79 ? 13   DA  N C8    1 
ATOM   983   N  N7    . DA  C 3  13   ? 52.765  12.610  85.130  1.00 222.08 ? 13   DA  N N7    1 
ATOM   984   C  C5    . DA  C 3  13   ? 53.574  11.819  84.332  1.00 224.34 ? 13   DA  N C5    1 
ATOM   985   C  C6    . DA  C 3  13   ? 54.532  12.128  83.347  1.00 227.12 ? 13   DA  N C6    1 
ATOM   986   N  N6    . DA  C 3  13   ? 54.843  13.379  82.991  1.00 226.15 ? 13   DA  N N6    1 
ATOM   987   N  N1    . DA  C 3  13   ? 55.158  11.099  82.738  1.00 226.91 ? 13   DA  N N1    1 
ATOM   988   C  C2    . DA  C 3  13   ? 54.840  9.847   83.091  1.00 224.43 ? 13   DA  N C2    1 
ATOM   989   N  N3    . DA  C 3  13   ? 53.963  9.434   84.004  1.00 223.39 ? 13   DA  N N3    1 
ATOM   990   C  C4    . DA  C 3  13   ? 53.357  10.479  84.592  1.00 223.22 ? 13   DA  N C4    1 
ATOM   991   P  P     . DG  C 3  14   ? 51.637  6.058   89.212  1.00 247.07 ? 14   DG  N P     1 
ATOM   992   O  OP1   . DG  C 3  14   ? 51.276  4.647   88.948  1.00 246.59 ? 14   DG  N OP1   1 
ATOM   993   O  OP2   . DG  C 3  14   ? 51.034  6.772   90.360  1.00 246.66 ? 14   DG  N OP2   1 
ATOM   994   O  "O5'" . DG  C 3  14   ? 53.226  6.172   89.347  1.00 243.74 ? 14   DG  N "O5'" 1 
ATOM   995   C  "C5'" . DG  C 3  14   ? 54.008  5.000   89.507  1.00 239.74 ? 14   DG  N "C5'" 1 
ATOM   996   C  "C4'" . DG  C 3  14   ? 54.710  4.637   88.211  1.00 237.63 ? 14   DG  N "C4'" 1 
ATOM   997   O  "O4'" . DG  C 3  14   ? 54.617  5.750   87.273  1.00 236.93 ? 14   DG  N "O4'" 1 
ATOM   998   C  "C3'" . DG  C 3  14   ? 56.201  4.355   88.352  1.00 237.80 ? 14   DG  N "C3'" 1 
ATOM   999   O  "O3'" . DG  C 3  14   ? 56.608  3.433   87.350  1.00 238.20 ? 14   DG  N "O3'" 1 
ATOM   1000  C  "C2'" . DG  C 3  14   ? 56.792  5.734   88.104  1.00 236.76 ? 14   DG  N "C2'" 1 
ATOM   1001  C  "C1'" . DG  C 3  14   ? 55.921  6.202   86.957  1.00 234.88 ? 14   DG  N "C1'" 1 
ATOM   1002  N  N9    . DG  C 3  14   ? 55.900  7.652   86.807  1.00 229.21 ? 14   DG  N N9    1 
ATOM   1003  C  C8    . DG  C 3  14   ? 55.093  8.534   87.474  1.00 227.58 ? 14   DG  N C8    1 
ATOM   1004  N  N7    . DG  C 3  14   ? 55.292  9.777   87.142  1.00 225.84 ? 14   DG  N N7    1 
ATOM   1005  C  C5    . DG  C 3  14   ? 56.309  9.719   86.202  1.00 224.64 ? 14   DG  N C5    1 
ATOM   1006  C  C6    . DG  C 3  14   ? 56.950  10.758  85.493  1.00 218.18 ? 14   DG  N C6    1 
ATOM   1007  O  O6    . DG  C 3  14   ? 56.729  11.974  85.559  1.00 215.41 ? 14   DG  N O6    1 
ATOM   1008  N  N1    . DG  C 3  14   ? 57.927  10.268  84.630  1.00 216.92 ? 14   DG  N N1    1 
ATOM   1009  C  C2    . DG  C 3  14   ? 58.246  8.937   84.476  1.00 216.29 ? 14   DG  N C2    1 
ATOM   1010  N  N2    . DG  C 3  14   ? 59.222  8.653   83.601  1.00 213.11 ? 14   DG  N N2    1 
ATOM   1011  N  N3    . DG  C 3  14   ? 57.655  7.953   85.142  1.00 220.67 ? 14   DG  N N3    1 
ATOM   1012  C  C4    . DG  C 3  14   ? 56.698  8.417   85.983  1.00 225.49 ? 14   DG  N C4    1 
ATOM   1013  P  P     . DA  C 3  15   ? 57.924  2.526   87.538  1.00 237.00 ? 15   DA  N P     1 
ATOM   1014  O  OP1   . DA  C 3  15   ? 58.439  2.305   86.170  1.00 236.22 ? 15   DA  N OP1   1 
ATOM   1015  O  OP2   . DA  C 3  15   ? 57.574  1.371   88.396  1.00 234.36 ? 15   DA  N OP2   1 
ATOM   1016  O  "O5'" . DA  C 3  15   ? 58.946  3.455   88.353  1.00 240.25 ? 15   DA  N "O5'" 1 
ATOM   1017  C  "C5'" . DA  C 3  15   ? 60.333  3.148   88.391  1.00 239.32 ? 15   DA  N "C5'" 1 
ATOM   1018  C  "C4'" . DA  C 3  15   ? 61.069  3.816   87.240  1.00 238.28 ? 15   DA  N "C4'" 1 
ATOM   1019  O  "O4'" . DA  C 3  15   ? 60.398  5.052   86.873  1.00 236.81 ? 15   DA  N "O4'" 1 
ATOM   1020  C  "C3'" . DA  C 3  15   ? 62.524  4.185   87.532  1.00 235.94 ? 15   DA  N "C3'" 1 
ATOM   1021  O  "O3'" . DA  C 3  15   ? 63.357  3.749   86.471  1.00 232.78 ? 15   DA  N "O3'" 1 
ATOM   1022  C  "C2'" . DA  C 3  15   ? 62.497  5.711   87.634  1.00 235.40 ? 15   DA  N "C2'" 1 
ATOM   1023  C  "C1'" . DA  C 3  15   ? 61.360  6.063   86.690  1.00 229.88 ? 15   DA  N "C1'" 1 
ATOM   1024  N  N9    . DA  C 3  15   ? 60.747  7.357   86.983  1.00 216.95 ? 15   DA  N N9    1 
ATOM   1025  C  C8    . DA  C 3  15   ? 59.716  7.605   87.846  1.00 213.85 ? 15   DA  N C8    1 
ATOM   1026  N  N7    . DA  C 3  15   ? 59.374  8.869   87.916  1.00 210.36 ? 15   DA  N N7    1 
ATOM   1027  C  C5    . DA  C 3  15   ? 60.246  9.498   87.044  1.00 214.22 ? 15   DA  N C5    1 
ATOM   1028  C  C6    . DA  C 3  15   ? 60.402  10.845  86.662  1.00 224.03 ? 15   DA  N C6    1 
ATOM   1029  N  N6    . DA  C 3  15   ? 59.647  11.839  87.143  1.00 229.38 ? 15   DA  N N6    1 
ATOM   1030  N  N1    . DA  C 3  15   ? 61.369  11.134  85.765  1.00 222.35 ? 15   DA  N N1    1 
ATOM   1031  C  C2    . DA  C 3  15   ? 62.123  10.137  85.285  1.00 214.84 ? 15   DA  N C2    1 
ATOM   1032  N  N3    . DA  C 3  15   ? 62.069  8.835   85.566  1.00 210.36 ? 15   DA  N N3    1 
ATOM   1033  C  C4    . DA  C 3  15   ? 61.099  8.580   86.459  1.00 212.55 ? 15   DA  N C4    1 
ATOM   1034  P  P     . DA  C 3  16   ? 64.902  3.410   86.749  1.00 228.34 ? 16   DA  N P     1 
ATOM   1035  O  OP1   . DA  C 3  16   ? 65.402  2.631   85.594  1.00 231.63 ? 16   DA  N OP1   1 
ATOM   1036  O  OP2   . DA  C 3  16   ? 64.987  2.835   88.110  1.00 224.10 ? 16   DA  N OP2   1 
ATOM   1037  O  "O5'" . DA  C 3  16   ? 65.618  4.846   86.755  1.00 225.06 ? 16   DA  N "O5'" 1 
ATOM   1038  C  "C5'" . DA  C 3  16   ? 65.571  5.672   85.589  1.00 217.08 ? 16   DA  N "C5'" 1 
ATOM   1039  C  "C4'" . DA  C 3  16   ? 66.246  7.014   85.837  1.00 209.38 ? 16   DA  N "C4'" 1 
ATOM   1040  O  "O4'" . DA  C 3  16   ? 65.277  7.978   86.283  1.00 213.90 ? 16   DA  N "O4'" 1 
ATOM   1041  C  "C3'" . DA  C 3  16   ? 67.320  7.012   86.920  1.00 196.75 ? 16   DA  N "C3'" 1 
ATOM   1042  O  "O3'" . DA  C 3  16   ? 68.603  6.818   86.334  1.00 180.92 ? 16   DA  N "O3'" 1 
ATOM   1043  C  "C2'" . DA  C 3  16   ? 67.201  8.404   87.577  1.00 204.23 ? 16   DA  N "C2'" 1 
ATOM   1044  C  "C1'" . DA  C 3  16   ? 65.976  9.031   86.899  1.00 211.56 ? 16   DA  N "C1'" 1 
ATOM   1045  N  N9    . DA  C 3  16   ? 65.078  9.727   87.824  1.00 208.51 ? 16   DA  N N9    1 
ATOM   1046  C  C8    . DA  C 3  16   ? 63.828  9.335   88.219  1.00 203.81 ? 16   DA  N C8    1 
ATOM   1047  N  N7    . DA  C 3  16   ? 63.251  10.165  89.058  1.00 200.76 ? 16   DA  N N7    1 
ATOM   1048  C  C5    . DA  C 3  16   ? 64.188  11.171  89.228  1.00 200.87 ? 16   DA  N C5    1 
ATOM   1049  C  C6    . DA  C 3  16   ? 64.188  12.351  89.999  1.00 193.56 ? 16   DA  N C6    1 
ATOM   1050  N  N6    . DA  C 3  16   ? 63.165  12.724  90.775  1.00 188.57 ? 16   DA  N N6    1 
ATOM   1051  N  N1    . DA  C 3  16   ? 65.285  13.136  89.942  1.00 191.48 ? 16   DA  N N1    1 
ATOM   1052  C  C2    . DA  C 3  16   ? 66.308  12.762  89.164  1.00 191.19 ? 16   DA  N C2    1 
ATOM   1053  N  N3    . DA  C 3  16   ? 66.424  11.679  88.397  1.00 195.65 ? 16   DA  N N3    1 
ATOM   1054  C  C4    . DA  C 3  16   ? 65.320  10.917  88.474  1.00 202.81 ? 16   DA  N C4    1 
ATOM   1055  N  N     . GLY D 4  3    ? 29.847  -8.592  14.993  1.00 133.25 ? 3    GLY A N     1 
ATOM   1056  C  CA    . GLY D 4  3    ? 30.772  -8.272  16.066  1.00 135.53 ? 3    GLY A CA    1 
ATOM   1057  C  C     . GLY D 4  3    ? 32.070  -7.641  15.596  1.00 137.22 ? 3    GLY A C     1 
ATOM   1058  O  O     . GLY D 4  3    ? 32.138  -7.079  14.501  1.00 150.54 ? 3    GLY A O     1 
ATOM   1059  N  N     . GLN D 4  4    ? 33.100  -7.731  16.434  1.00 122.54 ? 4    GLN A N     1 
ATOM   1060  C  CA    . GLN D 4  4    ? 34.403  -7.165  16.124  1.00 117.00 ? 4    GLN A CA    1 
ATOM   1061  C  C     . GLN D 4  4    ? 35.210  -8.110  15.232  1.00 125.89 ? 4    GLN A C     1 
ATOM   1062  O  O     . GLN D 4  4    ? 34.920  -9.305  15.121  1.00 138.38 ? 4    GLN A O     1 
ATOM   1063  C  CB    . GLN D 4  4    ? 35.168  -6.858  17.412  1.00 116.13 ? 4    GLN A CB    1 
ATOM   1064  C  CG    . GLN D 4  4    ? 34.431  -5.895  18.345  1.00 120.37 ? 4    GLN A CG    1 
ATOM   1065  C  CD    . GLN D 4  4    ? 35.130  -5.694  19.684  1.00 118.07 ? 4    GLN A CD    1 
ATOM   1066  O  OE1   . GLN D 4  4    ? 36.359  -5.712  19.771  1.00 120.32 ? 4    GLN A OE1   1 
ATOM   1067  N  NE2   . GLN D 4  4    ? 34.341  -5.501  20.735  1.00 109.86 ? 4    GLN A NE2   1 
ATOM   1068  N  N     . GLN D 4  5    ? 36.240  -7.555  14.596  1.00 126.66 ? 5    GLN A N     1 
ATOM   1069  C  CA    . GLN D 4  5    ? 37.050  -8.315  13.654  1.00 136.78 ? 5    GLN A CA    1 
ATOM   1070  C  C     . GLN D 4  5    ? 37.932  -9.330  14.382  1.00 136.66 ? 5    GLN A C     1 
ATOM   1071  O  O     . GLN D 4  5    ? 38.232  -9.198  15.572  1.00 145.37 ? 5    GLN A O     1 
ATOM   1072  C  CB    . GLN D 4  5    ? 37.909  -7.374  12.804  1.00 143.09 ? 5    GLN A CB    1 
ATOM   1073  C  CG    . GLN D 4  5    ? 37.137  -6.652  11.701  1.00 147.49 ? 5    GLN A CG    1 
ATOM   1074  C  CD    . GLN D 4  5    ? 37.069  -7.449  10.406  1.00 146.05 ? 5    GLN A CD    1 
ATOM   1075  O  OE1   . GLN D 4  5    ? 37.934  -8.279  10.129  1.00 161.72 ? 5    GLN A OE1   1 
ATOM   1076  N  NE2   . GLN D 4  5    ? 36.033  -7.201  9.609   1.00 121.83 ? 5    GLN A NE2   1 
ATOM   1077  N  N     . TYR D 4  6    ? 38.341  -10.361 13.645  1.00 129.55 ? 6    TYR A N     1 
ATOM   1078  C  CA    . TYR D 4  6    ? 39.159  -11.425 14.214  1.00 137.79 ? 6    TYR A CA    1 
ATOM   1079  C  C     . TYR D 4  6    ? 40.590  -10.942 14.437  1.00 146.87 ? 6    TYR A C     1 
ATOM   1080  O  O     . TYR D 4  6    ? 41.135  -10.178 13.636  1.00 145.98 ? 6    TYR A O     1 
ATOM   1081  C  CB    . TYR D 4  6    ? 39.139  -12.648 13.289  1.00 139.52 ? 6    TYR A CB    1 
ATOM   1082  C  CG    . TYR D 4  6    ? 40.233  -13.661 13.555  1.00 142.91 ? 6    TYR A CG    1 
ATOM   1083  C  CD1   . TYR D 4  6    ? 40.198  -14.472 14.683  1.00 148.11 ? 6    TYR A CD1   1 
ATOM   1084  C  CD2   . TYR D 4  6    ? 41.300  -13.809 12.674  1.00 141.94 ? 6    TYR A CD2   1 
ATOM   1085  C  CE1   . TYR D 4  6    ? 41.199  -15.398 14.931  1.00 153.35 ? 6    TYR A CE1   1 
ATOM   1086  C  CE2   . TYR D 4  6    ? 42.307  -14.733 12.915  1.00 147.11 ? 6    TYR A CE2   1 
ATOM   1087  C  CZ    . TYR D 4  6    ? 42.251  -15.525 14.044  1.00 153.00 ? 6    TYR A CZ    1 
ATOM   1088  O  OH    . TYR D 4  6    ? 43.245  -16.446 14.292  1.00 152.06 ? 6    TYR A OH    1 
ATOM   1089  N  N     . SER D 4  7    ? 41.200  -11.390 15.537  1.00 155.19 ? 7    SER A N     1 
ATOM   1090  C  CA    . SER D 4  7    ? 42.569  -11.031 15.886  1.00 157.07 ? 7    SER A CA    1 
ATOM   1091  C  C     . SER D 4  7    ? 43.423  -12.284 16.029  1.00 162.92 ? 7    SER A C     1 
ATOM   1092  O  O     . SER D 4  7    ? 42.977  -13.289 16.595  1.00 159.18 ? 7    SER A O     1 
ATOM   1093  C  CB    . SER D 4  7    ? 42.620  -10.227 17.190  1.00 150.49 ? 7    SER A CB    1 
ATOM   1094  O  OG    . SER D 4  7    ? 43.925  -10.229 17.746  1.00 150.19 ? 7    SER A OG    1 
ATOM   1095  N  N     . SER D 4  8    ? 44.661  -12.214 15.526  1.00 172.40 ? 8    SER A N     1 
ATOM   1096  C  CA    . SER D 4  8    ? 45.592  -13.334 15.645  1.00 177.14 ? 8    SER A CA    1 
ATOM   1097  C  C     . SER D 4  8    ? 46.107  -13.523 17.065  1.00 177.12 ? 8    SER A C     1 
ATOM   1098  O  O     . SER D 4  8    ? 46.696  -14.570 17.357  1.00 189.94 ? 8    SER A O     1 
ATOM   1099  C  CB    . SER D 4  8    ? 46.780  -13.149 14.700  1.00 175.72 ? 8    SER A CB    1 
ATOM   1100  O  OG    . SER D 4  8    ? 47.886  -13.947 15.092  1.00 176.47 ? 8    SER A OG    1 
ATOM   1101  N  N     . ALA D 4  9    ? 45.929  -12.537 17.936  1.00 162.62 ? 9    ALA A N     1 
ATOM   1102  C  CA    . ALA D 4  9    ? 46.239  -12.730 19.343  1.00 147.00 ? 9    ALA A CA    1 
ATOM   1103  C  C     . ALA D 4  9    ? 45.298  -13.783 19.920  1.00 140.33 ? 9    ALA A C     1 
ATOM   1104  O  O     . ALA D 4  9    ? 44.096  -13.761 19.621  1.00 146.75 ? 9    ALA A O     1 
ATOM   1105  C  CB    . ALA D 4  9    ? 46.102  -11.417 20.112  1.00 141.11 ? 9    ALA A CB    1 
ATOM   1106  N  N     . PRO D 4  10   ? 45.797  -14.734 20.703  1.00 128.47 ? 10   PRO A N     1 
ATOM   1107  C  CA    . PRO D 4  10   ? 44.906  -15.731 21.303  1.00 129.96 ? 10   PRO A CA    1 
ATOM   1108  C  C     . PRO D 4  10   ? 44.058  -15.121 22.410  1.00 135.48 ? 10   PRO A C     1 
ATOM   1109  O  O     . PRO D 4  10   ? 44.390  -14.087 22.997  1.00 137.24 ? 10   PRO A O     1 
ATOM   1110  C  CB    . PRO D 4  10   ? 45.870  -16.788 21.859  1.00 120.58 ? 10   PRO A CB    1 
ATOM   1111  C  CG    . PRO D 4  10   ? 47.174  -16.535 21.147  1.00 118.21 ? 10   PRO A CG    1 
ATOM   1112  C  CD    . PRO D 4  10   ? 47.216  -15.061 20.916  1.00 119.16 ? 10   PRO A CD    1 
ATOM   1113  N  N     . LEU D 4  11   ? 42.934  -15.777 22.685  1.00 134.30 ? 11   LEU A N     1 
ATOM   1114  C  CA    . LEU D 4  11   ? 42.062  -15.372 23.777  1.00 131.92 ? 11   LEU A CA    1 
ATOM   1115  C  C     . LEU D 4  11   ? 42.528  -16.044 25.063  1.00 133.52 ? 11   LEU A C     1 
ATOM   1116  O  O     . LEU D 4  11   ? 42.769  -17.257 25.087  1.00 128.12 ? 11   LEU A O     1 
ATOM   1117  C  CB    . LEU D 4  11   ? 40.604  -15.733 23.486  1.00 122.02 ? 11   LEU A CB    1 
ATOM   1118  C  CG    . LEU D 4  11   ? 39.595  -15.256 24.537  1.00 103.83 ? 11   LEU A CG    1 
ATOM   1119  C  CD1   . LEU D 4  11   ? 39.375  -13.759 24.414  1.00 98.36  ? 11   LEU A CD1   1 
ATOM   1120  C  CD2   . LEU D 4  11   ? 38.272  -16.012 24.437  1.00 90.65  ? 11   LEU A CD2   1 
ATOM   1121  N  N     . ARG D 4  12   ? 42.675  -15.251 26.121  1.00 135.93 ? 12   ARG A N     1 
ATOM   1122  C  CA    . ARG D 4  12   ? 43.054  -15.773 27.423  1.00 146.72 ? 12   ARG A CA    1 
ATOM   1123  C  C     . ARG D 4  12   ? 42.340  -14.974 28.499  1.00 145.80 ? 12   ARG A C     1 
ATOM   1124  O  O     . ARG D 4  12   ? 42.278  -13.743 28.432  1.00 137.79 ? 12   ARG A O     1 
ATOM   1125  C  CB    . ARG D 4  12   ? 44.572  -15.718 27.637  1.00 152.71 ? 12   ARG A CB    1 
ATOM   1126  C  CG    . ARG D 4  12   ? 45.105  -16.826 28.532  1.00 161.10 ? 12   ARG A CG    1 
ATOM   1127  C  CD    . ARG D 4  12   ? 45.148  -18.155 27.796  1.00 168.14 ? 12   ARG A CD    1 
ATOM   1128  N  NE    . ARG D 4  12   ? 46.166  -18.171 26.749  1.00 170.70 ? 12   ARG A NE    1 
ATOM   1129  C  CZ    . ARG D 4  12   ? 47.436  -18.507 26.949  1.00 164.91 ? 12   ARG A CZ    1 
ATOM   1130  N  NH1   . ARG D 4  12   ? 47.849  -18.858 28.160  1.00 157.75 ? 12   ARG A NH1   1 
ATOM   1131  N  NH2   . ARG D 4  12   ? 48.296  -18.495 25.938  1.00 160.83 ? 12   ARG A NH2   1 
ATOM   1132  N  N     . THR D 4  13   ? 41.798  -15.684 29.485  1.00 151.46 ? 13   THR A N     1 
ATOM   1133  C  CA    . THR D 4  13   ? 41.102  -15.034 30.583  1.00 150.30 ? 13   THR A CA    1 
ATOM   1134  C  C     . THR D 4  13   ? 42.103  -14.344 31.504  1.00 143.73 ? 13   THR A C     1 
ATOM   1135  O  O     . THR D 4  13   ? 43.228  -14.819 31.696  1.00 165.09 ? 13   THR A O     1 
ATOM   1136  C  CB    . THR D 4  13   ? 40.276  -16.060 31.367  1.00 151.94 ? 13   THR A CB    1 
ATOM   1137  O  OG1   . THR D 4  13   ? 39.864  -15.497 32.618  1.00 165.00 ? 13   THR A OG1   1 
ATOM   1138  C  CG2   . THR D 4  13   ? 41.081  -17.334 31.628  1.00 146.08 ? 13   THR A CG2   1 
ATOM   1139  N  N     . VAL D 4  14   ? 41.700  -13.199 32.054  1.00 119.16 ? 14   VAL A N     1 
ATOM   1140  C  CA    . VAL D 4  14   ? 42.512  -12.505 33.048  1.00 114.77 ? 14   VAL A CA    1 
ATOM   1141  C  C     . VAL D 4  14   ? 42.338  -13.199 34.394  1.00 120.89 ? 14   VAL A C     1 
ATOM   1142  O  O     . VAL D 4  14   ? 41.213  -13.486 34.822  1.00 124.63 ? 14   VAL A O     1 
ATOM   1143  C  CB    . VAL D 4  14   ? 42.144  -11.009 33.111  1.00 107.36 ? 14   VAL A CB    1 
ATOM   1144  C  CG1   . VAL D 4  14   ? 40.638  -10.809 33.155  1.00 104.21 ? 14   VAL A CG1   1 
ATOM   1145  C  CG2   . VAL D 4  14   ? 42.809  -10.322 34.303  1.00 107.28 ? 14   VAL A CG2   1 
ATOM   1146  N  N     . LYS D 4  15   ? 43.456  -13.501 35.050  1.00 120.00 ? 15   LYS A N     1 
ATOM   1147  C  CA    . LYS D 4  15   ? 43.445  -14.239 36.303  1.00 124.90 ? 15   LYS A CA    1 
ATOM   1148  C  C     . LYS D 4  15   ? 44.134  -13.518 37.448  1.00 128.49 ? 15   LYS A C     1 
ATOM   1149  O  O     . LYS D 4  15   ? 43.804  -13.781 38.606  1.00 136.97 ? 15   LYS A O     1 
ATOM   1150  C  CB    . LYS D 4  15   ? 44.102  -15.620 36.121  1.00 134.40 ? 15   LYS A CB    1 
ATOM   1151  C  CG    . LYS D 4  15   ? 43.410  -16.521 35.103  1.00 138.94 ? 15   LYS A CG    1 
ATOM   1152  C  CD    . LYS D 4  15   ? 42.952  -17.826 35.741  1.00 148.63 ? 15   LYS A CD    1 
ATOM   1153  C  CE    . LYS D 4  15   ? 41.942  -17.585 36.854  1.00 151.33 ? 15   LYS A CE    1 
ATOM   1154  N  NZ    . LYS D 4  15   ? 41.560  -18.844 37.552  1.00 149.65 ? 15   LYS A NZ    1 
ATOM   1155  N  N     . GLU D 4  16   ? 45.073  -12.619 37.166  1.00 123.50 ? 16   GLU A N     1 
ATOM   1156  C  CA    . GLU D 4  16   ? 45.827  -11.929 38.206  1.00 120.50 ? 16   GLU A CA    1 
ATOM   1157  C  C     . GLU D 4  16   ? 45.770  -10.433 37.940  1.00 118.05 ? 16   GLU A C     1 
ATOM   1158  O  O     . GLU D 4  16   ? 46.158  -9.977  36.858  1.00 95.05  ? 16   GLU A O     1 
ATOM   1159  C  CB    . GLU D 4  16   ? 47.277  -12.424 38.250  1.00 114.33 ? 16   GLU A CB    1 
ATOM   1160  C  CG    . GLU D 4  16   ? 47.905  -12.393 39.637  1.00 117.89 ? 16   GLU A CG    1 
ATOM   1161  C  CD    . GLU D 4  16   ? 49.331  -12.919 39.648  1.00 132.60 ? 16   GLU A CD    1 
ATOM   1162  O  OE1   . GLU D 4  16   ? 49.934  -13.023 38.558  1.00 139.24 ? 16   GLU A OE1   1 
ATOM   1163  O  OE2   . GLU D 4  16   ? 49.847  -13.239 40.742  1.00 131.04 ? 16   GLU A OE2   1 
ATOM   1164  N  N     . VAL D 4  17   ? 45.281  -9.674  38.919  1.00 142.77 ? 17   VAL A N     1 
ATOM   1165  C  CA    . VAL D 4  17   ? 45.238  -8.217  38.853  1.00 150.88 ? 17   VAL A CA    1 
ATOM   1166  C  C     . VAL D 4  17   ? 46.254  -7.673  39.847  1.00 147.39 ? 17   VAL A C     1 
ATOM   1167  O  O     . VAL D 4  17   ? 46.134  -7.902  41.058  1.00 143.68 ? 17   VAL A O     1 
ATOM   1168  C  CB    . VAL D 4  17   ? 43.831  -7.670  39.145  1.00 157.79 ? 17   VAL A CB    1 
ATOM   1169  C  CG1   . VAL D 4  17   ? 43.877  -6.161  39.345  1.00 154.61 ? 17   VAL A CG1   1 
ATOM   1170  C  CG2   . VAL D 4  17   ? 42.880  -8.016  38.011  1.00 158.70 ? 17   VAL A CG2   1 
ATOM   1171  N  N     . GLN D 4  18   ? 47.254  -6.956  39.337  1.00 137.32 ? 18   GLN A N     1 
ATOM   1172  C  CA    . GLN D 4  18   ? 48.280  -6.331  40.160  1.00 129.20 ? 18   GLN A CA    1 
ATOM   1173  C  C     . GLN D 4  18   ? 48.249  -4.830  39.918  1.00 120.38 ? 18   GLN A C     1 
ATOM   1174  O  O     . GLN D 4  18   ? 48.437  -4.377  38.783  1.00 118.93 ? 18   GLN A O     1 
ATOM   1175  C  CB    . GLN D 4  18   ? 49.667  -6.896  39.847  1.00 132.46 ? 18   GLN A CB    1 
ATOM   1176  C  CG    . GLN D 4  18   ? 50.811  -6.065  40.407  1.00 134.45 ? 18   GLN A CG    1 
ATOM   1177  C  CD    . GLN D 4  18   ? 50.830  -6.030  41.926  1.00 124.14 ? 18   GLN A CD    1 
ATOM   1178  O  OE1   . GLN D 4  18   ? 51.026  -7.053  42.580  1.00 112.55 ? 18   GLN A OE1   1 
ATOM   1179  N  NE2   . GLN D 4  18   ? 50.630  -4.845  42.494  1.00 120.85 ? 18   GLN A NE2   1 
ATOM   1180  N  N     . PHE D 4  19   ? 48.014  -4.066  40.983  1.00 119.10 ? 19   PHE A N     1 
ATOM   1181  C  CA    . PHE D 4  19   ? 47.998  -2.611  40.916  1.00 116.51 ? 19   PHE A CA    1 
ATOM   1182  C  C     . PHE D 4  19   ? 49.430  -2.086  41.013  1.00 127.50 ? 19   PHE A C     1 
ATOM   1183  O  O     . PHE D 4  19   ? 50.406  -2.832  40.891  1.00 140.40 ? 19   PHE A O     1 
ATOM   1184  C  CB    . PHE D 4  19   ? 47.104  -2.038  42.015  1.00 112.59 ? 19   PHE A CB    1 
ATOM   1185  C  CG    . PHE D 4  19   ? 45.680  -2.510  41.946  1.00 109.37 ? 19   PHE A CG    1 
ATOM   1186  C  CD1   . PHE D 4  19   ? 45.234  -3.525  42.775  1.00 117.85 ? 19   PHE A CD1   1 
ATOM   1187  C  CD2   . PHE D 4  19   ? 44.790  -1.944  41.048  1.00 103.14 ? 19   PHE A CD2   1 
ATOM   1188  C  CE1   . PHE D 4  19   ? 43.924  -3.968  42.714  1.00 119.10 ? 19   PHE A CE1   1 
ATOM   1189  C  CE2   . PHE D 4  19   ? 43.474  -2.385  40.984  1.00 113.32 ? 19   PHE A CE2   1 
ATOM   1190  C  CZ    . PHE D 4  19   ? 43.044  -3.398  41.820  1.00 121.09 ? 19   PHE A CZ    1 
ATOM   1191  N  N     . GLY D 4  20   ? 49.571  -0.791  41.226  1.00 125.46 ? 20   GLY A N     1 
ATOM   1192  C  CA    . GLY D 4  20   ? 50.871  -0.161  41.360  1.00 133.50 ? 20   GLY A CA    1 
ATOM   1193  C  C     . GLY D 4  20   ? 50.845  1.238   40.782  1.00 142.66 ? 20   GLY A C     1 
ATOM   1194  O  O     . GLY D 4  20   ? 50.022  1.580   39.932  1.00 146.96 ? 20   GLY A O     1 
ATOM   1195  N  N     . LEU D 4  21   ? 51.767  2.067   41.257  1.00 149.59 ? 21   LEU A N     1 
ATOM   1196  C  CA    . LEU D 4  21   ? 51.862  3.433   40.773  1.00 152.92 ? 21   LEU A CA    1 
ATOM   1197  C  C     . LEU D 4  21   ? 52.548  3.467   39.408  1.00 153.94 ? 21   LEU A C     1 
ATOM   1198  O  O     . LEU D 4  21   ? 53.108  2.475   38.931  1.00 155.00 ? 21   LEU A O     1 
ATOM   1199  C  CB    . LEU D 4  21   ? 52.605  4.306   41.784  1.00 158.68 ? 21   LEU A CB    1 
ATOM   1200  C  CG    . LEU D 4  21   ? 51.725  5.255   42.604  1.00 158.01 ? 21   LEU A CG    1 
ATOM   1201  C  CD1   . LEU D 4  21   ? 51.061  6.281   41.697  1.00 162.43 ? 21   LEU A CD1   1 
ATOM   1202  C  CD2   . LEU D 4  21   ? 50.672  4.488   43.390  1.00 152.66 ? 21   LEU A CD2   1 
ATOM   1203  N  N     . PHE D 4  22   ? 52.490  4.633   38.770  1.00 160.33 ? 22   PHE A N     1 
ATOM   1204  C  CA    . PHE D 4  22   ? 52.997  4.815   37.417  1.00 162.83 ? 22   PHE A CA    1 
ATOM   1205  C  C     . PHE D 4  22   ? 54.360  5.490   37.474  1.00 152.11 ? 22   PHE A C     1 
ATOM   1206  O  O     . PHE D 4  22   ? 54.510  6.546   38.100  1.00 134.55 ? 22   PHE A O     1 
ATOM   1207  C  CB    . PHE D 4  22   ? 52.023  5.656   36.587  1.00 170.47 ? 22   PHE A CB    1 
ATOM   1208  C  CG    . PHE D 4  22   ? 51.786  5.130   35.198  1.00 171.03 ? 22   PHE A CG    1 
ATOM   1209  C  CD1   . PHE D 4  22   ? 50.515  5.161   34.640  1.00 164.19 ? 22   PHE A CD1   1 
ATOM   1210  C  CD2   . PHE D 4  22   ? 52.828  4.608   34.451  1.00 176.96 ? 22   PHE A CD2   1 
ATOM   1211  C  CE1   . PHE D 4  22   ? 50.289  4.678   33.362  1.00 164.95 ? 22   PHE A CE1   1 
ATOM   1212  C  CE2   . PHE D 4  22   ? 52.608  4.123   33.172  1.00 175.83 ? 22   PHE A CE2   1 
ATOM   1213  C  CZ    . PHE D 4  22   ? 51.338  4.159   32.629  1.00 170.45 ? 22   PHE A CZ    1 
ATOM   1214  N  N     . SER D 4  23   ? 55.345  4.880   36.830  1.00 160.86 ? 23   SER A N     1 
ATOM   1215  C  CA    . SER D 4  23   ? 56.646  5.523   36.714  1.00 169.95 ? 23   SER A CA    1 
ATOM   1216  C  C     . SER D 4  23   ? 56.594  6.563   35.601  1.00 164.84 ? 23   SER A C     1 
ATOM   1217  O  O     . SER D 4  23   ? 56.179  6.240   34.484  1.00 159.61 ? 23   SER A O     1 
ATOM   1218  C  CB    . SER D 4  23   ? 57.739  4.495   36.429  1.00 179.87 ? 23   SER A CB    1 
ATOM   1219  O  OG    . SER D 4  23   ? 58.077  4.441   35.056  1.00 182.49 ? 23   SER A OG    1 
ATOM   1220  N  N     . PRO D 4  24   ? 56.981  7.814   35.871  1.00 159.64 ? 24   PRO A N     1 
ATOM   1221  C  CA    . PRO D 4  24   ? 56.933  8.846   34.820  1.00 157.73 ? 24   PRO A CA    1 
ATOM   1222  C  C     . PRO D 4  24   ? 57.844  8.569   33.637  1.00 158.84 ? 24   PRO A C     1 
ATOM   1223  O  O     . PRO D 4  24   ? 57.609  9.124   32.557  1.00 165.78 ? 24   PRO A O     1 
ATOM   1224  C  CB    . PRO D 4  24   ? 57.352  10.122  35.566  1.00 154.19 ? 24   PRO A CB    1 
ATOM   1225  C  CG    . PRO D 4  24   ? 57.013  9.842   36.997  1.00 155.03 ? 24   PRO A CG    1 
ATOM   1226  C  CD    . PRO D 4  24   ? 57.283  8.387   37.194  1.00 158.06 ? 24   PRO A CD    1 
ATOM   1227  N  N     . GLU D 4  25   ? 58.868  7.727   33.802  1.00 154.10 ? 25   GLU A N     1 
ATOM   1228  C  CA    . GLU D 4  25   ? 59.681  7.302   32.667  1.00 151.97 ? 25   GLU A CA    1 
ATOM   1229  C  C     . GLU D 4  25   ? 58.887  6.396   31.731  1.00 144.62 ? 25   GLU A C     1 
ATOM   1230  O  O     . GLU D 4  25   ? 59.075  6.435   30.509  1.00 136.32 ? 25   GLU A O     1 
ATOM   1231  C  CB    . GLU D 4  25   ? 60.942  6.585   33.160  1.00 150.75 ? 25   GLU A CB    1 
ATOM   1232  C  CG    . GLU D 4  25   ? 61.948  7.458   33.911  1.00 144.56 ? 25   GLU A CG    1 
ATOM   1233  C  CD    . GLU D 4  25   ? 61.588  7.669   35.371  1.00 136.68 ? 25   GLU A CD    1 
ATOM   1234  O  OE1   . GLU D 4  25   ? 60.597  8.377   35.650  1.00 131.62 ? 25   GLU A OE1   1 
ATOM   1235  O  OE2   . GLU D 4  25   ? 62.301  7.124   36.239  1.00 135.51 ? 25   GLU A OE2   1 
ATOM   1236  N  N     . GLU D 4  26   ? 57.995  5.572   32.291  1.00 148.15 ? 26   GLU A N     1 
ATOM   1237  C  CA    . GLU D 4  26   ? 57.178  4.680   31.473  1.00 154.85 ? 26   GLU A CA    1 
ATOM   1238  C  C     . GLU D 4  26   ? 56.146  5.451   30.661  1.00 156.06 ? 26   GLU A C     1 
ATOM   1239  O  O     . GLU D 4  26   ? 55.776  5.019   29.563  1.00 154.32 ? 26   GLU A O     1 
ATOM   1240  C  CB    . GLU D 4  26   ? 56.484  3.647   32.366  1.00 159.40 ? 26   GLU A CB    1 
ATOM   1241  C  CG    . GLU D 4  26   ? 55.837  2.482   31.631  1.00 162.20 ? 26   GLU A CG    1 
ATOM   1242  C  CD    . GLU D 4  26   ? 55.293  1.431   32.580  1.00 159.27 ? 26   GLU A CD    1 
ATOM   1243  O  OE1   . GLU D 4  26   ? 54.911  1.793   33.713  1.00 156.78 ? 26   GLU A OE1   1 
ATOM   1244  O  OE2   . GLU D 4  26   ? 55.263  0.242   32.202  1.00 159.47 ? 26   GLU A OE2   1 
ATOM   1245  N  N     . VAL D 4  27   ? 55.679  6.592   31.177  1.00 153.54 ? 27   VAL A N     1 
ATOM   1246  C  CA    . VAL D 4  27   ? 54.675  7.383   30.471  1.00 144.25 ? 27   VAL A CA    1 
ATOM   1247  C  C     . VAL D 4  27   ? 55.274  8.031   29.224  1.00 144.50 ? 27   VAL A C     1 
ATOM   1248  O  O     . VAL D 4  27   ? 54.553  8.325   28.262  1.00 136.03 ? 27   VAL A O     1 
ATOM   1249  C  CB    . VAL D 4  27   ? 54.054  8.425   31.426  1.00 135.08 ? 27   VAL A CB    1 
ATOM   1250  C  CG1   . VAL D 4  27   ? 52.712  8.905   30.907  1.00 129.09 ? 27   VAL A CG1   1 
ATOM   1251  C  CG2   . VAL D 4  27   ? 53.887  7.847   32.823  1.00 136.84 ? 27   VAL A CG2   1 
ATOM   1252  N  N     . ARG D 4  28   ? 56.594  8.251   29.207  1.00 155.33 ? 28   ARG A N     1 
ATOM   1253  C  CA    . ARG D 4  28   ? 57.245  8.801   28.019  1.00 158.50 ? 28   ARG A CA    1 
ATOM   1254  C  C     . ARG D 4  28   ? 57.268  7.789   26.879  1.00 154.29 ? 28   ARG A C     1 
ATOM   1255  O  O     . ARG D 4  28   ? 56.993  8.139   25.724  1.00 153.53 ? 28   ARG A O     1 
ATOM   1256  C  CB    . ARG D 4  28   ? 58.672  9.252   28.351  1.00 167.70 ? 28   ARG A CB    1 
ATOM   1257  C  CG    . ARG D 4  28   ? 58.833  9.952   29.691  1.00 170.33 ? 28   ARG A CG    1 
ATOM   1258  C  CD    . ARG D 4  28   ? 58.011  11.232  29.776  1.00 171.73 ? 28   ARG A CD    1 
ATOM   1259  N  NE    . ARG D 4  28   ? 58.078  11.830  31.107  1.00 168.01 ? 28   ARG A NE    1 
ATOM   1260  C  CZ    . ARG D 4  28   ? 59.010  12.693  31.496  1.00 160.70 ? 28   ARG A CZ    1 
ATOM   1261  N  NH1   . ARG D 4  28   ? 59.963  13.067  30.653  1.00 161.07 ? 28   ARG A NH1   1 
ATOM   1262  N  NH2   . ARG D 4  28   ? 58.990  13.184  32.728  1.00 155.58 ? 28   ARG A NH2   1 
ATOM   1263  N  N     . ALA D 4  29   ? 57.597  6.532   27.183  1.00 150.71 ? 29   ALA A N     1 
ATOM   1264  C  CA    . ALA D 4  29   ? 57.670  5.493   26.162  1.00 147.45 ? 29   ALA A CA    1 
ATOM   1265  C  C     . ALA D 4  29   ? 56.314  4.882   25.831  1.00 147.48 ? 29   ALA A C     1 
ATOM   1266  O  O     . ALA D 4  29   ? 56.173  4.268   24.768  1.00 144.28 ? 29   ALA A O     1 
ATOM   1267  C  CB    . ALA D 4  29   ? 58.639  4.392   26.606  1.00 140.51 ? 29   ALA A CB    1 
ATOM   1268  N  N     . ILE D 4  30   ? 55.312  5.039   26.704  1.00 147.32 ? 30   ILE A N     1 
ATOM   1269  C  CA    . ILE D 4  30   ? 54.007  4.413   26.489  1.00 143.45 ? 30   ILE A CA    1 
ATOM   1270  C  C     . ILE D 4  30   ? 53.015  5.346   25.799  1.00 147.36 ? 30   ILE A C     1 
ATOM   1271  O  O     . ILE D 4  30   ? 51.990  4.871   25.283  1.00 145.72 ? 30   ILE A O     1 
ATOM   1272  C  CB    . ILE D 4  30   ? 53.422  3.887   27.822  1.00 131.37 ? 30   ILE A CB    1 
ATOM   1273  C  CG1   . ILE D 4  30   ? 52.508  2.684   27.579  1.00 128.70 ? 30   ILE A CG1   1 
ATOM   1274  C  CG2   . ILE D 4  30   ? 52.644  4.975   28.558  1.00 130.50 ? 30   ILE A CG2   1 
ATOM   1275  C  CD1   . ILE D 4  30   ? 53.167  1.556   26.798  1.00 129.52 ? 30   ILE A CD1   1 
ATOM   1276  N  N     . SER D 4  31   ? 53.291  6.645   25.752  1.00 152.13 ? 31   SER A N     1 
ATOM   1277  C  CA    . SER D 4  31   ? 52.400  7.585   25.094  1.00 158.93 ? 31   SER A CA    1 
ATOM   1278  C  C     . SER D 4  31   ? 52.760  7.726   23.619  1.00 162.91 ? 31   SER A C     1 
ATOM   1279  O  O     . SER D 4  31   ? 53.870  7.401   23.187  1.00 166.94 ? 31   SER A O     1 
ATOM   1280  C  CB    . SER D 4  31   ? 52.456  8.950   25.777  1.00 171.52 ? 31   SER A CB    1 
ATOM   1281  O  OG    . SER D 4  31   ? 52.036  9.979   24.900  1.00 181.55 ? 31   SER A OG    1 
ATOM   1282  N  N     . VAL D 4  32   ? 51.796  8.225   22.845  1.00 157.77 ? 32   VAL A N     1 
ATOM   1283  C  CA    . VAL D 4  32   ? 51.934  8.337   21.397  1.00 150.92 ? 32   VAL A CA    1 
ATOM   1284  C  C     . VAL D 4  32   ? 52.333  9.754   21.003  1.00 151.59 ? 32   VAL A C     1 
ATOM   1285  O  O     . VAL D 4  32   ? 52.960  9.961   19.956  1.00 144.81 ? 32   VAL A O     1 
ATOM   1286  C  CB    . VAL D 4  32   ? 50.634  7.914   20.688  1.00 139.38 ? 32   VAL A CB    1 
ATOM   1287  C  CG1   . VAL D 4  32   ? 50.526  6.398   20.645  1.00 143.25 ? 32   VAL A CG1   1 
ATOM   1288  C  CG2   . VAL D 4  32   ? 49.422  8.518   21.388  1.00 128.80 ? 32   VAL A CG2   1 
ATOM   1289  N  N     . ALA D 4  33   ? 51.986  10.734  21.835  1.00 165.16 ? 33   ALA A N     1 
ATOM   1290  C  CA    . ALA D 4  33   ? 52.242  12.132  21.510  1.00 169.00 ? 33   ALA A CA    1 
ATOM   1291  C  C     . ALA D 4  33   ? 52.250  12.959  22.789  1.00 168.59 ? 33   ALA A C     1 
ATOM   1292  O  O     . ALA D 4  33   ? 51.953  12.463  23.879  1.00 170.32 ? 33   ALA A O     1 
ATOM   1293  C  CB    . ALA D 4  33   ? 51.204  12.670  20.525  1.00 166.95 ? 33   ALA A CB    1 
ATOM   1294  N  N     . LYS D 4  34   ? 52.589  14.236  22.634  1.00 163.67 ? 34   LYS A N     1 
ATOM   1295  C  CA    . LYS D 4  34   ? 52.705  15.178  23.739  1.00 158.55 ? 34   LYS A CA    1 
ATOM   1296  C  C     . LYS D 4  34   ? 51.592  16.214  23.652  1.00 152.14 ? 34   LYS A C     1 
ATOM   1297  O  O     . LYS D 4  34   ? 51.355  16.786  22.582  1.00 148.73 ? 34   LYS A O     1 
ATOM   1298  C  CB    . LYS D 4  34   ? 54.065  15.876  23.712  1.00 154.35 ? 34   LYS A CB    1 
ATOM   1299  C  CG    . LYS D 4  34   ? 55.214  14.971  23.298  1.00 150.60 ? 34   LYS A CG    1 
ATOM   1300  C  CD    . LYS D 4  34   ? 56.556  15.590  23.644  1.00 150.19 ? 34   LYS A CD    1 
ATOM   1301  C  CE    . LYS D 4  34   ? 56.636  15.930  25.119  1.00 148.13 ? 34   LYS A CE    1 
ATOM   1302  N  NZ    . LYS D 4  34   ? 57.881  16.671  25.460  1.00 149.87 ? 34   LYS A NZ    1 
ATOM   1303  N  N     . ILE D 4  35   ? 50.918  16.457  24.775  1.00 150.71 ? 35   ILE A N     1 
ATOM   1304  C  CA    . ILE D 4  35   ? 49.920  17.520  24.835  1.00 149.41 ? 35   ILE A CA    1 
ATOM   1305  C  C     . ILE D 4  35   ? 50.641  18.862  24.830  1.00 157.09 ? 35   ILE A C     1 
ATOM   1306  O  O     . ILE D 4  35   ? 51.486  19.133  25.691  1.00 159.53 ? 35   ILE A O     1 
ATOM   1307  C  CB    . ILE D 4  35   ? 49.029  17.371  26.073  1.00 143.44 ? 35   ILE A CB    1 
ATOM   1308  N  N     . ARG D 4  36   ? 50.318  19.706  23.851  1.00 155.72 ? 36   ARG A N     1 
ATOM   1309  C  CA    . ARG D 4  36   ? 50.957  21.009  23.712  1.00 151.91 ? 36   ARG A CA    1 
ATOM   1310  C  C     . ARG D 4  36   ? 49.986  22.167  23.887  1.00 154.19 ? 36   ARG A C     1 
ATOM   1311  O  O     . ARG D 4  36   ? 50.224  23.044  24.726  1.00 154.45 ? 36   ARG A O     1 
ATOM   1312  C  CB    . ARG D 4  36   ? 51.657  21.110  22.345  1.00 144.97 ? 36   ARG A CB    1 
ATOM   1313  C  CG    . ARG D 4  36   ? 53.032  20.464  22.298  1.00 142.68 ? 36   ARG A CG    1 
ATOM   1314  C  CD    . ARG D 4  36   ? 54.077  21.385  22.907  1.00 152.41 ? 36   ARG A CD    1 
ATOM   1315  N  NE    . ARG D 4  36   ? 54.874  20.716  23.932  1.00 164.43 ? 36   ARG A NE    1 
ATOM   1316  C  CZ    . ARG D 4  36   ? 55.997  20.047  23.689  1.00 171.56 ? 36   ARG A CZ    1 
ATOM   1317  N  NH1   . ARG D 4  36   ? 56.465  19.960  22.451  1.00 173.64 ? 36   ARG A NH1   1 
ATOM   1318  N  NH2   . ARG D 4  36   ? 56.657  19.470  24.684  1.00 175.84 ? 36   ARG A NH2   1 
ATOM   1319  N  N     . PHE D 4  37   ? 48.888  22.189  23.133  1.00 154.89 ? 37   PHE A N     1 
ATOM   1320  C  CA    . PHE D 4  37   ? 47.989  23.330  23.107  1.00 150.35 ? 37   PHE A CA    1 
ATOM   1321  C  C     . PHE D 4  37   ? 46.625  22.949  23.668  1.00 142.32 ? 37   PHE A C     1 
ATOM   1322  O  O     . PHE D 4  37   ? 46.021  21.969  23.207  1.00 139.40 ? 37   PHE A O     1 
ATOM   1323  C  CB    . PHE D 4  37   ? 47.840  23.865  21.671  1.00 160.90 ? 37   PHE A CB    1 
ATOM   1324  C  CG    . PHE D 4  37   ? 49.130  23.877  20.895  1.00 169.15 ? 37   PHE A CG    1 
ATOM   1325  C  CD1   . PHE D 4  37   ? 50.095  24.842  21.142  1.00 167.92 ? 37   PHE A CD1   1 
ATOM   1326  C  CD2   . PHE D 4  37   ? 49.383  22.918  19.925  1.00 171.87 ? 37   PHE A CD2   1 
ATOM   1327  C  CE1   . PHE D 4  37   ? 51.286  24.851  20.434  1.00 168.27 ? 37   PHE A CE1   1 
ATOM   1328  C  CE2   . PHE D 4  37   ? 50.572  22.922  19.215  1.00 173.19 ? 37   PHE A CE2   1 
ATOM   1329  C  CZ    . PHE D 4  37   ? 51.523  23.890  19.470  1.00 171.09 ? 37   PHE A CZ    1 
ATOM   1330  N  N     . PRO D 4  38   ? 46.100  23.697  24.645  1.00 137.97 ? 38   PRO A N     1 
ATOM   1331  C  CA    . PRO D 4  38   ? 44.800  23.341  25.241  1.00 142.15 ? 38   PRO A CA    1 
ATOM   1332  C  C     . PRO D 4  38   ? 43.606  23.560  24.322  1.00 131.80 ? 38   PRO A C     1 
ATOM   1333  O  O     . PRO D 4  38   ? 42.503  23.102  24.652  1.00 100.66 ? 38   PRO A O     1 
ATOM   1334  C  CB    . PRO D 4  38   ? 44.725  24.249  26.475  1.00 139.54 ? 38   PRO A CB    1 
ATOM   1335  C  CG    . PRO D 4  38   ? 45.568  25.431  26.111  1.00 134.57 ? 38   PRO A CG    1 
ATOM   1336  C  CD    . PRO D 4  38   ? 46.696  24.885  25.280  1.00 134.44 ? 38   PRO A CD    1 
ATOM   1337  N  N     . GLU D 4  39   ? 43.786  24.242  23.194  1.00 155.96 ? 39   GLU A N     1 
ATOM   1338  C  CA    . GLU D 4  39   ? 42.717  24.367  22.213  1.00 171.12 ? 39   GLU A CA    1 
ATOM   1339  C  C     . GLU D 4  39   ? 42.426  23.000  21.605  1.00 181.23 ? 39   GLU A C     1 
ATOM   1340  O  O     . GLU D 4  39   ? 43.299  22.393  20.973  1.00 184.60 ? 39   GLU A O     1 
ATOM   1341  C  CB    . GLU D 4  39   ? 43.099  25.377  21.133  1.00 168.81 ? 39   GLU A CB    1 
ATOM   1342  C  CG    . GLU D 4  39   ? 43.246  26.808  21.639  1.00 155.21 ? 39   GLU A CG    1 
ATOM   1343  C  CD    . GLU D 4  39   ? 44.646  27.114  22.134  1.00 141.54 ? 39   GLU A CD    1 
ATOM   1344  O  OE1   . GLU D 4  39   ? 44.837  28.167  22.776  1.00 137.76 ? 39   GLU A OE1   1 
ATOM   1345  O  OE2   . GLU D 4  39   ? 45.558  26.303  21.872  1.00 134.03 ? 39   GLU A OE2   1 
ATOM   1346  N  N     . THR D 4  40   ? 41.202  22.510  21.823  1.00 180.10 ? 40   THR A N     1 
ATOM   1347  C  CA    . THR D 4  40   ? 40.814  21.185  21.349  1.00 170.77 ? 40   THR A CA    1 
ATOM   1348  C  C     . THR D 4  40   ? 40.754  21.147  19.828  1.00 172.34 ? 40   THR A C     1 
ATOM   1349  O  O     . THR D 4  40   ? 41.520  20.427  19.176  1.00 163.41 ? 40   THR A O     1 
ATOM   1350  C  CB    . THR D 4  40   ? 39.457  20.799  21.940  1.00 155.83 ? 40   THR A CB    1 
ATOM   1351  O  OG1   . THR D 4  40   ? 38.426  21.567  21.303  1.00 144.69 ? 40   THR A OG1   1 
ATOM   1352  C  CG2   . THR D 4  40   ? 39.427  21.069  23.438  1.00 157.82 ? 40   THR A CG2   1 
ATOM   1353  N  N     . MET D 4  41   ? 39.853  21.933  19.247  1.00 182.92 ? 41   MET A N     1 
ATOM   1354  C  CA    . MET D 4  41   ? 39.748  22.034  17.805  1.00 180.10 ? 41   MET A CA    1 
ATOM   1355  C  C     . MET D 4  41   ? 40.944  22.802  17.242  1.00 181.42 ? 41   MET A C     1 
ATOM   1356  O  O     . MET D 4  41   ? 41.709  23.443  17.971  1.00 178.81 ? 41   MET A O     1 
ATOM   1357  C  CB    . MET D 4  41   ? 38.435  22.714  17.415  1.00 175.64 ? 41   MET A CB    1 
ATOM   1358  N  N     . ASP D 4  42   ? 41.108  22.728  15.923  1.00 182.39 ? 42   ASP A N     1 
ATOM   1359  C  CA    . ASP D 4  42   ? 42.187  23.463  15.286  1.00 181.76 ? 42   ASP A CA    1 
ATOM   1360  C  C     . ASP D 4  42   ? 41.853  24.954  15.247  1.00 184.70 ? 42   ASP A C     1 
ATOM   1361  O  O     . ASP D 4  42   ? 40.714  25.373  15.473  1.00 177.09 ? 42   ASP A O     1 
ATOM   1362  C  CB    . ASP D 4  42   ? 42.469  22.913  13.885  1.00 180.55 ? 42   ASP A CB    1 
ATOM   1363  C  CG    . ASP D 4  42   ? 41.399  23.281  12.879  1.00 183.87 ? 42   ASP A CG    1 
ATOM   1364  O  OD1   . ASP D 4  42   ? 40.201  23.264  13.229  1.00 187.53 ? 42   ASP A OD1   1 
ATOM   1365  O  OD2   . ASP D 4  42   ? 41.756  23.597  11.724  1.00 182.95 ? 42   ASP A OD2   1 
ATOM   1366  N  N     . GLU D 4  43   ? 42.869  25.759  14.955  1.00 197.95 ? 43   GLU A N     1 
ATOM   1367  C  CA    . GLU D 4  43   ? 42.779  27.200  15.121  1.00 208.20 ? 43   GLU A CA    1 
ATOM   1368  C  C     . GLU D 4  43   ? 41.945  27.829  14.002  1.00 220.48 ? 43   GLU A C     1 
ATOM   1369  O  O     . GLU D 4  43   ? 41.427  27.147  13.113  1.00 223.54 ? 43   GLU A O     1 
ATOM   1370  C  CB    . GLU D 4  43   ? 44.179  27.811  15.186  1.00 207.42 ? 43   GLU A CB    1 
ATOM   1371  C  CG    . GLU D 4  43   ? 44.867  27.664  16.546  1.00 206.32 ? 43   GLU A CG    1 
ATOM   1372  C  CD    . GLU D 4  43   ? 45.344  26.246  16.830  1.00 207.43 ? 43   GLU A CD    1 
ATOM   1373  O  OE1   . GLU D 4  43   ? 45.547  25.477  15.867  1.00 208.37 ? 43   GLU A OE1   1 
ATOM   1374  O  OE2   . GLU D 4  43   ? 45.498  25.894  18.019  1.00 205.70 ? 43   GLU A OE2   1 
ATOM   1375  N  N     . THR D 4  44   ? 41.816  29.163  14.071  1.00 227.25 ? 44   THR A N     1 
ATOM   1376  C  CA    . THR D 4  44   ? 41.007  29.989  13.159  1.00 229.96 ? 44   THR A CA    1 
ATOM   1377  C  C     . THR D 4  44   ? 39.539  29.552  13.123  1.00 234.65 ? 44   THR A C     1 
ATOM   1378  O  O     . THR D 4  44   ? 38.853  29.751  12.115  1.00 240.39 ? 44   THR A O     1 
ATOM   1379  C  CB    . THR D 4  44   ? 41.593  30.024  11.739  1.00 223.67 ? 44   THR A CB    1 
ATOM   1380  O  OG1   . THR D 4  44   ? 41.400  28.758  11.096  1.00 224.05 ? 44   THR A OG1   1 
ATOM   1381  C  CG2   . THR D 4  44   ? 43.086  30.343  11.778  1.00 217.73 ? 44   THR A CG2   1 
ATOM   1382  N  N     . GLN D 4  45   ? 39.059  28.968  14.232  1.00 227.36 ? 45   GLN A N     1 
ATOM   1383  C  CA    . GLN D 4  45   ? 37.676  28.499  14.407  1.00 213.06 ? 45   GLN A CA    1 
ATOM   1384  C  C     . GLN D 4  45   ? 37.243  27.511  13.322  1.00 205.57 ? 45   GLN A C     1 
ATOM   1385  O  O     . GLN D 4  45   ? 36.056  27.402  13.006  1.00 203.95 ? 45   GLN A O     1 
ATOM   1386  C  CB    . GLN D 4  45   ? 36.688  29.670  14.482  1.00 208.48 ? 45   GLN A CB    1 
ATOM   1387  C  CG    . GLN D 4  45   ? 36.958  30.638  15.623  1.00 199.61 ? 45   GLN A CG    1 
ATOM   1388  C  CD    . GLN D 4  45   ? 35.881  31.697  15.752  1.00 187.22 ? 45   GLN A CD    1 
ATOM   1389  O  OE1   . GLN D 4  45   ? 34.797  31.436  16.274  1.00 178.62 ? 45   GLN A OE1   1 
ATOM   1390  N  NE2   . GLN D 4  45   ? 36.174  32.901  15.271  1.00 183.02 ? 45   GLN A NE2   1 
ATOM   1391  N  N     . THR D 4  46   ? 38.196  26.777  12.752  1.00 197.39 ? 46   THR A N     1 
ATOM   1392  C  CA    . THR D 4  46   ? 37.893  25.821  11.701  1.00 178.79 ? 46   THR A CA    1 
ATOM   1393  C  C     . THR D 4  46   ? 37.418  24.498  12.310  1.00 167.60 ? 46   THR A C     1 
ATOM   1394  O  O     . THR D 4  46   ? 37.337  24.335  13.530  1.00 155.23 ? 46   THR A O     1 
ATOM   1395  C  CB    . THR D 4  46   ? 39.097  25.650  10.774  1.00 164.67 ? 46   THR A CB    1 
ATOM   1396  O  OG1   . THR D 4  46   ? 40.308  25.718  11.537  1.00 158.74 ? 46   THR A OG1   1 
ATOM   1397  C  CG2   . THR D 4  46   ? 39.116  26.737  9.706   1.00 161.14 ? 46   THR A CG2   1 
ATOM   1398  N  N     . ARG D 4  47   ? 37.094  23.540  11.441  1.00 174.96 ? 47   ARG A N     1 
ATOM   1399  C  CA    . ARG D 4  47   ? 36.298  22.377  11.815  1.00 186.78 ? 47   ARG A CA    1 
ATOM   1400  C  C     . ARG D 4  47   ? 37.132  21.104  11.947  1.00 190.92 ? 47   ARG A C     1 
ATOM   1401  O  O     . ARG D 4  47   ? 36.615  19.998  11.774  1.00 183.29 ? 47   ARG A O     1 
ATOM   1402  C  CB    . ARG D 4  47   ? 35.176  22.175  10.798  1.00 189.04 ? 47   ARG A CB    1 
ATOM   1403  C  CG    . ARG D 4  47   ? 34.516  23.476  10.365  1.00 187.68 ? 47   ARG A CG    1 
ATOM   1404  C  CD    . ARG D 4  47   ? 33.090  23.265  9.895   1.00 188.68 ? 47   ARG A CD    1 
ATOM   1405  N  NE    . ARG D 4  47   ? 32.375  24.530  9.746   1.00 192.26 ? 47   ARG A NE    1 
ATOM   1406  C  CZ    . ARG D 4  47   ? 31.751  25.161  10.735  1.00 190.48 ? 47   ARG A CZ    1 
ATOM   1407  N  NH1   . ARG D 4  47   ? 31.128  26.308  10.500  1.00 186.50 ? 47   ARG A NH1   1 
ATOM   1408  N  NH2   . ARG D 4  47   ? 31.746  24.646  11.958  1.00 190.33 ? 47   ARG A NH2   1 
ATOM   1409  N  N     . ALA D 4  48   ? 38.416  21.241  12.257  1.00 199.22 ? 48   ALA A N     1 
ATOM   1410  C  CA    . ALA D 4  48   ? 39.309  20.113  12.500  1.00 196.57 ? 48   ALA A CA    1 
ATOM   1411  C  C     . ALA D 4  48   ? 39.800  20.162  13.946  1.00 195.85 ? 48   ALA A C     1 
ATOM   1412  O  O     . ALA D 4  48   ? 39.333  20.967  14.753  1.00 205.70 ? 48   ALA A O     1 
ATOM   1413  C  CB    . ALA D 4  48   ? 40.480  20.119  11.513  1.00 195.63 ? 48   ALA A CB    1 
ATOM   1414  N  N     . LYS D 4  49   ? 40.738  19.275  14.279  1.00 171.39 ? 49   LYS A N     1 
ATOM   1415  C  CA    . LYS D 4  49   ? 41.382  19.264  15.589  1.00 151.22 ? 49   LYS A CA    1 
ATOM   1416  C  C     . LYS D 4  49   ? 42.890  19.261  15.392  1.00 156.88 ? 49   LYS A C     1 
ATOM   1417  O  O     . LYS D 4  49   ? 43.437  18.319  14.810  1.00 151.11 ? 49   LYS A O     1 
ATOM   1418  C  CB    . LYS D 4  49   ? 40.946  18.050  16.415  1.00 136.33 ? 49   LYS A CB    1 
ATOM   1419  N  N     . ILE D 4  50   ? 43.560  20.313  15.880  1.00 166.16 ? 50   ILE A N     1 
ATOM   1420  C  CA    . ILE D 4  50   ? 45.008  20.426  15.707  1.00 158.02 ? 50   ILE A CA    1 
ATOM   1421  C  C     . ILE D 4  50   ? 45.717  19.465  16.660  1.00 139.22 ? 50   ILE A C     1 
ATOM   1422  O  O     . ILE D 4  50   ? 45.132  18.940  17.616  1.00 131.75 ? 50   ILE A O     1 
ATOM   1423  C  CB    . ILE D 4  50   ? 45.467  21.882  15.923  1.00 162.52 ? 50   ILE A CB    1 
ATOM   1424  C  CG1   . ILE D 4  50   ? 46.702  22.216  15.073  1.00 162.13 ? 50   ILE A CG1   1 
ATOM   1425  C  CG2   . ILE D 4  50   ? 45.706  22.183  17.409  1.00 161.56 ? 50   ILE A CG2   1 
ATOM   1426  C  CD1   . ILE D 4  50   ? 46.433  22.246  13.575  1.00 155.85 ? 50   ILE A CD1   1 
ATOM   1427  N  N     . GLY D 4  51   ? 47.005  19.233  16.394  1.00 139.81 ? 51   GLY A N     1 
ATOM   1428  C  CA    . GLY D 4  51   ? 47.819  18.364  17.227  1.00 140.99 ? 51   GLY A CA    1 
ATOM   1429  C  C     . GLY D 4  51   ? 48.209  18.977  18.559  1.00 137.20 ? 51   GLY A C     1 
ATOM   1430  O  O     . GLY D 4  51   ? 49.395  19.074  18.891  1.00 120.89 ? 51   GLY A O     1 
ATOM   1431  N  N     . GLY D 4  52   ? 47.208  19.393  19.328  1.00 147.51 ? 52   GLY A N     1 
ATOM   1432  C  CA    . GLY D 4  52   ? 47.409  20.036  20.607  1.00 153.19 ? 52   GLY A CA    1 
ATOM   1433  C  C     . GLY D 4  52   ? 46.907  19.196  21.760  1.00 154.32 ? 52   GLY A C     1 
ATOM   1434  O  O     . GLY D 4  52   ? 47.609  18.297  22.234  1.00 161.67 ? 52   GLY A O     1 
ATOM   1435  N  N     . LEU D 4  53   ? 45.690  19.496  22.226  1.00 149.46 ? 53   LEU A N     1 
ATOM   1436  C  CA    . LEU D 4  53   ? 45.129  18.781  23.368  1.00 139.50 ? 53   LEU A CA    1 
ATOM   1437  C  C     . LEU D 4  53   ? 44.797  17.334  23.018  1.00 151.29 ? 53   LEU A C     1 
ATOM   1438  O  O     . LEU D 4  53   ? 45.022  16.430  23.832  1.00 162.49 ? 53   LEU A O     1 
ATOM   1439  C  CB    . LEU D 4  53   ? 43.885  19.508  23.887  1.00 121.10 ? 53   LEU A CB    1 
ATOM   1440  C  CG    . LEU D 4  53   ? 43.293  19.015  25.214  1.00 103.57 ? 53   LEU A CG    1 
ATOM   1441  C  CD1   . LEU D 4  53   ? 42.892  20.187  26.095  1.00 105.61 ? 53   LEU A CD1   1 
ATOM   1442  C  CD2   . LEU D 4  53   ? 42.101  18.086  24.993  1.00 95.86  ? 53   LEU A CD2   1 
ATOM   1443  N  N     . ASN D 4  54   ? 44.245  17.089  21.829  1.00 148.70 ? 54   ASN A N     1 
ATOM   1444  C  CA    . ASN D 4  54   ? 43.900  15.729  21.438  1.00 141.94 ? 54   ASN A CA    1 
ATOM   1445  C  C     . ASN D 4  54   ? 44.113  15.556  19.940  1.00 144.22 ? 54   ASN A C     1 
ATOM   1446  O  O     . ASN D 4  54   ? 44.262  16.523  19.187  1.00 150.88 ? 54   ASN A O     1 
ATOM   1447  C  CB    . ASN D 4  54   ? 42.458  15.366  21.829  1.00 128.24 ? 54   ASN A CB    1 
ATOM   1448  C  CG    . ASN D 4  54   ? 41.431  16.290  21.213  1.00 125.26 ? 54   ASN A CG    1 
ATOM   1449  O  OD1   . ASN D 4  54   ? 41.093  17.326  21.783  1.00 136.11 ? 54   ASN A OD1   1 
ATOM   1450  N  ND2   . ASN D 4  54   ? 40.918  15.912  20.047  1.00 121.84 ? 54   ASN A ND2   1 
ATOM   1451  N  N     . ASP D 4  55   ? 44.157  14.284  19.532  1.00 137.42 ? 55   ASP A N     1 
ATOM   1452  C  CA    . ASP D 4  55   ? 44.391  13.768  18.186  1.00 130.75 ? 55   ASP A CA    1 
ATOM   1453  C  C     . ASP D 4  55   ? 45.699  14.190  17.506  1.00 149.94 ? 55   ASP A C     1 
ATOM   1454  O  O     . ASP D 4  55   ? 45.654  14.596  16.337  1.00 159.29 ? 55   ASP A O     1 
ATOM   1455  C  CB    . ASP D 4  55   ? 43.211  14.149  17.283  1.00 113.80 ? 55   ASP A CB    1 
ATOM   1456  N  N     . PRO D 4  56   ? 46.900  14.120  18.169  1.00 159.10 ? 56   PRO A N     1 
ATOM   1457  C  CA    . PRO D 4  56   ? 48.107  13.870  17.342  1.00 168.53 ? 56   PRO A CA    1 
ATOM   1458  C  C     . PRO D 4  56   ? 48.292  12.360  17.184  1.00 182.36 ? 56   PRO A C     1 
ATOM   1459  O  O     . PRO D 4  56   ? 49.005  11.698  17.949  1.00 184.50 ? 56   PRO A O     1 
ATOM   1460  C  CB    . PRO D 4  56   ? 49.228  14.531  18.150  1.00 155.99 ? 56   PRO A CB    1 
ATOM   1461  C  CG    . PRO D 4  56   ? 48.555  15.334  19.218  1.00 151.36 ? 56   PRO A CG    1 
ATOM   1462  C  CD    . PRO D 4  56   ? 47.311  14.572  19.510  1.00 152.94 ? 56   PRO A CD    1 
ATOM   1463  N  N     . ARG D 4  57   ? 47.574  11.814  16.194  1.00 189.06 ? 57   ARG A N     1 
ATOM   1464  C  CA    . ARG D 4  57   ? 47.402  10.383  15.932  1.00 185.37 ? 57   ARG A CA    1 
ATOM   1465  C  C     . ARG D 4  57   ? 46.649  9.676   17.054  1.00 179.40 ? 57   ARG A C     1 
ATOM   1466  O  O     . ARG D 4  57   ? 46.891  8.493   17.320  1.00 167.73 ? 57   ARG A O     1 
ATOM   1467  C  CB    . ARG D 4  57   ? 48.731  9.663   15.647  1.00 182.56 ? 57   ARG A CB    1 
ATOM   1468  N  N     . LEU D 4  58   ? 45.748  10.383  17.731  1.00 178.89 ? 58   LEU A N     1 
ATOM   1469  C  CA    . LEU D 4  58   ? 44.824  9.776   18.670  1.00 177.87 ? 58   LEU A CA    1 
ATOM   1470  C  C     . LEU D 4  58   ? 43.447  9.611   18.022  1.00 201.97 ? 58   LEU A C     1 
ATOM   1471  O  O     . LEU D 4  58   ? 43.274  9.821   16.818  1.00 209.14 ? 58   LEU A O     1 
ATOM   1472  C  CB    . LEU D 4  58   ? 44.750  10.596  19.959  1.00 149.40 ? 58   LEU A CB    1 
ATOM   1473  C  CG    . LEU D 4  58   ? 45.193  9.831   21.203  1.00 128.25 ? 58   LEU A CG    1 
ATOM   1474  C  CD1   . LEU D 4  58   ? 44.790  10.569  22.475  1.00 118.50 ? 58   LEU A CD1   1 
ATOM   1475  C  CD2   . LEU D 4  58   ? 44.616  8.428   21.170  1.00 117.62 ? 58   LEU A CD2   1 
ATOM   1476  N  N     . GLY D 4  59   ? 42.456  9.252   18.835  1.00 212.71 ? 59   GLY A N     1 
ATOM   1477  C  CA    . GLY D 4  59   ? 41.148  8.892   18.309  1.00 205.21 ? 59   GLY A CA    1 
ATOM   1478  C  C     . GLY D 4  59   ? 40.396  10.099  17.780  1.00 198.78 ? 59   GLY A C     1 
ATOM   1479  O  O     . GLY D 4  59   ? 40.200  11.091  18.491  1.00 206.61 ? 59   GLY A O     1 
ATOM   1480  N  N     . SER D 4  60   ? 39.969  10.017  16.522  1.00 178.16 ? 60   SER A N     1 
ATOM   1481  C  CA    . SER D 4  60   ? 39.171  11.072  15.924  1.00 164.54 ? 60   SER A CA    1 
ATOM   1482  C  C     . SER D 4  60   ? 37.739  11.016  16.454  1.00 154.44 ? 60   SER A C     1 
ATOM   1483  O  O     . SER D 4  60   ? 37.288  10.002  16.995  1.00 144.88 ? 60   SER A O     1 
ATOM   1484  C  CB    . SER D 4  60   ? 39.185  10.955  14.399  1.00 159.48 ? 60   SER A CB    1 
ATOM   1485  O  OG    . SER D 4  60   ? 40.513  10.966  13.903  1.00 155.16 ? 60   SER A OG    1 
ATOM   1486  N  N     . ILE D 4  61   ? 37.026  12.134  16.300  1.00 156.90 ? 61   ILE A N     1 
ATOM   1487  C  CA    . ILE D 4  61   ? 35.675  12.283  16.823  1.00 162.64 ? 61   ILE A CA    1 
ATOM   1488  C  C     . ILE D 4  61   ? 34.655  12.562  15.724  1.00 175.64 ? 61   ILE A C     1 
ATOM   1489  O  O     . ILE D 4  61   ? 33.495  12.855  16.021  1.00 177.16 ? 61   ILE A O     1 
ATOM   1490  C  CB    . ILE D 4  61   ? 35.614  13.373  17.912  1.00 159.62 ? 61   ILE A CB    1 
ATOM   1491  C  CG1   . ILE D 4  61   ? 36.144  14.707  17.375  1.00 155.72 ? 61   ILE A CG1   1 
ATOM   1492  C  CG2   . ILE D 4  61   ? 36.387  12.939  19.153  1.00 156.78 ? 61   ILE A CG2   1 
ATOM   1493  C  CD1   . ILE D 4  61   ? 36.122  15.839  18.391  1.00 151.06 ? 61   ILE A CD1   1 
ATOM   1494  N  N     . ASP D 4  62   ? 35.056  12.475  14.457  1.00 189.22 ? 62   ASP A N     1 
ATOM   1495  C  CA    . ASP D 4  62   ? 34.143  12.660  13.335  1.00 198.43 ? 62   ASP A CA    1 
ATOM   1496  C  C     . ASP D 4  62   ? 33.527  11.342  12.873  1.00 189.58 ? 62   ASP A C     1 
ATOM   1497  O  O     . ASP D 4  62   ? 32.903  11.304  11.807  1.00 192.65 ? 62   ASP A O     1 
ATOM   1498  C  CB    . ASP D 4  62   ? 34.880  13.346  12.175  1.00 200.10 ? 62   ASP A CB    1 
ATOM   1499  C  CG    . ASP D 4  62   ? 33.967  14.220  11.318  1.00 193.25 ? 62   ASP A CG    1 
ATOM   1500  O  OD1   . ASP D 4  62   ? 33.320  13.699  10.385  1.00 190.70 ? 62   ASP A OD1   1 
ATOM   1501  O  OD2   . ASP D 4  62   ? 33.901  15.440  11.580  1.00 190.97 ? 62   ASP A OD2   1 
ATOM   1502  N  N     . ARG D 4  63   ? 33.678  10.278  13.673  1.00 164.87 ? 63   ARG A N     1 
ATOM   1503  C  CA    . ARG D 4  63   ? 33.361  8.898   13.284  1.00 144.81 ? 63   ARG A CA    1 
ATOM   1504  C  C     . ARG D 4  63   ? 34.075  8.520   11.989  1.00 137.03 ? 63   ARG A C     1 
ATOM   1505  O  O     . ARG D 4  63   ? 33.543  7.800   11.139  1.00 129.50 ? 63   ARG A O     1 
ATOM   1506  C  CB    . ARG D 4  63   ? 31.850  8.668   13.176  1.00 134.15 ? 63   ARG A CB    1 
ATOM   1507  C  CG    . ARG D 4  63   ? 31.083  9.017   14.440  1.00 128.40 ? 63   ARG A CG    1 
ATOM   1508  C  CD    . ARG D 4  63   ? 30.335  10.325  14.278  1.00 132.97 ? 63   ARG A CD    1 
ATOM   1509  N  NE    . ARG D 4  63   ? 29.375  10.257  13.182  1.00 141.65 ? 63   ARG A NE    1 
ATOM   1510  C  CZ    . ARG D 4  63   ? 28.105  9.894   13.327  1.00 142.19 ? 63   ARG A CZ    1 
ATOM   1511  N  NH1   . ARG D 4  63   ? 27.641  9.567   14.527  1.00 141.51 ? 63   ARG A NH1   1 
ATOM   1512  N  NH2   . ARG D 4  63   ? 27.296  9.859   12.275  1.00 141.26 ? 63   ARG A NH2   1 
ATOM   1513  N  N     . ASN D 4  64   ? 35.299  9.020   11.843  1.00 140.21 ? 64   ASN A N     1 
ATOM   1514  C  CA    . ASN D 4  64   ? 36.159  8.717   10.713  1.00 153.19 ? 64   ASN A CA    1 
ATOM   1515  C  C     . ASN D 4  64   ? 37.297  7.824   11.184  1.00 174.79 ? 64   ASN A C     1 
ATOM   1516  O  O     . ASN D 4  64   ? 37.835  8.013   12.280  1.00 173.15 ? 64   ASN A O     1 
ATOM   1517  C  CB    . ASN D 4  64   ? 36.712  9.996   10.078  1.00 150.64 ? 64   ASN A CB    1 
ATOM   1518  C  CG    . ASN D 4  64   ? 35.615  10.901  9.548   1.00 163.51 ? 64   ASN A CG    1 
ATOM   1519  O  OD1   . ASN D 4  64   ? 34.457  10.492  9.436   1.00 166.64 ? 64   ASN A OD1   1 
ATOM   1520  N  ND2   . ASN D 4  64   ? 35.975  12.135  9.211   1.00 168.19 ? 64   ASN A ND2   1 
ATOM   1521  N  N     . LEU D 4  65   ? 37.671  6.868   10.341  1.00 194.33 ? 65   LEU A N     1 
ATOM   1522  C  CA    . LEU D 4  65   ? 38.644  5.847   10.703  1.00 191.37 ? 65   LEU A CA    1 
ATOM   1523  C  C     . LEU D 4  65   ? 40.049  6.453   10.704  1.00 196.33 ? 65   LEU A C     1 
ATOM   1524  O  O     . LEU D 4  65   ? 40.237  7.666   10.565  1.00 198.40 ? 65   LEU A O     1 
ATOM   1525  C  CB    . LEU D 4  65   ? 38.540  4.662   9.746   1.00 183.44 ? 65   LEU A CB    1 
ATOM   1526  C  CG    . LEU D 4  65   ? 37.146  4.290   9.229   1.00 171.83 ? 65   LEU A CG    1 
ATOM   1527  C  CD1   . LEU D 4  65   ? 37.247  3.258   8.115   1.00 170.21 ? 65   LEU A CD1   1 
ATOM   1528  C  CD2   . LEU D 4  65   ? 36.253  3.779   10.351  1.00 165.10 ? 65   LEU A CD2   1 
ATOM   1529  N  N     . LYS D 4  66   ? 41.051  5.584   10.875  1.00 198.82 ? 66   LYS A N     1 
ATOM   1530  C  CA    . LYS D 4  66   ? 42.473  5.935   10.823  1.00 202.96 ? 66   LYS A CA    1 
ATOM   1531  C  C     . LYS D 4  66   ? 42.817  6.994   11.873  1.00 198.81 ? 66   LYS A C     1 
ATOM   1532  O  O     . LYS D 4  66   ? 43.259  8.103   11.561  1.00 202.96 ? 66   LYS A O     1 
ATOM   1533  C  CB    . LYS D 4  66   ? 42.880  6.396   9.416   1.00 205.75 ? 66   LYS A CB    1 
ATOM   1534  C  CG    . LYS D 4  66   ? 42.403  5.487   8.289   1.00 199.48 ? 66   LYS A CG    1 
ATOM   1535  C  CD    . LYS D 4  66   ? 42.661  6.112   6.924   1.00 191.27 ? 66   LYS A CD    1 
ATOM   1536  C  CE    . LYS D 4  66   ? 42.104  5.248   5.801   1.00 182.57 ? 66   LYS A CE    1 
ATOM   1537  N  NZ    . LYS D 4  66   ? 40.618  5.144   5.862   1.00 175.51 ? 66   LYS A NZ    1 
ATOM   1538  N  N     . CYS D 4  67   ? 42.576  6.640   13.134  1.00 187.43 ? 67   CYS A N     1 
ATOM   1539  C  CA    . CYS D 4  67   ? 42.929  7.524   14.235  1.00 186.93 ? 67   CYS A CA    1 
ATOM   1540  C  C     . CYS D 4  67   ? 44.446  7.630   14.323  1.00 194.81 ? 67   CYS A C     1 
ATOM   1541  O  O     . CYS D 4  67   ? 45.028  8.692   14.074  1.00 193.21 ? 67   CYS A O     1 
ATOM   1542  C  CB    . CYS D 4  67   ? 42.337  6.991   15.541  1.00 184.99 ? 67   CYS A CB    1 
ATOM   1543  S  SG    . CYS D 4  67   ? 43.173  5.541   16.225  1.00 189.36 ? 67   CYS A SG    1 
ATOM   1544  N  N     . GLN D 4  68   ? 45.080  6.518   14.670  1.00 199.24 ? 68   GLN A N     1 
ATOM   1545  C  CA    . GLN D 4  68   ? 46.478  6.229   14.394  1.00 195.74 ? 68   GLN A CA    1 
ATOM   1546  C  C     . GLN D 4  68   ? 46.509  5.441   13.083  1.00 206.99 ? 68   GLN A C     1 
ATOM   1547  O  O     . GLN D 4  68   ? 45.531  5.445   12.330  1.00 205.28 ? 68   GLN A O     1 
ATOM   1548  C  CB    . GLN D 4  68   ? 47.093  5.491   15.591  1.00 176.77 ? 68   GLN A CB    1 
ATOM   1549  C  CG    . GLN D 4  68   ? 48.483  5.971   15.985  1.00 161.96 ? 68   GLN A CG    1 
ATOM   1550  C  CD    . GLN D 4  68   ? 49.584  5.115   15.399  1.00 151.43 ? 68   GLN A CD    1 
ATOM   1551  O  OE1   . GLN D 4  68   ? 49.477  3.891   15.356  1.00 150.40 ? 68   GLN A OE1   1 
ATOM   1552  N  NE2   . GLN D 4  68   ? 50.648  5.758   14.930  1.00 143.67 ? 68   GLN A NE2   1 
ATOM   1553  N  N     . THR D 4  69   ? 47.612  4.754   12.780  1.00 223.53 ? 69   THR A N     1 
ATOM   1554  C  CA    . THR D 4  69   ? 47.518  3.649   11.828  1.00 224.26 ? 69   THR A CA    1 
ATOM   1555  C  C     . THR D 4  69   ? 46.902  2.394   12.453  1.00 216.24 ? 69   THR A C     1 
ATOM   1556  O  O     . THR D 4  69   ? 46.962  1.319   11.845  1.00 215.57 ? 69   THR A O     1 
ATOM   1557  C  CB    . THR D 4  69   ? 48.887  3.316   11.224  1.00 230.09 ? 69   THR A CB    1 
ATOM   1558  O  OG1   . THR D 4  69   ? 48.737  2.265   10.258  1.00 230.78 ? 69   THR A OG1   1 
ATOM   1559  C  CG2   . THR D 4  69   ? 49.861  2.872   12.293  1.00 230.23 ? 69   THR A CG2   1 
ATOM   1560  N  N     . CYS D 4  70   ? 46.310  2.529   13.648  1.00 204.99 ? 70   CYS A N     1 
ATOM   1561  C  CA    . CYS D 4  70   ? 45.458  1.519   14.263  1.00 191.72 ? 70   CYS A CA    1 
ATOM   1562  C  C     . CYS D 4  70   ? 44.325  1.057   13.351  1.00 186.76 ? 70   CYS A C     1 
ATOM   1563  O  O     . CYS D 4  70   ? 43.781  -0.031  13.571  1.00 187.79 ? 70   CYS A O     1 
ATOM   1564  C  CB    . CYS D 4  70   ? 44.888  2.087   15.567  1.00 182.22 ? 70   CYS A CB    1 
ATOM   1565  S  SG    . CYS D 4  70   ? 43.939  0.940   16.587  1.00 185.53 ? 70   CYS A SG    1 
ATOM   1566  N  N     . GLN D 4  71   ? 43.916  1.883   12.381  1.00 181.03 ? 71   GLN A N     1 
ATOM   1567  C  CA    . GLN D 4  71   ? 43.073  1.578   11.221  1.00 189.05 ? 71   GLN A CA    1 
ATOM   1568  C  C     . GLN D 4  71   ? 41.636  1.213   11.588  1.00 189.31 ? 71   GLN A C     1 
ATOM   1569  O  O     . GLN D 4  71   ? 40.803  1.038   10.683  1.00 197.82 ? 71   GLN A O     1 
ATOM   1570  C  CB    . GLN D 4  71   ? 43.684  0.474   10.333  1.00 197.71 ? 71   GLN A CB    1 
ATOM   1571  C  CG    . GLN D 4  71   ? 43.269  -0.973  10.637  1.00 194.52 ? 71   GLN A CG    1 
ATOM   1572  C  CD    . GLN D 4  71   ? 43.848  -1.980  9.663   1.00 182.36 ? 71   GLN A CD    1 
ATOM   1573  O  OE1   . GLN D 4  71   ? 45.045  -2.262  9.683   1.00 180.96 ? 71   GLN A OE1   1 
ATOM   1574  N  NE2   . GLN D 4  71   ? 42.999  -2.527  8.802   1.00 170.45 ? 71   GLN A NE2   1 
ATOM   1575  N  N     . GLU D 4  72   ? 41.297  1.151   12.869  1.00 172.37 ? 72   GLU A N     1 
ATOM   1576  C  CA    . GLU D 4  72   ? 39.961  0.800   13.316  1.00 153.11 ? 72   GLU A CA    1 
ATOM   1577  C  C     . GLU D 4  72   ? 39.208  2.052   13.748  1.00 130.09 ? 72   GLU A C     1 
ATOM   1578  O  O     . GLU D 4  72   ? 39.805  3.043   14.175  1.00 109.38 ? 72   GLU A O     1 
ATOM   1579  C  CB    . GLU D 4  72   ? 40.030  -0.205  14.464  1.00 153.87 ? 72   GLU A CB    1 
ATOM   1580  C  CG    . GLU D 4  72   ? 40.683  -1.535  14.096  1.00 153.84 ? 72   GLU A CG    1 
ATOM   1581  C  CD    . GLU D 4  72   ? 39.980  -2.238  12.946  1.00 154.59 ? 72   GLU A CD    1 
ATOM   1582  O  OE1   . GLU D 4  72   ? 40.613  -2.430  11.888  1.00 155.55 ? 72   GLU A OE1   1 
ATOM   1583  O  OE2   . GLU D 4  72   ? 38.791  -2.594  13.093  1.00 152.96 ? 72   GLU A OE2   1 
ATOM   1584  N  N     . GLY D 4  73   ? 37.882  1.995   13.631  1.00 132.45 ? 73   GLY A N     1 
ATOM   1585  C  CA    . GLY D 4  73   ? 37.031  3.124   13.944  1.00 133.03 ? 73   GLY A CA    1 
ATOM   1586  C  C     . GLY D 4  73   ? 36.877  3.343   15.435  1.00 132.19 ? 73   GLY A C     1 
ATOM   1587  O  O     . GLY D 4  73   ? 37.651  2.840   16.254  1.00 139.56 ? 73   GLY A O     1 
ATOM   1588  N  N     . MET D 4  74   ? 35.846  4.113   15.790  1.00 129.35 ? 74   MET A N     1 
ATOM   1589  C  CA    . MET D 4  74   ? 35.573  4.391   17.195  1.00 131.96 ? 74   MET A CA    1 
ATOM   1590  C  C     . MET D 4  74   ? 35.115  3.157   17.962  1.00 144.93 ? 74   MET A C     1 
ATOM   1591  O  O     . MET D 4  74   ? 35.238  3.131   19.191  1.00 154.07 ? 74   MET A O     1 
ATOM   1592  C  CB    . MET D 4  74   ? 34.520  5.493   17.321  1.00 121.77 ? 74   MET A CB    1 
ATOM   1593  C  CG    . MET D 4  74   ? 34.972  6.848   16.817  1.00 128.07 ? 74   MET A CG    1 
ATOM   1594  S  SD    . MET D 4  74   ? 33.741  8.118   17.162  1.00 144.76 ? 74   MET A SD    1 
ATOM   1595  C  CE    . MET D 4  74   ? 33.502  7.901   18.923  1.00 130.06 ? 74   MET A CE    1 
ATOM   1596  N  N     . ASN D 4  75   ? 34.609  2.132   17.271  1.00 142.39 ? 75   ASN A N     1 
ATOM   1597  C  CA    . ASN D 4  75   ? 34.073  0.967   17.965  1.00 140.65 ? 75   ASN A CA    1 
ATOM   1598  C  C     . ASN D 4  75   ? 35.172  0.023   18.448  1.00 143.88 ? 75   ASN A C     1 
ATOM   1599  O  O     . ASN D 4  75   ? 35.023  -0.596  19.508  1.00 147.14 ? 75   ASN A O     1 
ATOM   1600  C  CB    . ASN D 4  75   ? 33.088  0.217   17.062  1.00 132.71 ? 75   ASN A CB    1 
ATOM   1601  C  CG    . ASN D 4  75   ? 32.198  -0.745  17.838  1.00 136.40 ? 75   ASN A CG    1 
ATOM   1602  O  OD1   . ASN D 4  75   ? 32.117  -0.684  19.066  1.00 135.31 ? 75   ASN A OD1   1 
ATOM   1603  N  ND2   . ASN D 4  75   ? 31.525  -1.638  17.120  1.00 144.31 ? 75   ASN A ND2   1 
ATOM   1604  N  N     . GLU D 4  76   ? 36.275  -0.101  17.707  1.00 138.38 ? 76   GLU A N     1 
ATOM   1605  C  CA    . GLU D 4  76   ? 37.342  -1.026  18.076  1.00 136.51 ? 76   GLU A CA    1 
ATOM   1606  C  C     . GLU D 4  76   ? 38.526  -0.352  18.761  1.00 142.90 ? 76   GLU A C     1 
ATOM   1607  O  O     . GLU D 4  76   ? 39.068  -0.911  19.721  1.00 152.48 ? 76   GLU A O     1 
ATOM   1608  C  CB    . GLU D 4  76   ? 37.837  -1.792  16.842  1.00 135.90 ? 76   GLU A CB    1 
ATOM   1609  C  CG    . GLU D 4  76   ? 38.971  -2.777  17.122  1.00 133.93 ? 76   GLU A CG    1 
ATOM   1610  C  CD    . GLU D 4  76   ? 38.488  -4.032  17.816  1.00 126.46 ? 76   GLU A CD    1 
ATOM   1611  O  OE1   . GLU D 4  76   ? 37.488  -4.607  17.350  1.00 121.49 ? 76   GLU A OE1   1 
ATOM   1612  O  OE2   . GLU D 4  76   ? 39.101  -4.438  18.828  1.00 118.91 ? 76   GLU A OE2   1 
ATOM   1613  N  N     . CYS D 4  77   ? 38.942  0.839   18.300  1.00 138.40 ? 77   CYS A N     1 
ATOM   1614  C  CA    . CYS D 4  77   ? 40.059  1.558   18.908  1.00 135.23 ? 77   CYS A CA    1 
ATOM   1615  C  C     . CYS D 4  77   ? 39.727  1.943   20.343  1.00 135.49 ? 77   CYS A C     1 
ATOM   1616  O  O     . CYS D 4  77   ? 38.830  2.765   20.578  1.00 127.78 ? 77   CYS A O     1 
ATOM   1617  C  CB    . CYS D 4  77   ? 40.411  2.815   18.114  1.00 128.11 ? 77   CYS A CB    1 
ATOM   1618  S  SG    . CYS D 4  77   ? 41.508  3.960   19.001  1.00 112.88 ? 77   CYS A SG    1 
ATOM   1619  N  N     . PRO D 4  78   ? 40.435  1.379   21.326  1.00 147.05 ? 78   PRO A N     1 
ATOM   1620  C  CA    . PRO D 4  78   ? 40.108  1.665   22.730  1.00 146.61 ? 78   PRO A CA    1 
ATOM   1621  C  C     . PRO D 4  78   ? 40.467  3.071   23.157  1.00 145.59 ? 78   PRO A C     1 
ATOM   1622  O  O     . PRO D 4  78   ? 40.020  3.517   24.221  1.00 151.69 ? 78   PRO A O     1 
ATOM   1623  C  CB    . PRO D 4  78   ? 40.942  0.630   23.490  1.00 153.88 ? 78   PRO A CB    1 
ATOM   1624  C  CG    . PRO D 4  78   ? 42.143  0.436   22.616  1.00 154.07 ? 78   PRO A CG    1 
ATOM   1625  C  CD    . PRO D 4  78   ? 41.639  0.536   21.198  1.00 157.73 ? 78   PRO A CD    1 
ATOM   1626  N  N     . GLY D 4  79   ? 41.247  3.782   22.357  1.00 134.83 ? 79   GLY A N     1 
ATOM   1627  C  CA    . GLY D 4  79   ? 41.742  5.072   22.756  1.00 128.03 ? 79   GLY A CA    1 
ATOM   1628  C  C     . GLY D 4  79   ? 43.128  4.917   23.336  1.00 130.58 ? 79   GLY A C     1 
ATOM   1629  O  O     . GLY D 4  79   ? 43.292  4.427   24.458  1.00 123.86 ? 79   GLY A O     1 
ATOM   1630  N  N     . HIS D 4  80   ? 44.134  5.318   22.567  1.00 143.01 ? 80   HIS A N     1 
ATOM   1631  C  CA    . HIS D 4  80   ? 45.514  5.220   23.003  1.00 153.17 ? 80   HIS A CA    1 
ATOM   1632  C  C     . HIS D 4  80   ? 45.835  6.356   23.967  1.00 158.30 ? 80   HIS A C     1 
ATOM   1633  O  O     . HIS D 4  80   ? 45.116  7.352   24.060  1.00 156.33 ? 80   HIS A O     1 
ATOM   1634  C  CB    . HIS D 4  80   ? 46.436  5.236   21.788  1.00 160.95 ? 80   HIS A CB    1 
ATOM   1635  C  CG    . HIS D 4  80   ? 45.776  4.719   20.551  1.00 169.07 ? 80   HIS A CG    1 
ATOM   1636  N  ND1   . HIS D 4  80   ? 45.623  3.372   20.300  1.00 170.87 ? 80   HIS A ND1   1 
ATOM   1637  C  CD2   . HIS D 4  80   ? 45.202  5.367   19.510  1.00 172.86 ? 80   HIS A CD2   1 
ATOM   1638  C  CE1   . HIS D 4  80   ? 44.997  3.212   19.149  1.00 175.26 ? 80   HIS A CE1   1 
ATOM   1639  N  NE2   . HIS D 4  80   ? 44.734  4.407   18.649  1.00 185.27 ? 80   HIS A NE2   1 
ATOM   1640  N  N     . PHE D 4  81   ? 46.904  6.187   24.727  1.00 157.57 ? 81   PHE A N     1 
ATOM   1641  C  CA    . PHE D 4  81   ? 47.112  7.087   25.846  1.00 149.26 ? 81   PHE A CA    1 
ATOM   1642  C  C     . PHE D 4  81   ? 48.165  8.131   25.496  1.00 148.09 ? 81   PHE A C     1 
ATOM   1643  O  O     . PHE D 4  81   ? 49.087  7.873   24.717  1.00 144.30 ? 81   PHE A O     1 
ATOM   1644  C  CB    . PHE D 4  81   ? 47.511  6.304   27.100  1.00 139.58 ? 81   PHE A CB    1 
ATOM   1645  C  CG    . PHE D 4  81   ? 46.848  6.811   28.348  1.00 133.71 ? 81   PHE A CG    1 
ATOM   1646  C  CD1   . PHE D 4  81   ? 45.878  6.052   28.987  1.00 125.89 ? 81   PHE A CD1   1 
ATOM   1647  C  CD2   . PHE D 4  81   ? 47.167  8.052   28.867  1.00 138.63 ? 81   PHE A CD2   1 
ATOM   1648  C  CE1   . PHE D 4  81   ? 45.249  6.514   30.129  1.00 123.94 ? 81   PHE A CE1   1 
ATOM   1649  C  CE2   . PHE D 4  81   ? 46.536  8.518   30.010  1.00 137.78 ? 81   PHE A CE2   1 
ATOM   1650  C  CZ    . PHE D 4  81   ? 45.581  7.746   30.641  1.00 132.41 ? 81   PHE A CZ    1 
ATOM   1651  N  N     . GLY D 4  82   ? 48.001  9.330   26.058  1.00 148.78 ? 82   GLY A N     1 
ATOM   1652  C  CA    . GLY D 4  82   ? 48.948  10.402  25.870  1.00 149.14 ? 82   GLY A CA    1 
ATOM   1653  C  C     . GLY D 4  82   ? 49.678  10.754  27.155  1.00 147.54 ? 82   GLY A C     1 
ATOM   1654  O  O     . GLY D 4  82   ? 49.375  10.265  28.238  1.00 148.65 ? 82   GLY A O     1 
ATOM   1655  N  N     . HIS D 4  83   ? 50.619  11.689  27.022  1.00 147.26 ? 83   HIS A N     1 
ATOM   1656  C  CA    . HIS D 4  83   ? 51.345  12.201  28.176  1.00 155.14 ? 83   HIS A CA    1 
ATOM   1657  C  C     . HIS D 4  83   ? 51.586  13.694  28.013  1.00 159.24 ? 83   HIS A C     1 
ATOM   1658  O  O     . HIS D 4  83   ? 51.425  14.264  26.929  1.00 160.60 ? 83   HIS A O     1 
ATOM   1659  C  CB    . HIS D 4  83   ? 52.685  11.490  28.373  1.00 162.49 ? 83   HIS A CB    1 
ATOM   1660  C  CG    . HIS D 4  83   ? 53.804  12.079  27.572  1.00 163.06 ? 83   HIS A CG    1 
ATOM   1661  N  ND1   . HIS D 4  83   ? 53.880  11.965  26.200  1.00 162.34 ? 83   HIS A ND1   1 
ATOM   1662  C  CD2   . HIS D 4  83   ? 54.883  12.804  27.950  1.00 164.84 ? 83   HIS A CD2   1 
ATOM   1663  C  CE1   . HIS D 4  83   ? 54.966  12.580  25.770  1.00 164.24 ? 83   HIS A CE1   1 
ATOM   1664  N  NE2   . HIS D 4  83   ? 55.590  13.101  26.811  1.00 166.93 ? 83   HIS A NE2   1 
ATOM   1665  N  N     . ILE D 4  84   ? 51.973  14.320  29.120  1.00 163.17 ? 84   ILE A N     1 
ATOM   1666  C  CA    . ILE D 4  84   ? 52.394  15.717  29.154  1.00 166.15 ? 84   ILE A CA    1 
ATOM   1667  C  C     . ILE D 4  84   ? 53.304  15.901  30.363  1.00 170.44 ? 84   ILE A C     1 
ATOM   1668  O  O     . ILE D 4  84   ? 52.963  15.494  31.477  1.00 182.26 ? 84   ILE A O     1 
ATOM   1669  C  CB    . ILE D 4  84   ? 51.186  16.681  29.192  1.00 157.11 ? 84   ILE A CB    1 
ATOM   1670  C  CG1   . ILE D 4  84   ? 51.627  18.102  29.542  1.00 155.27 ? 84   ILE A CG1   1 
ATOM   1671  C  CG2   . ILE D 4  84   ? 50.089  16.177  30.129  1.00 153.17 ? 84   ILE A CG2   1 
ATOM   1672  C  CD1   . ILE D 4  84   ? 50.512  19.094  29.467  1.00 151.68 ? 84   ILE A CD1   1 
ATOM   1673  N  N     . ASP D 4  85   ? 54.470  16.497  30.144  1.00 162.45 ? 85   ASP A N     1 
ATOM   1674  C  CA    . ASP D 4  85   ? 55.425  16.726  31.219  1.00 154.85 ? 85   ASP A CA    1 
ATOM   1675  C  C     . ASP D 4  85   ? 55.256  18.136  31.774  1.00 149.87 ? 85   ASP A C     1 
ATOM   1676  O  O     . ASP D 4  85   ? 55.185  19.107  31.013  1.00 148.69 ? 85   ASP A O     1 
ATOM   1677  C  CB    . ASP D 4  85   ? 56.853  16.506  30.720  1.00 151.17 ? 85   ASP A CB    1 
ATOM   1678  C  CG    . ASP D 4  85   ? 57.082  17.102  29.346  1.00 156.17 ? 85   ASP A CG    1 
ATOM   1679  O  OD1   . ASP D 4  85   ? 56.907  16.372  28.350  1.00 157.08 ? 85   ASP A OD1   1 
ATOM   1680  O  OD2   . ASP D 4  85   ? 57.426  18.299  29.257  1.00 160.49 ? 85   ASP A OD2   1 
ATOM   1681  N  N     . LEU D 4  86   ? 55.176  18.242  33.099  1.00 146.81 ? 86   LEU A N     1 
ATOM   1682  C  CA    . LEU D 4  86   ? 55.113  19.530  33.775  1.00 149.15 ? 86   LEU A CA    1 
ATOM   1683  C  C     . LEU D 4  86   ? 56.513  20.000  34.151  1.00 155.65 ? 86   LEU A C     1 
ATOM   1684  O  O     . LEU D 4  86   ? 57.438  19.199  34.311  1.00 163.13 ? 86   LEU A O     1 
ATOM   1685  C  CB    . LEU D 4  86   ? 54.237  19.450  35.029  1.00 149.59 ? 86   LEU A CB    1 
ATOM   1686  C  CG    . LEU D 4  86   ? 52.782  19.021  34.826  1.00 152.51 ? 86   LEU A CG    1 
ATOM   1687  C  CD1   . LEU D 4  86   ? 52.056  18.910  36.158  1.00 154.80 ? 86   LEU A CD1   1 
ATOM   1688  C  CD2   . LEU D 4  86   ? 52.066  19.999  33.910  1.00 152.75 ? 86   LEU A CD2   1 
ATOM   1689  N  N     . ALA D 4  87   ? 56.662  21.320  34.283  1.00 154.42 ? 87   ALA A N     1 
ATOM   1690  C  CA    . ALA D 4  87   ? 57.953  21.880  34.671  1.00 157.98 ? 87   ALA A CA    1 
ATOM   1691  C  C     . ALA D 4  87   ? 58.263  21.578  36.133  1.00 173.09 ? 87   ALA A C     1 
ATOM   1692  O  O     . ALA D 4  87   ? 59.338  21.056  36.455  1.00 179.32 ? 87   ALA A O     1 
ATOM   1693  C  CB    . ALA D 4  87   ? 57.974  23.388  34.410  1.00 146.42 ? 87   ALA A CB    1 
ATOM   1694  N  N     . LYS D 4  88   ? 57.326  21.881  37.034  1.00 177.25 ? 88   LYS A N     1 
ATOM   1695  C  CA    . LYS D 4  88   ? 57.523  21.653  38.459  1.00 174.63 ? 88   LYS A CA    1 
ATOM   1696  C  C     . LYS D 4  88   ? 56.661  20.493  38.933  1.00 172.44 ? 88   LYS A C     1 
ATOM   1697  O  O     . LYS D 4  88   ? 55.467  20.446  38.605  1.00 167.57 ? 88   LYS A O     1 
ATOM   1698  C  CB    . LYS D 4  88   ? 57.188  22.918  39.260  1.00 166.64 ? 88   LYS A CB    1 
ATOM   1699  C  CG    . LYS D 4  88   ? 58.316  23.940  39.283  1.00 154.22 ? 88   LYS A CG    1 
ATOM   1700  C  CD    . LYS D 4  88   ? 59.623  23.313  39.750  1.00 141.47 ? 88   LYS A CD    1 
ATOM   1701  C  CE    . LYS D 4  88   ? 60.689  24.367  39.999  1.00 136.88 ? 88   LYS A CE    1 
ATOM   1702  N  NZ    . LYS D 4  88   ? 60.328  25.262  41.129  1.00 132.78 ? 88   LYS A NZ    1 
ATOM   1703  N  N     . PRO D 4  89   ? 57.224  19.542  39.681  1.00 171.86 ? 89   PRO A N     1 
ATOM   1704  C  CA    . PRO D 4  89   ? 56.420  18.424  40.189  1.00 169.24 ? 89   PRO A CA    1 
ATOM   1705  C  C     . PRO D 4  89   ? 55.384  18.888  41.201  1.00 164.37 ? 89   PRO A C     1 
ATOM   1706  O  O     . PRO D 4  89   ? 55.532  19.915  41.868  1.00 154.89 ? 89   PRO A O     1 
ATOM   1707  C  CB    . PRO D 4  89   ? 57.458  17.504  40.845  1.00 165.52 ? 89   PRO A CB    1 
ATOM   1708  C  CG    . PRO D 4  89   ? 58.751  17.870  40.194  1.00 165.78 ? 89   PRO A CG    1 
ATOM   1709  C  CD    . PRO D 4  89   ? 58.661  19.344  39.938  1.00 169.63 ? 89   PRO A CD    1 
ATOM   1710  N  N     . VAL D 4  90   ? 54.313  18.100  41.309  1.00 164.74 ? 90   VAL A N     1 
ATOM   1711  C  CA    . VAL D 4  90   ? 53.164  18.439  42.137  1.00 161.17 ? 90   VAL A CA    1 
ATOM   1712  C  C     . VAL D 4  90   ? 52.721  17.199  42.907  1.00 163.40 ? 90   VAL A C     1 
ATOM   1713  O  O     . VAL D 4  90   ? 53.222  16.092  42.698  1.00 154.18 ? 90   VAL A O     1 
ATOM   1714  C  CB    . VAL D 4  90   ? 51.997  19.021  41.306  1.00 141.74 ? 90   VAL A CB    1 
ATOM   1715  C  CG1   . VAL D 4  90   ? 52.223  20.507  41.045  1.00 131.96 ? 90   VAL A CG1   1 
ATOM   1716  C  CG2   . VAL D 4  90   ? 51.832  18.264  39.994  1.00 142.39 ? 90   VAL A CG2   1 
ATOM   1717  N  N     . PHE D 4  91   ? 51.769  17.406  43.816  1.00 169.43 ? 91   PHE A N     1 
ATOM   1718  C  CA    . PHE D 4  91   ? 51.313  16.377  44.738  1.00 164.94 ? 91   PHE A CA    1 
ATOM   1719  C  C     . PHE D 4  91   ? 50.169  15.578  44.109  1.00 160.24 ? 91   PHE A C     1 
ATOM   1720  O  O     . PHE D 4  91   ? 49.913  15.655  42.905  1.00 165.93 ? 91   PHE A O     1 
ATOM   1721  C  CB    . PHE D 4  91   ? 50.907  17.009  46.069  1.00 172.70 ? 91   PHE A CB    1 
ATOM   1722  C  CG    . PHE D 4  91   ? 51.931  17.961  46.630  1.00 185.91 ? 91   PHE A CG    1 
ATOM   1723  C  CD1   . PHE D 4  91   ? 53.064  17.484  47.270  1.00 194.33 ? 91   PHE A CD1   1 
ATOM   1724  C  CD2   . PHE D 4  91   ? 51.760  19.332  46.516  1.00 188.48 ? 91   PHE A CD2   1 
ATOM   1725  C  CE1   . PHE D 4  91   ? 54.007  18.361  47.787  1.00 198.18 ? 91   PHE A CE1   1 
ATOM   1726  C  CE2   . PHE D 4  91   ? 52.696  20.212  47.027  1.00 190.69 ? 91   PHE A CE2   1 
ATOM   1727  C  CZ    . PHE D 4  91   ? 53.819  19.726  47.666  1.00 195.95 ? 91   PHE A CZ    1 
ATOM   1728  N  N     . HIS D 4  92   ? 49.470  14.797  44.932  1.00 148.51 ? 92   HIS A N     1 
ATOM   1729  C  CA    . HIS D 4  92   ? 48.440  13.871  44.466  1.00 130.02 ? 92   HIS A CA    1 
ATOM   1730  C  C     . HIS D 4  92   ? 47.463  13.656  45.613  1.00 132.06 ? 92   HIS A C     1 
ATOM   1731  O  O     . HIS D 4  92   ? 47.874  13.188  46.678  1.00 144.28 ? 92   HIS A O     1 
ATOM   1732  C  CB    . HIS D 4  92   ? 49.089  12.548  44.023  1.00 121.23 ? 92   HIS A CB    1 
ATOM   1733  C  CG    . HIS D 4  92   ? 48.143  11.567  43.400  1.00 126.01 ? 92   HIS A CG    1 
ATOM   1734  N  ND1   . HIS D 4  92   ? 47.102  10.985  44.094  1.00 127.08 ? 92   HIS A ND1   1 
ATOM   1735  C  CD2   . HIS D 4  92   ? 48.098  11.047  42.151  1.00 129.68 ? 92   HIS A CD2   1 
ATOM   1736  C  CE1   . HIS D 4  92   ? 46.449  10.162  43.294  1.00 128.19 ? 92   HIS A CE1   1 
ATOM   1737  N  NE2   . HIS D 4  92   ? 47.032  10.182  42.109  1.00 127.51 ? 92   HIS A NE2   1 
ATOM   1738  N  N     . VAL D 4  93   ? 46.186  14.007  45.411  1.00 130.10 ? 93   VAL A N     1 
ATOM   1739  C  CA    . VAL D 4  93   ? 45.186  13.830  46.464  1.00 139.81 ? 93   VAL A CA    1 
ATOM   1740  C  C     . VAL D 4  93   ? 44.982  12.340  46.734  1.00 155.07 ? 93   VAL A C     1 
ATOM   1741  O  O     . VAL D 4  93   ? 45.120  11.497  45.839  1.00 164.09 ? 93   VAL A O     1 
ATOM   1742  C  CB    . VAL D 4  93   ? 43.855  14.508  46.091  1.00 137.93 ? 93   VAL A CB    1 
ATOM   1743  C  CG1   . VAL D 4  93   ? 42.995  14.770  47.332  1.00 132.00 ? 93   VAL A CG1   1 
ATOM   1744  C  CG2   . VAL D 4  93   ? 44.113  15.793  45.358  1.00 135.65 ? 93   VAL A CG2   1 
ATOM   1745  N  N     . GLY D 4  94   ? 44.653  12.012  47.985  1.00 154.09 ? 94   GLY A N     1 
ATOM   1746  C  CA    . GLY D 4  94   ? 44.687  10.644  48.451  1.00 144.99 ? 94   GLY A CA    1 
ATOM   1747  C  C     . GLY D 4  94   ? 46.064  10.158  48.842  1.00 142.50 ? 94   GLY A C     1 
ATOM   1748  O  O     . GLY D 4  94   ? 46.179  9.069   49.420  1.00 136.42 ? 94   GLY A O     1 
ATOM   1749  N  N     . PHE D 4  95   ? 47.114  10.933  48.538  1.00 149.02 ? 95   PHE A N     1 
ATOM   1750  C  CA    . PHE D 4  95   ? 48.487  10.612  48.896  1.00 149.81 ? 95   PHE A CA    1 
ATOM   1751  C  C     . PHE D 4  95   ? 49.131  11.635  49.824  1.00 149.05 ? 95   PHE A C     1 
ATOM   1752  O  O     . PHE D 4  95   ? 50.274  11.413  50.235  1.00 152.01 ? 95   PHE A O     1 
ATOM   1753  C  CB    . PHE D 4  95   ? 49.360  10.484  47.631  1.00 145.10 ? 95   PHE A CB    1 
ATOM   1754  C  CG    . PHE D 4  95   ? 49.093  9.244   46.823  1.00 136.35 ? 95   PHE A CG    1 
ATOM   1755  C  CD1   . PHE D 4  95   ? 49.476  9.175   45.492  1.00 137.53 ? 95   PHE A CD1   1 
ATOM   1756  C  CD2   . PHE D 4  95   ? 48.465  8.148   47.391  1.00 138.16 ? 95   PHE A CD2   1 
ATOM   1757  C  CE1   . PHE D 4  95   ? 49.233  8.039   44.742  1.00 145.10 ? 95   PHE A CE1   1 
ATOM   1758  C  CE2   . PHE D 4  95   ? 48.220  7.011   46.646  1.00 145.61 ? 95   PHE A CE2   1 
ATOM   1759  C  CZ    . PHE D 4  95   ? 48.605  6.956   45.321  1.00 149.35 ? 95   PHE A CZ    1 
ATOM   1760  N  N     . ILE D 4  96   ? 48.452  12.752  50.137  1.00 137.64 ? 96   ILE A N     1 
ATOM   1761  C  CA    . ILE D 4  96   ? 49.004  13.742  51.069  1.00 134.82 ? 96   ILE A CA    1 
ATOM   1762  C  C     . ILE D 4  96   ? 49.294  13.088  52.415  1.00 138.61 ? 96   ILE A C     1 
ATOM   1763  O  O     . ILE D 4  96   ? 50.415  13.169  52.937  1.00 136.38 ? 96   ILE A O     1 
ATOM   1764  C  CB    . ILE D 4  96   ? 48.059  14.958  51.221  1.00 108.88 ? 96   ILE A CB    1 
ATOM   1765  C  CG1   . ILE D 4  96   ? 48.228  15.997  50.099  1.00 112.49 ? 96   ILE A CG1   1 
ATOM   1766  C  CG2   . ILE D 4  96   ? 48.267  15.675  52.557  1.00 86.23  ? 96   ILE A CG2   1 
ATOM   1767  C  CD1   . ILE D 4  96   ? 47.637  15.634  48.761  1.00 118.62 ? 96   ILE A CD1   1 
ATOM   1768  N  N     . ALA D 4  97   ? 48.304  12.373  52.961  1.00 142.53 ? 97   ALA A N     1 
ATOM   1769  C  CA    . ALA D 4  97   ? 48.527  11.589  54.171  1.00 150.34 ? 97   ALA A CA    1 
ATOM   1770  C  C     . ALA D 4  97   ? 49.566  10.498  53.946  1.00 165.38 ? 97   ALA A C     1 
ATOM   1771  O  O     . ALA D 4  97   ? 50.268  10.109  54.884  1.00 175.29 ? 97   ALA A O     1 
ATOM   1772  C  CB    . ALA D 4  97   ? 47.209  10.984  54.658  1.00 149.60 ? 97   ALA A CB    1 
ATOM   1773  N  N     . LYS D 4  98   ? 49.690  10.005  52.710  1.00 161.14 ? 98   LYS A N     1 
ATOM   1774  C  CA    . LYS D 4  98   ? 50.768  9.077   52.388  1.00 154.66 ? 98   LYS A CA    1 
ATOM   1775  C  C     . LYS D 4  98   ? 52.102  9.789   52.186  1.00 160.20 ? 98   LYS A C     1 
ATOM   1776  O  O     . LYS D 4  98   ? 53.151  9.196   52.453  1.00 169.24 ? 98   LYS A O     1 
ATOM   1777  C  CB    . LYS D 4  98   ? 50.406  8.250   51.153  1.00 132.48 ? 98   LYS A CB    1 
ATOM   1778  C  CG    . LYS D 4  98   ? 49.658  6.964   51.476  1.00 123.35 ? 98   LYS A CG    1 
ATOM   1779  C  CD    . LYS D 4  98   ? 50.607  5.890   51.990  1.00 120.12 ? 98   LYS A CD    1 
ATOM   1780  C  CE    . LYS D 4  98   ? 49.884  4.570   52.203  1.00 121.84 ? 98   LYS A CE    1 
ATOM   1781  N  NZ    . LYS D 4  98   ? 50.831  3.429   52.343  1.00 122.76 ? 98   LYS A NZ    1 
ATOM   1782  N  N     . ILE D 4  99   ? 52.094  11.044  51.719  1.00 157.21 ? 99   ILE A N     1 
ATOM   1783  C  CA    . ILE D 4  99   ? 53.349  11.787  51.588  1.00 160.06 ? 99   ILE A CA    1 
ATOM   1784  C  C     . ILE D 4  99   ? 53.834  12.255  52.957  1.00 154.40 ? 99   ILE A C     1 
ATOM   1785  O  O     . ILE D 4  99   ? 55.025  12.155  53.274  1.00 151.36 ? 99   ILE A O     1 
ATOM   1786  C  CB    . ILE D 4  99   ? 53.188  12.965  50.600  1.00 172.74 ? 99   ILE A CB    1 
ATOM   1787  C  CG1   . ILE D 4  99   ? 53.075  12.471  49.152  1.00 167.79 ? 99   ILE A CG1   1 
ATOM   1788  C  CG2   . ILE D 4  99   ? 54.345  13.963  50.709  1.00 182.15 ? 99   ILE A CG2   1 
ATOM   1789  C  CD1   . ILE D 4  99   ? 54.332  11.844  48.616  1.00 166.82 ? 99   ILE A CD1   1 
ATOM   1790  N  N     . LYS D 4  100  ? 52.916  12.752  53.794  1.00 154.24 ? 100  LYS A N     1 
ATOM   1791  C  CA    . LYS D 4  100  ? 53.291  13.317  55.089  1.00 151.16 ? 100  LYS A CA    1 
ATOM   1792  C  C     . LYS D 4  100  ? 53.809  12.245  56.044  1.00 155.10 ? 100  LYS A C     1 
ATOM   1793  O  O     . LYS D 4  100  ? 54.806  12.467  56.746  1.00 165.15 ? 100  LYS A O     1 
ATOM   1794  C  CB    . LYS D 4  100  ? 52.091  14.055  55.696  1.00 146.99 ? 100  LYS A CB    1 
ATOM   1795  C  CG    . LYS D 4  100  ? 52.014  14.045  57.223  1.00 146.00 ? 100  LYS A CG    1 
ATOM   1796  C  CD    . LYS D 4  100  ? 50.686  14.586  57.735  1.00 145.16 ? 100  LYS A CD    1 
ATOM   1797  C  CE    . LYS D 4  100  ? 49.517  13.813  57.135  1.00 148.73 ? 100  LYS A CE    1 
ATOM   1798  N  NZ    . LYS D 4  100  ? 49.635  12.338  57.335  1.00 145.30 ? 100  LYS A NZ    1 
ATOM   1799  N  N     . LYS D 4  101  ? 53.160  11.073  56.063  1.00 147.30 ? 101  LYS A N     1 
ATOM   1800  C  CA    . LYS D 4  101  ? 53.502  10.031  57.031  1.00 150.95 ? 101  LYS A CA    1 
ATOM   1801  C  C     . LYS D 4  101  ? 54.930  9.530   56.839  1.00 160.69 ? 101  LYS A C     1 
ATOM   1802  O  O     . LYS D 4  101  ? 55.694  9.427   57.808  1.00 169.68 ? 101  LYS A O     1 
ATOM   1803  C  CB    . LYS D 4  101  ? 52.503  8.874   56.947  1.00 143.92 ? 101  LYS A CB    1 
ATOM   1804  C  CG    . LYS D 4  101  ? 51.230  9.098   57.764  1.00 136.94 ? 101  LYS A CG    1 
ATOM   1805  C  CD    . LYS D 4  101  ? 50.358  7.852   57.828  1.00 123.06 ? 101  LYS A CD    1 
ATOM   1806  C  CE    . LYS D 4  101  ? 49.223  8.041   58.825  1.00 104.33 ? 101  LYS A CE    1 
ATOM   1807  N  NZ    . LYS D 4  101  ? 48.486  6.778   59.083  1.00 91.05  ? 101  LYS A NZ    1 
ATOM   1808  N  N     . VAL D 4  102  ? 55.319  9.239   55.592  1.00 153.41 ? 102  VAL A N     1 
ATOM   1809  C  CA    . VAL D 4  102  ? 56.715  8.894   55.330  1.00 149.07 ? 102  VAL A CA    1 
ATOM   1810  C  C     . VAL D 4  102  ? 57.613  10.111  55.563  1.00 168.89 ? 102  VAL A C     1 
ATOM   1811  O  O     . VAL D 4  102  ? 58.746  9.970   56.041  1.00 165.57 ? 102  VAL A O     1 
ATOM   1812  C  CB    . VAL D 4  102  ? 56.876  8.293   53.912  1.00 113.19 ? 102  VAL A CB    1 
ATOM   1813  C  CG1   . VAL D 4  102  ? 56.335  9.215   52.852  1.00 100.73 ? 102  VAL A CG1   1 
ATOM   1814  C  CG2   . VAL D 4  102  ? 58.333  7.917   53.611  1.00 113.78 ? 102  VAL A CG2   1 
ATOM   1815  N  N     . CYS D 4  103  ? 57.111  11.325  55.298  1.00 183.11 ? 103  CYS A N     1 
ATOM   1816  C  CA    . CYS D 4  103  ? 57.852  12.519  55.691  1.00 185.00 ? 103  CYS A CA    1 
ATOM   1817  C  C     . CYS D 4  103  ? 57.895  12.682  57.202  1.00 172.00 ? 103  CYS A C     1 
ATOM   1818  O  O     . CYS D 4  103  ? 58.813  13.331  57.718  1.00 185.29 ? 103  CYS A O     1 
ATOM   1819  C  CB    . CYS D 4  103  ? 57.252  13.773  55.045  1.00 204.32 ? 103  CYS A CB    1 
ATOM   1820  S  SG    . CYS D 4  103  ? 57.675  14.022  53.297  1.00 221.73 ? 103  CYS A SG    1 
ATOM   1821  N  N     . GLU D 4  104  ? 56.937  12.095  57.922  1.00 163.71 ? 104  GLU A N     1 
ATOM   1822  C  CA    . GLU D 4  104  ? 57.018  12.037  59.375  1.00 169.87 ? 104  GLU A CA    1 
ATOM   1823  C  C     . GLU D 4  104  ? 58.012  10.987  59.862  1.00 198.85 ? 104  GLU A C     1 
ATOM   1824  O  O     . GLU D 4  104  ? 58.349  10.986  61.051  1.00 187.67 ? 104  GLU A O     1 
ATOM   1825  C  CB    . GLU D 4  104  ? 55.629  11.764  59.960  1.00 144.20 ? 104  GLU A CB    1 
ATOM   1826  N  N     . CYS D 4  105  ? 58.485  10.104  58.980  1.00 234.33 ? 105  CYS A N     1 
ATOM   1827  C  CA    . CYS D 4  105  ? 59.320  8.964   59.362  1.00 246.60 ? 105  CYS A CA    1 
ATOM   1828  C  C     . CYS D 4  105  ? 60.488  8.774   58.392  1.00 233.27 ? 105  CYS A C     1 
ATOM   1829  O  O     . CYS D 4  105  ? 60.752  7.669   57.915  1.00 232.62 ? 105  CYS A O     1 
ATOM   1830  C  CB    . CYS D 4  105  ? 58.482  7.690   59.441  1.00 266.52 ? 105  CYS A CB    1 
ATOM   1831  S  SG    . CYS D 4  105  ? 57.190  7.729   60.695  1.00 283.56 ? 105  CYS A SG    1 
ATOM   1832  N  N     . VAL D 4  106  ? 61.209  9.854   58.083  1.00 217.43 ? 106  VAL A N     1 
ATOM   1833  C  CA    . VAL D 4  106  ? 62.363  9.782   57.190  1.00 199.64 ? 106  VAL A CA    1 
ATOM   1834  C  C     . VAL D 4  106  ? 63.325  10.907  57.555  1.00 188.62 ? 106  VAL A C     1 
ATOM   1835  O  O     . VAL D 4  106  ? 62.974  11.848  58.270  1.00 180.71 ? 106  VAL A O     1 
ATOM   1836  C  CB    . VAL D 4  106  ? 61.945  9.862   55.694  1.00 183.79 ? 106  VAL A CB    1 
ATOM   1837  C  CG1   . VAL D 4  106  ? 61.757  11.313  55.237  1.00 182.13 ? 106  VAL A CG1   1 
ATOM   1838  C  CG2   . VAL D 4  106  ? 62.914  9.092   54.789  1.00 179.42 ? 106  VAL A CG2   1 
ATOM   1839  N  N     . CYS D 4  107  ? 64.559  10.792  57.075  1.00 184.62 ? 107  CYS A N     1 
ATOM   1840  C  CA    . CYS D 4  107  ? 65.559  11.839  57.206  1.00 193.20 ? 107  CYS A CA    1 
ATOM   1841  C  C     . CYS D 4  107  ? 65.898  12.369  55.818  1.00 202.45 ? 107  CYS A C     1 
ATOM   1842  O  O     . CYS D 4  107  ? 66.176  11.585  54.904  1.00 197.33 ? 107  CYS A O     1 
ATOM   1843  C  CB    . CYS D 4  107  ? 66.810  11.310  57.907  1.00 194.87 ? 107  CYS A CB    1 
ATOM   1844  S  SG    . CYS D 4  107  ? 68.127  12.521  58.053  1.00 194.03 ? 107  CYS A SG    1 
ATOM   1845  N  N     . MET D 4  108  ? 65.872  13.698  55.663  1.00 217.61 ? 108  MET A N     1 
ATOM   1846  C  CA    . MET D 4  108  ? 66.045  14.314  54.350  1.00 220.46 ? 108  MET A CA    1 
ATOM   1847  C  C     . MET D 4  108  ? 67.493  14.317  53.873  1.00 225.59 ? 108  MET A C     1 
ATOM   1848  O  O     . MET D 4  108  ? 67.734  14.457  52.670  1.00 222.27 ? 108  MET A O     1 
ATOM   1849  C  CB    . MET D 4  108  ? 65.495  15.748  54.355  1.00 215.39 ? 108  MET A CB    1 
ATOM   1850  C  CG    . MET D 4  108  ? 66.465  16.819  54.839  1.00 214.84 ? 108  MET A CG    1 
ATOM   1851  S  SD    . MET D 4  108  ? 67.015  16.590  56.542  1.00 214.63 ? 108  MET A SD    1 
ATOM   1852  C  CE    . MET D 4  108  ? 65.571  17.137  57.448  1.00 208.96 ? 108  MET A CE    1 
ATOM   1853  N  N     . HIS D 4  109  ? 68.462  14.171  54.774  1.00 233.14 ? 109  HIS A N     1 
ATOM   1854  C  CA    . HIS D 4  109  ? 69.858  14.074  54.369  1.00 244.61 ? 109  HIS A CA    1 
ATOM   1855  C  C     . HIS D 4  109  ? 70.356  12.637  54.305  1.00 267.86 ? 109  HIS A C     1 
ATOM   1856  O  O     . HIS D 4  109  ? 71.206  12.324  53.464  1.00 268.20 ? 109  HIS A O     1 
ATOM   1857  C  CB    . HIS D 4  109  ? 70.750  14.886  55.317  1.00 240.03 ? 109  HIS A CB    1 
ATOM   1858  C  CG    . HIS D 4  109  ? 70.642  16.370  55.130  1.00 225.00 ? 109  HIS A CG    1 
ATOM   1859  N  ND1   . HIS D 4  109  ? 69.699  17.137  55.782  1.00 219.22 ? 109  HIS A ND1   1 
ATOM   1860  C  CD2   . HIS D 4  109  ? 71.361  17.229  54.368  1.00 220.64 ? 109  HIS A CD2   1 
ATOM   1861  C  CE1   . HIS D 4  109  ? 69.840  18.402  55.428  1.00 216.29 ? 109  HIS A CE1   1 
ATOM   1862  N  NE2   . HIS D 4  109  ? 70.841  18.485  54.570  1.00 219.70 ? 109  HIS A NE2   1 
ATOM   1863  N  N     . CYS D 4  110  ? 69.845  11.754  55.166  1.00 295.36 ? 110  CYS A N     1 
ATOM   1864  C  CA    . CYS D 4  110  ? 70.219  10.346  55.105  1.00 248.51 ? 110  CYS A CA    1 
ATOM   1865  C  C     . CYS D 4  110  ? 69.490  9.614   53.988  1.00 219.24 ? 110  CYS A C     1 
ATOM   1866  O  O     . CYS D 4  110  ? 70.088  8.784   53.294  1.00 206.92 ? 110  CYS A O     1 
ATOM   1867  C  CB    . CYS D 4  110  ? 69.932  9.660   56.439  1.00 232.01 ? 110  CYS A CB    1 
ATOM   1868  S  SG    . CYS D 4  110  ? 71.297  9.726   57.592  1.00 232.15 ? 110  CYS A SG    1 
ATOM   1869  N  N     . GLY D 4  111  ? 68.207  9.907   53.799  1.00 202.00 ? 111  GLY A N     1 
ATOM   1870  C  CA    . GLY D 4  111  ? 67.389  9.070   52.948  1.00 199.52 ? 111  GLY A CA    1 
ATOM   1871  C  C     . GLY D 4  111  ? 67.192  7.682   53.511  1.00 196.77 ? 111  GLY A C     1 
ATOM   1872  O  O     . GLY D 4  111  ? 67.175  6.707   52.757  1.00 196.10 ? 111  GLY A O     1 
ATOM   1873  N  N     . LYS D 4  112  ? 67.084  7.563   54.827  1.00 191.26 ? 112  LYS A N     1 
ATOM   1874  C  CA    . LYS D 4  112  ? 66.942  6.287   55.513  1.00 184.31 ? 112  LYS A CA    1 
ATOM   1875  C  C     . LYS D 4  112  ? 65.734  6.342   56.443  1.00 174.73 ? 112  LYS A C     1 
ATOM   1876  O  O     . LYS D 4  112  ? 65.080  7.377   56.592  1.00 167.46 ? 112  LYS A O     1 
ATOM   1877  C  CB    . LYS D 4  112  ? 68.215  5.958   56.303  1.00 188.50 ? 112  LYS A CB    1 
ATOM   1878  C  CG    . LYS D 4  112  ? 68.598  4.483   56.354  1.00 187.41 ? 112  LYS A CG    1 
ATOM   1879  C  CD    . LYS D 4  112  ? 69.404  4.160   57.612  1.00 184.17 ? 112  LYS A CD    1 
ATOM   1880  C  CE    . LYS D 4  112  ? 70.596  5.091   57.783  1.00 181.42 ? 112  LYS A CE    1 
ATOM   1881  N  NZ    . LYS D 4  112  ? 71.580  4.960   56.676  1.00 183.26 ? 112  LYS A NZ    1 
ATOM   1882  N  N     . LEU D 4  113  ? 65.456  5.212   57.088  1.00 178.48 ? 113  LEU A N     1 
ATOM   1883  C  CA    . LEU D 4  113  ? 64.607  5.213   58.267  1.00 183.25 ? 113  LEU A CA    1 
ATOM   1884  C  C     . LEU D 4  113  ? 65.363  5.839   59.437  1.00 202.90 ? 113  LEU A C     1 
ATOM   1885  O  O     . LEU D 4  113  ? 66.555  6.159   59.358  1.00 211.40 ? 113  LEU A O     1 
ATOM   1886  C  CB    . LEU D 4  113  ? 64.147  3.795   58.603  1.00 167.63 ? 113  LEU A CB    1 
ATOM   1887  C  CG    . LEU D 4  113  ? 62.739  3.360   58.176  1.00 151.42 ? 113  LEU A CG    1 
ATOM   1888  C  CD1   . LEU D 4  113  ? 61.705  3.944   59.127  1.00 132.65 ? 113  LEU A CD1   1 
ATOM   1889  C  CD2   . LEU D 4  113  ? 62.426  3.773   56.751  1.00 162.90 ? 113  LEU A CD2   1 
ATOM   1890  N  N     . LEU D 4  114  ? 64.661  6.009   60.556  1.00 206.23 ? 114  LEU A N     1 
ATOM   1891  C  CA    . LEU D 4  114  ? 65.283  6.625   61.718  1.00 206.75 ? 114  LEU A CA    1 
ATOM   1892  C  C     . LEU D 4  114  ? 66.238  5.678   62.426  1.00 219.05 ? 114  LEU A C     1 
ATOM   1893  O  O     . LEU D 4  114  ? 67.109  6.144   63.171  1.00 220.28 ? 114  LEU A O     1 
ATOM   1894  C  CB    . LEU D 4  114  ? 64.215  7.118   62.698  1.00 190.17 ? 114  LEU A CB    1 
ATOM   1895  C  CG    . LEU D 4  114  ? 63.338  8.303   62.272  1.00 176.50 ? 114  LEU A CG    1 
ATOM   1896  C  CD1   . LEU D 4  114  ? 64.120  9.333   61.457  1.00 167.50 ? 114  LEU A CD1   1 
ATOM   1897  C  CD2   . LEU D 4  114  ? 62.085  7.851   61.534  1.00 171.75 ? 114  LEU A CD2   1 
ATOM   1898  N  N     . LEU D 4  115  ? 66.118  4.375   62.184  1.00 229.67 ? 115  LEU A N     1 
ATOM   1899  C  CA    . LEU D 4  115  ? 66.905  3.381   62.898  1.00 237.60 ? 115  LEU A CA    1 
ATOM   1900  C  C     . LEU D 4  115  ? 66.806  2.046   62.177  1.00 239.64 ? 115  LEU A C     1 
ATOM   1901  O  O     . LEU D 4  115  ? 65.871  1.797   61.411  1.00 237.75 ? 115  LEU A O     1 
ATOM   1902  C  CB    . LEU D 4  115  ? 66.432  3.229   64.348  1.00 235.07 ? 115  LEU A CB    1 
ATOM   1903  C  CG    . LEU D 4  115  ? 64.958  2.857   64.518  1.00 225.75 ? 115  LEU A CG    1 
ATOM   1904  C  CD1   . LEU D 4  115  ? 64.836  1.862   65.626  1.00 224.43 ? 115  LEU A CD1   1 
ATOM   1905  C  CD2   . LEU D 4  115  ? 64.091  4.071   64.819  1.00 217.74 ? 115  LEU A CD2   1 
ATOM   1906  N  N     . ASP D 4  116  ? 67.785  1.191   62.445  1.00 238.54 ? 116  ASP A N     1 
ATOM   1907  C  CA    . ASP D 4  116  ? 67.784  -0.198  62.009  1.00 228.95 ? 116  ASP A CA    1 
ATOM   1908  C  C     . ASP D 4  116  ? 67.121  -1.040  63.102  1.00 229.67 ? 116  ASP A C     1 
ATOM   1909  O  O     . ASP D 4  116  ? 66.424  -0.510  63.971  1.00 228.01 ? 116  ASP A O     1 
ATOM   1910  C  CB    . ASP D 4  116  ? 69.215  -0.645  61.684  1.00 215.66 ? 116  ASP A CB    1 
ATOM   1911  C  CG    . ASP D 4  116  ? 69.261  -1.743  60.635  1.00 199.09 ? 116  ASP A CG    1 
ATOM   1912  O  OD1   . ASP D 4  116  ? 69.372  -1.421  59.434  1.00 193.41 ? 116  ASP A OD1   1 
ATOM   1913  O  OD2   . ASP D 4  116  ? 69.187  -2.931  61.013  1.00 191.92 ? 116  ASP A OD2   1 
ATOM   1914  N  N     . GLU D 4  117  ? 67.326  -2.355  63.078  1.00 231.59 ? 117  GLU A N     1 
ATOM   1915  C  CA    . GLU D 4  117  ? 66.833  -3.300  64.084  1.00 231.53 ? 117  GLU A CA    1 
ATOM   1916  C  C     . GLU D 4  117  ? 67.441  -3.083  65.505  1.00 232.78 ? 117  GLU A C     1 
ATOM   1917  O  O     . GLU D 4  117  ? 67.147  -3.936  66.358  1.00 239.97 ? 117  GLU A O     1 
ATOM   1918  C  CB    . GLU D 4  117  ? 67.134  -4.732  63.641  1.00 235.13 ? 117  GLU A CB    1 
ATOM   1919  C  CG    . GLU D 4  117  ? 68.627  -5.018  63.545  1.00 240.21 ? 117  GLU A CG    1 
ATOM   1920  C  CD    . GLU D 4  117  ? 68.951  -6.497  63.612  1.00 240.38 ? 117  GLU A CD    1 
ATOM   1921  O  OE1   . GLU D 4  117  ? 68.106  -7.312  63.188  1.00 238.67 ? 117  GLU A OE1   1 
ATOM   1922  O  OE2   . GLU D 4  117  ? 70.048  -6.844  64.101  1.00 240.61 ? 117  GLU A OE2   1 
ATOM   1923  N  N     . HIS D 4  118  ? 68.242  -2.036  65.741  1.00 223.31 ? 118  HIS A N     1 
ATOM   1924  C  CA    . HIS D 4  118  ? 68.956  -1.883  67.008  1.00 209.50 ? 118  HIS A CA    1 
ATOM   1925  C  C     . HIS D 4  118  ? 67.997  -1.691  68.180  1.00 198.87 ? 118  HIS A C     1 
ATOM   1926  O  O     . HIS D 4  118  ? 68.262  -2.170  69.289  1.00 189.71 ? 118  HIS A O     1 
ATOM   1927  C  CB    . HIS D 4  118  ? 69.933  -0.713  66.900  1.00 198.61 ? 118  HIS A CB    1 
ATOM   1928  C  CG    . HIS D 4  118  ? 70.973  -0.899  65.838  1.00 192.13 ? 118  HIS A CG    1 
ATOM   1929  N  ND1   . HIS D 4  118  ? 71.350  0.112   64.978  1.00 188.94 ? 118  HIS A ND1   1 
ATOM   1930  C  CD2   . HIS D 4  118  ? 71.713  -1.980  65.494  1.00 190.90 ? 118  HIS A CD2   1 
ATOM   1931  C  CE1   . HIS D 4  118  ? 72.275  -0.340  64.151  1.00 188.97 ? 118  HIS A CE1   1 
ATOM   1932  N  NE2   . HIS D 4  118  ? 72.514  -1.605  64.443  1.00 192.47 ? 118  HIS A NE2   1 
ATOM   1933  N  N     . ASN D 4  119  ? 66.883  -0.996  67.959  1.00 198.75 ? 119  ASN A N     1 
ATOM   1934  C  CA    . ASN D 4  119  ? 65.799  -1.003  68.932  1.00 197.88 ? 119  ASN A CA    1 
ATOM   1935  C  C     . ASN D 4  119  ? 64.942  -2.241  68.711  1.00 205.95 ? 119  ASN A C     1 
ATOM   1936  O  O     . ASN D 4  119  ? 64.629  -2.603  67.574  1.00 207.39 ? 119  ASN A O     1 
ATOM   1937  C  CB    . ASN D 4  119  ? 64.949  0.266   68.822  1.00 183.97 ? 119  ASN A CB    1 
ATOM   1938  C  CG    . ASN D 4  119  ? 64.029  0.479   70.022  1.00 176.53 ? 119  ASN A CG    1 
ATOM   1939  O  OD1   . ASN D 4  119  ? 63.328  -0.431  70.469  1.00 166.76 ? 119  ASN A OD1   1 
ATOM   1940  N  ND2   . ASN D 4  119  ? 64.037  1.695   70.552  1.00 179.46 ? 119  ASN A ND2   1 
ATOM   1941  N  N     . GLU D 4  120  ? 64.560  -2.885  69.816  1.00 205.97 ? 120  GLU A N     1 
ATOM   1942  C  CA    . GLU D 4  120  ? 63.873  -4.168  69.730  1.00 200.89 ? 120  GLU A CA    1 
ATOM   1943  C  C     . GLU D 4  120  ? 62.421  -4.015  69.284  1.00 199.07 ? 120  GLU A C     1 
ATOM   1944  O  O     . GLU D 4  120  ? 61.860  -4.941  68.686  1.00 205.46 ? 120  GLU A O     1 
ATOM   1945  C  CB    . GLU D 4  120  ? 63.957  -4.884  71.078  1.00 195.57 ? 120  GLU A CB    1 
ATOM   1946  C  CG    . GLU D 4  120  ? 63.998  -6.396  70.975  1.00 194.26 ? 120  GLU A CG    1 
ATOM   1947  C  CD    . GLU D 4  120  ? 64.254  -7.060  72.311  1.00 192.51 ? 120  GLU A CD    1 
ATOM   1948  O  OE1   . GLU D 4  120  ? 64.227  -6.353  73.341  1.00 190.80 ? 120  GLU A OE1   1 
ATOM   1949  O  OE2   . GLU D 4  120  ? 64.494  -8.286  72.331  1.00 190.21 ? 120  GLU A OE2   1 
ATOM   1950  N  N     . LEU D 4  121  ? 61.802  -2.860  69.550  1.00 188.73 ? 121  LEU A N     1 
ATOM   1951  C  CA    . LEU D 4  121  ? 60.415  -2.649  69.139  1.00 172.31 ? 121  LEU A CA    1 
ATOM   1952  C  C     . LEU D 4  121  ? 60.302  -2.490  67.626  1.00 164.40 ? 121  LEU A C     1 
ATOM   1953  O  O     . LEU D 4  121  ? 59.386  -3.041  67.000  1.00 154.57 ? 121  LEU A O     1 
ATOM   1954  C  CB    . LEU D 4  121  ? 59.831  -1.429  69.853  1.00 158.18 ? 121  LEU A CB    1 
ATOM   1955  C  CG    . LEU D 4  121  ? 59.461  -1.567  71.336  1.00 150.52 ? 121  LEU A CG    1 
ATOM   1956  C  CD1   . LEU D 4  121  ? 58.849  -2.937  71.627  1.00 148.32 ? 121  LEU A CD1   1 
ATOM   1957  C  CD2   . LEU D 4  121  ? 60.649  -1.284  72.257  1.00 141.36 ? 121  LEU A CD2   1 
ATOM   1958  N  N     . MET D 4  122  ? 61.232  -1.753  67.016  1.00 165.10 ? 122  MET A N     1 
ATOM   1959  C  CA    . MET D 4  122  ? 61.263  -1.686  65.560  1.00 167.40 ? 122  MET A CA    1 
ATOM   1960  C  C     . MET D 4  122  ? 61.682  -3.018  64.950  1.00 168.83 ? 122  MET A C     1 
ATOM   1961  O  O     . MET D 4  122  ? 61.231  -3.360  63.853  1.00 164.48 ? 122  MET A O     1 
ATOM   1962  C  CB    . MET D 4  122  ? 62.196  -0.567  65.104  1.00 171.41 ? 122  MET A CB    1 
ATOM   1963  C  CG    . MET D 4  122  ? 62.076  -0.223  63.631  1.00 170.45 ? 122  MET A CG    1 
ATOM   1964  S  SD    . MET D 4  122  ? 60.421  0.354   63.201  1.00 161.35 ? 122  MET A SD    1 
ATOM   1965  C  CE    . MET D 4  122  ? 60.243  1.746   64.315  1.00 149.46 ? 122  MET A CE    1 
ATOM   1966  N  N     . ARG D 4  123  ? 62.530  -3.783  65.646  1.00 177.90 ? 123  ARG A N     1 
ATOM   1967  C  CA    . ARG D 4  123  ? 62.860  -5.133  65.193  1.00 183.20 ? 123  ARG A CA    1 
ATOM   1968  C  C     . ARG D 4  123  ? 61.628  -6.034  65.183  1.00 177.41 ? 123  ARG A C     1 
ATOM   1969  O  O     . ARG D 4  123  ? 61.493  -6.892  64.303  1.00 169.81 ? 123  ARG A O     1 
ATOM   1970  C  CB    . ARG D 4  123  ? 63.962  -5.728  66.079  1.00 189.66 ? 123  ARG A CB    1 
ATOM   1971  C  CG    . ARG D 4  123  ? 64.465  -7.101  65.637  1.00 180.89 ? 123  ARG A CG    1 
ATOM   1972  C  CD    . ARG D 4  123  ? 65.852  -7.414  66.190  1.00 170.44 ? 123  ARG A CD    1 
ATOM   1973  N  NE    . ARG D 4  123  ? 65.940  -7.245  67.638  1.00 164.79 ? 123  ARG A NE    1 
ATOM   1974  C  CZ    . ARG D 4  123  ? 66.977  -7.643  68.370  1.00 163.35 ? 123  ARG A CZ    1 
ATOM   1975  N  NH1   . ARG D 4  123  ? 68.018  -8.225  67.787  1.00 153.19 ? 123  ARG A NH1   1 
ATOM   1976  N  NH2   . ARG D 4  123  ? 66.981  -7.455  69.683  1.00 166.67 ? 123  ARG A NH2   1 
ATOM   1977  N  N     . GLN D 4  124  ? 60.720  -5.845  66.147  1.00 177.51 ? 124  GLN A N     1 
ATOM   1978  C  CA    . GLN D 4  124  ? 59.435  -6.540  66.112  1.00 168.48 ? 124  GLN A CA    1 
ATOM   1979  C  C     . GLN D 4  124  ? 58.563  -6.039  64.966  1.00 157.40 ? 124  GLN A C     1 
ATOM   1980  O  O     . GLN D 4  124  ? 57.921  -6.837  64.270  1.00 157.01 ? 124  GLN A O     1 
ATOM   1981  C  CB    . GLN D 4  124  ? 58.697  -6.358  67.441  1.00 167.44 ? 124  GLN A CB    1 
ATOM   1982  C  CG    . GLN D 4  124  ? 59.130  -7.282  68.567  1.00 166.07 ? 124  GLN A CG    1 
ATOM   1983  C  CD    . GLN D 4  124  ? 58.293  -7.089  69.820  1.00 165.81 ? 124  GLN A CD    1 
ATOM   1984  O  OE1   . GLN D 4  124  ? 57.586  -6.090  69.959  1.00 162.06 ? 124  GLN A OE1   1 
ATOM   1985  N  NE2   . GLN D 4  124  ? 58.375  -8.041  70.741  1.00 171.53 ? 124  GLN A NE2   1 
ATOM   1986  N  N     . ALA D 4  125  ? 58.525  -4.719  64.763  1.00 148.49 ? 125  ALA A N     1 
ATOM   1987  C  CA    . ALA D 4  125  ? 57.614  -4.133  63.781  1.00 143.56 ? 125  ALA A CA    1 
ATOM   1988  C  C     . ALA D 4  125  ? 58.024  -4.444  62.342  1.00 148.78 ? 125  ALA A C     1 
ATOM   1989  O  O     . ALA D 4  125  ? 57.161  -4.518  61.460  1.00 147.22 ? 125  ALA A O     1 
ATOM   1990  C  CB    . ALA D 4  125  ? 57.530  -2.621  63.990  1.00 131.68 ? 125  ALA A CB    1 
ATOM   1991  N  N     . LEU D 4  126  ? 59.321  -4.625  62.084  1.00 158.09 ? 126  LEU A N     1 
ATOM   1992  C  CA    . LEU D 4  126  ? 59.802  -4.850  60.723  1.00 164.49 ? 126  LEU A CA    1 
ATOM   1993  C  C     . LEU D 4  126  ? 59.552  -6.265  60.211  1.00 169.49 ? 126  LEU A C     1 
ATOM   1994  O  O     . LEU D 4  126  ? 59.523  -6.467  58.990  1.00 165.52 ? 126  LEU A O     1 
ATOM   1995  C  CB    . LEU D 4  126  ? 61.301  -4.539  60.635  1.00 169.22 ? 126  LEU A CB    1 
ATOM   1996  C  CG    . LEU D 4  126  ? 61.722  -3.068  60.696  1.00 167.58 ? 126  LEU A CG    1 
ATOM   1997  C  CD1   . LEU D 4  126  ? 63.237  -2.925  60.593  1.00 165.04 ? 126  LEU A CD1   1 
ATOM   1998  C  CD2   . LEU D 4  126  ? 61.024  -2.266  59.609  1.00 167.54 ? 126  LEU A CD2   1 
ATOM   1999  N  N     . ALA D 4  127  ? 59.369  -7.244  61.100  1.00 174.51 ? 127  ALA A N     1 
ATOM   2000  C  CA    . ALA D 4  127  ? 59.279  -8.639  60.680  1.00 179.29 ? 127  ALA A CA    1 
ATOM   2001  C  C     . ALA D 4  127  ? 57.902  -9.030  60.150  1.00 188.26 ? 127  ALA A C     1 
ATOM   2002  O  O     . ALA D 4  127  ? 57.807  -9.997  59.385  1.00 192.49 ? 127  ALA A O     1 
ATOM   2003  C  CB    . ALA D 4  127  ? 59.657  -9.561  61.842  1.00 177.36 ? 127  ALA A CB    1 
ATOM   2004  N  N     . ILE D 4  128  ? 56.842  -8.313  60.532  1.00 189.60 ? 128  ILE A N     1 
ATOM   2005  C  CA    . ILE D 4  128  ? 55.498  -8.680  60.096  1.00 183.64 ? 128  ILE A CA    1 
ATOM   2006  C  C     . ILE D 4  128  ? 55.329  -8.346  58.613  1.00 181.62 ? 128  ILE A C     1 
ATOM   2007  O  O     . ILE D 4  128  ? 55.892  -7.368  58.100  1.00 185.28 ? 128  ILE A O     1 
ATOM   2008  C  CB    . ILE D 4  128  ? 54.439  -7.991  60.983  1.00 166.62 ? 128  ILE A CB    1 
ATOM   2009  C  CG1   . ILE D 4  128  ? 53.019  -8.490  60.671  1.00 155.03 ? 128  ILE A CG1   1 
ATOM   2010  C  CG2   . ILE D 4  128  ? 54.547  -6.471  60.916  1.00 152.80 ? 128  ILE A CG2   1 
ATOM   2011  C  CD1   . ILE D 4  128  ? 52.815  -9.976  60.930  1.00 139.02 ? 128  ILE A CD1   1 
ATOM   2012  N  N     . LYS D 4  129  ? 54.573  -9.190  57.906  1.00 175.02 ? 129  LYS A N     1 
ATOM   2013  C  CA    . LYS D 4  129  ? 54.557  -9.169  56.447  1.00 173.82 ? 129  LYS A CA    1 
ATOM   2014  C  C     . LYS D 4  129  ? 53.468  -8.281  55.852  1.00 159.29 ? 129  LYS A C     1 
ATOM   2015  O  O     . LYS D 4  129  ? 53.636  -7.793  54.727  1.00 155.47 ? 129  LYS A O     1 
ATOM   2016  C  CB    . LYS D 4  129  ? 54.400  -10.596 55.908  1.00 181.48 ? 129  LYS A CB    1 
ATOM   2017  C  CG    . LYS D 4  129  ? 55.541  -11.533 56.293  1.00 184.23 ? 129  LYS A CG    1 
ATOM   2018  C  CD    . LYS D 4  129  ? 55.395  -12.903 55.644  1.00 176.52 ? 129  LYS A CD    1 
ATOM   2019  C  CE    . LYS D 4  129  ? 56.563  -13.809 56.011  1.00 167.27 ? 129  LYS A CE    1 
ATOM   2020  N  NZ    . LYS D 4  129  ? 56.438  -15.161 55.401  1.00 158.79 ? 129  LYS A NZ    1 
ATOM   2021  N  N     . ASP D 4  130  ? 52.357  -8.061  56.559  1.00 151.08 ? 130  ASP A N     1 
ATOM   2022  C  CA    . ASP D 4  130  ? 51.255  -7.289  55.988  1.00 150.75 ? 130  ASP A CA    1 
ATOM   2023  C  C     . ASP D 4  130  ? 51.628  -5.812  55.950  1.00 152.21 ? 130  ASP A C     1 
ATOM   2024  O  O     . ASP D 4  130  ? 51.862  -5.198  56.995  1.00 140.40 ? 130  ASP A O     1 
ATOM   2025  C  CB    . ASP D 4  130  ? 49.971  -7.503  56.789  1.00 143.04 ? 130  ASP A CB    1 
ATOM   2026  C  CG    . ASP D 4  130  ? 48.716  -7.122  56.001  1.00 135.58 ? 130  ASP A CG    1 
ATOM   2027  O  OD1   . ASP D 4  130  ? 48.600  -5.964  55.543  1.00 124.52 ? 130  ASP A OD1   1 
ATOM   2028  O  OD2   . ASP D 4  130  ? 47.835  -7.991  55.839  1.00 138.52 ? 130  ASP A OD2   1 
ATOM   2029  N  N     . SER D 4  131  ? 51.652  -5.245  54.741  1.00 161.07 ? 131  SER A N     1 
ATOM   2030  C  CA    . SER D 4  131  ? 52.205  -3.910  54.528  1.00 163.30 ? 131  SER A CA    1 
ATOM   2031  C  C     . SER D 4  131  ? 51.344  -2.820  55.160  1.00 153.58 ? 131  SER A C     1 
ATOM   2032  O  O     . SER D 4  131  ? 51.876  -1.877  55.759  1.00 151.12 ? 131  SER A O     1 
ATOM   2033  C  CB    . SER D 4  131  ? 52.368  -3.657  53.029  1.00 171.83 ? 131  SER A CB    1 
ATOM   2034  O  OG    . SER D 4  131  ? 53.202  -4.634  52.427  1.00 178.82 ? 131  SER A OG    1 
ATOM   2035  N  N     . LYS D 4  132  ? 50.017  -2.931  55.040  1.00 149.83 ? 132  LYS A N     1 
ATOM   2036  C  CA    . LYS D 4  132  ? 49.128  -1.853  55.469  1.00 141.04 ? 132  LYS A CA    1 
ATOM   2037  C  C     . LYS D 4  132  ? 49.109  -1.683  56.987  1.00 145.18 ? 132  LYS A C     1 
ATOM   2038  O  O     . LYS D 4  132  ? 48.840  -0.580  57.479  1.00 137.70 ? 132  LYS A O     1 
ATOM   2039  C  CB    . LYS D 4  132  ? 47.714  -2.102  54.943  1.00 130.77 ? 132  LYS A CB    1 
ATOM   2040  C  CG    . LYS D 4  132  ? 47.504  -1.688  53.493  1.00 131.15 ? 132  LYS A CG    1 
ATOM   2041  C  CD    . LYS D 4  132  ? 46.169  -2.189  52.968  1.00 131.33 ? 132  LYS A CD    1 
ATOM   2042  C  CE    . LYS D 4  132  ? 46.166  -3.704  52.848  1.00 136.77 ? 132  LYS A CE    1 
ATOM   2043  N  NZ    . LYS D 4  132  ? 44.881  -4.225  52.303  1.00 128.30 ? 132  LYS A NZ    1 
ATOM   2044  N  N     . LYS D 4  133  ? 49.380  -2.751  57.742  1.00 149.19 ? 133  LYS A N     1 
ATOM   2045  C  CA    . LYS D 4  133  ? 49.449  -2.664  59.199  1.00 132.07 ? 133  LYS A CA    1 
ATOM   2046  C  C     . LYS D 4  133  ? 50.875  -2.444  59.697  1.00 127.76 ? 133  LYS A C     1 
ATOM   2047  O  O     . LYS D 4  133  ? 51.074  -1.726  60.685  1.00 121.00 ? 133  LYS A O     1 
ATOM   2048  C  CB    . LYS D 4  133  ? 48.848  -3.918  59.847  1.00 123.00 ? 133  LYS A CB    1 
ATOM   2049  C  CG    . LYS D 4  133  ? 47.364  -4.126  59.538  1.00 131.97 ? 133  LYS A CG    1 
ATOM   2050  C  CD    . LYS D 4  133  ? 47.156  -5.078  58.358  1.00 141.66 ? 133  LYS A CD    1 
ATOM   2051  C  CE    . LYS D 4  133  ? 45.682  -5.361  58.070  1.00 136.72 ? 133  LYS A CE    1 
ATOM   2052  N  NZ    . LYS D 4  133  ? 44.924  -4.128  57.687  1.00 118.93 ? 133  LYS A NZ    1 
ATOM   2053  N  N     . ARG D 4  134  ? 51.869  -3.045  59.030  1.00 132.25 ? 134  ARG A N     1 
ATOM   2054  C  CA    . ARG D 4  134  ? 53.269  -2.806  59.380  1.00 135.88 ? 134  ARG A CA    1 
ATOM   2055  C  C     . ARG D 4  134  ? 53.650  -1.345  59.174  1.00 147.36 ? 134  ARG A C     1 
ATOM   2056  O  O     . ARG D 4  134  ? 54.392  -0.774  59.981  1.00 146.11 ? 134  ARG A O     1 
ATOM   2057  C  CB    . ARG D 4  134  ? 54.183  -3.721  58.559  1.00 126.32 ? 134  ARG A CB    1 
ATOM   2058  C  CG    . ARG D 4  134  ? 55.514  -3.118  58.112  1.00 123.78 ? 134  ARG A CG    1 
ATOM   2059  C  CD    . ARG D 4  134  ? 56.600  -4.174  57.967  1.00 132.74 ? 134  ARG A CD    1 
ATOM   2060  N  NE    . ARG D 4  134  ? 56.248  -5.192  56.979  1.00 141.29 ? 134  ARG A NE    1 
ATOM   2061  C  CZ    . ARG D 4  134  ? 56.376  -5.048  55.662  1.00 141.87 ? 134  ARG A CZ    1 
ATOM   2062  N  NH1   . ARG D 4  134  ? 56.028  -6.038  54.851  1.00 136.03 ? 134  ARG A NH1   1 
ATOM   2063  N  NH2   . ARG D 4  134  ? 56.839  -3.917  55.151  1.00 144.19 ? 134  ARG A NH2   1 
ATOM   2064  N  N     . PHE D 4  135  ? 53.131  -0.717  58.112  1.00 158.18 ? 135  PHE A N     1 
ATOM   2065  C  CA    . PHE D 4  135  ? 53.443  0.685   57.838  1.00 165.93 ? 135  PHE A CA    1 
ATOM   2066  C  C     . PHE D 4  135  ? 52.874  1.597   58.921  1.00 162.95 ? 135  PHE A C     1 
ATOM   2067  O  O     . PHE D 4  135  ? 53.559  2.503   59.408  1.00 167.63 ? 135  PHE A O     1 
ATOM   2068  C  CB    . PHE D 4  135  ? 52.914  1.077   56.456  1.00 168.92 ? 135  PHE A CB    1 
ATOM   2069  C  CG    . PHE D 4  135  ? 53.215  2.503   56.066  1.00 163.50 ? 135  PHE A CG    1 
ATOM   2070  C  CD1   . PHE D 4  135  ? 54.423  2.825   55.467  1.00 162.71 ? 135  PHE A CD1   1 
ATOM   2071  C  CD2   . PHE D 4  135  ? 52.283  3.514   56.270  1.00 158.97 ? 135  PHE A CD2   1 
ATOM   2072  C  CE1   . PHE D 4  135  ? 54.708  4.129   55.103  1.00 166.61 ? 135  PHE A CE1   1 
ATOM   2073  C  CE2   . PHE D 4  135  ? 52.564  4.822   55.908  1.00 162.07 ? 135  PHE A CE2   1 
ATOM   2074  C  CZ    . PHE D 4  135  ? 53.777  5.127   55.323  1.00 166.41 ? 135  PHE A CZ    1 
ATOM   2075  N  N     . ALA D 4  136  ? 51.616  1.366   59.311  1.00 157.18 ? 136  ALA A N     1 
ATOM   2076  C  CA    . ALA D 4  136  ? 51.004  2.168   60.366  1.00 153.39 ? 136  ALA A CA    1 
ATOM   2077  C  C     . ALA D 4  136  ? 51.654  1.913   61.724  1.00 162.10 ? 136  ALA A C     1 
ATOM   2078  O  O     . ALA D 4  136  ? 51.790  2.847   62.522  1.00 157.28 ? 136  ALA A O     1 
ATOM   2079  C  CB    . ALA D 4  136  ? 49.502  1.891   60.429  1.00 144.53 ? 136  ALA A CB    1 
ATOM   2080  N  N     . ALA D 4  137  ? 52.091  0.675   61.990  1.00 178.15 ? 137  ALA A N     1 
ATOM   2081  C  CA    . ALA D 4  137  ? 52.811  0.386   63.231  1.00 184.15 ? 137  ALA A CA    1 
ATOM   2082  C  C     . ALA D 4  137  ? 54.170  1.080   63.265  1.00 182.85 ? 137  ALA A C     1 
ATOM   2083  O  O     . ALA D 4  137  ? 54.557  1.643   64.298  1.00 186.94 ? 137  ALA A O     1 
ATOM   2084  C  CB    . ALA D 4  137  ? 52.972  -1.124  63.402  1.00 185.98 ? 137  ALA A CB    1 
ATOM   2085  N  N     . ILE D 4  138  ? 54.902  1.048   62.143  1.00 167.56 ? 138  ILE A N     1 
ATOM   2086  C  CA    . ILE D 4  138  ? 56.177  1.759   62.025  1.00 153.10 ? 138  ILE A CA    1 
ATOM   2087  C  C     . ILE D 4  138  ? 55.972  3.252   62.247  1.00 142.63 ? 138  ILE A C     1 
ATOM   2088  O  O     . ILE D 4  138  ? 56.713  3.896   63.001  1.00 149.83 ? 138  ILE A O     1 
ATOM   2089  C  CB    . ILE D 4  138  ? 56.812  1.480   60.647  1.00 147.45 ? 138  ILE A CB    1 
ATOM   2090  C  CG1   . ILE D 4  138  ? 57.438  0.083   60.597  1.00 151.87 ? 138  ILE A CG1   1 
ATOM   2091  C  CG2   . ILE D 4  138  ? 57.855  2.541   60.283  1.00 143.02 ? 138  ILE A CG2   1 
ATOM   2092  C  CD1   . ILE D 4  138  ? 57.901  -0.323  59.205  1.00 146.31 ? 138  ILE A CD1   1 
ATOM   2093  N  N     . TRP D 4  139  ? 54.944  3.814   61.605  1.00 142.10 ? 139  TRP A N     1 
ATOM   2094  C  CA    . TRP D 4  139  ? 54.685  5.246   61.704  1.00 152.77 ? 139  TRP A CA    1 
ATOM   2095  C  C     . TRP D 4  139  ? 54.277  5.650   63.119  1.00 163.31 ? 139  TRP A C     1 
ATOM   2096  O  O     . TRP D 4  139  ? 54.690  6.708   63.602  1.00 163.27 ? 139  TRP A O     1 
ATOM   2097  C  CB    . TRP D 4  139  ? 53.621  5.652   60.679  1.00 151.90 ? 139  TRP A CB    1 
ATOM   2098  C  CG    . TRP D 4  139  ? 53.241  7.099   60.747  1.00 151.21 ? 139  TRP A CG    1 
ATOM   2099  C  CD1   . TRP D 4  139  ? 53.832  8.136   60.087  1.00 151.55 ? 139  TRP A CD1   1 
ATOM   2100  C  CD2   . TRP D 4  139  ? 52.171  7.667   61.511  1.00 154.57 ? 139  TRP A CD2   1 
ATOM   2101  N  NE1   . TRP D 4  139  ? 53.208  9.318   60.405  1.00 158.13 ? 139  TRP A NE1   1 
ATOM   2102  C  CE2   . TRP D 4  139  ? 52.182  9.055   61.274  1.00 161.59 ? 139  TRP A CE2   1 
ATOM   2103  C  CE3   . TRP D 4  139  ? 51.211  7.137   62.378  1.00 152.18 ? 139  TRP A CE3   1 
ATOM   2104  C  CZ2   . TRP D 4  139  ? 51.269  9.917   61.871  1.00 165.22 ? 139  TRP A CZ2   1 
ATOM   2105  C  CZ3   . TRP D 4  139  ? 50.306  7.996   62.969  1.00 155.36 ? 139  TRP A CZ3   1 
ATOM   2106  C  CH2   . TRP D 4  139  ? 50.342  9.368   62.714  1.00 161.33 ? 139  TRP A CH2   1 
ATOM   2107  N  N     . THR D 4  140  ? 53.484  4.818   63.808  1.00 167.35 ? 140  THR A N     1 
ATOM   2108  C  CA    . THR D 4  140  ? 53.119  5.132   65.188  1.00 163.77 ? 140  THR A CA    1 
ATOM   2109  C  C     . THR D 4  140  ? 54.300  4.968   66.139  1.00 165.22 ? 140  THR A C     1 
ATOM   2110  O  O     . THR D 4  140  ? 54.366  5.663   67.159  1.00 165.38 ? 140  THR A O     1 
ATOM   2111  C  CB    . THR D 4  140  ? 51.952  4.256   65.657  1.00 163.28 ? 140  THR A CB    1 
ATOM   2112  O  OG1   . THR D 4  140  ? 52.199  2.892   65.298  1.00 171.54 ? 140  THR A OG1   1 
ATOM   2113  C  CG2   . THR D 4  140  ? 50.636  4.713   65.037  1.00 156.32 ? 140  THR A CG2   1 
ATOM   2114  N  N     . LEU D 4  141  ? 55.237  4.063   65.829  1.00 173.75 ? 141  LEU A N     1 
ATOM   2115  C  CA    . LEU D 4  141  ? 56.396  3.872   66.700  1.00 178.39 ? 141  LEU A CA    1 
ATOM   2116  C  C     . LEU D 4  141  ? 57.420  4.993   66.543  1.00 180.39 ? 141  LEU A C     1 
ATOM   2117  O  O     . LEU D 4  141  ? 57.888  5.556   67.540  1.00 184.63 ? 141  LEU A O     1 
ATOM   2118  C  CB    . LEU D 4  141  ? 57.049  2.512   66.435  1.00 178.15 ? 141  LEU A CB    1 
ATOM   2119  C  CG    . LEU D 4  141  ? 56.330  1.290   67.016  1.00 171.97 ? 141  LEU A CG    1 
ATOM   2120  C  CD1   . LEU D 4  141  ? 57.092  0.003   66.716  1.00 170.53 ? 141  LEU A CD1   1 
ATOM   2121  C  CD2   . LEU D 4  141  ? 56.109  1.459   68.514  1.00 168.77 ? 141  LEU A CD2   1 
ATOM   2122  N  N     . CYS D 4  142  ? 57.784  5.335   65.306  1.00 176.76 ? 142  CYS A N     1 
ATOM   2123  C  CA    . CYS D 4  142  ? 58.752  6.400   65.050  1.00 174.03 ? 142  CYS A CA    1 
ATOM   2124  C  C     . CYS D 4  142  ? 58.073  7.674   64.544  1.00 167.36 ? 142  CYS A C     1 
ATOM   2125  O  O     . CYS D 4  142  ? 58.593  8.375   63.673  1.00 162.66 ? 142  CYS A O     1 
ATOM   2126  C  CB    . CYS D 4  142  ? 59.853  5.931   64.096  1.00 173.79 ? 142  CYS A CB    1 
ATOM   2127  S  SG    . CYS D 4  142  ? 59.384  5.492   62.409  1.00 173.50 ? 142  CYS A SG    1 
ATOM   2128  N  N     . LYS D 4  143  ? 56.896  7.987   65.100  1.00 163.32 ? 143  LYS A N     1 
ATOM   2129  C  CA    . LYS D 4  143  ? 56.300  9.306   64.896  1.00 159.05 ? 143  LYS A CA    1 
ATOM   2130  C  C     . LYS D 4  143  ? 57.111  10.386  65.599  1.00 160.82 ? 143  LYS A C     1 
ATOM   2131  O  O     . LYS D 4  143  ? 57.259  11.498  65.078  1.00 151.28 ? 143  LYS A O     1 
ATOM   2132  C  CB    . LYS D 4  143  ? 54.853  9.323   65.401  1.00 146.57 ? 143  LYS A CB    1 
ATOM   2133  C  CG    . LYS D 4  143  ? 53.985  10.447  64.834  1.00 131.70 ? 143  LYS A CG    1 
ATOM   2134  C  CD    . LYS D 4  143  ? 52.775  10.741  65.726  1.00 121.99 ? 143  LYS A CD    1 
ATOM   2135  C  CE    . LYS D 4  143  ? 52.006  9.474   66.082  1.00 109.63 ? 143  LYS A CE    1 
ATOM   2136  N  NZ    . LYS D 4  143  ? 50.959  9.713   67.116  1.00 102.38 ? 143  LYS A NZ    1 
ATOM   2137  N  N     . THR D 4  144  ? 57.641  10.076  66.784  1.00 172.58 ? 144  THR A N     1 
ATOM   2138  C  CA    . THR D 4  144  ? 58.402  11.026  67.598  1.00 177.68 ? 144  THR A CA    1 
ATOM   2139  C  C     . THR D 4  144  ? 59.887  10.731  67.406  1.00 179.97 ? 144  THR A C     1 
ATOM   2140  O  O     . THR D 4  144  ? 60.473  9.897   68.098  1.00 176.80 ? 144  THR A O     1 
ATOM   2141  C  CB    . THR D 4  144  ? 57.998  10.933  69.068  1.00 178.58 ? 144  THR A CB    1 
ATOM   2142  O  OG1   . THR D 4  144  ? 56.571  11.011  69.181  1.00 177.89 ? 144  THR A OG1   1 
ATOM   2143  C  CG2   . THR D 4  144  ? 58.620  12.072  69.869  1.00 173.64 ? 144  THR A CG2   1 
ATOM   2144  N  N     . LYS D 4  145  ? 60.496  11.425  66.444  1.00 183.43 ? 145  LYS A N     1 
ATOM   2145  C  CA    . LYS D 4  145  ? 61.934  11.328  66.200  1.00 187.79 ? 145  LYS A CA    1 
ATOM   2146  C  C     . LYS D 4  145  ? 62.377  12.687  65.666  1.00 199.54 ? 145  LYS A C     1 
ATOM   2147  O  O     . LYS D 4  145  ? 62.267  12.952  64.465  1.00 199.39 ? 145  LYS A O     1 
ATOM   2148  C  CB    . LYS D 4  145  ? 62.259  10.205  65.225  1.00 175.71 ? 145  LYS A CB    1 
ATOM   2149  N  N     . MET D 4  146  ? 62.884  13.534  66.564  1.00 213.99 ? 146  MET A N     1 
ATOM   2150  C  CA    . MET D 4  146  ? 63.134  14.929  66.224  1.00 228.08 ? 146  MET A CA    1 
ATOM   2151  C  C     . MET D 4  146  ? 64.381  15.110  65.368  1.00 234.87 ? 146  MET A C     1 
ATOM   2152  O  O     . MET D 4  146  ? 64.444  16.053  64.572  1.00 238.40 ? 146  MET A O     1 
ATOM   2153  C  CB    . MET D 4  146  ? 63.245  15.767  67.504  1.00 238.97 ? 146  MET A CB    1 
ATOM   2154  C  CG    . MET D 4  146  ? 64.371  15.362  68.453  1.00 244.55 ? 146  MET A CG    1 
ATOM   2155  S  SD    . MET D 4  146  ? 64.356  13.611  68.898  1.00 241.56 ? 146  MET A SD    1 
ATOM   2156  C  CE    . MET D 4  146  ? 62.971  13.554  70.031  1.00 236.78 ? 146  MET A CE    1 
ATOM   2157  N  N     . VAL D 4  147  ? 65.380  14.238  65.518  1.00 231.60 ? 147  VAL A N     1 
ATOM   2158  C  CA    . VAL D 4  147  ? 66.640  14.359  64.800  1.00 220.34 ? 147  VAL A CA    1 
ATOM   2159  C  C     . VAL D 4  147  ? 66.996  13.010  64.192  1.00 213.24 ? 147  VAL A C     1 
ATOM   2160  O  O     . VAL D 4  147  ? 66.445  11.968  64.554  1.00 205.73 ? 147  VAL A O     1 
ATOM   2161  C  CB    . VAL D 4  147  ? 67.805  14.847  65.704  1.00 216.59 ? 147  VAL A CB    1 
ATOM   2162  C  CG1   . VAL D 4  147  ? 67.482  16.176  66.380  1.00 214.00 ? 147  VAL A CG1   1 
ATOM   2163  C  CG2   . VAL D 4  147  ? 68.159  13.790  66.744  1.00 216.42 ? 147  VAL A CG2   1 
ATOM   2164  N  N     . CYS D 4  148  ? 67.921  13.047  63.239  1.00 217.58 ? 148  CYS A N     1 
ATOM   2165  C  CA    . CYS D 4  148  ? 68.687  11.860  62.904  1.00 221.48 ? 148  CYS A CA    1 
ATOM   2166  C  C     . CYS D 4  148  ? 69.859  11.772  63.871  1.00 230.67 ? 148  CYS A C     1 
ATOM   2167  O  O     . CYS D 4  148  ? 70.469  12.788  64.215  1.00 240.37 ? 148  CYS A O     1 
ATOM   2168  C  CB    . CYS D 4  148  ? 69.183  11.916  61.460  1.00 216.79 ? 148  CYS A CB    1 
ATOM   2169  S  SG    . CYS D 4  148  ? 69.946  10.386  60.875  1.00 214.81 ? 148  CYS A SG    1 
ATOM   2170  N  N     . GLU D 4  149  ? 70.161  10.564  64.329  1.00 223.94 ? 149  GLU A N     1 
ATOM   2171  C  CA    . GLU D 4  149  ? 71.152  10.385  65.378  1.00 212.76 ? 149  GLU A CA    1 
ATOM   2172  C  C     . GLU D 4  149  ? 72.488  9.934   64.797  1.00 214.82 ? 149  GLU A C     1 
ATOM   2173  O  O     . GLU D 4  149  ? 72.566  9.405   63.685  1.00 215.47 ? 149  GLU A O     1 
ATOM   2174  C  CB    . GLU D 4  149  ? 70.663  9.376   66.423  1.00 195.00 ? 149  GLU A CB    1 
ATOM   2175  C  CG    . GLU D 4  149  ? 70.449  9.979   67.805  1.00 179.49 ? 149  GLU A CG    1 
ATOM   2176  C  CD    . GLU D 4  149  ? 71.741  10.457  68.445  1.00 175.72 ? 149  GLU A CD    1 
ATOM   2177  O  OE1   . GLU D 4  149  ? 72.797  9.835   68.201  1.00 175.99 ? 149  GLU A OE1   1 
ATOM   2178  O  OE2   . GLU D 4  149  ? 71.702  11.463  69.186  1.00 173.90 ? 149  GLU A OE2   1 
ATOM   2179  N  N     . THR D 4  150  ? 73.552  10.165  65.573  1.00 211.09 ? 150  THR A N     1 
ATOM   2180  C  CA    . THR D 4  150  ? 74.886  9.744   65.154  1.00 203.08 ? 150  THR A CA    1 
ATOM   2181  C  C     . THR D 4  150  ? 75.039  8.233   65.280  1.00 209.27 ? 150  THR A C     1 
ATOM   2182  O  O     . THR D 4  150  ? 75.273  7.540   64.282  1.00 216.90 ? 150  THR A O     1 
ATOM   2183  C  CB    . THR D 4  150  ? 75.957  10.467  65.975  1.00 196.23 ? 150  THR A CB    1 
ATOM   2184  O  OG1   . THR D 4  150  ? 75.811  11.883  65.812  1.00 196.79 ? 150  THR A OG1   1 
ATOM   2185  C  CG2   . THR D 4  150  ? 77.353  10.055  65.515  1.00 190.78 ? 150  THR A CG2   1 
ATOM   2186  N  N     . ASP D 4  151  ? 74.895  7.703   66.497  1.00 207.10 ? 151  ASP A N     1 
ATOM   2187  C  CA    . ASP D 4  151  ? 74.958  6.262   66.711  1.00 208.29 ? 151  ASP A CA    1 
ATOM   2188  C  C     . ASP D 4  151  ? 74.339  5.899   68.056  1.00 212.96 ? 151  ASP A C     1 
ATOM   2189  O  O     . ASP D 4  151  ? 74.116  6.753   68.917  1.00 212.15 ? 151  ASP A O     1 
ATOM   2190  C  CB    . ASP D 4  151  ? 76.395  5.743   66.644  1.00 202.25 ? 151  ASP A CB    1 
ATOM   2191  C  CG    . ASP D 4  151  ? 76.475  4.374   66.019  1.00 198.23 ? 151  ASP A CG    1 
ATOM   2192  O  OD1   . ASP D 4  151  ? 76.247  4.273   64.799  1.00 195.51 ? 151  ASP A OD1   1 
ATOM   2193  O  OD2   . ASP D 4  151  ? 76.757  3.396   66.740  1.00 200.15 ? 151  ASP A OD2   1 
ATOM   2194  N  N     . VAL D 4  152  ? 74.081  4.600   68.218  1.00 218.38 ? 152  VAL A N     1 
ATOM   2195  C  CA    . VAL D 4  152  ? 73.611  3.958   69.447  1.00 215.94 ? 152  VAL A CA    1 
ATOM   2196  C  C     . VAL D 4  152  ? 74.231  2.563   69.489  1.00 219.52 ? 152  VAL A C     1 
ATOM   2197  O  O     . VAL D 4  152  ? 74.573  2.019   68.429  1.00 216.29 ? 152  VAL A O     1 
ATOM   2198  C  CB    . VAL D 4  152  ? 72.074  3.887   69.506  1.00 210.45 ? 152  VAL A CB    1 
ATOM   2199  C  CG1   . VAL D 4  152  ? 71.476  5.200   70.002  1.00 205.83 ? 152  VAL A CG1   1 
ATOM   2200  C  CG2   . VAL D 4  152  ? 71.501  3.507   68.143  1.00 206.33 ? 152  VAL A CG2   1 
ATOM   2201  N  N     . PRO D 4  153  ? 74.409  1.938   70.670  1.00 223.64 ? 153  PRO A N     1 
ATOM   2202  C  CA    . PRO D 4  153  ? 74.980  0.584   70.655  1.00 220.46 ? 153  PRO A CA    1 
ATOM   2203  C  C     . PRO D 4  153  ? 73.965  -0.492  70.270  1.00 200.50 ? 153  PRO A C     1 
ATOM   2204  O  O     . PRO D 4  153  ? 74.208  -1.675  70.519  1.00 185.93 ? 153  PRO A O     1 
ATOM   2205  C  CB    . PRO D 4  153  ? 75.454  0.394   72.098  1.00 226.44 ? 153  PRO A CB    1 
ATOM   2206  C  CG    . PRO D 4  153  ? 74.511  1.217   72.897  1.00 226.68 ? 153  PRO A CG    1 
ATOM   2207  C  CD    . PRO D 4  153  ? 74.208  2.430   72.046  1.00 225.38 ? 153  PRO A CD    1 
ATOM   2208  N  N     . LEU D 4  161  ? 77.275  3.547   69.064  1.00 239.06 ? 161  LEU A N     1 
ATOM   2209  C  CA    . LEU D 4  161  ? 78.598  3.122   69.503  1.00 241.23 ? 161  LEU A CA    1 
ATOM   2210  C  C     . LEU D 4  161  ? 79.308  2.291   68.431  1.00 259.63 ? 161  LEU A C     1 
ATOM   2211  O  O     . LEU D 4  161  ? 80.532  2.168   68.447  1.00 268.80 ? 161  LEU A O     1 
ATOM   2212  C  CB    . LEU D 4  161  ? 78.497  2.325   70.809  1.00 222.51 ? 161  LEU A CB    1 
ATOM   2213  C  CG    . LEU D 4  161  ? 78.672  3.094   72.124  1.00 206.50 ? 161  LEU A CG    1 
ATOM   2214  C  CD1   . LEU D 4  161  ? 79.997  3.844   72.139  1.00 202.51 ? 161  LEU A CD1   1 
ATOM   2215  C  CD2   . LEU D 4  161  ? 77.510  4.046   72.379  1.00 196.58 ? 161  LEU A CD2   1 
ATOM   2216  N  N     . VAL D 4  162  ? 78.538  1.732   67.493  1.00 267.44 ? 162  VAL A N     1 
ATOM   2217  C  CA    . VAL D 4  162  ? 79.091  0.865   66.456  1.00 270.92 ? 162  VAL A CA    1 
ATOM   2218  C  C     . VAL D 4  162  ? 79.393  1.666   65.192  1.00 286.86 ? 162  VAL A C     1 
ATOM   2219  O  O     . VAL D 4  162  ? 79.819  1.100   64.178  1.00 294.87 ? 162  VAL A O     1 
ATOM   2220  C  CB    . VAL D 4  162  ? 78.140  -0.308  66.148  1.00 254.35 ? 162  VAL A CB    1 
ATOM   2221  C  CG1   . VAL D 4  162  ? 78.100  -1.284  67.318  1.00 244.49 ? 162  VAL A CG1   1 
ATOM   2222  C  CG2   . VAL D 4  162  ? 76.743  0.201   65.815  1.00 248.29 ? 162  VAL A CG2   1 
ATOM   2223  N  N     . SER D 4  163  ? 79.173  2.986   65.257  1.00 287.66 ? 163  SER A N     1 
ATOM   2224  C  CA    . SER D 4  163  ? 79.457  3.938   64.170  1.00 283.26 ? 163  SER A CA    1 
ATOM   2225  C  C     . SER D 4  163  ? 78.720  3.584   62.874  1.00 275.96 ? 163  SER A C     1 
ATOM   2226  O  O     . SER D 4  163  ? 79.278  3.678   61.780  1.00 279.17 ? 163  SER A O     1 
ATOM   2227  C  CB    . SER D 4  163  ? 80.964  4.074   63.924  1.00 283.48 ? 163  SER A CB    1 
ATOM   2228  O  OG    . SER D 4  163  ? 81.239  5.075   62.957  1.00 280.06 ? 163  SER A OG    1 
ATOM   2229  N  N     . ARG D 4  164  ? 77.451  3.187   62.994  1.00 263.11 ? 164  ARG A N     1 
ATOM   2230  C  CA    . ARG D 4  164  ? 76.626  2.892   61.828  1.00 247.76 ? 164  ARG A CA    1 
ATOM   2231  C  C     . ARG D 4  164  ? 76.179  4.196   61.158  1.00 240.20 ? 164  ARG A C     1 
ATOM   2232  O  O     . ARG D 4  164  ? 76.493  5.300   61.617  1.00 249.07 ? 164  ARG A O     1 
ATOM   2233  C  CB    . ARG D 4  164  ? 75.443  2.001   62.228  1.00 238.41 ? 164  ARG A CB    1 
ATOM   2234  C  CG    . ARG D 4  164  ? 74.235  2.718   62.834  1.00 229.97 ? 164  ARG A CG    1 
ATOM   2235  C  CD    . ARG D 4  164  ? 73.213  3.120   61.773  1.00 219.57 ? 164  ARG A CD    1 
ATOM   2236  N  NE    . ARG D 4  164  ? 72.435  4.286   62.195  1.00 210.20 ? 164  ARG A NE    1 
ATOM   2237  C  CZ    . ARG D 4  164  ? 71.329  4.716   61.596  1.00 201.80 ? 164  ARG A CZ    1 
ATOM   2238  N  NH1   . ARG D 4  164  ? 70.700  5.787   62.059  1.00 202.23 ? 164  ARG A NH1   1 
ATOM   2239  N  NH2   . ARG D 4  164  ? 70.858  4.086   60.528  1.00 193.76 ? 164  ARG A NH2   1 
ATOM   2240  N  N     . GLY D 4  165  ? 75.459  4.065   60.041  1.00 228.35 ? 165  GLY A N     1 
ATOM   2241  C  CA    . GLY D 4  165  ? 75.019  5.229   59.291  1.00 217.05 ? 165  GLY A CA    1 
ATOM   2242  C  C     . GLY D 4  165  ? 74.058  6.109   60.070  1.00 214.03 ? 165  GLY A C     1 
ATOM   2243  O  O     . GLY D 4  165  ? 73.477  5.718   61.081  1.00 213.82 ? 165  GLY A O     1 
ATOM   2244  N  N     . GLY D 4  166  ? 73.894  7.333   59.583  1.00 216.27 ? 166  GLY A N     1 
ATOM   2245  C  CA    . GLY D 4  166  ? 73.070  8.299   60.282  1.00 227.64 ? 166  GLY A CA    1 
ATOM   2246  C  C     . GLY D 4  166  ? 73.693  9.677   60.371  1.00 243.94 ? 166  GLY A C     1 
ATOM   2247  O  O     . GLY D 4  166  ? 74.823  9.829   60.845  1.00 245.21 ? 166  GLY A O     1 
ATOM   2248  N  N     . CYS D 4  167  ? 72.961  10.690  59.917  1.00 257.00 ? 167  CYS A N     1 
ATOM   2249  C  CA    . CYS D 4  167  ? 73.410  12.074  59.975  1.00 261.56 ? 167  CYS A CA    1 
ATOM   2250  C  C     . CYS D 4  167  ? 72.926  12.700  61.285  1.00 256.71 ? 167  CYS A C     1 
ATOM   2251  O  O     . CYS D 4  167  ? 72.489  11.995  62.198  1.00 267.81 ? 167  CYS A O     1 
ATOM   2252  C  CB    . CYS D 4  167  ? 72.916  12.837  58.743  1.00 269.07 ? 167  CYS A CB    1 
ATOM   2253  S  SG    . CYS D 4  167  ? 71.371  13.718  59.017  1.00 273.56 ? 167  CYS A SG    1 
ATOM   2254  N  N     . GLY D 4  168  ? 73.007  14.024  61.398  1.00 234.29 ? 168  GLY A N     1 
ATOM   2255  C  CA    . GLY D 4  168  ? 72.574  14.708  62.600  1.00 211.82 ? 168  GLY A CA    1 
ATOM   2256  C  C     . GLY D 4  168  ? 71.522  15.772  62.362  1.00 192.56 ? 168  GLY A C     1 
ATOM   2257  O  O     . GLY D 4  168  ? 71.153  16.504  63.287  1.00 187.53 ? 168  GLY A O     1 
ATOM   2258  N  N     . ASN D 4  169  ? 71.029  15.868  61.129  1.00 189.71 ? 169  ASN A N     1 
ATOM   2259  C  CA    . ASN D 4  169  ? 70.075  16.912  60.780  1.00 196.86 ? 169  ASN A CA    1 
ATOM   2260  C  C     . ASN D 4  169  ? 68.724  16.639  61.431  1.00 207.00 ? 169  ASN A C     1 
ATOM   2261  O  O     . ASN D 4  169  ? 68.196  15.523  61.353  1.00 206.93 ? 169  ASN A O     1 
ATOM   2262  C  CB    . ASN D 4  169  ? 69.925  17.006  59.261  1.00 192.40 ? 169  ASN A CB    1 
ATOM   2263  C  CG    . ASN D 4  169  ? 70.939  17.947  58.630  1.00 185.61 ? 169  ASN A CG    1 
ATOM   2264  O  OD1   . ASN D 4  169  ? 70.661  19.128  58.419  1.00 183.08 ? 169  ASN A OD1   1 
ATOM   2265  N  ND2   . ASN D 4  169  ? 72.121  17.424  58.324  1.00 180.97 ? 169  ASN A ND2   1 
ATOM   2266  N  N     . THR D 4  170  ? 68.170  17.662  62.076  1.00 215.21 ? 170  THR A N     1 
ATOM   2267  C  CA    . THR D 4  170  ? 66.912  17.513  62.791  1.00 219.24 ? 170  THR A CA    1 
ATOM   2268  C  C     . THR D 4  170  ? 65.736  17.427  61.819  1.00 225.05 ? 170  THR A C     1 
ATOM   2269  O  O     . THR D 4  170  ? 65.765  17.978  60.714  1.00 227.18 ? 170  THR A O     1 
ATOM   2270  C  CB    . THR D 4  170  ? 66.716  18.676  63.771  1.00 217.54 ? 170  THR A CB    1 
ATOM   2271  O  OG1   . THR D 4  170  ? 65.357  18.706  64.228  1.00 219.33 ? 170  THR A OG1   1 
ATOM   2272  C  CG2   . THR D 4  170  ? 67.079  20.008  63.129  1.00 212.48 ? 170  THR A CG2   1 
ATOM   2273  N  N     . GLN D 4  171  ? 64.690  16.716  62.245  1.00 220.03 ? 171  GLN A N     1 
ATOM   2274  C  CA    . GLN D 4  171  ? 63.490  16.507  61.453  1.00 208.01 ? 171  GLN A CA    1 
ATOM   2275  C  C     . GLN D 4  171  ? 62.346  17.318  62.036  1.00 198.18 ? 171  GLN A C     1 
ATOM   2276  O  O     . GLN D 4  171  ? 62.098  17.246  63.248  1.00 190.80 ? 171  GLN A O     1 
ATOM   2277  C  CB    . GLN D 4  171  ? 63.113  15.020  61.420  1.00 208.05 ? 171  GLN A CB    1 
ATOM   2278  C  CG    . GLN D 4  171  ? 64.263  14.097  61.052  1.00 212.23 ? 171  GLN A CG    1 
ATOM   2279  C  CD    . GLN D 4  171  ? 64.783  14.353  59.654  1.00 213.51 ? 171  GLN A CD    1 
ATOM   2280  O  OE1   . GLN D 4  171  ? 64.008  14.518  58.712  1.00 210.63 ? 171  GLN A OE1   1 
ATOM   2281  N  NE2   . GLN D 4  171  ? 66.103  14.393  59.512  1.00 215.91 ? 171  GLN A NE2   1 
ATOM   2282  N  N     . PRO D 4  172  ? 61.637  18.099  61.225  1.00 197.75 ? 172  PRO A N     1 
ATOM   2283  C  CA    . PRO D 4  172  ? 60.580  18.959  61.765  1.00 191.37 ? 172  PRO A CA    1 
ATOM   2284  C  C     . PRO D 4  172  ? 59.332  18.174  62.136  1.00 181.74 ? 172  PRO A C     1 
ATOM   2285  O  O     . PRO D 4  172  ? 59.096  17.056  61.672  1.00 173.14 ? 172  PRO A O     1 
ATOM   2286  C  CB    . PRO D 4  172  ? 60.295  19.924  60.611  1.00 185.64 ? 172  PRO A CB    1 
ATOM   2287  C  CG    . PRO D 4  172  ? 60.601  19.124  59.394  1.00 184.23 ? 172  PRO A CG    1 
ATOM   2288  C  CD    . PRO D 4  172  ? 61.777  18.251  59.765  1.00 193.84 ? 172  PRO A CD    1 
ATOM   2289  N  N     . THR D 4  173  ? 58.527  18.785  63.002  1.00 180.34 ? 173  THR A N     1 
ATOM   2290  C  CA    . THR D 4  173  ? 57.169  18.311  63.243  1.00 177.31 ? 173  THR A CA    1 
ATOM   2291  C  C     . THR D 4  173  ? 56.299  18.725  62.061  1.00 179.20 ? 173  THR A C     1 
ATOM   2292  O  O     . THR D 4  173  ? 56.041  19.916  61.860  1.00 178.29 ? 173  THR A O     1 
ATOM   2293  C  CB    . THR D 4  173  ? 56.629  18.872  64.558  1.00 171.34 ? 173  THR A CB    1 
ATOM   2294  O  OG1   . THR D 4  173  ? 56.606  20.305  64.501  1.00 174.58 ? 173  THR A OG1   1 
ATOM   2295  C  CG2   . THR D 4  173  ? 57.498  18.428  65.729  1.00 167.41 ? 173  THR A CG2   1 
ATOM   2296  N  N     . ILE D 4  174  ? 55.859  17.750  61.271  1.00 177.75 ? 174  ILE A N     1 
ATOM   2297  C  CA    . ILE D 4  174  ? 55.193  18.019  60.002  1.00 168.03 ? 174  ILE A CA    1 
ATOM   2298  C  C     . ILE D 4  174  ? 53.696  18.188  60.244  1.00 176.01 ? 174  ILE A C     1 
ATOM   2299  O  O     . ILE D 4  174  ? 53.129  17.662  61.210  1.00 183.93 ? 174  ILE A O     1 
ATOM   2300  C  CB    . ILE D 4  174  ? 55.503  16.901  58.976  1.00 145.09 ? 174  ILE A CB    1 
ATOM   2301  C  CG1   . ILE D 4  174  ? 55.415  17.425  57.536  1.00 128.32 ? 174  ILE A CG1   1 
ATOM   2302  C  CG2   . ILE D 4  174  ? 54.616  15.676  59.189  1.00 135.98 ? 174  ILE A CG2   1 
ATOM   2303  C  CD1   . ILE D 4  174  ? 56.671  18.150  57.064  1.00 113.41 ? 174  ILE A CD1   1 
ATOM   2304  N  N     . ARG D 4  175  ? 53.060  18.974  59.378  1.00 171.61 ? 175  ARG A N     1 
ATOM   2305  C  CA    . ARG D 4  175  ? 51.624  19.211  59.429  1.00 160.99 ? 175  ARG A CA    1 
ATOM   2306  C  C     . ARG D 4  175  ? 51.159  19.604  58.035  1.00 154.76 ? 175  ARG A C     1 
ATOM   2307  O  O     . ARG D 4  175  ? 51.964  19.923  57.158  1.00 155.61 ? 175  ARG A O     1 
ATOM   2308  C  CB    . ARG D 4  175  ? 51.261  20.302  60.441  1.00 164.06 ? 175  ARG A CB    1 
ATOM   2309  C  CG    . ARG D 4  175  ? 51.664  21.700  59.995  1.00 171.04 ? 175  ARG A CG    1 
ATOM   2310  C  CD    . ARG D 4  175  ? 50.966  22.780  60.803  1.00 175.96 ? 175  ARG A CD    1 
ATOM   2311  N  NE    . ARG D 4  175  ? 51.249  24.115  60.282  1.00 177.33 ? 175  ARG A NE    1 
ATOM   2312  C  CZ    . ARG D 4  175  ? 50.760  25.239  60.798  1.00 175.63 ? 175  ARG A CZ    1 
ATOM   2313  N  NH1   . ARG D 4  175  ? 51.073  26.409  60.260  1.00 174.50 ? 175  ARG A NH1   1 
ATOM   2314  N  NH2   . ARG D 4  175  ? 49.959  25.192  61.853  1.00 173.99 ? 175  ARG A NH2   1 
ATOM   2315  N  N     . LYS D 4  176  ? 49.845  19.597  57.843  1.00 147.57 ? 176  LYS A N     1 
ATOM   2316  C  CA    . LYS D 4  176  ? 49.233  19.926  56.563  1.00 142.98 ? 176  LYS A CA    1 
ATOM   2317  C  C     . LYS D 4  176  ? 48.501  21.257  56.680  1.00 140.66 ? 176  LYS A C     1 
ATOM   2318  O  O     . LYS D 4  176  ? 47.721  21.458  57.617  1.00 124.53 ? 176  LYS A O     1 
ATOM   2319  C  CB    . LYS D 4  176  ? 48.279  18.810  56.124  1.00 151.23 ? 176  LYS A CB    1 
ATOM   2320  C  CG    . LYS D 4  176  ? 47.125  19.243  55.225  1.00 154.60 ? 176  LYS A CG    1 
ATOM   2321  C  CD    . LYS D 4  176  ? 46.264  18.043  54.830  1.00 141.57 ? 176  LYS A CD    1 
ATOM   2322  C  CE    . LYS D 4  176  ? 44.839  18.454  54.482  1.00 132.66 ? 176  LYS A CE    1 
ATOM   2323  N  NZ    . LYS D 4  176  ? 44.768  19.307  53.263  1.00 134.64 ? 176  LYS A NZ    1 
ATOM   2324  N  N     . ASP D 4  177  ? 48.763  22.167  55.737  1.00 160.81 ? 177  ASP A N     1 
ATOM   2325  C  CA    . ASP D 4  177  ? 48.089  23.467  55.690  1.00 168.65 ? 177  ASP A CA    1 
ATOM   2326  C  C     . ASP D 4  177  ? 47.704  23.701  54.232  1.00 164.66 ? 177  ASP A C     1 
ATOM   2327  O  O     . ASP D 4  177  ? 48.548  24.081  53.415  1.00 169.31 ? 177  ASP A O     1 
ATOM   2328  C  CB    . ASP D 4  177  ? 48.983  24.584  56.224  1.00 178.52 ? 177  ASP A CB    1 
ATOM   2329  C  CG    . ASP D 4  177  ? 48.202  25.837  56.617  1.00 179.03 ? 177  ASP A CG    1 
ATOM   2330  O  OD1   . ASP D 4  177  ? 47.223  26.192  55.925  1.00 177.04 ? 177  ASP A OD1   1 
ATOM   2331  O  OD2   . ASP D 4  177  ? 48.570  26.469  57.629  1.00 177.09 ? 177  ASP A OD2   1 
ATOM   2332  N  N     . GLY D 4  178  ? 46.432  23.470  53.911  1.00 157.09 ? 178  GLY A N     1 
ATOM   2333  C  CA    . GLY D 4  178  ? 45.999  23.604  52.530  1.00 147.90 ? 178  GLY A CA    1 
ATOM   2334  C  C     . GLY D 4  178  ? 46.496  22.446  51.686  1.00 133.07 ? 178  GLY A C     1 
ATOM   2335  O  O     . GLY D 4  178  ? 46.509  21.287  52.116  1.00 119.72 ? 178  GLY A O     1 
ATOM   2336  N  N     . LEU D 4  179  ? 46.920  22.763  50.464  1.00 132.55 ? 179  LEU A N     1 
ATOM   2337  C  CA    . LEU D 4  179  ? 47.430  21.756  49.541  1.00 133.90 ? 179  LEU A CA    1 
ATOM   2338  C  C     . LEU D 4  179  ? 48.906  21.452  49.746  1.00 139.46 ? 179  LEU A C     1 
ATOM   2339  O  O     . LEU D 4  179  ? 49.450  20.600  49.033  1.00 137.15 ? 179  LEU A O     1 
ATOM   2340  C  CB    . LEU D 4  179  ? 47.195  22.202  48.097  1.00 135.96 ? 179  LEU A CB    1 
ATOM   2341  C  CG    . LEU D 4  179  ? 45.986  21.627  47.356  1.00 121.24 ? 179  LEU A CG    1 
ATOM   2342  C  CD1   . LEU D 4  179  ? 44.724  21.581  48.210  1.00 114.72 ? 179  LEU A CD1   1 
ATOM   2343  C  CD2   . LEU D 4  179  ? 45.750  22.461  46.129  1.00 111.93 ? 179  LEU A CD2   1 
ATOM   2344  N  N     . LYS D 4  180  ? 49.558  22.113  50.697  1.00 145.34 ? 180  LYS A N     1 
ATOM   2345  C  CA    . LYS D 4  180  ? 50.955  21.873  51.012  1.00 138.78 ? 180  LYS A CA    1 
ATOM   2346  C  C     . LYS D 4  180  ? 51.090  21.384  52.447  1.00 129.01 ? 180  LYS A C     1 
ATOM   2347  O  O     . LYS D 4  180  ? 50.159  21.463  53.256  1.00 119.26 ? 180  LYS A O     1 
ATOM   2348  C  CB    . LYS D 4  180  ? 51.803  23.137  50.807  1.00 139.36 ? 180  LYS A CB    1 
ATOM   2349  C  CG    . LYS D 4  180  ? 52.287  23.335  49.380  1.00 142.62 ? 180  LYS A CG    1 
ATOM   2350  C  CD    . LYS D 4  180  ? 51.253  24.074  48.545  1.00 142.84 ? 180  LYS A CD    1 
ATOM   2351  C  CE    . LYS D 4  180  ? 51.067  25.498  49.039  1.00 137.35 ? 180  LYS A CE    1 
ATOM   2352  N  NZ    . LYS D 4  180  ? 50.203  26.294  48.128  1.00 128.31 ? 180  LYS A NZ    1 
ATOM   2353  N  N     . LEU D 4  181  ? 52.270  20.855  52.745  1.00 139.29 ? 181  LEU A N     1 
ATOM   2354  C  CA    . LEU D 4  181  ? 52.633  20.428  54.084  1.00 152.51 ? 181  LEU A CA    1 
ATOM   2355  C  C     . LEU D 4  181  ? 53.911  21.138  54.515  1.00 158.52 ? 181  LEU A C     1 
ATOM   2356  O  O     . LEU D 4  181  ? 54.810  21.372  53.703  1.00 156.24 ? 181  LEU A O     1 
ATOM   2357  C  CB    . LEU D 4  181  ? 52.749  18.892  54.140  1.00 145.80 ? 181  LEU A CB    1 
ATOM   2358  C  CG    . LEU D 4  181  ? 53.381  18.081  52.997  1.00 133.77 ? 181  LEU A CG    1 
ATOM   2359  C  CD1   . LEU D 4  181  ? 54.890  18.198  52.905  1.00 145.42 ? 181  LEU A CD1   1 
ATOM   2360  C  CD2   . LEU D 4  181  ? 52.968  16.623  53.116  1.00 118.16 ? 181  LEU A CD2   1 
ATOM   2361  N  N     . VAL D 4  182  ? 53.961  21.516  55.794  1.00 159.78 ? 182  VAL A N     1 
ATOM   2362  C  CA    . VAL D 4  182  ? 55.026  22.348  56.337  1.00 165.60 ? 182  VAL A CA    1 
ATOM   2363  C  C     . VAL D 4  182  ? 55.550  21.710  57.618  1.00 175.98 ? 182  VAL A C     1 
ATOM   2364  O  O     . VAL D 4  182  ? 54.974  20.761  58.150  1.00 178.94 ? 182  VAL A O     1 
ATOM   2365  C  CB    . VAL D 4  182  ? 54.558  23.798  56.600  1.00 151.90 ? 182  VAL A CB    1 
ATOM   2366  C  CG1   . VAL D 4  182  ? 54.402  24.557  55.290  1.00 144.24 ? 182  VAL A CG1   1 
ATOM   2367  C  CG2   . VAL D 4  182  ? 53.247  23.804  57.374  1.00 142.37 ? 182  VAL A CG2   1 
ATOM   2368  N  N     . GLY D 4  183  ? 56.668  22.238  58.101  1.00 176.33 ? 183  GLY A N     1 
ATOM   2369  C  CA    . GLY D 4  183  ? 57.272  21.746  59.328  1.00 177.75 ? 183  GLY A CA    1 
ATOM   2370  C  C     . GLY D 4  183  ? 57.969  22.869  60.062  1.00 183.35 ? 183  GLY A C     1 
ATOM   2371  O  O     . GLY D 4  183  ? 58.426  23.841  59.451  1.00 187.10 ? 183  GLY A O     1 
ATOM   2372  N  N     . SER D 4  184  ? 58.046  22.734  61.390  1.00 178.08 ? 184  SER A N     1 
ATOM   2373  C  CA    . SER D 4  184  ? 58.653  23.771  62.220  1.00 163.86 ? 184  SER A CA    1 
ATOM   2374  C  C     . SER D 4  184  ? 60.144  23.904  61.932  1.00 171.13 ? 184  SER A C     1 
ATOM   2375  O  O     . SER D 4  184  ? 60.612  24.965  61.500  1.00 178.76 ? 184  SER A O     1 
ATOM   2376  C  CB    . SER D 4  184  ? 58.421  23.464  63.700  1.00 142.15 ? 184  SER A CB    1 
ATOM   2377  O  OG    . SER D 4  184  ? 59.261  22.408  64.135  1.00 133.96 ? 184  SER A OG    1 
ATOM   2378  N  N     . TRP D 4  185  ? 60.895  22.822  62.162  1.00 173.43 ? 185  TRP A N     1 
ATOM   2379  C  CA    . TRP D 4  185  ? 62.337  22.734  61.909  1.00 184.31 ? 185  TRP A CA    1 
ATOM   2380  C  C     . TRP D 4  185  ? 63.094  23.834  62.659  1.00 194.02 ? 185  TRP A C     1 
ATOM   2381  O  O     . TRP D 4  185  ? 63.762  24.684  62.064  1.00 205.27 ? 185  TRP A O     1 
ATOM   2382  C  CB    . TRP D 4  185  ? 62.637  22.769  60.402  1.00 187.52 ? 185  TRP A CB    1 
ATOM   2383  C  CG    . TRP D 4  185  ? 63.858  21.991  60.025  1.00 197.98 ? 185  TRP A CG    1 
ATOM   2384  C  CD1   . TRP D 4  185  ? 64.581  21.170  60.836  1.00 209.35 ? 185  TRP A CD1   1 
ATOM   2385  C  CD2   . TRP D 4  185  ? 64.519  21.978  58.751  1.00 198.73 ? 185  TRP A CD2   1 
ATOM   2386  N  NE1   . TRP D 4  185  ? 65.642  20.635  60.147  1.00 213.97 ? 185  TRP A NE1   1 
ATOM   2387  C  CE2   . TRP D 4  185  ? 65.629  21.118  58.866  1.00 206.48 ? 185  TRP A CE2   1 
ATOM   2388  C  CE3   . TRP D 4  185  ? 64.279  22.607  57.525  1.00 191.78 ? 185  TRP A CE3   1 
ATOM   2389  C  CZ2   . TRP D 4  185  ? 66.497  20.869  57.804  1.00 200.83 ? 185  TRP A CZ2   1 
ATOM   2390  C  CZ3   . TRP D 4  185  ? 65.144  22.357  56.471  1.00 190.53 ? 185  TRP A CZ3   1 
ATOM   2391  C  CH2   . TRP D 4  185  ? 66.238  21.497  56.618  1.00 194.62 ? 185  TRP A CH2   1 
ATOM   2392  N  N     . LYS D 4  186  ? 62.954  23.800  63.988  1.00 183.76 ? 186  LYS A N     1 
ATOM   2393  C  CA    . LYS D 4  186  ? 63.492  24.806  64.914  1.00 165.53 ? 186  LYS A CA    1 
ATOM   2394  C  C     . LYS D 4  186  ? 63.029  26.224  64.567  1.00 157.81 ? 186  LYS A C     1 
ATOM   2395  O  O     . LYS D 4  186  ? 61.862  26.573  64.762  1.00 148.39 ? 186  LYS A O     1 
ATOM   2396  C  CB    . LYS D 4  186  ? 65.026  24.746  64.956  1.00 153.97 ? 186  LYS A CB    1 
ATOM   2397  C  CG    . LYS D 4  186  ? 65.652  25.555  66.080  1.00 151.78 ? 186  LYS A CG    1 
ATOM   2398  C  CD    . LYS D 4  186  ? 65.299  24.972  67.439  1.00 150.05 ? 186  LYS A CD    1 
ATOM   2399  C  CE    . LYS D 4  186  ? 65.882  25.809  68.567  1.00 148.05 ? 186  LYS A CE    1 
ATOM   2400  N  NZ    . LYS D 4  186  ? 65.583  25.234  69.908  1.00 144.92 ? 186  LYS A NZ    1 
ATOM   2401  N  N     . LEU D 4  199  ? 58.037  26.166  59.851  1.00 155.09 ? 199  LEU A N     1 
ATOM   2402  C  CA    . LEU D 4  199  ? 58.457  27.461  59.335  1.00 160.85 ? 199  LEU A CA    1 
ATOM   2403  C  C     . LEU D 4  199  ? 58.780  27.384  57.843  1.00 182.26 ? 199  LEU A C     1 
ATOM   2404  O  O     . LEU D 4  199  ? 58.351  28.237  57.066  1.00 183.67 ? 199  LEU A O     1 
ATOM   2405  C  CB    . LEU D 4  199  ? 59.670  27.981  60.114  1.00 151.50 ? 199  LEU A CB    1 
ATOM   2406  C  CG    . LEU D 4  199  ? 59.483  28.135  61.627  1.00 137.53 ? 199  LEU A CG    1 
ATOM   2407  C  CD1   . LEU D 4  199  ? 60.741  28.705  62.282  1.00 114.30 ? 199  LEU A CD1   1 
ATOM   2408  C  CD2   . LEU D 4  199  ? 58.257  28.986  61.939  1.00 142.32 ? 199  LEU A CD2   1 
ATOM   2409  N  N     . ARG D 4  200  ? 59.528  26.356  57.446  1.00 199.31 ? 200  ARG A N     1 
ATOM   2410  C  CA    . ARG D 4  200  ? 59.968  26.199  56.064  1.00 200.68 ? 200  ARG A CA    1 
ATOM   2411  C  C     . ARG D 4  200  ? 58.904  25.452  55.265  1.00 206.03 ? 200  ARG A C     1 
ATOM   2412  O  O     . ARG D 4  200  ? 58.545  24.319  55.605  1.00 206.32 ? 200  ARG A O     1 
ATOM   2413  C  CB    . ARG D 4  200  ? 61.303  25.457  56.002  1.00 191.47 ? 200  ARG A CB    1 
ATOM   2414  C  CG    . ARG D 4  200  ? 61.664  24.944  54.615  1.00 181.72 ? 200  ARG A CG    1 
ATOM   2415  C  CD    . ARG D 4  200  ? 63.124  24.535  54.542  1.00 182.47 ? 200  ARG A CD    1 
ATOM   2416  N  NE    . ARG D 4  200  ? 63.336  23.407  53.640  1.00 183.68 ? 200  ARG A NE    1 
ATOM   2417  C  CZ    . ARG D 4  200  ? 63.845  23.515  52.417  1.00 186.17 ? 200  ARG A CZ    1 
ATOM   2418  N  NH1   . ARG D 4  200  ? 64.202  24.705  51.952  1.00 186.98 ? 200  ARG A NH1   1 
ATOM   2419  N  NH2   . ARG D 4  200  ? 64.003  22.437  51.661  1.00 185.43 ? 200  ARG A NH2   1 
ATOM   2420  N  N     . VAL D 4  201  ? 58.403  26.089  54.203  1.00 203.75 ? 201  VAL A N     1 
ATOM   2421  C  CA    . VAL D 4  201  ? 57.461  25.428  53.309  1.00 191.68 ? 201  VAL A CA    1 
ATOM   2422  C  C     . VAL D 4  201  ? 58.208  24.398  52.472  1.00 184.84 ? 201  VAL A C     1 
ATOM   2423  O  O     . VAL D 4  201  ? 59.300  24.665  51.950  1.00 182.05 ? 201  VAL A O     1 
ATOM   2424  C  CB    . VAL D 4  201  ? 56.735  26.461  52.429  1.00 189.42 ? 201  VAL A CB    1 
ATOM   2425  C  CG1   . VAL D 4  201  ? 55.423  25.888  51.900  1.00 190.12 ? 201  VAL A CG1   1 
ATOM   2426  C  CG2   . VAL D 4  201  ? 56.485  27.752  53.211  1.00 183.05 ? 201  VAL A CG2   1 
ATOM   2427  N  N     . LEU D 4  202  ? 57.621  23.210  52.339  1.00 182.48 ? 202  LEU A N     1 
ATOM   2428  C  CA    . LEU D 4  202  ? 58.332  22.065  51.785  1.00 180.80 ? 202  LEU A CA    1 
ATOM   2429  C  C     . LEU D 4  202  ? 58.502  22.198  50.278  1.00 183.58 ? 202  LEU A C     1 
ATOM   2430  O  O     . LEU D 4  202  ? 57.540  22.475  49.555  1.00 182.87 ? 202  LEU A O     1 
ATOM   2431  C  CB    . LEU D 4  202  ? 57.592  20.768  52.111  1.00 163.67 ? 202  LEU A CB    1 
ATOM   2432  C  CG    . LEU D 4  202  ? 58.112  19.972  53.311  1.00 151.85 ? 202  LEU A CG    1 
ATOM   2433  C  CD1   . LEU D 4  202  ? 59.533  19.485  53.052  1.00 146.58 ? 202  LEU A CD1   1 
ATOM   2434  C  CD2   . LEU D 4  202  ? 58.035  20.772  54.607  1.00 148.27 ? 202  LEU A CD2   1 
ATOM   2435  N  N     . SER D 4  203  ? 59.730  21.988  49.809  1.00 183.29 ? 203  SER A N     1 
ATOM   2436  C  CA    . SER D 4  203  ? 60.013  21.988  48.381  1.00 173.77 ? 203  SER A CA    1 
ATOM   2437  C  C     . SER D 4  203  ? 59.610  20.639  47.799  1.00 158.54 ? 203  SER A C     1 
ATOM   2438  O  O     . SER D 4  203  ? 60.062  19.592  48.280  1.00 161.15 ? 203  SER A O     1 
ATOM   2439  C  CB    . SER D 4  203  ? 61.492  22.273  48.128  1.00 176.41 ? 203  SER A CB    1 
ATOM   2440  O  OG    . SER D 4  203  ? 61.852  21.991  46.786  1.00 172.72 ? 203  SER A OG    1 
ATOM   2441  N  N     . THR D 4  204  ? 58.747  20.665  46.779  1.00 140.91 ? 204  THR A N     1 
ATOM   2442  C  CA    . THR D 4  204  ? 58.289  19.429  46.150  1.00 146.87 ? 204  THR A CA    1 
ATOM   2443  C  C     . THR D 4  204  ? 59.434  18.712  45.443  1.00 161.12 ? 204  THR A C     1 
ATOM   2444  O  O     . THR D 4  204  ? 59.509  17.476  45.467  1.00 163.87 ? 204  THR A O     1 
ATOM   2445  C  CB    . THR D 4  204  ? 57.153  19.734  45.168  1.00 139.49 ? 204  THR A CB    1 
ATOM   2446  O  OG1   . THR D 4  204  ? 56.203  20.611  45.788  1.00 139.33 ? 204  THR A OG1   1 
ATOM   2447  C  CG2   . THR D 4  204  ? 56.442  18.453  44.732  1.00 125.71 ? 204  THR A CG2   1 
ATOM   2448  N  N     . GLU D 4  205  ? 60.345  19.470  44.823  1.00 172.19 ? 205  GLU A N     1 
ATOM   2449  C  CA    . GLU D 4  205  ? 61.496  18.856  44.166  1.00 180.55 ? 205  GLU A CA    1 
ATOM   2450  C  C     . GLU D 4  205  ? 62.471  18.268  45.180  1.00 175.38 ? 205  GLU A C     1 
ATOM   2451  O  O     . GLU D 4  205  ? 63.101  17.237  44.912  1.00 170.93 ? 205  GLU A O     1 
ATOM   2452  C  CB    . GLU D 4  205  ? 62.204  19.878  43.273  1.00 193.61 ? 205  GLU A CB    1 
ATOM   2453  C  CG    . GLU D 4  205  ? 62.190  19.522  41.788  1.00 199.39 ? 205  GLU A CG    1 
ATOM   2454  C  CD    . GLU D 4  205  ? 63.223  18.470  41.406  1.00 206.11 ? 205  GLU A CD    1 
ATOM   2455  O  OE1   . GLU D 4  205  ? 64.039  18.073  42.265  1.00 210.90 ? 205  GLU A OE1   1 
ATOM   2456  O  OE2   . GLU D 4  205  ? 63.206  18.026  40.238  1.00 204.61 ? 205  GLU A OE2   1 
ATOM   2457  N  N     . GLU D 4  206  ? 62.598  18.894  46.352  1.00 172.88 ? 206  GLU A N     1 
ATOM   2458  C  CA    . GLU D 4  206  ? 63.400  18.294  47.410  1.00 167.24 ? 206  GLU A CA    1 
ATOM   2459  C  C     . GLU D 4  206  ? 62.742  17.036  47.962  1.00 154.67 ? 206  GLU A C     1 
ATOM   2460  O  O     . GLU D 4  206  ? 63.445  16.095  48.346  1.00 153.72 ? 206  GLU A O     1 
ATOM   2461  C  CB    . GLU D 4  206  ? 63.654  19.308  48.527  1.00 171.71 ? 206  GLU A CB    1 
ATOM   2462  C  CG    . GLU D 4  206  ? 64.741  20.323  48.200  1.00 175.48 ? 206  GLU A CG    1 
ATOM   2463  C  CD    . GLU D 4  206  ? 66.026  19.666  47.728  1.00 179.74 ? 206  GLU A CD    1 
ATOM   2464  O  OE1   . GLU D 4  206  ? 66.253  19.613  46.501  1.00 182.06 ? 206  GLU A OE1   1 
ATOM   2465  O  OE2   . GLU D 4  206  ? 66.809  19.201  48.582  1.00 182.39 ? 206  GLU A OE2   1 
ATOM   2466  N  N     . ILE D 4  207  ? 61.406  16.995  47.992  1.00 144.63 ? 207  ILE A N     1 
ATOM   2467  C  CA    . ILE D 4  207  ? 60.695  15.771  48.364  1.00 134.97 ? 207  ILE A CA    1 
ATOM   2468  C  C     . ILE D 4  207  ? 60.969  14.670  47.344  1.00 138.17 ? 207  ILE A C     1 
ATOM   2469  O  O     . ILE D 4  207  ? 61.201  13.510  47.709  1.00 132.38 ? 207  ILE A O     1 
ATOM   2470  C  CB    . ILE D 4  207  ? 59.186  16.056  48.518  1.00 115.70 ? 207  ILE A CB    1 
ATOM   2471  C  CG1   . ILE D 4  207  ? 58.918  16.916  49.757  1.00 122.30 ? 207  ILE A CG1   1 
ATOM   2472  C  CG2   . ILE D 4  207  ? 58.382  14.771  48.599  1.00 98.47  ? 207  ILE A CG2   1 
ATOM   2473  C  CD1   . ILE D 4  207  ? 57.442  17.205  50.004  1.00 122.02 ? 207  ILE A CD1   1 
ATOM   2474  N  N     . LEU D 4  208  ? 60.981  15.029  46.052  1.00 144.69 ? 208  LEU A N     1 
ATOM   2475  C  CA    . LEU D 4  208  ? 61.371  14.090  44.998  1.00 151.71 ? 208  LEU A CA    1 
ATOM   2476  C  C     . LEU D 4  208  ? 62.790  13.565  45.208  1.00 163.40 ? 208  LEU A C     1 
ATOM   2477  O  O     . LEU D 4  208  ? 63.030  12.359  45.081  1.00 167.77 ? 208  LEU A O     1 
ATOM   2478  C  CB    . LEU D 4  208  ? 61.230  14.756  43.621  1.00 143.89 ? 208  LEU A CB    1 
ATOM   2479  C  CG    . LEU D 4  208  ? 61.545  14.060  42.278  1.00 127.63 ? 208  LEU A CG    1 
ATOM   2480  C  CD1   . LEU D 4  208  ? 63.016  14.185  41.848  1.00 121.88 ? 208  LEU A CD1   1 
ATOM   2481  C  CD2   . LEU D 4  208  ? 61.136  12.586  42.302  1.00 123.76 ? 208  LEU A CD2   1 
ATOM   2482  N  N     . ASN D 4  209  ? 63.737  14.453  45.532  1.00 160.56 ? 209  ASN A N     1 
ATOM   2483  C  CA    . ASN D 4  209  ? 65.127  14.030  45.729  1.00 165.95 ? 209  ASN A CA    1 
ATOM   2484  C  C     . ASN D 4  209  ? 65.261  13.096  46.929  1.00 177.67 ? 209  ASN A C     1 
ATOM   2485  O  O     . ASN D 4  209  ? 65.905  12.040  46.841  1.00 185.64 ? 209  ASN A O     1 
ATOM   2486  C  CB    . ASN D 4  209  ? 66.036  15.253  45.887  1.00 167.25 ? 209  ASN A CB    1 
ATOM   2487  C  CG    . ASN D 4  209  ? 67.301  14.956  46.701  1.00 158.83 ? 209  ASN A CG    1 
ATOM   2488  O  OD1   . ASN D 4  209  ? 67.338  15.155  47.918  1.00 143.21 ? 209  ASN A OD1   1 
ATOM   2489  N  ND2   . ASN D 4  209  ? 68.341  14.477  46.025  1.00 157.67 ? 209  ASN A ND2   1 
ATOM   2490  N  N     . ILE D 4  210  ? 64.649  13.462  48.060  1.00 180.63 ? 210  ILE A N     1 
ATOM   2491  C  CA    . ILE D 4  210  ? 64.820  12.661  49.269  1.00 179.18 ? 210  ILE A CA    1 
ATOM   2492  C  C     . ILE D 4  210  ? 64.043  11.352  49.170  1.00 167.25 ? 210  ILE A C     1 
ATOM   2493  O  O     . ILE D 4  210  ? 64.418  10.359  49.803  1.00 160.90 ? 210  ILE A O     1 
ATOM   2494  C  CB    . ILE D 4  210  ? 64.429  13.458  50.532  1.00 178.59 ? 210  ILE A CB    1 
ATOM   2495  C  CG1   . ILE D 4  210  ? 62.933  13.787  50.551  1.00 166.60 ? 210  ILE A CG1   1 
ATOM   2496  C  CG2   . ILE D 4  210  ? 65.263  14.728  50.646  1.00 180.34 ? 210  ILE A CG2   1 
ATOM   2497  C  CD1   . ILE D 4  210  ? 62.489  14.582  51.767  1.00 159.62 ? 210  ILE A CD1   1 
ATOM   2498  N  N     . PHE D 4  211  ? 62.971  11.310  48.368  1.00 161.43 ? 211  PHE A N     1 
ATOM   2499  C  CA    . PHE D 4  211  ? 62.251  10.058  48.169  1.00 161.03 ? 211  PHE A CA    1 
ATOM   2500  C  C     . PHE D 4  211  ? 62.954  9.161   47.162  1.00 172.64 ? 211  PHE A C     1 
ATOM   2501  O  O     . PHE D 4  211  ? 62.866  7.932   47.266  1.00 173.48 ? 211  PHE A O     1 
ATOM   2502  C  CB    . PHE D 4  211  ? 60.815  10.331  47.717  1.00 147.88 ? 211  PHE A CB    1 
ATOM   2503  C  CG    . PHE D 4  211  ? 59.892  10.740  48.832  1.00 142.68 ? 211  PHE A CG    1 
ATOM   2504  C  CD1   . PHE D 4  211  ? 60.344  10.802  50.141  1.00 140.17 ? 211  PHE A CD1   1 
ATOM   2505  C  CD2   . PHE D 4  211  ? 58.568  11.047  48.576  1.00 143.82 ? 211  PHE A CD2   1 
ATOM   2506  C  CE1   . PHE D 4  211  ? 59.498  11.172  51.162  1.00 139.34 ? 211  PHE A CE1   1 
ATOM   2507  C  CE2   . PHE D 4  211  ? 57.719  11.414  49.601  1.00 137.63 ? 211  PHE A CE2   1 
ATOM   2508  C  CZ    . PHE D 4  211  ? 58.187  11.481  50.889  1.00 135.08 ? 211  PHE A CZ    1 
ATOM   2509  N  N     . LYS D 4  212  ? 63.636  9.756   46.179  1.00 182.53 ? 212  LYS A N     1 
ATOM   2510  C  CA    . LYS D 4  212  ? 64.510  8.986   45.302  1.00 182.67 ? 212  LYS A CA    1 
ATOM   2511  C  C     . LYS D 4  212  ? 65.661  8.369   46.088  1.00 183.97 ? 212  LYS A C     1 
ATOM   2512  O  O     . LYS D 4  212  ? 66.044  7.218   45.843  1.00 187.58 ? 212  LYS A O     1 
ATOM   2513  C  CB    . LYS D 4  212  ? 65.033  9.885   44.178  1.00 181.21 ? 212  LYS A CB    1 
ATOM   2514  C  CG    . LYS D 4  212  ? 66.120  9.262   43.315  1.00 180.94 ? 212  LYS A CG    1 
ATOM   2515  C  CD    . LYS D 4  212  ? 65.597  8.062   42.549  1.00 175.80 ? 212  LYS A CD    1 
ATOM   2516  C  CE    . LYS D 4  212  ? 66.646  6.967   42.440  1.00 173.02 ? 212  LYS A CE    1 
ATOM   2517  N  NZ    . LYS D 4  212  ? 66.970  6.376   43.768  1.00 169.48 ? 212  LYS A NZ    1 
ATOM   2518  N  N     . HIS D 4  213  ? 66.208  9.105   47.057  1.00 171.93 ? 213  HIS A N     1 
ATOM   2519  C  CA    . HIS D 4  213  ? 67.326  8.615   47.852  1.00 157.06 ? 213  HIS A CA    1 
ATOM   2520  C  C     . HIS D 4  213  ? 66.893  7.831   49.090  1.00 157.89 ? 213  HIS A C     1 
ATOM   2521  O  O     . HIS D 4  213  ? 67.706  7.645   50.002  1.00 164.52 ? 213  HIS A O     1 
ATOM   2522  C  CB    . HIS D 4  213  ? 68.240  9.775   48.251  1.00 150.96 ? 213  HIS A CB    1 
ATOM   2523  C  CG    . HIS D 4  213  ? 69.235  10.143  47.195  1.00 158.58 ? 213  HIS A CG    1 
ATOM   2524  N  ND1   . HIS D 4  213  ? 70.066  9.215   46.604  1.00 161.65 ? 213  HIS A ND1   1 
ATOM   2525  C  CD2   . HIS D 4  213  ? 69.531  11.333  46.621  1.00 162.74 ? 213  HIS A CD2   1 
ATOM   2526  C  CE1   . HIS D 4  213  ? 70.833  9.817   45.712  1.00 164.28 ? 213  HIS A CE1   1 
ATOM   2527  N  NE2   . HIS D 4  213  ? 70.528  11.103  45.703  1.00 164.40 ? 213  HIS A NE2   1 
ATOM   2528  N  N     . ILE D 4  214  ? 65.642  7.364   49.145  1.00 155.51 ? 214  ILE A N     1 
ATOM   2529  C  CA    . ILE D 4  214  ? 65.252  6.432   50.197  1.00 163.80 ? 214  ILE A CA    1 
ATOM   2530  C  C     . ILE D 4  214  ? 65.919  5.087   49.935  1.00 177.91 ? 214  ILE A C     1 
ATOM   2531  O  O     . ILE D 4  214  ? 65.952  4.607   48.793  1.00 176.12 ? 214  ILE A O     1 
ATOM   2532  C  CB    . ILE D 4  214  ? 63.719  6.303   50.280  1.00 156.70 ? 214  ILE A CB    1 
ATOM   2533  C  CG1   . ILE D 4  214  ? 63.100  7.600   50.799  1.00 160.70 ? 214  ILE A CG1   1 
ATOM   2534  C  CG2   . ILE D 4  214  ? 63.315  5.186   51.226  1.00 149.81 ? 214  ILE A CG2   1 
ATOM   2535  C  CD1   . ILE D 4  214  ? 61.591  7.543   50.984  1.00 161.30 ? 214  ILE A CD1   1 
ATOM   2536  N  N     . SER D 4  215  ? 66.491  4.496   50.989  1.00 192.72 ? 215  SER A N     1 
ATOM   2537  C  CA    . SER D 4  215  ? 67.165  3.207   50.883  1.00 196.06 ? 215  SER A CA    1 
ATOM   2538  C  C     . SER D 4  215  ? 66.211  2.122   50.391  1.00 192.51 ? 215  SER A C     1 
ATOM   2539  O  O     . SER D 4  215  ? 65.040  2.078   50.777  1.00 189.34 ? 215  SER A O     1 
ATOM   2540  C  CB    . SER D 4  215  ? 67.768  2.819   52.236  1.00 200.60 ? 215  SER A CB    1 
ATOM   2541  O  OG    . SER D 4  215  ? 66.940  3.240   53.307  1.00 201.42 ? 215  SER A OG    1 
ATOM   2542  N  N     . VAL D 4  216  ? 66.730  1.247   49.521  1.00 187.68 ? 216  VAL A N     1 
ATOM   2543  C  CA    . VAL D 4  216  ? 65.877  0.315   48.786  1.00 171.04 ? 216  VAL A CA    1 
ATOM   2544  C  C     . VAL D 4  216  ? 65.353  -0.792  49.700  1.00 167.31 ? 216  VAL A C     1 
ATOM   2545  O  O     . VAL D 4  216  ? 64.265  -1.336  49.469  1.00 156.39 ? 216  VAL A O     1 
ATOM   2546  C  CB    . VAL D 4  216  ? 66.638  -0.237  47.558  1.00 156.14 ? 216  VAL A CB    1 
ATOM   2547  C  CG1   . VAL D 4  216  ? 67.861  -1.067  47.974  1.00 154.00 ? 216  VAL A CG1   1 
ATOM   2548  C  CG2   . VAL D 4  216  ? 65.706  -1.015  46.614  1.00 139.15 ? 216  VAL A CG2   1 
ATOM   2549  N  N     . LYS D 4  217  ? 66.084  -1.125  50.764  1.00 173.50 ? 217  LYS A N     1 
ATOM   2550  C  CA    . LYS D 4  217  ? 65.583  -2.123  51.701  1.00 179.47 ? 217  LYS A CA    1 
ATOM   2551  C  C     . LYS D 4  217  ? 64.548  -1.542  52.656  1.00 182.61 ? 217  LYS A C     1 
ATOM   2552  O  O     . LYS D 4  217  ? 63.627  -2.254  53.071  1.00 179.96 ? 217  LYS A O     1 
ATOM   2553  C  CB    . LYS D 4  217  ? 66.740  -2.737  52.490  1.00 182.19 ? 217  LYS A CB    1 
ATOM   2554  C  CG    . LYS D 4  217  ? 67.611  -3.687  51.682  1.00 175.68 ? 217  LYS A CG    1 
ATOM   2555  C  CD    . LYS D 4  217  ? 68.694  -4.331  52.541  1.00 171.95 ? 217  LYS A CD    1 
ATOM   2556  C  CE    . LYS D 4  217  ? 68.097  -5.198  53.641  1.00 160.07 ? 217  LYS A CE    1 
ATOM   2557  N  NZ    . LYS D 4  217  ? 68.067  -4.515  54.968  1.00 148.79 ? 217  LYS A NZ    1 
ATOM   2558  N  N     . ASP D 4  218  ? 64.659  -0.254  52.988  1.00 194.14 ? 218  ASP A N     1 
ATOM   2559  C  CA    . ASP D 4  218  ? 63.807  0.323   54.023  1.00 198.88 ? 218  ASP A CA    1 
ATOM   2560  C  C     . ASP D 4  218  ? 62.407  0.650   53.508  1.00 193.92 ? 218  ASP A C     1 
ATOM   2561  O  O     . ASP D 4  218  ? 61.423  0.437   54.225  1.00 203.03 ? 218  ASP A O     1 
ATOM   2562  C  CB    . ASP D 4  218  ? 64.462  1.573   54.609  1.00 209.47 ? 218  ASP A CB    1 
ATOM   2563  C  CG    . ASP D 4  218  ? 65.042  1.337   55.995  1.00 213.58 ? 218  ASP A CG    1 
ATOM   2564  O  OD1   . ASP D 4  218  ? 64.414  0.602   56.788  1.00 212.42 ? 218  ASP A OD1   1 
ATOM   2565  O  OD2   . ASP D 4  218  ? 66.119  1.893   56.296  1.00 215.17 ? 218  ASP A OD2   1 
ATOM   2566  N  N     . PHE D 4  219  ? 62.286  1.174   52.283  1.00 178.19 ? 219  PHE A N     1 
ATOM   2567  C  CA    . PHE D 4  219  ? 60.949  1.467   51.773  1.00 165.42 ? 219  PHE A CA    1 
ATOM   2568  C  C     . PHE D 4  219  ? 60.214  0.197   51.363  1.00 159.83 ? 219  PHE A C     1 
ATOM   2569  O  O     . PHE D 4  219  ? 58.978  0.163   51.400  1.00 157.09 ? 219  PHE A O     1 
ATOM   2570  C  CB    . PHE D 4  219  ? 61.008  2.463   50.607  1.00 163.56 ? 219  PHE A CB    1 
ATOM   2571  C  CG    . PHE D 4  219  ? 61.198  1.831   49.252  1.00 164.21 ? 219  PHE A CG    1 
ATOM   2572  C  CD1   . PHE D 4  219  ? 60.206  1.937   48.290  1.00 161.78 ? 219  PHE A CD1   1 
ATOM   2573  C  CD2   . PHE D 4  219  ? 62.373  1.182   48.918  1.00 166.49 ? 219  PHE A CD2   1 
ATOM   2574  C  CE1   . PHE D 4  219  ? 60.366  1.374   47.035  1.00 160.90 ? 219  PHE A CE1   1 
ATOM   2575  C  CE2   . PHE D 4  219  ? 62.534  0.616   47.658  1.00 165.79 ? 219  PHE A CE2   1 
ATOM   2576  C  CZ    . PHE D 4  219  ? 61.531  0.715   46.720  1.00 160.85 ? 219  PHE A CZ    1 
ATOM   2577  N  N     . THR D 4  220  ? 60.949  -0.852  50.981  1.00 159.12 ? 220  THR A N     1 
ATOM   2578  C  CA    . THR D 4  220  ? 60.335  -2.165  50.825  1.00 159.99 ? 220  THR A CA    1 
ATOM   2579  C  C     . THR D 4  220  ? 59.927  -2.728  52.182  1.00 162.20 ? 220  THR A C     1 
ATOM   2580  O  O     . THR D 4  220  ? 58.893  -3.396  52.300  1.00 167.38 ? 220  THR A O     1 
ATOM   2581  C  CB    . THR D 4  220  ? 61.294  -3.118  50.102  1.00 166.44 ? 220  THR A CB    1 
ATOM   2582  O  OG1   . THR D 4  220  ? 61.907  -2.441  48.996  1.00 167.69 ? 220  THR A OG1   1 
ATOM   2583  C  CG2   . THR D 4  220  ? 60.555  -4.345  49.581  1.00 166.46 ? 220  THR A CG2   1 
ATOM   2584  N  N     . SER D 4  221  ? 60.726  -2.455  53.222  1.00 160.55 ? 221  SER A N     1 
ATOM   2585  C  CA    . SER D 4  221  ? 60.332  -2.763  54.592  1.00 152.94 ? 221  SER A CA    1 
ATOM   2586  C  C     . SER D 4  221  ? 59.193  -1.874  55.081  1.00 143.14 ? 221  SER A C     1 
ATOM   2587  O  O     . SER D 4  221  ? 58.470  -2.266  56.005  1.00 126.89 ? 221  SER A O     1 
ATOM   2588  C  CB    . SER D 4  221  ? 61.535  -2.628  55.533  1.00 148.94 ? 221  SER A CB    1 
ATOM   2589  O  OG    . SER D 4  221  ? 62.685  -3.263  55.000  1.00 145.48 ? 221  SER A OG    1 
ATOM   2590  N  N     . LEU D 4  222  ? 59.018  -0.690  54.486  1.00 152.33 ? 222  LEU A N     1 
ATOM   2591  C  CA    . LEU D 4  222  ? 57.875  0.152   54.825  1.00 160.08 ? 222  LEU A CA    1 
ATOM   2592  C  C     . LEU D 4  222  ? 56.570  -0.433  54.299  1.00 174.01 ? 222  LEU A C     1 
ATOM   2593  O  O     . LEU D 4  222  ? 55.508  -0.198  54.887  1.00 176.46 ? 222  LEU A O     1 
ATOM   2594  C  CB    . LEU D 4  222  ? 58.080  1.569   54.283  1.00 145.07 ? 222  LEU A CB    1 
ATOM   2595  C  CG    . LEU D 4  222  ? 58.907  2.522   55.154  1.00 128.76 ? 222  LEU A CG    1 
ATOM   2596  C  CD1   . LEU D 4  222  ? 59.450  3.696   54.351  1.00 118.62 ? 222  LEU A CD1   1 
ATOM   2597  C  CD2   . LEU D 4  222  ? 58.079  3.017   56.335  1.00 124.08 ? 222  LEU A CD2   1 
ATOM   2598  N  N     . GLY D 4  223  ? 56.623  -1.191  53.207  1.00 180.44 ? 223  GLY A N     1 
ATOM   2599  C  CA    . GLY D 4  223  ? 55.435  -1.825  52.670  1.00 174.15 ? 223  GLY A CA    1 
ATOM   2600  C  C     . GLY D 4  223  ? 55.203  -1.514  51.207  1.00 160.57 ? 223  GLY A C     1 
ATOM   2601  O  O     . GLY D 4  223  ? 54.112  -1.738  50.670  1.00 145.55 ? 223  GLY A O     1 
ATOM   2602  N  N     . PHE D 4  224  ? 56.231  -0.987  50.556  1.00 160.75 ? 224  PHE A N     1 
ATOM   2603  C  CA    . PHE D 4  224  ? 56.159  -0.574  49.166  1.00 151.77 ? 224  PHE A CA    1 
ATOM   2604  C  C     . PHE D 4  224  ? 56.725  -1.685  48.279  1.00 150.26 ? 224  PHE A C     1 
ATOM   2605  O  O     . PHE D 4  224  ? 56.947  -2.815  48.726  1.00 161.35 ? 224  PHE A O     1 
ATOM   2606  C  CB    . PHE D 4  224  ? 56.889  0.759   48.986  1.00 150.09 ? 224  PHE A CB    1 
ATOM   2607  C  CG    . PHE D 4  224  ? 56.049  1.970   49.318  1.00 153.05 ? 224  PHE A CG    1 
ATOM   2608  C  CD1   . PHE D 4  224  ? 54.969  1.883   50.187  1.00 155.86 ? 224  PHE A CD1   1 
ATOM   2609  C  CD2   . PHE D 4  224  ? 56.326  3.195   48.736  1.00 149.53 ? 224  PHE A CD2   1 
ATOM   2610  C  CE1   . PHE D 4  224  ? 54.199  2.996   50.481  1.00 152.00 ? 224  PHE A CE1   1 
ATOM   2611  C  CE2   . PHE D 4  224  ? 55.555  4.313   49.024  1.00 143.65 ? 224  PHE A CE2   1 
ATOM   2612  C  CZ    . PHE D 4  224  ? 54.493  4.211   49.898  1.00 144.12 ? 224  PHE A CZ    1 
ATOM   2613  N  N     . ASN D 4  225  ? 56.952  -1.378  47.003  1.00 138.10 ? 225  ASN A N     1 
ATOM   2614  C  CA    . ASN D 4  225  ? 57.492  -2.362  46.075  1.00 140.84 ? 225  ASN A CA    1 
ATOM   2615  C  C     . ASN D 4  225  ? 58.577  -1.721  45.219  1.00 157.36 ? 225  ASN A C     1 
ATOM   2616  O  O     . ASN D 4  225  ? 58.547  -0.521  44.941  1.00 167.98 ? 225  ASN A O     1 
ATOM   2617  C  CB    . ASN D 4  225  ? 56.386  -2.957  45.190  1.00 129.04 ? 225  ASN A CB    1 
ATOM   2618  C  CG    . ASN D 4  225  ? 56.815  -4.238  44.497  1.00 127.36 ? 225  ASN A CG    1 
ATOM   2619  O  OD1   . ASN D 4  225  ? 57.613  -4.216  43.560  1.00 130.86 ? 225  ASN A OD1   1 
ATOM   2620  N  ND2   . ASN D 4  225  ? 56.290  -5.366  44.964  1.00 119.01 ? 225  ASN A ND2   1 
ATOM   2621  N  N     . GLU D 4  226  ? 59.543  -2.545  44.806  1.00 159.20 ? 226  GLU A N     1 
ATOM   2622  C  CA    . GLU D 4  226  ? 60.672  -2.051  44.023  1.00 154.88 ? 226  GLU A CA    1 
ATOM   2623  C  C     . GLU D 4  226  ? 60.269  -1.723  42.588  1.00 149.38 ? 226  GLU A C     1 
ATOM   2624  O  O     . GLU D 4  226  ? 60.657  -0.677  42.053  1.00 145.65 ? 226  GLU A O     1 
ATOM   2625  C  CB    . GLU D 4  226  ? 61.801  -3.084  44.047  1.00 160.17 ? 226  GLU A CB    1 
ATOM   2626  C  CG    . GLU D 4  226  ? 62.847  -2.918  42.957  1.00 163.12 ? 226  GLU A CG    1 
ATOM   2627  C  CD    . GLU D 4  226  ? 63.825  -4.079  42.916  1.00 161.72 ? 226  GLU A CD    1 
ATOM   2628  O  OE1   . GLU D 4  226  ? 64.965  -3.881  42.446  1.00 159.72 ? 226  GLU A OE1   1 
ATOM   2629  O  OE2   . GLU D 4  226  ? 63.456  -5.186  43.363  1.00 157.55 ? 226  GLU A OE2   1 
ATOM   2630  N  N     . VAL D 4  227  ? 59.488  -2.597  41.946  1.00 152.99 ? 227  VAL A N     1 
ATOM   2631  C  CA    . VAL D 4  227  ? 59.190  -2.448  40.521  1.00 156.78 ? 227  VAL A CA    1 
ATOM   2632  C  C     . VAL D 4  227  ? 57.799  -1.877  40.242  1.00 159.58 ? 227  VAL A C     1 
ATOM   2633  O  O     . VAL D 4  227  ? 57.520  -1.509  39.088  1.00 151.74 ? 227  VAL A O     1 
ATOM   2634  C  CB    . VAL D 4  227  ? 59.366  -3.790  39.772  1.00 140.19 ? 227  VAL A CB    1 
ATOM   2635  C  CG1   . VAL D 4  227  ? 60.838  -4.023  39.426  1.00 128.49 ? 227  VAL A CG1   1 
ATOM   2636  C  CG2   . VAL D 4  227  ? 58.815  -4.949  40.593  1.00 131.51 ? 227  VAL A CG2   1 
ATOM   2637  N  N     . PHE D 4  228  ? 56.924  -1.784  41.246  1.00 162.19 ? 228  PHE A N     1 
ATOM   2638  C  CA    . PHE D 4  228  ? 55.565  -1.288  41.046  1.00 153.29 ? 228  PHE A CA    1 
ATOM   2639  C  C     . PHE D 4  228  ? 55.305  0.029   41.767  1.00 155.19 ? 228  PHE A C     1 
ATOM   2640  O  O     . PHE D 4  228  ? 54.912  1.015   41.136  1.00 152.88 ? 228  PHE A O     1 
ATOM   2641  C  CB    . PHE D 4  228  ? 54.537  -2.337  41.503  1.00 144.57 ? 228  PHE A CB    1 
ATOM   2642  C  CG    . PHE D 4  228  ? 54.602  -3.632  40.743  1.00 138.12 ? 228  PHE A CG    1 
ATOM   2643  C  CD1   . PHE D 4  228  ? 54.275  -4.830  41.358  1.00 135.63 ? 228  PHE A CD1   1 
ATOM   2644  C  CD2   . PHE D 4  228  ? 54.970  -3.650  39.408  1.00 140.34 ? 228  PHE A CD2   1 
ATOM   2645  C  CE1   . PHE D 4  228  ? 54.335  -6.025  40.659  1.00 138.99 ? 228  PHE A CE1   1 
ATOM   2646  C  CE2   . PHE D 4  228  ? 55.028  -4.839  38.705  1.00 141.71 ? 228  PHE A CE2   1 
ATOM   2647  C  CZ    . PHE D 4  228  ? 54.708  -6.026  39.331  1.00 141.52 ? 228  PHE A CZ    1 
ATOM   2648  N  N     . SER D 4  229  ? 55.518  0.075   43.081  1.00 154.98 ? 229  SER A N     1 
ATOM   2649  C  CA    . SER D 4  229  ? 55.030  1.170   43.917  1.00 148.38 ? 229  SER A CA    1 
ATOM   2650  C  C     . SER D 4  229  ? 56.179  1.727   44.754  1.00 143.59 ? 229  SER A C     1 
ATOM   2651  O  O     . SER D 4  229  ? 56.488  1.196   45.823  1.00 138.34 ? 229  SER A O     1 
ATOM   2652  C  CB    . SER D 4  229  ? 53.882  0.686   44.802  1.00 140.63 ? 229  SER A CB    1 
ATOM   2653  O  OG    . SER D 4  229  ? 53.301  1.749   45.533  1.00 135.70 ? 229  SER A OG    1 
ATOM   2654  N  N     . ARG D 4  230  ? 56.797  2.807   44.273  1.00 151.00 ? 230  ARG A N     1 
ATOM   2655  C  CA    . ARG D 4  230  ? 57.848  3.547   44.958  1.00 157.59 ? 230  ARG A CA    1 
ATOM   2656  C  C     . ARG D 4  230  ? 57.345  4.944   45.322  1.00 161.38 ? 230  ARG A C     1 
ATOM   2657  O  O     . ARG D 4  230  ? 56.514  5.505   44.601  1.00 175.35 ? 230  ARG A O     1 
ATOM   2658  C  CB    . ARG D 4  230  ? 59.100  3.654   44.072  1.00 161.38 ? 230  ARG A CB    1 
ATOM   2659  C  CG    . ARG D 4  230  ? 59.600  2.325   43.531  1.00 160.26 ? 230  ARG A CG    1 
ATOM   2660  C  CD    . ARG D 4  230  ? 60.737  2.531   42.550  1.00 157.91 ? 230  ARG A CD    1 
ATOM   2661  N  NE    . ARG D 4  230  ? 61.972  2.943   43.206  1.00 155.68 ? 230  ARG A NE    1 
ATOM   2662  C  CZ    . ARG D 4  230  ? 63.089  3.248   42.554  1.00 155.13 ? 230  ARG A CZ    1 
ATOM   2663  N  NH1   . ARG D 4  230  ? 64.175  3.615   43.222  1.00 153.09 ? 230  ARG A NH1   1 
ATOM   2664  N  NH2   . ARG D 4  230  ? 63.115  3.194   41.229  1.00 155.56 ? 230  ARG A NH2   1 
ATOM   2665  N  N     . PRO D 4  231  ? 57.816  5.534   46.433  1.00 148.54 ? 231  PRO A N     1 
ATOM   2666  C  CA    . PRO D 4  231  ? 57.307  6.866   46.810  1.00 144.96 ? 231  PRO A CA    1 
ATOM   2667  C  C     . PRO D 4  231  ? 57.773  7.975   45.883  1.00 138.99 ? 231  PRO A C     1 
ATOM   2668  O  O     . PRO D 4  231  ? 57.069  8.987   45.757  1.00 125.47 ? 231  PRO A O     1 
ATOM   2669  C  CB    . PRO D 4  231  ? 57.838  7.071   48.239  1.00 151.66 ? 231  PRO A CB    1 
ATOM   2670  C  CG    . PRO D 4  231  ? 58.713  5.886   48.547  1.00 156.21 ? 231  PRO A CG    1 
ATOM   2671  C  CD    . PRO D 4  231  ? 58.946  5.126   47.287  1.00 153.30 ? 231  PRO A CD    1 
ATOM   2672  N  N     . GLU D 4  232  ? 58.918  7.798   45.209  1.00 147.60 ? 232  GLU A N     1 
ATOM   2673  C  CA    . GLU D 4  232  ? 59.383  8.747   44.201  1.00 154.03 ? 232  GLU A CA    1 
ATOM   2674  C  C     . GLU D 4  232  ? 58.404  8.883   43.041  1.00 159.89 ? 232  GLU A C     1 
ATOM   2675  O  O     . GLU D 4  232  ? 58.414  9.910   42.354  1.00 164.24 ? 232  GLU A O     1 
ATOM   2676  C  CB    . GLU D 4  232  ? 60.755  8.314   43.671  1.00 160.76 ? 232  GLU A CB    1 
ATOM   2677  C  CG    . GLU D 4  232  ? 60.741  6.975   42.932  1.00 165.96 ? 232  GLU A CG    1 
ATOM   2678  C  CD    . GLU D 4  232  ? 62.121  6.516   42.501  1.00 173.50 ? 232  GLU A CD    1 
ATOM   2679  O  OE1   . GLU D 4  232  ? 62.978  6.296   43.382  1.00 178.42 ? 232  GLU A OE1   1 
ATOM   2680  O  OE2   . GLU D 4  232  ? 62.347  6.375   41.280  1.00 171.94 ? 232  GLU A OE2   1 
ATOM   2681  N  N     . TRP D 4  233  ? 57.564  7.871   42.810  1.00 164.71 ? 233  TRP A N     1 
ATOM   2682  C  CA    . TRP D 4  233  ? 56.510  7.913   41.809  1.00 161.83 ? 233  TRP A CA    1 
ATOM   2683  C  C     . TRP D 4  233  ? 55.168  8.309   42.404  1.00 163.60 ? 233  TRP A C     1 
ATOM   2684  O  O     . TRP D 4  233  ? 54.226  8.569   41.648  1.00 167.81 ? 233  TRP A O     1 
ATOM   2685  C  CB    . TRP D 4  233  ? 56.375  6.545   41.125  1.00 153.88 ? 233  TRP A CB    1 
ATOM   2686  C  CG    . TRP D 4  233  ? 57.623  6.106   40.437  1.00 159.33 ? 233  TRP A CG    1 
ATOM   2687  C  CD1   . TRP D 4  233  ? 58.634  6.904   39.992  1.00 163.85 ? 233  TRP A CD1   1 
ATOM   2688  C  CD2   . TRP D 4  233  ? 58.016  4.760   40.143  1.00 171.83 ? 233  TRP A CD2   1 
ATOM   2689  N  NE1   . TRP D 4  233  ? 59.626  6.142   39.426  1.00 170.59 ? 233  TRP A NE1   1 
ATOM   2690  C  CE2   . TRP D 4  233  ? 59.273  4.822   39.509  1.00 178.66 ? 233  TRP A CE2   1 
ATOM   2691  C  CE3   . TRP D 4  233  ? 57.425  3.509   40.349  1.00 179.00 ? 233  TRP A CE3   1 
ATOM   2692  C  CZ2   . TRP D 4  233  ? 59.950  3.682   39.078  1.00 189.92 ? 233  TRP A CZ2   1 
ATOM   2693  C  CZ3   . TRP D 4  233  ? 58.099  2.377   39.920  1.00 186.35 ? 233  TRP A CZ3   1 
ATOM   2694  C  CH2   . TRP D 4  233  ? 59.346  2.472   39.288  1.00 191.84 ? 233  TRP A CH2   1 
ATOM   2695  N  N     . MET D 4  234  ? 55.059  8.335   43.737  1.00 155.63 ? 234  MET A N     1 
ATOM   2696  C  CA    . MET D 4  234  ? 53.824  8.762   44.387  1.00 146.53 ? 234  MET A CA    1 
ATOM   2697  C  C     . MET D 4  234  ? 53.528  10.228  44.093  1.00 150.13 ? 234  MET A C     1 
ATOM   2698  O  O     . MET D 4  234  ? 52.365  10.612  43.920  1.00 145.23 ? 234  MET A O     1 
ATOM   2699  C  CB    . MET D 4  234  ? 53.925  8.509   45.893  1.00 140.47 ? 234  MET A CB    1 
ATOM   2700  C  CG    . MET D 4  234  ? 52.793  9.078   46.725  1.00 138.96 ? 234  MET A CG    1 
ATOM   2701  S  SD    . MET D 4  234  ? 52.466  8.115   48.217  1.00 140.02 ? 234  MET A SD    1 
ATOM   2702  C  CE    . MET D 4  234  ? 54.058  8.155   49.040  1.00 122.93 ? 234  MET A CE    1 
ATOM   2703  N  N     . ILE D 4  235  ? 54.572  11.058  44.014  1.00 163.46 ? 235  ILE A N     1 
ATOM   2704  C  CA    . ILE D 4  235  ? 54.399  12.444  43.595  1.00 164.06 ? 235  ILE A CA    1 
ATOM   2705  C  C     . ILE D 4  235  ? 54.199  12.498  42.083  1.00 150.10 ? 235  ILE A C     1 
ATOM   2706  O  O     . ILE D 4  235  ? 54.559  11.576  41.345  1.00 144.08 ? 235  ILE A O     1 
ATOM   2707  C  CB    . ILE D 4  235  ? 55.586  13.323  44.039  1.00 173.31 ? 235  ILE A CB    1 
ATOM   2708  C  CG1   . ILE D 4  235  ? 56.933  12.675  43.695  1.00 172.36 ? 235  ILE A CG1   1 
ATOM   2709  C  CG2   . ILE D 4  235  ? 55.510  13.620  45.530  1.00 174.69 ? 235  ILE A CG2   1 
ATOM   2710  C  CD1   . ILE D 4  235  ? 57.533  13.136  42.373  1.00 169.73 ? 235  ILE A CD1   1 
ATOM   2711  N  N     . LEU D 4  236  ? 53.644  13.611  41.616  1.00 139.78 ? 236  LEU A N     1 
ATOM   2712  C  CA    . LEU D 4  236  ? 53.268  13.772  40.218  1.00 131.38 ? 236  LEU A CA    1 
ATOM   2713  C  C     . LEU D 4  236  ? 54.211  14.760  39.544  1.00 137.61 ? 236  LEU A C     1 
ATOM   2714  O  O     . LEU D 4  236  ? 54.236  15.943  39.903  1.00 133.44 ? 236  LEU A O     1 
ATOM   2715  C  CB    . LEU D 4  236  ? 51.818  14.244  40.101  1.00 125.58 ? 236  LEU A CB    1 
ATOM   2716  C  CG    . LEU D 4  236  ? 50.752  13.304  40.674  1.00 127.84 ? 236  LEU A CG    1 
ATOM   2717  C  CD1   . LEU D 4  236  ? 49.348  13.738  40.254  1.00 130.22 ? 236  LEU A CD1   1 
ATOM   2718  C  CD2   . LEU D 4  236  ? 51.019  11.860  40.265  1.00 126.82 ? 236  LEU A CD2   1 
ATOM   2719  N  N     . THR D 4  237  ? 54.994  14.270  38.582  1.00 152.77 ? 237  THR A N     1 
ATOM   2720  C  CA    . THR D 4  237  ? 55.814  15.130  37.735  1.00 168.98 ? 237  THR A CA    1 
ATOM   2721  C  C     . THR D 4  237  ? 55.398  15.051  36.270  1.00 178.30 ? 237  THR A C     1 
ATOM   2722  O  O     . THR D 4  237  ? 55.151  16.093  35.652  1.00 176.17 ? 237  THR A O     1 
ATOM   2723  C  CB    . THR D 4  237  ? 57.306  14.799  37.925  1.00 173.79 ? 237  THR A CB    1 
ATOM   2724  O  OG1   . THR D 4  237  ? 58.081  15.387  36.871  1.00 185.96 ? 237  THR A OG1   1 
ATOM   2725  C  CG2   . THR D 4  237  ? 57.555  13.298  38.007  1.00 167.59 ? 237  THR A CG2   1 
ATOM   2726  N  N     . CYS D 4  238  ? 55.299  13.855  35.690  1.00 183.30 ? 238  CYS A N     1 
ATOM   2727  C  CA    . CYS D 4  238  ? 54.778  13.671  34.339  1.00 185.23 ? 238  CYS A CA    1 
ATOM   2728  C  C     . CYS D 4  238  ? 53.361  13.119  34.424  1.00 171.65 ? 238  CYS A C     1 
ATOM   2729  O  O     . CYS D 4  238  ? 53.128  12.100  35.084  1.00 162.33 ? 238  CYS A O     1 
ATOM   2730  C  CB    . CYS D 4  238  ? 55.667  12.724  33.532  1.00 191.22 ? 238  CYS A CB    1 
ATOM   2731  S  SG    . CYS D 4  238  ? 54.997  12.262  31.914  1.00 192.23 ? 238  CYS A SG    1 
ATOM   2732  N  N     . LEU D 4  239  ? 52.419  13.784  33.750  1.00 163.27 ? 239  LEU A N     1 
ATOM   2733  C  CA    . LEU D 4  239  ? 51.013  13.440  33.856  1.00 152.82 ? 239  LEU A CA    1 
ATOM   2734  C  C     . LEU D 4  239  ? 50.540  12.727  32.601  1.00 155.95 ? 239  LEU A C     1 
ATOM   2735  O  O     . LEU D 4  239  ? 50.727  13.242  31.491  1.00 155.87 ? 239  LEU A O     1 
ATOM   2736  C  CB    . LEU D 4  239  ? 50.168  14.701  34.083  1.00 137.42 ? 239  LEU A CB    1 
ATOM   2737  C  CG    . LEU D 4  239  ? 48.655  14.484  34.173  1.00 124.61 ? 239  LEU A CG    1 
ATOM   2738  C  CD1   . LEU D 4  239  ? 48.291  13.736  35.442  1.00 123.37 ? 239  LEU A CD1   1 
ATOM   2739  C  CD2   . LEU D 4  239  ? 47.904  15.808  34.098  1.00 121.65 ? 239  LEU A CD2   1 
ATOM   2740  N  N     . PRO D 4  240  ? 49.924  11.552  32.729  1.00 155.21 ? 240  PRO A N     1 
ATOM   2741  C  CA    . PRO D 4  240  ? 49.308  10.911  31.560  1.00 153.00 ? 240  PRO A CA    1 
ATOM   2742  C  C     . PRO D 4  240  ? 47.946  11.530  31.254  1.00 143.89 ? 240  PRO A C     1 
ATOM   2743  O  O     . PRO D 4  240  ? 47.105  11.684  32.144  1.00 134.45 ? 240  PRO A O     1 
ATOM   2744  C  CB    . PRO D 4  240  ? 49.187  9.444   31.987  1.00 145.18 ? 240  PRO A CB    1 
ATOM   2745  C  CG    . PRO D 4  240  ? 49.090  9.493   33.476  1.00 141.37 ? 240  PRO A CG    1 
ATOM   2746  C  CD    . PRO D 4  240  ? 49.921  10.674  33.914  1.00 147.78 ? 240  PRO A CD    1 
ATOM   2747  N  N     . VAL D 4  241  ? 47.736  11.894  29.996  1.00 137.65 ? 241  VAL A N     1 
ATOM   2748  C  CA    . VAL D 4  241  ? 46.489  12.518  29.548  1.00 132.38 ? 241  VAL A CA    1 
ATOM   2749  C  C     . VAL D 4  241  ? 45.641  11.468  28.832  1.00 133.29 ? 241  VAL A C     1 
ATOM   2750  O  O     . VAL D 4  241  ? 46.153  10.782  27.928  1.00 128.50 ? 241  VAL A O     1 
ATOM   2751  C  CB    . VAL D 4  241  ? 46.737  13.763  28.660  1.00 127.58 ? 241  VAL A CB    1 
ATOM   2752  C  CG1   . VAL D 4  241  ? 47.782  13.529  27.584  1.00 123.05 ? 241  VAL A CG1   1 
ATOM   2753  C  CG2   . VAL D 4  241  ? 45.437  14.275  28.032  1.00 122.40 ? 241  VAL A CG2   1 
ATOM   2754  N  N     . PRO D 4  242  ? 44.377  11.287  29.227  1.00 135.90 ? 242  PRO A N     1 
ATOM   2755  C  CA    . PRO D 4  242  ? 43.569  10.156  28.738  1.00 131.20 ? 242  PRO A CA    1 
ATOM   2756  C  C     . PRO D 4  242  ? 43.101  10.370  27.310  1.00 143.12 ? 242  PRO A C     1 
ATOM   2757  O  O     . PRO D 4  242  ? 43.079  11.508  26.816  1.00 144.06 ? 242  PRO A O     1 
ATOM   2758  C  CB    . PRO D 4  242  ? 42.374  10.132  29.711  1.00 113.59 ? 242  PRO A CB    1 
ATOM   2759  C  CG    . PRO D 4  242  ? 42.767  11.000  30.856  1.00 125.68 ? 242  PRO A CG    1 
ATOM   2760  C  CD    . PRO D 4  242  ? 43.683  12.027  30.295  1.00 137.41 ? 242  PRO A CD    1 
ATOM   2761  N  N     . PRO D 4  243  ? 42.712  9.301   26.615  1.00 156.43 ? 243  PRO A N     1 
ATOM   2762  C  CA    . PRO D 4  243  ? 42.131  9.442   25.269  1.00 155.55 ? 243  PRO A CA    1 
ATOM   2763  C  C     . PRO D 4  243  ? 40.761  10.096  25.310  1.00 149.39 ? 243  PRO A C     1 
ATOM   2764  O  O     . PRO D 4  243  ? 40.123  10.159  26.373  1.00 153.73 ? 243  PRO A O     1 
ATOM   2765  C  CB    . PRO D 4  243  ? 42.035  7.990   24.782  1.00 162.81 ? 243  PRO A CB    1 
ATOM   2766  C  CG    . PRO D 4  243  ? 41.992  7.172   26.025  1.00 171.20 ? 243  PRO A CG    1 
ATOM   2767  C  CD    . PRO D 4  243  ? 42.905  7.884   26.975  1.00 167.84 ? 243  PRO A CD    1 
ATOM   2768  N  N     . PRO D 4  244  ? 40.278  10.597  24.173  1.00 135.24 ? 244  PRO A N     1 
ATOM   2769  C  CA    . PRO D 4  244  ? 38.927  11.206  24.114  1.00 129.50 ? 244  PRO A CA    1 
ATOM   2770  C  C     . PRO D 4  244  ? 37.779  10.277  24.504  1.00 122.56 ? 244  PRO A C     1 
ATOM   2771  O  O     . PRO D 4  244  ? 36.744  10.791  24.953  1.00 118.96 ? 244  PRO A O     1 
ATOM   2772  C  CB    . PRO D 4  244  ? 38.812  11.661  22.649  1.00 132.62 ? 244  PRO A CB    1 
ATOM   2773  C  CG    . PRO D 4  244  ? 40.225  11.903  22.231  1.00 134.27 ? 244  PRO A CG    1 
ATOM   2774  C  CD    . PRO D 4  244  ? 41.051  10.871  22.943  1.00 131.91 ? 244  PRO A CD    1 
ATOM   2775  N  N     . PRO D 4  245  ? 37.860  8.940   24.342  1.00 130.22 ? 245  PRO A N     1 
ATOM   2776  C  CA    . PRO D 4  245  ? 36.784  8.096   24.915  1.00 127.98 ? 245  PRO A CA    1 
ATOM   2777  C  C     . PRO D 4  245  ? 36.597  8.205   26.427  1.00 121.71 ? 245  PRO A C     1 
ATOM   2778  O  O     . PRO D 4  245  ? 35.523  7.841   26.925  1.00 115.75 ? 245  PRO A O     1 
ATOM   2779  C  CB    . PRO D 4  245  ? 37.204  6.678   24.513  1.00 123.74 ? 245  PRO A CB    1 
ATOM   2780  C  CG    . PRO D 4  245  ? 37.792  6.876   23.196  1.00 124.59 ? 245  PRO A CG    1 
ATOM   2781  C  CD    . PRO D 4  245  ? 38.581  8.158   23.306  1.00 129.56 ? 245  PRO A CD    1 
ATOM   2782  N  N     . VAL D 4  246  ? 37.595  8.680   27.174  1.00 114.10 ? 246  VAL A N     1 
ATOM   2783  C  CA    . VAL D 4  246  ? 37.384  8.928   28.597  1.00 113.41 ? 246  VAL A CA    1 
ATOM   2784  C  C     . VAL D 4  246  ? 36.563  10.199  28.809  1.00 123.79 ? 246  VAL A C     1 
ATOM   2785  O  O     . VAL D 4  246  ? 35.796  10.292  29.774  1.00 125.73 ? 246  VAL A O     1 
ATOM   2786  C  CB    . VAL D 4  246  ? 38.740  8.985   29.325  1.00 107.33 ? 246  VAL A CB    1 
ATOM   2787  C  CG1   . VAL D 4  246  ? 38.558  8.944   30.842  1.00 93.29  ? 246  VAL A CG1   1 
ATOM   2788  C  CG2   . VAL D 4  246  ? 39.628  7.833   28.865  1.00 110.70 ? 246  VAL A CG2   1 
ATOM   2789  N  N     . ARG D 4  247  ? 36.671  11.175  27.902  1.00 132.38 ? 247  ARG A N     1 
ATOM   2790  C  CA    . ARG D 4  247  ? 36.018  12.479  28.060  1.00 137.21 ? 247  ARG A CA    1 
ATOM   2791  C  C     . ARG D 4  247  ? 35.409  12.929  26.731  1.00 140.27 ? 247  ARG A C     1 
ATOM   2792  O  O     . ARG D 4  247  ? 35.835  13.926  26.141  1.00 138.07 ? 247  ARG A O     1 
ATOM   2793  C  CB    . ARG D 4  247  ? 37.027  13.506  28.572  1.00 137.38 ? 247  ARG A CB    1 
ATOM   2794  C  CG    . ARG D 4  247  ? 38.413  13.288  27.978  1.00 138.55 ? 247  ARG A CG    1 
ATOM   2795  C  CD    . ARG D 4  247  ? 39.409  14.356  28.368  1.00 143.38 ? 247  ARG A CD    1 
ATOM   2796  N  NE    . ARG D 4  247  ? 40.688  14.128  27.703  1.00 148.45 ? 247  ARG A NE    1 
ATOM   2797  C  CZ    . ARG D 4  247  ? 40.972  14.554  26.475  1.00 152.08 ? 247  ARG A CZ    1 
ATOM   2798  N  NH1   . ARG D 4  247  ? 40.070  15.236  25.781  1.00 153.11 ? 247  ARG A NH1   1 
ATOM   2799  N  NH2   . ARG D 4  247  ? 42.158  14.301  25.939  1.00 159.06 ? 247  ARG A NH2   1 
ATOM   2800  N  N     . PRO D 4  248  ? 34.384  12.228  26.244  1.00 134.70 ? 248  PRO A N     1 
ATOM   2801  C  CA    . PRO D 4  248  ? 33.884  12.493  24.892  1.00 130.71 ? 248  PRO A CA    1 
ATOM   2802  C  C     . PRO D 4  248  ? 33.040  13.759  24.810  1.00 139.47 ? 248  PRO A C     1 
ATOM   2803  O  O     . PRO D 4  248  ? 32.610  14.330  25.813  1.00 147.06 ? 248  PRO A O     1 
ATOM   2804  C  CB    . PRO D 4  248  ? 33.041  11.251  24.590  1.00 116.47 ? 248  PRO A CB    1 
ATOM   2805  C  CG    . PRO D 4  248  ? 32.471  10.896  25.916  1.00 115.32 ? 248  PRO A CG    1 
ATOM   2806  C  CD    . PRO D 4  248  ? 33.533  11.246  26.947  1.00 124.35 ? 248  PRO A CD    1 
ATOM   2807  N  N     . SER D 4  249  ? 32.814  14.193  23.573  1.00 135.33 ? 249  SER A N     1 
ATOM   2808  C  CA    . SER D 4  249  ? 32.025  15.392  23.303  1.00 121.76 ? 249  SER A CA    1 
ATOM   2809  C  C     . SER D 4  249  ? 30.546  15.064  23.086  1.00 114.50 ? 249  SER A C     1 
ATOM   2810  O  O     . SER D 4  249  ? 29.802  14.817  24.038  1.00 99.97  ? 249  SER A O     1 
ATOM   2811  C  CB    . SER D 4  249  ? 32.594  16.128  22.088  1.00 108.09 ? 249  SER A CB    1 
ATOM   2812  O  OG    . SER D 4  249  ? 33.018  15.214  21.091  1.00 103.82 ? 249  SER A OG    1 
ATOM   2813  N  N     . ARG D 4  257  ? 29.208  20.929  19.551  1.00 137.92 ? 257  ARG A N     1 
ATOM   2814  C  CA    . ARG D 4  257  ? 28.002  20.480  20.237  1.00 143.94 ? 257  ARG A CA    1 
ATOM   2815  C  C     . ARG D 4  257  ? 28.199  20.471  21.751  1.00 162.74 ? 257  ARG A C     1 
ATOM   2816  O  O     . ARG D 4  257  ? 27.262  20.727  22.508  1.00 162.96 ? 257  ARG A O     1 
ATOM   2817  C  CB    . ARG D 4  257  ? 27.594  19.088  19.750  1.00 125.80 ? 257  ARG A CB    1 
ATOM   2818  N  N     . GLY D 4  258  ? 29.416  20.167  22.186  1.00 176.97 ? 258  GLY A N     1 
ATOM   2819  C  CA    . GLY D 4  258  ? 29.726  20.166  23.606  1.00 184.45 ? 258  GLY A CA    1 
ATOM   2820  C  C     . GLY D 4  258  ? 31.132  19.658  23.841  1.00 192.53 ? 258  GLY A C     1 
ATOM   2821  O  O     . GLY D 4  258  ? 31.810  19.182  22.924  1.00 195.94 ? 258  GLY A O     1 
ATOM   2822  N  N     . GLU D 4  259  ? 31.563  19.773  25.098  1.00 180.98 ? 259  GLU A N     1 
ATOM   2823  C  CA    . GLU D 4  259  ? 32.858  19.273  25.537  1.00 161.92 ? 259  GLU A CA    1 
ATOM   2824  C  C     . GLU D 4  259  ? 32.734  18.757  26.963  1.00 155.11 ? 259  GLU A C     1 
ATOM   2825  O  O     . GLU D 4  259  ? 31.906  19.236  27.742  1.00 147.12 ? 259  GLU A O     1 
ATOM   2826  C  CB    . GLU D 4  259  ? 33.951  20.352  25.461  1.00 151.07 ? 259  GLU A CB    1 
ATOM   2827  C  CG    . GLU D 4  259  ? 34.694  20.408  24.130  1.00 150.82 ? 259  GLU A CG    1 
ATOM   2828  C  CD    . GLU D 4  259  ? 35.656  19.247  23.929  1.00 147.65 ? 259  GLU A CD    1 
ATOM   2829  O  OE1   . GLU D 4  259  ? 35.982  18.552  24.912  1.00 146.00 ? 259  GLU A OE1   1 
ATOM   2830  O  OE2   . GLU D 4  259  ? 36.086  19.026  22.777  1.00 147.34 ? 259  GLU A OE2   1 
ATOM   2831  N  N     . ASP D 4  260  ? 33.566  17.773  27.298  1.00 160.29 ? 260  ASP A N     1 
ATOM   2832  C  CA    . ASP D 4  260  ? 33.506  17.158  28.615  1.00 161.28 ? 260  ASP A CA    1 
ATOM   2833  C  C     . ASP D 4  260  ? 34.199  18.035  29.657  1.00 162.26 ? 260  ASP A C     1 
ATOM   2834  O  O     . ASP D 4  260  ? 35.080  18.842  29.344  1.00 167.16 ? 260  ASP A O     1 
ATOM   2835  C  CB    . ASP D 4  260  ? 34.138  15.765  28.585  1.00 154.77 ? 260  ASP A CB    1 
ATOM   2836  C  CG    . ASP D 4  260  ? 33.535  14.828  29.620  1.00 144.89 ? 260  ASP A CG    1 
ATOM   2837  O  OD1   . ASP D 4  260  ? 32.597  14.075  29.279  1.00 136.59 ? 260  ASP A OD1   1 
ATOM   2838  O  OD2   . ASP D 4  260  ? 34.002  14.845  30.777  1.00 141.77 ? 260  ASP A OD2   1 
ATOM   2839  N  N     . ASP D 4  261  ? 33.778  17.866  30.918  1.00 150.93 ? 261  ASP A N     1 
ATOM   2840  C  CA    . ASP D 4  261  ? 34.309  18.687  32.005  1.00 123.97 ? 261  ASP A CA    1 
ATOM   2841  C  C     . ASP D 4  261  ? 35.755  18.336  32.330  1.00 98.47  ? 261  ASP A C     1 
ATOM   2842  O  O     . ASP D 4  261  ? 36.528  19.215  32.736  1.00 110.88 ? 261  ASP A O     1 
ATOM   2843  C  CB    . ASP D 4  261  ? 33.438  18.547  33.255  1.00 112.68 ? 261  ASP A CB    1 
ATOM   2844  C  CG    . ASP D 4  261  ? 31.995  18.970  33.018  1.00 114.98 ? 261  ASP A CG    1 
ATOM   2845  O  OD1   . ASP D 4  261  ? 31.592  19.119  31.843  1.00 113.33 ? 261  ASP A OD1   1 
ATOM   2846  O  OD2   . ASP D 4  261  ? 31.266  19.175  34.013  1.00 111.44 ? 261  ASP A OD2   1 
ATOM   2847  N  N     . LEU D 4  262  ? 36.139  17.065  32.163  1.00 82.17  ? 262  LEU A N     1 
ATOM   2848  C  CA    . LEU D 4  262  ? 37.538  16.686  32.338  1.00 101.15 ? 262  LEU A CA    1 
ATOM   2849  C  C     . LEU D 4  262  ? 38.431  17.335  31.289  1.00 102.80 ? 262  LEU A C     1 
ATOM   2850  O  O     . LEU D 4  262  ? 39.578  17.691  31.592  1.00 100.46 ? 262  LEU A O     1 
ATOM   2851  C  CB    . LEU D 4  262  ? 37.694  15.165  32.288  1.00 105.55 ? 262  LEU A CB    1 
ATOM   2852  C  CG    . LEU D 4  262  ? 37.088  14.342  33.425  1.00 107.36 ? 262  LEU A CG    1 
ATOM   2853  C  CD1   . LEU D 4  262  ? 37.621  12.920  33.360  1.00 112.57 ? 262  LEU A CD1   1 
ATOM   2854  C  CD2   . LEU D 4  262  ? 37.394  14.971  34.784  1.00 97.93  ? 262  LEU A CD2   1 
ATOM   2855  N  N     . THR D 4  263  ? 37.918  17.506  30.068  1.00 117.27 ? 263  THR A N     1 
ATOM   2856  C  CA    . THR D 4  263  ? 38.664  18.203  29.024  1.00 133.51 ? 263  THR A CA    1 
ATOM   2857  C  C     . THR D 4  263  ? 38.926  19.656  29.409  1.00 136.72 ? 263  THR A C     1 
ATOM   2858  O  O     . THR D 4  263  ? 40.038  20.163  29.224  1.00 136.92 ? 263  THR A O     1 
ATOM   2859  C  CB    . THR D 4  263  ? 37.901  18.133  27.698  1.00 147.34 ? 263  THR A CB    1 
ATOM   2860  O  OG1   . THR D 4  263  ? 37.384  16.809  27.501  1.00 145.04 ? 263  THR A OG1   1 
ATOM   2861  C  CG2   . THR D 4  263  ? 38.809  18.490  26.540  1.00 154.63 ? 263  THR A CG2   1 
ATOM   2862  N  N     . PHE D 4  264  ? 37.919  20.331  29.977  1.00 135.70 ? 264  PHE A N     1 
ATOM   2863  C  CA    . PHE D 4  264  ? 38.093  21.715  30.416  1.00 134.50 ? 264  PHE A CA    1 
ATOM   2864  C  C     . PHE D 4  264  ? 39.031  21.810  31.613  1.00 134.37 ? 264  PHE A C     1 
ATOM   2865  O  O     . PHE D 4  264  ? 39.820  22.759  31.715  1.00 135.14 ? 264  PHE A O     1 
ATOM   2866  C  CB    . PHE D 4  264  ? 36.735  22.332  30.753  1.00 132.08 ? 264  PHE A CB    1 
ATOM   2867  C  CG    . PHE D 4  264  ? 35.995  22.860  29.559  1.00 137.45 ? 264  PHE A CG    1 
ATOM   2868  C  CD1   . PHE D 4  264  ? 34.610  22.907  29.548  1.00 141.30 ? 264  PHE A CD1   1 
ATOM   2869  C  CD2   . PHE D 4  264  ? 36.687  23.322  28.450  1.00 137.03 ? 264  PHE A CD2   1 
ATOM   2870  C  CE1   . PHE D 4  264  ? 33.927  23.395  28.449  1.00 143.01 ? 264  PHE A CE1   1 
ATOM   2871  C  CE2   . PHE D 4  264  ? 36.012  23.811  27.351  1.00 142.89 ? 264  PHE A CE2   1 
ATOM   2872  C  CZ    . PHE D 4  264  ? 34.630  23.847  27.350  1.00 147.21 ? 264  PHE A CZ    1 
ATOM   2873  N  N     . LYS D 4  265  ? 38.975  20.833  32.525  1.00 132.96 ? 265  LYS A N     1 
ATOM   2874  C  CA    . LYS D 4  265  ? 39.858  20.884  33.688  1.00 130.72 ? 265  LYS A CA    1 
ATOM   2875  C  C     . LYS D 4  265  ? 41.312  20.638  33.292  1.00 130.56 ? 265  LYS A C     1 
ATOM   2876  O  O     . LYS D 4  265  ? 42.216  21.339  33.766  1.00 143.07 ? 265  LYS A O     1 
ATOM   2877  C  CB    . LYS D 4  265  ? 39.397  19.887  34.756  1.00 129.82 ? 265  LYS A CB    1 
ATOM   2878  C  CG    . LYS D 4  265  ? 40.152  19.993  36.088  1.00 138.88 ? 265  LYS A CG    1 
ATOM   2879  C  CD    . LYS D 4  265  ? 40.323  21.451  36.542  1.00 141.35 ? 265  LYS A CD    1 
ATOM   2880  C  CE    . LYS D 4  265  ? 39.029  22.057  37.079  1.00 134.04 ? 265  LYS A CE    1 
ATOM   2881  N  NZ    . LYS D 4  265  ? 39.158  23.527  37.305  1.00 127.79 ? 265  LYS A NZ    1 
ATOM   2882  N  N     . LEU D 4  266  ? 41.565  19.683  32.394  1.00 120.56 ? 266  LEU A N     1 
ATOM   2883  C  CA    . LEU D 4  266  ? 42.936  19.515  31.923  1.00 129.48 ? 266  LEU A CA    1 
ATOM   2884  C  C     . LEU D 4  266  ? 43.359  20.614  30.947  1.00 136.31 ? 266  LEU A C     1 
ATOM   2885  O  O     . LEU D 4  266  ? 44.561  20.842  30.777  1.00 142.26 ? 266  LEU A O     1 
ATOM   2886  C  CB    . LEU D 4  266  ? 43.135  18.122  31.310  1.00 124.10 ? 266  LEU A CB    1 
ATOM   2887  C  CG    . LEU D 4  266  ? 42.496  17.668  30.001  1.00 116.85 ? 266  LEU A CG    1 
ATOM   2888  C  CD1   . LEU D 4  266  ? 43.468  17.823  28.848  1.00 125.69 ? 266  LEU A CD1   1 
ATOM   2889  C  CD2   . LEU D 4  266  ? 42.068  16.215  30.133  1.00 100.88 ? 266  LEU A CD2   1 
ATOM   2890  N  N     . ALA D 4  267  ? 42.408  21.333  30.344  1.00 127.48 ? 267  ALA A N     1 
ATOM   2891  C  CA    . ALA D 4  267  ? 42.754  22.552  29.620  1.00 127.61 ? 267  ALA A CA    1 
ATOM   2892  C  C     . ALA D 4  267  ? 43.230  23.642  30.576  1.00 136.58 ? 267  ALA A C     1 
ATOM   2893  O  O     . ALA D 4  267  ? 44.183  24.372  30.271  1.00 146.84 ? 267  ALA A O     1 
ATOM   2894  C  CB    . ALA D 4  267  ? 41.554  23.032  28.805  1.00 124.32 ? 267  ALA A CB    1 
ATOM   2895  N  N     . ASP D 4  268  ? 42.570  23.770  31.735  1.00 127.72 ? 268  ASP A N     1 
ATOM   2896  C  CA    . ASP D 4  268  ? 43.064  24.654  32.793  1.00 126.91 ? 268  ASP A CA    1 
ATOM   2897  C  C     . ASP D 4  268  ? 44.446  24.221  33.278  1.00 135.38 ? 268  ASP A C     1 
ATOM   2898  O  O     . ASP D 4  268  ? 45.300  25.065  33.586  1.00 133.32 ? 268  ASP A O     1 
ATOM   2899  C  CB    . ASP D 4  268  ? 42.081  24.679  33.968  1.00 117.84 ? 268  ASP A CB    1 
ATOM   2900  C  CG    . ASP D 4  268  ? 40.691  25.145  33.570  1.00 124.71 ? 268  ASP A CG    1 
ATOM   2901  O  OD1   . ASP D 4  268  ? 40.494  25.523  32.396  1.00 131.63 ? 268  ASP A OD1   1 
ATOM   2902  O  OD2   . ASP D 4  268  ? 39.789  25.124  34.436  1.00 124.55 ? 268  ASP A OD2   1 
ATOM   2903  N  N     . ILE D 4  269  ? 44.667  22.904  33.366  1.00 143.46 ? 269  ILE A N     1 
ATOM   2904  C  CA    . ILE D 4  269  ? 45.978  22.362  33.732  1.00 147.76 ? 269  ILE A CA    1 
ATOM   2905  C  C     . ILE D 4  269  ? 47.040  22.786  32.718  1.00 149.61 ? 269  ILE A C     1 
ATOM   2906  O  O     . ILE D 4  269  ? 48.126  23.247  33.089  1.00 150.93 ? 269  ILE A O     1 
ATOM   2907  C  CB    . ILE D 4  269  ? 45.903  20.827  33.854  1.00 152.43 ? 269  ILE A CB    1 
ATOM   2908  C  CG1   . ILE D 4  269  ? 45.078  20.414  35.075  1.00 156.66 ? 269  ILE A CG1   1 
ATOM   2909  C  CG2   . ILE D 4  269  ? 47.298  20.209  33.927  1.00 151.49 ? 269  ILE A CG2   1 
ATOM   2910  C  CD1   . ILE D 4  269  ? 44.870  18.918  35.201  1.00 159.19 ? 269  ILE A CD1   1 
ATOM   2911  N  N     . LEU D 4  270  ? 46.739  22.625  31.424  1.00 147.42 ? 270  LEU A N     1 
ATOM   2912  C  CA    . LEU D 4  270  ? 47.666  23.037  30.368  1.00 154.88 ? 270  LEU A CA    1 
ATOM   2913  C  C     . LEU D 4  270  ? 47.920  24.540  30.385  1.00 166.31 ? 270  LEU A C     1 
ATOM   2914  O  O     . LEU D 4  270  ? 49.045  24.988  30.126  1.00 162.54 ? 270  LEU A O     1 
ATOM   2915  C  CB    . LEU D 4  270  ? 47.142  22.602  28.998  1.00 145.17 ? 270  LEU A CB    1 
ATOM   2916  C  CG    . LEU D 4  270  ? 48.018  21.606  28.234  1.00 140.36 ? 270  LEU A CG    1 
ATOM   2917  C  CD1   . LEU D 4  270  ? 47.500  21.363  26.828  1.00 133.33 ? 270  LEU A CD1   1 
ATOM   2918  C  CD2   . LEU D 4  270  ? 49.438  22.160  28.167  1.00 138.68 ? 270  LEU A CD2   1 
ATOM   2919  N  N     . LYS D 4  271  ? 46.894  25.336  30.700  1.00 175.75 ? 271  LYS A N     1 
ATOM   2920  C  CA    . LYS D 4  271  ? 47.084  26.786  30.736  1.00 173.93 ? 271  LYS A CA    1 
ATOM   2921  C  C     . LYS D 4  271  ? 47.950  27.205  31.921  1.00 166.42 ? 271  LYS A C     1 
ATOM   2922  O  O     . LYS D 4  271  ? 48.827  28.063  31.775  1.00 171.03 ? 271  LYS A O     1 
ATOM   2923  C  CB    . LYS D 4  271  ? 45.733  27.501  30.759  1.00 168.04 ? 271  LYS A CB    1 
ATOM   2924  C  CG    . LYS D 4  271  ? 45.847  28.997  30.499  1.00 164.18 ? 271  LYS A CG    1 
ATOM   2925  C  CD    . LYS D 4  271  ? 46.654  29.254  29.231  1.00 159.71 ? 271  LYS A CD    1 
ATOM   2926  C  CE    . LYS D 4  271  ? 46.897  30.735  28.989  1.00 152.94 ? 271  LYS A CE    1 
ATOM   2927  N  NZ    . LYS D 4  271  ? 47.703  30.959  27.755  1.00 151.48 ? 271  LYS A NZ    1 
ATOM   2928  N  N     . ALA D 4  272  ? 47.743  26.590  33.093  1.00 151.80 ? 272  ALA A N     1 
ATOM   2929  C  CA    . ALA D 4  272  ? 48.614  26.869  34.235  1.00 142.71 ? 272  ALA A CA    1 
ATOM   2930  C  C     . ALA D 4  272  ? 50.037  26.365  34.000  1.00 145.35 ? 272  ALA A C     1 
ATOM   2931  O  O     . ALA D 4  272  ? 51.003  27.006  34.438  1.00 149.46 ? 272  ALA A O     1 
ATOM   2932  C  CB    . ALA D 4  272  ? 48.031  26.251  35.506  1.00 135.08 ? 272  ALA A CB    1 
ATOM   2933  N  N     . ASN D 4  273  ? 50.185  25.246  33.282  1.00 148.08 ? 273  ASN A N     1 
ATOM   2934  C  CA    . ASN D 4  273  ? 51.510  24.719  32.969  1.00 157.25 ? 273  ASN A CA    1 
ATOM   2935  C  C     . ASN D 4  273  ? 52.266  25.648  32.025  1.00 172.32 ? 273  ASN A C     1 
ATOM   2936  O  O     . ASN D 4  273  ? 53.441  25.958  32.256  1.00 175.88 ? 273  ASN A O     1 
ATOM   2937  C  CB    . ASN D 4  273  ? 51.388  23.318  32.363  1.00 149.74 ? 273  ASN A CB    1 
ATOM   2938  C  CG    . ASN D 4  273  ? 52.662  22.866  31.664  1.00 153.00 ? 273  ASN A CG    1 
ATOM   2939  O  OD1   . ASN D 4  273  ? 53.632  22.466  32.310  1.00 157.58 ? 273  ASN A OD1   1 
ATOM   2940  N  ND2   . ASN D 4  273  ? 52.664  22.931  30.336  1.00 151.88 ? 273  ASN A ND2   1 
ATOM   2941  N  N     . ILE D 4  274  ? 51.607  26.108  30.955  1.00 175.91 ? 274  ILE A N     1 
ATOM   2942  C  CA    . ILE D 4  274  ? 52.270  27.024  30.032  1.00 167.71 ? 274  ILE A CA    1 
ATOM   2943  C  C     . ILE D 4  274  ? 52.463  28.402  30.668  1.00 173.53 ? 274  ILE A C     1 
ATOM   2944  O  O     . ILE D 4  274  ? 53.408  29.113  30.307  1.00 177.78 ? 274  ILE A O     1 
ATOM   2945  C  CB    . ILE D 4  274  ? 51.510  27.094  28.685  1.00 148.61 ? 274  ILE A CB    1 
ATOM   2946  C  CG1   . ILE D 4  274  ? 52.429  27.607  27.570  1.00 139.99 ? 274  ILE A CG1   1 
ATOM   2947  C  CG2   . ILE D 4  274  ? 50.246  27.948  28.776  1.00 140.01 ? 274  ILE A CG2   1 
ATOM   2948  C  CD1   . ILE D 4  274  ? 53.629  26.713  27.299  1.00 136.08 ? 274  ILE A CD1   1 
ATOM   2949  N  N     . SER D 4  275  ? 51.636  28.769  31.658  1.00 169.37 ? 275  SER A N     1 
ATOM   2950  C  CA    . SER D 4  275  ? 51.877  29.987  32.431  1.00 159.17 ? 275  SER A CA    1 
ATOM   2951  C  C     . SER D 4  275  ? 53.143  29.873  33.274  1.00 163.73 ? 275  SER A C     1 
ATOM   2952  O  O     . SER D 4  275  ? 53.928  30.825  33.356  1.00 166.96 ? 275  SER A O     1 
ATOM   2953  C  CB    . SER D 4  275  ? 50.668  30.290  33.322  1.00 140.32 ? 275  SER A CB    1 
ATOM   2954  O  OG    . SER D 4  275  ? 50.980  31.259  34.310  1.00 132.01 ? 275  SER A OG    1 
ATOM   2955  N  N     . LEU D 4  276  ? 53.358  28.716  33.909  1.00 163.18 ? 276  LEU A N     1 
ATOM   2956  C  CA    . LEU D 4  276  ? 54.587  28.515  34.677  1.00 168.33 ? 276  LEU A CA    1 
ATOM   2957  C  C     . LEU D 4  276  ? 55.812  28.424  33.768  1.00 177.58 ? 276  LEU A C     1 
ATOM   2958  O  O     . LEU D 4  276  ? 56.900  28.890  34.134  1.00 172.81 ? 276  LEU A O     1 
ATOM   2959  C  CB    . LEU D 4  276  ? 54.462  27.264  35.546  1.00 163.62 ? 276  LEU A CB    1 
ATOM   2960  C  CG    . LEU D 4  276  ? 55.022  27.396  36.965  1.00 163.12 ? 276  LEU A CG    1 
ATOM   2961  C  CD1   . LEU D 4  276  ? 54.255  28.449  37.744  1.00 155.19 ? 276  LEU A CD1   1 
ATOM   2962  C  CD2   . LEU D 4  276  ? 54.994  26.058  37.693  1.00 165.45 ? 276  LEU A CD2   1 
ATOM   2963  N  N     . GLU D 4  277  ? 55.654  27.827  32.580  1.00 187.31 ? 277  GLU A N     1 
ATOM   2964  C  CA    . GLU D 4  277  ? 56.746  27.786  31.607  1.00 188.52 ? 277  GLU A CA    1 
ATOM   2965  C  C     . GLU D 4  277  ? 57.095  29.185  31.104  1.00 198.57 ? 277  GLU A C     1 
ATOM   2966  O  O     . GLU D 4  277  ? 58.271  29.494  30.875  1.00 200.10 ? 277  GLU A O     1 
ATOM   2967  C  CB    . GLU D 4  277  ? 56.375  26.881  30.429  1.00 174.12 ? 277  GLU A CB    1 
ATOM   2968  C  CG    . GLU D 4  277  ? 56.250  25.402  30.763  1.00 162.88 ? 277  GLU A CG    1 
ATOM   2969  C  CD    . GLU D 4  277  ? 55.757  24.585  29.583  1.00 151.66 ? 277  GLU A CD    1 
ATOM   2970  O  OE1   . GLU D 4  277  ? 56.581  24.229  28.715  1.00 148.19 ? 277  GLU A OE1   1 
ATOM   2971  O  OE2   . GLU D 4  277  ? 54.540  24.309  29.516  1.00 145.41 ? 277  GLU A OE2   1 
ATOM   2972  N  N     . THR D 4  278  ? 56.082  30.037  30.912  1.00 206.99 ? 278  THR A N     1 
ATOM   2973  C  CA    . THR D 4  278  ? 56.321  31.430  30.546  1.00 209.59 ? 278  THR A CA    1 
ATOM   2974  C  C     . THR D 4  278  ? 56.990  32.189  31.688  1.00 208.74 ? 278  THR A C     1 
ATOM   2975  O  O     . THR D 4  278  ? 57.901  32.994  31.458  1.00 212.64 ? 278  THR A O     1 
ATOM   2976  C  CB    . THR D 4  278  ? 54.995  32.097  30.156  1.00 210.68 ? 278  THR A CB    1 
ATOM   2977  O  OG1   . THR D 4  278  ? 54.441  31.437  29.010  1.00 211.62 ? 278  THR A OG1   1 
ATOM   2978  C  CG2   . THR D 4  278  ? 55.188  33.573  29.826  1.00 213.92 ? 278  THR A CG2   1 
ATOM   2979  N  N     . LEU D 4  279  ? 56.562  31.926  32.926  1.00 200.97 ? 279  LEU A N     1 
ATOM   2980  C  CA    . LEU D 4  279  ? 57.114  32.622  34.085  1.00 193.89 ? 279  LEU A CA    1 
ATOM   2981  C  C     . LEU D 4  279  ? 58.574  32.251  34.326  1.00 192.72 ? 279  LEU A C     1 
ATOM   2982  O  O     . LEU D 4  279  ? 59.368  33.096  34.757  1.00 193.88 ? 279  LEU A O     1 
ATOM   2983  C  CB    . LEU D 4  279  ? 56.273  32.316  35.323  1.00 181.97 ? 279  LEU A CB    1 
ATOM   2984  C  CG    . LEU D 4  279  ? 55.365  33.441  35.820  1.00 169.75 ? 279  LEU A CG    1 
ATOM   2985  C  CD1   . LEU D 4  279  ? 56.199  34.630  36.284  1.00 168.59 ? 279  LEU A CD1   1 
ATOM   2986  C  CD2   . LEU D 4  279  ? 54.372  33.855  34.743  1.00 160.65 ? 279  LEU A CD2   1 
ATOM   2987  N  N     . GLU D 4  280  ? 58.947  30.993  34.067  1.00 185.87 ? 280  GLU A N     1 
ATOM   2988  C  CA    . GLU D 4  280  ? 60.357  30.620  34.144  1.00 180.83 ? 280  GLU A CA    1 
ATOM   2989  C  C     . GLU D 4  280  ? 61.169  31.250  33.019  1.00 179.72 ? 280  GLU A C     1 
ATOM   2990  O  O     . GLU D 4  280  ? 62.348  31.574  33.214  1.00 175.12 ? 280  GLU A O     1 
ATOM   2991  C  CB    . GLU D 4  280  ? 60.514  29.100  34.116  1.00 179.61 ? 280  GLU A CB    1 
ATOM   2992  C  CG    . GLU D 4  280  ? 60.415  28.438  35.481  1.00 180.81 ? 280  GLU A CG    1 
ATOM   2993  C  CD    . GLU D 4  280  ? 60.852  26.986  35.458  1.00 180.86 ? 280  GLU A CD    1 
ATOM   2994  O  OE1   . GLU D 4  280  ? 61.015  26.430  34.351  1.00 181.70 ? 280  GLU A OE1   1 
ATOM   2995  O  OE2   . GLU D 4  280  ? 61.038  26.402  36.547  1.00 180.31 ? 280  GLU A OE2   1 
ATOM   2996  N  N     . HIS D 4  281  ? 60.566  31.425  31.841  1.00 186.01 ? 281  HIS A N     1 
ATOM   2997  C  CA    . HIS D 4  281  ? 61.246  32.065  30.721  1.00 193.07 ? 281  HIS A CA    1 
ATOM   2998  C  C     . HIS D 4  281  ? 61.179  33.589  30.782  1.00 203.73 ? 281  HIS A C     1 
ATOM   2999  O  O     . HIS D 4  281  ? 61.848  34.252  29.983  1.00 206.85 ? 281  HIS A O     1 
ATOM   3000  C  CB    . HIS D 4  281  ? 60.661  31.566  29.393  1.00 183.50 ? 281  HIS A CB    1 
ATOM   3001  C  CG    . HIS D 4  281  ? 61.689  31.347  28.324  1.00 178.42 ? 281  HIS A CG    1 
ATOM   3002  N  ND1   . HIS D 4  281  ? 61.898  32.239  27.292  1.00 177.79 ? 281  HIS A ND1   1 
ATOM   3003  C  CD2   . HIS D 4  281  ? 62.572  30.338  28.131  1.00 176.68 ? 281  HIS A CD2   1 
ATOM   3004  C  CE1   . HIS D 4  281  ? 62.863  31.787  26.510  1.00 177.41 ? 281  HIS A CE1   1 
ATOM   3005  N  NE2   . HIS D 4  281  ? 63.289  30.636  26.998  1.00 177.75 ? 281  HIS A NE2   1 
ATOM   3006  N  N     . ASN D 4  282  ? 60.395  34.154  31.699  1.00 205.95 ? 282  ASN A N     1 
ATOM   3007  C  CA    . ASN D 4  282  ? 60.343  35.594  31.909  1.00 203.19 ? 282  ASN A CA    1 
ATOM   3008  C  C     . ASN D 4  282  ? 61.343  35.966  33.010  1.00 207.97 ? 282  ASN A C     1 
ATOM   3009  O  O     . ASN D 4  282  ? 62.172  35.149  33.420  1.00 212.67 ? 282  ASN A O     1 
ATOM   3010  C  CB    . ASN D 4  282  ? 58.908  36.018  32.235  1.00 192.46 ? 282  ASN A CB    1 
ATOM   3011  C  CG    . ASN D 4  282  ? 58.634  37.480  31.915  1.00 183.17 ? 282  ASN A CG    1 
ATOM   3012  O  OD1   . ASN D 4  282  ? 58.857  38.361  32.745  1.00 177.72 ? 282  ASN A OD1   1 
ATOM   3013  N  ND2   . ASN D 4  282  ? 58.152  37.741  30.706  1.00 180.52 ? 282  ASN A ND2   1 
ATOM   3014  N  N     . GLY D 4  283  ? 61.275  37.204  33.505  1.00 203.49 ? 283  GLY A N     1 
ATOM   3015  C  CA    . GLY D 4  283  ? 62.135  37.653  34.591  1.00 200.91 ? 283  GLY A CA    1 
ATOM   3016  C  C     . GLY D 4  283  ? 61.884  36.972  35.923  1.00 198.64 ? 283  GLY A C     1 
ATOM   3017  O  O     . GLY D 4  283  ? 62.720  37.095  36.826  1.00 202.66 ? 283  GLY A O     1 
ATOM   3018  N  N     . ALA D 4  284  ? 60.748  36.273  36.063  1.00 189.99 ? 284  ALA A N     1 
ATOM   3019  C  CA    . ALA D 4  284  ? 60.376  35.413  37.185  1.00 184.98 ? 284  ALA A CA    1 
ATOM   3020  C  C     . ALA D 4  284  ? 60.354  36.127  38.536  1.00 182.85 ? 284  ALA A C     1 
ATOM   3021  O  O     . ALA D 4  284  ? 61.263  35.917  39.351  1.00 178.71 ? 284  ALA A O     1 
ATOM   3022  C  CB    . ALA D 4  284  ? 61.315  34.204  37.254  1.00 180.10 ? 284  ALA A CB    1 
ATOM   3023  N  N     . PRO D 4  285  ? 59.352  36.995  38.813  1.00 183.27 ? 285  PRO A N     1 
ATOM   3024  C  CA    . PRO D 4  285  ? 59.156  37.461  40.196  1.00 187.21 ? 285  PRO A CA    1 
ATOM   3025  C  C     . PRO D 4  285  ? 58.729  36.310  41.096  1.00 196.37 ? 285  PRO A C     1 
ATOM   3026  O  O     . PRO D 4  285  ? 57.646  35.747  40.906  1.00 195.48 ? 285  PRO A O     1 
ATOM   3027  C  CB    . PRO D 4  285  ? 58.050  38.520  40.066  1.00 179.54 ? 285  PRO A CB    1 
ATOM   3028  C  CG    . PRO D 4  285  ? 58.029  38.890  38.612  1.00 176.68 ? 285  PRO A CG    1 
ATOM   3029  C  CD    . PRO D 4  285  ? 58.401  37.635  37.887  1.00 176.65 ? 285  PRO A CD    1 
ATOM   3030  N  N     . HIS D 4  286  ? 59.567  35.954  42.077  1.00 201.01 ? 286  HIS A N     1 
ATOM   3031  C  CA    . HIS D 4  286  ? 59.396  34.684  42.780  1.00 195.83 ? 286  HIS A CA    1 
ATOM   3032  C  C     . HIS D 4  286  ? 58.245  34.696  43.782  1.00 203.67 ? 286  HIS A C     1 
ATOM   3033  O  O     . HIS D 4  286  ? 57.775  33.620  44.168  1.00 204.45 ? 286  HIS A O     1 
ATOM   3034  C  CB    . HIS D 4  286  ? 60.697  34.284  43.485  1.00 179.69 ? 286  HIS A CB    1 
ATOM   3035  C  CG    . HIS D 4  286  ? 61.018  32.825  43.362  1.00 166.65 ? 286  HIS A CG    1 
ATOM   3036  N  ND1   . HIS D 4  286  ? 61.715  32.303  42.292  1.00 163.28 ? 286  HIS A ND1   1 
ATOM   3037  C  CD2   . HIS D 4  286  ? 60.713  31.775  44.161  1.00 162.95 ? 286  HIS A CD2   1 
ATOM   3038  C  CE1   . HIS D 4  286  ? 61.837  30.996  42.446  1.00 162.04 ? 286  HIS A CE1   1 
ATOM   3039  N  NE2   . HIS D 4  286  ? 61.236  30.650  43.571  1.00 162.27 ? 286  HIS A NE2   1 
ATOM   3040  N  N     . HIS D 4  287  ? 57.784  35.873  44.217  1.00 207.65 ? 287  HIS A N     1 
ATOM   3041  C  CA    . HIS D 4  287  ? 56.601  35.925  45.074  1.00 201.57 ? 287  HIS A CA    1 
ATOM   3042  C  C     . HIS D 4  287  ? 55.337  35.542  44.309  1.00 188.05 ? 287  HIS A C     1 
ATOM   3043  O  O     . HIS D 4  287  ? 54.380  35.034  44.908  1.00 182.12 ? 287  HIS A O     1 
ATOM   3044  C  CB    . HIS D 4  287  ? 56.452  37.316  45.695  1.00 205.22 ? 287  HIS A CB    1 
ATOM   3045  C  CG    . HIS D 4  287  ? 56.983  37.419  47.095  1.00 201.94 ? 287  HIS A CG    1 
ATOM   3046  N  ND1   . HIS D 4  287  ? 56.753  36.452  48.051  1.00 198.39 ? 287  HIS A ND1   1 
ATOM   3047  C  CD2   . HIS D 4  287  ? 57.714  38.383  47.704  1.00 200.48 ? 287  HIS A CD2   1 
ATOM   3048  C  CE1   . HIS D 4  287  ? 57.328  36.810  49.185  1.00 198.12 ? 287  HIS A CE1   1 
ATOM   3049  N  NE2   . HIS D 4  287  ? 57.918  37.978  49.001  1.00 200.75 ? 287  HIS A NE2   1 
ATOM   3050  N  N     . ALA D 4  288  ? 55.314  35.773  42.997  1.00 179.94 ? 288  ALA A N     1 
ATOM   3051  C  CA    . ALA D 4  288  ? 54.207  35.357  42.145  1.00 169.06 ? 288  ALA A CA    1 
ATOM   3052  C  C     . ALA D 4  288  ? 54.399  33.966  41.549  1.00 166.12 ? 288  ALA A C     1 
ATOM   3053  O  O     . ALA D 4  288  ? 53.445  33.417  40.987  1.00 164.22 ? 288  ALA A O     1 
ATOM   3054  C  CB    . ALA D 4  288  ? 54.002  36.375  41.015  1.00 166.98 ? 288  ALA A CB    1 
ATOM   3055  N  N     . ILE D 4  289  ? 55.603  33.391  41.656  1.00 165.63 ? 289  ILE A N     1 
ATOM   3056  C  CA    . ILE D 4  289  ? 55.869  32.064  41.097  1.00 165.05 ? 289  ILE A CA    1 
ATOM   3057  C  C     . ILE D 4  289  ? 55.099  30.996  41.866  1.00 173.17 ? 289  ILE A C     1 
ATOM   3058  O  O     . ILE D 4  289  ? 54.436  30.131  41.274  1.00 162.97 ? 289  ILE A O     1 
ATOM   3059  C  CB    . ILE D 4  289  ? 57.384  31.776  41.103  1.00 148.34 ? 289  ILE A CB    1 
ATOM   3060  C  CG1   . ILE D 4  289  ? 58.098  32.574  40.009  1.00 143.54 ? 289  ILE A CG1   1 
ATOM   3061  C  CG2   . ILE D 4  289  ? 57.672  30.278  40.946  1.00 138.75 ? 289  ILE A CG2   1 
ATOM   3062  C  CD1   . ILE D 4  289  ? 57.830  32.084  38.614  1.00 136.75 ? 289  ILE A CD1   1 
ATOM   3063  N  N     . GLU D 4  290  ? 55.174  31.046  43.199  1.00 196.79 ? 290  GLU A N     1 
ATOM   3064  C  CA    . GLU D 4  290  ? 54.531  30.038  44.032  1.00 208.34 ? 290  GLU A CA    1 
ATOM   3065  C  C     . GLU D 4  290  ? 53.013  30.123  43.983  1.00 211.85 ? 290  GLU A C     1 
ATOM   3066  O  O     . GLU D 4  290  ? 52.349  29.105  44.195  1.00 222.16 ? 290  GLU A O     1 
ATOM   3067  C  CB    . GLU D 4  290  ? 55.019  30.163  45.477  1.00 214.31 ? 290  GLU A CB    1 
ATOM   3068  C  CG    . GLU D 4  290  ? 56.486  29.805  45.661  1.00 217.12 ? 290  GLU A CG    1 
ATOM   3069  C  CD    . GLU D 4  290  ? 56.775  28.345  45.361  1.00 217.89 ? 290  GLU A CD    1 
ATOM   3070  O  OE1   . GLU D 4  290  ? 55.899  27.490  45.615  1.00 217.34 ? 290  GLU A OE1   1 
ATOM   3071  O  OE2   . GLU D 4  290  ? 57.880  28.052  44.858  1.00 217.33 ? 290  GLU A OE2   1 
ATOM   3072  N  N     . GLU D 4  291  ? 52.454  31.296  43.672  1.00 194.84 ? 291  GLU A N     1 
ATOM   3073  C  CA    . GLU D 4  291  ? 51.008  31.419  43.501  1.00 174.49 ? 291  GLU A CA    1 
ATOM   3074  C  C     . GLU D 4  291  ? 50.518  30.598  42.308  1.00 165.86 ? 291  GLU A C     1 
ATOM   3075  O  O     . GLU D 4  291  ? 49.579  29.799  42.430  1.00 156.30 ? 291  GLU A O     1 
ATOM   3076  C  CB    . GLU D 4  291  ? 50.631  32.892  43.339  1.00 158.70 ? 291  GLU A CB    1 
ATOM   3077  C  CG    . GLU D 4  291  ? 49.143  33.169  43.447  1.00 147.62 ? 291  GLU A CG    1 
ATOM   3078  C  CD    . GLU D 4  291  ? 48.824  34.648  43.368  1.00 135.31 ? 291  GLU A CD    1 
ATOM   3079  O  OE1   . GLU D 4  291  ? 49.522  35.367  42.619  1.00 131.68 ? 291  GLU A OE1   1 
ATOM   3080  O  OE2   . GLU D 4  291  ? 47.867  35.087  44.041  1.00 126.08 ? 291  GLU A OE2   1 
ATOM   3081  N  N     . ALA D 4  292  ? 51.165  30.757  41.151  1.00 171.74 ? 292  ALA A N     1 
ATOM   3082  C  CA    . ALA D 4  292  ? 50.776  29.980  39.978  1.00 177.78 ? 292  ALA A CA    1 
ATOM   3083  C  C     . ALA D 4  292  ? 51.184  28.515  40.105  1.00 182.00 ? 292  ALA A C     1 
ATOM   3084  O  O     . ALA D 4  292  ? 50.533  27.642  39.518  1.00 189.26 ? 292  ALA A O     1 
ATOM   3085  C  CB    . ALA D 4  292  ? 51.375  30.598  38.714  1.00 182.93 ? 292  ALA A CB    1 
ATOM   3086  N  N     . GLU D 4  293  ? 52.238  28.220  40.875  1.00 173.88 ? 293  GLU A N     1 
ATOM   3087  C  CA    . GLU D 4  293  ? 52.586  26.824  41.142  1.00 166.44 ? 293  GLU A CA    1 
ATOM   3088  C  C     . GLU D 4  293  ? 51.524  26.142  42.003  1.00 160.21 ? 293  GLU A C     1 
ATOM   3089  O  O     . GLU D 4  293  ? 51.153  24.987  41.748  1.00 154.91 ? 293  GLU A O     1 
ATOM   3090  C  CB    . GLU D 4  293  ? 53.958  26.747  41.813  1.00 165.23 ? 293  GLU A CB    1 
ATOM   3091  C  CG    . GLU D 4  293  ? 54.490  25.332  41.979  1.00 165.19 ? 293  GLU A CG    1 
ATOM   3092  C  CD    . GLU D 4  293  ? 55.903  25.304  42.526  1.00 168.94 ? 293  GLU A CD    1 
ATOM   3093  O  OE1   . GLU D 4  293  ? 56.429  26.384  42.871  1.00 172.21 ? 293  GLU A OE1   1 
ATOM   3094  O  OE2   . GLU D 4  293  ? 56.490  24.204  42.606  1.00 167.21 ? 293  GLU A OE2   1 
ATOM   3095  N  N     . SER D 4  294  ? 51.022  26.847  43.025  1.00 161.82 ? 294  SER A N     1 
ATOM   3096  C  CA    . SER D 4  294  ? 49.891  26.357  43.805  1.00 162.76 ? 294  SER A CA    1 
ATOM   3097  C  C     . SER D 4  294  ? 48.638  26.231  42.954  1.00 164.89 ? 294  SER A C     1 
ATOM   3098  O  O     . SER D 4  294  ? 47.827  25.333  43.184  1.00 161.65 ? 294  SER A O     1 
ATOM   3099  C  CB    . SER D 4  294  ? 49.617  27.291  44.984  1.00 163.95 ? 294  SER A CB    1 
ATOM   3100  O  OG    . SER D 4  294  ? 49.152  28.554  44.533  1.00 164.19 ? 294  SER A OG    1 
ATOM   3101  N  N     . LEU D 4  295  ? 48.465  27.116  41.968  1.00 170.06 ? 295  LEU A N     1 
ATOM   3102  C  CA    . LEU D 4  295  ? 47.315  27.010  41.071  1.00 156.45 ? 295  LEU A CA    1 
ATOM   3103  C  C     . LEU D 4  295  ? 47.408  25.780  40.170  1.00 147.73 ? 295  LEU A C     1 
ATOM   3104  O  O     . LEU D 4  295  ? 46.398  25.111  39.923  1.00 148.32 ? 295  LEU A O     1 
ATOM   3105  C  CB    . LEU D 4  295  ? 47.184  28.278  40.230  1.00 148.67 ? 295  LEU A CB    1 
ATOM   3106  C  CG    . LEU D 4  295  ? 45.872  28.377  39.451  1.00 135.89 ? 295  LEU A CG    1 
ATOM   3107  C  CD1   . LEU D 4  295  ? 44.679  28.349  40.397  1.00 122.66 ? 295  LEU A CD1   1 
ATOM   3108  C  CD2   . LEU D 4  295  ? 45.858  29.628  38.587  1.00 146.26 ? 295  LEU A CD2   1 
ATOM   3109  N  N     . LEU D 4  296  ? 48.607  25.473  39.663  1.00 139.90 ? 296  LEU A N     1 
ATOM   3110  C  CA    . LEU D 4  296  ? 48.800  24.249  38.884  1.00 133.78 ? 296  LEU A CA    1 
ATOM   3111  C  C     . LEU D 4  296  ? 48.569  23.005  39.738  1.00 142.00 ? 296  LEU A C     1 
ATOM   3112  O  O     . LEU D 4  296  ? 47.911  22.047  39.297  1.00 136.12 ? 296  LEU A O     1 
ATOM   3113  C  CB    . LEU D 4  296  ? 50.204  24.222  38.278  1.00 120.17 ? 296  LEU A CB    1 
ATOM   3114  C  CG    . LEU D 4  296  ? 50.537  22.952  37.485  1.00 116.63 ? 296  LEU A CG    1 
ATOM   3115  C  CD1   . LEU D 4  296  ? 50.159  23.110  36.025  1.00 117.77 ? 296  LEU A CD1   1 
ATOM   3116  C  CD2   . LEU D 4  296  ? 52.005  22.551  37.629  1.00 119.46 ? 296  LEU A CD2   1 
ATOM   3117  N  N     . GLN D 4  297  ? 49.119  23.000  40.960  1.00 151.34 ? 297  GLN A N     1 
ATOM   3118  C  CA    . GLN D 4  297  ? 48.855  21.913  41.901  1.00 152.29 ? 297  GLN A CA    1 
ATOM   3119  C  C     . GLN D 4  297  ? 47.363  21.786  42.198  1.00 150.06 ? 297  GLN A C     1 
ATOM   3120  O  O     . GLN D 4  297  ? 46.834  20.673  42.279  1.00 150.31 ? 297  GLN A O     1 
ATOM   3121  C  CB    . GLN D 4  297  ? 49.660  22.132  43.190  1.00 150.20 ? 297  GLN A CB    1 
ATOM   3122  C  CG    . GLN D 4  297  ? 49.026  21.569  44.462  1.00 138.75 ? 297  GLN A CG    1 
ATOM   3123  C  CD    . GLN D 4  297  ? 49.135  20.061  44.563  1.00 123.05 ? 297  GLN A CD    1 
ATOM   3124  O  OE1   . GLN D 4  297  ? 49.820  19.417  43.768  1.00 115.04 ? 297  GLN A OE1   1 
ATOM   3125  N  NE2   . GLN D 4  297  ? 48.445  19.485  45.540  1.00 117.26 ? 297  GLN A NE2   1 
ATOM   3126  N  N     . PHE D 4  298  ? 46.663  22.919  42.312  1.00 146.82 ? 298  PHE A N     1 
ATOM   3127  C  CA    . PHE D 4  298  ? 45.227  22.917  42.573  1.00 148.30 ? 298  PHE A CA    1 
ATOM   3128  C  C     . PHE D 4  298  ? 44.442  22.359  41.391  1.00 154.53 ? 298  PHE A C     1 
ATOM   3129  O  O     . PHE D 4  298  ? 43.447  21.649  41.581  1.00 155.77 ? 298  PHE A O     1 
ATOM   3130  C  CB    . PHE D 4  298  ? 44.773  24.339  42.914  1.00 146.26 ? 298  PHE A CB    1 
ATOM   3131  C  CG    . PHE D 4  298  ? 43.287  24.487  43.066  1.00 144.90 ? 298  PHE A CG    1 
ATOM   3132  C  CD1   . PHE D 4  298  ? 42.657  24.083  44.229  1.00 145.22 ? 298  PHE A CD1   1 
ATOM   3133  C  CD2   . PHE D 4  298  ? 42.521  25.040  42.051  1.00 142.45 ? 298  PHE A CD2   1 
ATOM   3134  C  CE1   . PHE D 4  298  ? 41.291  24.216  44.372  1.00 141.98 ? 298  PHE A CE1   1 
ATOM   3135  C  CE2   . PHE D 4  298  ? 41.151  25.174  42.193  1.00 137.79 ? 298  PHE A CE2   1 
ATOM   3136  C  CZ    . PHE D 4  298  ? 40.539  24.762  43.357  1.00 136.94 ? 298  PHE A CZ    1 
ATOM   3137  N  N     . HIS D 4  299  ? 44.874  22.675  40.168  1.00 157.37 ? 299  HIS A N     1 
ATOM   3138  C  CA    . HIS D 4  299  ? 44.216  22.147  38.975  1.00 149.36 ? 299  HIS A CA    1 
ATOM   3139  C  C     . HIS D 4  299  ? 44.382  20.635  38.871  1.00 132.08 ? 299  HIS A C     1 
ATOM   3140  O  O     . HIS D 4  299  ? 43.405  19.917  38.621  1.00 120.55 ? 299  HIS A O     1 
ATOM   3141  C  CB    . HIS D 4  299  ? 44.768  22.843  37.732  1.00 154.18 ? 299  HIS A CB    1 
ATOM   3142  C  CG    . HIS D 4  299  ? 44.125  24.163  37.441  1.00 165.76 ? 299  HIS A CG    1 
ATOM   3143  N  ND1   . HIS D 4  299  ? 43.042  24.636  38.151  1.00 170.18 ? 299  HIS A ND1   1 
ATOM   3144  C  CD2   . HIS D 4  299  ? 44.431  25.124  36.538  1.00 172.28 ? 299  HIS A CD2   1 
ATOM   3145  C  CE1   . HIS D 4  299  ? 42.696  25.822  37.683  1.00 173.87 ? 299  HIS A CE1   1 
ATOM   3146  N  NE2   . HIS D 4  299  ? 43.524  26.142  36.705  1.00 173.67 ? 299  HIS A NE2   1 
ATOM   3147  N  N     . VAL D 4  300  ? 45.606  20.134  39.091  1.00 128.34 ? 300  VAL A N     1 
ATOM   3148  C  CA    . VAL D 4  300  ? 45.837  18.686  39.089  1.00 122.06 ? 300  VAL A CA    1 
ATOM   3149  C  C     . VAL D 4  300  ? 45.071  18.015  40.233  1.00 113.36 ? 300  VAL A C     1 
ATOM   3150  O  O     . VAL D 4  300  ? 44.519  16.916  40.074  1.00 104.68 ? 300  VAL A O     1 
ATOM   3151  C  CB    . VAL D 4  300  ? 47.349  18.388  39.154  1.00 106.21 ? 300  VAL A CB    1 
ATOM   3152  C  CG1   . VAL D 4  300  ? 47.620  16.883  39.143  1.00 82.93  ? 300  VAL A CG1   1 
ATOM   3153  C  CG2   . VAL D 4  300  ? 48.085  19.067  37.997  1.00 103.91 ? 300  VAL A CG2   1 
ATOM   3154  N  N     . ALA D 4  301  ? 44.983  18.689  41.385  1.00 117.29 ? 301  ALA A N     1 
ATOM   3155  C  CA    . ALA D 4  301  ? 44.294  18.139  42.548  1.00 122.44 ? 301  ALA A CA    1 
ATOM   3156  C  C     . ALA D 4  301  ? 42.798  17.996  42.299  1.00 130.45 ? 301  ALA A C     1 
ATOM   3157  O  O     . ALA D 4  301  ? 42.223  16.925  42.522  1.00 136.89 ? 301  ALA A O     1 
ATOM   3158  C  CB    . ALA D 4  301  ? 44.553  19.029  43.764  1.00 125.54 ? 301  ALA A CB    1 
ATOM   3159  N  N     . THR D 4  302  ? 42.151  19.073  41.836  1.00 127.30 ? 302  THR A N     1 
ATOM   3160  C  CA    . THR D 4  302  ? 40.718  19.031  41.556  1.00 126.22 ? 302  THR A CA    1 
ATOM   3161  C  C     . THR D 4  302  ? 40.401  18.142  40.356  1.00 121.04 ? 302  THR A C     1 
ATOM   3162  O  O     . THR D 4  302  ? 39.292  17.601  40.265  1.00 99.60  ? 302  THR A O     1 
ATOM   3163  C  CB    . THR D 4  302  ? 40.183  20.449  41.335  1.00 120.27 ? 302  THR A CB    1 
ATOM   3164  O  OG1   . THR D 4  302  ? 41.074  21.177  40.478  1.00 121.23 ? 302  THR A OG1   1 
ATOM   3165  C  CG2   . THR D 4  302  ? 40.055  21.182  42.661  1.00 107.26 ? 302  THR A CG2   1 
ATOM   3166  N  N     . TYR D 4  303  ? 41.357  17.979  39.431  1.00 127.74 ? 303  TYR A N     1 
ATOM   3167  C  CA    . TYR D 4  303  ? 41.201  17.005  38.355  1.00 121.35 ? 303  TYR A CA    1 
ATOM   3168  C  C     . TYR D 4  303  ? 41.211  15.579  38.896  1.00 122.67 ? 303  TYR A C     1 
ATOM   3169  O  O     . TYR D 4  303  ? 40.473  14.716  38.402  1.00 111.57 ? 303  TYR A O     1 
ATOM   3170  C  CB    . TYR D 4  303  ? 42.307  17.215  37.316  1.00 120.49 ? 303  TYR A CB    1 
ATOM   3171  C  CG    . TYR D 4  303  ? 42.546  16.041  36.395  1.00 113.93 ? 303  TYR A CG    1 
ATOM   3172  C  CD1   . TYR D 4  303  ? 41.654  15.734  35.377  1.00 105.84 ? 303  TYR A CD1   1 
ATOM   3173  C  CD2   . TYR D 4  303  ? 43.679  15.251  36.534  1.00 114.75 ? 303  TYR A CD2   1 
ATOM   3174  C  CE1   . TYR D 4  303  ? 41.879  14.659  34.532  1.00 104.73 ? 303  TYR A CE1   1 
ATOM   3175  C  CE2   . TYR D 4  303  ? 43.910  14.175  35.695  1.00 117.85 ? 303  TYR A CE2   1 
ATOM   3176  C  CZ    . TYR D 4  303  ? 43.011  13.884  34.696  1.00 112.92 ? 303  TYR A CZ    1 
ATOM   3177  O  OH    . TYR D 4  303  ? 43.250  12.809  33.866  1.00 108.45 ? 303  TYR A OH    1 
ATOM   3178  N  N     . MET D 4  304  ? 42.043  15.317  39.909  1.00 133.72 ? 304  MET A N     1 
ATOM   3179  C  CA    . MET D 4  304  ? 41.996  14.033  40.608  1.00 129.37 ? 304  MET A CA    1 
ATOM   3180  C  C     . MET D 4  304  ? 40.721  13.908  41.441  1.00 125.30 ? 304  MET A C     1 
ATOM   3181  O  O     . MET D 4  304  ? 39.909  13.000  41.225  1.00 119.47 ? 304  MET A O     1 
ATOM   3182  C  CB    . MET D 4  304  ? 43.242  13.870  41.486  1.00 126.22 ? 304  MET A CB    1 
ATOM   3183  C  CG    . MET D 4  304  ? 44.526  13.664  40.701  1.00 131.24 ? 304  MET A CG    1 
ATOM   3184  S  SD    . MET D 4  304  ? 44.418  12.242  39.599  1.00 127.56 ? 304  MET A SD    1 
ATOM   3185  C  CE    . MET D 4  304  ? 45.994  12.335  38.749  1.00 121.71 ? 304  MET A CE    1 
ATOM   3186  N  N     . ASP D 4  305  ? 40.527  14.816  42.397  1.00 114.26 ? 305  ASP A N     1 
ATOM   3187  C  CA    . ASP D 4  305  ? 39.340  14.810  43.243  1.00 120.75 ? 305  ASP A CA    1 
ATOM   3188  C  C     . ASP D 4  305  ? 39.003  16.265  43.538  1.00 133.64 ? 305  ASP A C     1 
ATOM   3189  O  O     . ASP D 4  305  ? 39.846  16.998  44.063  1.00 161.81 ? 305  ASP A O     1 
ATOM   3190  C  CB    . ASP D 4  305  ? 39.595  14.012  44.538  1.00 131.48 ? 305  ASP A CB    1 
ATOM   3191  C  CG    . ASP D 4  305  ? 38.708  14.441  45.718  1.00 141.31 ? 305  ASP A CG    1 
ATOM   3192  O  OD1   . ASP D 4  305  ? 37.507  14.740  45.527  1.00 144.76 ? 305  ASP A OD1   1 
ATOM   3193  O  OD2   . ASP D 4  305  ? 39.225  14.484  46.857  1.00 143.00 ? 305  ASP A OD2   1 
ATOM   3194  N  N     . ASN D 4  306  ? 37.776  16.677  43.212  1.00 119.94 ? 306  ASN A N     1 
ATOM   3195  C  CA    . ASN D 4  306  ? 37.368  18.048  43.491  1.00 126.03 ? 306  ASN A CA    1 
ATOM   3196  C  C     . ASN D 4  306  ? 36.894  18.227  44.929  1.00 146.64 ? 306  ASN A C     1 
ATOM   3197  O  O     . ASN D 4  306  ? 37.066  19.310  45.505  1.00 159.69 ? 306  ASN A O     1 
ATOM   3198  C  CB    . ASN D 4  306  ? 36.273  18.484  42.514  1.00 112.58 ? 306  ASN A CB    1 
ATOM   3199  C  CG    . ASN D 4  306  ? 35.887  19.943  42.681  1.00 115.52 ? 306  ASN A CG    1 
ATOM   3200  O  OD1   . ASN D 4  306  ? 34.988  20.280  43.452  1.00 119.64 ? 306  ASN A OD1   1 
ATOM   3201  N  ND2   . ASN D 4  306  ? 36.585  20.819  41.973  1.00 112.84 ? 306  ASN A ND2   1 
ATOM   3202  N  N     . ASP D 4  307  ? 36.317  17.189  45.528  1.00 143.31 ? 307  ASP A N     1 
ATOM   3203  C  CA    . ASP D 4  307  ? 35.761  17.279  46.878  1.00 144.70 ? 307  ASP A CA    1 
ATOM   3204  C  C     . ASP D 4  307  ? 36.885  17.054  47.886  1.00 148.98 ? 307  ASP A C     1 
ATOM   3205  O  O     . ASP D 4  307  ? 37.118  15.938  48.353  1.00 154.45 ? 307  ASP A O     1 
ATOM   3206  C  CB    . ASP D 4  307  ? 34.628  16.273  47.053  1.00 139.26 ? 307  ASP A CB    1 
ATOM   3207  C  CG    . ASP D 4  307  ? 33.620  16.700  48.109  1.00 140.53 ? 307  ASP A CG    1 
ATOM   3208  O  OD1   . ASP D 4  307  ? 34.039  17.217  49.170  1.00 145.68 ? 307  ASP A OD1   1 
ATOM   3209  O  OD2   . ASP D 4  307  ? 32.406  16.529  47.874  1.00 132.54 ? 307  ASP A OD2   1 
ATOM   3210  N  N     . ILE D 4  308  ? 37.597  18.132  48.218  1.00 140.07 ? 308  ILE A N     1 
ATOM   3211  C  CA    . ILE D 4  308  ? 38.666  18.103  49.207  1.00 124.86 ? 308  ILE A CA    1 
ATOM   3212  C  C     . ILE D 4  308  ? 38.232  18.971  50.384  1.00 132.25 ? 308  ILE A C     1 
ATOM   3213  O  O     . ILE D 4  308  ? 37.345  19.820  50.265  1.00 144.98 ? 308  ILE A O     1 
ATOM   3214  C  CB    . ILE D 4  308  ? 40.020  18.590  48.629  1.00 100.97 ? 308  ILE A CB    1 
ATOM   3215  C  CG1   . ILE D 4  308  ? 40.139  18.247  47.141  1.00 92.58  ? 308  ILE A CG1   1 
ATOM   3216  C  CG2   . ILE D 4  308  ? 41.192  17.952  49.362  1.00 84.44  ? 308  ILE A CG2   1 
ATOM   3217  C  CD1   . ILE D 4  308  ? 41.388  18.814  46.470  1.00 78.86  ? 308  ILE A CD1   1 
ATOM   3218  N  N     . ALA D 4  309  ? 38.863  18.743  51.536  1.00 129.31 ? 309  ALA A N     1 
ATOM   3219  C  CA    . ALA D 4  309  ? 38.603  19.555  52.715  1.00 135.66 ? 309  ALA A CA    1 
ATOM   3220  C  C     . ALA D 4  309  ? 39.196  20.956  52.541  1.00 146.69 ? 309  ALA A C     1 
ATOM   3221  O  O     . ALA D 4  309  ? 40.031  21.207  51.667  1.00 153.59 ? 309  ALA A O     1 
ATOM   3222  C  CB    . ALA D 4  309  ? 39.171  18.882  53.964  1.00 135.45 ? 309  ALA A CB    1 
ATOM   3223  N  N     . GLY D 4  310  ? 38.762  21.876  53.402  1.00 147.81 ? 310  GLY A N     1 
ATOM   3224  C  CA    . GLY D 4  310  ? 39.141  23.271  53.278  1.00 148.43 ? 310  GLY A CA    1 
ATOM   3225  C  C     . GLY D 4  310  ? 38.308  24.058  52.296  1.00 153.48 ? 310  GLY A C     1 
ATOM   3226  O  O     . GLY D 4  310  ? 38.640  25.217  52.014  1.00 158.25 ? 310  GLY A O     1 
ATOM   3227  N  N     . GLN D 4  311  ? 37.240  23.453  51.774  1.00 155.38 ? 311  GLN A N     1 
ATOM   3228  C  CA    . GLN D 4  311  ? 36.362  24.042  50.770  1.00 161.86 ? 311  GLN A CA    1 
ATOM   3229  C  C     . GLN D 4  311  ? 37.023  24.706  49.536  1.00 175.33 ? 311  GLN A C     1 
ATOM   3230  O  O     . GLN D 4  311  ? 36.687  25.806  49.175  1.00 171.12 ? 311  GLN A O     1 
ATOM   3231  C  CB    . GLN D 4  311  ? 35.446  25.056  51.446  1.00 152.86 ? 311  GLN A CB    1 
ATOM   3232  C  CG    . GLN D 4  311  ? 34.797  24.563  52.737  1.00 142.83 ? 311  GLN A CG    1 
ATOM   3233  C  CD    . GLN D 4  311  ? 34.138  25.686  53.521  1.00 137.58 ? 311  GLN A CD    1 
ATOM   3234  O  OE1   . GLN D 4  311  ? 34.817  26.556  54.071  1.00 146.87 ? 311  GLN A OE1   1 
ATOM   3235  N  NE2   . GLN D 4  311  ? 32.810  25.673  53.576  1.00 123.56 ? 311  GLN A NE2   1 
ATOM   3236  N  N     . PRO D 4  312  ? 37.990  23.996  48.865  1.00 191.51 ? 312  PRO A N     1 
ATOM   3237  C  CA    . PRO D 4  312  ? 38.507  24.555  47.605  1.00 189.73 ? 312  PRO A CA    1 
ATOM   3238  C  C     . PRO D 4  312  ? 37.772  23.986  46.390  1.00 193.38 ? 312  PRO A C     1 
ATOM   3239  O  O     . PRO D 4  312  ? 38.378  23.425  45.471  1.00 204.90 ? 312  PRO A O     1 
ATOM   3240  C  CB    . PRO D 4  312  ? 39.984  24.139  47.649  1.00 185.77 ? 312  PRO A CB    1 
ATOM   3241  C  CG    . PRO D 4  312  ? 40.090  23.061  48.751  1.00 182.77 ? 312  PRO A CG    1 
ATOM   3242  C  CD    . PRO D 4  312  ? 38.677  22.720  49.116  1.00 189.92 ? 312  PRO A CD    1 
ATOM   3243  N  N     . GLN D 4  313  ? 36.445  24.121  46.385  1.00 178.69 ? 313  GLN A N     1 
ATOM   3244  C  CA    . GLN D 4  313  ? 35.613  23.478  45.369  1.00 160.68 ? 313  GLN A CA    1 
ATOM   3245  C  C     . GLN D 4  313  ? 35.711  24.269  44.069  1.00 160.57 ? 313  GLN A C     1 
ATOM   3246  O  O     . GLN D 4  313  ? 35.193  25.387  43.972  1.00 170.54 ? 313  GLN A O     1 
ATOM   3247  C  CB    . GLN D 4  313  ? 34.166  23.375  45.844  1.00 138.65 ? 313  GLN A CB    1 
ATOM   3248  C  CG    . GLN D 4  313  ? 33.234  22.696  44.845  1.00 124.07 ? 313  GLN A CG    1 
ATOM   3249  C  CD    . GLN D 4  313  ? 32.136  21.881  45.513  1.00 115.23 ? 313  GLN A CD    1 
ATOM   3250  O  OE1   . GLN D 4  313  ? 31.422  22.374  46.387  1.00 119.85 ? 313  GLN A OE1   1 
ATOM   3251  N  NE2   . GLN D 4  313  ? 32.015  20.619  45.118  1.00 100.96 ? 313  GLN A NE2   1 
ATOM   3252  N  N     . ALA D 4  314  ? 36.361  23.683  43.063  1.00 148.54 ? 314  ALA A N     1 
ATOM   3253  C  CA    . ALA D 4  314  ? 36.655  24.377  41.810  1.00 143.18 ? 314  ALA A CA    1 
ATOM   3254  C  C     . ALA D 4  314  ? 35.431  24.332  40.906  1.00 145.43 ? 314  ALA A C     1 
ATOM   3255  O  O     . ALA D 4  314  ? 35.285  23.448  40.060  1.00 146.26 ? 314  ALA A O     1 
ATOM   3256  C  CB    . ALA D 4  314  ? 37.869  23.762  41.124  1.00 137.38 ? 314  ALA A CB    1 
ATOM   3257  N  N     . LEU D 4  315  ? 34.540  25.302  41.090  1.00 142.66 ? 315  LEU A N     1 
ATOM   3258  C  CA    . LEU D 4  315  ? 33.416  25.468  40.182  1.00 138.74 ? 315  LEU A CA    1 
ATOM   3259  C  C     . LEU D 4  315  ? 33.907  26.002  38.840  1.00 154.80 ? 315  LEU A C     1 
ATOM   3260  O  O     . LEU D 4  315  ? 34.799  26.854  38.783  1.00 156.41 ? 315  LEU A O     1 
ATOM   3261  C  CB    . LEU D 4  315  ? 32.384  26.419  40.788  1.00 119.18 ? 315  LEU A CB    1 
ATOM   3262  N  N     . GLN D 4  316  ? 33.328  25.488  37.755  1.00 171.06 ? 316  GLN A N     1 
ATOM   3263  C  CA    . GLN D 4  316  ? 33.744  25.836  36.400  1.00 181.65 ? 316  GLN A CA    1 
ATOM   3264  C  C     . GLN D 4  316  ? 32.532  26.264  35.587  1.00 176.82 ? 316  GLN A C     1 
ATOM   3265  O  O     . GLN D 4  316  ? 31.572  25.497  35.449  1.00 178.86 ? 316  GLN A O     1 
ATOM   3266  C  CB    . GLN D 4  316  ? 34.460  24.660  35.722  1.00 178.31 ? 316  GLN A CB    1 
ATOM   3267  C  CG    . GLN D 4  316  ? 34.541  24.751  34.202  1.00 168.29 ? 316  GLN A CG    1 
ATOM   3268  C  CD    . GLN D 4  316  ? 33.467  23.930  33.509  1.00 158.00 ? 316  GLN A CD    1 
ATOM   3269  O  OE1   . GLN D 4  316  ? 32.778  23.129  34.139  1.00 150.83 ? 316  GLN A OE1   1 
ATOM   3270  N  NE2   . GLN D 4  316  ? 33.287  24.165  32.217  1.00 161.83 ? 316  GLN A NE2   1 
ATOM   3271  N  N     . LYS D 4  317  ? 32.556  27.506  35.095  1.00 167.40 ? 317  LYS A N     1 
ATOM   3272  C  CA    . LYS D 4  317  ? 31.671  28.065  34.070  1.00 158.82 ? 317  LYS A CA    1 
ATOM   3273  C  C     . LYS D 4  317  ? 30.212  28.184  34.503  1.00 154.03 ? 317  LYS A C     1 
ATOM   3274  O  O     . LYS D 4  317  ? 29.404  28.732  33.742  1.00 161.01 ? 317  LYS A O     1 
ATOM   3275  C  CB    . LYS D 4  317  ? 31.728  27.270  32.756  1.00 157.38 ? 317  LYS A CB    1 
ATOM   3276  N  N     . SER D 4  318  ? 29.849  27.710  35.692  1.00 144.02 ? 318  SER A N     1 
ATOM   3277  C  CA    . SER D 4  318  ? 28.480  27.732  36.189  1.00 137.01 ? 318  SER A CA    1 
ATOM   3278  C  C     . SER D 4  318  ? 28.539  27.539  37.700  1.00 153.89 ? 318  SER A C     1 
ATOM   3279  O  O     . SER D 4  318  ? 29.617  27.407  38.284  1.00 157.90 ? 318  SER A O     1 
ATOM   3280  C  CB    . SER D 4  318  ? 27.624  26.652  35.513  1.00 111.29 ? 318  SER A CB    1 
ATOM   3281  N  N     . GLY D 4  319  ? 27.365  27.505  38.332  1.00 163.06 ? 319  GLY A N     1 
ATOM   3282  C  CA    . GLY D 4  319  ? 27.304  27.220  39.757  1.00 170.33 ? 319  GLY A CA    1 
ATOM   3283  C  C     . GLY D 4  319  ? 27.633  25.786  40.127  1.00 175.07 ? 319  GLY A C     1 
ATOM   3284  O  O     . GLY D 4  319  ? 27.869  25.511  41.309  1.00 171.05 ? 319  GLY A O     1 
ATOM   3285  N  N     . ARG D 4  320  ? 27.658  24.871  39.145  1.00 177.99 ? 320  ARG A N     1 
ATOM   3286  C  CA    . ARG D 4  320  ? 27.978  23.468  39.374  1.00 174.48 ? 320  ARG A CA    1 
ATOM   3287  C  C     . ARG D 4  320  ? 29.495  23.260  39.370  1.00 172.64 ? 320  ARG A C     1 
ATOM   3288  O  O     . ARG D 4  320  ? 30.208  23.903  38.594  1.00 172.96 ? 320  ARG A O     1 
ATOM   3289  C  CB    . ARG D 4  320  ? 27.331  22.591  38.301  1.00 167.25 ? 320  ARG A CB    1 
ATOM   3290  N  N     . PRO D 4  321  ? 30.009  22.379  40.224  1.00 137.79 ? 321  PRO A N     1 
ATOM   3291  C  CA    . PRO D 4  321  ? 31.443  22.070  40.211  1.00 110.89 ? 321  PRO A CA    1 
ATOM   3292  C  C     . PRO D 4  321  ? 31.763  20.994  39.179  1.00 100.39 ? 321  PRO A C     1 
ATOM   3293  O  O     . PRO D 4  321  ? 30.879  20.360  38.599  1.00 102.85 ? 321  PRO A O     1 
ATOM   3294  C  CB    . PRO D 4  321  ? 31.716  21.566  41.638  1.00 111.96 ? 321  PRO A CB    1 
ATOM   3295  C  CG    . PRO D 4  321  ? 30.352  21.519  42.338  1.00 116.63 ? 321  PRO A CG    1 
ATOM   3296  C  CD    . PRO D 4  321  ? 29.304  21.647  41.288  1.00 124.80 ? 321  PRO A CD    1 
ATOM   3297  N  N     . VAL D 4  322  ? 33.063  20.792  38.958  1.00 107.88 ? 322  VAL A N     1 
ATOM   3298  C  CA    . VAL D 4  322  ? 33.516  19.772  38.017  1.00 121.72 ? 322  VAL A CA    1 
ATOM   3299  C  C     . VAL D 4  322  ? 33.351  18.396  38.647  1.00 137.66 ? 322  VAL A C     1 
ATOM   3300  O  O     . VAL D 4  322  ? 33.702  18.182  39.815  1.00 139.74 ? 322  VAL A O     1 
ATOM   3301  C  CB    . VAL D 4  322  ? 34.978  20.019  37.611  1.00 105.44 ? 322  VAL A CB    1 
ATOM   3302  C  CG1   . VAL D 4  322  ? 35.357  19.185  36.388  1.00 92.67  ? 322  VAL A CG1   1 
ATOM   3303  C  CG2   . VAL D 4  322  ? 35.222  21.492  37.360  1.00 109.19 ? 322  VAL A CG2   1 
ATOM   3304  N  N     . LYS D 4  323  ? 32.808  17.454  37.880  1.00 144.61 ? 323  LYS A N     1 
ATOM   3305  C  CA    . LYS D 4  323  ? 32.818  16.053  38.285  1.00 148.62 ? 323  LYS A CA    1 
ATOM   3306  C  C     . LYS D 4  323  ? 34.225  15.511  38.059  1.00 154.40 ? 323  LYS A C     1 
ATOM   3307  O  O     . LYS D 4  323  ? 34.630  15.270  36.917  1.00 170.77 ? 323  LYS A O     1 
ATOM   3308  C  CB    . LYS D 4  323  ? 31.779  15.251  37.506  1.00 146.71 ? 323  LYS A CB    1 
ATOM   3309  C  CG    . LYS D 4  323  ? 30.375  15.300  38.095  1.00 139.29 ? 323  LYS A CG    1 
ATOM   3310  C  CD    . LYS D 4  323  ? 29.526  14.142  37.592  1.00 130.56 ? 323  LYS A CD    1 
ATOM   3311  C  CE    . LYS D 4  323  ? 28.117  14.212  38.148  1.00 126.64 ? 323  LYS A CE    1 
ATOM   3312  N  NZ    . LYS D 4  323  ? 27.288  13.063  37.694  1.00 125.72 ? 323  LYS A NZ    1 
ATOM   3313  N  N     . SER D 4  324  ? 34.977  15.332  39.144  1.00 137.16 ? 324  SER A N     1 
ATOM   3314  C  CA    . SER D 4  324  ? 36.326  14.796  39.048  1.00 123.77 ? 324  SER A CA    1 
ATOM   3315  C  C     . SER D 4  324  ? 36.284  13.300  38.736  1.00 119.21 ? 324  SER A C     1 
ATOM   3316  O  O     . SER D 4  324  ? 35.225  12.664  38.736  1.00 131.56 ? 324  SER A O     1 
ATOM   3317  C  CB    . SER D 4  324  ? 37.096  15.053  40.344  1.00 124.09 ? 324  SER A CB    1 
ATOM   3318  O  OG    . SER D 4  324  ? 36.266  14.886  41.485  1.00 120.75 ? 324  SER A OG    1 
ATOM   3319  N  N     . ILE D 4  325  ? 37.465  12.738  38.462  1.00 106.17 ? 325  ILE A N     1 
ATOM   3320  C  CA    . ILE D 4  325  ? 37.560  11.313  38.147  1.00 105.82 ? 325  ILE A CA    1 
ATOM   3321  C  C     . ILE D 4  325  ? 37.169  10.478  39.362  1.00 116.55 ? 325  ILE A C     1 
ATOM   3322  O  O     . ILE D 4  325  ? 36.590  9.391   39.221  1.00 119.86 ? 325  ILE A O     1 
ATOM   3323  C  CB    . ILE D 4  325  ? 38.981  10.970  37.652  1.00 91.01  ? 325  ILE A CB    1 
ATOM   3324  C  CG1   . ILE D 4  325  ? 39.389  11.887  36.496  1.00 85.27  ? 325  ILE A CG1   1 
ATOM   3325  C  CG2   . ILE D 4  325  ? 39.068  9.512   37.197  1.00 68.27  ? 325  ILE A CG2   1 
ATOM   3326  C  CD1   . ILE D 4  325  ? 40.716  11.509  35.852  1.00 65.91  ? 325  ILE A CD1   1 
ATOM   3327  N  N     . ARG D 4  326  ? 37.456  10.985  40.566  1.00 114.10 ? 326  ARG A N     1 
ATOM   3328  C  CA    . ARG D 4  326  ? 37.052  10.310  41.794  1.00 108.35 ? 326  ARG A CA    1 
ATOM   3329  C  C     . ARG D 4  326  ? 35.535  10.177  41.889  1.00 106.57 ? 326  ARG A C     1 
ATOM   3330  O  O     . ARG D 4  326  ? 35.019  9.102   42.215  1.00 114.17 ? 326  ARG A O     1 
ATOM   3331  C  CB    . ARG D 4  326  ? 37.602  11.068  43.005  1.00 108.75 ? 326  ARG A CB    1 
ATOM   3332  C  CG    . ARG D 4  326  ? 36.911  10.724  44.312  1.00 106.99 ? 326  ARG A CG    1 
ATOM   3333  C  CD    . ARG D 4  326  ? 37.819  10.932  45.506  1.00 99.86  ? 326  ARG A CD    1 
ATOM   3334  N  NE    . ARG D 4  326  ? 37.377  10.154  46.658  1.00 102.46 ? 326  ARG A NE    1 
ATOM   3335  C  CZ    . ARG D 4  326  ? 36.457  10.558  47.527  1.00 125.97 ? 326  ARG A CZ    1 
ATOM   3336  N  NH1   . ARG D 4  326  ? 35.870  11.740  47.380  1.00 134.10 ? 326  ARG A NH1   1 
ATOM   3337  N  NH2   . ARG D 4  326  ? 36.122  9.779   48.547  1.00 137.64 ? 326  ARG A NH2   1 
ATOM   3338  N  N     . ALA D 4  327  ? 34.803  11.250  41.580  1.00 90.97  ? 327  ALA A N     1 
ATOM   3339  C  CA    . ALA D 4  327  ? 33.346  11.199  41.620  1.00 90.70  ? 327  ALA A CA    1 
ATOM   3340  C  C     . ALA D 4  327  ? 32.744  10.422  40.454  1.00 92.54  ? 327  ALA A C     1 
ATOM   3341  O  O     . ALA D 4  327  ? 31.547  10.119  40.492  1.00 95.34  ? 327  ALA A O     1 
ATOM   3342  C  CB    . ALA D 4  327  ? 32.773  12.618  41.649  1.00 99.16  ? 327  ALA A CB    1 
ATOM   3343  N  N     . ARG D 4  328  ? 33.537  10.093  39.429  1.00 98.18  ? 328  ARG A N     1 
ATOM   3344  C  CA    . ARG D 4  328  ? 33.019  9.295   38.321  1.00 109.24 ? 328  ARG A CA    1 
ATOM   3345  C  C     . ARG D 4  328  ? 32.745  7.860   38.749  1.00 99.98  ? 328  ARG A C     1 
ATOM   3346  O  O     . ARG D 4  328  ? 31.771  7.246   38.296  1.00 108.32 ? 328  ARG A O     1 
ATOM   3347  C  CB    . ARG D 4  328  ? 33.996  9.302   37.148  1.00 122.01 ? 328  ARG A CB    1 
ATOM   3348  C  CG    . ARG D 4  328  ? 33.798  10.424  36.156  1.00 123.91 ? 328  ARG A CG    1 
ATOM   3349  C  CD    . ARG D 4  328  ? 34.641  10.160  34.930  1.00 117.61 ? 328  ARG A CD    1 
ATOM   3350  N  NE    . ARG D 4  328  ? 34.375  11.096  33.849  1.00 113.63 ? 328  ARG A NE    1 
ATOM   3351  C  CZ    . ARG D 4  328  ? 34.863  10.959  32.622  1.00 111.64 ? 328  ARG A CZ    1 
ATOM   3352  N  NH1   . ARG D 4  328  ? 35.635  9.920   32.326  1.00 94.07  ? 328  ARG A NH1   1 
ATOM   3353  N  NH2   . ARG D 4  328  ? 34.578  11.854  31.687  1.00 125.73 ? 328  ARG A NH2   1 
ATOM   3354  N  N     . LEU D 4  329  ? 33.599  7.308   39.607  1.00 83.31  ? 329  LEU A N     1 
ATOM   3355  C  CA    . LEU D 4  329  ? 33.493  5.926   40.052  1.00 80.93  ? 329  LEU A CA    1 
ATOM   3356  C  C     . LEU D 4  329  ? 33.113  5.788   41.521  1.00 79.14  ? 329  LEU A C     1 
ATOM   3357  O  O     . LEU D 4  329  ? 33.080  4.664   42.037  1.00 83.68  ? 329  LEU A O     1 
ATOM   3358  C  CB    . LEU D 4  329  ? 34.799  5.182   39.735  1.00 72.05  ? 329  LEU A CB    1 
ATOM   3359  C  CG    . LEU D 4  329  ? 36.154  5.882   39.936  1.00 70.59  ? 329  LEU A CG    1 
ATOM   3360  C  CD1   . LEU D 4  329  ? 36.560  6.035   41.382  1.00 85.00  ? 329  LEU A CD1   1 
ATOM   3361  C  CD2   . LEU D 4  329  ? 37.258  5.195   39.144  1.00 55.30  ? 329  LEU A CD2   1 
ATOM   3362  N  N     . LYS D 4  330  ? 32.814  6.895   42.200  1.00 82.74  ? 330  LYS A N     1 
ATOM   3363  C  CA    . LYS D 4  330  ? 32.385  6.856   43.593  1.00 92.15  ? 330  LYS A CA    1 
ATOM   3364  C  C     . LYS D 4  330  ? 30.882  6.605   43.692  1.00 89.17  ? 330  LYS A C     1 
ATOM   3365  O  O     . LYS D 4  330  ? 30.097  7.130   42.894  1.00 91.80  ? 330  LYS A O     1 
ATOM   3366  C  CB    . LYS D 4  330  ? 32.737  8.172   44.295  1.00 99.32  ? 330  LYS A CB    1 
ATOM   3367  C  CG    . LYS D 4  330  ? 32.463  8.196   45.798  1.00 106.23 ? 330  LYS A CG    1 
ATOM   3368  C  CD    . LYS D 4  330  ? 31.317  9.144   46.149  1.00 99.13  ? 330  LYS A CD    1 
ATOM   3369  C  CE    . LYS D 4  330  ? 30.980  9.091   47.635  1.00 88.03  ? 330  LYS A CE    1 
ATOM   3370  N  NZ    . LYS D 4  330  ? 29.732  9.842   47.961  1.00 88.80  ? 330  LYS A NZ    1 
ATOM   3371  N  N     . GLY D 4  331  ? 30.489  5.783   44.670  1.00 85.62  ? 331  GLY A N     1 
ATOM   3372  C  CA    . GLY D 4  331  ? 29.105  5.722   45.110  1.00 92.25  ? 331  GLY A CA    1 
ATOM   3373  C  C     . GLY D 4  331  ? 28.187  4.906   44.214  1.00 94.79  ? 331  GLY A C     1 
ATOM   3374  O  O     . GLY D 4  331  ? 28.617  4.089   43.391  1.00 105.74 ? 331  GLY A O     1 
ATOM   3375  N  N     . LYS D 4  332  ? 26.883  5.160   44.384  1.00 83.88  ? 332  LYS A N     1 
ATOM   3376  C  CA    . LYS D 4  332  ? 25.854  4.349   43.734  1.00 74.49  ? 332  LYS A CA    1 
ATOM   3377  C  C     . LYS D 4  332  ? 25.859  4.541   42.218  1.00 89.85  ? 332  LYS A C     1 
ATOM   3378  O  O     . LYS D 4  332  ? 25.749  3.567   41.465  1.00 91.49  ? 332  LYS A O     1 
ATOM   3379  C  CB    . LYS D 4  332  ? 24.482  4.692   44.321  1.00 74.94  ? 332  LYS A CB    1 
ATOM   3380  C  CG    . LYS D 4  332  ? 23.289  4.082   43.598  1.00 88.33  ? 332  LYS A CG    1 
ATOM   3381  C  CD    . LYS D 4  332  ? 21.978  4.510   44.252  1.00 111.69 ? 332  LYS A CD    1 
ATOM   3382  C  CE    . LYS D 4  332  ? 21.786  6.027   44.231  1.00 117.43 ? 332  LYS A CE    1 
ATOM   3383  N  NZ    . LYS D 4  332  ? 21.092  6.498   42.993  1.00 109.38 ? 332  LYS A NZ    1 
ATOM   3384  N  N     . GLU D 4  333  ? 25.990  5.785   41.749  1.00 101.40 ? 333  GLU A N     1 
ATOM   3385  C  CA    . GLU D 4  333  ? 26.067  6.083   40.322  1.00 100.31 ? 333  GLU A CA    1 
ATOM   3386  C  C     . GLU D 4  333  ? 27.489  6.001   39.772  1.00 101.85 ? 333  GLU A C     1 
ATOM   3387  O  O     . GLU D 4  333  ? 27.726  6.429   38.636  1.00 121.02 ? 333  GLU A O     1 
ATOM   3388  C  CB    . GLU D 4  333  ? 25.481  7.469   40.024  1.00 108.29 ? 333  GLU A CB    1 
ATOM   3389  C  CG    . GLU D 4  333  ? 24.024  7.456   39.584  1.00 109.72 ? 333  GLU A CG    1 
ATOM   3390  C  CD    . GLU D 4  333  ? 23.073  7.635   40.744  1.00 120.81 ? 333  GLU A CD    1 
ATOM   3391  O  OE1   . GLU D 4  333  ? 23.543  8.021   41.836  1.00 128.25 ? 333  GLU A OE1   1 
ATOM   3392  O  OE2   . GLU D 4  333  ? 21.863  7.372   40.575  1.00 117.77 ? 333  GLU A OE2   1 
ATOM   3393  N  N     . GLY D 4  334  ? 28.432  5.461   40.541  1.00 89.76  ? 334  GLY A N     1 
ATOM   3394  C  CA    . GLY D 4  334  ? 29.800  5.314   40.086  1.00 87.05  ? 334  GLY A CA    1 
ATOM   3395  C  C     . GLY D 4  334  ? 29.938  4.262   38.995  1.00 86.08  ? 334  GLY A C     1 
ATOM   3396  O  O     . GLY D 4  334  ? 28.976  3.623   38.568  1.00 97.32  ? 334  GLY A O     1 
ATOM   3397  N  N     . ARG D 4  335  ? 31.176  4.108   38.512  1.00 88.99  ? 335  ARG A N     1 
ATOM   3398  C  CA    . ARG D 4  335  ? 31.484  3.017   37.590  1.00 85.55  ? 335  ARG A CA    1 
ATOM   3399  C  C     . ARG D 4  335  ? 31.243  1.672   38.260  1.00 94.41  ? 335  ARG A C     1 
ATOM   3400  O  O     . ARG D 4  335  ? 30.444  0.859   37.786  1.00 105.16 ? 335  ARG A O     1 
ATOM   3401  C  CB    . ARG D 4  335  ? 32.928  3.123   37.088  1.00 82.16  ? 335  ARG A CB    1 
ATOM   3402  C  CG    . ARG D 4  335  ? 33.193  4.317   36.187  1.00 85.87  ? 335  ARG A CG    1 
ATOM   3403  C  CD    . ARG D 4  335  ? 32.311  4.270   34.952  1.00 102.64 ? 335  ARG A CD    1 
ATOM   3404  N  NE    . ARG D 4  335  ? 31.217  5.233   35.027  1.00 119.25 ? 335  ARG A NE    1 
ATOM   3405  C  CZ    . ARG D 4  335  ? 31.283  6.484   34.582  1.00 113.97 ? 335  ARG A CZ    1 
ATOM   3406  N  NH1   . ARG D 4  335  ? 32.401  6.937   34.032  1.00 113.43 ? 335  ARG A NH1   1 
ATOM   3407  N  NH2   . ARG D 4  335  ? 30.229  7.282   34.695  1.00 106.25 ? 335  ARG A NH2   1 
ATOM   3408  N  N     . ILE D 4  336  ? 31.891  1.446   39.393  1.00 93.41  ? 336  ILE A N     1 
ATOM   3409  C  CA    . ILE D 4  336  ? 31.629  0.262   40.197  1.00 86.16  ? 336  ILE A CA    1 
ATOM   3410  C  C     . ILE D 4  336  ? 30.295  0.460   40.906  1.00 82.87  ? 336  ILE A C     1 
ATOM   3411  O  O     . ILE D 4  336  ? 30.006  1.555   41.402  1.00 82.03  ? 336  ILE A O     1 
ATOM   3412  C  CB    . ILE D 4  336  ? 32.775  0.030   41.191  1.00 84.82  ? 336  ILE A CB    1 
ATOM   3413  C  CG1   . ILE D 4  336  ? 34.088  -0.146  40.427  1.00 69.18  ? 336  ILE A CG1   1 
ATOM   3414  C  CG2   . ILE D 4  336  ? 32.512  -1.194  42.044  1.00 100.76 ? 336  ILE A CG2   1 
ATOM   3415  C  CD1   . ILE D 4  336  ? 35.024  1.033   40.565  1.00 67.12  ? 336  ILE A CD1   1 
ATOM   3416  N  N     . ARG D 4  337  ? 29.461  -0.586  40.897  1.00 82.09  ? 337  ARG A N     1 
ATOM   3417  C  CA    . ARG D 4  337  ? 28.119  -0.724  41.480  1.00 89.28  ? 337  ARG A CA    1 
ATOM   3418  C  C     . ARG D 4  337  ? 27.063  0.144   40.788  1.00 81.51  ? 337  ARG A C     1 
ATOM   3419  O  O     . ARG D 4  337  ? 25.876  0.032   41.135  1.00 92.32  ? 337  ARG A O     1 
ATOM   3420  C  CB    . ARG D 4  337  ? 28.101  -0.510  43.010  1.00 85.00  ? 337  ARG A CB    1 
ATOM   3421  C  CG    . ARG D 4  337  ? 27.796  0.873   43.573  1.00 54.27  ? 337  ARG A CG    1 
ATOM   3422  C  CD    . ARG D 4  337  ? 28.088  0.872   45.075  1.00 50.97  ? 337  ARG A CD    1 
ATOM   3423  N  NE    . ARG D 4  337  ? 27.321  1.871   45.816  1.00 92.88  ? 337  ARG A NE    1 
ATOM   3424  C  CZ    . ARG D 4  337  ? 26.113  1.668   46.335  1.00 79.56  ? 337  ARG A CZ    1 
ATOM   3425  N  NH1   . ARG D 4  337  ? 25.500  2.638   46.999  1.00 97.18  ? 337  ARG A NH1   1 
ATOM   3426  N  NH2   . ARG D 4  337  ? 25.516  0.499   46.193  1.00 74.07  ? 337  ARG A NH2   1 
ATOM   3427  N  N     . GLY D 4  338  ? 27.429  0.940   39.779  1.00 67.01  ? 338  GLY A N     1 
ATOM   3428  C  CA    . GLY D 4  338  ? 26.450  1.622   38.953  1.00 74.85  ? 338  GLY A CA    1 
ATOM   3429  C  C     . GLY D 4  338  ? 26.488  1.256   37.476  1.00 81.36  ? 338  GLY A C     1 
ATOM   3430  O  O     . GLY D 4  338  ? 25.448  1.273   36.807  1.00 91.09  ? 338  GLY A O     1 
ATOM   3431  N  N     . ASN D 4  339  ? 27.678  0.940   36.950  1.00 79.23  ? 339  ASN A N     1 
ATOM   3432  C  CA    . ASN D 4  339  ? 27.840  0.404   35.599  1.00 86.68  ? 339  ASN A CA    1 
ATOM   3433  C  C     . ASN D 4  339  ? 28.405  -1.009  35.637  1.00 110.85 ? 339  ASN A C     1 
ATOM   3434  O  O     . ASN D 4  339  ? 27.798  -1.927  35.079  1.00 117.89 ? 339  ASN A O     1 
ATOM   3435  C  CB    . ASN D 4  339  ? 28.743  1.325   34.765  1.00 65.78  ? 339  ASN A CB    1 
ATOM   3436  C  CG    . ASN D 4  339  ? 28.234  2.747   34.715  1.00 80.33  ? 339  ASN A CG    1 
ATOM   3437  O  OD1   . ASN D 4  339  ? 29.016  3.696   34.703  1.00 100.34 ? 339  ASN A OD1   1 
ATOM   3438  N  ND2   . ASN D 4  339  ? 26.915  2.905   34.665  1.00 87.46  ? 339  ASN A ND2   1 
ATOM   3439  N  N     . LEU D 4  340  ? 29.556  -1.209  36.272  1.00 114.97 ? 340  LEU A N     1 
ATOM   3440  C  CA    . LEU D 4  340  ? 29.939  -2.535  36.727  1.00 98.26  ? 340  LEU A CA    1 
ATOM   3441  C  C     . LEU D 4  340  ? 29.075  -2.911  37.921  1.00 100.55 ? 340  LEU A C     1 
ATOM   3442  O  O     . LEU D 4  340  ? 28.581  -2.041  38.640  1.00 119.90 ? 340  LEU A O     1 
ATOM   3443  C  CB    . LEU D 4  340  ? 31.420  -2.566  37.102  1.00 88.36  ? 340  LEU A CB    1 
ATOM   3444  C  CG    . LEU D 4  340  ? 32.335  -2.114  35.965  1.00 88.20  ? 340  LEU A CG    1 
ATOM   3445  C  CD1   . LEU D 4  340  ? 33.727  -1.795  36.486  1.00 88.12  ? 340  LEU A CD1   1 
ATOM   3446  C  CD2   . LEU D 4  340  ? 32.379  -3.177  34.866  1.00 93.18  ? 340  LEU A CD2   1 
ATOM   3447  N  N     . MET D 4  341  ? 28.810  -4.217  38.055  1.00 86.98  ? 341  MET A N     1 
ATOM   3448  C  CA    . MET D 4  341  ? 28.016  -4.861  39.111  1.00 98.80  ? 341  MET A CA    1 
ATOM   3449  C  C     . MET D 4  341  ? 26.521  -4.580  38.989  1.00 96.49  ? 341  MET A C     1 
ATOM   3450  O  O     . MET D 4  341  ? 25.711  -5.236  39.649  1.00 105.81 ? 341  MET A O     1 
ATOM   3451  C  CB    . MET D 4  341  ? 28.472  -4.448  40.518  1.00 93.82  ? 341  MET A CB    1 
ATOM   3452  C  CG    . MET D 4  341  ? 29.821  -4.953  40.933  1.00 84.84  ? 341  MET A CG    1 
ATOM   3453  S  SD    . MET D 4  341  ? 29.793  -5.556  42.622  1.00 79.86  ? 341  MET A SD    1 
ATOM   3454  C  CE    . MET D 4  341  ? 28.692  -4.358  43.389  1.00 67.40  ? 341  MET A CE    1 
ATOM   3455  N  N     . GLY D 4  342  ? 26.146  -3.629  38.141  1.00 95.10  ? 342  GLY A N     1 
ATOM   3456  C  CA    . GLY D 4  342  ? 24.759  -3.368  37.827  1.00 100.31 ? 342  GLY A CA    1 
ATOM   3457  C  C     . GLY D 4  342  ? 24.644  -2.591  36.533  1.00 100.14 ? 342  GLY A C     1 
ATOM   3458  O  O     . GLY D 4  342  ? 25.225  -1.511  36.403  1.00 99.85  ? 342  GLY A O     1 
ATOM   3459  N  N     . LYS D 4  343  ? 23.884  -3.114  35.573  1.00 97.55  ? 343  LYS A N     1 
ATOM   3460  C  CA    . LYS D 4  343  ? 23.772  -2.499  34.260  1.00 94.32  ? 343  LYS A CA    1 
ATOM   3461  C  C     . LYS D 4  343  ? 22.319  -2.487  33.816  1.00 86.68  ? 343  LYS A C     1 
ATOM   3462  O  O     . LYS D 4  343  ? 21.494  -3.279  34.279  1.00 68.85  ? 343  LYS A O     1 
ATOM   3463  C  CB    . LYS D 4  343  ? 24.596  -3.234  33.180  1.00 76.69  ? 343  LYS A CB    1 
ATOM   3464  C  CG    . LYS D 4  343  ? 25.807  -4.007  33.677  1.00 54.93  ? 343  LYS A CG    1 
ATOM   3465  C  CD    . LYS D 4  343  ? 26.859  -4.145  32.588  1.00 56.64  ? 343  LYS A CD    1 
ATOM   3466  C  CE    . LYS D 4  343  ? 28.092  -4.888  33.088  1.00 60.51  ? 343  LYS A CE    1 
ATOM   3467  N  NZ    . LYS D 4  343  ? 29.063  -5.159  31.988  1.00 50.36  ? 343  LYS A NZ    1 
ATOM   3468  N  N     . ARG D 4  344  ? 22.016  -1.571  32.904  1.00 83.64  ? 344  ARG A N     1 
ATOM   3469  C  CA    . ARG D 4  344  ? 20.853  -1.741  32.058  1.00 78.02  ? 344  ARG A CA    1 
ATOM   3470  C  C     . ARG D 4  344  ? 21.218  -2.766  30.998  1.00 88.33  ? 344  ARG A C     1 
ATOM   3471  O  O     . ARG D 4  344  ? 22.322  -2.739  30.448  1.00 97.33  ? 344  ARG A O     1 
ATOM   3472  C  CB    . ARG D 4  344  ? 20.434  -0.415  31.425  1.00 77.58  ? 344  ARG A CB    1 
ATOM   3473  C  CG    . ARG D 4  344  ? 20.649  0.756   32.355  1.00 73.61  ? 344  ARG A CG    1 
ATOM   3474  C  CD    . ARG D 4  344  ? 19.799  1.945   31.994  1.00 62.92  ? 344  ARG A CD    1 
ATOM   3475  N  NE    . ARG D 4  344  ? 19.496  2.708   33.196  1.00 75.13  ? 344  ARG A NE    1 
ATOM   3476  C  CZ    . ARG D 4  344  ? 18.440  2.475   33.969  1.00 90.98  ? 344  ARG A CZ    1 
ATOM   3477  N  NH1   . ARG D 4  344  ? 17.610  1.483   33.673  1.00 63.22  ? 344  ARG A NH1   1 
ATOM   3478  N  NH2   . ARG D 4  344  ? 18.226  3.211   35.052  1.00 121.51 ? 344  ARG A NH2   1 
ATOM   3479  N  N     . VAL D 4  345  ? 20.314  -3.706  30.750  1.00 83.27  ? 345  VAL A N     1 
ATOM   3480  C  CA    . VAL D 4  345  ? 20.659  -4.859  29.935  1.00 73.68  ? 345  VAL A CA    1 
ATOM   3481  C  C     . VAL D 4  345  ? 19.660  -5.016  28.803  1.00 69.12  ? 345  VAL A C     1 
ATOM   3482  O  O     . VAL D 4  345  ? 18.489  -4.635  28.909  1.00 65.38  ? 345  VAL A O     1 
ATOM   3483  C  CB    . VAL D 4  345  ? 20.740  -6.158  30.771  1.00 62.75  ? 345  VAL A CB    1 
ATOM   3484  C  CG1   . VAL D 4  345  ? 21.957  -6.112  31.681  1.00 46.03  ? 345  VAL A CG1   1 
ATOM   3485  C  CG2   . VAL D 4  345  ? 19.447  -6.388  31.561  1.00 69.43  ? 345  VAL A CG2   1 
ATOM   3486  N  N     . ASP D 4  346  ? 20.155  -5.576  27.703  1.00 68.16  ? 346  ASP A N     1 
ATOM   3487  C  CA    . ASP D 4  346  ? 19.333  -5.960  26.569  1.00 64.42  ? 346  ASP A CA    1 
ATOM   3488  C  C     . ASP D 4  346  ? 18.442  -7.145  26.937  1.00 57.50  ? 346  ASP A C     1 
ATOM   3489  O  O     . ASP D 4  346  ? 18.692  -7.855  27.917  1.00 73.32  ? 346  ASP A O     1 
ATOM   3490  C  CB    . ASP D 4  346  ? 20.227  -6.319  25.381  1.00 66.15  ? 346  ASP A CB    1 
ATOM   3491  C  CG    . ASP D 4  346  ? 20.860  -5.101  24.747  1.00 71.81  ? 346  ASP A CG    1 
ATOM   3492  O  OD1   . ASP D 4  346  ? 20.606  -3.981  25.235  1.00 73.61  ? 346  ASP A OD1   1 
ATOM   3493  O  OD2   . ASP D 4  346  ? 21.596  -5.259  23.752  1.00 84.85  ? 346  ASP A OD2   1 
ATOM   3494  N  N     . PHE D 4  347  ? 17.403  -7.356  26.121  1.00 58.11  ? 347  PHE A N     1 
ATOM   3495  C  CA    . PHE D 4  347  ? 16.441  -8.458  26.267  1.00 57.89  ? 347  PHE A CA    1 
ATOM   3496  C  C     . PHE D 4  347  ? 15.753  -8.403  27.636  1.00 61.50  ? 347  PHE A C     1 
ATOM   3497  O  O     . PHE D 4  347  ? 15.756  -9.359  28.419  1.00 78.11  ? 347  PHE A O     1 
ATOM   3498  C  CB    . PHE D 4  347  ? 17.106  -9.823  26.016  1.00 47.91  ? 347  PHE A CB    1 
ATOM   3499  C  CG    . PHE D 4  347  ? 17.931  -9.871  24.751  1.00 49.79  ? 347  PHE A CG    1 
ATOM   3500  C  CD1   . PHE D 4  347  ? 19.304  -9.685  24.790  1.00 61.37  ? 347  PHE A CD1   1 
ATOM   3501  C  CD2   . PHE D 4  347  ? 17.332  -10.092 23.522  1.00 64.03  ? 347  PHE A CD2   1 
ATOM   3502  C  CE1   . PHE D 4  347  ? 20.065  -9.718  23.626  1.00 64.54  ? 347  PHE A CE1   1 
ATOM   3503  C  CE2   . PHE D 4  347  ? 18.091  -10.124 22.356  1.00 75.88  ? 347  PHE A CE2   1 
ATOM   3504  C  CZ    . PHE D 4  347  ? 19.456  -9.932  22.414  1.00 72.43  ? 347  PHE A CZ    1 
ATOM   3505  N  N     . SER D 4  348  ? 15.152  -7.247  27.904  1.00 54.50  ? 348  SER A N     1 
ATOM   3506  C  CA    . SER D 4  348  ? 14.548  -6.967  29.192  1.00 63.71  ? 348  SER A CA    1 
ATOM   3507  C  C     . SER D 4  348  ? 13.208  -6.285  28.961  1.00 70.11  ? 348  SER A C     1 
ATOM   3508  O  O     . SER D 4  348  ? 13.002  -5.619  27.941  1.00 85.26  ? 348  SER A O     1 
ATOM   3509  C  CB    . SER D 4  348  ? 15.467  -6.092  30.074  1.00 74.53  ? 348  SER A CB    1 
ATOM   3510  O  OG    . SER D 4  348  ? 15.927  -4.921  29.404  1.00 66.62  ? 348  SER A OG    1 
ATOM   3511  N  N     . ALA D 4  349  ? 12.292  -6.473  29.912  1.00 57.68  ? 349  ALA A N     1 
ATOM   3512  C  CA    . ALA D 4  349  ? 10.969  -5.880  29.775  1.00 57.59  ? 349  ALA A CA    1 
ATOM   3513  C  C     . ALA D 4  349  ? 10.344  -5.704  31.151  1.00 55.64  ? 349  ALA A C     1 
ATOM   3514  O  O     . ALA D 4  349  ? 10.687  -6.416  32.095  1.00 85.47  ? 349  ALA A O     1 
ATOM   3515  C  CB    . ALA D 4  349  ? 10.063  -6.748  28.899  1.00 60.66  ? 349  ALA A CB    1 
ATOM   3516  N  N     . ARG D 4  350  ? 9.419   -4.750  31.252  1.00 49.89  ? 350  ARG A N     1 
ATOM   3517  C  CA    . ARG D 4  350  ? 8.636   -4.559  32.465  1.00 67.73  ? 350  ARG A CA    1 
ATOM   3518  C  C     . ARG D 4  350  ? 7.221   -4.137  32.082  1.00 65.60  ? 350  ARG A C     1 
ATOM   3519  O  O     . ARG D 4  350  ? 7.008   -3.512  31.036  1.00 58.58  ? 350  ARG A O     1 
ATOM   3520  C  CB    . ARG D 4  350  ? 9.290   -3.524  33.421  1.00 65.07  ? 350  ARG A CB    1 
ATOM   3521  C  CG    . ARG D 4  350  ? 8.878   -2.076  33.199  1.00 83.83  ? 350  ARG A CG    1 
ATOM   3522  C  CD    . ARG D 4  350  ? 9.665   -1.119  34.077  1.00 98.37  ? 350  ARG A CD    1 
ATOM   3523  N  NE    . ARG D 4  350  ? 9.147   -1.024  35.441  1.00 102.13 ? 350  ARG A NE    1 
ATOM   3524  C  CZ    . ARG D 4  350  ? 9.691   -1.629  36.490  1.00 98.12  ? 350  ARG A CZ    1 
ATOM   3525  N  NH1   . ARG D 4  350  ? 10.766  -2.385  36.329  1.00 105.61 ? 350  ARG A NH1   1 
ATOM   3526  N  NH2   . ARG D 4  350  ? 9.166   -1.476  37.697  1.00 94.89  ? 350  ARG A NH2   1 
ATOM   3527  N  N     . THR D 4  351  ? 6.241   -4.546  32.896  1.00 64.09  ? 351  THR A N     1 
ATOM   3528  C  CA    . THR D 4  351  ? 4.874   -4.047  32.767  1.00 53.20  ? 351  THR A CA    1 
ATOM   3529  C  C     . THR D 4  351  ? 4.160   -4.194  34.110  1.00 74.11  ? 351  THR A C     1 
ATOM   3530  O  O     . THR D 4  351  ? 4.628   -4.902  35.013  1.00 115.80 ? 351  THR A O     1 
ATOM   3531  C  CB    . THR D 4  351  ? 4.067   -4.783  31.684  1.00 72.78  ? 351  THR A CB    1 
ATOM   3532  O  OG1   . THR D 4  351  ? 4.764   -4.761  30.436  1.00 109.03 ? 351  THR A OG1   1 
ATOM   3533  C  CG2   . THR D 4  351  ? 2.762   -4.065  31.444  1.00 70.29  ? 351  THR A CG2   1 
ATOM   3534  N  N     . VAL D 4  352  ? 3.047   -3.457  34.235  1.00 55.54  ? 352  VAL A N     1 
ATOM   3535  C  CA    . VAL D 4  352  ? 2.015   -3.717  35.233  1.00 62.66  ? 352  VAL A CA    1 
ATOM   3536  C  C     . VAL D 4  352  ? 1.605   -5.186  35.184  1.00 74.92  ? 352  VAL A C     1 
ATOM   3537  O  O     . VAL D 4  352  ? 1.470   -5.777  34.107  1.00 99.44  ? 352  VAL A O     1 
ATOM   3538  C  CB    . VAL D 4  352  ? 0.818   -2.778  34.973  1.00 60.29  ? 352  VAL A CB    1 
ATOM   3539  C  CG1   . VAL D 4  352  ? -0.459  -3.231  35.698  1.00 49.41  ? 352  VAL A CG1   1 
ATOM   3540  C  CG2   . VAL D 4  352  ? 1.175   -1.333  35.353  1.00 96.46  ? 352  VAL A CG2   1 
ATOM   3541  N  N     . ILE D 4  353  ? 1.410   -5.785  36.364  1.00 69.85  ? 353  ILE A N     1 
ATOM   3542  C  CA    . ILE D 4  353  ? 1.059   -7.195  36.491  1.00 66.65  ? 353  ILE A CA    1 
ATOM   3543  C  C     . ILE D 4  353  ? -0.355  -7.339  37.035  1.00 76.01  ? 353  ILE A C     1 
ATOM   3544  O  O     . ILE D 4  353  ? -0.885  -6.450  37.713  1.00 92.46  ? 353  ILE A O     1 
ATOM   3545  C  CB    . ILE D 4  353  ? 2.059   -7.946  37.391  1.00 75.02  ? 353  ILE A CB    1 
ATOM   3546  C  CG1   . ILE D 4  353  ? 1.936   -7.485  38.846  1.00 76.53  ? 353  ILE A CG1   1 
ATOM   3547  C  CG2   . ILE D 4  353  ? 3.433   -7.691  36.909  1.00 85.75  ? 353  ILE A CG2   1 
ATOM   3548  C  CD1   . ILE D 4  353  ? 2.848   -8.211  39.803  1.00 77.92  ? 353  ILE A CD1   1 
ATOM   3549  N  N     . SER D 4  354  ? -0.970  -8.479  36.707  1.00 67.52  ? 354  SER A N     1 
ATOM   3550  C  CA    . SER D 4  354  ? -2.221  -8.930  37.302  1.00 71.51  ? 354  SER A CA    1 
ATOM   3551  C  C     . SER D 4  354  ? -2.185  -10.455 37.417  1.00 73.48  ? 354  SER A C     1 
ATOM   3552  O  O     . SER D 4  354  ? -1.302  -11.122 36.866  1.00 67.47  ? 354  SER A O     1 
ATOM   3553  C  CB    . SER D 4  354  ? -3.442  -8.426  36.509  1.00 67.08  ? 354  SER A CB    1 
ATOM   3554  O  OG    . SER D 4  354  ? -3.183  -8.390  35.117  1.00 72.23  ? 354  SER A OG    1 
ATOM   3555  N  N     . GLY D 4  355  ? -3.138  -11.013 38.156  1.00 68.15  ? 355  GLY A N     1 
ATOM   3556  C  CA    . GLY D 4  355  ? -3.112  -12.425 38.527  1.00 60.97  ? 355  GLY A CA    1 
ATOM   3557  C  C     . GLY D 4  355  ? -4.131  -13.238 37.752  1.00 74.79  ? 355  GLY A C     1 
ATOM   3558  O  O     . GLY D 4  355  ? -5.273  -12.806 37.567  1.00 91.70  ? 355  GLY A O     1 
ATOM   3559  N  N     . ASP D 4  356  ? -3.710  -14.420 37.314  1.00 80.69  ? 356  ASP A N     1 
ATOM   3560  C  CA    . ASP D 4  356  ? -4.528  -15.297 36.477  1.00 70.87  ? 356  ASP A CA    1 
ATOM   3561  C  C     . ASP D 4  356  ? -4.754  -16.639 37.160  1.00 57.06  ? 356  ASP A C     1 
ATOM   3562  O  O     . ASP D 4  356  ? -3.805  -17.438 37.277  1.00 70.61  ? 356  ASP A O     1 
ATOM   3563  C  CB    . ASP D 4  356  ? -3.859  -15.495 35.118  1.00 65.37  ? 356  ASP A CB    1 
ATOM   3564  C  CG    . ASP D 4  356  ? -4.857  -15.727 34.000  1.00 81.17  ? 356  ASP A CG    1 
ATOM   3565  O  OD1   . ASP D 4  356  ? -6.007  -16.114 34.285  1.00 83.31  ? 356  ASP A OD1   1 
ATOM   3566  O  OD2   . ASP D 4  356  ? -4.493  -15.500 32.830  1.00 96.12  ? 356  ASP A OD2   1 
ATOM   3567  N  N     . PRO D 4  357  ? -5.979  -16.943 37.608  1.00 46.64  ? 357  PRO A N     1 
ATOM   3568  C  CA    . PRO D 4  357  ? -6.225  -18.240 38.264  1.00 70.48  ? 357  PRO A CA    1 
ATOM   3569  C  C     . PRO D 4  357  ? -6.126  -19.423 37.323  1.00 69.09  ? 357  PRO A C     1 
ATOM   3570  O  O     . PRO D 4  357  ? -5.963  -20.560 37.791  1.00 61.37  ? 357  PRO A O     1 
ATOM   3571  C  CB    . PRO D 4  357  ? -7.660  -18.099 38.795  1.00 72.47  ? 357  PRO A CB    1 
ATOM   3572  C  CG    . PRO D 4  357  ? -7.929  -16.644 38.798  1.00 55.18  ? 357  PRO A CG    1 
ATOM   3573  C  CD    . PRO D 4  357  ? -7.159  -16.065 37.671  1.00 45.60  ? 357  PRO A CD    1 
ATOM   3574  N  N     . ASN D 4  358  ? -6.241  -19.198 36.016  1.00 68.94  ? 358  ASN A N     1 
ATOM   3575  C  CA    . ASN D 4  358  ? -6.185  -20.263 35.025  1.00 64.35  ? 358  ASN A CA    1 
ATOM   3576  C  C     . ASN D 4  358  ? -4.837  -20.295 34.308  1.00 65.29  ? 358  ASN A C     1 
ATOM   3577  O  O     . ASN D 4  358  ? -4.735  -20.767 33.171  1.00 76.99  ? 358  ASN A O     1 
ATOM   3578  C  CB    . ASN D 4  358  ? -7.350  -20.133 34.045  1.00 53.08  ? 358  ASN A CB    1 
ATOM   3579  C  CG    . ASN D 4  358  ? -8.709  -20.223 34.740  1.00 61.52  ? 358  ASN A CG    1 
ATOM   3580  O  OD1   . ASN D 4  358  ? -8.818  -20.754 35.850  1.00 74.59  ? 358  ASN A OD1   1 
ATOM   3581  N  ND2   . ASN D 4  358  ? -9.740  -19.697 34.102  1.00 71.78  ? 358  ASN A ND2   1 
ATOM   3582  N  N     . LEU D 4  359  ? -3.797  -19.798 34.981  1.00 53.33  ? 359  LEU A N     1 
ATOM   3583  C  CA    . LEU D 4  359  ? -2.406  -20.019 34.615  1.00 64.81  ? 359  LEU A CA    1 
ATOM   3584  C  C     . LEU D 4  359  ? -1.760  -21.004 35.584  1.00 77.13  ? 359  LEU A C     1 
ATOM   3585  O  O     . LEU D 4  359  ? -2.266  -21.253 36.683  1.00 79.87  ? 359  LEU A O     1 
ATOM   3586  C  CB    . LEU D 4  359  ? -1.619  -18.706 34.612  1.00 57.05  ? 359  LEU A CB    1 
ATOM   3587  C  CG    . LEU D 4  359  ? -1.553  -17.985 33.268  1.00 61.33  ? 359  LEU A CG    1 
ATOM   3588  C  CD1   . LEU D 4  359  ? -0.446  -16.950 33.315  1.00 53.19  ? 359  LEU A CD1   1 
ATOM   3589  C  CD2   . LEU D 4  359  ? -1.346  -18.968 32.113  1.00 84.32  ? 359  LEU A CD2   1 
ATOM   3590  N  N     . GLU D 4  360  ? -0.626  -21.567 35.167  1.00 78.38  ? 360  GLU A N     1 
ATOM   3591  C  CA    . GLU D 4  360  ? 0.101   -22.473 36.043  1.00 96.61  ? 360  GLU A CA    1 
ATOM   3592  C  C     . GLU D 4  360  ? 1.102   -21.694 36.891  1.00 84.17  ? 360  GLU A C     1 
ATOM   3593  O  O     . GLU D 4  360  ? 1.381   -20.520 36.646  1.00 81.59  ? 360  GLU A O     1 
ATOM   3594  C  CB    . GLU D 4  360  ? 0.799   -23.580 35.243  1.00 107.89 ? 360  GLU A CB    1 
ATOM   3595  C  CG    . GLU D 4  360  ? -0.166  -24.551 34.582  1.00 96.02  ? 360  GLU A CG    1 
ATOM   3596  C  CD    . GLU D 4  360  ? -0.888  -25.422 35.594  1.00 97.41  ? 360  GLU A CD    1 
ATOM   3597  O  OE1   . GLU D 4  360  ? -0.289  -25.758 36.637  1.00 101.47 ? 360  GLU A OE1   1 
ATOM   3598  O  OE2   . GLU D 4  360  ? -2.064  -25.761 35.350  1.00 100.01 ? 360  GLU A OE2   1 
ATOM   3599  N  N     . LEU D 4  361  ? 1.632   -22.370 37.918  1.00 88.93  ? 361  LEU A N     1 
ATOM   3600  C  CA    . LEU D 4  361  ? 2.495   -21.714 38.900  1.00 81.38  ? 361  LEU A CA    1 
ATOM   3601  C  C     . LEU D 4  361  ? 3.826   -21.293 38.292  1.00 86.05  ? 361  LEU A C     1 
ATOM   3602  O  O     . LEU D 4  361  ? 4.334   -20.202 38.587  1.00 110.46 ? 361  LEU A O     1 
ATOM   3603  C  CB    . LEU D 4  361  ? 2.728   -22.639 40.093  1.00 66.16  ? 361  LEU A CB    1 
ATOM   3604  C  CG    . LEU D 4  361  ? 3.569   -22.062 41.229  1.00 52.42  ? 361  LEU A CG    1 
ATOM   3605  C  CD1   . LEU D 4  361  ? 2.677   -21.385 42.239  1.00 54.47  ? 361  LEU A CD1   1 
ATOM   3606  C  CD2   . LEU D 4  361  ? 4.385   -23.175 41.889  1.00 55.44  ? 361  LEU A CD2   1 
ATOM   3607  N  N     . ASP D 4  362  ? 4.409   -22.147 37.452  1.00 67.94  ? 362  ASP A N     1 
ATOM   3608  C  CA    . ASP D 4  362  ? 5.638   -21.809 36.750  1.00 71.21  ? 362  ASP A CA    1 
ATOM   3609  C  C     . ASP D 4  362  ? 5.389   -20.989 35.489  1.00 80.09  ? 362  ASP A C     1 
ATOM   3610  O  O     . ASP D 4  362  ? 6.353   -20.552 34.857  1.00 76.59  ? 362  ASP A O     1 
ATOM   3611  C  CB    . ASP D 4  362  ? 6.410   -23.086 36.392  1.00 76.30  ? 362  ASP A CB    1 
ATOM   3612  C  CG    . ASP D 4  362  ? 5.502   -24.212 35.933  1.00 80.66  ? 362  ASP A CG    1 
ATOM   3613  O  OD1   . ASP D 4  362  ? 5.924   -24.971 35.041  1.00 83.55  ? 362  ASP A OD1   1 
ATOM   3614  O  OD2   . ASP D 4  362  ? 4.364   -24.333 36.440  1.00 82.84  ? 362  ASP A OD2   1 
ATOM   3615  N  N     . GLN D 4  363  ? 4.136   -20.769 35.107  1.00 84.60  ? 363  GLN A N     1 
ATOM   3616  C  CA    . GLN D 4  363  ? 3.847   -20.003 33.906  1.00 81.27  ? 363  GLN A CA    1 
ATOM   3617  C  C     . GLN D 4  363  ? 3.763   -18.510 34.209  1.00 94.60  ? 363  GLN A C     1 
ATOM   3618  O  O     . GLN D 4  363  ? 3.323   -18.086 35.284  1.00 100.91 ? 363  GLN A O     1 
ATOM   3619  C  CB    . GLN D 4  363  ? 2.552   -20.479 33.242  1.00 59.84  ? 363  GLN A CB    1 
ATOM   3620  C  CG    . GLN D 4  363  ? 2.748   -21.656 32.295  1.00 51.06  ? 363  GLN A CG    1 
ATOM   3621  C  CD    . GLN D 4  363  ? 1.452   -22.098 31.643  1.00 67.21  ? 363  GLN A CD    1 
ATOM   3622  O  OE1   . GLN D 4  363  ? 0.397   -22.117 32.283  1.00 67.14  ? 363  GLN A OE1   1 
ATOM   3623  N  NE2   . GLN D 4  363  ? 1.526   -22.472 30.367  1.00 78.12  ? 363  GLN A NE2   1 
ATOM   3624  N  N     . VAL D 4  364  ? 4.208   -17.717 33.237  1.00 82.72  ? 364  VAL A N     1 
ATOM   3625  C  CA    . VAL D 4  364  ? 4.115   -16.265 33.278  1.00 66.51  ? 364  VAL A CA    1 
ATOM   3626  C  C     . VAL D 4  364  ? 3.354   -15.817 32.033  1.00 76.82  ? 364  VAL A C     1 
ATOM   3627  O  O     . VAL D 4  364  ? 3.590   -16.328 30.928  1.00 87.42  ? 364  VAL A O     1 
ATOM   3628  C  CB    . VAL D 4  364  ? 5.505   -15.600 33.369  1.00 50.52  ? 364  VAL A CB    1 
ATOM   3629  C  CG1   . VAL D 4  364  ? 6.422   -16.011 32.201  1.00 44.82  ? 364  VAL A CG1   1 
ATOM   3630  C  CG2   . VAL D 4  364  ? 5.391   -14.074 33.515  1.00 47.89  ? 364  VAL A CG2   1 
ATOM   3631  N  N     . GLY D 4  365  ? 2.408   -14.902 32.222  1.00 74.75  ? 365  GLY A N     1 
ATOM   3632  C  CA    . GLY D 4  365  ? 1.662   -14.361 31.108  1.00 70.30  ? 365  GLY A CA    1 
ATOM   3633  C  C     . GLY D 4  365  ? 2.429   -13.266 30.403  1.00 68.14  ? 365  GLY A C     1 
ATOM   3634  O  O     . GLY D 4  365  ? 2.617   -12.185 30.959  1.00 94.75  ? 365  GLY A O     1 
ATOM   3635  N  N     . VAL D 4  366  ? 2.875   -13.523 29.184  1.00 61.01  ? 366  VAL A N     1 
ATOM   3636  C  CA    . VAL D 4  366  ? 3.676   -12.571 28.414  1.00 64.95  ? 366  VAL A CA    1 
ATOM   3637  C  C     . VAL D 4  366  ? 2.795   -11.975 27.324  1.00 69.93  ? 366  VAL A C     1 
ATOM   3638  O  O     . VAL D 4  366  ? 2.155   -12.725 26.577  1.00 68.50  ? 366  VAL A O     1 
ATOM   3639  C  CB    . VAL D 4  366  ? 4.935   -13.225 27.812  1.00 79.19  ? 366  VAL A CB    1 
ATOM   3640  C  CG1   . VAL D 4  366  ? 5.750   -12.204 26.994  1.00 42.51  ? 366  VAL A CG1   1 
ATOM   3641  C  CG2   . VAL D 4  366  ? 5.783   -13.870 28.917  1.00 67.09  ? 366  VAL A CG2   1 
ATOM   3642  N  N     . PRO D 4  367  ? 2.695   -10.650 27.237  1.00 78.52  ? 367  PRO A N     1 
ATOM   3643  C  CA    . PRO D 4  367  ? 1.935   -10.019 26.153  1.00 79.30  ? 367  PRO A CA    1 
ATOM   3644  C  C     . PRO D 4  367  ? 2.553   -10.312 24.794  1.00 94.45  ? 367  PRO A C     1 
ATOM   3645  O  O     . PRO D 4  367  ? 3.748   -10.598 24.680  1.00 109.18 ? 367  PRO A O     1 
ATOM   3646  C  CB    . PRO D 4  367  ? 2.026   -8.526  26.488  1.00 79.17  ? 367  PRO A CB    1 
ATOM   3647  C  CG    . PRO D 4  367  ? 2.312   -8.489  27.964  1.00 72.05  ? 367  PRO A CG    1 
ATOM   3648  C  CD    . PRO D 4  367  ? 3.145   -9.683  28.250  1.00 79.59  ? 367  PRO A CD    1 
ATOM   3649  N  N     . LYS D 4  368  ? 1.720   -10.243 23.751  1.00 86.35  ? 368  LYS A N     1 
ATOM   3650  C  CA    . LYS D 4  368  ? 2.232   -10.428 22.397  1.00 82.89  ? 368  LYS A CA    1 
ATOM   3651  C  C     . LYS D 4  368  ? 3.149   -9.280  21.982  1.00 88.40  ? 368  LYS A C     1 
ATOM   3652  O  O     . LYS D 4  368  ? 4.083   -9.494  21.198  1.00 97.61  ? 368  LYS A O     1 
ATOM   3653  C  CB    . LYS D 4  368  ? 1.072   -10.571 21.408  1.00 82.98  ? 368  LYS A CB    1 
ATOM   3654  C  CG    . LYS D 4  368  ? 0.389   -11.933 21.426  1.00 84.53  ? 368  LYS A CG    1 
ATOM   3655  C  CD    . LYS D 4  368  ? -0.701  -12.029 20.362  1.00 104.07 ? 368  LYS A CD    1 
ATOM   3656  C  CE    . LYS D 4  368  ? -2.070  -11.670 20.930  1.00 108.73 ? 368  LYS A CE    1 
ATOM   3657  N  NZ    . LYS D 4  368  ? -3.187  -12.133 20.058  1.00 99.35  ? 368  LYS A NZ    1 
ATOM   3658  N  N     . SER D 4  369  ? 2.901   -8.068  22.505  1.00 78.33  ? 369  SER A N     1 
ATOM   3659  C  CA    . SER D 4  369  ? 3.755   -6.913  22.221  1.00 78.58  ? 369  SER A CA    1 
ATOM   3660  C  C     . SER D 4  369  ? 5.188   -7.171  22.658  1.00 98.38  ? 369  SER A C     1 
ATOM   3661  O  O     . SER D 4  369  ? 6.143   -6.831  21.948  1.00 107.21 ? 369  SER A O     1 
ATOM   3662  C  CB    . SER D 4  369  ? 3.240   -5.672  22.959  1.00 55.90  ? 369  SER A CB    1 
ATOM   3663  O  OG    . SER D 4  369  ? 1.830   -5.627  23.036  1.00 42.64  ? 369  SER A OG    1 
ATOM   3664  N  N     . ILE D 4  370  ? 5.346   -7.749  23.846  1.00 99.92  ? 370  ILE A N     1 
ATOM   3665  C  CA    . ILE D 4  370  ? 6.658   -8.047  24.395  1.00 88.49  ? 370  ILE A CA    1 
ATOM   3666  C  C     . ILE D 4  370  ? 7.241   -9.280  23.728  1.00 92.43  ? 370  ILE A C     1 
ATOM   3667  O  O     . ILE D 4  370  ? 8.449   -9.354  23.471  1.00 85.95  ? 370  ILE A O     1 
ATOM   3668  C  CB    . ILE D 4  370  ? 6.538   -8.220  25.919  1.00 70.81  ? 370  ILE A CB    1 
ATOM   3669  C  CG1   . ILE D 4  370  ? 5.785   -7.030  26.529  1.00 47.81  ? 370  ILE A CG1   1 
ATOM   3670  C  CG2   . ILE D 4  370  ? 7.896   -8.395  26.535  1.00 82.80  ? 370  ILE A CG2   1 
ATOM   3671  C  CD1   . ILE D 4  370  ? 5.714   -7.033  28.039  1.00 45.25  ? 370  ILE A CD1   1 
ATOM   3672  N  N     . ALA D 4  371  ? 6.383   -10.257 23.427  1.00 96.04  ? 371  ALA A N     1 
ATOM   3673  C  CA    . ALA D 4  371  ? 6.846   -11.494 22.816  1.00 79.60  ? 371  ALA A CA    1 
ATOM   3674  C  C     . ALA D 4  371  ? 7.316   -11.272 21.384  1.00 82.76  ? 371  ALA A C     1 
ATOM   3675  O  O     . ALA D 4  371  ? 8.236   -11.963 20.928  1.00 82.92  ? 371  ALA A O     1 
ATOM   3676  C  CB    . ALA D 4  371  ? 5.733   -12.542 22.869  1.00 75.81  ? 371  ALA A CB    1 
ATOM   3677  N  N     . LYS D 4  372  ? 6.715   -10.309 20.670  1.00 85.14  ? 372  LYS A N     1 
ATOM   3678  C  CA    . LYS D 4  372  ? 7.194   -9.903  19.351  1.00 73.41  ? 372  LYS A CA    1 
ATOM   3679  C  C     . LYS D 4  372  ? 8.465   -9.064  19.410  1.00 64.75  ? 372  LYS A C     1 
ATOM   3680  O  O     . LYS D 4  372  ? 9.112   -8.877  18.370  1.00 59.73  ? 372  LYS A O     1 
ATOM   3681  C  CB    . LYS D 4  372  ? 6.111   -9.118  18.591  1.00 76.79  ? 372  LYS A CB    1 
ATOM   3682  C  CG    . LYS D 4  372  ? 4.949   -9.962  18.066  1.00 74.98  ? 372  LYS A CG    1 
ATOM   3683  C  CD    . LYS D 4  372  ? 4.136   -9.233  16.983  1.00 66.43  ? 372  LYS A CD    1 
ATOM   3684  C  CE    . LYS D 4  372  ? 3.196   -8.184  17.550  1.00 59.73  ? 372  LYS A CE    1 
ATOM   3685  N  NZ    . LYS D 4  372  ? 2.465   -7.482  16.457  1.00 49.30  ? 372  LYS A NZ    1 
ATOM   3686  N  N     . THR D 4  373  ? 8.835   -8.558  20.589  1.00 55.88  ? 373  THR A N     1 
ATOM   3687  C  CA    . THR D 4  373  ? 10.029  -7.739  20.777  1.00 50.13  ? 373  THR A CA    1 
ATOM   3688  C  C     . THR D 4  373  ? 11.247  -8.564  21.176  1.00 67.72  ? 373  THR A C     1 
ATOM   3689  O  O     . THR D 4  373  ? 12.300  -8.460  20.539  1.00 75.14  ? 373  THR A O     1 
ATOM   3690  C  CB    . THR D 4  373  ? 9.769   -6.664  21.840  1.00 43.10  ? 373  THR A CB    1 
ATOM   3691  O  OG1   . THR D 4  373  ? 8.404   -6.223  21.760  1.00 46.29  ? 373  THR A OG1   1 
ATOM   3692  C  CG2   . THR D 4  373  ? 10.719  -5.479  21.668  1.00 44.36  ? 373  THR A CG2   1 
ATOM   3693  N  N     . LEU D 4  374  ? 11.116  -9.386  22.222  1.00 64.40  ? 374  LEU A N     1 
ATOM   3694  C  CA    . LEU D 4  374  ? 12.243  -10.140 22.756  1.00 52.02  ? 374  LEU A CA    1 
ATOM   3695  C  C     . LEU D 4  374  ? 12.521  -11.376 21.904  1.00 70.99  ? 374  LEU A C     1 
ATOM   3696  O  O     . LEU D 4  374  ? 11.602  -12.127 21.554  1.00 83.13  ? 374  LEU A O     1 
ATOM   3697  C  CB    . LEU D 4  374  ? 11.976  -10.539 24.209  1.00 57.66  ? 374  LEU A CB    1 
ATOM   3698  C  CG    . LEU D 4  374  ? 11.627  -9.420  25.201  1.00 50.04  ? 374  LEU A CG    1 
ATOM   3699  C  CD1   . LEU D 4  374  ? 11.170  -9.999  26.526  1.00 43.37  ? 374  LEU A CD1   1 
ATOM   3700  C  CD2   . LEU D 4  374  ? 12.795  -8.464  25.427  1.00 69.28  ? 374  LEU A CD2   1 
ATOM   3701  N  N     . THR D 4  375  ? 13.795  -11.587 21.571  1.00 76.57  ? 375  THR A N     1 
ATOM   3702  C  CA    . THR D 4  375  ? 14.199  -12.658 20.674  1.00 85.36  ? 375  THR A CA    1 
ATOM   3703  C  C     . THR D 4  375  ? 15.112  -13.645 21.390  1.00 75.65  ? 375  THR A C     1 
ATOM   3704  O  O     . THR D 4  375  ? 15.695  -13.353 22.439  1.00 66.20  ? 375  THR A O     1 
ATOM   3705  C  CB    . THR D 4  375  ? 14.929  -12.124 19.426  1.00 83.53  ? 375  THR A CB    1 
ATOM   3706  O  OG1   . THR D 4  375  ? 16.288  -11.810 19.763  1.00 89.15  ? 375  THR A OG1   1 
ATOM   3707  C  CG2   . THR D 4  375  ? 14.243  -10.886 18.881  1.00 86.09  ? 375  THR A CG2   1 
ATOM   3708  N  N     . TYR D 4  376  ? 15.226  -14.827 20.794  1.00 66.45  ? 376  TYR A N     1 
ATOM   3709  C  CA    . TYR D 4  376  ? 16.207  -15.823 21.193  1.00 55.21  ? 376  TYR A CA    1 
ATOM   3710  C  C     . TYR D 4  376  ? 16.903  -16.346 19.942  1.00 63.11  ? 376  TYR A C     1 
ATOM   3711  O  O     . TYR D 4  376  ? 16.223  -16.709 18.956  1.00 78.84  ? 376  TYR A O     1 
ATOM   3712  C  CB    . TYR D 4  376  ? 15.561  -16.977 21.977  1.00 62.05  ? 376  TYR A CB    1 
ATOM   3713  C  CG    . TYR D 4  376  ? 16.513  -18.128 22.215  1.00 63.85  ? 376  TYR A CG    1 
ATOM   3714  C  CD1   . TYR D 4  376  ? 17.734  -17.928 22.839  1.00 73.31  ? 376  TYR A CD1   1 
ATOM   3715  C  CD2   . TYR D 4  376  ? 16.193  -19.410 21.805  1.00 74.84  ? 376  TYR A CD2   1 
ATOM   3716  C  CE1   . TYR D 4  376  ? 18.613  -18.970 23.043  1.00 79.05  ? 376  TYR A CE1   1 
ATOM   3717  C  CE2   . TYR D 4  376  ? 17.068  -20.463 22.011  1.00 87.39  ? 376  TYR A CE2   1 
ATOM   3718  C  CZ    . TYR D 4  376  ? 18.277  -20.237 22.627  1.00 85.83  ? 376  TYR A CZ    1 
ATOM   3719  O  OH    . TYR D 4  376  ? 19.151  -21.283 22.835  1.00 94.36  ? 376  TYR A OH    1 
ATOM   3720  N  N     . PRO D 4  377  ? 18.239  -16.344 19.907  1.00 67.22  ? 377  PRO A N     1 
ATOM   3721  C  CA    . PRO D 4  377  ? 18.960  -16.988 18.796  1.00 79.14  ? 377  PRO A CA    1 
ATOM   3722  C  C     . PRO D 4  377  ? 18.775  -18.497 18.832  1.00 92.18  ? 377  PRO A C     1 
ATOM   3723  O  O     . PRO D 4  377  ? 19.106  -19.150 19.824  1.00 103.53 ? 377  PRO A O     1 
ATOM   3724  C  CB    . PRO D 4  377  ? 20.422  -16.595 19.045  1.00 82.46  ? 377  PRO A CB    1 
ATOM   3725  C  CG    . PRO D 4  377  ? 20.337  -15.334 19.834  1.00 87.52  ? 377  PRO A CG    1 
ATOM   3726  C  CD    . PRO D 4  377  ? 19.129  -15.491 20.714  1.00 76.29  ? 377  PRO A CD    1 
ATOM   3727  N  N     . GLU D 4  378  ? 18.253  -19.049 17.739  1.00 86.41  ? 378  GLU A N     1 
ATOM   3728  C  CA    . GLU D 4  378  ? 18.111  -20.487 17.564  1.00 79.34  ? 378  GLU A CA    1 
ATOM   3729  C  C     . GLU D 4  378  ? 18.979  -20.905 16.387  1.00 88.67  ? 378  GLU A C     1 
ATOM   3730  O  O     . GLU D 4  378  ? 18.802  -20.396 15.275  1.00 103.04 ? 378  GLU A O     1 
ATOM   3731  C  CB    . GLU D 4  378  ? 16.648  -20.868 17.327  1.00 73.30  ? 378  GLU A CB    1 
ATOM   3732  C  CG    . GLU D 4  378  ? 16.377  -22.352 17.401  1.00 87.63  ? 378  GLU A CG    1 
ATOM   3733  C  CD    . GLU D 4  378  ? 15.100  -22.658 18.141  1.00 96.37  ? 378  GLU A CD    1 
ATOM   3734  O  OE1   . GLU D 4  378  ? 14.684  -21.827 18.971  1.00 97.62  ? 378  GLU A OE1   1 
ATOM   3735  O  OE2   . GLU D 4  378  ? 14.516  -23.730 17.893  1.00 105.18 ? 378  GLU A OE2   1 
ATOM   3736  N  N     . VAL D 4  379  ? 19.942  -21.794 16.640  1.00 88.67  ? 379  VAL A N     1 
ATOM   3737  C  CA    . VAL D 4  379  ? 20.756  -22.319 15.552  1.00 95.72  ? 379  VAL A CA    1 
ATOM   3738  C  C     . VAL D 4  379  ? 19.934  -23.337 14.767  1.00 106.95 ? 379  VAL A C     1 
ATOM   3739  O  O     . VAL D 4  379  ? 19.131  -24.093 15.333  1.00 106.77 ? 379  VAL A O     1 
ATOM   3740  C  CB    . VAL D 4  379  ? 22.063  -22.935 16.088  1.00 91.63  ? 379  VAL A CB    1 
ATOM   3741  C  CG1   . VAL D 4  379  ? 23.111  -23.025 14.978  1.00 78.32  ? 379  VAL A CG1   1 
ATOM   3742  C  CG2   . VAL D 4  379  ? 22.596  -22.127 17.274  1.00 99.06  ? 379  VAL A CG2   1 
ATOM   3743  N  N     . VAL D 4  380  ? 20.128  -23.353 13.450  1.00 113.83 ? 380  VAL A N     1 
ATOM   3744  C  CA    . VAL D 4  380  ? 19.340  -24.204 12.562  1.00 116.31 ? 380  VAL A CA    1 
ATOM   3745  C  C     . VAL D 4  380  ? 19.876  -25.633 12.627  1.00 119.08 ? 380  VAL A C     1 
ATOM   3746  O  O     . VAL D 4  380  ? 20.979  -25.927 12.161  1.00 115.35 ? 380  VAL A O     1 
ATOM   3747  C  CB    . VAL D 4  380  ? 19.331  -23.669 11.124  1.00 112.74 ? 380  VAL A CB    1 
ATOM   3748  C  CG1   . VAL D 4  380  ? 18.280  -22.581 10.965  1.00 117.94 ? 380  VAL A CG1   1 
ATOM   3749  C  CG2   . VAL D 4  380  ? 20.672  -23.088 10.776  1.00 102.47 ? 380  VAL A CG2   1 
ATOM   3750  N  N     . THR D 4  381  ? 19.095  -26.517 13.226  1.00 122.64 ? 381  THR A N     1 
ATOM   3751  C  CA    . THR D 4  381  ? 19.311  -27.953 13.233  1.00 117.38 ? 381  THR A CA    1 
ATOM   3752  C  C     . THR D 4  381  ? 18.426  -28.596 12.176  1.00 114.70 ? 381  THR A C     1 
ATOM   3753  O  O     . THR D 4  381  ? 17.581  -27.931 11.570  1.00 119.23 ? 381  THR A O     1 
ATOM   3754  C  CB    . THR D 4  381  ? 18.998  -28.523 14.627  1.00 119.48 ? 381  THR A CB    1 
ATOM   3755  O  OG1   . THR D 4  381  ? 17.579  -28.615 14.807  1.00 131.56 ? 381  THR A OG1   1 
ATOM   3756  C  CG2   . THR D 4  381  ? 19.588  -27.646 15.735  1.00 109.87 ? 381  THR A CG2   1 
ATOM   3757  N  N     . PRO D 4  382  ? 18.612  -29.887 11.889  1.00 101.45 ? 382  PRO A N     1 
ATOM   3758  C  CA    . PRO D 4  382  ? 17.580  -30.603 11.122  1.00 109.06 ? 382  PRO A CA    1 
ATOM   3759  C  C     . PRO D 4  382  ? 16.239  -30.693 11.844  1.00 109.34 ? 382  PRO A C     1 
ATOM   3760  O  O     . PRO D 4  382  ? 15.210  -30.890 11.182  1.00 107.79 ? 382  PRO A O     1 
ATOM   3761  C  CB    . PRO D 4  382  ? 18.205  -31.987 10.909  1.00 111.47 ? 382  PRO A CB    1 
ATOM   3762  C  CG    . PRO D 4  382  ? 19.670  -31.706 10.860  1.00 100.50 ? 382  PRO A CG    1 
ATOM   3763  C  CD    . PRO D 4  382  ? 19.900  -30.611 11.870  1.00 89.83  ? 382  PRO A CD    1 
ATOM   3764  N  N     . TYR D 4  383  ? 16.217  -30.538 13.174  1.00 106.86 ? 383  TYR A N     1 
ATOM   3765  C  CA    . TYR D 4  383  ? 14.986  -30.694 13.942  1.00 111.90 ? 383  TYR A CA    1 
ATOM   3766  C  C     . TYR D 4  383  ? 14.111  -29.442 13.913  1.00 110.62 ? 383  TYR A C     1 
ATOM   3767  O  O     . TYR D 4  383  ? 12.889  -29.549 14.063  1.00 117.77 ? 383  TYR A O     1 
ATOM   3768  C  CB    . TYR D 4  383  ? 15.308  -31.068 15.398  1.00 123.96 ? 383  TYR A CB    1 
ATOM   3769  C  CG    . TYR D 4  383  ? 16.549  -31.923 15.563  1.00 137.64 ? 383  TYR A CG    1 
ATOM   3770  C  CD1   . TYR D 4  383  ? 17.668  -31.439 16.233  1.00 132.55 ? 383  TYR A CD1   1 
ATOM   3771  C  CD2   . TYR D 4  383  ? 16.609  -33.206 15.033  1.00 155.97 ? 383  TYR A CD2   1 
ATOM   3772  C  CE1   . TYR D 4  383  ? 18.810  -32.210 16.375  1.00 136.81 ? 383  TYR A CE1   1 
ATOM   3773  C  CE2   . TYR D 4  383  ? 17.748  -33.984 15.171  1.00 163.75 ? 383  TYR A CE2   1 
ATOM   3774  C  CZ    . TYR D 4  383  ? 18.844  -33.481 15.842  1.00 156.29 ? 383  TYR A CZ    1 
ATOM   3775  O  OH    . TYR D 4  383  ? 19.975  -34.253 15.981  1.00 167.01 ? 383  TYR A OH    1 
ATOM   3776  N  N     . ASN D 4  384  ? 14.700  -28.255 13.725  1.00 108.58 ? 384  ASN A N     1 
ATOM   3777  C  CA    . ASN D 4  384  ? 13.952  -27.011 13.862  1.00 110.35 ? 384  ASN A CA    1 
ATOM   3778  C  C     . ASN D 4  384  ? 13.670  -26.290 12.550  1.00 104.38 ? 384  ASN A C     1 
ATOM   3779  O  O     . ASN D 4  384  ? 12.804  -25.406 12.531  1.00 91.69  ? 384  ASN A O     1 
ATOM   3780  C  CB    . ASN D 4  384  ? 14.683  -26.036 14.805  1.00 112.56 ? 384  ASN A CB    1 
ATOM   3781  C  CG    . ASN D 4  384  ? 16.137  -25.772 14.397  1.00 107.88 ? 384  ASN A CG    1 
ATOM   3782  O  OD1   . ASN D 4  384  ? 16.514  -25.878 13.223  1.00 58.61  ? 384  ASN A OD1   1 
ATOM   3783  N  ND2   . ASN D 4  384  ? 16.960  -25.419 15.381  1.00 130.56 ? 384  ASN A ND2   1 
ATOM   3784  N  N     . ILE D 4  385  ? 14.380  -26.637 11.470  1.00 103.18 ? 385  ILE A N     1 
ATOM   3785  C  CA    . ILE D 4  385  ? 14.401  -25.807 10.267  1.00 98.20  ? 385  ILE A CA    1 
ATOM   3786  C  C     . ILE D 4  385  ? 13.025  -25.758 9.605   1.00 107.34 ? 385  ILE A C     1 
ATOM   3787  O  O     . ILE D 4  385  ? 12.627  -24.719 9.059   1.00 115.07 ? 385  ILE A O     1 
ATOM   3788  C  CB    . ILE D 4  385  ? 15.508  -26.309 9.313   1.00 82.19  ? 385  ILE A CB    1 
ATOM   3789  C  CG1   . ILE D 4  385  ? 15.507  -25.537 7.987   1.00 64.62  ? 385  ILE A CG1   1 
ATOM   3790  C  CG2   . ILE D 4  385  ? 15.407  -27.818 9.094   1.00 93.37  ? 385  ILE A CG2   1 
ATOM   3791  C  CD1   . ILE D 4  385  ? 16.711  -25.809 7.102   1.00 65.77  ? 385  ILE A CD1   1 
ATOM   3792  N  N     . ASP D 4  386  ? 12.250  -26.842 9.708   1.00 118.55 ? 386  ASP A N     1 
ATOM   3793  C  CA    . ASP D 4  386  ? 10.895  -26.846 9.163   1.00 119.52 ? 386  ASP A CA    1 
ATOM   3794  C  C     . ASP D 4  386  ? 9.970   -25.908 9.935   1.00 100.77 ? 386  ASP A C     1 
ATOM   3795  O  O     . ASP D 4  386  ? 8.995   -25.400 9.369   1.00 93.55  ? 386  ASP A O     1 
ATOM   3796  C  CB    . ASP D 4  386  ? 10.339  -28.271 9.160   1.00 129.55 ? 386  ASP A CB    1 
ATOM   3797  C  CG    . ASP D 4  386  ? 11.059  -29.177 8.175   1.00 134.88 ? 386  ASP A CG    1 
ATOM   3798  O  OD1   . ASP D 4  386  ? 11.351  -28.721 7.049   1.00 137.09 ? 386  ASP A OD1   1 
ATOM   3799  O  OD2   . ASP D 4  386  ? 11.335  -30.343 8.526   1.00 141.98 ? 386  ASP A OD2   1 
ATOM   3800  N  N     . ARG D 4  387  ? 10.259  -25.660 11.214  1.00 80.35  ? 387  ARG A N     1 
ATOM   3801  C  CA    . ARG D 4  387  ? 9.515   -24.674 11.987  1.00 73.95  ? 387  ARG A CA    1 
ATOM   3802  C  C     . ARG D 4  387  ? 10.111  -23.272 11.858  1.00 80.63  ? 387  ARG A C     1 
ATOM   3803  O  O     . ARG D 4  387  ? 9.366   -22.288 11.782  1.00 93.71  ? 387  ARG A O     1 
ATOM   3804  C  CB    . ARG D 4  387  ? 9.470   -25.086 13.459  1.00 82.96  ? 387  ARG A CB    1 
ATOM   3805  C  CG    . ARG D 4  387  ? 8.628   -24.167 14.332  1.00 95.73  ? 387  ARG A CG    1 
ATOM   3806  C  CD    . ARG D 4  387  ? 8.936   -24.380 15.802  1.00 112.80 ? 387  ARG A CD    1 
ATOM   3807  N  NE    . ARG D 4  387  ? 10.368  -24.248 16.057  1.00 119.83 ? 387  ARG A NE    1 
ATOM   3808  C  CZ    . ARG D 4  387  ? 10.909  -24.112 17.264  1.00 98.30  ? 387  ARG A CZ    1 
ATOM   3809  N  NH1   . ARG D 4  387  ? 10.139  -24.084 18.344  1.00 102.27 ? 387  ARG A NH1   1 
ATOM   3810  N  NH2   . ARG D 4  387  ? 12.224  -23.996 17.389  1.00 74.29  ? 387  ARG A NH2   1 
ATOM   3811  N  N     . LEU D 4  388  ? 11.446  -23.169 11.812  1.00 69.22  ? 388  LEU A N     1 
ATOM   3812  C  CA    . LEU D 4  388  ? 12.109  -21.867 11.713  1.00 74.78  ? 388  LEU A CA    1 
ATOM   3813  C  C     . LEU D 4  388  ? 11.834  -21.180 10.377  1.00 81.30  ? 388  LEU A C     1 
ATOM   3814  O  O     . LEU D 4  388  ? 11.710  -19.949 10.324  1.00 70.50  ? 388  LEU A O     1 
ATOM   3815  C  CB    . LEU D 4  388  ? 13.615  -22.030 11.919  1.00 76.10  ? 388  LEU A CB    1 
ATOM   3816  C  CG    . LEU D 4  388  ? 14.053  -22.326 13.354  1.00 84.26  ? 388  LEU A CG    1 
ATOM   3817  C  CD1   . LEU D 4  388  ? 15.571  -22.270 13.498  1.00 88.57  ? 388  LEU A CD1   1 
ATOM   3818  C  CD2   . LEU D 4  388  ? 13.379  -21.361 14.328  1.00 81.07  ? 388  LEU A CD2   1 
ATOM   3819  N  N     . THR D 4  389  ? 11.763  -21.948 9.283   1.00 99.89  ? 389  THR A N     1 
ATOM   3820  C  CA    . THR D 4  389  ? 11.444  -21.347 7.990   1.00 95.58  ? 389  THR A CA    1 
ATOM   3821  C  C     . THR D 4  389  ? 10.039  -20.756 7.997   1.00 82.94  ? 389  THR A C     1 
ATOM   3822  O  O     . THR D 4  389  ? 9.823   -19.655 7.480   1.00 87.60  ? 389  THR A O     1 
ATOM   3823  C  CB    . THR D 4  389  ? 11.592  -22.379 6.866   1.00 92.83  ? 389  THR A CB    1 
ATOM   3824  O  OG1   . THR D 4  389  ? 12.669  -23.273 7.171   1.00 107.18 ? 389  THR A OG1   1 
ATOM   3825  C  CG2   . THR D 4  389  ? 11.896  -21.692 5.541   1.00 87.85  ? 389  THR A CG2   1 
ATOM   3826  N  N     . GLN D 4  390  ? 9.083   -21.451 8.628   1.00 76.42  ? 390  GLN A N     1 
ATOM   3827  C  CA    . GLN D 4  390  ? 7.729   -20.918 8.752   1.00 80.54  ? 390  GLN A CA    1 
ATOM   3828  C  C     . GLN D 4  390  ? 7.682   -19.711 9.682   1.00 74.58  ? 390  GLN A C     1 
ATOM   3829  O  O     . GLN D 4  390  ? 6.888   -18.789 9.457   1.00 87.16  ? 390  GLN A O     1 
ATOM   3830  C  CB    . GLN D 4  390  ? 6.770   -22.012 9.243   1.00 95.35  ? 390  GLN A CB    1 
ATOM   3831  C  CG    . GLN D 4  390  ? 5.361   -21.939 8.638   1.00 121.63 ? 390  GLN A CG    1 
ATOM   3832  C  CD    . GLN D 4  390  ? 4.430   -20.998 9.385   1.00 136.50 ? 390  GLN A CD    1 
ATOM   3833  O  OE1   . GLN D 4  390  ? 4.744   -20.536 10.482  1.00 147.57 ? 390  GLN A OE1   1 
ATOM   3834  N  NE2   . GLN D 4  390  ? 3.282   -20.694 8.780   1.00 129.14 ? 390  GLN A NE2   1 
ATOM   3835  N  N     . LEU D 4  391  ? 8.521   -19.695 10.721  1.00 78.23  ? 391  LEU A N     1 
ATOM   3836  C  CA    . LEU D 4  391  ? 8.601   -18.524 11.596  1.00 89.34  ? 391  LEU A CA    1 
ATOM   3837  C  C     . LEU D 4  391  ? 9.128   -17.299 10.851  1.00 82.04  ? 391  LEU A C     1 
ATOM   3838  O  O     . LEU D 4  391  ? 8.578   -16.199 10.989  1.00 75.19  ? 391  LEU A O     1 
ATOM   3839  C  CB    . LEU D 4  391  ? 9.482   -18.836 12.806  1.00 90.45  ? 391  LEU A CB    1 
ATOM   3840  C  CG    . LEU D 4  391  ? 8.930   -19.835 13.825  1.00 78.53  ? 391  LEU A CG    1 
ATOM   3841  C  CD1   . LEU D 4  391  ? 9.937   -20.039 14.929  1.00 87.14  ? 391  LEU A CD1   1 
ATOM   3842  C  CD2   . LEU D 4  391  ? 7.602   -19.355 14.402  1.00 63.19  ? 391  LEU A CD2   1 
ATOM   3843  N  N     . VAL D 4  392  ? 10.192  -17.472 10.059  1.00 85.05  ? 392  VAL A N     1 
ATOM   3844  C  CA    . VAL D 4  392  ? 10.715  -16.377 9.242   1.00 82.06  ? 392  VAL A CA    1 
ATOM   3845  C  C     . VAL D 4  392  ? 9.683   -15.951 8.197   1.00 94.60  ? 392  VAL A C     1 
ATOM   3846  O  O     . VAL D 4  392  ? 9.527   -14.757 7.904   1.00 102.01 ? 392  VAL A O     1 
ATOM   3847  C  CB    . VAL D 4  392  ? 12.057  -16.789 8.601   1.00 68.05  ? 392  VAL A CB    1 
ATOM   3848  C  CG1   . VAL D 4  392  ? 12.588  -15.707 7.686   1.00 64.21  ? 392  VAL A CG1   1 
ATOM   3849  C  CG2   . VAL D 4  392  ? 13.096  -17.088 9.676   1.00 76.87  ? 392  VAL A CG2   1 
ATOM   3850  N  N     . ARG D 4  393  ? 8.941   -16.919 7.646   1.00 101.55 ? 393  ARG A N     1 
ATOM   3851  C  CA    . ARG D 4  393  ? 7.870   -16.617 6.697   1.00 106.60 ? 393  ARG A CA    1 
ATOM   3852  C  C     . ARG D 4  393  ? 6.778   -15.769 7.340   1.00 111.39 ? 393  ARG A C     1 
ATOM   3853  O  O     . ARG D 4  393  ? 6.219   -14.870 6.698   1.00 134.31 ? 393  ARG A O     1 
ATOM   3854  C  CB    . ARG D 4  393  ? 7.292   -17.927 6.152   1.00 110.59 ? 393  ARG A CB    1 
ATOM   3855  C  CG    . ARG D 4  393  ? 5.951   -17.822 5.433   1.00 113.89 ? 393  ARG A CG    1 
ATOM   3856  C  CD    . ARG D 4  393  ? 5.794   -18.945 4.428   1.00 120.41 ? 393  ARG A CD    1 
ATOM   3857  N  NE    . ARG D 4  393  ? 6.852   -18.906 3.423   1.00 129.95 ? 393  ARG A NE    1 
ATOM   3858  C  CZ    . ARG D 4  393  ? 7.749   -19.871 3.249   1.00 123.59 ? 393  ARG A CZ    1 
ATOM   3859  N  NH1   . ARG D 4  393  ? 7.720   -20.949 4.022   1.00 102.41 ? 393  ARG A NH1   1 
ATOM   3860  N  NH2   . ARG D 4  393  ? 8.680   -19.754 2.311   1.00 132.46 ? 393  ARG A NH2   1 
ATOM   3861  N  N     . ASN D 4  394  ? 6.472   -16.033 8.613   1.00 90.05  ? 394  ASN A N     1 
ATOM   3862  C  CA    . ASN D 4  394  ? 5.473   -15.232 9.316   1.00 90.33  ? 394  ASN A CA    1 
ATOM   3863  C  C     . ASN D 4  394  ? 5.949   -13.804 9.545   1.00 100.86 ? 394  ASN A C     1 
ATOM   3864  O  O     . ASN D 4  394  ? 5.130   -12.879 9.585   1.00 108.34 ? 394  ASN A O     1 
ATOM   3865  C  CB    . ASN D 4  394  ? 5.119   -15.890 10.644  1.00 79.52  ? 394  ASN A CB    1 
ATOM   3866  C  CG    . ASN D 4  394  ? 4.102   -16.994 10.491  1.00 98.02  ? 394  ASN A CG    1 
ATOM   3867  O  OD1   . ASN D 4  394  ? 4.076   -17.692 9.477   1.00 126.60 ? 394  ASN A OD1   1 
ATOM   3868  N  ND2   . ASN D 4  394  ? 3.254   -17.162 11.498  1.00 93.88  ? 394  ASN A ND2   1 
ATOM   3869  N  N     . GLY D 4  395  ? 7.255   -13.605 9.700   1.00 96.50  ? 395  GLY A N     1 
ATOM   3870  C  CA    . GLY D 4  395  ? 7.808   -12.282 9.851   1.00 94.32  ? 395  GLY A CA    1 
ATOM   3871  C  C     . GLY D 4  395  ? 7.649   -11.736 11.256  1.00 94.24  ? 395  GLY A C     1 
ATOM   3872  O  O     . GLY D 4  395  ? 7.023   -12.350 12.127  1.00 82.26  ? 395  GLY A O     1 
ATOM   3873  N  N     . PRO D 4  396  ? 8.219   -10.551 11.496  1.00 92.47  ? 396  PRO A N     1 
ATOM   3874  C  CA    . PRO D 4  396  ? 8.205   -9.974  12.849  1.00 73.99  ? 396  PRO A CA    1 
ATOM   3875  C  C     . PRO D 4  396  ? 6.925   -9.235  13.212  1.00 56.99  ? 396  PRO A C     1 
ATOM   3876  O  O     . PRO D 4  396  ? 6.924   -8.449  14.163  1.00 53.79  ? 396  PRO A O     1 
ATOM   3877  C  CB    . PRO D 4  396  ? 9.403   -9.016  12.822  1.00 69.61  ? 396  PRO A CB    1 
ATOM   3878  C  CG    . PRO D 4  396  ? 9.508   -8.610  11.387  1.00 64.74  ? 396  PRO A CG    1 
ATOM   3879  C  CD    . PRO D 4  396  ? 9.127   -9.820  10.590  1.00 84.32  ? 396  PRO A CD    1 
ATOM   3880  N  N     . ASN D 4  397  ? 5.832   -9.454  12.486  1.00 75.72  ? 397  ASN A N     1 
ATOM   3881  C  CA    . ASN D 4  397  ? 4.603   -8.733  12.771  1.00 103.05 ? 397  ASN A CA    1 
ATOM   3882  C  C     . ASN D 4  397  ? 3.498   -9.594  13.368  1.00 112.19 ? 397  ASN A C     1 
ATOM   3883  O  O     . ASN D 4  397  ? 2.411   -9.071  13.635  1.00 130.63 ? 397  ASN A O     1 
ATOM   3884  C  CB    . ASN D 4  397  ? 4.092   -8.034  11.509  1.00 130.01 ? 397  ASN A CB    1 
ATOM   3885  C  CG    . ASN D 4  397  ? 3.466   -6.692  11.816  1.00 143.36 ? 397  ASN A CG    1 
ATOM   3886  O  OD1   . ASN D 4  397  ? 4.159   -5.676  11.884  1.00 144.54 ? 397  ASN A OD1   1 
ATOM   3887  N  ND2   . ASN D 4  397  ? 2.150   -6.677  11.999  1.00 146.92 ? 397  ASN A ND2   1 
ATOM   3888  N  N     . GLU D 4  398  ? 3.731   -10.888 13.586  1.00 108.66 ? 398  GLU A N     1 
ATOM   3889  C  CA    . GLU D 4  398  ? 2.840   -11.680 14.426  1.00 122.36 ? 398  GLU A CA    1 
ATOM   3890  C  C     . GLU D 4  398  ? 3.658   -12.654 15.257  1.00 126.29 ? 398  GLU A C     1 
ATOM   3891  O  O     . GLU D 4  398  ? 4.756   -13.058 14.860  1.00 115.01 ? 398  GLU A O     1 
ATOM   3892  C  CB    . GLU D 4  398  ? 1.770   -12.429 13.627  1.00 128.45 ? 398  GLU A CB    1 
ATOM   3893  C  CG    . GLU D 4  398  ? 0.381   -11.833 13.841  1.00 129.52 ? 398  GLU A CG    1 
ATOM   3894  C  CD    . GLU D 4  398  ? -0.012  -11.729 15.320  1.00 107.99 ? 398  GLU A CD    1 
ATOM   3895  O  OE1   . GLU D 4  398  ? 0.230   -12.685 16.093  1.00 94.24  ? 398  GLU A OE1   1 
ATOM   3896  O  OE2   . GLU D 4  398  ? -0.538  -10.667 15.719  1.00 90.48  ? 398  GLU A OE2   1 
ATOM   3897  N  N     . HIS D 4  399  ? 3.081   -13.052 16.401  1.00 143.17 ? 399  HIS A N     1 
ATOM   3898  C  CA    . HIS D 4  399  ? 3.879   -13.547 17.525  1.00 153.57 ? 399  HIS A CA    1 
ATOM   3899  C  C     . HIS D 4  399  ? 4.674   -14.813 17.219  1.00 152.01 ? 399  HIS A C     1 
ATOM   3900  O  O     . HIS D 4  399  ? 5.858   -14.862 17.595  1.00 161.14 ? 399  HIS A O     1 
ATOM   3901  C  CB    . HIS D 4  399  ? 2.992   -13.735 18.763  1.00 157.98 ? 399  HIS A CB    1 
ATOM   3902  C  CG    . HIS D 4  399  ? 3.508   -14.772 19.714  1.00 154.99 ? 399  HIS A CG    1 
ATOM   3903  N  ND1   . HIS D 4  399  ? 2.847   -15.958 19.954  1.00 159.92 ? 399  HIS A ND1   1 
ATOM   3904  C  CD2   . HIS D 4  399  ? 4.631   -14.807 20.472  1.00 151.15 ? 399  HIS A CD2   1 
ATOM   3905  C  CE1   . HIS D 4  399  ? 3.537   -16.674 20.823  1.00 161.94 ? 399  HIS A CE1   1 
ATOM   3906  N  NE2   . HIS D 4  399  ? 4.625   -16.000 21.149  1.00 156.01 ? 399  HIS A NE2   1 
ATOM   3907  N  N     . PRO D 4  400  ? 4.125   -15.870 16.570  1.00 114.94 ? 400  PRO A N     1 
ATOM   3908  C  CA    . PRO D 4  400  ? 5.042   -16.913 16.096  1.00 95.97  ? 400  PRO A CA    1 
ATOM   3909  C  C     . PRO D 4  400  ? 5.795   -16.367 14.895  1.00 92.71  ? 400  PRO A C     1 
ATOM   3910  O  O     . PRO D 4  400  ? 5.226   -16.261 13.807  1.00 113.71 ? 400  PRO A O     1 
ATOM   3911  C  CB    . PRO D 4  400  ? 4.112   -18.077 15.731  1.00 87.25  ? 400  PRO A CB    1 
ATOM   3912  C  CG    . PRO D 4  400  ? 2.829   -17.782 16.450  1.00 77.65  ? 400  PRO A CG    1 
ATOM   3913  C  CD    . PRO D 4  400  ? 2.722   -16.293 16.389  1.00 83.58  ? 400  PRO A CD    1 
ATOM   3914  N  N     . GLY D 4  401  ? 7.055   -15.997 15.084  1.00 69.60  ? 401  GLY A N     1 
ATOM   3915  C  CA    . GLY D 4  401  ? 7.769   -15.255 14.063  1.00 58.85  ? 401  GLY A CA    1 
ATOM   3916  C  C     . GLY D 4  401  ? 9.191   -14.978 14.498  1.00 60.23  ? 401  GLY A C     1 
ATOM   3917  O  O     . GLY D 4  401  ? 9.644   -15.430 15.554  1.00 83.67  ? 401  GLY A O     1 
ATOM   3918  N  N     . ALA D 4  402  ? 9.891   -14.215 13.662  1.00 71.86  ? 402  ALA A N     1 
ATOM   3919  C  CA    . ALA D 4  402  ? 11.294  -13.908 13.891  1.00 80.59  ? 402  ALA A CA    1 
ATOM   3920  C  C     . ALA D 4  402  ? 11.589  -12.516 13.351  1.00 83.88  ? 402  ALA A C     1 
ATOM   3921  O  O     . ALA D 4  402  ? 10.861  -11.990 12.504  1.00 99.09  ? 402  ALA A O     1 
ATOM   3922  C  CB    . ALA D 4  402  ? 12.211  -14.944 13.230  1.00 100.98 ? 402  ALA A CB    1 
ATOM   3923  N  N     . LYS D 4  403  ? 12.674  -11.927 13.848  1.00 71.87  ? 403  LYS A N     1 
ATOM   3924  C  CA    . LYS D 4  403  ? 13.062  -10.566 13.494  1.00 77.40  ? 403  LYS A CA    1 
ATOM   3925  C  C     . LYS D 4  403  ? 14.357  -10.482 12.703  1.00 73.93  ? 403  LYS A C     1 
ATOM   3926  O  O     . LYS D 4  403  ? 14.439  -9.702  11.749  1.00 100.25 ? 403  LYS A O     1 
ATOM   3927  C  CB    . LYS D 4  403  ? 13.189  -9.702  14.759  1.00 78.81  ? 403  LYS A CB    1 
ATOM   3928  C  CG    . LYS D 4  403  ? 11.954  -9.711  15.653  1.00 81.42  ? 403  LYS A CG    1 
ATOM   3929  C  CD    . LYS D 4  403  ? 11.745  -8.370  16.347  1.00 90.79  ? 403  LYS A CD    1 
ATOM   3930  C  CE    . LYS D 4  403  ? 13.021  -7.898  17.040  1.00 97.04  ? 403  LYS A CE    1 
ATOM   3931  N  NZ    . LYS D 4  403  ? 12.920  -6.501  17.542  1.00 104.92 ? 403  LYS A NZ    1 
ATOM   3932  N  N     . TYR D 4  404  ? 15.379  -11.251 13.069  1.00 49.27  ? 404  TYR A N     1 
ATOM   3933  C  CA    . TYR D 4  404  ? 16.688  -11.150 12.437  1.00 65.46  ? 404  TYR A CA    1 
ATOM   3934  C  C     . TYR D 4  404  ? 17.183  -12.532 12.030  1.00 75.82  ? 404  TYR A C     1 
ATOM   3935  O  O     . TYR D 4  404  ? 16.813  -13.548 12.631  1.00 85.54  ? 404  TYR A O     1 
ATOM   3936  C  CB    . TYR D 4  404  ? 17.720  -10.479 13.375  1.00 81.54  ? 404  TYR A CB    1 
ATOM   3937  C  CG    . TYR D 4  404  ? 17.652  -8.961  13.397  1.00 88.54  ? 404  TYR A CG    1 
ATOM   3938  C  CD1   . TYR D 4  404  ? 16.565  -8.298  13.954  1.00 86.89  ? 404  TYR A CD1   1 
ATOM   3939  C  CD2   . TYR D 4  404  ? 18.687  -8.190  12.872  1.00 99.08  ? 404  TYR A CD2   1 
ATOM   3940  C  CE1   . TYR D 4  404  ? 16.499  -6.911  13.976  1.00 99.58  ? 404  TYR A CE1   1 
ATOM   3941  C  CE2   . TYR D 4  404  ? 18.630  -6.797  12.892  1.00 107.97 ? 404  TYR A CE2   1 
ATOM   3942  C  CZ    . TYR D 4  404  ? 17.534  -6.165  13.446  1.00 110.30 ? 404  TYR A CZ    1 
ATOM   3943  O  OH    . TYR D 4  404  ? 17.467  -4.789  13.473  1.00 111.68 ? 404  TYR A OH    1 
ATOM   3944  N  N     . VAL D 4  405  ? 18.027  -12.562 10.998  1.00 81.03  ? 405  VAL A N     1 
ATOM   3945  C  CA    . VAL D 4  405  ? 18.698  -13.792 10.575  1.00 93.37  ? 405  VAL A CA    1 
ATOM   3946  C  C     . VAL D 4  405  ? 20.195  -13.515 10.506  1.00 112.51 ? 405  VAL A C     1 
ATOM   3947  O  O     . VAL D 4  405  ? 20.628  -12.586 9.817   1.00 130.02 ? 405  VAL A O     1 
ATOM   3948  C  CB    . VAL D 4  405  ? 18.172  -14.314 9.226   1.00 78.69  ? 405  VAL A CB    1 
ATOM   3949  C  CG1   . VAL D 4  405  ? 19.101  -15.392 8.666   1.00 65.30  ? 405  VAL A CG1   1 
ATOM   3950  C  CG2   . VAL D 4  405  ? 16.743  -14.850 9.377   1.00 75.53  ? 405  VAL A CG2   1 
ATOM   3951  N  N     . ILE D 4  406  ? 20.981  -14.309 11.223  1.00 110.17 ? 406  ILE A N     1 
ATOM   3952  C  CA    . ILE D 4  406  ? 22.423  -14.137 11.315  1.00 110.20 ? 406  ILE A CA    1 
ATOM   3953  C  C     . ILE D 4  406  ? 23.060  -15.233 10.476  1.00 98.03  ? 406  ILE A C     1 
ATOM   3954  O  O     . ILE D 4  406  ? 22.972  -16.421 10.815  1.00 85.78  ? 406  ILE A O     1 
ATOM   3955  C  CB    . ILE D 4  406  ? 22.908  -14.189 12.769  1.00 128.62 ? 406  ILE A CB    1 
ATOM   3956  C  CG1   . ILE D 4  406  ? 22.136  -13.167 13.613  1.00 136.05 ? 406  ILE A CG1   1 
ATOM   3957  C  CG2   . ILE D 4  406  ? 24.407  -13.937 12.844  1.00 135.94 ? 406  ILE A CG2   1 
ATOM   3958  C  CD1   . ILE D 4  406  ? 22.553  -13.111 15.071  1.00 140.38 ? 406  ILE A CD1   1 
ATOM   3959  N  N     . ARG D 4  407  ? 23.689  -14.836 9.373   1.00 108.98 ? 407  ARG A N     1 
ATOM   3960  C  CA    . ARG D 4  407  ? 24.415  -15.755 8.516   1.00 123.86 ? 407  ARG A CA    1 
ATOM   3961  C  C     . ARG D 4  407  ? 25.765  -16.108 9.144   1.00 140.19 ? 407  ARG A C     1 
ATOM   3962  O  O     . ARG D 4  407  ? 26.218  -15.487 10.110  1.00 131.11 ? 407  ARG A O     1 
ATOM   3963  C  CB    . ARG D 4  407  ? 24.604  -15.146 7.124   1.00 124.36 ? 407  ARG A CB    1 
ATOM   3964  C  CG    . ARG D 4  407  ? 23.335  -15.106 6.271   1.00 118.86 ? 407  ARG A CG    1 
ATOM   3965  C  CD    . ARG D 4  407  ? 23.468  -14.162 5.070   1.00 119.08 ? 407  ARG A CD    1 
ATOM   3966  N  NE    . ARG D 4  407  ? 24.792  -14.189 4.460   1.00 133.44 ? 407  ARG A NE    1 
ATOM   3967  C  CZ    . ARG D 4  407  ? 25.592  -13.130 4.369   1.00 143.96 ? 407  ARG A CZ    1 
ATOM   3968  N  NH1   . ARG D 4  407  ? 25.205  -11.956 4.851   1.00 146.12 ? 407  ARG A NH1   1 
ATOM   3969  N  NH2   . ARG D 4  407  ? 26.784  -13.245 3.798   1.00 147.41 ? 407  ARG A NH2   1 
ATOM   3970  N  N     . ASP D 4  408  ? 26.409  -17.132 8.573   1.00 168.55 ? 408  ASP A N     1 
ATOM   3971  C  CA    . ASP D 4  408  ? 27.689  -17.602 9.095   1.00 173.13 ? 408  ASP A CA    1 
ATOM   3972  C  C     . ASP D 4  408  ? 28.805  -16.590 8.863   1.00 162.44 ? 408  ASP A C     1 
ATOM   3973  O  O     . ASP D 4  408  ? 29.763  -16.537 9.644   1.00 164.60 ? 408  ASP A O     1 
ATOM   3974  C  CB    . ASP D 4  408  ? 28.052  -18.946 8.458   1.00 186.40 ? 408  ASP A CB    1 
ATOM   3975  C  CG    . ASP D 4  408  ? 28.014  -18.901 6.939   1.00 197.77 ? 408  ASP A CG    1 
ATOM   3976  O  OD1   . ASP D 4  408  ? 29.036  -18.522 6.330   1.00 201.35 ? 408  ASP A OD1   1 
ATOM   3977  O  OD2   . ASP D 4  408  ? 26.964  -19.243 6.353   1.00 201.04 ? 408  ASP A OD2   1 
ATOM   3978  N  N     . SER D 4  409  ? 28.702  -15.787 7.800   1.00 146.05 ? 409  SER A N     1 
ATOM   3979  C  CA    . SER D 4  409  ? 29.697  -14.747 7.564   1.00 140.29 ? 409  SER A CA    1 
ATOM   3980  C  C     . SER D 4  409  ? 29.597  -13.631 8.597   1.00 144.71 ? 409  SER A C     1 
ATOM   3981  O  O     . SER D 4  409  ? 30.605  -12.988 8.908   1.00 151.91 ? 409  SER A O     1 
ATOM   3982  C  CB    . SER D 4  409  ? 29.550  -14.183 6.149   1.00 139.09 ? 409  SER A CB    1 
ATOM   3983  O  OG    . SER D 4  409  ? 28.223  -13.764 5.890   1.00 140.41 ? 409  SER A OG    1 
ATOM   3984  N  N     . GLY D 4  410  ? 28.404  -13.385 9.134   1.00 146.23 ? 410  GLY A N     1 
ATOM   3985  C  CA    . GLY D 4  410  ? 28.230  -12.455 10.230  1.00 159.45 ? 410  GLY A CA    1 
ATOM   3986  C  C     . GLY D 4  410  ? 27.510  -11.161 9.909   1.00 167.01 ? 410  GLY A C     1 
ATOM   3987  O  O     . GLY D 4  410  ? 27.601  -10.215 10.701  1.00 171.34 ? 410  GLY A O     1 
ATOM   3988  N  N     . ASP D 4  411  ? 26.807  -11.080 8.784   1.00 157.65 ? 411  ASP A N     1 
ATOM   3989  C  CA    . ASP D 4  411  ? 26.058  -9.885  8.412   1.00 148.67 ? 411  ASP A CA    1 
ATOM   3990  C  C     . ASP D 4  411  ? 24.580  -10.125 8.702   1.00 126.44 ? 411  ASP A C     1 
ATOM   3991  O  O     . ASP D 4  411  ? 23.985  -11.066 8.166   1.00 117.59 ? 411  ASP A O     1 
ATOM   3992  C  CB    . ASP D 4  411  ? 26.285  -9.541  6.941   1.00 156.83 ? 411  ASP A CB    1 
ATOM   3993  C  CG    . ASP D 4  411  ? 27.756  -9.328  6.612   1.00 162.83 ? 411  ASP A CG    1 
ATOM   3994  O  OD1   . ASP D 4  411  ? 28.579  -9.299  7.552   1.00 164.26 ? 411  ASP A OD1   1 
ATOM   3995  O  OD2   . ASP D 4  411  ? 28.091  -9.189  5.417   1.00 164.43 ? 411  ASP A OD2   1 
ATOM   3996  N  N     . ARG D 4  412  ? 23.996  -9.278  9.548   1.00 114.92 ? 412  ARG A N     1 
ATOM   3997  C  CA    . ARG D 4  412  ? 22.627  -9.485  9.999   1.00 106.87 ? 412  ARG A CA    1 
ATOM   3998  C  C     . ARG D 4  412  ? 21.621  -9.177  8.893   1.00 99.98  ? 412  ARG A C     1 
ATOM   3999  O  O     . ARG D 4  412  ? 21.849  -8.325  8.031   1.00 104.68 ? 412  ARG A O     1 
ATOM   4000  C  CB    . ARG D 4  412  ? 22.330  -8.618  11.223  1.00 115.29 ? 412  ARG A CB    1 
ATOM   4001  C  CG    . ARG D 4  412  ? 23.044  -9.072  12.481  1.00 120.34 ? 412  ARG A CG    1 
ATOM   4002  C  CD    . ARG D 4  412  ? 22.326  -8.581  13.726  1.00 124.17 ? 412  ARG A CD    1 
ATOM   4003  N  NE    . ARG D 4  412  ? 22.888  -9.176  14.936  1.00 134.26 ? 412  ARG A NE    1 
ATOM   4004  C  CZ    . ARG D 4  412  ? 23.689  -8.534  15.779  1.00 145.53 ? 412  ARG A CZ    1 
ATOM   4005  N  NH1   . ARG D 4  412  ? 24.017  -7.270  15.550  1.00 148.74 ? 412  ARG A NH1   1 
ATOM   4006  N  NH2   . ARG D 4  412  ? 24.159  -9.153  16.855  1.00 146.57 ? 412  ARG A NH2   1 
ATOM   4007  N  N     . ILE D 4  413  ? 20.494  -9.886  8.930   1.00 94.56  ? 413  ILE A N     1 
ATOM   4008  C  CA    . ILE D 4  413  ? 19.405  -9.740  7.970   1.00 87.25  ? 413  ILE A CA    1 
ATOM   4009  C  C     . ILE D 4  413  ? 18.180  -9.255  8.728   1.00 80.99  ? 413  ILE A C     1 
ATOM   4010  O  O     . ILE D 4  413  ? 17.616  -9.995  9.547   1.00 86.34  ? 413  ILE A O     1 
ATOM   4011  C  CB    . ILE D 4  413  ? 19.101  -11.059 7.244   1.00 79.71  ? 413  ILE A CB    1 
ATOM   4012  C  CG1   . ILE D 4  413  ? 20.320  -11.550 6.459   1.00 66.91  ? 413  ILE A CG1   1 
ATOM   4013  C  CG2   . ILE D 4  413  ? 17.882  -10.917 6.336   1.00 77.74  ? 413  ILE A CG2   1 
ATOM   4014  C  CD1   . ILE D 4  413  ? 20.137  -12.935 5.882   1.00 64.16  ? 413  ILE A CD1   1 
ATOM   4015  N  N     . ASP D 4  414  ? 17.769  -8.021  8.438   1.00 74.76  ? 414  ASP A N     1 
ATOM   4016  C  CA    . ASP D 4  414  ? 16.621  -7.381  9.070   1.00 76.99  ? 414  ASP A CA    1 
ATOM   4017  C  C     . ASP D 4  414  ? 15.388  -7.740  8.250   1.00 76.34  ? 414  ASP A C     1 
ATOM   4018  O  O     . ASP D 4  414  ? 15.244  -7.296  7.108   1.00 102.18 ? 414  ASP A O     1 
ATOM   4019  C  CB    . ASP D 4  414  ? 16.841  -5.869  9.128   1.00 87.63  ? 414  ASP A CB    1 
ATOM   4020  C  CG    . ASP D 4  414  ? 15.855  -5.143  10.039  1.00 83.82  ? 414  ASP A CG    1 
ATOM   4021  O  OD1   . ASP D 4  414  ? 14.782  -5.693  10.372  1.00 79.31  ? 414  ASP A OD1   1 
ATOM   4022  O  OD2   . ASP D 4  414  ? 16.166  -3.998  10.427  1.00 79.94  ? 414  ASP A OD2   1 
ATOM   4023  N  N     . LEU D 4  415  ? 14.491  -8.535  8.835   1.00 64.86  ? 415  LEU A N     1 
ATOM   4024  C  CA    . LEU D 4  415  ? 13.299  -8.966  8.115   1.00 76.49  ? 415  LEU A CA    1 
ATOM   4025  C  C     . LEU D 4  415  ? 12.229  -7.883  7.998   1.00 74.29  ? 415  LEU A C     1 
ATOM   4026  O  O     . LEU D 4  415  ? 11.261  -8.080  7.258   1.00 69.26  ? 415  LEU A O     1 
ATOM   4027  C  CB    . LEU D 4  415  ? 12.692  -10.205 8.781   1.00 73.05  ? 415  LEU A CB    1 
ATOM   4028  C  CG    . LEU D 4  415  ? 13.633  -11.382 9.050   1.00 69.11  ? 415  LEU A CG    1 
ATOM   4029  C  CD1   . LEU D 4  415  ? 12.816  -12.566 9.547   1.00 84.84  ? 415  LEU A CD1   1 
ATOM   4030  C  CD2   . LEU D 4  415  ? 14.488  -11.761 7.833   1.00 58.42  ? 415  LEU A CD2   1 
ATOM   4031  N  N     . ARG D 4  416  ? 12.368  -6.753  8.695   1.00 86.17  ? 416  ARG A N     1 
ATOM   4032  C  CA    . ARG D 4  416  ? 11.373  -5.691  8.565   1.00 84.91  ? 416  ARG A CA    1 
ATOM   4033  C  C     . ARG D 4  416  ? 11.517  -4.959  7.235   1.00 87.98  ? 416  ARG A C     1 
ATOM   4034  O  O     . ARG D 4  416  ? 10.516  -4.592  6.607   1.00 99.22  ? 416  ARG A O     1 
ATOM   4035  C  CB    . ARG D 4  416  ? 11.483  -4.713  9.736   1.00 85.45  ? 416  ARG A CB    1 
ATOM   4036  C  CG    . ARG D 4  416  ? 11.509  -5.388  11.102  1.00 106.76 ? 416  ARG A CG    1 
ATOM   4037  C  CD    . ARG D 4  416  ? 11.509  -4.369  12.236  1.00 118.37 ? 416  ARG A CD    1 
ATOM   4038  N  NE    . ARG D 4  416  ? 12.496  -3.313  12.031  1.00 118.79 ? 416  ARG A NE    1 
ATOM   4039  C  CZ    . ARG D 4  416  ? 13.785  -3.417  12.340  1.00 116.31 ? 416  ARG A CZ    1 
ATOM   4040  N  NH1   . ARG D 4  416  ? 14.261  -4.534  12.880  1.00 124.03 ? 416  ARG A NH1   1 
ATOM   4041  N  NH2   . ARG D 4  416  ? 14.603  -2.399  12.111  1.00 112.06 ? 416  ARG A NH2   1 
ATOM   4042  N  N     . TYR D 4  417  ? 12.754  -4.731  6.790   1.00 77.14  ? 417  TYR A N     1 
ATOM   4043  C  CA    . TYR D 4  417  ? 13.034  -4.084  5.508   1.00 86.45  ? 417  TYR A CA    1 
ATOM   4044  C  C     . TYR D 4  417  ? 14.091  -4.922  4.795   1.00 89.46  ? 417  TYR A C     1 
ATOM   4045  O  O     . TYR D 4  417  ? 15.289  -4.687  4.974   1.00 108.07 ? 417  TYR A O     1 
ATOM   4046  C  CB    . TYR D 4  417  ? 13.517  -2.638  5.687   1.00 110.57 ? 417  TYR A CB    1 
ATOM   4047  C  CG    . TYR D 4  417  ? 13.058  -1.947  6.953   1.00 113.34 ? 417  TYR A CG    1 
ATOM   4048  C  CD1   . TYR D 4  417  ? 13.958  -1.648  7.965   1.00 95.80  ? 417  TYR A CD1   1 
ATOM   4049  C  CD2   . TYR D 4  417  ? 11.733  -1.570  7.123   1.00 129.10 ? 417  TYR A CD2   1 
ATOM   4050  C  CE1   . TYR D 4  417  ? 13.548  -1.010  9.122   1.00 101.16 ? 417  TYR A CE1   1 
ATOM   4051  C  CE2   . TYR D 4  417  ? 11.315  -0.932  8.279   1.00 122.45 ? 417  TYR A CE2   1 
ATOM   4052  C  CZ    . TYR D 4  417  ? 12.224  -0.656  9.273   1.00 106.55 ? 417  TYR A CZ    1 
ATOM   4053  O  OH    . TYR D 4  417  ? 11.806  -0.021  10.420  1.00 104.39 ? 417  TYR A OH    1 
ATOM   4054  N  N     . SER D 4  418  ? 13.656  -5.885  3.985   1.00 81.88  ? 418  SER A N     1 
ATOM   4055  C  CA    . SER D 4  418  ? 14.594  -6.620  3.149   1.00 82.36  ? 418  SER A CA    1 
ATOM   4056  C  C     . SER D 4  418  ? 13.858  -7.178  1.943   1.00 91.75  ? 418  SER A C     1 
ATOM   4057  O  O     . SER D 4  418  ? 12.643  -7.393  1.982   1.00 95.02  ? 418  SER A O     1 
ATOM   4058  C  CB    . SER D 4  418  ? 15.282  -7.759  3.913   1.00 71.60  ? 418  SER A CB    1 
ATOM   4059  O  OG    . SER D 4  418  ? 16.418  -8.231  3.205   1.00 65.91  ? 418  SER A OG    1 
ATOM   4060  N  N     . LYS D 4  419  ? 14.617  -7.396  0.867   1.00 89.82  ? 419  LYS A N     1 
ATOM   4061  C  CA    . LYS D 4  419  ? 14.072  -8.056  -0.313  1.00 78.61  ? 419  LYS A CA    1 
ATOM   4062  C  C     . LYS D 4  419  ? 13.820  -9.530  -0.048  1.00 85.21  ? 419  LYS A C     1 
ATOM   4063  O  O     . LYS D 4  419  ? 12.763  -10.064 -0.402  1.00 105.86 ? 419  LYS A O     1 
ATOM   4064  C  CB    . LYS D 4  419  ? 15.039  -7.908  -1.482  1.00 64.16  ? 419  LYS A CB    1 
ATOM   4065  C  CG    . LYS D 4  419  ? 15.522  -6.509  -1.691  1.00 61.48  ? 419  LYS A CG    1 
ATOM   4066  C  CD    . LYS D 4  419  ? 16.802  -6.507  -2.486  1.00 62.77  ? 419  LYS A CD    1 
ATOM   4067  C  CE    . LYS D 4  419  ? 17.198  -5.089  -2.830  1.00 78.31  ? 419  LYS A CE    1 
ATOM   4068  N  NZ    . LYS D 4  419  ? 18.443  -5.026  -3.638  1.00 81.71  ? 419  LYS A NZ    1 
ATOM   4069  N  N     . ARG D 4  420  ? 14.782  -10.198 0.584   1.00 62.88  ? 420  ARG A N     1 
ATOM   4070  C  CA    . ARG D 4  420  ? 14.805  -11.647 0.701   1.00 65.15  ? 420  ARG A CA    1 
ATOM   4071  C  C     . ARG D 4  420  ? 13.965  -12.180 1.868   1.00 78.49  ? 420  ARG A C     1 
ATOM   4072  O  O     . ARG D 4  420  ? 14.132  -13.348 2.247   1.00 95.97  ? 420  ARG A O     1 
ATOM   4073  C  CB    . ARG D 4  420  ? 16.254  -12.123 0.818   1.00 77.61  ? 420  ARG A CB    1 
ATOM   4074  C  CG    . ARG D 4  420  ? 17.209  -11.440 -0.162  1.00 84.04  ? 420  ARG A CG    1 
ATOM   4075  C  CD    . ARG D 4  420  ? 16.999  -11.936 -1.582  1.00 91.42  ? 420  ARG A CD    1 
ATOM   4076  N  NE    . ARG D 4  420  ? 16.913  -13.393 -1.633  1.00 105.00 ? 420  ARG A NE    1 
ATOM   4077  C  CZ    . ARG D 4  420  ? 17.960  -14.202 -1.749  1.00 119.17 ? 420  ARG A CZ    1 
ATOM   4078  N  NH1   . ARG D 4  420  ? 19.188  -13.701 -1.826  1.00 117.04 ? 420  ARG A NH1   1 
ATOM   4079  N  NH2   . ARG D 4  420  ? 17.780  -15.515 -1.789  1.00 132.77 ? 420  ARG A NH2   1 
ATOM   4080  N  N     . ALA D 4  421  ? 13.039  -11.385 2.412   1.00 75.40  ? 421  ALA A N     1 
ATOM   4081  C  CA    . ALA D 4  421  ? 12.186  -11.835 3.509   1.00 78.47  ? 421  ALA A CA    1 
ATOM   4082  C  C     . ALA D 4  421  ? 11.168  -12.897 3.096   1.00 106.99 ? 421  ALA A C     1 
ATOM   4083  O  O     . ALA D 4  421  ? 10.464  -13.418 3.969   1.00 114.67 ? 421  ALA A O     1 
ATOM   4084  C  CB    . ALA D 4  421  ? 11.460  -10.638 4.125   1.00 56.33  ? 421  ALA A CB    1 
ATOM   4085  N  N     . GLY D 4  422  ? 11.069  -13.232 1.808   1.00 114.15 ? 422  GLY A N     1 
ATOM   4086  C  CA    . GLY D 4  422  ? 10.199  -14.303 1.361   1.00 114.29 ? 422  GLY A CA    1 
ATOM   4087  C  C     . GLY D 4  422  ? 10.919  -15.510 0.784   1.00 118.63 ? 422  GLY A C     1 
ATOM   4088  O  O     . GLY D 4  422  ? 10.393  -16.629 0.831   1.00 130.08 ? 422  GLY A O     1 
ATOM   4089  N  N     . ASP D 4  423  ? 12.120  -15.305 0.242   1.00 109.32 ? 423  ASP A N     1 
ATOM   4090  C  CA    . ASP D 4  423  ? 12.888  -16.359 -0.415  1.00 117.51 ? 423  ASP A CA    1 
ATOM   4091  C  C     . ASP D 4  423  ? 14.199  -16.632 0.319   1.00 122.49 ? 423  ASP A C     1 
ATOM   4092  O  O     . ASP D 4  423  ? 15.253  -16.816 -0.299  1.00 131.17 ? 423  ASP A O     1 
ATOM   4093  C  CB    . ASP D 4  423  ? 13.149  -16.020 -1.882  1.00 122.31 ? 423  ASP A CB    1 
ATOM   4094  C  CG    . ASP D 4  423  ? 13.921  -14.725 -2.057  1.00 128.08 ? 423  ASP A CG    1 
ATOM   4095  O  OD1   . ASP D 4  423  ? 13.468  -13.685 -1.545  1.00 134.50 ? 423  ASP A OD1   1 
ATOM   4096  O  OD2   . ASP D 4  423  ? 14.984  -14.752 -2.717  1.00 131.32 ? 423  ASP A OD2   1 
ATOM   4097  N  N     . ILE D 4  424  ? 14.150  -16.662 1.652   1.00 114.94 ? 424  ILE A N     1 
ATOM   4098  C  CA    . ILE D 4  424  ? 15.310  -17.092 2.422   1.00 105.59 ? 424  ILE A CA    1 
ATOM   4099  C  C     . ILE D 4  424  ? 15.579  -18.574 2.197   1.00 110.09 ? 424  ILE A C     1 
ATOM   4100  O  O     . ILE D 4  424  ? 14.660  -19.379 2.003   1.00 122.35 ? 424  ILE A O     1 
ATOM   4101  C  CB    . ILE D 4  424  ? 15.141  -16.730 3.912   1.00 88.75  ? 424  ILE A CB    1 
ATOM   4102  C  CG1   . ILE D 4  424  ? 13.698  -16.923 4.440   1.00 105.76 ? 424  ILE A CG1   1 
ATOM   4103  C  CG2   . ILE D 4  424  ? 15.684  -15.325 4.198   1.00 61.85  ? 424  ILE A CG2   1 
ATOM   4104  C  CD1   . ILE D 4  424  ? 13.084  -18.324 4.444   1.00 96.33  ? 424  ILE A CD1   1 
ATOM   4105  N  N     . GLN D 4  425  ? 16.858  -18.930 2.146   1.00 108.09 ? 425  GLN A N     1 
ATOM   4106  C  CA    . GLN D 4  425  ? 17.278  -20.320 2.022   1.00 125.23 ? 425  GLN A CA    1 
ATOM   4107  C  C     . GLN D 4  425  ? 18.112  -20.633 3.257   1.00 127.15 ? 425  GLN A C     1 
ATOM   4108  O  O     . GLN D 4  425  ? 19.312  -20.337 3.291   1.00 133.03 ? 425  GLN A O     1 
ATOM   4109  C  CB    . GLN D 4  425  ? 18.056  -20.562 0.729   1.00 143.49 ? 425  GLN A CB    1 
ATOM   4110  C  CG    . GLN D 4  425  ? 17.660  -21.845 0.004   1.00 156.51 ? 425  GLN A CG    1 
ATOM   4111  C  CD    . GLN D 4  425  ? 18.020  -23.095 0.787   1.00 165.48 ? 425  GLN A CD    1 
ATOM   4112  O  OE1   . GLN D 4  425  ? 19.194  -23.436 0.927   1.00 169.22 ? 425  GLN A OE1   1 
ATOM   4113  N  NE2   . GLN D 4  425  ? 17.007  -23.784 1.301   1.00 165.79 ? 425  GLN A NE2   1 
ATOM   4114  N  N     . LEU D 4  426  ? 17.472  -21.213 4.271   1.00 125.49 ? 426  LEU A N     1 
ATOM   4115  C  CA    . LEU D 4  426  ? 18.165  -21.521 5.515   1.00 121.62 ? 426  LEU A CA    1 
ATOM   4116  C  C     . LEU D 4  426  ? 19.170  -22.650 5.312   1.00 128.43 ? 426  LEU A C     1 
ATOM   4117  O  O     . LEU D 4  426  ? 18.822  -23.736 4.837   1.00 146.68 ? 426  LEU A O     1 
ATOM   4118  C  CB    . LEU D 4  426  ? 17.164  -21.892 6.612   1.00 110.13 ? 426  LEU A CB    1 
ATOM   4119  C  CG    . LEU D 4  426  ? 16.287  -20.756 7.149   1.00 102.20 ? 426  LEU A CG    1 
ATOM   4120  C  CD1   . LEU D 4  426  ? 15.199  -21.275 8.083   1.00 100.50 ? 426  LEU A CD1   1 
ATOM   4121  C  CD2   . LEU D 4  426  ? 17.139  -19.700 7.849   1.00 92.65  ? 426  LEU A CD2   1 
ATOM   4122  N  N     . GLN D 4  427  ? 20.419  -22.382 5.677   1.00 116.56 ? 427  GLN A N     1 
ATOM   4123  C  CA    . GLN D 4  427  ? 21.484  -23.369 5.660   1.00 130.32 ? 427  GLN A CA    1 
ATOM   4124  C  C     . GLN D 4  427  ? 21.989  -23.567 7.081   1.00 134.88 ? 427  GLN A C     1 
ATOM   4125  O  O     . GLN D 4  427  ? 21.948  -22.642 7.897   1.00 136.91 ? 427  GLN A O     1 
ATOM   4126  C  CB    . GLN D 4  427  ? 22.636  -22.936 4.744   1.00 132.25 ? 427  GLN A CB    1 
ATOM   4127  C  CG    . GLN D 4  427  ? 22.261  -22.823 3.277   1.00 136.25 ? 427  GLN A CG    1 
ATOM   4128  C  CD    . GLN D 4  427  ? 23.362  -22.192 2.451   1.00 145.87 ? 427  GLN A CD    1 
ATOM   4129  O  OE1   . GLN D 4  427  ? 24.399  -21.793 2.981   1.00 142.67 ? 427  GLN A OE1   1 
ATOM   4130  N  NE2   . GLN D 4  427  ? 23.145  -22.102 1.143   1.00 154.38 ? 427  GLN A NE2   1 
ATOM   4131  N  N     . TYR D 4  428  ? 22.462  -24.782 7.363   1.00 129.89 ? 428  TYR A N     1 
ATOM   4132  C  CA    . TYR D 4  428  ? 22.914  -25.136 8.703   1.00 114.30 ? 428  TYR A CA    1 
ATOM   4133  C  C     . TYR D 4  428  ? 24.108  -24.281 9.117   1.00 106.67 ? 428  TYR A C     1 
ATOM   4134  O  O     . TYR D 4  428  ? 24.934  -23.882 8.291   1.00 106.71 ? 428  TYR A O     1 
ATOM   4135  C  CB    . TYR D 4  428  ? 23.287  -26.619 8.770   1.00 123.08 ? 428  TYR A CB    1 
ATOM   4136  C  CG    . TYR D 4  428  ? 22.186  -27.565 8.340   1.00 120.42 ? 428  TYR A CG    1 
ATOM   4137  C  CD1   . TYR D 4  428  ? 22.180  -28.130 7.071   1.00 124.42 ? 428  TYR A CD1   1 
ATOM   4138  C  CD2   . TYR D 4  428  ? 21.146  -27.886 9.204   1.00 123.15 ? 428  TYR A CD2   1 
ATOM   4139  C  CE1   . TYR D 4  428  ? 21.169  -29.000 6.679   1.00 132.48 ? 428  TYR A CE1   1 
ATOM   4140  C  CE2   . TYR D 4  428  ? 20.133  -28.750 8.819   1.00 120.82 ? 428  TYR A CE2   1 
ATOM   4141  C  CZ    . TYR D 4  428  ? 20.149  -29.304 7.560   1.00 128.09 ? 428  TYR A CZ    1 
ATOM   4142  O  OH    . TYR D 4  428  ? 19.140  -30.162 7.183   1.00 132.23 ? 428  TYR A OH    1 
ATOM   4143  N  N     . GLY D 4  429  ? 24.187  -23.995 10.413  1.00 97.92  ? 429  GLY A N     1 
ATOM   4144  C  CA    . GLY D 4  429  ? 25.192  -23.095 10.934  1.00 96.34  ? 429  GLY A CA    1 
ATOM   4145  C  C     . GLY D 4  429  ? 24.778  -21.643 10.995  1.00 99.31  ? 429  GLY A C     1 
ATOM   4146  O  O     . GLY D 4  429  ? 25.628  -20.784 11.263  1.00 100.07 ? 429  GLY A O     1 
ATOM   4147  N  N     . TRP D 4  430  ? 23.508  -21.339 10.748  1.00 100.03 ? 430  TRP A N     1 
ATOM   4148  C  CA    . TRP D 4  430  ? 22.983  -19.984 10.836  1.00 99.57  ? 430  TRP A CA    1 
ATOM   4149  C  C     . TRP D 4  430  ? 22.155  -19.830 12.106  1.00 101.97 ? 430  TRP A C     1 
ATOM   4150  O  O     . TRP D 4  430  ? 21.829  -20.803 12.790  1.00 111.87 ? 430  TRP A O     1 
ATOM   4151  C  CB    . TRP D 4  430  ? 22.129  -19.645 9.609   1.00 105.98 ? 430  TRP A CB    1 
ATOM   4152  C  CG    . TRP D 4  430  ? 22.920  -19.388 8.361   1.00 109.95 ? 430  TRP A CG    1 
ATOM   4153  C  CD1   . TRP D 4  430  ? 24.264  -19.550 8.196   1.00 120.30 ? 430  TRP A CD1   1 
ATOM   4154  C  CD2   . TRP D 4  430  ? 22.414  -18.928 7.099   1.00 88.96  ? 430  TRP A CD2   1 
ATOM   4155  N  NE1   . TRP D 4  430  ? 24.628  -19.219 6.913   1.00 115.35 ? 430  TRP A NE1   1 
ATOM   4156  C  CE2   . TRP D 4  430  ? 23.512  -18.835 6.220   1.00 100.82 ? 430  TRP A CE2   1 
ATOM   4157  C  CE3   . TRP D 4  430  ? 21.142  -18.585 6.630   1.00 64.45  ? 430  TRP A CE3   1 
ATOM   4158  C  CZ2   . TRP D 4  430  ? 23.379  -18.416 4.901   1.00 94.78  ? 430  TRP A CZ2   1 
ATOM   4159  C  CZ3   . TRP D 4  430  ? 21.013  -18.169 5.323   1.00 69.66  ? 430  TRP A CZ3   1 
ATOM   4160  C  CH2   . TRP D 4  430  ? 22.124  -18.087 4.472   1.00 89.81  ? 430  TRP A CH2   1 
ATOM   4161  N  N     . LYS D 4  431  ? 21.810  -18.584 12.418  1.00 97.24  ? 431  LYS A N     1 
ATOM   4162  C  CA    . LYS D 4  431  ? 21.017  -18.264 13.598  1.00 86.00  ? 431  LYS A CA    1 
ATOM   4163  C  C     . LYS D 4  431  ? 19.751  -17.533 13.172  1.00 71.97  ? 431  LYS A C     1 
ATOM   4164  O  O     . LYS D 4  431  ? 19.798  -16.655 12.306  1.00 67.06  ? 431  LYS A O     1 
ATOM   4165  C  CB    . LYS D 4  431  ? 21.817  -17.414 14.594  1.00 87.63  ? 431  LYS A CB    1 
ATOM   4166  C  CG    . LYS D 4  431  ? 23.191  -17.980 14.942  1.00 90.23  ? 431  LYS A CG    1 
ATOM   4167  C  CD    . LYS D 4  431  ? 23.890  -17.163 16.022  1.00 90.49  ? 431  LYS A CD    1 
ATOM   4168  C  CE    . LYS D 4  431  ? 25.401  -17.162 15.824  1.00 94.93  ? 431  LYS A CE    1 
ATOM   4169  N  NZ    . LYS D 4  431  ? 25.972  -18.538 15.765  1.00 96.79  ? 431  LYS A NZ    1 
ATOM   4170  N  N     . VAL D 4  432  ? 18.623  -17.903 13.771  1.00 76.42  ? 432  VAL A N     1 
ATOM   4171  C  CA    . VAL D 4  432  ? 17.356  -17.205 13.584  1.00 71.73  ? 432  VAL A CA    1 
ATOM   4172  C  C     . VAL D 4  432  ? 16.972  -16.591 14.922  1.00 72.03  ? 432  VAL A C     1 
ATOM   4173  O  O     . VAL D 4  432  ? 16.811  -17.309 15.916  1.00 92.88  ? 432  VAL A O     1 
ATOM   4174  C  CB    . VAL D 4  432  ? 16.261  -18.151 13.065  1.00 69.99  ? 432  VAL A CB    1 
ATOM   4175  C  CG1   . VAL D 4  432  ? 14.886  -17.520 13.206  1.00 55.43  ? 432  VAL A CG1   1 
ATOM   4176  C  CG2   . VAL D 4  432  ? 16.534  -18.539 11.608  1.00 78.43  ? 432  VAL A CG2   1 
ATOM   4177  N  N     . GLU D 4  433  ? 16.862  -15.264 14.970  1.00 63.97  ? 433  GLU A N     1 
ATOM   4178  C  CA    . GLU D 4  433  ? 16.438  -14.601 16.198  1.00 76.39  ? 433  GLU A CA    1 
ATOM   4179  C  C     . GLU D 4  433  ? 14.921  -14.690 16.241  1.00 65.06  ? 433  GLU A C     1 
ATOM   4180  O  O     . GLU D 4  433  ? 14.205  -13.790 15.798  1.00 53.30  ? 433  GLU A O     1 
ATOM   4181  C  CB    . GLU D 4  433  ? 16.926  -13.161 16.249  1.00 77.72  ? 433  GLU A CB    1 
ATOM   4182  C  CG    . GLU D 4  433  ? 18.429  -13.043 16.400  1.00 78.37  ? 433  GLU A CG    1 
ATOM   4183  C  CD    . GLU D 4  433  ? 18.834  -11.909 17.305  1.00 95.32  ? 433  GLU A CD    1 
ATOM   4184  O  OE1   . GLU D 4  433  ? 18.034  -11.550 18.193  1.00 103.49 ? 433  GLU A OE1   1 
ATOM   4185  O  OE2   . GLU D 4  433  ? 19.942  -11.367 17.116  1.00 105.98 ? 433  GLU A OE2   1 
ATOM   4186  N  N     . ARG D 4  434  ? 14.425  -15.806 16.767  1.00 68.33  ? 434  ARG A N     1 
ATOM   4187  C  CA    . ARG D 4  434  ? 12.987  -15.995 16.771  1.00 71.62  ? 434  ARG A CA    1 
ATOM   4188  C  C     . ARG D 4  434  ? 12.368  -15.229 17.939  1.00 68.08  ? 434  ARG A C     1 
ATOM   4189  O  O     . ARG D 4  434  ? 13.062  -14.724 18.826  1.00 69.64  ? 434  ARG A O     1 
ATOM   4190  C  CB    . ARG D 4  434  ? 12.634  -17.480 16.845  1.00 62.15  ? 434  ARG A CB    1 
ATOM   4191  C  CG    . ARG D 4  434  ? 13.072  -18.146 18.128  1.00 59.83  ? 434  ARG A CG    1 
ATOM   4192  C  CD    . ARG D 4  434  ? 12.319  -19.440 18.353  1.00 81.50  ? 434  ARG A CD    1 
ATOM   4193  N  NE    . ARG D 4  434  ? 11.745  -19.477 19.693  1.00 101.82 ? 434  ARG A NE    1 
ATOM   4194  C  CZ    . ARG D 4  434  ? 12.282  -20.116 20.725  1.00 114.61 ? 434  ARG A CZ    1 
ATOM   4195  N  NH1   . ARG D 4  434  ? 13.421  -20.786 20.595  1.00 123.63 ? 434  ARG A NH1   1 
ATOM   4196  N  NH2   . ARG D 4  434  ? 11.675  -20.084 21.900  1.00 118.06 ? 434  ARG A NH2   1 
ATOM   4197  N  N     . HIS D 4  435  ? 11.040  -15.150 17.928  1.00 63.73  ? 435  HIS A N     1 
ATOM   4198  C  CA    . HIS D 4  435  ? 10.309  -14.495 18.999  1.00 58.05  ? 435  HIS A CA    1 
ATOM   4199  C  C     . HIS D 4  435  ? 10.325  -15.350 20.263  1.00 82.04  ? 435  HIS A C     1 
ATOM   4200  O  O     . HIS D 4  435  ? 10.728  -16.518 20.263  1.00 95.62  ? 435  HIS A O     1 
ATOM   4201  C  CB    . HIS D 4  435  ? 8.859   -14.235 18.590  1.00 72.16  ? 435  HIS A CB    1 
ATOM   4202  C  CG    . HIS D 4  435  ? 8.696   -13.174 17.546  1.00 88.95  ? 435  HIS A CG    1 
ATOM   4203  N  ND1   . HIS D 4  435  ? 7.471   -12.618 17.240  1.00 87.79  ? 435  HIS A ND1   1 
ATOM   4204  C  CD2   . HIS D 4  435  ? 9.601   -12.554 16.751  1.00 94.99  ? 435  HIS A CD2   1 
ATOM   4205  C  CE1   . HIS D 4  435  ? 7.629   -11.709 16.295  1.00 94.47  ? 435  HIS A CE1   1 
ATOM   4206  N  NE2   . HIS D 4  435  ? 8.911   -11.651 15.981  1.00 92.36  ? 435  HIS A NE2   1 
ATOM   4207  N  N     . ILE D 4  436  ? 9.882   -14.734 21.360  1.00 94.85  ? 436  ILE A N     1 
ATOM   4208  C  CA    . ILE D 4  436  ? 9.467   -15.494 22.528  1.00 94.98  ? 436  ILE A CA    1 
ATOM   4209  C  C     . ILE D 4  436  ? 8.306   -16.393 22.139  1.00 92.47  ? 436  ILE A C     1 
ATOM   4210  O  O     . ILE D 4  436  ? 7.355   -15.955 21.482  1.00 101.94 ? 436  ILE A O     1 
ATOM   4211  C  CB    . ILE D 4  436  ? 9.093   -14.534 23.668  1.00 95.70  ? 436  ILE A CB    1 
ATOM   4212  C  CG1   . ILE D 4  436  ? 10.346  -14.039 24.386  1.00 82.70  ? 436  ILE A CG1   1 
ATOM   4213  C  CG2   . ILE D 4  436  ? 8.098   -15.159 24.631  1.00 116.27 ? 436  ILE A CG2   1 
ATOM   4214  C  CD1   . ILE D 4  436  ? 10.054  -13.420 25.731  1.00 92.60  ? 436  ILE A CD1   1 
ATOM   4215  N  N     . MET D 4  437  ? 8.386   -17.664 22.520  1.00 83.03  ? 437  MET A N     1 
ATOM   4216  C  CA    . MET D 4  437  ? 7.304   -18.596 22.265  1.00 88.63  ? 437  MET A CA    1 
ATOM   4217  C  C     . MET D 4  437  ? 6.909   -19.267 23.574  1.00 85.27  ? 437  MET A C     1 
ATOM   4218  O  O     . MET D 4  437  ? 7.547   -19.073 24.615  1.00 81.30  ? 437  MET A O     1 
ATOM   4219  C  CB    . MET D 4  437  ? 7.705   -19.627 21.205  1.00 89.55  ? 437  MET A CB    1 
ATOM   4220  C  CG    . MET D 4  437  ? 6.611   -19.952 20.212  1.00 92.96  ? 437  MET A CG    1 
ATOM   4221  S  SD    . MET D 4  437  ? 7.307   -20.855 18.827  1.00 114.19 ? 437  MET A SD    1 
ATOM   4222  C  CE    . MET D 4  437  ? 8.654   -19.770 18.376  1.00 91.56  ? 437  MET A CE    1 
ATOM   4223  N  N     . ASP D 4  438  ? 5.832   -20.049 23.512  1.00 86.09  ? 438  ASP A N     1 
ATOM   4224  C  CA    . ASP D 4  438  ? 5.295   -20.693 24.703  1.00 66.35  ? 438  ASP A CA    1 
ATOM   4225  C  C     . ASP D 4  438  ? 6.281   -21.712 25.263  1.00 77.55  ? 438  ASP A C     1 
ATOM   4226  O  O     . ASP D 4  438  ? 7.092   -22.291 24.532  1.00 68.72  ? 438  ASP A O     1 
ATOM   4227  C  CB    . ASP D 4  438  ? 3.964   -21.380 24.392  1.00 64.96  ? 438  ASP A CB    1 
ATOM   4228  C  CG    . ASP D 4  438  ? 2.868   -20.392 24.023  1.00 83.87  ? 438  ASP A CG    1 
ATOM   4229  O  OD1   . ASP D 4  438  ? 3.063   -19.579 23.090  1.00 87.78  ? 438  ASP A OD1   1 
ATOM   4230  O  OD2   . ASP D 4  438  ? 1.805   -20.423 24.680  1.00 82.70  ? 438  ASP A OD2   1 
ATOM   4231  N  N     . ASN D 4  439  ? 6.204   -21.902 26.585  1.00 91.68  ? 439  ASN A N     1 
ATOM   4232  C  CA    . ASN D 4  439  ? 7.030   -22.854 27.337  1.00 87.61  ? 439  ASN A CA    1 
ATOM   4233  C  C     . ASN D 4  439  ? 8.520   -22.597 27.119  1.00 94.12  ? 439  ASN A C     1 
ATOM   4234  O  O     . ASN D 4  439  ? 9.307   -23.517 26.885  1.00 110.11 ? 439  ASN A O     1 
ATOM   4235  C  CB    . ASN D 4  439  ? 6.650   -24.298 27.001  1.00 95.55  ? 439  ASN A CB    1 
ATOM   4236  C  CG    . ASN D 4  439  ? 5.247   -24.647 27.470  1.00 102.02 ? 439  ASN A CG    1 
ATOM   4237  O  OD1   . ASN D 4  439  ? 4.697   -23.984 28.354  1.00 72.06  ? 439  ASN A OD1   1 
ATOM   4238  N  ND2   . ASN D 4  439  ? 4.662   -25.688 26.883  1.00 125.46 ? 439  ASN A ND2   1 
ATOM   4239  N  N     . ASP D 4  440  ? 8.900   -21.325 27.173  1.00 85.66  ? 440  ASP A N     1 
ATOM   4240  C  CA    . ASP D 4  440  ? 10.250  -20.788 27.158  1.00 92.18  ? 440  ASP A CA    1 
ATOM   4241  C  C     . ASP D 4  440  ? 10.674  -20.390 28.562  1.00 100.72 ? 440  ASP A C     1 
ATOM   4242  O  O     . ASP D 4  440  ? 9.851   -19.911 29.347  1.00 117.20 ? 440  ASP A O     1 
ATOM   4243  C  CB    . ASP D 4  440  ? 10.343  -19.573 26.238  1.00 89.99  ? 440  ASP A CB    1 
ATOM   4244  C  CG    . ASP D 4  440  ? 11.052  -19.880 24.937  1.00 86.53  ? 440  ASP A CG    1 
ATOM   4245  O  OD1   . ASP D 4  440  ? 12.014  -20.679 24.960  1.00 88.90  ? 440  ASP A OD1   1 
ATOM   4246  O  OD2   . ASP D 4  440  ? 10.653  -19.331 23.888  1.00 82.14  ? 440  ASP A OD2   1 
ATOM   4247  N  N     . PRO D 4  441  ? 11.943  -20.593 28.914  1.00 79.89  ? 441  PRO A N     1 
ATOM   4248  C  CA    . PRO D 4  441  ? 12.415  -20.177 30.243  1.00 73.88  ? 441  PRO A CA    1 
ATOM   4249  C  C     . PRO D 4  441  ? 12.754  -18.691 30.243  1.00 64.98  ? 441  PRO A C     1 
ATOM   4250  O  O     . PRO D 4  441  ? 13.487  -18.213 29.376  1.00 70.90  ? 441  PRO A O     1 
ATOM   4251  C  CB    . PRO D 4  441  ? 13.660  -21.047 30.462  1.00 83.51  ? 441  PRO A CB    1 
ATOM   4252  C  CG    . PRO D 4  441  ? 14.163  -21.326 29.076  1.00 78.80  ? 441  PRO A CG    1 
ATOM   4253  C  CD    . PRO D 4  441  ? 12.958  -21.364 28.171  1.00 67.32  ? 441  PRO A CD    1 
ATOM   4254  N  N     . VAL D 4  442  ? 12.198  -17.955 31.205  1.00 53.86  ? 442  VAL A N     1 
ATOM   4255  C  CA    . VAL D 4  442  ? 12.494  -16.533 31.363  1.00 59.03  ? 442  VAL A CA    1 
ATOM   4256  C  C     . VAL D 4  442  ? 12.722  -16.229 32.838  1.00 69.76  ? 442  VAL A C     1 
ATOM   4257  O  O     . VAL D 4  442  ? 12.116  -16.858 33.710  1.00 72.58  ? 442  VAL A O     1 
ATOM   4258  C  CB    . VAL D 4  442  ? 11.376  -15.628 30.799  1.00 54.29  ? 442  VAL A CB    1 
ATOM   4259  C  CG1   . VAL D 4  442  ? 11.429  -15.572 29.269  1.00 43.88  ? 442  VAL A CG1   1 
ATOM   4260  C  CG2   . VAL D 4  442  ? 9.997   -16.083 31.296  1.00 46.76  ? 442  VAL A CG2   1 
ATOM   4261  N  N     . LEU D 4  443  ? 13.595  -15.263 33.121  1.00 77.21  ? 443  LEU A N     1 
ATOM   4262  C  CA    . LEU D 4  443  ? 13.690  -14.733 34.471  1.00 63.94  ? 443  LEU A CA    1 
ATOM   4263  C  C     . LEU D 4  443  ? 12.561  -13.756 34.749  1.00 63.26  ? 443  LEU A C     1 
ATOM   4264  O  O     . LEU D 4  443  ? 12.251  -12.900 33.917  1.00 77.13  ? 443  LEU A O     1 
ATOM   4265  C  CB    . LEU D 4  443  ? 15.002  -14.003 34.722  1.00 44.02  ? 443  LEU A CB    1 
ATOM   4266  C  CG    . LEU D 4  443  ? 15.973  -14.807 35.571  1.00 48.34  ? 443  LEU A CG    1 
ATOM   4267  C  CD1   . LEU D 4  443  ? 17.261  -14.051 35.629  1.00 71.95  ? 443  LEU A CD1   1 
ATOM   4268  C  CD2   . LEU D 4  443  ? 15.436  -15.083 36.970  1.00 54.06  ? 443  LEU A CD2   1 
ATOM   4269  N  N     . PHE D 4  444  ? 11.993  -13.846 35.952  1.00 54.26  ? 444  PHE A N     1 
ATOM   4270  C  CA    . PHE D 4  444  ? 10.866  -13.020 36.347  1.00 69.64  ? 444  PHE A CA    1 
ATOM   4271  C  C     . PHE D 4  444  ? 11.160  -12.404 37.705  1.00 93.17  ? 444  PHE A C     1 
ATOM   4272  O  O     . PHE D 4  444  ? 11.467  -13.123 38.661  1.00 110.51 ? 444  PHE A O     1 
ATOM   4273  C  CB    . PHE D 4  444  ? 9.579   -13.851 36.386  1.00 61.84  ? 444  PHE A CB    1 
ATOM   4274  C  CG    . PHE D 4  444  ? 8.325   -13.032 36.350  1.00 48.14  ? 444  PHE A CG    1 
ATOM   4275  C  CD1   . PHE D 4  444  ? 8.177   -12.014 35.429  1.00 47.86  ? 444  PHE A CD1   1 
ATOM   4276  C  CD2   . PHE D 4  444  ? 7.267   -13.316 37.201  1.00 54.25  ? 444  PHE A CD2   1 
ATOM   4277  C  CE1   . PHE D 4  444  ? 7.013   -11.263 35.386  1.00 65.43  ? 444  PHE A CE1   1 
ATOM   4278  C  CE2   . PHE D 4  444  ? 6.099   -12.574 37.149  1.00 44.84  ? 444  PHE A CE2   1 
ATOM   4279  C  CZ    . PHE D 4  444  ? 5.978   -11.544 36.245  1.00 64.67  ? 444  PHE A CZ    1 
ATOM   4280  N  N     . ASN D 4  445  ? 11.058  -11.078 37.793  1.00 85.27  ? 445  ASN A N     1 
ATOM   4281  C  CA    . ASN D 4  445  ? 11.635  -10.327 38.895  1.00 81.12  ? 445  ASN A CA    1 
ATOM   4282  C  C     . ASN D 4  445  ? 10.630  -9.327  39.446  1.00 82.53  ? 445  ASN A C     1 
ATOM   4283  O  O     . ASN D 4  445  ? 9.895   -8.690  38.688  1.00 108.63 ? 445  ASN A O     1 
ATOM   4284  C  CB    . ASN D 4  445  ? 12.900  -9.571  38.437  1.00 82.86  ? 445  ASN A CB    1 
ATOM   4285  C  CG    . ASN D 4  445  ? 13.550  -8.773  39.556  1.00 81.29  ? 445  ASN A CG    1 
ATOM   4286  O  OD1   . ASN D 4  445  ? 13.395  -9.093  40.735  1.00 101.50 ? 445  ASN A OD1   1 
ATOM   4287  N  ND2   . ASN D 4  445  ? 14.251  -7.705  39.191  1.00 61.26  ? 445  ASN A ND2   1 
ATOM   4288  N  N     . ARG D 4  446  ? 10.621  -9.177  40.770  1.00 77.60  ? 446  ARG A N     1 
ATOM   4289  C  CA    . ARG D 4  446  ? 9.973   -8.057  41.442  1.00 74.72  ? 446  ARG A CA    1 
ATOM   4290  C  C     . ARG D 4  446  ? 11.065  -7.236  42.115  1.00 72.55  ? 446  ARG A C     1 
ATOM   4291  O  O     . ARG D 4  446  ? 11.898  -7.791  42.842  1.00 77.53  ? 446  ARG A O     1 
ATOM   4292  C  CB    . ARG D 4  446  ? 8.951   -8.527  42.475  1.00 70.61  ? 446  ARG A CB    1 
ATOM   4293  C  CG    . ARG D 4  446  ? 7.752   -7.619  42.563  1.00 43.78  ? 446  ARG A CG    1 
ATOM   4294  C  CD    . ARG D 4  446  ? 7.942   -6.545  43.615  1.00 57.30  ? 446  ARG A CD    1 
ATOM   4295  N  NE    . ARG D 4  446  ? 6.657   -6.133  44.159  1.00 74.90  ? 446  ARG A NE    1 
ATOM   4296  C  CZ    . ARG D 4  446  ? 6.507   -5.306  45.187  1.00 76.91  ? 446  ARG A CZ    1 
ATOM   4297  N  NH1   . ARG D 4  446  ? 7.566   -4.777  45.784  1.00 57.33  ? 446  ARG A NH1   1 
ATOM   4298  N  NH2   . ARG D 4  446  ? 5.288   -4.991  45.606  1.00 83.05  ? 446  ARG A NH2   1 
ATOM   4299  N  N     . GLN D 4  447  ? 11.028  -5.910  41.912  1.00 71.37  ? 447  GLN A N     1 
ATOM   4300  C  CA    . GLN D 4  447  ? 12.251  -5.110  41.918  1.00 68.43  ? 447  GLN A CA    1 
ATOM   4301  C  C     . GLN D 4  447  ? 12.985  -4.945  43.251  1.00 90.08  ? 447  GLN A C     1 
ATOM   4302  O  O     . GLN D 4  447  ? 14.219  -4.862  43.229  1.00 101.48 ? 447  GLN A O     1 
ATOM   4303  C  CB    . GLN D 4  447  ? 11.987  -3.725  41.319  1.00 79.89  ? 447  GLN A CB    1 
ATOM   4304  C  CG    . GLN D 4  447  ? 12.565  -3.576  39.904  1.00 87.14  ? 447  GLN A CG    1 
ATOM   4305  C  CD    . GLN D 4  447  ? 14.037  -3.962  39.818  1.00 88.59  ? 447  GLN A CD    1 
ATOM   4306  O  OE1   . GLN D 4  447  ? 14.823  -3.677  40.718  1.00 105.22 ? 447  GLN A OE1   1 
ATOM   4307  N  NE2   . GLN D 4  447  ? 14.412  -4.618  38.730  1.00 93.61  ? 447  GLN A NE2   1 
ATOM   4308  N  N     . PRO D 4  448  ? 12.331  -4.875  44.430  1.00 78.53  ? 448  PRO A N     1 
ATOM   4309  C  CA    . PRO D 4  448  ? 13.142  -5.037  45.649  1.00 64.87  ? 448  PRO A CA    1 
ATOM   4310  C  C     . PRO D 4  448  ? 13.588  -6.493  45.768  1.00 87.96  ? 448  PRO A C     1 
ATOM   4311  O  O     . PRO D 4  448  ? 12.810  -7.367  46.169  1.00 88.24  ? 448  PRO A O     1 
ATOM   4312  C  CB    . PRO D 4  448  ? 12.193  -4.599  46.779  1.00 46.21  ? 448  PRO A CB    1 
ATOM   4313  C  CG    . PRO D 4  448  ? 10.827  -4.702  46.191  1.00 47.48  ? 448  PRO A CG    1 
ATOM   4314  C  CD    . PRO D 4  448  ? 10.986  -4.347  44.744  1.00 48.86  ? 448  PRO A CD    1 
ATOM   4315  N  N     . SER D 4  449  ? 14.846  -6.761  45.401  1.00 85.06  ? 449  SER A N     1 
ATOM   4316  C  CA    . SER D 4  449  ? 15.353  -8.134  45.292  1.00 77.54  ? 449  SER A CA    1 
ATOM   4317  C  C     . SER D 4  449  ? 16.152  -8.495  46.543  1.00 91.30  ? 449  SER A C     1 
ATOM   4318  O  O     . SER D 4  449  ? 17.384  -8.602  46.551  1.00 88.39  ? 449  SER A O     1 
ATOM   4319  C  CB    . SER D 4  449  ? 16.183  -8.307  44.022  1.00 62.05  ? 449  SER A CB    1 
ATOM   4320  O  OG    . SER D 4  449  ? 15.512  -7.770  42.898  1.00 72.86  ? 449  SER A OG    1 
ATOM   4321  N  N     . LEU D 4  450  ? 15.390  -8.703  47.612  1.00 88.34  ? 450  LEU A N     1 
ATOM   4322  C  CA    . LEU D 4  450  ? 15.875  -9.143  48.911  1.00 86.89  ? 450  LEU A CA    1 
ATOM   4323  C  C     . LEU D 4  450  ? 15.709  -10.650 49.122  1.00 97.42  ? 450  LEU A C     1 
ATOM   4324  O  O     . LEU D 4  450  ? 15.573  -11.105 50.260  1.00 103.88 ? 450  LEU A O     1 
ATOM   4325  C  CB    . LEU D 4  450  ? 15.164  -8.322  49.993  1.00 93.88  ? 450  LEU A CB    1 
ATOM   4326  C  CG    . LEU D 4  450  ? 13.668  -8.005  49.797  1.00 80.46  ? 450  LEU A CG    1 
ATOM   4327  C  CD1   . LEU D 4  450  ? 12.715  -9.177  49.997  1.00 86.47  ? 450  LEU A CD1   1 
ATOM   4328  C  CD2   . LEU D 4  450  ? 13.265  -6.818  50.670  1.00 53.76  ? 450  LEU A CD2   1 
ATOM   4329  N  N     . HIS D 4  451  ? 15.774  -11.416 48.035  1.00 103.07 ? 451  HIS A N     1 
ATOM   4330  C  CA    . HIS D 4  451  ? 15.411  -12.828 47.921  1.00 80.73  ? 451  HIS A CA    1 
ATOM   4331  C  C     . HIS D 4  451  ? 15.960  -13.449 46.649  1.00 83.35  ? 451  HIS A C     1 
ATOM   4332  O  O     . HIS D 4  451  ? 15.866  -12.848 45.581  1.00 64.39  ? 451  HIS A O     1 
ATOM   4333  C  CB    . HIS D 4  451  ? 13.900  -13.025 47.929  1.00 78.77  ? 451  HIS A CB    1 
ATOM   4334  C  CG    . HIS D 4  451  ? 13.334  -13.475 49.234  1.00 87.65  ? 451  HIS A CG    1 
ATOM   4335  N  ND1   . HIS D 4  451  ? 12.057  -13.983 49.344  1.00 94.08  ? 451  HIS A ND1   1 
ATOM   4336  C  CD2   . HIS D 4  451  ? 13.906  -13.634 50.449  1.00 95.17  ? 451  HIS A CD2   1 
ATOM   4337  C  CE1   . HIS D 4  451  ? 11.840  -14.350 50.597  1.00 102.13 ? 451  HIS A CE1   1 
ATOM   4338  N  NE2   . HIS D 4  451  ? 12.954  -14.166 51.283  1.00 98.98  ? 451  HIS A NE2   1 
ATOM   4339  N  N     . LYS D 4  452  ? 16.491  -14.677 46.752  1.00 99.03  ? 452  LYS A N     1 
ATOM   4340  C  CA    . LYS D 4  452  ? 16.661  -15.484 45.546  1.00 83.88  ? 452  LYS A CA    1 
ATOM   4341  C  C     . LYS D 4  452  ? 15.312  -15.889 44.962  1.00 68.81  ? 452  LYS A C     1 
ATOM   4342  O  O     . LYS D 4  452  ? 15.219  -16.120 43.755  1.00 68.49  ? 452  LYS A O     1 
ATOM   4343  C  CB    . LYS D 4  452  ? 17.522  -16.715 45.863  1.00 72.17  ? 452  LYS A CB    1 
ATOM   4344  C  CG    . LYS D 4  452  ? 16.897  -17.672 46.859  1.00 76.31  ? 452  LYS A CG    1 
ATOM   4345  C  CD    . LYS D 4  452  ? 17.812  -18.842 47.206  1.00 69.14  ? 452  LYS A CD    1 
ATOM   4346  C  CE    . LYS D 4  452  ? 18.001  -19.784 46.047  1.00 73.16  ? 452  LYS A CE    1 
ATOM   4347  N  NZ    . LYS D 4  452  ? 18.813  -20.958 46.455  1.00 75.39  ? 452  LYS A NZ    1 
ATOM   4348  N  N     . MET D 4  453  ? 14.257  -15.924 45.786  1.00 60.32  ? 453  MET A N     1 
ATOM   4349  C  CA    . MET D 4  453  ? 12.892  -16.142 45.324  1.00 58.16  ? 453  MET A CA    1 
ATOM   4350  C  C     . MET D 4  453  ? 12.208  -14.856 44.858  1.00 62.30  ? 453  MET A C     1 
ATOM   4351  O  O     . MET D 4  453  ? 10.975  -14.825 44.754  1.00 50.90  ? 453  MET A O     1 
ATOM   4352  C  CB    . MET D 4  453  ? 12.077  -16.813 46.430  1.00 58.41  ? 453  MET A CB    1 
ATOM   4353  C  CG    . MET D 4  453  ? 12.642  -18.155 46.825  1.00 87.75  ? 453  MET A CG    1 
ATOM   4354  S  SD    . MET D 4  453  ? 13.473  -18.063 48.415  1.00 104.34 ? 453  MET A SD    1 
ATOM   4355  C  CE    . MET D 4  453  ? 12.124  -17.556 49.477  1.00 104.82 ? 453  MET A CE    1 
ATOM   4356  N  N     . SER D 4  454  ? 12.980  -13.800 44.586  1.00 72.66  ? 454  SER A N     1 
ATOM   4357  C  CA    . SER D 4  454  ? 12.475  -12.606 43.920  1.00 74.46  ? 454  SER A CA    1 
ATOM   4358  C  C     . SER D 4  454  ? 12.877  -12.544 42.452  1.00 69.26  ? 454  SER A C     1 
ATOM   4359  O  O     . SER D 4  454  ? 12.360  -11.697 41.720  1.00 79.54  ? 454  SER A O     1 
ATOM   4360  C  CB    . SER D 4  454  ? 12.956  -11.330 44.636  1.00 84.65  ? 454  SER A CB    1 
ATOM   4361  O  OG    . SER D 4  454  ? 12.165  -11.037 45.777  1.00 85.51  ? 454  SER A OG    1 
ATOM   4362  N  N     . MET D 4  455  ? 13.793  -13.402 42.015  1.00 62.22  ? 455  MET A N     1 
ATOM   4363  C  CA    . MET D 4  455  ? 14.048  -13.636 40.595  1.00 64.12  ? 455  MET A CA    1 
ATOM   4364  C  C     . MET D 4  455  ? 13.970  -15.136 40.361  1.00 69.00  ? 455  MET A C     1 
ATOM   4365  O  O     . MET D 4  455  ? 14.860  -15.880 40.784  1.00 77.16  ? 455  MET A O     1 
ATOM   4366  C  CB    . MET D 4  455  ? 15.403  -13.085 40.157  1.00 47.21  ? 455  MET A CB    1 
ATOM   4367  C  CG    . MET D 4  455  ? 15.512  -11.584 40.248  1.00 60.65  ? 455  MET A CG    1 
ATOM   4368  S  SD    . MET D 4  455  ? 16.402  -10.912 38.840  1.00 103.53 ? 455  MET A SD    1 
ATOM   4369  C  CE    . MET D 4  455  ? 18.037  -11.560 39.161  1.00 96.28  ? 455  MET A CE    1 
ATOM   4370  N  N     . MET D 4  456  ? 12.914  -15.580 39.689  1.00 57.92  ? 456  MET A N     1 
ATOM   4371  C  CA    . MET D 4  456  ? 12.684  -16.993 39.459  1.00 66.03  ? 456  MET A CA    1 
ATOM   4372  C  C     . MET D 4  456  ? 12.374  -17.238 37.988  1.00 87.45  ? 456  MET A C     1 
ATOM   4373  O  O     . MET D 4  456  ? 11.762  -16.402 37.313  1.00 86.82  ? 456  MET A O     1 
ATOM   4374  C  CB    . MET D 4  456  ? 11.542  -17.506 40.342  1.00 55.51  ? 456  MET A CB    1 
ATOM   4375  C  CG    . MET D 4  456  ? 11.877  -17.555 41.818  1.00 65.86  ? 456  MET A CG    1 
ATOM   4376  S  SD    . MET D 4  456  ? 10.658  -18.530 42.729  1.00 74.46  ? 456  MET A SD    1 
ATOM   4377  C  CE    . MET D 4  456  ? 9.244   -17.439 42.581  1.00 53.32  ? 456  MET A CE    1 
ATOM   4378  N  N     . ALA D 4  457  ? 12.822  -18.394 37.497  1.00 87.55  ? 457  ALA A N     1 
ATOM   4379  C  CA    . ALA D 4  457  ? 12.550  -18.784 36.123  1.00 64.05  ? 457  ALA A CA    1 
ATOM   4380  C  C     . ALA D 4  457  ? 11.090  -19.184 35.957  1.00 73.87  ? 457  ALA A C     1 
ATOM   4381  O  O     . ALA D 4  457  ? 10.449  -19.689 36.881  1.00 69.34  ? 457  ALA A O     1 
ATOM   4382  C  CB    . ALA D 4  457  ? 13.445  -19.945 35.703  1.00 53.68  ? 457  ALA A CB    1 
ATOM   4383  N  N     . HIS D 4  458  ? 10.578  -18.970 34.750  1.00 91.06  ? 458  HIS A N     1 
ATOM   4384  C  CA    . HIS D 4  458  ? 9.172   -19.155 34.452  1.00 85.69  ? 458  HIS A CA    1 
ATOM   4385  C  C     . HIS D 4  458  ? 9.022   -19.697 33.040  1.00 84.83  ? 458  HIS A C     1 
ATOM   4386  O  O     . HIS D 4  458  ? 9.837   -19.408 32.158  1.00 69.52  ? 458  HIS A O     1 
ATOM   4387  C  CB    . HIS D 4  458  ? 8.383   -17.847 34.552  1.00 73.84  ? 458  HIS A CB    1 
ATOM   4388  C  CG    . HIS D 4  458  ? 7.903   -17.513 35.933  1.00 70.72  ? 458  HIS A CG    1 
ATOM   4389  N  ND1   . HIS D 4  458  ? 6.570   -17.575 36.290  1.00 68.59  ? 458  HIS A ND1   1 
ATOM   4390  C  CD2   . HIS D 4  458  ? 8.568   -17.055 37.023  1.00 67.88  ? 458  HIS A CD2   1 
ATOM   4391  C  CE1   . HIS D 4  458  ? 6.443   -17.198 37.550  1.00 71.39  ? 458  HIS A CE1   1 
ATOM   4392  N  NE2   . HIS D 4  458  ? 7.637   -16.867 38.013  1.00 64.33  ? 458  HIS A NE2   1 
ATOM   4393  N  N     . ARG D 4  459  ? 7.959   -20.475 32.840  1.00 77.81  ? 459  ARG A N     1 
ATOM   4394  C  CA    . ARG D 4  459  ? 7.563   -20.956 31.524  1.00 55.36  ? 459  ARG A CA    1 
ATOM   4395  C  C     . ARG D 4  459  ? 6.636   -19.931 30.889  1.00 65.72  ? 459  ARG A C     1 
ATOM   4396  O  O     . ARG D 4  459  ? 5.677   -19.484 31.522  1.00 70.25  ? 459  ARG A O     1 
ATOM   4397  C  CB    . ARG D 4  459  ? 6.843   -22.299 31.629  1.00 67.58  ? 459  ARG A CB    1 
ATOM   4398  C  CG    . ARG D 4  459  ? 7.730   -23.541 31.599  1.00 56.90  ? 459  ARG A CG    1 
ATOM   4399  C  CD    . ARG D 4  459  ? 6.896   -24.752 31.971  1.00 48.38  ? 459  ARG A CD    1 
ATOM   4400  N  NE    . ARG D 4  459  ? 5.559   -24.666 31.381  1.00 69.32  ? 459  ARG A NE    1 
ATOM   4401  C  CZ    . ARG D 4  459  ? 4.435   -25.042 31.990  1.00 74.45  ? 459  ARG A CZ    1 
ATOM   4402  N  NH1   . ARG D 4  459  ? 4.463   -25.513 33.228  1.00 78.85  ? 459  ARG A NH1   1 
ATOM   4403  N  NH2   . ARG D 4  459  ? 3.273   -24.927 31.361  1.00 76.87  ? 459  ARG A NH2   1 
ATOM   4404  N  N     . VAL D 4  460  ? 6.906   -19.578 29.638  1.00 80.41  ? 460  VAL A N     1 
ATOM   4405  C  CA    . VAL D 4  460  ? 6.141   -18.538 28.958  1.00 68.99  ? 460  VAL A CA    1 
ATOM   4406  C  C     . VAL D 4  460  ? 4.797   -19.094 28.500  1.00 65.70  ? 460  VAL A C     1 
ATOM   4407  O  O     . VAL D 4  460  ? 4.730   -20.139 27.839  1.00 73.99  ? 460  VAL A O     1 
ATOM   4408  C  CB    . VAL D 4  460  ? 6.932   -17.983 27.767  1.00 56.26  ? 460  VAL A CB    1 
ATOM   4409  C  CG1   . VAL D 4  460  ? 6.051   -17.073 26.935  1.00 68.41  ? 460  VAL A CG1   1 
ATOM   4410  C  CG2   . VAL D 4  460  ? 8.171   -17.253 28.253  1.00 44.54  ? 460  VAL A CG2   1 
ATOM   4411  N  N     . LYS D 4  461  ? 3.716   -18.399 28.854  1.00 51.37  ? 461  LYS A N     1 
ATOM   4412  C  CA    . LYS D 4  461  ? 2.420   -18.553 28.205  1.00 60.80  ? 461  LYS A CA    1 
ATOM   4413  C  C     . LYS D 4  461  ? 2.043   -17.187 27.649  1.00 70.35  ? 461  LYS A C     1 
ATOM   4414  O  O     . LYS D 4  461  ? 1.996   -16.205 28.397  1.00 81.47  ? 461  LYS A O     1 
ATOM   4415  C  CB    . LYS D 4  461  ? 1.363   -19.068 29.188  1.00 58.37  ? 461  LYS A CB    1 
ATOM   4416  C  CG    . LYS D 4  461  ? -0.057  -18.973 28.653  1.00 64.53  ? 461  LYS A CG    1 
ATOM   4417  C  CD    . LYS D 4  461  ? -0.309  -20.000 27.563  1.00 80.46  ? 461  LYS A CD    1 
ATOM   4418  C  CE    . LYS D 4  461  ? -1.774  -20.033 27.137  1.00 82.24  ? 461  LYS A CE    1 
ATOM   4419  N  NZ    . LYS D 4  461  ? -2.018  -20.992 26.017  1.00 82.83  ? 461  LYS A NZ    1 
ATOM   4420  N  N     . VAL D 4  462  ? 1.819   -17.109 26.341  1.00 75.06  ? 462  VAL A N     1 
ATOM   4421  C  CA    . VAL D 4  462  ? 1.605   -15.823 25.683  1.00 63.67  ? 462  VAL A CA    1 
ATOM   4422  C  C     . VAL D 4  462  ? 0.111   -15.508 25.669  1.00 57.65  ? 462  VAL A C     1 
ATOM   4423  O  O     . VAL D 4  462  ? -0.717  -16.343 25.276  1.00 66.29  ? 462  VAL A O     1 
ATOM   4424  C  CB    . VAL D 4  462  ? 2.205   -15.817 24.267  1.00 50.38  ? 462  VAL A CB    1 
ATOM   4425  C  CG1   . VAL D 4  462  ? 1.745   -14.604 23.498  1.00 53.93  ? 462  VAL A CG1   1 
ATOM   4426  C  CG2   . VAL D 4  462  ? 3.725   -15.827 24.346  1.00 44.23  ? 462  VAL A CG2   1 
ATOM   4427  N  N     . ILE D 4  463  ? -0.232  -14.301 26.108  1.00 54.23  ? 463  ILE A N     1 
ATOM   4428  C  CA    . ILE D 4  463  ? -1.618  -13.899 26.341  1.00 66.43  ? 463  ILE A CA    1 
ATOM   4429  C  C     . ILE D 4  463  ? -1.880  -12.593 25.598  1.00 60.34  ? 463  ILE A C     1 
ATOM   4430  O  O     . ILE D 4  463  ? -0.945  -11.835 25.293  1.00 53.83  ? 463  ILE A O     1 
ATOM   4431  C  CB    . ILE D 4  463  ? -1.929  -13.806 27.860  1.00 77.63  ? 463  ILE A CB    1 
ATOM   4432  C  CG1   . ILE D 4  463  ? -0.765  -13.208 28.675  1.00 63.37  ? 463  ILE A CG1   1 
ATOM   4433  C  CG2   . ILE D 4  463  ? -2.349  -15.172 28.394  1.00 78.93  ? 463  ILE A CG2   1 
ATOM   4434  C  CD1   . ILE D 4  463  ? -0.328  -11.794 28.341  1.00 68.03  ? 463  ILE A CD1   1 
ATOM   4435  N  N     . PRO D 4  464  ? -3.147  -12.317 25.252  1.00 59.32  ? 464  PRO A N     1 
ATOM   4436  C  CA    . PRO D 4  464  ? -3.424  -11.170 24.382  1.00 89.79  ? 464  PRO A CA    1 
ATOM   4437  C  C     . PRO D 4  464  ? -3.612  -9.839  25.093  1.00 100.34 ? 464  PRO A C     1 
ATOM   4438  O  O     . PRO D 4  464  ? -4.210  -8.929  24.513  1.00 132.81 ? 464  PRO A O     1 
ATOM   4439  C  CB    . PRO D 4  464  ? -4.708  -11.597 23.661  1.00 110.38 ? 464  PRO A CB    1 
ATOM   4440  C  CG    . PRO D 4  464  ? -5.421  -12.389 24.692  1.00 101.90 ? 464  PRO A CG    1 
ATOM   4441  C  CD    . PRO D 4  464  ? -4.337  -13.192 25.361  1.00 79.80  ? 464  PRO A CD    1 
ATOM   4442  N  N     . TYR D 4  465  ? -3.161  -9.687  26.334  1.00 73.01  ? 465  TYR A N     1 
ATOM   4443  C  CA    . TYR D 4  465  ? -3.292  -8.399  26.997  1.00 73.89  ? 465  TYR A CA    1 
ATOM   4444  C  C     . TYR D 4  465  ? -1.933  -7.929  27.493  1.00 92.61  ? 465  TYR A C     1 
ATOM   4445  O  O     . TYR D 4  465  ? -0.994  -8.715  27.649  1.00 84.03  ? 465  TYR A O     1 
ATOM   4446  C  CB    . TYR D 4  465  ? -4.301  -8.450  28.148  1.00 73.54  ? 465  TYR A CB    1 
ATOM   4447  C  CG    . TYR D 4  465  ? -5.721  -8.563  27.649  1.00 61.69  ? 465  TYR A CG    1 
ATOM   4448  C  CD1   . TYR D 4  465  ? -6.258  -9.794  27.298  1.00 74.31  ? 465  TYR A CD1   1 
ATOM   4449  C  CD2   . TYR D 4  465  ? -6.506  -7.436  27.474  1.00 49.28  ? 465  TYR A CD2   1 
ATOM   4450  C  CE1   . TYR D 4  465  ? -7.552  -9.906  26.822  1.00 76.89  ? 465  TYR A CE1   1 
ATOM   4451  C  CE2   . TYR D 4  465  ? -7.809  -7.541  26.994  1.00 59.57  ? 465  TYR A CE2   1 
ATOM   4452  C  CZ    . TYR D 4  465  ? -8.325  -8.778  26.671  1.00 60.58  ? 465  TYR A CZ    1 
ATOM   4453  O  OH    . TYR D 4  465  ? -9.612  -8.891  26.194  1.00 69.80  ? 465  TYR A OH    1 
ATOM   4454  N  N     . SER D 4  466  ? -1.850  -6.619  27.749  1.00 103.64 ? 466  SER A N     1 
ATOM   4455  C  CA    . SER D 4  466  ? -0.584  -5.943  28.013  1.00 100.92 ? 466  SER A CA    1 
ATOM   4456  C  C     . SER D 4  466  ? 0.014   -6.254  29.382  1.00 99.64  ? 466  SER A C     1 
ATOM   4457  O  O     . SER D 4  466  ? 1.181   -5.925  29.610  1.00 71.28  ? 466  SER A O     1 
ATOM   4458  C  CB    . SER D 4  466  ? -0.780  -4.434  27.873  1.00 91.13  ? 466  SER A CB    1 
ATOM   4459  O  OG    . SER D 4  466  ? -1.694  -4.149  26.832  1.00 97.02  ? 466  SER A OG    1 
ATOM   4460  N  N     . THR D 4  467  ? -0.730  -6.884  30.285  1.00 103.46 ? 467  THR A N     1 
ATOM   4461  C  CA    . THR D 4  467  ? -0.247  -7.152  31.632  1.00 61.58  ? 467  THR A CA    1 
ATOM   4462  C  C     . THR D 4  467  ? 0.505   -8.478  31.711  1.00 66.39  ? 467  THR A C     1 
ATOM   4463  O  O     . THR D 4  467  ? 0.229   -9.418  30.961  1.00 79.54  ? 467  THR A O     1 
ATOM   4464  C  CB    . THR D 4  467  ? -1.416  -7.160  32.624  1.00 47.72  ? 467  THR A CB    1 
ATOM   4465  O  OG1   . THR D 4  467  ? -2.326  -8.216  32.279  1.00 58.48  ? 467  THR A OG1   1 
ATOM   4466  C  CG2   . THR D 4  467  ? -2.155  -5.834  32.609  1.00 45.20  ? 467  THR A CG2   1 
ATOM   4467  N  N     . PHE D 4  468  ? 1.482   -8.529  32.626  1.00 70.51  ? 468  PHE A N     1 
ATOM   4468  C  CA    . PHE D 4  468  ? 2.132   -9.782  33.006  1.00 50.69  ? 468  PHE A CA    1 
ATOM   4469  C  C     . PHE D 4  468  ? 1.200   -10.586 33.900  1.00 55.65  ? 468  PHE A C     1 
ATOM   4470  O  O     . PHE D 4  468  ? 0.883   -10.167 35.018  1.00 65.98  ? 468  PHE A O     1 
ATOM   4471  C  CB    . PHE D 4  468  ? 3.447   -9.519  33.739  1.00 42.50  ? 468  PHE A CB    1 
ATOM   4472  C  CG    . PHE D 4  468  ? 4.614   -9.265  32.831  1.00 65.00  ? 468  PHE A CG    1 
ATOM   4473  C  CD1   . PHE D 4  468  ? 5.555   -8.295  33.139  1.00 78.91  ? 468  PHE A CD1   1 
ATOM   4474  C  CD2   . PHE D 4  468  ? 4.782   -10.005 31.677  1.00 77.63  ? 468  PHE A CD2   1 
ATOM   4475  C  CE1   . PHE D 4  468  ? 6.634   -8.059  32.298  1.00 77.25  ? 468  PHE A CE1   1 
ATOM   4476  C  CE2   . PHE D 4  468  ? 5.859   -9.776  30.840  1.00 87.26  ? 468  PHE A CE2   1 
ATOM   4477  C  CZ    . PHE D 4  468  ? 6.783   -8.803  31.151  1.00 83.84  ? 468  PHE A CZ    1 
ATOM   4478  N  N     . ARG D 4  469  ? 0.766   -11.743 33.420  1.00 67.17  ? 469  ARG A N     1 
ATOM   4479  C  CA    . ARG D 4  469  ? -0.108  -12.591 34.209  1.00 71.95  ? 469  ARG A CA    1 
ATOM   4480  C  C     . ARG D 4  469  ? 0.736   -13.572 35.013  1.00 74.69  ? 469  ARG A C     1 
ATOM   4481  O  O     . ARG D 4  469  ? 1.721   -14.117 34.507  1.00 82.95  ? 469  ARG A O     1 
ATOM   4482  C  CB    . ARG D 4  469  ? -1.103  -13.334 33.311  1.00 73.26  ? 469  ARG A CB    1 
ATOM   4483  C  CG    . ARG D 4  469  ? -1.593  -12.547 32.089  1.00 68.76  ? 469  ARG A CG    1 
ATOM   4484  C  CD    . ARG D 4  469  ? -2.606  -11.484 32.478  1.00 42.71  ? 469  ARG A CD    1 
ATOM   4485  N  NE    . ARG D 4  469  ? -3.818  -12.043 33.069  1.00 43.08  ? 469  ARG A NE    1 
ATOM   4486  C  CZ    . ARG D 4  469  ? -4.882  -11.325 33.420  1.00 63.26  ? 469  ARG A CZ    1 
ATOM   4487  N  NH1   . ARG D 4  469  ? -4.907  -10.009 33.237  1.00 62.96  ? 469  ARG A NH1   1 
ATOM   4488  N  NH2   . ARG D 4  469  ? -5.924  -11.926 33.973  1.00 63.30  ? 469  ARG A NH2   1 
ATOM   4489  N  N     . LEU D 4  470  ? 0.368   -13.772 36.279  1.00 57.48  ? 470  LEU A N     1 
ATOM   4490  C  CA    . LEU D 4  470  ? 1.061   -14.755 37.102  1.00 57.01  ? 470  LEU A CA    1 
ATOM   4491  C  C     . LEU D 4  470  ? 0.066   -15.415 38.049  1.00 53.84  ? 470  LEU A C     1 
ATOM   4492  O  O     . LEU D 4  470  ? -1.040  -14.915 38.272  1.00 53.61  ? 470  LEU A O     1 
ATOM   4493  C  CB    . LEU D 4  470  ? 2.224   -14.127 37.881  1.00 49.34  ? 470  LEU A CB    1 
ATOM   4494  C  CG    . LEU D 4  470  ? 1.875   -12.855 38.658  1.00 67.49  ? 470  LEU A CG    1 
ATOM   4495  C  CD1   . LEU D 4  470  ? 1.594   -13.163 40.109  1.00 51.25  ? 470  LEU A CD1   1 
ATOM   4496  C  CD2   . LEU D 4  470  ? 2.955   -11.799 38.538  1.00 78.01  ? 470  LEU A CD2   1 
ATOM   4497  N  N     . ASN D 4  471  ? 0.488   -16.545 38.615  1.00 48.54  ? 471  ASN A N     1 
ATOM   4498  C  CA    . ASN D 4  471  ? -0.364  -17.297 39.519  1.00 53.82  ? 471  ASN A CA    1 
ATOM   4499  C  C     . ASN D 4  471  ? -0.381  -16.617 40.886  1.00 71.96  ? 471  ASN A C     1 
ATOM   4500  O  O     . ASN D 4  471  ? 0.612   -16.024 41.315  1.00 92.19  ? 471  ASN A O     1 
ATOM   4501  C  CB    . ASN D 4  471  ? 0.138   -18.739 39.647  1.00 50.51  ? 471  ASN A CB    1 
ATOM   4502  C  CG    . ASN D 4  471  ? -0.922  -19.677 40.166  1.00 56.84  ? 471  ASN A CG    1 
ATOM   4503  O  OD1   . ASN D 4  471  ? -2.073  -19.275 40.356  1.00 68.98  ? 471  ASN A OD1   1 
ATOM   4504  N  ND2   . ASN D 4  471  ? -0.549  -20.926 40.403  1.00 48.13  ? 471  ASN A ND2   1 
ATOM   4505  N  N     . LEU D 4  472  ? -1.530  -16.701 41.568  1.00 55.51  ? 472  LEU A N     1 
ATOM   4506  C  CA    . LEU D 4  472  ? -1.675  -16.081 42.885  1.00 50.03  ? 472  LEU A CA    1 
ATOM   4507  C  C     . LEU D 4  472  ? -0.697  -16.657 43.902  1.00 69.82  ? 472  LEU A C     1 
ATOM   4508  O  O     . LEU D 4  472  ? -0.224  -15.936 44.787  1.00 80.69  ? 472  LEU A O     1 
ATOM   4509  C  CB    . LEU D 4  472  ? -3.104  -16.277 43.389  1.00 46.52  ? 472  LEU A CB    1 
ATOM   4510  C  CG    . LEU D 4  472  ? -4.103  -16.090 42.263  1.00 54.58  ? 472  LEU A CG    1 
ATOM   4511  C  CD1   . LEU D 4  472  ? -5.389  -16.865 42.507  1.00 57.14  ? 472  LEU A CD1   1 
ATOM   4512  C  CD2   . LEU D 4  472  ? -4.346  -14.605 42.113  1.00 65.40  ? 472  LEU A CD2   1 
ATOM   4513  N  N     . SER D 4  473  ? -0.377  -17.942 43.784  1.00 79.05  ? 473  SER A N     1 
ATOM   4514  C  CA    . SER D 4  473  ? 0.497   -18.619 44.726  1.00 83.69  ? 473  SER A CA    1 
ATOM   4515  C  C     . SER D 4  473  ? 1.982   -18.357 44.471  1.00 79.78  ? 473  SER A C     1 
ATOM   4516  O  O     . SER D 4  473  ? 2.824   -18.974 45.138  1.00 80.81  ? 473  SER A O     1 
ATOM   4517  C  CB    . SER D 4  473  ? 0.193   -20.119 44.709  1.00 83.05  ? 473  SER A CB    1 
ATOM   4518  O  OG    . SER D 4  473  ? -1.163  -20.340 45.074  1.00 80.39  ? 473  SER A OG    1 
ATOM   4519  N  N     . VAL D 4  474  ? 2.326   -17.451 43.555  1.00 68.53  ? 474  VAL A N     1 
ATOM   4520  C  CA    . VAL D 4  474  ? 3.700   -16.992 43.391  1.00 75.09  ? 474  VAL A CA    1 
ATOM   4521  C  C     . VAL D 4  474  ? 3.871   -15.547 43.883  1.00 83.21  ? 474  VAL A C     1 
ATOM   4522  O  O     . VAL D 4  474  ? 4.972   -14.985 43.804  1.00 81.33  ? 474  VAL A O     1 
ATOM   4523  C  CB    . VAL D 4  474  ? 4.176   -17.176 41.931  1.00 71.83  ? 474  VAL A CB    1 
ATOM   4524  C  CG1   . VAL D 4  474  ? 3.426   -16.281 40.935  1.00 89.27  ? 474  VAL A CG1   1 
ATOM   4525  C  CG2   . VAL D 4  474  ? 5.687   -17.021 41.813  1.00 75.54  ? 474  VAL A CG2   1 
ATOM   4526  N  N     . THR D 4  475  ? 2.814   -14.953 44.453  1.00 73.52  ? 475  THR A N     1 
ATOM   4527  C  CA    . THR D 4  475  ? 2.870   -13.563 44.906  1.00 61.30  ? 475  THR A CA    1 
ATOM   4528  C  C     . THR D 4  475  ? 3.804   -13.394 46.102  1.00 71.62  ? 475  THR A C     1 
ATOM   4529  O  O     . THR D 4  475  ? 4.656   -12.498 46.111  1.00 84.17  ? 475  THR A O     1 
ATOM   4530  C  CB    . THR D 4  475  ? 1.466   -13.072 45.271  1.00 64.20  ? 475  THR A CB    1 
ATOM   4531  O  OG1   . THR D 4  475  ? 0.810   -14.058 46.088  1.00 63.51  ? 475  THR A OG1   1 
ATOM   4532  C  CG2   . THR D 4  475  ? 0.634   -12.802 44.026  1.00 59.96  ? 475  THR A CG2   1 
ATOM   4533  N  N     . SER D 4  476  ? 3.648   -14.243 47.120  1.00 68.34  ? 476  SER A N     1 
ATOM   4534  C  CA    . SER D 4  476  ? 4.372   -14.062 48.379  1.00 74.75  ? 476  SER A CA    1 
ATOM   4535  C  C     . SER D 4  476  ? 5.903   -14.100 48.274  1.00 75.80  ? 476  SER A C     1 
ATOM   4536  O  O     . SER D 4  476  ? 6.546   -13.293 48.968  1.00 92.29  ? 476  SER A O     1 
ATOM   4537  C  CB    . SER D 4  476  ? 3.864   -15.087 49.403  1.00 87.02  ? 476  SER A CB    1 
ATOM   4538  O  OG    . SER D 4  476  ? 2.468   -14.939 49.618  1.00 103.09 ? 476  SER A OG    1 
ATOM   4539  N  N     . PRO D 4  477  ? 6.549   -14.973 47.482  1.00 65.72  ? 477  PRO A N     1 
ATOM   4540  C  CA    . PRO D 4  477  ? 8.011   -14.830 47.329  1.00 66.60  ? 477  PRO A CA    1 
ATOM   4541  C  C     . PRO D 4  477  ? 8.444   -13.539 46.649  1.00 71.47  ? 477  PRO A C     1 
ATOM   4542  O  O     . PRO D 4  477  ? 9.505   -13.004 46.995  1.00 85.00  ? 477  PRO A O     1 
ATOM   4543  C  CB    . PRO D 4  477  ? 8.405   -16.071 46.510  1.00 66.28  ? 477  PRO A CB    1 
ATOM   4544  C  CG    . PRO D 4  477  ? 7.134   -16.542 45.881  1.00 65.06  ? 477  PRO A CG    1 
ATOM   4545  C  CD    . PRO D 4  477  ? 6.092   -16.253 46.902  1.00 62.02  ? 477  PRO A CD    1 
ATOM   4546  N  N     . TYR D 4  478  ? 7.657   -13.015 45.705  1.00 75.12  ? 478  TYR A N     1 
ATOM   4547  C  CA    . TYR D 4  478  ? 7.951   -11.718 45.107  1.00 66.15  ? 478  TYR A CA    1 
ATOM   4548  C  C     . TYR D 4  478  ? 7.443   -10.554 45.948  1.00 71.09  ? 478  TYR A C     1 
ATOM   4549  O  O     . TYR D 4  478  ? 7.861   -9.415  45.702  1.00 62.26  ? 478  TYR A O     1 
ATOM   4550  C  CB    . TYR D 4  478  ? 7.324   -11.608 43.711  1.00 70.14  ? 478  TYR A CB    1 
ATOM   4551  C  CG    . TYR D 4  478  ? 7.877   -12.560 42.668  1.00 56.19  ? 478  TYR A CG    1 
ATOM   4552  C  CD1   . TYR D 4  478  ? 7.077   -13.535 42.097  1.00 44.45  ? 478  TYR A CD1   1 
ATOM   4553  C  CD2   . TYR D 4  478  ? 9.201   -12.486 42.260  1.00 65.24  ? 478  TYR A CD2   1 
ATOM   4554  C  CE1   . TYR D 4  478  ? 7.576   -14.414 41.140  1.00 52.11  ? 478  TYR A CE1   1 
ATOM   4555  C  CE2   . TYR D 4  478  ? 9.709   -13.362 41.303  1.00 68.45  ? 478  TYR A CE2   1 
ATOM   4556  C  CZ    . TYR D 4  478  ? 8.893   -14.324 40.748  1.00 65.41  ? 478  TYR A CZ    1 
ATOM   4557  O  OH    . TYR D 4  478  ? 9.381   -15.198 39.799  1.00 66.35  ? 478  TYR A OH    1 
ATOM   4558  N  N     . ASN D 4  479  ? 6.566   -10.823 46.923  1.00 90.10  ? 479  ASN A N     1 
ATOM   4559  C  CA    . ASN D 4  479  ? 5.761   -9.810  47.621  1.00 93.57  ? 479  ASN A CA    1 
ATOM   4560  C  C     . ASN D 4  479  ? 5.039   -8.903  46.625  1.00 95.66  ? 479  ASN A C     1 
ATOM   4561  O  O     . ASN D 4  479  ? 5.126   -7.674  46.675  1.00 105.63 ? 479  ASN A O     1 
ATOM   4562  C  CB    . ASN D 4  479  ? 6.599   -8.994  48.609  1.00 95.58  ? 479  ASN A CB    1 
ATOM   4563  C  CG    . ASN D 4  479  ? 5.739   -8.182  49.564  1.00 95.10  ? 479  ASN A CG    1 
ATOM   4564  O  OD1   . ASN D 4  479  ? 4.541   -8.440  49.709  1.00 84.89  ? 479  ASN A OD1   1 
ATOM   4565  N  ND2   . ASN D 4  479  ? 6.343   -7.197  50.216  1.00 116.46 ? 479  ASN A ND2   1 
ATOM   4566  N  N     . ALA D 4  480  ? 4.322   -9.529  45.703  1.00 90.74  ? 480  ALA A N     1 
ATOM   4567  C  CA    . ALA D 4  480  ? 3.583   -8.797  44.690  1.00 80.28  ? 480  ALA A CA    1 
ATOM   4568  C  C     . ALA D 4  480  ? 2.190   -8.442  45.188  1.00 96.92  ? 480  ALA A C     1 
ATOM   4569  O  O     . ALA D 4  480  ? 1.602   -9.140  46.022  1.00 111.90 ? 480  ALA A O     1 
ATOM   4570  C  CB    . ALA D 4  480  ? 3.464   -9.611  43.402  1.00 69.03  ? 480  ALA A CB    1 
ATOM   4571  N  N     . ASP D 4  481  ? 1.671   -7.337  44.663  1.00 86.39  ? 481  ASP A N     1 
ATOM   4572  C  CA    . ASP D 4  481  ? 0.287   -6.946  44.851  1.00 80.37  ? 481  ASP A CA    1 
ATOM   4573  C  C     . ASP D 4  481  ? -0.209  -6.410  43.519  1.00 95.41  ? 481  ASP A C     1 
ATOM   4574  O  O     . ASP D 4  481  ? 0.568   -5.874  42.726  1.00 103.74 ? 481  ASP A O     1 
ATOM   4575  C  CB    . ASP D 4  481  ? 0.129   -5.896  45.965  1.00 86.32  ? 481  ASP A CB    1 
ATOM   4576  C  CG    . ASP D 4  481  ? 0.129   -6.512  47.361  1.00 115.23 ? 481  ASP A CG    1 
ATOM   4577  O  OD1   . ASP D 4  481  ? 1.217   -6.848  47.882  1.00 128.41 ? 481  ASP A OD1   1 
ATOM   4578  O  OD2   . ASP D 4  481  ? -0.967  -6.681  47.932  1.00 123.09 ? 481  ASP A OD2   1 
ATOM   4579  N  N     . PHE D 4  482  ? -1.491  -6.614  43.243  1.00 100.07 ? 482  PHE A N     1 
ATOM   4580  C  CA    . PHE D 4  482  ? -2.087  -6.123  42.001  1.00 90.44  ? 482  PHE A CA    1 
ATOM   4581  C  C     . PHE D 4  482  ? -2.838  -4.813  42.244  1.00 78.27  ? 482  PHE A C     1 
ATOM   4582  O  O     . PHE D 4  482  ? -4.030  -4.672  41.956  1.00 67.15  ? 482  PHE A O     1 
ATOM   4583  C  CB    . PHE D 4  482  ? -2.983  -7.200  41.396  1.00 85.05  ? 482  PHE A CB    1 
ATOM   4584  C  CG    . PHE D 4  482  ? -2.281  -8.518  41.211  1.00 65.63  ? 482  PHE A CG    1 
ATOM   4585  C  CD1   . PHE D 4  482  ? -2.869  -9.700  41.620  1.00 58.15  ? 482  PHE A CD1   1 
ATOM   4586  C  CD2   . PHE D 4  482  ? -1.028  -8.571  40.625  1.00 62.07  ? 482  PHE A CD2   1 
ATOM   4587  C  CE1   . PHE D 4  482  ? -2.219  -10.900 41.474  1.00 65.28  ? 482  PHE A CE1   1 
ATOM   4588  C  CE2   . PHE D 4  482  ? -0.384  -9.780  40.456  1.00 67.09  ? 482  PHE A CE2   1 
ATOM   4589  C  CZ    . PHE D 4  482  ? -0.983  -10.940 40.884  1.00 65.77  ? 482  PHE A CZ    1 
ATOM   4590  N  N     . ASP D 4  483  ? -2.110  -3.843  42.799  1.00 86.18  ? 483  ASP A N     1 
ATOM   4591  C  CA    . ASP D 4  483  ? -2.590  -2.472  42.906  1.00 81.76  ? 483  ASP A CA    1 
ATOM   4592  C  C     . ASP D 4  483  ? -1.810  -1.528  41.998  1.00 67.53  ? 483  ASP A C     1 
ATOM   4593  O  O     . ASP D 4  483  ? -1.988  -0.306  42.085  1.00 79.54  ? 483  ASP A O     1 
ATOM   4594  C  CB    . ASP D 4  483  ? -2.553  -1.980  44.363  1.00 106.64 ? 483  ASP A CB    1 
ATOM   4595  C  CG    . ASP D 4  483  ? -1.202  -2.200  45.044  1.00 131.09 ? 483  ASP A CG    1 
ATOM   4596  O  OD1   . ASP D 4  483  ? -1.154  -2.905  46.075  1.00 137.17 ? 483  ASP A OD1   1 
ATOM   4597  O  OD2   . ASP D 4  483  ? -0.190  -1.644  44.570  1.00 138.96 ? 483  ASP A OD2   1 
ATOM   4598  N  N     . GLY D 4  484  ? -0.954  -2.066  41.126  1.00 44.42  ? 484  GLY A N     1 
ATOM   4599  C  CA    . GLY D 4  484  ? -0.202  -1.248  40.193  1.00 53.08  ? 484  GLY A CA    1 
ATOM   4600  C  C     . GLY D 4  484  ? 1.283   -1.536  40.170  1.00 58.49  ? 484  GLY A C     1 
ATOM   4601  O  O     . GLY D 4  484  ? 2.064   -0.753  39.614  1.00 67.90  ? 484  GLY A O     1 
ATOM   4602  N  N     . ASP D 4  485  ? 1.686   -2.643  40.787  1.00 63.80  ? 485  ASP A N     1 
ATOM   4603  C  CA    . ASP D 4  485  ? 3.084   -3.045  40.766  1.00 74.14  ? 485  ASP A CA    1 
ATOM   4604  C  C     . ASP D 4  485  ? 3.510   -3.412  39.352  1.00 64.34  ? 485  ASP A C     1 
ATOM   4605  O  O     . ASP D 4  485  ? 2.719   -3.917  38.548  1.00 83.92  ? 485  ASP A O     1 
ATOM   4606  C  CB    . ASP D 4  485  ? 3.313   -4.237  41.692  1.00 98.17  ? 485  ASP A CB    1 
ATOM   4607  C  CG    . ASP D 4  485  ? 2.952   -3.929  43.126  1.00 116.04 ? 485  ASP A CG    1 
ATOM   4608  O  OD1   . ASP D 4  485  ? 1.837   -3.417  43.361  1.00 128.51 ? 485  ASP A OD1   1 
ATOM   4609  O  OD2   . ASP D 4  485  ? 3.772   -4.209  44.020  1.00 113.08 ? 485  ASP A OD2   1 
ATOM   4610  N  N     . GLU D 4  486  ? 4.773   -3.142  39.052  1.00 54.21  ? 486  GLU A N     1 
ATOM   4611  C  CA    . GLU D 4  486  ? 5.385   -3.537  37.794  1.00 59.90  ? 486  GLU A CA    1 
ATOM   4612  C  C     . GLU D 4  486  ? 6.431   -4.605  38.082  1.00 61.54  ? 486  GLU A C     1 
ATOM   4613  O  O     . GLU D 4  486  ? 7.132   -4.542  39.099  1.00 77.57  ? 486  GLU A O     1 
ATOM   4614  C  CB    . GLU D 4  486  ? 6.042   -2.349  37.077  1.00 63.42  ? 486  GLU A CB    1 
ATOM   4615  C  CG    . GLU D 4  486  ? 5.084   -1.384  36.387  1.00 73.69  ? 486  GLU A CG    1 
ATOM   4616  C  CD    . GLU D 4  486  ? 5.739   -0.049  36.045  1.00 87.53  ? 486  GLU A CD    1 
ATOM   4617  O  OE1   . GLU D 4  486  ? 5.367   0.979   36.650  1.00 89.70  ? 486  GLU A OE1   1 
ATOM   4618  O  OE2   . GLU D 4  486  ? 6.624   -0.030  35.162  1.00 93.15  ? 486  GLU A OE2   1 
ATOM   4619  N  N     . MET D 4  487  ? 6.534   -5.585  37.187  1.00 45.44  ? 487  MET A N     1 
ATOM   4620  C  CA    . MET D 4  487  ? 7.523   -6.644  37.329  1.00 45.99  ? 487  MET A CA    1 
ATOM   4621  C  C     . MET D 4  487  ? 8.403   -6.733  36.092  1.00 44.43  ? 487  MET A C     1 
ATOM   4622  O  O     . MET D 4  487  ? 7.948   -6.504  34.968  1.00 75.97  ? 487  MET A O     1 
ATOM   4623  C  CB    . MET D 4  487  ? 6.875   -8.003  37.580  1.00 45.65  ? 487  MET A CB    1 
ATOM   4624  C  CG    . MET D 4  487  ? 6.645   -8.282  39.040  1.00 47.76  ? 487  MET A CG    1 
ATOM   4625  S  SD    . MET D 4  487  ? 6.906   -10.030 39.377  1.00 70.58  ? 487  MET A SD    1 
ATOM   4626  C  CE    . MET D 4  487  ? 5.633   -10.363 40.581  1.00 67.95  ? 487  MET A CE    1 
ATOM   4627  N  N     . ASN D 4  488  ? 9.665   -7.091  36.315  1.00 42.08  ? 488  ASN A N     1 
ATOM   4628  C  CA    . ASN D 4  488  ? 10.656  -7.218  35.259  1.00 62.55  ? 488  ASN A CA    1 
ATOM   4629  C  C     . ASN D 4  488  ? 10.747  -8.662  34.755  1.00 79.60  ? 488  ASN A C     1 
ATOM   4630  O  O     . ASN D 4  488  ? 10.356  -9.621  35.430  1.00 86.44  ? 488  ASN A O     1 
ATOM   4631  C  CB    . ASN D 4  488  ? 12.028  -6.753  35.758  1.00 89.60  ? 488  ASN A CB    1 
ATOM   4632  C  CG    . ASN D 4  488  ? 11.962  -5.431  36.499  1.00 108.31 ? 488  ASN A CG    1 
ATOM   4633  O  OD1   . ASN D 4  488  ? 11.102  -5.217  37.358  1.00 116.45 ? 488  ASN A OD1   1 
ATOM   4634  N  ND2   . ASN D 4  488  ? 12.873  -4.529  36.161  1.00 118.10 ? 488  ASN A ND2   1 
ATOM   4635  N  N     . LEU D 4  489  ? 11.282  -8.801  33.544  1.00 72.00  ? 489  LEU A N     1 
ATOM   4636  C  CA    . LEU D 4  489  ? 11.458  -10.102 32.913  1.00 69.40  ? 489  LEU A CA    1 
ATOM   4637  C  C     . LEU D 4  489  ? 12.670  -10.029 31.996  1.00 68.13  ? 489  LEU A C     1 
ATOM   4638  O  O     . LEU D 4  489  ? 12.791  -9.104  31.181  1.00 59.84  ? 489  LEU A O     1 
ATOM   4639  C  CB    . LEU D 4  489  ? 10.200  -10.516 32.133  1.00 71.00  ? 489  LEU A CB    1 
ATOM   4640  C  CG    . LEU D 4  489  ? 10.190  -11.860 31.392  1.00 56.84  ? 489  LEU A CG    1 
ATOM   4641  C  CD1   . LEU D 4  489  ? 8.869   -12.572 31.649  1.00 51.23  ? 489  LEU A CD1   1 
ATOM   4642  C  CD2   . LEU D 4  489  ? 10.427  -11.689 29.884  1.00 46.37  ? 489  LEU A CD2   1 
ATOM   4643  N  N     . HIS D 4  490  ? 13.566  -11.001 32.154  1.00 67.92  ? 490  HIS A N     1 
ATOM   4644  C  CA    . HIS D 4  490  ? 14.788  -11.120 31.371  1.00 62.18  ? 490  HIS A CA    1 
ATOM   4645  C  C     . HIS D 4  490  ? 14.737  -12.417 30.577  1.00 76.34  ? 490  HIS A C     1 
ATOM   4646  O  O     . HIS D 4  490  ? 14.068  -13.375 30.976  1.00 96.45  ? 490  HIS A O     1 
ATOM   4647  C  CB    . HIS D 4  490  ? 16.045  -11.090 32.265  1.00 62.62  ? 490  HIS A CB    1 
ATOM   4648  C  CG    . HIS D 4  490  ? 16.155  -9.865  33.128  1.00 71.86  ? 490  HIS A CG    1 
ATOM   4649  N  ND1   . HIS D 4  490  ? 17.176  -8.947  32.987  1.00 71.87  ? 490  HIS A ND1   1 
ATOM   4650  C  CD2   . HIS D 4  490  ? 15.391  -9.422  34.157  1.00 74.80  ? 490  HIS A CD2   1 
ATOM   4651  C  CE1   . HIS D 4  490  ? 17.025  -7.983  33.877  1.00 80.39  ? 490  HIS A CE1   1 
ATOM   4652  N  NE2   . HIS D 4  490  ? 15.951  -8.249  34.601  1.00 76.03  ? 490  HIS A NE2   1 
ATOM   4653  N  N     . VAL D 4  491  ? 15.450  -12.448 29.448  1.00 83.94  ? 491  VAL A N     1 
ATOM   4654  C  CA    . VAL D 4  491  ? 15.381  -13.556 28.507  1.00 79.32  ? 491  VAL A CA    1 
ATOM   4655  C  C     . VAL D 4  491  ? 16.777  -14.103 28.238  1.00 79.09  ? 491  VAL A C     1 
ATOM   4656  O  O     . VAL D 4  491  ? 17.650  -13.363 27.776  1.00 75.60  ? 491  VAL A O     1 
ATOM   4657  C  CB    . VAL D 4  491  ? 14.711  -13.148 27.183  1.00 68.35  ? 491  VAL A CB    1 
ATOM   4658  C  CG1   . VAL D 4  491  ? 14.927  -14.213 26.126  1.00 54.97  ? 491  VAL A CG1   1 
ATOM   4659  C  CG2   . VAL D 4  491  ? 13.239  -12.892 27.401  1.00 67.67  ? 491  VAL A CG2   1 
ATOM   4660  N  N     . PRO D 4  492  ? 17.028  -15.391 28.488  1.00 88.05  ? 492  PRO A N     1 
ATOM   4661  C  CA    . PRO D 4  492  ? 18.339  -15.986 28.191  1.00 85.30  ? 492  PRO A CA    1 
ATOM   4662  C  C     . PRO D 4  492  ? 18.683  -15.930 26.706  1.00 84.48  ? 492  PRO A C     1 
ATOM   4663  O  O     . PRO D 4  492  ? 17.826  -15.716 25.846  1.00 97.34  ? 492  PRO A O     1 
ATOM   4664  C  CB    . PRO D 4  492  ? 18.175  -17.436 28.670  1.00 90.34  ? 492  PRO A CB    1 
ATOM   4665  C  CG    . PRO D 4  492  ? 16.691  -17.666 28.684  1.00 93.93  ? 492  PRO A CG    1 
ATOM   4666  C  CD    . PRO D 4  492  ? 16.115  -16.358 29.117  1.00 85.70  ? 492  PRO A CD    1 
ATOM   4667  N  N     . GLN D 4  493  ? 19.975  -16.104 26.405  1.00 65.24  ? 493  GLN A N     1 
ATOM   4668  C  CA    . GLN D 4  493  ? 20.443  -16.008 25.026  1.00 69.90  ? 493  GLN A CA    1 
ATOM   4669  C  C     . GLN D 4  493  ? 21.358  -17.155 24.601  1.00 85.30  ? 493  GLN A C     1 
ATOM   4670  O  O     . GLN D 4  493  ? 21.937  -17.089 23.509  1.00 92.10  ? 493  GLN A O     1 
ATOM   4671  C  CB    . GLN D 4  493  ? 21.149  -14.662 24.784  1.00 66.87  ? 493  GLN A CB    1 
ATOM   4672  C  CG    . GLN D 4  493  ? 20.233  -13.443 24.883  1.00 55.85  ? 493  GLN A CG    1 
ATOM   4673  C  CD    . GLN D 4  493  ? 19.435  -13.207 23.614  1.00 70.10  ? 493  GLN A CD    1 
ATOM   4674  O  OE1   . GLN D 4  493  ? 19.999  -12.979 22.542  1.00 79.72  ? 493  GLN A OE1   1 
ATOM   4675  N  NE2   . GLN D 4  493  ? 18.112  -13.285 23.727  1.00 62.73  ? 493  GLN A NE2   1 
ATOM   4676  N  N     . SER D 4  494  ? 21.493  -18.206 25.409  1.00 103.99 ? 494  SER A N     1 
ATOM   4677  C  CA    . SER D 4  494  ? 22.309  -19.356 25.036  1.00 114.49 ? 494  SER A CA    1 
ATOM   4678  C  C     . SER D 4  494  ? 21.767  -20.600 25.730  1.00 105.63 ? 494  SER A C     1 
ATOM   4679  O  O     . SER D 4  494  ? 20.950  -20.517 26.649  1.00 106.40 ? 494  SER A O     1 
ATOM   4680  C  CB    . SER D 4  494  ? 23.787  -19.122 25.372  1.00 127.58 ? 494  SER A CB    1 
ATOM   4681  O  OG    . SER D 4  494  ? 23.961  -18.779 26.736  1.00 143.20 ? 494  SER A OG    1 
ATOM   4682  N  N     . GLU D 4  495  ? 22.239  -21.768 25.279  1.00 106.84 ? 495  GLU A N     1 
ATOM   4683  C  CA    . GLU D 4  495  ? 21.660  -23.026 25.748  1.00 104.16 ? 495  GLU A CA    1 
ATOM   4684  C  C     . GLU D 4  495  ? 22.043  -23.322 27.197  1.00 110.64 ? 495  GLU A C     1 
ATOM   4685  O  O     . GLU D 4  495  ? 21.210  -23.810 27.975  1.00 110.57 ? 495  GLU A O     1 
ATOM   4686  C  CB    . GLU D 4  495  ? 22.081  -24.176 24.827  1.00 85.90  ? 495  GLU A CB    1 
ATOM   4687  C  CG    . GLU D 4  495  ? 21.215  -24.321 23.583  1.00 88.65  ? 495  GLU A CG    1 
ATOM   4688  C  CD    . GLU D 4  495  ? 19.783  -24.730 23.900  1.00 107.82 ? 495  GLU A CD    1 
ATOM   4689  O  OE1   . GLU D 4  495  ? 18.877  -24.389 23.109  1.00 111.79 ? 495  GLU A OE1   1 
ATOM   4690  O  OE2   . GLU D 4  495  ? 19.558  -25.389 24.939  1.00 113.57 ? 495  GLU A OE2   1 
ATOM   4691  N  N     . GLU D 4  496  ? 23.293  -23.023 27.581  1.00 105.20 ? 496  GLU A N     1 
ATOM   4692  C  CA    . GLU D 4  496  ? 23.701  -23.172 28.976  1.00 94.91  ? 496  GLU A CA    1 
ATOM   4693  C  C     . GLU D 4  496  ? 22.943  -22.211 29.874  1.00 94.11  ? 496  GLU A C     1 
ATOM   4694  O  O     . GLU D 4  496  ? 22.659  -22.530 31.035  1.00 109.67 ? 496  GLU A O     1 
ATOM   4695  C  CB    . GLU D 4  496  ? 25.206  -22.934 29.133  1.00 94.43  ? 496  GLU A CB    1 
ATOM   4696  C  CG    . GLU D 4  496  ? 26.070  -23.411 27.980  1.00 103.16 ? 496  GLU A CG    1 
ATOM   4697  C  CD    . GLU D 4  496  ? 26.453  -22.274 27.055  1.00 108.14 ? 496  GLU A CD    1 
ATOM   4698  O  OE1   . GLU D 4  496  ? 25.564  -21.467 26.721  1.00 105.78 ? 496  GLU A OE1   1 
ATOM   4699  O  OE2   . GLU D 4  496  ? 27.638  -22.177 26.672  1.00 113.94 ? 496  GLU A OE2   1 
ATOM   4700  N  N     . THR D 4  497  ? 22.597  -21.039 29.345  1.00 82.77  ? 497  THR A N     1 
ATOM   4701  C  CA    . THR D 4  497  ? 21.844  -20.051 30.106  1.00 71.06  ? 497  THR A CA    1 
ATOM   4702  C  C     . THR D 4  497  ? 20.420  -20.529 30.377  1.00 74.88  ? 497  THR A C     1 
ATOM   4703  O  O     . THR D 4  497  ? 19.937  -20.459 31.515  1.00 83.61  ? 497  THR A O     1 
ATOM   4704  C  CB    . THR D 4  497  ? 21.849  -18.725 29.348  1.00 74.15  ? 497  THR A CB    1 
ATOM   4705  O  OG1   . THR D 4  497  ? 23.188  -18.421 28.926  1.00 77.52  ? 497  THR A OG1   1 
ATOM   4706  C  CG2   . THR D 4  497  ? 21.379  -17.636 30.219  1.00 86.40  ? 497  THR A CG2   1 
ATOM   4707  N  N     . ARG D 4  498  ? 19.737  -21.035 29.344  1.00 87.28  ? 498  ARG A N     1 
ATOM   4708  C  CA    . ARG D 4  498  ? 18.413  -21.619 29.542  1.00 97.58  ? 498  ARG A CA    1 
ATOM   4709  C  C     . ARG D 4  498  ? 18.466  -22.835 30.456  1.00 113.52 ? 498  ARG A C     1 
ATOM   4710  O  O     . ARG D 4  498  ? 17.528  -23.070 31.226  1.00 124.24 ? 498  ARG A O     1 
ATOM   4711  C  CB    . ARG D 4  498  ? 17.798  -22.009 28.197  1.00 104.39 ? 498  ARG A CB    1 
ATOM   4712  C  CG    . ARG D 4  498  ? 17.792  -20.902 27.172  1.00 100.72 ? 498  ARG A CG    1 
ATOM   4713  C  CD    . ARG D 4  498  ? 17.558  -21.454 25.785  1.00 93.72  ? 498  ARG A CD    1 
ATOM   4714  N  NE    . ARG D 4  498  ? 16.158  -21.342 25.391  1.00 87.30  ? 498  ARG A NE    1 
ATOM   4715  C  CZ    . ARG D 4  498  ? 15.262  -22.313 25.520  1.00 82.72  ? 498  ARG A CZ    1 
ATOM   4716  N  NH1   . ARG D 4  498  ? 15.614  -23.494 26.021  1.00 94.90  ? 498  ARG A NH1   1 
ATOM   4717  N  NH2   . ARG D 4  498  ? 14.013  -22.107 25.132  1.00 85.24  ? 498  ARG A NH2   1 
ATOM   4718  N  N     . ALA D 4  499  ? 19.552  -23.613 30.392  1.00 115.19 ? 499  ALA A N     1 
ATOM   4719  C  CA    . ALA D 4  499  ? 19.709  -24.738 31.307  1.00 114.94 ? 499  ALA A CA    1 
ATOM   4720  C  C     . ALA D 4  499  ? 19.847  -24.269 32.752  1.00 109.96 ? 499  ALA A C     1 
ATOM   4721  O  O     . ALA D 4  499  ? 19.245  -24.859 33.657  1.00 119.70 ? 499  ALA A O     1 
ATOM   4722  C  CB    . ALA D 4  499  ? 20.917  -25.579 30.899  1.00 118.16 ? 499  ALA A CB    1 
ATOM   4723  N  N     . GLU D 4  500  ? 20.641  -23.216 32.987  1.00 95.96  ? 500  GLU A N     1 
ATOM   4724  C  CA    . GLU D 4  500  ? 20.766  -22.649 34.331  1.00 77.61  ? 500  GLU A CA    1 
ATOM   4725  C  C     . GLU D 4  500  ? 19.444  -22.092 34.836  1.00 65.03  ? 500  GLU A C     1 
ATOM   4726  O  O     . GLU D 4  500  ? 19.154  -22.176 36.035  1.00 75.17  ? 500  GLU A O     1 
ATOM   4727  C  CB    . GLU D 4  500  ? 21.838  -21.551 34.364  1.00 78.02  ? 500  GLU A CB    1 
ATOM   4728  C  CG    . GLU D 4  500  ? 23.278  -22.041 34.240  1.00 73.67  ? 500  GLU A CG    1 
ATOM   4729  C  CD    . GLU D 4  500  ? 24.307  -20.931 34.454  1.00 81.24  ? 500  GLU A CD    1 
ATOM   4730  O  OE1   . GLU D 4  500  ? 23.921  -19.740 34.561  1.00 49.85  ? 500  GLU A OE1   1 
ATOM   4731  O  OE2   . GLU D 4  500  ? 25.509  -21.261 34.542  1.00 68.44  ? 500  GLU A OE2   1 
ATOM   4732  N  N     . LEU D 4  501  ? 18.639  -21.514 33.946  1.00 74.78  ? 501  LEU A N     1 
ATOM   4733  C  CA    . LEU D 4  501  ? 17.325  -21.016 34.350  1.00 81.45  ? 501  LEU A CA    1 
ATOM   4734  C  C     . LEU D 4  501  ? 16.385  -22.167 34.712  1.00 72.32  ? 501  LEU A C     1 
ATOM   4735  O  O     . LEU D 4  501  ? 15.767  -22.164 35.783  1.00 66.70  ? 501  LEU A O     1 
ATOM   4736  C  CB    . LEU D 4  501  ? 16.725  -20.154 33.237  1.00 93.89  ? 501  LEU A CB    1 
ATOM   4737  C  CG    . LEU D 4  501  ? 16.936  -18.633 33.253  1.00 89.55  ? 501  LEU A CG    1 
ATOM   4738  C  CD1   . LEU D 4  501  ? 16.250  -18.024 34.452  1.00 93.42  ? 501  LEU A CD1   1 
ATOM   4739  C  CD2   . LEU D 4  501  ? 18.397  -18.238 33.240  1.00 92.03  ? 501  LEU A CD2   1 
ATOM   4740  N  N     . SER D 4  502  ? 16.285  -23.175 33.838  1.00 68.14  ? 502  SER A N     1 
ATOM   4741  C  CA    . SER D 4  502  ? 15.281  -24.226 33.994  1.00 66.22  ? 502  SER A CA    1 
ATOM   4742  C  C     . SER D 4  502  ? 15.640  -25.229 35.080  1.00 71.95  ? 502  SER A C     1 
ATOM   4743  O  O     . SER D 4  502  ? 14.744  -25.762 35.741  1.00 77.96  ? 502  SER A O     1 
ATOM   4744  C  CB    . SER D 4  502  ? 15.085  -24.980 32.674  1.00 91.84  ? 502  SER A CB    1 
ATOM   4745  O  OG    . SER D 4  502  ? 16.303  -25.118 31.956  1.00 104.81 ? 502  SER A OG    1 
ATOM   4746  N  N     . GLN D 4  503  ? 16.928  -25.509 35.267  1.00 78.51  ? 503  GLN A N     1 
ATOM   4747  C  CA    . GLN D 4  503  ? 17.362  -26.584 36.147  1.00 65.40  ? 503  GLN A CA    1 
ATOM   4748  C  C     . GLN D 4  503  ? 17.819  -26.101 37.518  1.00 67.50  ? 503  GLN A C     1 
ATOM   4749  O  O     . GLN D 4  503  ? 17.999  -26.931 38.417  1.00 73.49  ? 503  GLN A O     1 
ATOM   4750  C  CB    . GLN D 4  503  ? 18.492  -27.376 35.478  1.00 56.12  ? 503  GLN A CB    1 
ATOM   4751  C  CG    . GLN D 4  503  ? 18.070  -28.009 34.172  1.00 56.61  ? 503  GLN A CG    1 
ATOM   4752  C  CD    . GLN D 4  503  ? 17.023  -29.081 34.366  1.00 72.75  ? 503  GLN A CD    1 
ATOM   4753  O  OE1   . GLN D 4  503  ? 17.316  -30.177 34.850  1.00 86.09  ? 503  GLN A OE1   1 
ATOM   4754  N  NE2   . GLN D 4  503  ? 15.786  -28.768 33.991  1.00 72.48  ? 503  GLN A NE2   1 
ATOM   4755  N  N     . LEU D 4  504  ? 18.023  -24.798 37.698  1.00 78.50  ? 504  LEU A N     1 
ATOM   4756  C  CA    . LEU D 4  504  ? 18.392  -24.235 38.993  1.00 78.38  ? 504  LEU A CA    1 
ATOM   4757  C  C     . LEU D 4  504  ? 17.390  -23.202 39.492  1.00 65.73  ? 504  LEU A C     1 
ATOM   4758  O  O     . LEU D 4  504  ? 16.915  -23.304 40.633  1.00 60.39  ? 504  LEU A O     1 
ATOM   4759  C  CB    . LEU D 4  504  ? 19.803  -23.617 38.910  1.00 51.22  ? 504  LEU A CB    1 
ATOM   4760  C  CG    . LEU D 4  504  ? 20.919  -24.571 38.468  1.00 55.81  ? 504  LEU A CG    1 
ATOM   4761  C  CD1   . LEU D 4  504  ? 22.271  -23.871 38.437  1.00 52.33  ? 504  LEU A CD1   1 
ATOM   4762  C  CD2   . LEU D 4  504  ? 20.968  -25.784 39.387  1.00 74.05  ? 504  LEU A CD2   1 
ATOM   4763  N  N     . CYS D 4  505  ? 17.024  -22.227 38.655  1.00 61.97  ? 505  CYS A N     1 
ATOM   4764  C  CA    . CYS D 4  505  ? 16.262  -21.054 39.073  1.00 66.01  ? 505  CYS A CA    1 
ATOM   4765  C  C     . CYS D 4  505  ? 14.763  -21.177 38.813  1.00 66.03  ? 505  CYS A C     1 
ATOM   4766  O  O     . CYS D 4  505  ? 14.042  -20.178 38.937  1.00 55.84  ? 505  CYS A O     1 
ATOM   4767  C  CB    . CYS D 4  505  ? 16.795  -19.802 38.372  1.00 65.17  ? 505  CYS A CB    1 
ATOM   4768  S  SG    . CYS D 4  505  ? 18.593  -19.698 38.255  1.00 89.31  ? 505  CYS A SG    1 
ATOM   4769  N  N     . ALA D 4  506  ? 14.281  -22.368 38.458  1.00 74.73  ? 506  ALA A N     1 
ATOM   4770  C  CA    . ALA D 4  506  ? 12.873  -22.577 38.144  1.00 62.76  ? 506  ALA A CA    1 
ATOM   4771  C  C     . ALA D 4  506  ? 11.989  -22.349 39.365  1.00 63.46  ? 506  ALA A C     1 
ATOM   4772  O  O     . ALA D 4  506  ? 12.427  -22.492 40.510  1.00 90.41  ? 506  ALA A O     1 
ATOM   4773  C  CB    . ALA D 4  506  ? 12.658  -23.991 37.611  1.00 68.44  ? 506  ALA A CB    1 
ATOM   4774  N  N     . VAL D 4  507  ? 10.732  -21.968 39.103  1.00 59.72  ? 507  VAL A N     1 
ATOM   4775  C  CA    . VAL D 4  507  ? 9.764   -21.759 40.189  1.00 62.60  ? 507  VAL A CA    1 
ATOM   4776  C  C     . VAL D 4  507  ? 9.509   -23.013 41.036  1.00 66.69  ? 507  VAL A C     1 
ATOM   4777  O  O     . VAL D 4  507  ? 9.527   -22.903 42.273  1.00 81.57  ? 507  VAL A O     1 
ATOM   4778  C  CB    . VAL D 4  507  ? 8.478   -21.133 39.633  1.00 57.99  ? 507  VAL A CB    1 
ATOM   4779  C  CG1   . VAL D 4  507  ? 7.258   -21.476 40.472  1.00 47.33  ? 507  VAL A CG1   1 
ATOM   4780  C  CG2   . VAL D 4  507  ? 8.619   -19.628 39.569  1.00 46.17  ? 507  VAL A CG2   1 
ATOM   4781  N  N     . PRO D 4  508  ? 9.275   -24.211 40.464  1.00 64.12  ? 508  PRO A N     1 
ATOM   4782  C  CA    . PRO D 4  508  ? 9.005   -25.366 41.350  1.00 74.24  ? 508  PRO A CA    1 
ATOM   4783  C  C     . PRO D 4  508  ? 10.193  -25.808 42.202  1.00 62.76  ? 508  PRO A C     1 
ATOM   4784  O  O     . PRO D 4  508  ? 9.981   -26.485 43.216  1.00 71.77  ? 508  PRO A O     1 
ATOM   4785  C  CB    . PRO D 4  508  ? 8.564   -26.475 40.376  1.00 82.16  ? 508  PRO A CB    1 
ATOM   4786  C  CG    . PRO D 4  508  ? 8.163   -25.752 39.131  1.00 80.04  ? 508  PRO A CG    1 
ATOM   4787  C  CD    . PRO D 4  508  ? 9.122   -24.621 39.051  1.00 68.40  ? 508  PRO A CD    1 
ATOM   4788  N  N     . LEU D 4  509  ? 11.422  -25.432 41.846  1.00 63.22  ? 509  LEU A N     1 
ATOM   4789  C  CA    . LEU D 4  509  ? 12.580  -25.801 42.656  1.00 69.86  ? 509  LEU A CA    1 
ATOM   4790  C  C     . LEU D 4  509  ? 12.700  -24.933 43.906  1.00 74.74  ? 509  LEU A C     1 
ATOM   4791  O  O     . LEU D 4  509  ? 13.139  -25.419 44.957  1.00 79.80  ? 509  LEU A O     1 
ATOM   4792  C  CB    . LEU D 4  509  ? 13.854  -25.688 41.815  1.00 78.36  ? 509  LEU A CB    1 
ATOM   4793  C  CG    . LEU D 4  509  ? 13.816  -26.363 40.443  1.00 83.71  ? 509  LEU A CG    1 
ATOM   4794  C  CD1   . LEU D 4  509  ? 15.153  -26.223 39.769  1.00 80.74  ? 509  LEU A CD1   1 
ATOM   4795  C  CD2   . LEU D 4  509  ? 13.440  -27.834 40.556  1.00 101.54 ? 509  LEU A CD2   1 
ATOM   4796  N  N     . GLN D 4  510  ? 12.305  -23.662 43.819  1.00 71.98  ? 510  GLN A N     1 
ATOM   4797  C  CA    . GLN D 4  510  ? 12.372  -22.736 44.942  1.00 63.32  ? 510  GLN A CA    1 
ATOM   4798  C  C     . GLN D 4  510  ? 11.092  -22.715 45.773  1.00 74.79  ? 510  GLN A C     1 
ATOM   4799  O  O     . GLN D 4  510  ? 10.809  -21.699 46.418  1.00 77.58  ? 510  GLN A O     1 
ATOM   4800  C  CB    . GLN D 4  510  ? 12.693  -21.315 44.454  1.00 49.34  ? 510  GLN A CB    1 
ATOM   4801  C  CG    . GLN D 4  510  ? 13.623  -21.258 43.258  1.00 56.86  ? 510  GLN A CG    1 
ATOM   4802  C  CD    . GLN D 4  510  ? 15.079  -21.411 43.635  1.00 81.85  ? 510  GLN A CD    1 
ATOM   4803  O  OE1   . GLN D 4  510  ? 15.446  -21.320 44.806  1.00 107.03 ? 510  GLN A OE1   1 
ATOM   4804  N  NE2   . GLN D 4  510  ? 15.916  -21.682 42.642  1.00 87.48  ? 510  GLN A NE2   1 
ATOM   4805  N  N     . ILE D 4  511  ? 10.317  -23.805 45.775  1.00 73.79  ? 511  ILE A N     1 
ATOM   4806  C  CA    . ILE D 4  511  ? 9.126   -23.862 46.621  1.00 75.20  ? 511  ILE A CA    1 
ATOM   4807  C  C     . ILE D 4  511  ? 9.514   -24.002 48.089  1.00 85.63  ? 511  ILE A C     1 
ATOM   4808  O  O     . ILE D 4  511  ? 9.097   -23.199 48.930  1.00 102.69 ? 511  ILE A O     1 
ATOM   4809  C  CB    . ILE D 4  511  ? 8.184   -24.994 46.176  1.00 79.11  ? 511  ILE A CB    1 
ATOM   4810  C  CG1   . ILE D 4  511  ? 7.678   -24.742 44.753  1.00 65.47  ? 511  ILE A CG1   1 
ATOM   4811  C  CG2   . ILE D 4  511  ? 7.021   -25.117 47.149  1.00 84.03  ? 511  ILE A CG2   1 
ATOM   4812  C  CD1   . ILE D 4  511  ? 6.638   -25.743 44.289  1.00 53.91  ? 511  ILE A CD1   1 
ATOM   4813  N  N     . VAL D 4  512  ? 10.319  -25.010 48.422  1.00 85.96  ? 512  VAL A N     1 
ATOM   4814  C  CA    . VAL D 4  512  ? 10.877  -25.129 49.769  1.00 86.60  ? 512  VAL A CA    1 
ATOM   4815  C  C     . VAL D 4  512  ? 12.139  -24.278 49.849  1.00 95.33  ? 512  VAL A C     1 
ATOM   4816  O  O     . VAL D 4  512  ? 13.123  -24.527 49.144  1.00 88.62  ? 512  VAL A O     1 
ATOM   4817  C  CB    . VAL D 4  512  ? 11.152  -26.593 50.152  1.00 79.71  ? 512  VAL A CB    1 
ATOM   4818  C  CG1   . VAL D 4  512  ? 9.873   -27.252 50.650  1.00 56.09  ? 512  VAL A CG1   1 
ATOM   4819  C  CG2   . VAL D 4  512  ? 11.718  -27.379 48.972  1.00 95.30  ? 512  VAL A CG2   1 
ATOM   4820  N  N     . SER D 4  513  ? 12.106  -23.252 50.718  1.00 95.29  ? 513  SER A N     1 
ATOM   4821  C  CA    . SER D 4  513  ? 13.200  -22.298 50.735  1.00 91.83  ? 513  SER A CA    1 
ATOM   4822  C  C     . SER D 4  513  ? 14.212  -22.657 51.816  1.00 90.08  ? 513  SER A C     1 
ATOM   4823  O  O     . SER D 4  513  ? 13.849  -23.213 52.860  1.00 84.04  ? 513  SER A O     1 
ATOM   4824  C  CB    . SER D 4  513  ? 12.679  -20.875 50.971  1.00 99.96  ? 513  SER A CB    1 
ATOM   4825  O  OG    . SER D 4  513  ? 12.115  -20.718 52.264  1.00 105.56 ? 513  SER A OG    1 
ATOM   4826  N  N     . PRO D 4  514  ? 15.493  -22.378 51.564  1.00 92.69  ? 514  PRO A N     1 
ATOM   4827  C  CA    . PRO D 4  514  ? 16.497  -22.563 52.623  1.00 86.36  ? 514  PRO A CA    1 
ATOM   4828  C  C     . PRO D 4  514  ? 16.275  -21.643 53.811  1.00 98.48  ? 514  PRO A C     1 
ATOM   4829  O  O     . PRO D 4  514  ? 16.527  -22.045 54.953  1.00 104.54 ? 514  PRO A O     1 
ATOM   4830  C  CB    . PRO D 4  514  ? 17.820  -22.261 51.906  1.00 79.07  ? 514  PRO A CB    1 
ATOM   4831  C  CG    . PRO D 4  514  ? 17.537  -22.558 50.459  1.00 95.68  ? 514  PRO A CG    1 
ATOM   4832  C  CD    . PRO D 4  514  ? 16.109  -22.147 50.243  1.00 103.90 ? 514  PRO A CD    1 
ATOM   4833  N  N     . GLN D 4  515  ? 15.798  -20.423 53.589  1.00 107.70 ? 515  GLN A N     1 
ATOM   4834  C  CA    . GLN D 4  515  ? 15.367  -19.612 54.715  1.00 101.72 ? 515  GLN A CA    1 
ATOM   4835  C  C     . GLN D 4  515  ? 14.079  -20.191 55.283  1.00 88.60  ? 515  GLN A C     1 
ATOM   4836  O  O     . GLN D 4  515  ? 13.222  -20.690 54.545  1.00 103.95 ? 515  GLN A O     1 
ATOM   4837  C  CB    . GLN D 4  515  ? 15.181  -18.147 54.308  1.00 110.66 ? 515  GLN A CB    1 
ATOM   4838  C  CG    . GLN D 4  515  ? 13.857  -17.730 53.691  1.00 104.97 ? 515  GLN A CG    1 
ATOM   4839  C  CD    . GLN D 4  515  ? 13.704  -16.226 53.716  1.00 87.94  ? 515  GLN A CD    1 
ATOM   4840  O  OE1   . GLN D 4  515  ? 14.343  -15.511 52.945  1.00 86.69  ? 515  GLN A OE1   1 
ATOM   4841  N  NE2   . GLN D 4  515  ? 12.884  -15.732 54.638  1.00 71.98  ? 515  GLN A NE2   1 
ATOM   4842  N  N     . SER D 4  516  ? 13.991  -20.208 56.613  1.00 69.24  ? 516  SER A N     1 
ATOM   4843  C  CA    . SER D 4  516  ? 12.856  -20.679 57.408  1.00 92.91  ? 516  SER A CA    1 
ATOM   4844  C  C     . SER D 4  516  ? 12.582  -22.178 57.252  1.00 100.11 ? 516  SER A C     1 
ATOM   4845  O  O     . SER D 4  516  ? 11.654  -22.678 57.907  1.00 112.07 ? 516  SER A O     1 
ATOM   4846  C  CB    . SER D 4  516  ? 11.562  -19.896 57.111  1.00 106.13 ? 516  SER A CB    1 
ATOM   4847  O  OG    . SER D 4  516  ? 11.691  -18.511 57.406  1.00 108.52 ? 516  SER A OG    1 
ATOM   4848  N  N     . ASN D 4  517  ? 13.381  -22.903 56.454  1.00 95.89  ? 517  ASN A N     1 
ATOM   4849  C  CA    . ASN D 4  517  ? 13.263  -24.342 56.136  1.00 83.15  ? 517  ASN A CA    1 
ATOM   4850  C  C     . ASN D 4  517  ? 11.811  -24.794 55.947  1.00 81.92  ? 517  ASN A C     1 
ATOM   4851  O  O     . ASN D 4  517  ? 11.354  -25.787 56.517  1.00 100.49 ? 517  ASN A O     1 
ATOM   4852  C  CB    . ASN D 4  517  ? 13.991  -25.217 57.176  1.00 77.89  ? 517  ASN A CB    1 
ATOM   4853  C  CG    . ASN D 4  517  ? 13.499  -25.008 58.600  1.00 84.02  ? 517  ASN A CG    1 
ATOM   4854  O  OD1   . ASN D 4  517  ? 14.112  -24.277 59.382  1.00 98.13  ? 517  ASN A OD1   1 
ATOM   4855  N  ND2   . ASN D 4  517  ? 12.404  -25.671 58.951  1.00 74.44  ? 517  ASN A ND2   1 
ATOM   4856  N  N     . LYS D 4  518  ? 11.098  -24.067 55.096  1.00 69.01  ? 518  LYS A N     1 
ATOM   4857  C  CA    . LYS D 4  518  ? 9.657   -24.208 54.947  1.00 75.12  ? 518  LYS A CA    1 
ATOM   4858  C  C     . LYS D 4  518  ? 9.278   -23.788 53.531  1.00 69.32  ? 518  LYS A C     1 
ATOM   4859  O  O     . LYS D 4  518  ? 10.090  -23.175 52.827  1.00 54.67  ? 518  LYS A O     1 
ATOM   4860  C  CB    . LYS D 4  518  ? 8.927   -23.379 56.022  1.00 79.86  ? 518  LYS A CB    1 
ATOM   4861  C  CG    . LYS D 4  518  ? 8.686   -21.917 55.672  1.00 82.44  ? 518  LYS A CG    1 
ATOM   4862  C  CD    . LYS D 4  518  ? 7.688   -21.274 56.624  1.00 71.75  ? 518  LYS A CD    1 
ATOM   4863  C  CE    . LYS D 4  518  ? 7.102   -20.020 56.005  1.00 77.20  ? 518  LYS A CE    1 
ATOM   4864  N  NZ    . LYS D 4  518  ? 6.579   -20.292 54.648  1.00 89.80  ? 518  LYS A NZ    1 
ATOM   4865  N  N     . PRO D 4  519  ? 8.081   -24.153 53.059  1.00 68.14  ? 519  PRO A N     1 
ATOM   4866  C  CA    . PRO D 4  519  ? 7.648   -23.683 51.734  1.00 73.77  ? 519  PRO A CA    1 
ATOM   4867  C  C     . PRO D 4  519  ? 7.278   -22.203 51.747  1.00 68.78  ? 519  PRO A C     1 
ATOM   4868  O  O     . PRO D 4  519  ? 6.505   -21.751 52.596  1.00 55.13  ? 519  PRO A O     1 
ATOM   4869  C  CB    . PRO D 4  519  ? 6.433   -24.566 51.428  1.00 74.38  ? 519  PRO A CB    1 
ATOM   4870  C  CG    . PRO D 4  519  ? 5.913   -24.957 52.775  1.00 72.10  ? 519  PRO A CG    1 
ATOM   4871  C  CD    . PRO D 4  519  ? 7.159   -25.183 53.582  1.00 77.06  ? 519  PRO A CD    1 
ATOM   4872  N  N     . CYS D 4  520  ? 7.819   -21.445 50.781  1.00 68.19  ? 520  CYS A N     1 
ATOM   4873  C  CA    . CYS D 4  520  ? 7.490   -20.021 50.714  1.00 77.54  ? 520  CYS A CA    1 
ATOM   4874  C  C     . CYS D 4  520  ? 6.180   -19.756 49.971  1.00 65.88  ? 520  CYS A C     1 
ATOM   4875  O  O     . CYS D 4  520  ? 5.532   -18.731 50.212  1.00 83.92  ? 520  CYS A O     1 
ATOM   4876  C  CB    . CYS D 4  520  ? 8.645   -19.221 50.088  1.00 81.63  ? 520  CYS A CB    1 
ATOM   4877  S  SG    . CYS D 4  520  ? 9.191   -19.709 48.443  1.00 69.40  ? 520  CYS A SG    1 
ATOM   4878  N  N     . MET D 4  521  ? 5.767   -20.654 49.091  1.00 59.95  ? 521  MET A N     1 
ATOM   4879  C  CA    . MET D 4  521  ? 4.512   -20.501 48.376  1.00 55.04  ? 521  MET A CA    1 
ATOM   4880  C  C     . MET D 4  521  ? 3.403   -21.296 49.064  1.00 68.73  ? 521  MET A C     1 
ATOM   4881  O  O     . MET D 4  521  ? 3.657   -22.300 49.736  1.00 79.95  ? 521  MET A O     1 
ATOM   4882  C  CB    . MET D 4  521  ? 4.690   -20.955 46.932  1.00 49.46  ? 521  MET A CB    1 
ATOM   4883  C  CG    . MET D 4  521  ? 6.027   -20.515 46.354  1.00 51.88  ? 521  MET A CG    1 
ATOM   4884  S  SD    . MET D 4  521  ? 6.116   -20.708 44.568  1.00 76.26  ? 521  MET A SD    1 
ATOM   4885  C  CE    . MET D 4  521  ? 7.860   -20.423 44.261  1.00 63.29  ? 521  MET A CE    1 
ATOM   4886  N  N     . GLY D 4  522  ? 2.166   -20.841 48.881  1.00 54.81  ? 522  GLY A N     1 
ATOM   4887  C  CA    . GLY D 4  522  ? 1.021   -21.515 49.466  1.00 51.30  ? 522  GLY A CA    1 
ATOM   4888  C  C     . GLY D 4  522  ? -0.256  -21.002 48.836  1.00 65.69  ? 522  GLY A C     1 
ATOM   4889  O  O     . GLY D 4  522  ? -0.238  -20.173 47.923  1.00 79.38  ? 522  GLY A O     1 
ATOM   4890  N  N     . ILE D 4  523  ? -1.376  -21.515 49.331  1.00 67.63  ? 523  ILE A N     1 
ATOM   4891  C  CA    . ILE D 4  523  ? -2.689  -21.101 48.840  1.00 79.06  ? 523  ILE A CA    1 
ATOM   4892  C  C     . ILE D 4  523  ? -3.046  -19.757 49.468  1.00 87.05  ? 523  ILE A C     1 
ATOM   4893  O  O     . ILE D 4  523  ? -2.815  -19.524 50.658  1.00 94.58  ? 523  ILE A O     1 
ATOM   4894  C  CB    . ILE D 4  523  ? -3.734  -22.202 49.129  1.00 84.42  ? 523  ILE A CB    1 
ATOM   4895  C  CG1   . ILE D 4  523  ? -3.885  -23.165 47.935  1.00 92.41  ? 523  ILE A CG1   1 
ATOM   4896  C  CG2   . ILE D 4  523  ? -5.090  -21.640 49.474  1.00 66.83  ? 523  ILE A CG2   1 
ATOM   4897  C  CD1   . ILE D 4  523  ? -2.609  -23.827 47.421  1.00 94.01  ? 523  ILE A CD1   1 
ATOM   4898  N  N     . VAL D 4  524  ? -3.610  -18.854 48.655  1.00 89.86  ? 524  VAL A N     1 
ATOM   4899  C  CA    . VAL D 4  524  ? -3.764  -17.439 49.011  1.00 62.44  ? 524  VAL A CA    1 
ATOM   4900  C  C     . VAL D 4  524  ? -5.263  -17.146 48.898  1.00 72.21  ? 524  VAL A C     1 
ATOM   4901  O  O     . VAL D 4  524  ? -6.057  -18.068 48.680  1.00 102.52 ? 524  VAL A O     1 
ATOM   4902  C  CB    . VAL D 4  524  ? -2.891  -16.532 48.101  1.00 74.56  ? 524  VAL A CB    1 
ATOM   4903  C  CG1   . VAL D 4  524  ? -2.620  -15.133 48.725  1.00 103.96 ? 524  VAL A CG1   1 
ATOM   4904  C  CG2   . VAL D 4  524  ? -1.571  -17.203 47.723  1.00 76.22  ? 524  VAL A CG2   1 
ATOM   4905  N  N     . GLN D 4  525  ? -5.638  -15.867 48.992  1.00 78.94  ? 525  GLN A N     1 
ATOM   4906  C  CA    . GLN D 4  525  ? -6.915  -15.351 49.486  1.00 90.34  ? 525  GLN A CA    1 
ATOM   4907  C  C     . GLN D 4  525  ? -8.188  -16.104 49.097  1.00 78.44  ? 525  GLN A C     1 
ATOM   4908  O  O     . GLN D 4  525  ? -8.882  -16.653 49.964  1.00 65.60  ? 525  GLN A O     1 
ATOM   4909  C  CB    . GLN D 4  525  ? -7.041  -13.900 49.007  1.00 94.69  ? 525  GLN A CB    1 
ATOM   4910  C  CG    . GLN D 4  525  ? -5.763  -13.101 49.097  1.00 107.30 ? 525  GLN A CG    1 
ATOM   4911  C  CD    . GLN D 4  525  ? -5.980  -11.646 48.768  1.00 116.76 ? 525  GLN A CD    1 
ATOM   4912  O  OE1   . GLN D 4  525  ? -7.045  -11.261 48.286  1.00 125.70 ? 525  GLN A OE1   1 
ATOM   4913  N  NE2   . GLN D 4  525  ? -4.976  -10.821 49.043  1.00 123.48 ? 525  GLN A NE2   1 
ATOM   4914  N  N     . ASP D 4  526  ? -8.535  -16.111 47.806  1.00 74.71  ? 526  ASP A N     1 
ATOM   4915  C  CA    . ASP D 4  526  ? -9.830  -16.666 47.416  1.00 72.63  ? 526  ASP A CA    1 
ATOM   4916  C  C     . ASP D 4  526  ? -9.849  -18.174 47.573  1.00 65.19  ? 526  ASP A C     1 
ATOM   4917  O  O     . ASP D 4  526  ? -10.822 -18.732 48.092  1.00 57.75  ? 526  ASP A O     1 
ATOM   4918  C  CB    . ASP D 4  526  ? -10.178 -16.287 45.978  1.00 77.40  ? 526  ASP A CB    1 
ATOM   4919  C  CG    . ASP D 4  526  ? -10.737 -14.894 45.862  1.00 57.90  ? 526  ASP A CG    1 
ATOM   4920  O  OD1   . ASP D 4  526  ? -9.957  -13.921 45.835  1.00 59.44  ? 526  ASP A OD1   1 
ATOM   4921  O  OD2   . ASP D 4  526  ? -11.969 -14.775 45.798  1.00 49.86  ? 526  ASP A OD2   1 
ATOM   4922  N  N     . THR D 4  527  ? -8.788  -18.841 47.112  1.00 68.06  ? 527  THR A N     1 
ATOM   4923  C  CA    . THR D 4  527  ? -8.673  -20.284 47.285  1.00 80.59  ? 527  THR A CA    1 
ATOM   4924  C  C     . THR D 4  527  ? -8.696  -20.657 48.765  1.00 79.86  ? 527  THR A C     1 
ATOM   4925  O  O     . THR D 4  527  ? -9.361  -21.621 49.157  1.00 69.27  ? 527  THR A O     1 
ATOM   4926  C  CB    . THR D 4  527  ? -7.393  -20.776 46.599  1.00 86.02  ? 527  THR A CB    1 
ATOM   4927  O  OG1   . THR D 4  527  ? -7.154  -19.993 45.417  1.00 84.22  ? 527  THR A OG1   1 
ATOM   4928  C  CG2   . THR D 4  527  ? -7.491  -22.237 46.205  1.00 74.02  ? 527  THR A CG2   1 
ATOM   4929  N  N     . LEU D 4  528  ? -8.041  -19.853 49.607  1.00 83.63  ? 528  LEU A N     1 
ATOM   4930  C  CA    . LEU D 4  528  ? -7.975  -20.143 51.037  1.00 65.48  ? 528  LEU A CA    1 
ATOM   4931  C  C     . LEU D 4  528  ? -9.323  -19.927 51.717  1.00 72.95  ? 528  LEU A C     1 
ATOM   4932  O  O     . LEU D 4  528  ? -9.690  -20.673 52.634  1.00 77.36  ? 528  LEU A O     1 
ATOM   4933  C  CB    . LEU D 4  528  ? -6.884  -19.282 51.679  1.00 54.35  ? 528  LEU A CB    1 
ATOM   4934  C  CG    . LEU D 4  528  ? -6.363  -19.653 53.068  1.00 73.10  ? 528  LEU A CG    1 
ATOM   4935  C  CD1   . LEU D 4  528  ? -6.271  -21.160 53.232  1.00 90.30  ? 528  LEU A CD1   1 
ATOM   4936  C  CD2   . LEU D 4  528  ? -5.006  -18.999 53.325  1.00 63.55  ? 528  LEU A CD2   1 
ATOM   4937  N  N     . CYS D 4  529  ? -10.078 -18.920 51.275  1.00 77.00  ? 529  CYS A N     1 
ATOM   4938  C  CA    . CYS D 4  529  ? -11.392 -18.671 51.854  1.00 74.51  ? 529  CYS A CA    1 
ATOM   4939  C  C     . CYS D 4  529  ? -12.405 -19.708 51.384  1.00 82.41  ? 529  CYS A C     1 
ATOM   4940  O  O     . CYS D 4  529  ? -13.255 -20.157 52.165  1.00 85.55  ? 529  CYS A O     1 
ATOM   4941  C  CB    . CYS D 4  529  ? -11.850 -17.260 51.492  1.00 67.52  ? 529  CYS A CB    1 
ATOM   4942  S  SG    . CYS D 4  529  ? -13.521 -16.870 52.007  1.00 89.47  ? 529  CYS A SG    1 
ATOM   4943  N  N     . GLY D 4  530  ? -12.314 -20.117 50.116  1.00 88.13  ? 530  GLY A N     1 
ATOM   4944  C  CA    . GLY D 4  530  ? -13.281 -21.050 49.570  1.00 91.31  ? 530  GLY A CA    1 
ATOM   4945  C  C     . GLY D 4  530  ? -13.008 -22.497 49.911  1.00 86.01  ? 530  GLY A C     1 
ATOM   4946  O  O     . GLY D 4  530  ? -13.936 -23.312 49.916  1.00 86.18  ? 530  GLY A O     1 
ATOM   4947  N  N     . ILE D 4  531  ? -11.747 -22.846 50.194  1.00 85.22  ? 531  ILE A N     1 
ATOM   4948  C  CA    . ILE D 4  531  ? -11.418 -24.226 50.527  1.00 70.23  ? 531  ILE A CA    1 
ATOM   4949  C  C     . ILE D 4  531  ? -11.908 -24.577 51.925  1.00 67.54  ? 531  ILE A C     1 
ATOM   4950  O  O     . ILE D 4  531  ? -12.078 -25.760 52.237  1.00 91.33  ? 531  ILE A O     1 
ATOM   4951  C  CB    . ILE D 4  531  ? -9.899  -24.469 50.360  1.00 60.33  ? 531  ILE A CB    1 
ATOM   4952  C  CG1   . ILE D 4  531  ? -9.619  -25.940 50.041  1.00 58.68  ? 531  ILE A CG1   1 
ATOM   4953  C  CG2   . ILE D 4  531  ? -9.114  -24.050 51.609  1.00 56.08  ? 531  ILE A CG2   1 
ATOM   4954  C  CD1   . ILE D 4  531  ? -8.162  -26.248 49.725  1.00 66.72  ? 531  ILE A CD1   1 
ATOM   4955  N  N     . ARG D 4  532  ? -12.161 -23.576 52.772  1.00 61.02  ? 532  ARG A N     1 
ATOM   4956  C  CA    . ARG D 4  532  ? -12.764 -23.841 54.072  1.00 72.83  ? 532  ARG A CA    1 
ATOM   4957  C  C     . ARG D 4  532  ? -14.266 -24.076 53.939  1.00 81.75  ? 532  ARG A C     1 
ATOM   4958  O  O     . ARG D 4  532  ? -14.799 -25.055 54.476  1.00 89.00  ? 532  ARG A O     1 
ATOM   4959  C  CB    . ARG D 4  532  ? -12.487 -22.687 55.039  1.00 70.60  ? 532  ARG A CB    1 
ATOM   4960  C  CG    . ARG D 4  532  ? -13.296 -22.793 56.321  1.00 70.22  ? 532  ARG A CG    1 
ATOM   4961  C  CD    . ARG D 4  532  ? -13.328 -21.495 57.091  1.00 68.63  ? 532  ARG A CD    1 
ATOM   4962  N  NE    . ARG D 4  532  ? -14.578 -21.388 57.833  1.00 76.08  ? 532  ARG A NE    1 
ATOM   4963  C  CZ    . ARG D 4  532  ? -15.602 -20.641 57.434  1.00 87.14  ? 532  ARG A CZ    1 
ATOM   4964  N  NH1   . ARG D 4  532  ? -15.510 -19.941 56.306  1.00 60.26  ? 532  ARG A NH1   1 
ATOM   4965  N  NH2   . ARG D 4  532  ? -16.719 -20.593 58.151  1.00 79.45  ? 532  ARG A NH2   1 
ATOM   4966  N  N     . LYS D 4  533  ? -14.961 -23.183 53.222  1.00 75.64  ? 533  LYS A N     1 
ATOM   4967  C  CA    . LYS D 4  533  ? -16.391 -23.357 52.985  1.00 80.87  ? 533  LYS A CA    1 
ATOM   4968  C  C     . LYS D 4  533  ? -16.673 -24.621 52.184  1.00 96.06  ? 533  LYS A C     1 
ATOM   4969  O  O     . LYS D 4  533  ? -17.756 -25.205 52.306  1.00 116.23 ? 533  LYS A O     1 
ATOM   4970  C  CB    . LYS D 4  533  ? -16.963 -22.133 52.257  1.00 85.35  ? 533  LYS A CB    1 
ATOM   4971  C  CG    . LYS D 4  533  ? -16.632 -20.779 52.879  1.00 75.22  ? 533  LYS A CG    1 
ATOM   4972  C  CD    . LYS D 4  533  ? -17.579 -19.713 52.355  1.00 58.07  ? 533  LYS A CD    1 
ATOM   4973  C  CE    . LYS D 4  533  ? -19.001 -20.016 52.814  1.00 68.70  ? 533  LYS A CE    1 
ATOM   4974  N  NZ    . LYS D 4  533  ? -20.047 -19.122 52.235  1.00 67.03  ? 533  LYS A NZ    1 
ATOM   4975  N  N     . LEU D 4  534  ? -15.711 -25.058 51.368  1.00 87.52  ? 534  LEU A N     1 
ATOM   4976  C  CA    . LEU D 4  534  ? -15.857 -26.307 50.633  1.00 82.20  ? 534  LEU A CA    1 
ATOM   4977  C  C     . LEU D 4  534  ? -15.778 -27.504 51.569  1.00 96.82  ? 534  LEU A C     1 
ATOM   4978  O  O     . LEU D 4  534  ? -16.512 -28.484 51.399  1.00 118.61 ? 534  LEU A O     1 
ATOM   4979  C  CB    . LEU D 4  534  ? -14.772 -26.406 49.558  1.00 81.05  ? 534  LEU A CB    1 
ATOM   4980  C  CG    . LEU D 4  534  ? -14.667 -27.692 48.730  1.00 72.20  ? 534  LEU A CG    1 
ATOM   4981  C  CD1   . LEU D 4  534  ? -15.891 -27.873 47.829  1.00 58.88  ? 534  LEU A CD1   1 
ATOM   4982  C  CD2   . LEU D 4  534  ? -13.357 -27.742 47.940  1.00 57.77  ? 534  LEU A CD2   1 
ATOM   4983  N  N     . THR D 4  535  ? -14.906 -27.437 52.574  1.00 92.47  ? 535  THR A N     1 
ATOM   4984  C  CA    . THR D 4  535  ? -14.576 -28.595 53.393  1.00 74.41  ? 535  THR A CA    1 
ATOM   4985  C  C     . THR D 4  535  ? -15.424 -28.678 54.666  1.00 76.25  ? 535  THR A C     1 
ATOM   4986  O  O     . THR D 4  535  ? -15.151 -29.513 55.533  1.00 104.60 ? 535  THR A O     1 
ATOM   4987  C  CB    . THR D 4  535  ? -13.080 -28.570 53.741  1.00 70.26  ? 535  THR A CB    1 
ATOM   4988  O  OG1   . THR D 4  535  ? -12.352 -28.048 52.627  1.00 86.99  ? 535  THR A OG1   1 
ATOM   4989  C  CG2   . THR D 4  535  ? -12.560 -29.981 53.925  1.00 87.10  ? 535  THR A CG2   1 
ATOM   4990  N  N     . LEU D 4  536  ? -16.459 -27.853 54.794  1.00 70.77  ? 536  LEU A N     1 
ATOM   4991  C  CA    . LEU D 4  536  ? -17.374 -27.996 55.918  1.00 83.62  ? 536  LEU A CA    1 
ATOM   4992  C  C     . LEU D 4  536  ? -18.213 -29.265 55.773  1.00 87.04  ? 536  LEU A C     1 
ATOM   4993  O  O     . LEU D 4  536  ? -18.448 -29.765 54.669  1.00 89.95  ? 536  LEU A O     1 
ATOM   4994  C  CB    . LEU D 4  536  ? -18.292 -26.776 56.033  1.00 87.37  ? 536  LEU A CB    1 
ATOM   4995  C  CG    . LEU D 4  536  ? -17.641 -25.407 56.255  1.00 81.03  ? 536  LEU A CG    1 
ATOM   4996  C  CD1   . LEU D 4  536  ? -18.677 -24.399 56.737  1.00 84.07  ? 536  LEU A CD1   1 
ATOM   4997  C  CD2   . LEU D 4  536  ? -16.477 -25.490 57.239  1.00 79.77  ? 536  LEU A CD2   1 
ATOM   4998  N  N     . ARG D 4  537  ? -18.658 -29.795 56.917  1.00 90.18  ? 537  ARG A N     1 
ATOM   4999  C  CA    . ARG D 4  537  ? -19.534 -30.961 56.895  1.00 96.41  ? 537  ARG A CA    1 
ATOM   5000  C  C     . ARG D 4  537  ? -20.922 -30.614 56.369  1.00 91.42  ? 537  ARG A C     1 
ATOM   5001  O  O     . ARG D 4  537  ? -21.633 -31.496 55.872  1.00 97.26  ? 537  ARG A O     1 
ATOM   5002  C  CB    . ARG D 4  537  ? -19.626 -31.576 58.294  1.00 111.64 ? 537  ARG A CB    1 
ATOM   5003  C  CG    . ARG D 4  537  ? -18.312 -32.164 58.787  1.00 119.93 ? 537  ARG A CG    1 
ATOM   5004  C  CD    . ARG D 4  537  ? -18.540 -33.489 59.495  1.00 121.84 ? 537  ARG A CD    1 
ATOM   5005  N  NE    . ARG D 4  537  ? -18.321 -33.424 60.937  1.00 117.71 ? 537  ARG A NE    1 
ATOM   5006  C  CZ    . ARG D 4  537  ? -17.205 -33.826 61.541  1.00 101.44 ? 537  ARG A CZ    1 
ATOM   5007  N  NH1   . ARG D 4  537  ? -16.201 -34.329 60.829  1.00 89.90  ? 537  ARG A NH1   1 
ATOM   5008  N  NH2   . ARG D 4  537  ? -17.098 -33.735 62.858  1.00 94.16  ? 537  ARG A NH2   1 
ATOM   5009  N  N     . ASP D 4  538  ? -21.327 -29.345 56.476  1.00 85.27  ? 538  ASP A N     1 
ATOM   5010  C  CA    . ASP D 4  538  ? -22.575 -28.896 55.868  1.00 85.85  ? 538  ASP A CA    1 
ATOM   5011  C  C     . ASP D 4  538  ? -22.477 -28.856 54.351  1.00 89.64  ? 538  ASP A C     1 
ATOM   5012  O  O     . ASP D 4  538  ? -23.498 -28.952 53.660  1.00 95.89  ? 538  ASP A O     1 
ATOM   5013  C  CB    . ASP D 4  538  ? -22.944 -27.503 56.378  1.00 102.50 ? 538  ASP A CB    1 
ATOM   5014  C  CG    . ASP D 4  538  ? -23.354 -27.499 57.830  1.00 104.84 ? 538  ASP A CG    1 
ATOM   5015  O  OD1   . ASP D 4  538  ? -24.151 -28.371 58.233  1.00 101.15 ? 538  ASP A OD1   1 
ATOM   5016  O  OD2   . ASP D 4  538  ? -22.882 -26.610 58.564  1.00 107.32 ? 538  ASP A OD2   1 
ATOM   5017  N  N     . THR D 4  539  ? -21.269 -28.689 53.822  1.00 89.01  ? 539  THR A N     1 
ATOM   5018  C  CA    . THR D 4  539  ? -21.079 -28.463 52.395  1.00 96.35  ? 539  THR A CA    1 
ATOM   5019  C  C     . THR D 4  539  ? -21.269 -29.778 51.655  1.00 94.22  ? 539  THR A C     1 
ATOM   5020  O  O     . THR D 4  539  ? -20.433 -30.683 51.757  1.00 69.33  ? 539  THR A O     1 
ATOM   5021  C  CB    . THR D 4  539  ? -19.698 -27.880 52.120  1.00 89.35  ? 539  THR A CB    1 
ATOM   5022  O  OG1   . THR D 4  539  ? -19.542 -26.659 52.850  1.00 91.16  ? 539  THR A OG1   1 
ATOM   5023  C  CG2   . THR D 4  539  ? -19.542 -27.595 50.636  1.00 88.82  ? 539  THR A CG2   1 
ATOM   5024  N  N     . PHE D 4  540  ? -22.373 -29.878 50.915  1.00 105.39 ? 540  PHE A N     1 
ATOM   5025  C  CA    . PHE D 4  540  ? -22.676 -31.038 50.093  1.00 101.64 ? 540  PHE A CA    1 
ATOM   5026  C  C     . PHE D 4  540  ? -22.942 -30.584 48.666  1.00 105.83 ? 540  PHE A C     1 
ATOM   5027  O  O     . PHE D 4  540  ? -23.601 -29.565 48.441  1.00 124.39 ? 540  PHE A O     1 
ATOM   5028  C  CB    . PHE D 4  540  ? -23.874 -31.823 50.646  1.00 99.84  ? 540  PHE A CB    1 
ATOM   5029  C  CG    . PHE D 4  540  ? -23.553 -32.631 51.875  1.00 99.97  ? 540  PHE A CG    1 
ATOM   5030  C  CD1   . PHE D 4  540  ? -24.425 -32.677 52.953  1.00 98.98  ? 540  PHE A CD1   1 
ATOM   5031  C  CD2   . PHE D 4  540  ? -22.358 -33.330 51.959  1.00 97.60  ? 540  PHE A CD2   1 
ATOM   5032  C  CE1   . PHE D 4  540  ? -24.114 -33.424 54.082  1.00 97.29  ? 540  PHE A CE1   1 
ATOM   5033  C  CE2   . PHE D 4  540  ? -22.045 -34.069 53.083  1.00 89.94  ? 540  PHE A CE2   1 
ATOM   5034  C  CZ    . PHE D 4  540  ? -22.924 -34.116 54.145  1.00 93.99  ? 540  PHE A CZ    1 
ATOM   5035  N  N     . ILE D 4  541  ? -22.425 -31.345 47.704  1.00 93.80  ? 541  ILE A N     1 
ATOM   5036  C  CA    . ILE D 4  541  ? -22.412 -30.950 46.301  1.00 81.91  ? 541  ILE A CA    1 
ATOM   5037  C  C     . ILE D 4  541  ? -23.216 -31.967 45.502  1.00 96.25  ? 541  ILE A C     1 
ATOM   5038  O  O     . ILE D 4  541  ? -22.999 -33.177 45.635  1.00 87.79  ? 541  ILE A O     1 
ATOM   5039  C  CB    . ILE D 4  541  ? -20.974 -30.846 45.764  1.00 65.94  ? 541  ILE A CB    1 
ATOM   5040  C  CG1   . ILE D 4  541  ? -20.094 -30.082 46.747  1.00 62.09  ? 541  ILE A CG1   1 
ATOM   5041  C  CG2   . ILE D 4  541  ? -20.967 -30.107 44.462  1.00 91.05  ? 541  ILE A CG2   1 
ATOM   5042  C  CD1   . ILE D 4  541  ? -18.652 -29.965 46.315  1.00 77.38  ? 541  ILE A CD1   1 
ATOM   5043  N  N     . GLU D 4  542  ? -24.144 -31.477 44.678  1.00 110.35 ? 542  GLU A N     1 
ATOM   5044  C  CA    . GLU D 4  542  ? -24.965 -32.341 43.841  1.00 100.22 ? 542  GLU A CA    1 
ATOM   5045  C  C     . GLU D 4  542  ? -24.183 -32.784 42.604  1.00 87.89  ? 542  GLU A C     1 
ATOM   5046  O  O     . GLU D 4  542  ? -23.058 -32.347 42.354  1.00 87.61  ? 542  GLU A O     1 
ATOM   5047  C  CB    . GLU D 4  542  ? -26.255 -31.633 43.435  1.00 103.85 ? 542  GLU A CB    1 
ATOM   5048  C  CG    . GLU D 4  542  ? -27.151 -31.228 44.589  1.00 119.99 ? 542  GLU A CG    1 
ATOM   5049  C  CD    . GLU D 4  542  ? -28.494 -30.710 44.114  1.00 134.68 ? 542  GLU A CD    1 
ATOM   5050  O  OE1   . GLU D 4  542  ? -29.064 -31.306 43.176  1.00 135.17 ? 542  GLU A OE1   1 
ATOM   5051  O  OE2   . GLU D 4  542  ? -28.972 -29.695 44.663  1.00 145.25 ? 542  GLU A OE2   1 
ATOM   5052  N  N     . LEU D 4  543  ? -24.826 -33.638 41.800  1.00 79.77  ? 543  LEU A N     1 
ATOM   5053  C  CA    . LEU D 4  543  ? -24.146 -34.341 40.713  1.00 93.77  ? 543  LEU A CA    1 
ATOM   5054  C  C     . LEU D 4  543  ? -23.674 -33.391 39.614  1.00 97.52  ? 543  LEU A C     1 
ATOM   5055  O  O     . LEU D 4  543  ? -22.545 -33.524 39.120  1.00 100.69 ? 543  LEU A O     1 
ATOM   5056  C  CB    . LEU D 4  543  ? -25.084 -35.396 40.128  1.00 99.38  ? 543  LEU A CB    1 
ATOM   5057  C  CG    . LEU D 4  543  ? -24.596 -36.208 38.931  1.00 81.29  ? 543  LEU A CG    1 
ATOM   5058  C  CD1   . LEU D 4  543  ? -23.864 -37.444 39.410  1.00 69.63  ? 543  LEU A CD1   1 
ATOM   5059  C  CD2   . LEU D 4  543  ? -25.761 -36.573 38.027  1.00 86.58  ? 543  LEU A CD2   1 
ATOM   5060  N  N     . ASP D 4  544  ? -24.526 -32.430 39.226  1.00 90.68  ? 544  ASP A N     1 
ATOM   5061  C  CA    . ASP D 4  544  ? -24.207 -31.518 38.128  1.00 97.11  ? 544  ASP A CA    1 
ATOM   5062  C  C     . ASP D 4  544  ? -22.953 -30.699 38.419  1.00 96.46  ? 544  ASP A C     1 
ATOM   5063  O  O     . ASP D 4  544  ? -22.112 -30.502 37.533  1.00 97.24  ? 544  ASP A O     1 
ATOM   5064  C  CB    . ASP D 4  544  ? -25.396 -30.592 37.849  1.00 110.74 ? 544  ASP A CB    1 
ATOM   5065  C  CG    . ASP D 4  544  ? -25.949 -29.937 39.113  1.00 114.57 ? 544  ASP A CG    1 
ATOM   5066  O  OD1   . ASP D 4  544  ? -25.243 -29.114 39.736  1.00 110.97 ? 544  ASP A OD1   1 
ATOM   5067  O  OD2   . ASP D 4  544  ? -27.097 -30.250 39.489  1.00 119.72 ? 544  ASP A OD2   1 
ATOM   5068  N  N     . GLN D 4  545  ? -22.805 -30.228 39.657  1.00 98.78  ? 545  GLN A N     1 
ATOM   5069  C  CA    . GLN D 4  545  ? -21.612 -29.478 40.025  1.00 103.65 ? 545  GLN A CA    1 
ATOM   5070  C  C     . GLN D 4  545  ? -20.410 -30.394 40.240  1.00 87.41  ? 545  GLN A C     1 
ATOM   5071  O  O     . GLN D 4  545  ? -19.277 -30.000 39.932  1.00 78.44  ? 545  GLN A O     1 
ATOM   5072  C  CB    . GLN D 4  545  ? -21.874 -28.662 41.293  1.00 109.57 ? 545  GLN A CB    1 
ATOM   5073  C  CG    . GLN D 4  545  ? -21.285 -27.258 41.300  1.00 111.88 ? 545  GLN A CG    1 
ATOM   5074  C  CD    . GLN D 4  545  ? -21.570 -26.530 42.602  1.00 104.22 ? 545  GLN A CD    1 
ATOM   5075  O  OE1   . GLN D 4  545  ? -22.442 -26.931 43.372  1.00 107.39 ? 545  GLN A OE1   1 
ATOM   5076  N  NE2   . GLN D 4  545  ? -20.825 -25.461 42.859  1.00 93.96  ? 545  GLN A NE2   1 
ATOM   5077  N  N     . VAL D 4  546  ? -20.642 -31.607 40.764  1.00 82.94  ? 546  VAL A N     1 
ATOM   5078  C  CA    . VAL D 4  546  ? -19.562 -32.565 41.013  1.00 85.91  ? 546  VAL A CA    1 
ATOM   5079  C  C     . VAL D 4  546  ? -18.884 -32.965 39.707  1.00 92.84  ? 546  VAL A C     1 
ATOM   5080  O  O     . VAL D 4  546  ? -17.653 -33.077 39.638  1.00 83.36  ? 546  VAL A O     1 
ATOM   5081  C  CB    . VAL D 4  546  ? -20.105 -33.789 41.783  1.00 78.71  ? 546  VAL A CB    1 
ATOM   5082  C  CG1   . VAL D 4  546  ? -19.237 -35.034 41.577  1.00 81.68  ? 546  VAL A CG1   1 
ATOM   5083  C  CG2   . VAL D 4  546  ? -20.186 -33.483 43.267  1.00 63.59  ? 546  VAL A CG2   1 
ATOM   5084  N  N     . LEU D 4  547  ? -19.670 -33.147 38.644  1.00 111.17 ? 547  LEU A N     1 
ATOM   5085  C  CA    . LEU D 4  547  ? -19.117 -33.590 37.362  1.00 111.46 ? 547  LEU A CA    1 
ATOM   5086  C  C     . LEU D 4  547  ? -18.204 -32.526 36.739  1.00 98.63  ? 547  LEU A C     1 
ATOM   5087  O  O     . LEU D 4  547  ? -17.098 -32.838 36.271  1.00 83.66  ? 547  LEU A O     1 
ATOM   5088  C  CB    . LEU D 4  547  ? -20.265 -33.979 36.425  1.00 114.95 ? 547  LEU A CB    1 
ATOM   5089  C  CG    . LEU D 4  547  ? -20.784 -35.436 36.433  1.00 98.13  ? 547  LEU A CG    1 
ATOM   5090  C  CD1   . LEU D 4  547  ? -20.929 -36.060 37.806  1.00 75.68  ? 547  LEU A CD1   1 
ATOM   5091  C  CD2   . LEU D 4  547  ? -22.100 -35.549 35.671  1.00 109.03 ? 547  LEU A CD2   1 
ATOM   5092  N  N     . ASN D 4  548  ? -18.641 -31.257 36.743  1.00 95.80  ? 548  ASN A N     1 
ATOM   5093  C  CA    . ASN D 4  548  ? -17.794 -30.166 36.250  1.00 85.42  ? 548  ASN A CA    1 
ATOM   5094  C  C     . ASN D 4  548  ? -16.575 -29.962 37.141  1.00 92.96  ? 548  ASN A C     1 
ATOM   5095  O  O     . ASN D 4  548  ? -15.480 -29.659 36.648  1.00 91.36  ? 548  ASN A O     1 
ATOM   5096  C  CB    . ASN D 4  548  ? -18.596 -28.865 36.161  1.00 80.90  ? 548  ASN A CB    1 
ATOM   5097  C  CG    . ASN D 4  548  ? -19.662 -28.896 35.078  1.00 94.05  ? 548  ASN A CG    1 
ATOM   5098  O  OD1   . ASN D 4  548  ? -19.356 -28.868 33.884  1.00 93.14  ? 548  ASN A OD1   1 
ATOM   5099  N  ND2   . ASN D 4  548  ? -20.922 -28.938 35.494  1.00 106.79 ? 548  ASN A ND2   1 
ATOM   5100  N  N     . MET D 4  549  ? -16.752 -30.121 38.457  1.00 96.20  ? 549  MET A N     1 
ATOM   5101  C  CA    . MET D 4  549  ? -15.642 -29.970 39.389  1.00 85.81  ? 549  MET A CA    1 
ATOM   5102  C  C     . MET D 4  549  ? -14.590 -31.052 39.171  1.00 93.01  ? 549  MET A C     1 
ATOM   5103  O  O     . MET D 4  549  ? -13.386 -30.799 39.300  1.00 99.75  ? 549  MET A O     1 
ATOM   5104  C  CB    . MET D 4  549  ? -16.188 -30.011 40.813  1.00 68.87  ? 549  MET A CB    1 
ATOM   5105  C  CG    . MET D 4  549  ? -15.606 -28.983 41.739  1.00 76.61  ? 549  MET A CG    1 
ATOM   5106  S  SD    . MET D 4  549  ? -16.539 -28.904 43.275  1.00 91.91  ? 549  MET A SD    1 
ATOM   5107  C  CE    . MET D 4  549  ? -18.158 -28.469 42.660  1.00 73.08  ? 549  MET A CE    1 
ATOM   5108  N  N     . LEU D 4  550  ? -15.035 -32.260 38.817  1.00 85.92  ? 550  LEU A N     1 
ATOM   5109  C  CA    . LEU D 4  550  ? -14.113 -33.347 38.510  1.00 78.44  ? 550  LEU A CA    1 
ATOM   5110  C  C     . LEU D 4  550  ? -13.395 -33.097 37.191  1.00 77.61  ? 550  LEU A C     1 
ATOM   5111  O  O     . LEU D 4  550  ? -12.171 -33.263 37.097  1.00 73.46  ? 550  LEU A O     1 
ATOM   5112  C  CB    . LEU D 4  550  ? -14.870 -34.673 38.458  1.00 82.44  ? 550  LEU A CB    1 
ATOM   5113  C  CG    . LEU D 4  550  ? -15.232 -35.305 39.801  1.00 86.98  ? 550  LEU A CG    1 
ATOM   5114  C  CD1   . LEU D 4  550  ? -16.274 -36.409 39.619  1.00 85.75  ? 550  LEU A CD1   1 
ATOM   5115  C  CD2   . LEU D 4  550  ? -13.986 -35.817 40.499  1.00 86.43  ? 550  LEU A CD2   1 
ATOM   5116  N  N     . TYR D 4  551  ? -14.143 -32.695 36.156  1.00 91.24  ? 551  TYR A N     1 
ATOM   5117  C  CA    . TYR D 4  551  ? -13.528 -32.440 34.857  1.00 91.60  ? 551  TYR A CA    1 
ATOM   5118  C  C     . TYR D 4  551  ? -12.583 -31.243 34.897  1.00 84.99  ? 551  TYR A C     1 
ATOM   5119  O  O     . TYR D 4  551  ? -11.703 -31.129 34.035  1.00 81.22  ? 551  TYR A O     1 
ATOM   5120  C  CB    . TYR D 4  551  ? -14.604 -32.223 33.781  1.00 77.28  ? 551  TYR A CB    1 
ATOM   5121  C  CG    . TYR D 4  551  ? -14.027 -32.218 32.381  1.00 77.22  ? 551  TYR A CG    1 
ATOM   5122  C  CD1   . TYR D 4  551  ? -13.029 -33.115 32.024  1.00 101.05 ? 551  TYR A CD1   1 
ATOM   5123  C  CD2   . TYR D 4  551  ? -14.427 -31.282 31.439  1.00 58.93  ? 551  TYR A CD2   1 
ATOM   5124  C  CE1   . TYR D 4  551  ? -12.470 -33.106 30.759  1.00 95.96  ? 551  TYR A CE1   1 
ATOM   5125  C  CE2   . TYR D 4  551  ? -13.867 -31.265 30.163  1.00 56.80  ? 551  TYR A CE2   1 
ATOM   5126  C  CZ    . TYR D 4  551  ? -12.888 -32.180 29.836  1.00 68.97  ? 551  TYR A CZ    1 
ATOM   5127  O  OH    . TYR D 4  551  ? -12.325 -32.173 28.582  1.00 70.34  ? 551  TYR A OH    1 
ATOM   5128  N  N     . TRP D 4  552  ? -12.733 -30.365 35.894  1.00 80.61  ? 552  TRP A N     1 
ATOM   5129  C  CA    . TRP D 4  552  ? -11.847 -29.212 36.011  1.00 77.62  ? 552  TRP A CA    1 
ATOM   5130  C  C     . TRP D 4  552  ? -10.419 -29.599 36.390  1.00 80.34  ? 552  TRP A C     1 
ATOM   5131  O  O     . TRP D 4  552  ? -9.478  -28.871 36.047  1.00 56.99  ? 552  TRP A O     1 
ATOM   5132  C  CB    . TRP D 4  552  ? -12.420 -28.219 37.020  1.00 74.83  ? 552  TRP A CB    1 
ATOM   5133  C  CG    . TRP D 4  552  ? -12.966 -27.005 36.351  1.00 74.44  ? 552  TRP A CG    1 
ATOM   5134  C  CD1   . TRP D 4  552  ? -14.271 -26.613 36.290  1.00 64.29  ? 552  TRP A CD1   1 
ATOM   5135  C  CD2   . TRP D 4  552  ? -12.213 -26.011 35.645  1.00 71.65  ? 552  TRP A CD2   1 
ATOM   5136  N  NE1   . TRP D 4  552  ? -14.378 -25.441 35.582  1.00 55.35  ? 552  TRP A NE1   1 
ATOM   5137  C  CE2   . TRP D 4  552  ? -13.128 -25.049 35.179  1.00 59.68  ? 552  TRP A CE2   1 
ATOM   5138  C  CE3   . TRP D 4  552  ? -10.853 -25.841 35.362  1.00 73.38  ? 552  TRP A CE3   1 
ATOM   5139  C  CZ2   . TRP D 4  552  ? -12.728 -23.938 34.446  1.00 69.58  ? 552  TRP A CZ2   1 
ATOM   5140  C  CZ3   . TRP D 4  552  ? -10.461 -24.736 34.636  1.00 64.62  ? 552  TRP A CZ3   1 
ATOM   5141  C  CH2   . TRP D 4  552  ? -11.392 -23.800 34.186  1.00 75.47  ? 552  TRP A CH2   1 
ATOM   5142  N  N     . VAL D 4  553  ? -10.231 -30.725 37.075  1.00 82.34  ? 553  VAL A N     1 
ATOM   5143  C  CA    . VAL D 4  553  ? -8.896  -31.205 37.441  1.00 68.78  ? 553  VAL A CA    1 
ATOM   5144  C  C     . VAL D 4  553  ? -8.186  -31.713 36.190  1.00 86.97  ? 553  VAL A C     1 
ATOM   5145  O  O     . VAL D 4  553  ? -8.708  -32.608 35.502  1.00 109.49 ? 553  VAL A O     1 
ATOM   5146  C  CB    . VAL D 4  553  ? -8.971  -32.306 38.508  1.00 80.44  ? 553  VAL A CB    1 
ATOM   5147  C  CG1   . VAL D 4  553  ? -7.639  -32.445 39.218  1.00 89.08  ? 553  VAL A CG1   1 
ATOM   5148  C  CG2   . VAL D 4  553  ? -10.089 -32.022 39.493  1.00 82.63  ? 553  VAL A CG2   1 
ATOM   5149  N  N     . PRO D 4  554  ? -7.002  -31.167 35.858  1.00 78.38  ? 554  PRO A N     1 
ATOM   5150  C  CA    . PRO D 4  554  ? -6.340  -31.496 34.584  1.00 95.69  ? 554  PRO A CA    1 
ATOM   5151  C  C     . PRO D 4  554  ? -5.919  -32.952 34.448  1.00 102.48 ? 554  PRO A C     1 
ATOM   5152  O  O     . PRO D 4  554  ? -6.372  -33.648 33.533  1.00 100.73 ? 554  PRO A O     1 
ATOM   5153  C  CB    . PRO D 4  554  ? -5.115  -30.573 34.590  1.00 94.74  ? 554  PRO A CB    1 
ATOM   5154  C  CG    . PRO D 4  554  ? -5.538  -29.407 35.436  1.00 89.39  ? 554  PRO A CG    1 
ATOM   5155  C  CD    . PRO D 4  554  ? -6.394  -30.001 36.518  1.00 77.83  ? 554  PRO A CD    1 
ATOM   5156  N  N     . ASP D 4  555  ? -5.074  -33.433 35.358  1.00 108.93 ? 555  ASP A N     1 
ATOM   5157  C  CA    . ASP D 4  555  ? -4.634  -34.826 35.314  1.00 118.39 ? 555  ASP A CA    1 
ATOM   5158  C  C     . ASP D 4  555  ? -5.652  -35.660 36.080  1.00 113.59 ? 555  ASP A C     1 
ATOM   5159  O  O     . ASP D 4  555  ? -5.610  -35.755 37.307  1.00 130.02 ? 555  ASP A O     1 
ATOM   5160  C  CB    . ASP D 4  555  ? -3.220  -34.983 35.867  1.00 134.39 ? 555  ASP A CB    1 
ATOM   5161  C  CG    . ASP D 4  555  ? -2.980  -34.170 37.127  1.00 145.85 ? 555  ASP A CG    1 
ATOM   5162  O  OD1   . ASP D 4  555  ? -2.699  -32.961 37.007  1.00 154.28 ? 555  ASP A OD1   1 
ATOM   5163  O  OD2   . ASP D 4  555  ? -3.042  -34.746 38.234  1.00 154.66 ? 555  ASP A OD2   1 
ATOM   5164  N  N     . TRP D 4  556  ? -6.584  -36.257 35.349  1.00 95.09  ? 556  TRP A N     1 
ATOM   5165  C  CA    . TRP D 4  556  ? -7.674  -37.008 35.941  1.00 96.02  ? 556  TRP A CA    1 
ATOM   5166  C  C     . TRP D 4  556  ? -7.618  -38.454 35.466  1.00 124.42 ? 556  TRP A C     1 
ATOM   5167  O  O     . TRP D 4  556  ? -7.178  -38.740 34.348  1.00 139.43 ? 556  TRP A O     1 
ATOM   5168  C  CB    . TRP D 4  556  ? -9.032  -36.384 35.580  1.00 91.60  ? 556  TRP A CB    1 
ATOM   5169  C  CG    . TRP D 4  556  ? -10.127 -36.807 36.492  1.00 88.42  ? 556  TRP A CG    1 
ATOM   5170  C  CD1   . TRP D 4  556  ? -10.007 -37.133 37.802  1.00 100.48 ? 556  TRP A CD1   1 
ATOM   5171  C  CD2   . TRP D 4  556  ? -11.500 -37.042 36.142  1.00 98.33  ? 556  TRP A CD2   1 
ATOM   5172  N  NE1   . TRP D 4  556  ? -11.225 -37.517 38.308  1.00 115.14 ? 556  TRP A NE1   1 
ATOM   5173  C  CE2   . TRP D 4  556  ? -12.158 -37.473 37.308  1.00 102.96 ? 556  TRP A CE2   1 
ATOM   5174  C  CE3   . TRP D 4  556  ? -12.240 -36.909 34.961  1.00 99.36  ? 556  TRP A CE3   1 
ATOM   5175  C  CZ2   . TRP D 4  556  ? -13.518 -37.779 37.332  1.00 94.15  ? 556  TRP A CZ2   1 
ATOM   5176  C  CZ3   . TRP D 4  556  ? -13.594 -37.213 34.988  1.00 90.96  ? 556  TRP A CZ3   1 
ATOM   5177  C  CH2   . TRP D 4  556  ? -14.217 -37.642 36.165  1.00 89.17  ? 556  TRP A CH2   1 
ATOM   5178  N  N     . ASP D 4  557  ? -8.045  -39.371 36.341  1.00 137.39 ? 557  ASP A N     1 
ATOM   5179  C  CA    . ASP D 4  557  ? -8.159  -40.779 35.982  1.00 139.50 ? 557  ASP A CA    1 
ATOM   5180  C  C     . ASP D 4  557  ? -9.438  -41.092 35.217  1.00 147.78 ? 557  ASP A C     1 
ATOM   5181  O  O     . ASP D 4  557  ? -9.548  -42.186 34.649  1.00 167.99 ? 557  ASP A O     1 
ATOM   5182  C  CB    . ASP D 4  557  ? -8.072  -41.669 37.235  1.00 139.07 ? 557  ASP A CB    1 
ATOM   5183  C  CG    . ASP D 4  557  ? -9.095  -41.298 38.307  1.00 138.53 ? 557  ASP A CG    1 
ATOM   5184  O  OD1   . ASP D 4  557  ? -9.816  -40.292 38.145  1.00 140.52 ? 557  ASP A OD1   1 
ATOM   5185  O  OD2   . ASP D 4  557  ? -9.179  -42.028 39.319  1.00 134.31 ? 557  ASP A OD2   1 
ATOM   5186  N  N     . GLY D 4  558  ? -10.395 -40.166 35.187  1.00 122.48 ? 558  GLY A N     1 
ATOM   5187  C  CA    . GLY D 4  558  ? -11.690 -40.423 34.597  1.00 111.28 ? 558  GLY A CA    1 
ATOM   5188  C  C     . GLY D 4  558  ? -12.623 -41.251 35.450  1.00 115.38 ? 558  GLY A C     1 
ATOM   5189  O  O     . GLY D 4  558  ? -13.669 -41.684 34.954  1.00 130.28 ? 558  GLY A O     1 
ATOM   5190  N  N     . VAL D 4  559  ? -12.277 -41.495 36.710  1.00 116.15 ? 559  VAL A N     1 
ATOM   5191  C  CA    . VAL D 4  559  ? -13.074 -42.321 37.610  1.00 118.58 ? 559  VAL A CA    1 
ATOM   5192  C  C     . VAL D 4  559  ? -13.870 -41.390 38.517  1.00 106.52 ? 559  VAL A C     1 
ATOM   5193  O  O     . VAL D 4  559  ? -13.296 -40.695 39.362  1.00 105.27 ? 559  VAL A O     1 
ATOM   5194  C  CB    . VAL D 4  559  ? -12.194 -43.275 38.431  1.00 132.43 ? 559  VAL A CB    1 
ATOM   5195  C  CG1   . VAL D 4  559  ? -13.049 -44.182 39.312  1.00 151.36 ? 559  VAL A CG1   1 
ATOM   5196  C  CG2   . VAL D 4  559  ? -11.297 -44.100 37.514  1.00 128.93 ? 559  VAL A CG2   1 
ATOM   5197  N  N     . ILE D 4  560  ? -15.188 -41.367 38.338  1.00 102.73 ? 560  ILE A N     1 
ATOM   5198  C  CA    . ILE D 4  560  ? -16.090 -40.667 39.250  1.00 100.81 ? 560  ILE A CA    1 
ATOM   5199  C  C     . ILE D 4  560  ? -16.015 -41.377 40.596  1.00 100.82 ? 560  ILE A C     1 
ATOM   5200  O  O     . ILE D 4  560  ? -16.237 -42.594 40.666  1.00 120.56 ? 560  ILE A O     1 
ATOM   5201  C  CB    . ILE D 4  560  ? -17.530 -40.629 38.710  1.00 99.21  ? 560  ILE A CB    1 
ATOM   5202  C  CG1   . ILE D 4  560  ? -17.614 -39.765 37.448  1.00 90.34  ? 560  ILE A CG1   1 
ATOM   5203  C  CG2   . ILE D 4  560  ? -18.501 -40.130 39.774  1.00 94.44  ? 560  ILE A CG2   1 
ATOM   5204  C  CD1   . ILE D 4  560  ? -19.021 -39.619 36.878  1.00 79.43  ? 560  ILE A CD1   1 
ATOM   5205  N  N     . PRO D 4  561  ? -15.680 -40.676 41.675  1.00 85.61  ? 561  PRO A N     1 
ATOM   5206  C  CA    . PRO D 4  561  ? -15.639 -41.326 42.988  1.00 87.22  ? 561  PRO A CA    1 
ATOM   5207  C  C     . PRO D 4  561  ? -17.036 -41.671 43.480  1.00 87.01  ? 561  PRO A C     1 
ATOM   5208  O  O     . PRO D 4  561  ? -18.018 -41.001 43.151  1.00 75.88  ? 561  PRO A O     1 
ATOM   5209  C  CB    . PRO D 4  561  ? -14.979 -40.269 43.880  1.00 87.16  ? 561  PRO A CB    1 
ATOM   5210  C  CG    . PRO D 4  561  ? -15.339 -38.973 43.226  1.00 84.89  ? 561  PRO A CG    1 
ATOM   5211  C  CD    . PRO D 4  561  ? -15.298 -39.255 41.750  1.00 89.28  ? 561  PRO A CD    1 
ATOM   5212  N  N     . THR D 4  562  ? -17.110 -42.744 44.260  1.00 97.01  ? 562  THR A N     1 
ATOM   5213  C  CA    . THR D 4  562  ? -18.363 -43.131 44.888  1.00 97.47  ? 562  THR A CA    1 
ATOM   5214  C  C     . THR D 4  562  ? -18.811 -42.025 45.842  1.00 99.91  ? 562  THR A C     1 
ATOM   5215  O  O     . THR D 4  562  ? -17.983 -41.494 46.593  1.00 101.08 ? 562  THR A O     1 
ATOM   5216  C  CB    . THR D 4  562  ? -18.180 -44.452 45.636  1.00 96.88  ? 562  THR A CB    1 
ATOM   5217  O  OG1   . THR D 4  562  ? -17.264 -45.281 44.907  1.00 100.74 ? 562  THR A OG1   1 
ATOM   5218  C  CG2   . THR D 4  562  ? -19.500 -45.185 45.791  1.00 94.20  ? 562  THR A CG2   1 
ATOM   5219  N  N     . PRO D 4  563  ? -20.080 -41.617 45.809  1.00 98.38  ? 563  PRO A N     1 
ATOM   5220  C  CA    . PRO D 4  563  ? -20.527 -40.509 46.661  1.00 102.42 ? 563  PRO A CA    1 
ATOM   5221  C  C     . PRO D 4  563  ? -20.551 -40.891 48.134  1.00 107.92 ? 563  PRO A C     1 
ATOM   5222  O  O     . PRO D 4  563  ? -20.566 -42.067 48.504  1.00 118.31 ? 563  PRO A O     1 
ATOM   5223  C  CB    . PRO D 4  563  ? -21.942 -40.221 46.152  1.00 102.32 ? 563  PRO A CB    1 
ATOM   5224  C  CG    . PRO D 4  563  ? -22.378 -41.506 45.527  1.00 102.71 ? 563  PRO A CG    1 
ATOM   5225  C  CD    . PRO D 4  563  ? -21.143 -42.067 44.896  1.00 98.98  ? 563  PRO A CD    1 
ATOM   5226  N  N     . ALA D 4  564  ? -20.562 -39.860 48.983  1.00 105.32 ? 564  ALA A N     1 
ATOM   5227  C  CA    . ALA D 4  564  ? -20.696 -40.083 50.420  1.00 98.08  ? 564  ALA A CA    1 
ATOM   5228  C  C     . ALA D 4  564  ? -22.099 -40.568 50.765  1.00 96.61  ? 564  ALA A C     1 
ATOM   5229  O  O     . ALA D 4  564  ? -22.277 -41.687 51.254  1.00 106.58 ? 564  ALA A O     1 
ATOM   5230  C  CB    . ALA D 4  564  ? -20.361 -38.805 51.192  1.00 100.44 ? 564  ALA A CB    1 
ATOM   5231  N  N     . ILE D 4  565  ? -23.111 -39.743 50.494  1.00 96.87  ? 565  ILE A N     1 
ATOM   5232  C  CA    . ILE D 4  565  ? -24.510 -40.079 50.739  1.00 107.58 ? 565  ILE A CA    1 
ATOM   5233  C  C     . ILE D 4  565  ? -25.087 -40.651 49.450  1.00 110.66 ? 565  ILE A C     1 
ATOM   5234  O  O     . ILE D 4  565  ? -24.808 -40.138 48.359  1.00 109.34 ? 565  ILE A O     1 
ATOM   5235  C  CB    . ILE D 4  565  ? -25.293 -38.838 51.211  1.00 117.86 ? 565  ILE A CB    1 
ATOM   5236  C  CG1   . ILE D 4  565  ? -24.745 -38.359 52.559  1.00 118.60 ? 565  ILE A CG1   1 
ATOM   5237  C  CG2   . ILE D 4  565  ? -26.769 -39.153 51.350  1.00 131.25 ? 565  ILE A CG2   1 
ATOM   5238  C  CD1   . ILE D 4  565  ? -25.510 -37.204 53.187  1.00 129.54 ? 565  ILE A CD1   1 
ATOM   5239  N  N     . ILE D 4  566  ? -25.880 -41.726 49.567  1.00 108.57 ? 566  ILE A N     1 
ATOM   5240  C  CA    . ILE D 4  566  ? -26.360 -42.486 48.418  1.00 106.00 ? 566  ILE A CA    1 
ATOM   5241  C  C     . ILE D 4  566  ? -27.887 -42.503 48.341  1.00 112.14 ? 566  ILE A C     1 
ATOM   5242  O  O     . ILE D 4  566  ? -28.468 -42.131 47.314  1.00 123.41 ? 566  ILE A O     1 
ATOM   5243  C  CB    . ILE D 4  566  ? -25.790 -43.924 48.420  1.00 98.23  ? 566  ILE A CB    1 
ATOM   5244  C  CG1   . ILE D 4  566  ? -24.269 -43.886 48.197  1.00 88.75  ? 566  ILE A CG1   1 
ATOM   5245  C  CG2   . ILE D 4  566  ? -26.478 -44.787 47.359  1.00 97.14  ? 566  ILE A CG2   1 
ATOM   5246  C  CD1   . ILE D 4  566  ? -23.603 -45.251 48.107  1.00 91.96  ? 566  ILE A CD1   1 
ATOM   5247  N  N     . LYS D 4  567  ? -28.564 -42.906 49.439  1.00 116.08 ? 567  LYS A N     1 
ATOM   5248  C  CA    . LYS D 4  567  ? -29.971 -43.300 49.322  1.00 129.74 ? 567  LYS A CA    1 
ATOM   5249  C  C     . LYS D 4  567  ? -30.921 -42.134 49.048  1.00 139.66 ? 567  LYS A C     1 
ATOM   5250  O  O     . LYS D 4  567  ? -31.543 -42.118 47.971  1.00 165.17 ? 567  LYS A O     1 
ATOM   5251  C  CB    . LYS D 4  567  ? -30.392 -44.126 50.546  1.00 138.25 ? 567  LYS A CB    1 
ATOM   5252  C  CG    . LYS D 4  567  ? -31.908 -44.246 50.778  1.00 147.57 ? 567  LYS A CG    1 
ATOM   5253  C  CD    . LYS D 4  567  ? -32.625 -45.027 49.676  1.00 152.36 ? 567  LYS A CD    1 
ATOM   5254  C  CE    . LYS D 4  567  ? -32.300 -46.500 49.739  1.00 155.16 ? 567  LYS A CE    1 
ATOM   5255  N  NZ    . LYS D 4  567  ? -33.001 -47.250 48.661  1.00 153.76 ? 567  LYS A NZ    1 
ATOM   5256  N  N     . PRO D 4  568  ? -31.104 -41.149 49.947  1.00 114.28 ? 568  PRO A N     1 
ATOM   5257  C  CA    . PRO D 4  568  ? -32.231 -40.218 49.737  1.00 103.43 ? 568  PRO A CA    1 
ATOM   5258  C  C     . PRO D 4  568  ? -31.992 -39.242 48.599  1.00 102.44 ? 568  PRO A C     1 
ATOM   5259  O  O     . PRO D 4  568  ? -32.942 -38.881 47.893  1.00 114.15 ? 568  PRO A O     1 
ATOM   5260  C  CB    . PRO D 4  568  ? -32.357 -39.494 51.088  1.00 104.77 ? 568  PRO A CB    1 
ATOM   5261  C  CG    . PRO D 4  568  ? -31.346 -40.166 52.013  1.00 105.81 ? 568  PRO A CG    1 
ATOM   5262  C  CD    . PRO D 4  568  ? -30.301 -40.705 51.102  1.00 108.83 ? 568  PRO A CD    1 
ATOM   5263  N  N     . LYS D 4  569  ? -30.753 -38.804 48.416  1.00 104.03 ? 569  LYS A N     1 
ATOM   5264  C  CA    . LYS D 4  569  ? -30.292 -38.015 47.284  1.00 104.77 ? 569  LYS A CA    1 
ATOM   5265  C  C     . LYS D 4  569  ? -28.786 -38.229 47.176  1.00 107.09 ? 569  LYS A C     1 
ATOM   5266  O  O     . LYS D 4  569  ? -28.061 -37.934 48.137  1.00 123.54 ? 569  LYS A O     1 
ATOM   5267  C  CB    . LYS D 4  569  ? -30.631 -36.533 47.473  1.00 117.70 ? 569  LYS A CB    1 
ATOM   5268  C  CG    . LYS D 4  569  ? -30.329 -35.659 46.267  1.00 132.98 ? 569  LYS A CG    1 
ATOM   5269  C  CD    . LYS D 4  569  ? -30.671 -34.200 46.547  1.00 130.90 ? 569  LYS A CD    1 
ATOM   5270  C  CE    . LYS D 4  569  ? -30.536 -33.341 45.297  1.00 127.35 ? 569  LYS A CE    1 
ATOM   5271  N  NZ    . LYS D 4  569  ? -31.550 -33.680 44.260  1.00 128.70 ? 569  LYS A NZ    1 
ATOM   5272  N  N     . PRO D 4  570  ? -28.276 -38.771 46.052  1.00 99.69  ? 570  PRO A N     1 
ATOM   5273  C  CA    . PRO D 4  570  ? -26.828 -39.013 45.940  1.00 104.26 ? 570  PRO A CA    1 
ATOM   5274  C  C     . PRO D 4  570  ? -26.010 -37.730 45.981  1.00 105.12 ? 570  PRO A C     1 
ATOM   5275  O  O     . PRO D 4  570  ? -26.039 -36.918 45.046  1.00 98.51  ? 570  PRO A O     1 
ATOM   5276  C  CB    . PRO D 4  570  ? -26.690 -39.739 44.592  1.00 105.23 ? 570  PRO A CB    1 
ATOM   5277  C  CG    . PRO D 4  570  ? -27.938 -39.418 43.844  1.00 119.06 ? 570  PRO A CG    1 
ATOM   5278  C  CD    . PRO D 4  570  ? -29.013 -39.274 44.880  1.00 117.30 ? 570  PRO A CD    1 
ATOM   5279  N  N     . LEU D 4  571  ? -25.271 -37.553 47.076  1.00 103.09 ? 571  LEU A N     1 
ATOM   5280  C  CA    . LEU D 4  571  ? -24.568 -36.317 47.379  1.00 87.11  ? 571  LEU A CA    1 
ATOM   5281  C  C     . LEU D 4  571  ? -23.107 -36.608 47.688  1.00 85.46  ? 571  LEU A C     1 
ATOM   5282  O  O     . LEU D 4  571  ? -22.752 -37.696 48.157  1.00 99.21  ? 571  LEU A O     1 
ATOM   5283  C  CB    . LEU D 4  571  ? -25.226 -35.598 48.566  1.00 85.07  ? 571  LEU A CB    1 
ATOM   5284  C  CG    . LEU D 4  571  ? -25.987 -34.305 48.273  1.00 89.11  ? 571  LEU A CG    1 
ATOM   5285  C  CD1   . LEU D 4  571  ? -26.986 -34.505 47.173  1.00 104.13 ? 571  LEU A CD1   1 
ATOM   5286  C  CD2   . LEU D 4  571  ? -26.709 -33.863 49.532  1.00 95.65  ? 571  LEU A CD2   1 
ATOM   5287  N  N     . TRP D 4  572  ? -22.262 -35.620 47.409  1.00 84.28  ? 572  TRP A N     1 
ATOM   5288  C  CA    . TRP D 4  572  ? -20.833 -35.685 47.672  1.00 94.91  ? 572  TRP A CA    1 
ATOM   5289  C  C     . TRP D 4  572  ? -20.479 -34.651 48.731  1.00 105.13 ? 572  TRP A C     1 
ATOM   5290  O  O     . TRP D 4  572  ? -21.190 -33.658 48.911  1.00 115.07 ? 572  TRP A O     1 
ATOM   5291  C  CB    . TRP D 4  572  ? -20.008 -35.413 46.401  1.00 98.39  ? 572  TRP A CB    1 
ATOM   5292  C  CG    . TRP D 4  572  ? -19.978 -36.551 45.420  1.00 96.08  ? 572  TRP A CG    1 
ATOM   5293  C  CD1   . TRP D 4  572  ? -18.907 -37.342 45.126  1.00 103.26 ? 572  TRP A CD1   1 
ATOM   5294  C  CD2   . TRP D 4  572  ? -21.045 -36.990 44.569  1.00 97.04  ? 572  TRP A CD2   1 
ATOM   5295  N  NE1   . TRP D 4  572  ? -19.249 -38.268 44.171  1.00 106.78 ? 572  TRP A NE1   1 
ATOM   5296  C  CE2   . TRP D 4  572  ? -20.554 -38.068 43.807  1.00 107.64 ? 572  TRP A CE2   1 
ATOM   5297  C  CE3   . TRP D 4  572  ? -22.369 -36.582 44.382  1.00 94.50  ? 572  TRP A CE3   1 
ATOM   5298  C  CZ2   . TRP D 4  572  ? -21.341 -38.746 42.882  1.00 115.68 ? 572  TRP A CZ2   1 
ATOM   5299  C  CZ3   . TRP D 4  572  ? -23.148 -37.257 43.463  1.00 99.95  ? 572  TRP A CZ3   1 
ATOM   5300  C  CH2   . TRP D 4  572  ? -22.632 -38.325 42.724  1.00 111.04 ? 572  TRP A CH2   1 
ATOM   5301  N  N     . SER D 4  573  ? -19.378 -34.884 49.433  1.00 97.37  ? 573  SER A N     1 
ATOM   5302  C  CA    . SER D 4  573  ? -18.821 -33.886 50.333  1.00 91.67  ? 573  SER A CA    1 
ATOM   5303  C  C     . SER D 4  573  ? -17.709 -33.115 49.632  1.00 96.79  ? 573  SER A C     1 
ATOM   5304  O  O     . SER D 4  573  ? -17.087 -33.603 48.685  1.00 96.61  ? 573  SER A O     1 
ATOM   5305  C  CB    . SER D 4  573  ? -18.282 -34.538 51.606  1.00 85.34  ? 573  SER A CB    1 
ATOM   5306  O  OG    . SER D 4  573  ? -16.921 -34.904 51.453  1.00 88.37  ? 573  SER A OG    1 
ATOM   5307  N  N     . GLY D 4  574  ? -17.467 -31.891 50.113  1.00 86.18  ? 574  GLY A N     1 
ATOM   5308  C  CA    . GLY D 4  574  ? -16.361 -31.112 49.587  1.00 83.14  ? 574  GLY A CA    1 
ATOM   5309  C  C     . GLY D 4  574  ? -15.019 -31.743 49.885  1.00 94.56  ? 574  GLY A C     1 
ATOM   5310  O  O     . GLY D 4  574  ? -14.080 -31.624 49.090  1.00 96.67  ? 574  GLY A O     1 
ATOM   5311  N  N     . LYS D 4  575  ? -14.913 -32.423 51.032  1.00 101.22 ? 575  LYS A N     1 
ATOM   5312  C  CA    . LYS D 4  575  ? -13.755 -33.266 51.312  1.00 108.77 ? 575  LYS A CA    1 
ATOM   5313  C  C     . LYS D 4  575  ? -13.584 -34.348 50.252  1.00 105.76 ? 575  LYS A C     1 
ATOM   5314  O  O     . LYS D 4  575  ? -12.457 -34.672 49.857  1.00 105.12 ? 575  LYS A O     1 
ATOM   5315  C  CB    . LYS D 4  575  ? -13.902 -33.898 52.696  1.00 101.32 ? 575  LYS A CB    1 
ATOM   5316  C  CG    . LYS D 4  575  ? -14.654 -33.039 53.693  1.00 93.81  ? 575  LYS A CG    1 
ATOM   5317  C  CD    . LYS D 4  575  ? -14.228 -33.365 55.116  1.00 99.23  ? 575  LYS A CD    1 
ATOM   5318  C  CE    . LYS D 4  575  ? -15.174 -32.741 56.129  1.00 96.72  ? 575  LYS A CE    1 
ATOM   5319  N  NZ    . LYS D 4  575  ? -14.603 -31.515 56.751  1.00 78.29  ? 575  LYS A NZ    1 
ATOM   5320  N  N     . GLN D 4  576  ? -14.693 -34.913 49.774  1.00 96.84  ? 576  GLN A N     1 
ATOM   5321  C  CA    . GLN D 4  576  ? -14.609 -35.991 48.799  1.00 99.03  ? 576  GLN A CA    1 
ATOM   5322  C  C     . GLN D 4  576  ? -14.181 -35.473 47.434  1.00 104.44 ? 576  GLN A C     1 
ATOM   5323  O  O     . GLN D 4  576  ? -13.490 -36.181 46.691  1.00 114.08 ? 576  GLN A O     1 
ATOM   5324  C  CB    . GLN D 4  576  ? -15.958 -36.702 48.695  1.00 91.91  ? 576  GLN A CB    1 
ATOM   5325  C  CG    . GLN D 4  576  ? -15.881 -38.150 48.254  1.00 80.79  ? 576  GLN A CG    1 
ATOM   5326  C  CD    . GLN D 4  576  ? -17.195 -38.869 48.462  1.00 95.52  ? 576  GLN A CD    1 
ATOM   5327  O  OE1   . GLN D 4  576  ? -18.223 -38.241 48.720  1.00 98.33  ? 576  GLN A OE1   1 
ATOM   5328  N  NE2   . GLN D 4  576  ? -17.166 -40.191 48.388  1.00 113.11 ? 576  GLN A NE2   1 
ATOM   5329  N  N     . ILE D 4  577  ? -14.576 -34.246 47.091  1.00 100.13 ? 577  ILE A N     1 
ATOM   5330  C  CA    . ILE D 4  577  ? -14.283 -33.704 45.768  1.00 89.63  ? 577  ILE A CA    1 
ATOM   5331  C  C     . ILE D 4  577  ? -12.879 -33.119 45.720  1.00 88.26  ? 577  ILE A C     1 
ATOM   5332  O  O     . ILE D 4  577  ? -12.166 -33.273 44.720  1.00 71.32  ? 577  ILE A O     1 
ATOM   5333  C  CB    . ILE D 4  577  ? -15.350 -32.665 45.376  1.00 75.34  ? 577  ILE A CB    1 
ATOM   5334  C  CG1   . ILE D 4  577  ? -16.740 -33.299 45.430  1.00 86.77  ? 577  ILE A CG1   1 
ATOM   5335  C  CG2   . ILE D 4  577  ? -15.079 -32.104 43.997  1.00 74.27  ? 577  ILE A CG2   1 
ATOM   5336  C  CD1   . ILE D 4  577  ? -16.893 -34.500 44.517  1.00 87.82  ? 577  ILE A CD1   1 
ATOM   5337  N  N     . LEU D 4  578  ? -12.457 -32.448 46.796  1.00 94.68  ? 578  LEU A N     1 
ATOM   5338  C  CA    . LEU D 4  578  ? -11.139 -31.823 46.818  1.00 88.93  ? 578  LEU A CA    1 
ATOM   5339  C  C     . LEU D 4  578  ? -10.019 -32.859 46.734  1.00 80.88  ? 578  LEU A C     1 
ATOM   5340  O  O     . LEU D 4  578  ? -8.972  -32.594 46.128  1.00 59.47  ? 578  LEU A O     1 
ATOM   5341  C  CB    . LEU D 4  578  ? -11.008 -30.970 48.085  1.00 76.35  ? 578  LEU A CB    1 
ATOM   5342  C  CG    . LEU D 4  578  ? -9.661  -30.380 48.517  1.00 79.38  ? 578  LEU A CG    1 
ATOM   5343  C  CD1   . LEU D 4  578  ? -9.062  -29.486 47.441  1.00 57.39  ? 578  LEU A CD1   1 
ATOM   5344  C  CD2   . LEU D 4  578  ? -9.787  -29.643 49.852  1.00 83.07  ? 578  LEU A CD2   1 
ATOM   5345  N  N     . SER D 4  579  ? -10.250 -34.065 47.276  1.00 89.72  ? 579  SER A N     1 
ATOM   5346  C  CA    . SER D 4  579  ? -9.208  -35.087 47.370  1.00 102.50 ? 579  SER A CA    1 
ATOM   5347  C  C     . SER D 4  579  ? -8.734  -35.592 46.008  1.00 107.02 ? 579  SER A C     1 
ATOM   5348  O  O     . SER D 4  579  ? -7.672  -36.220 45.933  1.00 117.28 ? 579  SER A O     1 
ATOM   5349  C  CB    . SER D 4  579  ? -9.713  -36.262 48.215  1.00 113.55 ? 579  SER A CB    1 
ATOM   5350  O  OG    . SER D 4  579  ? -10.540 -35.824 49.280  1.00 121.57 ? 579  SER A OG    1 
ATOM   5351  N  N     . VAL D 4  580  ? -9.489  -35.327 44.935  1.00 91.46  ? 580  VAL A N     1 
ATOM   5352  C  CA    . VAL D 4  580  ? -9.054  -35.692 43.587  1.00 80.80  ? 580  VAL A CA    1 
ATOM   5353  C  C     . VAL D 4  580  ? -7.839  -34.867 43.170  1.00 76.96  ? 580  VAL A C     1 
ATOM   5354  O  O     . VAL D 4  580  ? -7.023  -35.312 42.349  1.00 60.28  ? 580  VAL A O     1 
ATOM   5355  C  CB    . VAL D 4  580  ? -10.217 -35.535 42.584  1.00 61.38  ? 580  VAL A CB    1 
ATOM   5356  C  CG1   . VAL D 4  580  ? -9.918  -36.270 41.272  1.00 65.31  ? 580  VAL A CG1   1 
ATOM   5357  C  CG2   . VAL D 4  580  ? -11.521 -36.040 43.191  1.00 62.52  ? 580  VAL A CG2   1 
ATOM   5358  N  N     . ALA D 4  581  ? -7.695  -33.656 43.714  1.00 86.81  ? 581  ALA A N     1 
ATOM   5359  C  CA    . ALA D 4  581  ? -6.501  -32.868 43.433  1.00 85.66  ? 581  ALA A CA    1 
ATOM   5360  C  C     . ALA D 4  581  ? -5.274  -33.397 44.167  1.00 68.35  ? 581  ALA A C     1 
ATOM   5361  O  O     . ALA D 4  581  ? -4.148  -33.133 43.728  1.00 57.98  ? 581  ALA A O     1 
ATOM   5362  C  CB    . ALA D 4  581  ? -6.733  -31.397 43.793  1.00 56.83  ? 581  ALA A CB    1 
ATOM   5363  N  N     . ILE D 4  582  ? -5.464  -34.135 45.260  1.00 75.21  ? 582  ILE A N     1 
ATOM   5364  C  CA    . ILE D 4  582  ? -4.354  -34.679 46.045  1.00 83.26  ? 582  ILE A CA    1 
ATOM   5365  C  C     . ILE D 4  582  ? -3.918  -36.011 45.443  1.00 92.41  ? 582  ILE A C     1 
ATOM   5366  O  O     . ILE D 4  582  ? -4.756  -36.905 45.253  1.00 98.46  ? 582  ILE A O     1 
ATOM   5367  C  CB    . ILE D 4  582  ? -4.733  -34.842 47.527  1.00 77.92  ? 582  ILE A CB    1 
ATOM   5368  C  CG1   . ILE D 4  582  ? -5.696  -33.738 47.970  1.00 76.35  ? 582  ILE A CG1   1 
ATOM   5369  C  CG2   . ILE D 4  582  ? -3.488  -34.819 48.395  1.00 85.56  ? 582  ILE A CG2   1 
ATOM   5370  C  CD1   . ILE D 4  582  ? -6.068  -33.780 49.446  1.00 61.98  ? 582  ILE A CD1   1 
ATOM   5371  N  N     . PRO D 4  583  ? -2.630  -36.193 45.140  1.00 84.28  ? 583  PRO A N     1 
ATOM   5372  C  CA    . PRO D 4  583  ? -2.193  -37.449 44.524  1.00 103.94 ? 583  PRO A CA    1 
ATOM   5373  C  C     . PRO D 4  583  ? -2.214  -38.574 45.540  1.00 113.61 ? 583  PRO A C     1 
ATOM   5374  O  O     . PRO D 4  583  ? -1.973  -38.366 46.731  1.00 114.95 ? 583  PRO A O     1 
ATOM   5375  C  CB    . PRO D 4  583  ? -0.754  -37.152 44.076  1.00 86.02  ? 583  PRO A CB    1 
ATOM   5376  C  CG    . PRO D 4  583  ? -0.593  -35.677 44.183  1.00 61.42  ? 583  PRO A CG    1 
ATOM   5377  C  CD    . PRO D 4  583  ? -1.512  -35.246 45.280  1.00 63.26  ? 583  PRO A CD    1 
ATOM   5378  N  N     . ASN D 4  584  ? -2.508  -39.776 45.052  1.00 113.36 ? 584  ASN A N     1 
ATOM   5379  C  CA    . ASN D 4  584  ? -2.481  -40.958 45.898  1.00 120.45 ? 584  ASN A CA    1 
ATOM   5380  C  C     . ASN D 4  584  ? -1.066  -41.234 46.400  1.00 124.78 ? 584  ASN A C     1 
ATOM   5381  O  O     . ASN D 4  584  ? -0.089  -41.117 45.656  1.00 128.89 ? 584  ASN A O     1 
ATOM   5382  C  CB    . ASN D 4  584  ? -3.035  -42.154 45.123  1.00 125.57 ? 584  ASN A CB    1 
ATOM   5383  C  CG    . ASN D 4  584  ? -2.712  -42.082 43.640  1.00 128.64 ? 584  ASN A CG    1 
ATOM   5384  O  OD1   . ASN D 4  584  ? -1.550  -41.987 43.243  1.00 131.60 ? 584  ASN A OD1   1 
ATOM   5385  N  ND2   . ASN D 4  584  ? -3.748  -42.112 42.814  1.00 136.45 ? 584  ASN A ND2   1 
ATOM   5386  N  N     . GLY D 4  585  ? -0.961  -41.587 47.677  1.00 117.51 ? 585  GLY A N     1 
ATOM   5387  C  CA    . GLY D 4  585  ? 0.316   -41.711 48.340  1.00 107.80 ? 585  GLY A CA    1 
ATOM   5388  C  C     . GLY D 4  585  ? 0.709   -40.545 49.226  1.00 92.52  ? 585  GLY A C     1 
ATOM   5389  O  O     . GLY D 4  585  ? 1.897   -40.404 49.537  1.00 82.78  ? 585  GLY A O     1 
ATOM   5390  N  N     . ILE D 4  586  ? -0.247  -39.711 49.638  1.00 92.77  ? 586  ILE A N     1 
ATOM   5391  C  CA    . ILE D 4  586  ? -0.008  -38.592 50.549  1.00 97.01  ? 586  ILE A CA    1 
ATOM   5392  C  C     . ILE D 4  586  ? -0.631  -38.922 51.897  1.00 94.49  ? 586  ILE A C     1 
ATOM   5393  O  O     . ILE D 4  586  ? -1.788  -39.359 51.968  1.00 102.12 ? 586  ILE A O     1 
ATOM   5394  C  CB    . ILE D 4  586  ? -0.544  -37.257 49.979  1.00 89.42  ? 586  ILE A CB    1 
ATOM   5395  C  CG1   . ILE D 4  586  ? 0.549   -36.482 49.224  1.00 63.58  ? 586  ILE A CG1   1 
ATOM   5396  C  CG2   . ILE D 4  586  ? -1.149  -36.347 51.062  1.00 93.06  ? 586  ILE A CG2   1 
ATOM   5397  C  CD1   . ILE D 4  586  ? 1.264   -37.219 48.132  1.00 63.84  ? 586  ILE A CD1   1 
ATOM   5398  N  N     . HIS D 4  587  ? 0.146   -38.730 52.962  1.00 72.01  ? 587  HIS A N     1 
ATOM   5399  C  CA    . HIS D 4  587  ? -0.303  -38.983 54.326  1.00 89.38  ? 587  HIS A CA    1 
ATOM   5400  C  C     . HIS D 4  587  ? 0.014   -37.749 55.160  1.00 94.56  ? 587  HIS A C     1 
ATOM   5401  O  O     . HIS D 4  587  ? 1.178   -37.342 55.257  1.00 96.24  ? 587  HIS A O     1 
ATOM   5402  C  CB    . HIS D 4  587  ? 0.366   -40.237 54.899  1.00 102.01 ? 587  HIS A CB    1 
ATOM   5403  C  CG    . HIS D 4  587  ? 0.344   -41.414 53.968  1.00 110.22 ? 587  HIS A CG    1 
ATOM   5404  N  ND1   . HIS D 4  587  ? 1.375   -41.696 53.096  1.00 114.72 ? 587  HIS A ND1   1 
ATOM   5405  C  CD2   . HIS D 4  587  ? -0.590  -42.375 53.766  1.00 112.09 ? 587  HIS A CD2   1 
ATOM   5406  C  CE1   . HIS D 4  587  ? 1.079   -42.781 52.402  1.00 113.14 ? 587  HIS A CE1   1 
ATOM   5407  N  NE2   . HIS D 4  587  ? -0.109  -43.210 52.788  1.00 114.48 ? 587  HIS A NE2   1 
ATOM   5408  N  N     . LEU D 4  588  ? -1.020  -37.152 55.749  1.00 92.66  ? 588  LEU A N     1 
ATOM   5409  C  CA    . LEU D 4  588  ? -0.880  -35.946 56.548  1.00 87.84  ? 588  LEU A CA    1 
ATOM   5410  C  C     . LEU D 4  588  ? -1.615  -36.132 57.868  1.00 85.25  ? 588  LEU A C     1 
ATOM   5411  O  O     . LEU D 4  588  ? -2.812  -36.441 57.880  1.00 79.64  ? 588  LEU A O     1 
ATOM   5412  C  CB    . LEU D 4  588  ? -1.425  -34.725 55.797  1.00 85.70  ? 588  LEU A CB    1 
ATOM   5413  C  CG    . LEU D 4  588  ? -0.976  -33.383 56.367  1.00 93.67  ? 588  LEU A CG    1 
ATOM   5414  C  CD1   . LEU D 4  588  ? 0.331   -32.951 55.734  1.00 96.56  ? 588  LEU A CD1   1 
ATOM   5415  C  CD2   . LEU D 4  588  ? -2.041  -32.328 56.154  1.00 99.21  ? 588  LEU A CD2   1 
ATOM   5416  N  N     . GLN D 4  589  ? -0.899  -35.949 58.973  1.00 83.73  ? 589  GLN A N     1 
ATOM   5417  C  CA    . GLN D 4  589  ? -1.469  -36.057 60.308  1.00 98.48  ? 589  GLN A CA    1 
ATOM   5418  C  C     . GLN D 4  589  ? -1.298  -34.717 61.015  1.00 99.67  ? 589  GLN A C     1 
ATOM   5419  O  O     . GLN D 4  589  ? -0.223  -34.106 60.943  1.00 84.73  ? 589  GLN A O     1 
ATOM   5420  C  CB    . GLN D 4  589  ? -0.797  -37.183 61.104  1.00 114.33 ? 589  GLN A CB    1 
ATOM   5421  C  CG    . GLN D 4  589  ? -1.434  -37.470 62.453  1.00 131.35 ? 589  GLN A CG    1 
ATOM   5422  C  CD    . GLN D 4  589  ? -0.762  -38.619 63.178  1.00 148.77 ? 589  GLN A CD    1 
ATOM   5423  O  OE1   . GLN D 4  589  ? 0.439   -38.580 63.447  1.00 150.25 ? 589  GLN A OE1   1 
ATOM   5424  N  NE2   . GLN D 4  589  ? -1.535  -39.657 63.487  1.00 155.38 ? 589  GLN A NE2   1 
ATOM   5425  N  N     . ARG D 4  590  ? -2.358  -34.251 61.678  1.00 101.47 ? 590  ARG A N     1 
ATOM   5426  C  CA    . ARG D 4  590  ? -2.284  -33.003 62.425  1.00 99.52  ? 590  ARG A CA    1 
ATOM   5427  C  C     . ARG D 4  590  ? -3.365  -32.987 63.494  1.00 105.30 ? 590  ARG A C     1 
ATOM   5428  O  O     . ARG D 4  590  ? -4.543  -33.207 63.191  1.00 111.19 ? 590  ARG A O     1 
ATOM   5429  C  CB    . ARG D 4  590  ? -2.452  -31.794 61.499  1.00 114.97 ? 590  ARG A CB    1 
ATOM   5430  C  CG    . ARG D 4  590  ? -1.217  -30.916 61.365  1.00 128.12 ? 590  ARG A CG    1 
ATOM   5431  C  CD    . ARG D 4  590  ? -1.602  -29.600 60.726  1.00 127.43 ? 590  ARG A CD    1 
ATOM   5432  N  NE    . ARG D 4  590  ? -2.459  -28.860 61.644  1.00 122.62 ? 590  ARG A NE    1 
ATOM   5433  C  CZ    . ARG D 4  590  ? -3.758  -28.669 61.454  1.00 108.30 ? 590  ARG A CZ    1 
ATOM   5434  N  NH1   . ARG D 4  590  ? -4.459  -27.994 62.352  1.00 114.74 ? 590  ARG A NH1   1 
ATOM   5435  N  NH2   . ARG D 4  590  ? -4.363  -29.160 60.377  1.00 91.33  ? 590  ARG A NH2   1 
ATOM   5436  N  N     . PHE D 4  591  ? -2.961  -32.709 64.732  1.00 107.75 ? 591  PHE A N     1 
ATOM   5437  C  CA    . PHE D 4  591  ? -3.879  -32.523 65.844  1.00 106.22 ? 591  PHE A CA    1 
ATOM   5438  C  C     . PHE D 4  591  ? -3.686  -31.131 66.434  1.00 107.86 ? 591  PHE A C     1 
ATOM   5439  O  O     . PHE D 4  591  ? -2.569  -30.598 66.472  1.00 111.57 ? 591  PHE A O     1 
ATOM   5440  C  CB    . PHE D 4  591  ? -3.675  -33.592 66.942  1.00 123.44 ? 591  PHE A CB    1 
ATOM   5441  C  CG    . PHE D 4  591  ? -3.938  -35.006 66.483  1.00 118.20 ? 591  PHE A CG    1 
ATOM   5442  C  CD1   . PHE D 4  591  ? -2.916  -35.787 65.964  1.00 119.36 ? 591  PHE A CD1   1 
ATOM   5443  C  CD2   . PHE D 4  591  ? -5.212  -35.552 66.568  1.00 107.47 ? 591  PHE A CD2   1 
ATOM   5444  C  CE1   . PHE D 4  591  ? -3.163  -37.087 65.542  1.00 123.22 ? 591  PHE A CE1   1 
ATOM   5445  C  CE2   . PHE D 4  591  ? -5.466  -36.848 66.145  1.00 100.28 ? 591  PHE A CE2   1 
ATOM   5446  C  CZ    . PHE D 4  591  ? -4.440  -37.614 65.631  1.00 114.39 ? 591  PHE A CZ    1 
ATOM   5447  N  N     . ASP D 4  592  ? -4.789  -30.548 66.890  1.00 111.24 ? 592  ASP A N     1 
ATOM   5448  C  CA    . ASP D 4  592  ? -4.800  -29.236 67.533  1.00 130.91 ? 592  ASP A CA    1 
ATOM   5449  C  C     . ASP D 4  592  ? -5.802  -29.304 68.687  1.00 134.35 ? 592  ASP A C     1 
ATOM   5450  O  O     . ASP D 4  592  ? -6.166  -30.400 69.129  1.00 146.52 ? 592  ASP A O     1 
ATOM   5451  C  CB    . ASP D 4  592  ? -5.057  -28.122 66.502  1.00 141.79 ? 592  ASP A CB    1 
ATOM   5452  C  CG    . ASP D 4  592  ? -6.132  -28.485 65.507  1.00 134.25 ? 592  ASP A CG    1 
ATOM   5453  O  OD1   . ASP D 4  592  ? -5.912  -28.295 64.292  1.00 116.71 ? 592  ASP A OD1   1 
ATOM   5454  O  OD2   . ASP D 4  592  ? -7.190  -28.973 65.935  1.00 133.19 ? 592  ASP A OD2   1 
ATOM   5455  N  N     . GLU D 4  593  ? -6.249  -28.123 69.147  1.00 134.32 ? 593  GLU A N     1 
ATOM   5456  C  CA    . GLU D 4  593  ? -6.811  -27.858 70.476  1.00 142.34 ? 593  GLU A CA    1 
ATOM   5457  C  C     . GLU D 4  593  ? -7.748  -28.937 71.021  1.00 146.55 ? 593  GLU A C     1 
ATOM   5458  O  O     . GLU D 4  593  ? -7.480  -29.535 72.070  1.00 166.30 ? 593  GLU A O     1 
ATOM   5459  C  CB    . GLU D 4  593  ? -7.554  -26.515 70.426  1.00 153.60 ? 593  GLU A CB    1 
ATOM   5460  C  CG    . GLU D 4  593  ? -6.697  -25.323 69.991  1.00 164.47 ? 593  GLU A CG    1 
ATOM   5461  C  CD    . GLU D 4  593  ? -7.179  -24.695 68.680  1.00 156.14 ? 593  GLU A CD    1 
ATOM   5462  O  OE1   . GLU D 4  593  ? -8.400  -24.725 68.410  1.00 152.03 ? 593  GLU A OE1   1 
ATOM   5463  O  OE2   . GLU D 4  593  ? -6.336  -24.185 67.909  1.00 146.02 ? 593  GLU A OE2   1 
ATOM   5464  N  N     . GLY D 4  594  ? -8.847  -29.205 70.324  1.00 131.50 ? 594  GLY A N     1 
ATOM   5465  C  CA    . GLY D 4  594  ? -9.658  -30.359 70.662  1.00 136.28 ? 594  GLY A CA    1 
ATOM   5466  C  C     . GLY D 4  594  ? -9.707  -31.348 69.517  1.00 143.51 ? 594  GLY A C     1 
ATOM   5467  O  O     . GLY D 4  594  ? -10.380 -31.099 68.514  1.00 156.00 ? 594  GLY A O     1 
ATOM   5468  N  N     . THR D 4  595  ? -9.020  -32.485 69.649  1.00 131.85 ? 595  THR A N     1 
ATOM   5469  C  CA    . THR D 4  595  ? -8.878  -33.431 68.534  1.00 124.67 ? 595  THR A CA    1 
ATOM   5470  C  C     . THR D 4  595  ? -8.977  -34.871 69.036  1.00 113.08 ? 595  THR A C     1 
ATOM   5471  O  O     . THR D 4  595  ? -7.963  -35.507 69.329  1.00 101.53 ? 595  THR A O     1 
ATOM   5472  C  CB    . THR D 4  595  ? -7.573  -33.204 67.779  1.00 108.23 ? 595  THR A CB    1 
ATOM   5473  O  OG1   . THR D 4  595  ? -6.534  -32.840 68.702  1.00 133.13 ? 595  THR A OG1   1 
ATOM   5474  C  CG2   . THR D 4  595  ? -7.720  -32.152 66.692  1.00 75.53  ? 595  THR A CG2   1 
ATOM   5475  N  N     . THR D 4  596  ? -10.201 -35.384 69.097  1.00 109.32 ? 596  THR A N     1 
ATOM   5476  C  CA    . THR D 4  596  ? -10.411 -36.820 69.155  1.00 95.34  ? 596  THR A CA    1 
ATOM   5477  C  C     . THR D 4  596  ? -10.255 -37.385 67.740  1.00 97.85  ? 596  THR A C     1 
ATOM   5478  O  O     . THR D 4  596  ? -10.120 -36.643 66.764  1.00 105.80 ? 596  THR A O     1 
ATOM   5479  C  CB    . THR D 4  596  ? -11.801 -37.124 69.738  1.00 100.08 ? 596  THR A CB    1 
ATOM   5480  O  OG1   . THR D 4  596  ? -12.088 -36.185 70.782  1.00 93.60  ? 596  THR A OG1   1 
ATOM   5481  C  CG2   . THR D 4  596  ? -11.863 -38.525 70.354  1.00 122.52 ? 596  THR A CG2   1 
ATOM   5482  N  N     . LEU D 4  597  ? -10.244 -38.711 67.623  1.00 116.89 ? 597  LEU A N     1 
ATOM   5483  C  CA    . LEU D 4  597  ? -10.357 -39.311 66.301  1.00 121.24 ? 597  LEU A CA    1 
ATOM   5484  C  C     . LEU D 4  597  ? -11.778 -39.204 65.755  1.00 123.01 ? 597  LEU A C     1 
ATOM   5485  O  O     . LEU D 4  597  ? -11.980 -39.368 64.544  1.00 118.21 ? 597  LEU A O     1 
ATOM   5486  C  CB    . LEU D 4  597  ? -9.878  -40.766 66.340  1.00 129.78 ? 597  LEU A CB    1 
ATOM   5487  C  CG    . LEU D 4  597  ? -8.370  -40.891 66.599  1.00 120.07 ? 597  LEU A CG    1 
ATOM   5488  C  CD1   . LEU D 4  597  ? -7.919  -42.348 66.688  1.00 111.78 ? 597  LEU A CD1   1 
ATOM   5489  C  CD2   . LEU D 4  597  ? -7.570  -40.128 65.535  1.00 107.51 ? 597  LEU A CD2   1 
ATOM   5490  N  N     . LEU D 4  598  ? -12.757 -38.923 66.619  1.00 129.02 ? 598  LEU A N     1 
ATOM   5491  C  CA    . LEU D 4  598  ? -14.093 -38.516 66.188  1.00 131.85 ? 598  LEU A CA    1 
ATOM   5492  C  C     . LEU D 4  598  ? -14.205 -37.022 65.925  1.00 140.80 ? 598  LEU A C     1 
ATOM   5493  O  O     . LEU D 4  598  ? -15.177 -36.597 65.290  1.00 145.77 ? 598  LEU A O     1 
ATOM   5494  C  CB    . LEU D 4  598  ? -15.145 -38.933 67.226  1.00 120.28 ? 598  LEU A CB    1 
ATOM   5495  C  CG    . LEU D 4  598  ? -15.949 -40.204 66.930  1.00 110.16 ? 598  LEU A CG    1 
ATOM   5496  C  CD1   . LEU D 4  598  ? -17.031 -39.914 65.909  1.00 106.24 ? 598  LEU A CD1   1 
ATOM   5497  C  CD2   . LEU D 4  598  ? -15.049 -41.293 66.403  1.00 113.31 ? 598  LEU A CD2   1 
ATOM   5498  N  N     . SER D 4  599  ? -13.248 -36.226 66.435  1.00 131.27 ? 599  SER A N     1 
ATOM   5499  C  CA    . SER D 4  599  ? -12.967 -34.815 66.153  1.00 110.86 ? 599  SER A CA    1 
ATOM   5500  C  C     . SER D 4  599  ? -14.203 -33.950 65.917  1.00 112.75 ? 599  SER A C     1 
ATOM   5501  O  O     . SER D 4  599  ? -14.437 -33.513 64.781  1.00 115.15 ? 599  SER A O     1 
ATOM   5502  C  CB    . SER D 4  599  ? -12.044 -34.715 64.940  1.00 92.68  ? 599  SER A CB    1 
ATOM   5503  O  OG    . SER D 4  599  ? -12.014 -33.398 64.414  1.00 98.21  ? 599  SER A OG    1 
ATOM   5504  N  N     . PRO D 4  600  ? -15.036 -33.714 66.932  1.00 116.57 ? 600  PRO A N     1 
ATOM   5505  C  CA    . PRO D 4  600  ? -16.156 -32.785 66.750  1.00 127.57 ? 600  PRO A CA    1 
ATOM   5506  C  C     . PRO D 4  600  ? -15.635 -31.376 66.520  1.00 141.52 ? 600  PRO A C     1 
ATOM   5507  O  O     . PRO D 4  600  ? -14.544 -31.022 66.972  1.00 142.64 ? 600  PRO A O     1 
ATOM   5508  C  CB    . PRO D 4  600  ? -16.927 -32.899 68.068  1.00 129.82 ? 600  PRO A CB    1 
ATOM   5509  C  CG    . PRO D 4  600  ? -15.875 -33.276 69.069  1.00 117.56 ? 600  PRO A CG    1 
ATOM   5510  C  CD    . PRO D 4  600  ? -14.936 -34.186 68.328  1.00 114.11 ? 600  PRO A CD    1 
ATOM   5511  N  N     . LYS D 4  601  ? -16.424 -30.589 65.779  1.00 155.32 ? 601  LYS A N     1 
ATOM   5512  C  CA    . LYS D 4  601  ? -16.068 -29.294 65.190  1.00 167.13 ? 601  LYS A CA    1 
ATOM   5513  C  C     . LYS D 4  601  ? -14.975 -29.407 64.124  1.00 155.56 ? 601  LYS A C     1 
ATOM   5514  O  O     . LYS D 4  601  ? -14.418 -28.378 63.710  1.00 158.62 ? 601  LYS A O     1 
ATOM   5515  C  CB    . LYS D 4  601  ? -15.661 -28.250 66.249  1.00 167.48 ? 601  LYS A CB    1 
ATOM   5516  C  CG    . LYS D 4  601  ? -16.642 -28.090 67.403  1.00 158.24 ? 601  LYS A CG    1 
ATOM   5517  C  CD    . LYS D 4  601  ? -15.910 -27.824 68.714  1.00 151.51 ? 601  LYS A CD    1 
ATOM   5518  C  CE    . LYS D 4  601  ? -15.043 -26.575 68.627  1.00 140.54 ? 601  LYS A CE    1 
ATOM   5519  N  NZ    . LYS D 4  601  ? -15.844 -25.320 68.587  1.00 129.79 ? 601  LYS A NZ    1 
ATOM   5520  N  N     . ASP D 4  602  ? -14.659 -30.634 63.680  1.00 124.83 ? 602  ASP A N     1 
ATOM   5521  C  CA    . ASP D 4  602  ? -13.801 -30.909 62.519  1.00 103.31 ? 602  ASP A CA    1 
ATOM   5522  C  C     . ASP D 4  602  ? -12.398 -30.319 62.674  1.00 100.28 ? 602  ASP A C     1 
ATOM   5523  O  O     . ASP D 4  602  ? -11.800 -29.832 61.710  1.00 96.67  ? 602  ASP A O     1 
ATOM   5524  C  CB    . ASP D 4  602  ? -14.456 -30.413 61.228  1.00 100.40 ? 602  ASP A CB    1 
ATOM   5525  C  CG    . ASP D 4  602  ? -14.492 -31.466 60.134  1.00 98.72  ? 602  ASP A CG    1 
ATOM   5526  O  OD1   . ASP D 4  602  ? -14.197 -32.652 60.405  1.00 104.19 ? 602  ASP A OD1   1 
ATOM   5527  O  OD2   . ASP D 4  602  ? -14.820 -31.097 58.991  1.00 81.41  ? 602  ASP A OD2   1 
ATOM   5528  N  N     . ASN D 4  603  ? -11.862 -30.363 63.892  1.00 108.92 ? 603  ASN A N     1 
ATOM   5529  C  CA    . ASN D 4  603  ? -10.512 -29.872 64.127  1.00 101.35 ? 603  ASN A CA    1 
ATOM   5530  C  C     . ASN D 4  603  ? -9.475  -30.820 63.525  1.00 85.17  ? 603  ASN A C     1 
ATOM   5531  O  O     . ASN D 4  603  ? -9.778  -31.950 63.124  1.00 98.97  ? 603  ASN A O     1 
ATOM   5532  C  CB    . ASN D 4  603  ? -10.240 -29.697 65.626  1.00 104.11 ? 603  ASN A CB    1 
ATOM   5533  C  CG    . ASN D 4  603  ? -11.357 -28.977 66.356  1.00 115.32 ? 603  ASN A CG    1 
ATOM   5534  O  OD1   . ASN D 4  603  ? -12.530 -29.288 66.179  1.00 137.34 ? 603  ASN A OD1   1 
ATOM   5535  N  ND2   . ASN D 4  603  ? -10.992 -28.003 67.185  1.00 103.09 ? 603  ASN A ND2   1 
ATOM   5536  N  N     . GLY D 4  604  ? -8.231  -30.333 63.453  1.00 76.29  ? 604  GLY A N     1 
ATOM   5537  C  CA    . GLY D 4  604  ? -7.115  -31.140 62.990  1.00 88.95  ? 604  GLY A CA    1 
ATOM   5538  C  C     . GLY D 4  604  ? -7.210  -31.458 61.505  1.00 92.98  ? 604  GLY A C     1 
ATOM   5539  O  O     . GLY D 4  604  ? -7.974  -30.845 60.751  1.00 109.26 ? 604  GLY A O     1 
ATOM   5540  N  N     . MET D 4  605  ? -6.420  -32.447 61.087  1.00 92.28  ? 605  MET A N     1 
ATOM   5541  C  CA    . MET D 4  605  ? -6.407  -32.851 59.686  1.00 91.00  ? 605  MET A CA    1 
ATOM   5542  C  C     . MET D 4  605  ? -5.863  -34.267 59.575  1.00 98.34  ? 605  MET A C     1 
ATOM   5543  O  O     . MET D 4  605  ? -4.771  -34.552 60.079  1.00 111.90 ? 605  MET A O     1 
ATOM   5544  C  CB    . MET D 4  605  ? -5.547  -31.897 58.851  1.00 77.91  ? 605  MET A CB    1 
ATOM   5545  C  CG    . MET D 4  605  ? -5.441  -32.292 57.407  1.00 67.14  ? 605  MET A CG    1 
ATOM   5546  S  SD    . MET D 4  605  ? -7.059  -32.323 56.611  1.00 88.86  ? 605  MET A SD    1 
ATOM   5547  C  CE    . MET D 4  605  ? -7.679  -30.673 56.972  1.00 92.27  ? 605  MET A CE    1 
ATOM   5548  N  N     . LEU D 4  606  ? -6.606  -35.146 58.904  1.00 91.36  ? 606  LEU A N     1 
ATOM   5549  C  CA    . LEU D 4  606  ? -6.129  -36.496 58.628  1.00 91.31  ? 606  LEU A CA    1 
ATOM   5550  C  C     . LEU D 4  606  ? -6.325  -36.798 57.148  1.00 94.04  ? 606  LEU A C     1 
ATOM   5551  O  O     . LEU D 4  606  ? -7.451  -36.729 56.643  1.00 95.08  ? 606  LEU A O     1 
ATOM   5552  C  CB    . LEU D 4  606  ? -6.852  -37.528 59.495  1.00 92.77  ? 606  LEU A CB    1 
ATOM   5553  C  CG    . LEU D 4  606  ? -6.340  -38.953 59.311  1.00 86.61  ? 606  LEU A CG    1 
ATOM   5554  C  CD1   . LEU D 4  606  ? -4.905  -39.053 59.809  1.00 86.68  ? 606  LEU A CD1   1 
ATOM   5555  C  CD2   . LEU D 4  606  ? -7.243  -39.940 60.023  1.00 83.47  ? 606  LEU A CD2   1 
ATOM   5556  N  N     . ILE D 4  607  ? -5.226  -37.113 56.457  1.00 91.99  ? 607  ILE A N     1 
ATOM   5557  C  CA    . ILE D 4  607  ? -5.213  -37.420 55.028  1.00 101.12 ? 607  ILE A CA    1 
ATOM   5558  C  C     . ILE D 4  607  ? -4.412  -38.702 54.843  1.00 111.44 ? 607  ILE A C     1 
ATOM   5559  O  O     . ILE D 4  607  ? -3.319  -38.831 55.402  1.00 122.65 ? 607  ILE A O     1 
ATOM   5560  C  CB    . ILE D 4  607  ? -4.588  -36.277 54.198  1.00 96.40  ? 607  ILE A CB    1 
ATOM   5561  C  CG1   . ILE D 4  607  ? -5.337  -34.958 54.415  1.00 72.56  ? 607  ILE A CG1   1 
ATOM   5562  C  CG2   . ILE D 4  607  ? -4.564  -36.624 52.708  1.00 102.12 ? 607  ILE A CG2   1 
ATOM   5563  C  CD1   . ILE D 4  607  ? -4.679  -33.749 53.776  1.00 64.12  ? 607  ILE A CD1   1 
ATOM   5564  N  N     . ILE D 4  608  ? -4.947  -39.653 54.071  1.00 104.59 ? 608  ILE A N     1 
ATOM   5565  C  CA    . ILE D 4  608  ? -4.232  -40.894 53.779  1.00 97.18  ? 608  ILE A CA    1 
ATOM   5566  C  C     . ILE D 4  608  ? -4.470  -41.277 52.323  1.00 97.05  ? 608  ILE A C     1 
ATOM   5567  O  O     . ILE D 4  608  ? -5.620  -41.456 51.906  1.00 102.47 ? 608  ILE A O     1 
ATOM   5568  C  CB    . ILE D 4  608  ? -4.636  -42.048 54.719  1.00 87.22  ? 608  ILE A CB    1 
ATOM   5569  C  CG1   . ILE D 4  608  ? -6.131  -42.000 55.038  1.00 99.35  ? 608  ILE A CG1   1 
ATOM   5570  C  CG2   . ILE D 4  608  ? -3.802  -42.026 56.003  1.00 77.84  ? 608  ILE A CG2   1 
ATOM   5571  C  CD1   . ILE D 4  608  ? -6.626  -43.183 55.852  1.00 112.38 ? 608  ILE A CD1   1 
ATOM   5572  N  N     . ASP D 4  609  ? -3.378  -41.380 51.551  1.00 100.52 ? 609  ASP A N     1 
ATOM   5573  C  CA    . ASP D 4  609  ? -3.373  -41.867 50.165  1.00 104.94 ? 609  ASP A CA    1 
ATOM   5574  C  C     . ASP D 4  609  ? -4.271  -41.015 49.262  1.00 135.20 ? 609  ASP A C     1 
ATOM   5575  O  O     . ASP D 4  609  ? -5.192  -41.514 48.611  1.00 163.88 ? 609  ASP A O     1 
ATOM   5576  C  CB    . ASP D 4  609  ? -3.767  -43.348 50.108  1.00 97.10  ? 609  ASP A CB    1 
ATOM   5577  C  CG    . ASP D 4  609  ? -3.380  -44.015 48.793  1.00 110.01 ? 609  ASP A CG    1 
ATOM   5578  O  OD1   . ASP D 4  609  ? -2.215  -43.858 48.365  1.00 113.49 ? 609  ASP A OD1   1 
ATOM   5579  O  OD2   . ASP D 4  609  ? -4.233  -44.705 48.190  1.00 115.16 ? 609  ASP A OD2   1 
ATOM   5580  N  N     . GLY D 4  610  ? -4.001  -39.708 49.239  1.00 125.39 ? 610  GLY A N     1 
ATOM   5581  C  CA    . GLY D 4  610  ? -4.730  -38.798 48.372  1.00 119.24 ? 610  GLY A CA    1 
ATOM   5582  C  C     . GLY D 4  610  ? -6.193  -38.625 48.702  1.00 120.43 ? 610  GLY A C     1 
ATOM   5583  O  O     . GLY D 4  610  ? -6.975  -38.240 47.829  1.00 132.96 ? 610  GLY A O     1 
ATOM   5584  N  N     . GLN D 4  611  ? -6.590  -38.921 49.938  1.00 107.89 ? 611  GLN A N     1 
ATOM   5585  C  CA    . GLN D 4  611  ? -7.964  -38.764 50.398  1.00 104.24 ? 611  GLN A CA    1 
ATOM   5586  C  C     . GLN D 4  611  ? -7.927  -38.246 51.823  1.00 104.16 ? 611  GLN A C     1 
ATOM   5587  O  O     . GLN D 4  611  ? -7.182  -38.777 52.652  1.00 120.97 ? 611  GLN A O     1 
ATOM   5588  C  CB    . GLN D 4  611  ? -8.735  -40.092 50.339  1.00 100.32 ? 611  GLN A CB    1 
ATOM   5589  C  CG    . GLN D 4  611  ? -9.159  -40.494 48.939  1.00 110.86 ? 611  GLN A CG    1 
ATOM   5590  C  CD    . GLN D 4  611  ? -10.487 -39.884 48.532  1.00 110.96 ? 611  GLN A CD    1 
ATOM   5591  O  OE1   . GLN D 4  611  ? -11.389 -39.714 49.355  1.00 124.65 ? 611  GLN A OE1   1 
ATOM   5592  N  NE2   . GLN D 4  611  ? -10.597 -39.507 47.261  1.00 92.01  ? 611  GLN A NE2   1 
ATOM   5593  N  N     . ILE D 4  612  ? -8.718  -37.220 52.112  1.00 87.94  ? 612  ILE A N     1 
ATOM   5594  C  CA    . ILE D 4  612  ? -8.753  -36.698 53.473  1.00 98.68  ? 612  ILE A CA    1 
ATOM   5595  C  C     . ILE D 4  612  ? -9.856  -37.429 54.231  1.00 108.92 ? 612  ILE A C     1 
ATOM   5596  O  O     . ILE D 4  612  ? -10.843 -37.892 53.648  1.00 109.38 ? 612  ILE A O     1 
ATOM   5597  C  CB    . ILE D 4  612  ? -8.932  -35.161 53.493  1.00 93.27  ? 612  ILE A CB    1 
ATOM   5598  C  CG1   . ILE D 4  612  ? -10.395 -34.738 53.449  1.00 83.34  ? 612  ILE A CG1   1 
ATOM   5599  C  CG2   . ILE D 4  612  ? -8.228  -34.533 52.303  1.00 98.28  ? 612  ILE A CG2   1 
ATOM   5600  C  CD1   . ILE D 4  612  ? -10.570 -33.253 53.704  1.00 77.12  ? 612  ILE A CD1   1 
ATOM   5601  N  N     . ILE D 4  613  ? -9.663  -37.584 55.543  1.00 117.53 ? 613  ILE A N     1 
ATOM   5602  C  CA    . ILE D 4  613  ? -10.571 -38.350 56.402  1.00 117.54 ? 613  ILE A CA    1 
ATOM   5603  C  C     . ILE D 4  613  ? -11.443 -37.425 57.239  1.00 109.76 ? 613  ILE A C     1 
ATOM   5604  O  O     . ILE D 4  613  ? -12.672 -37.512 57.203  1.00 119.39 ? 613  ILE A O     1 
ATOM   5605  C  CB    . ILE D 4  613  ? -9.789  -39.341 57.293  1.00 110.55 ? 613  ILE A CB    1 
ATOM   5606  C  CG1   . ILE D 4  613  ? -9.073  -40.369 56.426  1.00 95.26  ? 613  ILE A CG1   1 
ATOM   5607  C  CG2   . ILE D 4  613  ? -10.706 -40.022 58.301  1.00 109.25 ? 613  ILE A CG2   1 
ATOM   5608  C  CD1   . ILE D 4  613  ? -10.006 -41.173 55.564  1.00 96.97  ? 613  ILE A CD1   1 
ATOM   5609  N  N     . PHE D 4  614  ? -10.822 -36.541 58.016  1.00 89.32  ? 614  PHE A N     1 
ATOM   5610  C  CA    . PHE D 4  614  ? -11.535 -35.481 58.704  1.00 90.83  ? 614  PHE A CA    1 
ATOM   5611  C  C     . PHE D 4  614  ? -10.652 -34.243 58.759  1.00 88.50  ? 614  PHE A C     1 
ATOM   5612  O  O     . PHE D 4  614  ? -9.420  -34.318 58.683  1.00 79.49  ? 614  PHE A O     1 
ATOM   5613  C  CB    . PHE D 4  614  ? -11.982 -35.898 60.121  1.00 102.44 ? 614  PHE A CB    1 
ATOM   5614  C  CG    . PHE D 4  614  ? -10.842 -36.177 61.075  1.00 114.00 ? 614  PHE A CG    1 
ATOM   5615  C  CD1   . PHE D 4  614  ? -10.334 -35.178 61.894  1.00 95.61  ? 614  PHE A CD1   1 
ATOM   5616  C  CD2   . PHE D 4  614  ? -10.317 -37.455 61.190  1.00 123.98 ? 614  PHE A CD2   1 
ATOM   5617  C  CE1   . PHE D 4  614  ? -9.299  -35.437 62.769  1.00 90.40  ? 614  PHE A CE1   1 
ATOM   5618  C  CE2   . PHE D 4  614  ? -9.284  -37.721 62.078  1.00 118.51 ? 614  PHE A CE2   1 
ATOM   5619  C  CZ    . PHE D 4  614  ? -8.777  -36.711 62.863  1.00 117.46 ? 614  PHE A CZ    1 
ATOM   5620  N  N     . GLY D 4  615  ? -11.311 -33.096 58.903  1.00 86.71  ? 615  GLY A N     1 
ATOM   5621  C  CA    . GLY D 4  615  ? -10.623 -31.840 59.104  1.00 81.10  ? 615  GLY A CA    1 
ATOM   5622  C  C     . GLY D 4  615  ? -11.067 -30.775 58.131  1.00 77.11  ? 615  GLY A C     1 
ATOM   5623  O  O     . GLY D 4  615  ? -11.050 -31.000 56.919  1.00 84.82  ? 615  GLY A O     1 
ATOM   5624  N  N     . VAL D 4  616  ? -11.499 -29.624 58.648  1.00 77.05  ? 616  VAL A N     1 
ATOM   5625  C  CA    . VAL D 4  616  ? -11.700 -28.449 57.809  1.00 85.82  ? 616  VAL A CA    1 
ATOM   5626  C  C     . VAL D 4  616  ? -10.341 -27.975 57.304  1.00 92.29  ? 616  VAL A C     1 
ATOM   5627  O  O     . VAL D 4  616  ? -9.399  -27.795 58.089  1.00 112.70 ? 616  VAL A O     1 
ATOM   5628  C  CB    . VAL D 4  616  ? -12.430 -27.348 58.599  1.00 79.56  ? 616  VAL A CB    1 
ATOM   5629  C  CG1   . VAL D 4  616  ? -12.305 -25.994 57.909  1.00 102.08 ? 616  VAL A CG1   1 
ATOM   5630  C  CG2   . VAL D 4  616  ? -13.901 -27.718 58.825  1.00 64.43  ? 616  VAL A CG2   1 
ATOM   5631  N  N     . VAL D 4  617  ? -10.220 -27.800 55.986  1.00 72.06  ? 617  VAL A N     1 
ATOM   5632  C  CA    . VAL D 4  617  ? -8.971  -27.323 55.394  1.00 85.76  ? 617  VAL A CA    1 
ATOM   5633  C  C     . VAL D 4  617  ? -8.860  -25.816 55.600  1.00 92.55  ? 617  VAL A C     1 
ATOM   5634  O  O     . VAL D 4  617  ? -9.793  -25.062 55.290  1.00 86.19  ? 617  VAL A O     1 
ATOM   5635  C  CB    . VAL D 4  617  ? -8.893  -27.688 53.902  1.00 72.98  ? 617  VAL A CB    1 
ATOM   5636  C  CG1   . VAL D 4  617  ? -7.585  -27.183 53.282  1.00 66.60  ? 617  VAL A CG1   1 
ATOM   5637  C  CG2   . VAL D 4  617  ? -9.009  -29.191 53.721  1.00 62.91  ? 617  VAL A CG2   1 
ATOM   5638  N  N     . GLU D 4  618  ? -7.721  -25.375 56.125  1.00 88.12  ? 618  GLU A N     1 
ATOM   5639  C  CA    . GLU D 4  618  ? -7.450  -23.956 56.318  1.00 78.40  ? 618  GLU A CA    1 
ATOM   5640  C  C     . GLU D 4  618  ? -5.943  -23.735 56.188  1.00 79.44  ? 618  GLU A C     1 
ATOM   5641  O  O     . GLU D 4  618  ? -5.220  -24.591 55.666  1.00 76.86  ? 618  GLU A O     1 
ATOM   5642  C  CB    . GLU D 4  618  ? -8.044  -23.468 57.655  1.00 69.71  ? 618  GLU A CB    1 
ATOM   5643  C  CG    . GLU D 4  618  ? -7.799  -24.374 58.836  1.00 75.72  ? 618  GLU A CG    1 
ATOM   5644  C  CD    . GLU D 4  618  ? -6.372  -24.325 59.320  1.00 95.61  ? 618  GLU A CD    1 
ATOM   5645  O  OE1   . GLU D 4  618  ? -5.754  -23.241 59.237  1.00 88.58  ? 618  GLU A OE1   1 
ATOM   5646  O  OE2   . GLU D 4  618  ? -5.860  -25.374 59.754  1.00 114.07 ? 618  GLU A OE2   1 
ATOM   5647  N  N     . LYS D 4  619  ? -5.475  -22.588 56.690  1.00 77.72  ? 619  LYS A N     1 
ATOM   5648  C  CA    . LYS D 4  619  ? -4.116  -22.119 56.432  1.00 72.82  ? 619  LYS A CA    1 
ATOM   5649  C  C     . LYS D 4  619  ? -3.046  -23.050 56.999  1.00 82.17  ? 619  LYS A C     1 
ATOM   5650  O  O     . LYS D 4  619  ? -1.984  -23.208 56.385  1.00 79.70  ? 619  LYS A O     1 
ATOM   5651  C  CB    . LYS D 4  619  ? -3.958  -20.708 57.003  1.00 76.81  ? 619  LYS A CB    1 
ATOM   5652  C  CG    . LYS D 4  619  ? -2.661  -20.002 56.642  1.00 89.49  ? 619  LYS A CG    1 
ATOM   5653  C  CD    . LYS D 4  619  ? -2.741  -18.521 56.977  1.00 101.23 ? 619  LYS A CD    1 
ATOM   5654  C  CE    . LYS D 4  619  ? -1.487  -17.783 56.533  1.00 107.11 ? 619  LYS A CE    1 
ATOM   5655  N  NZ    . LYS D 4  619  ? -1.578  -16.319 56.802  1.00 104.09 ? 619  LYS A NZ    1 
ATOM   5656  N  N     . LYS D 4  620  ? -3.293  -23.677 58.153  1.00 92.87  ? 620  LYS A N     1 
ATOM   5657  C  CA    . LYS D 4  620  ? -2.293  -24.581 58.720  1.00 99.48  ? 620  LYS A CA    1 
ATOM   5658  C  C     . LYS D 4  620  ? -2.127  -25.853 57.897  1.00 101.13 ? 620  LYS A C     1 
ATOM   5659  O  O     . LYS D 4  620  ? -1.078  -26.503 57.985  1.00 113.88 ? 620  LYS A O     1 
ATOM   5660  C  CB    . LYS D 4  620  ? -2.650  -24.947 60.166  1.00 98.74  ? 620  LYS A CB    1 
ATOM   5661  C  CG    . LYS D 4  620  ? -2.441  -23.831 61.184  1.00 95.01  ? 620  LYS A CG    1 
ATOM   5662  C  CD    . LYS D 4  620  ? -3.089  -24.169 62.525  1.00 85.55  ? 620  LYS A CD    1 
ATOM   5663  C  CE    . LYS D 4  620  ? -4.604  -24.017 62.462  1.00 70.36  ? 620  LYS A CE    1 
ATOM   5664  N  NZ    . LYS D 4  620  ? -5.283  -24.462 63.709  1.00 81.90  ? 620  LYS A NZ    1 
ATOM   5665  N  N     . THR D 4  621  ? -3.135  -26.221 57.108  1.00 81.50  ? 621  THR A N     1 
ATOM   5666  C  CA    . THR D 4  621  ? -3.057  -27.394 56.246  1.00 80.65  ? 621  THR A CA    1 
ATOM   5667  C  C     . THR D 4  621  ? -2.464  -27.062 54.882  1.00 88.15  ? 621  THR A C     1 
ATOM   5668  O  O     . THR D 4  621  ? -1.570  -27.772 54.403  1.00 74.22  ? 621  THR A O     1 
ATOM   5669  C  CB    . THR D 4  621  ? -4.453  -28.013 56.074  1.00 78.29  ? 621  THR A CB    1 
ATOM   5670  O  OG1   . THR D 4  621  ? -5.090  -28.143 57.357  1.00 79.69  ? 621  THR A OG1   1 
ATOM   5671  C  CG2   . THR D 4  621  ? -4.381  -29.381 55.380  1.00 71.24  ? 621  THR A CG2   1 
ATOM   5672  N  N     . VAL D 4  622  ? -2.918  -25.964 54.274  1.00 107.38 ? 622  VAL A N     1 
ATOM   5673  C  CA    . VAL D 4  622  ? -2.695  -25.694 52.860  1.00 100.72 ? 622  VAL A CA    1 
ATOM   5674  C  C     . VAL D 4  622  ? -1.989  -24.367 52.612  1.00 108.68 ? 622  VAL A C     1 
ATOM   5675  O  O     . VAL D 4  622  ? -1.715  -24.026 51.458  1.00 120.25 ? 622  VAL A O     1 
ATOM   5676  C  CB    . VAL D 4  622  ? -4.034  -25.757 52.085  1.00 85.43  ? 622  VAL A CB    1 
ATOM   5677  C  CG1   . VAL D 4  622  ? -4.804  -24.429 52.158  1.00 80.00  ? 622  VAL A CG1   1 
ATOM   5678  C  CG2   . VAL D 4  622  ? -3.842  -26.247 50.652  1.00 89.41  ? 622  VAL A CG2   1 
ATOM   5679  N  N     . GLY D 4  623  ? -1.656  -23.610 53.653  1.00 100.04 ? 623  GLY A N     1 
ATOM   5680  C  CA    . GLY D 4  623  ? -0.871  -22.400 53.493  1.00 98.81  ? 623  GLY A CA    1 
ATOM   5681  C  C     . GLY D 4  623  ? 0.607   -22.686 53.330  1.00 102.54 ? 623  GLY A C     1 
ATOM   5682  O  O     . GLY D 4  623  ? 1.018   -23.764 52.886  1.00 112.10 ? 623  GLY A O     1 
ATOM   5683  N  N     . SER D 4  624  ? 1.427   -21.708 53.717  1.00 102.13 ? 624  SER A N     1 
ATOM   5684  C  CA    . SER D 4  624  ? 2.878   -21.823 53.635  1.00 90.06  ? 624  SER A CA    1 
ATOM   5685  C  C     . SER D 4  624  ? 3.479   -22.456 54.884  1.00 88.41  ? 624  SER A C     1 
ATOM   5686  O  O     . SER D 4  624  ? 4.653   -22.214 55.197  1.00 109.58 ? 624  SER A O     1 
ATOM   5687  C  CB    . SER D 4  624  ? 3.502   -20.451 53.361  1.00 95.10  ? 624  SER A CB    1 
ATOM   5688  O  OG    . SER D 4  624  ? 3.071   -19.459 54.286  1.00 95.10  ? 624  SER A OG    1 
ATOM   5689  N  N     . SER D 4  625  ? 2.704   -23.277 55.590  1.00 83.11  ? 625  SER A N     1 
ATOM   5690  C  CA    . SER D 4  625  ? 3.099   -23.794 56.892  1.00 98.78  ? 625  SER A CA    1 
ATOM   5691  C  C     . SER D 4  625  ? 4.246   -24.798 56.781  1.00 108.82 ? 625  SER A C     1 
ATOM   5692  O  O     . SER D 4  625  ? 4.386   -25.515 55.785  1.00 109.01 ? 625  SER A O     1 
ATOM   5693  C  CB    . SER D 4  625  ? 1.896   -24.450 57.577  1.00 75.02  ? 625  SER A CB    1 
ATOM   5694  O  OG    . SER D 4  625  ? 1.498   -25.632 56.902  1.00 59.42  ? 625  SER A OG    1 
ATOM   5695  N  N     . ASN D 4  626  ? 5.083   -24.826 57.818  1.00 110.73 ? 626  ASN A N     1 
ATOM   5696  C  CA    . ASN D 4  626  ? 6.089   -25.871 57.949  1.00 110.61 ? 626  ASN A CA    1 
ATOM   5697  C  C     . ASN D 4  626  ? 5.392   -27.194 58.240  1.00 103.31 ? 626  ASN A C     1 
ATOM   5698  O  O     . ASN D 4  626  ? 4.465   -27.253 59.056  1.00 81.58  ? 626  ASN A O     1 
ATOM   5699  C  CB    . ASN D 4  626  ? 7.080   -25.520 59.064  1.00 123.87 ? 626  ASN A CB    1 
ATOM   5700  C  CG    . ASN D 4  626  ? 8.398   -26.283 58.955  1.00 141.30 ? 626  ASN A CG    1 
ATOM   5701  O  OD1   . ASN D 4  626  ? 8.513   -27.256 58.209  1.00 156.58 ? 626  ASN A OD1   1 
ATOM   5702  N  ND2   . ASN D 4  626  ? 9.396   -25.844 59.715  1.00 136.89 ? 626  ASN A ND2   1 
ATOM   5703  N  N     . GLY D 4  627  ? 5.824   -28.251 57.558  1.00 103.90 ? 627  GLY A N     1 
ATOM   5704  C  CA    . GLY D 4  627  ? 5.179   -29.542 57.698  1.00 100.80 ? 627  GLY A CA    1 
ATOM   5705  C  C     . GLY D 4  627  ? 3.780   -29.588 57.126  1.00 93.33  ? 627  GLY A C     1 
ATOM   5706  O  O     . GLY D 4  627  ? 2.963   -30.405 57.563  1.00 85.20  ? 627  GLY A O     1 
ATOM   5707  N  N     . GLY D 4  628  ? 3.481   -28.724 56.158  1.00 103.81 ? 628  GLY A N     1 
ATOM   5708  C  CA    . GLY D 4  628  ? 2.169   -28.660 55.557  1.00 107.51 ? 628  GLY A CA    1 
ATOM   5709  C  C     . GLY D 4  628  ? 2.041   -29.580 54.360  1.00 97.91  ? 628  GLY A C     1 
ATOM   5710  O  O     . GLY D 4  628  ? 2.889   -30.433 54.092  1.00 97.58  ? 628  GLY A O     1 
ATOM   5711  N  N     . LEU D 4  629  ? 0.942   -29.388 53.622  1.00 89.91  ? 629  LEU A N     1 
ATOM   5712  C  CA    . LEU D 4  629  ? 0.648   -30.260 52.486  1.00 91.09  ? 629  LEU A CA    1 
ATOM   5713  C  C     . LEU D 4  629  ? 1.607   -30.001 51.327  1.00 84.09  ? 629  LEU A C     1 
ATOM   5714  O  O     . LEU D 4  629  ? 2.010   -30.939 50.624  1.00 78.77  ? 629  LEU A O     1 
ATOM   5715  C  CB    . LEU D 4  629  ? -0.810  -30.071 52.052  1.00 77.36  ? 629  LEU A CB    1 
ATOM   5716  C  CG    . LEU D 4  629  ? -1.611  -31.245 51.464  1.00 63.90  ? 629  LEU A CG    1 
ATOM   5717  C  CD1   . LEU D 4  629  ? -3.090  -30.925 51.524  1.00 69.35  ? 629  LEU A CD1   1 
ATOM   5718  C  CD2   . LEU D 4  629  ? -1.228  -31.567 50.035  1.00 72.90  ? 629  LEU A CD2   1 
ATOM   5719  N  N     . ILE D 4  630  ? 1.988   -28.736 51.120  1.00 73.81  ? 630  ILE A N     1 
ATOM   5720  C  CA    . ILE D 4  630  ? 2.936   -28.410 50.057  1.00 76.43  ? 630  ILE A CA    1 
ATOM   5721  C  C     . ILE D 4  630  ? 4.318   -28.956 50.395  1.00 85.24  ? 630  ILE A C     1 
ATOM   5722  O  O     . ILE D 4  630  ? 5.023   -29.474 49.518  1.00 109.59 ? 630  ILE A O     1 
ATOM   5723  C  CB    . ILE D 4  630  ? 2.947   -26.888 49.805  1.00 69.79  ? 630  ILE A CB    1 
ATOM   5724  C  CG1   . ILE D 4  630  ? 1.583   -26.430 49.291  1.00 69.72  ? 630  ILE A CG1   1 
ATOM   5725  C  CG2   . ILE D 4  630  ? 4.016   -26.479 48.801  1.00 60.49  ? 630  ILE A CG2   1 
ATOM   5726  C  CD1   . ILE D 4  630  ? 0.712   -25.813 50.341  1.00 84.08  ? 630  ILE A CD1   1 
ATOM   5727  N  N     . HIS D 4  631  ? 4.703   -28.882 51.675  1.00 71.04  ? 631  HIS A N     1 
ATOM   5728  C  CA    . HIS D 4  631  ? 5.927   -29.524 52.151  1.00 74.64  ? 631  HIS A CA    1 
ATOM   5729  C  C     . HIS D 4  631  ? 5.930   -31.020 51.844  1.00 91.01  ? 631  HIS A C     1 
ATOM   5730  O  O     . HIS D 4  631  ? 6.903   -31.546 51.286  1.00 101.69 ? 631  HIS A O     1 
ATOM   5731  C  CB    . HIS D 4  631  ? 6.081   -29.278 53.653  1.00 68.51  ? 631  HIS A CB    1 
ATOM   5732  C  CG    . HIS D 4  631  ? 7.503   -29.104 54.098  1.00 70.12  ? 631  HIS A CG    1 
ATOM   5733  N  ND1   . HIS D 4  631  ? 7.843   -28.803 55.402  1.00 65.49  ? 631  HIS A ND1   1 
ATOM   5734  C  CD2   . HIS D 4  631  ? 8.669   -29.204 53.416  1.00 73.93  ? 631  HIS A CD2   1 
ATOM   5735  C  CE1   . HIS D 4  631  ? 9.158   -28.713 55.499  1.00 69.75  ? 631  HIS A CE1   1 
ATOM   5736  N  NE2   . HIS D 4  631  ? 9.682   -28.955 54.309  1.00 67.10  ? 631  HIS A NE2   1 
ATOM   5737  N  N     . VAL D 4  632  ? 4.822   -31.705 52.152  1.00 84.79  ? 632  VAL A N     1 
ATOM   5738  C  CA    . VAL D 4  632  ? 4.730   -33.152 51.953  1.00 70.50  ? 632  VAL A CA    1 
ATOM   5739  C  C     . VAL D 4  632  ? 4.810   -33.505 50.470  1.00 78.79  ? 632  VAL A C     1 
ATOM   5740  O  O     . VAL D 4  632  ? 5.562   -34.404 50.075  1.00 89.59  ? 632  VAL A O     1 
ATOM   5741  C  CB    . VAL D 4  632  ? 3.441   -33.699 52.599  1.00 74.81  ? 632  VAL A CB    1 
ATOM   5742  C  CG1   . VAL D 4  632  ? 3.135   -35.125 52.120  1.00 103.50 ? 632  VAL A CG1   1 
ATOM   5743  C  CG2   . VAL D 4  632  ? 3.558   -33.674 54.110  1.00 72.07  ? 632  VAL A CG2   1 
ATOM   5744  N  N     . VAL D 4  633  ? 4.045   -32.802 49.625  1.00 79.46  ? 633  VAL A N     1 
ATOM   5745  C  CA    . VAL D 4  633  ? 3.997   -33.170 48.209  1.00 77.30  ? 633  VAL A CA    1 
ATOM   5746  C  C     . VAL D 4  633  ? 5.308   -32.814 47.508  1.00 67.24  ? 633  VAL A C     1 
ATOM   5747  O  O     . VAL D 4  633  ? 5.799   -33.574 46.659  1.00 69.46  ? 633  VAL A O     1 
ATOM   5748  C  CB    . VAL D 4  633  ? 2.774   -32.528 47.532  1.00 66.93  ? 633  VAL A CB    1 
ATOM   5749  C  CG1   . VAL D 4  633  ? 2.740   -32.851 46.037  1.00 81.44  ? 633  VAL A CG1   1 
ATOM   5750  C  CG2   . VAL D 4  633  ? 1.506   -33.046 48.179  1.00 66.06  ? 633  VAL A CG2   1 
ATOM   5751  N  N     . THR D 4  634  ? 5.920   -31.683 47.876  1.00 65.95  ? 634  THR A N     1 
ATOM   5752  C  CA    . THR D 4  634  ? 7.214   -31.316 47.305  1.00 82.56  ? 634  THR A CA    1 
ATOM   5753  C  C     . THR D 4  634  ? 8.302   -32.300 47.719  1.00 85.31  ? 634  THR A C     1 
ATOM   5754  O  O     . THR D 4  634  ? 9.144   -32.683 46.895  1.00 71.08  ? 634  THR A O     1 
ATOM   5755  C  CB    . THR D 4  634  ? 7.579   -29.891 47.734  1.00 76.99  ? 634  THR A CB    1 
ATOM   5756  O  OG1   . THR D 4  634  ? 6.488   -29.011 47.429  1.00 71.95  ? 634  THR A OG1   1 
ATOM   5757  C  CG2   . THR D 4  634  ? 8.842   -29.393 47.025  1.00 65.25  ? 634  THR A CG2   1 
ATOM   5758  N  N     . ARG D 4  635  ? 8.286   -32.742 48.981  1.00 89.97  ? 635  ARG A N     1 
ATOM   5759  C  CA    . ARG D 4  635  ? 9.333   -33.639 49.448  1.00 94.98  ? 635  ARG A CA    1 
ATOM   5760  C  C     . ARG D 4  635  ? 9.151   -35.048 48.895  1.00 89.14  ? 635  ARG A C     1 
ATOM   5761  O  O     . ARG D 4  635  ? 10.117  -35.666 48.429  1.00 112.15 ? 635  ARG A O     1 
ATOM   5762  C  CB    . ARG D 4  635  ? 9.375   -33.651 50.977  1.00 99.62  ? 635  ARG A CB    1 
ATOM   5763  C  CG    . ARG D 4  635  ? 10.021  -32.413 51.570  1.00 90.18  ? 635  ARG A CG    1 
ATOM   5764  C  CD    . ARG D 4  635  ? 11.511  -32.557 51.444  1.00 87.91  ? 635  ARG A CD    1 
ATOM   5765  N  NE    . ARG D 4  635  ? 12.072  -31.475 50.648  1.00 100.47 ? 635  ARG A NE    1 
ATOM   5766  C  CZ    . ARG D 4  635  ? 13.138  -31.625 49.872  1.00 104.92 ? 635  ARG A CZ    1 
ATOM   5767  N  NH1   . ARG D 4  635  ? 13.689  -32.822 49.759  1.00 126.28 ? 635  ARG A NH1   1 
ATOM   5768  N  NH2   . ARG D 4  635  ? 13.610  -30.600 49.169  1.00 94.70  ? 635  ARG A NH2   1 
ATOM   5769  N  N     . GLU D 4  636  ? 7.925   -35.567 48.924  1.00 70.70  ? 636  GLU A N     1 
ATOM   5770  C  CA    . GLU D 4  636  ? 7.686   -36.953 48.536  1.00 76.73  ? 636  GLU A CA    1 
ATOM   5771  C  C     . GLU D 4  636  ? 7.551   -37.093 47.022  1.00 87.80  ? 636  GLU A C     1 
ATOM   5772  O  O     . GLU D 4  636  ? 8.350   -37.786 46.377  1.00 73.47  ? 636  GLU A O     1 
ATOM   5773  C  CB    . GLU D 4  636  ? 6.430   -37.481 49.240  1.00 82.88  ? 636  GLU A CB    1 
ATOM   5774  C  CG    . GLU D 4  636  ? 6.544   -38.920 49.711  1.00 96.54  ? 636  GLU A CG    1 
ATOM   5775  C  CD    . GLU D 4  636  ? 7.396   -39.047 50.955  1.00 110.71 ? 636  GLU A CD    1 
ATOM   5776  O  OE1   . GLU D 4  636  ? 6.966   -38.554 52.018  1.00 112.49 ? 636  GLU A OE1   1 
ATOM   5777  O  OE2   . GLU D 4  636  ? 8.500   -39.627 50.870  1.00 120.40 ? 636  GLU A OE2   1 
ATOM   5778  N  N     . LYS D 4  637  ? 6.549   -36.424 46.440  1.00 102.72 ? 637  LYS A N     1 
ATOM   5779  C  CA    . LYS D 4  637  ? 6.236   -36.610 45.025  1.00 96.60  ? 637  LYS A CA    1 
ATOM   5780  C  C     . LYS D 4  637  ? 7.212   -35.863 44.123  1.00 104.20 ? 637  LYS A C     1 
ATOM   5781  O  O     . LYS D 4  637  ? 7.633   -36.394 43.090  1.00 123.54 ? 637  LYS A O     1 
ATOM   5782  C  CB    . LYS D 4  637  ? 4.802   -36.158 44.742  1.00 77.39  ? 637  LYS A CB    1 
ATOM   5783  C  CG    . LYS D 4  637  ? 3.766   -37.009 45.450  1.00 79.53  ? 637  LYS A CG    1 
ATOM   5784  C  CD    . LYS D 4  637  ? 3.706   -38.409 44.851  1.00 97.85  ? 637  LYS A CD    1 
ATOM   5785  C  CE    . LYS D 4  637  ? 2.423   -39.139 45.221  1.00 98.17  ? 637  LYS A CE    1 
ATOM   5786  N  NZ    . LYS D 4  637  ? 2.375   -40.535 44.690  1.00 98.70  ? 637  LYS A NZ    1 
ATOM   5787  N  N     . GLY D 4  638  ? 7.588   -34.642 44.496  1.00 86.48  ? 638  GLY A N     1 
ATOM   5788  C  CA    . GLY D 4  638  ? 8.526   -33.872 43.718  1.00 85.13  ? 638  GLY A CA    1 
ATOM   5789  C  C     . GLY D 4  638  ? 8.041   -32.468 43.415  1.00 101.39 ? 638  GLY A C     1 
ATOM   5790  O  O     . GLY D 4  638  ? 6.919   -32.078 43.753  1.00 112.86 ? 638  GLY A O     1 
ATOM   5791  N  N     . PRO D 4  639  ? 8.898   -31.676 42.765  1.00 96.02  ? 639  PRO A N     1 
ATOM   5792  C  CA    . PRO D 4  639  ? 8.535   -30.273 42.507  1.00 84.98  ? 639  PRO A CA    1 
ATOM   5793  C  C     . PRO D 4  639  ? 7.465   -30.105 41.441  1.00 93.13  ? 639  PRO A C     1 
ATOM   5794  O  O     . PRO D 4  639  ? 6.570   -29.266 41.606  1.00 95.22  ? 639  PRO A O     1 
ATOM   5795  C  CB    . PRO D 4  639  ? 9.871   -29.647 42.083  1.00 76.16  ? 639  PRO A CB    1 
ATOM   5796  C  CG    . PRO D 4  639  ? 10.676  -30.794 41.546  1.00 68.66  ? 639  PRO A CG    1 
ATOM   5797  C  CD    . PRO D 4  639  ? 10.278  -31.989 42.349  1.00 92.15  ? 639  PRO A CD    1 
ATOM   5798  N  N     . GLN D 4  640  ? 7.537   -30.875 40.349  1.00 87.83  ? 640  GLN A N     1 
ATOM   5799  C  CA    . GLN D 4  640  ? 6.579   -30.719 39.256  1.00 89.38  ? 640  GLN A CA    1 
ATOM   5800  C  C     . GLN D 4  640  ? 5.177   -31.135 39.684  1.00 85.92  ? 640  GLN A C     1 
ATOM   5801  O  O     . GLN D 4  640  ? 4.189   -30.485 39.311  1.00 84.06  ? 640  GLN A O     1 
ATOM   5802  C  CB    . GLN D 4  640  ? 7.031   -31.534 38.043  1.00 107.76 ? 640  GLN A CB    1 
ATOM   5803  C  CG    . GLN D 4  640  ? 8.461   -31.275 37.611  1.00 127.64 ? 640  GLN A CG    1 
ATOM   5804  C  CD    . GLN D 4  640  ? 8.568   -30.099 36.663  1.00 147.39 ? 640  GLN A CD    1 
ATOM   5805  O  OE1   . GLN D 4  640  ? 7.701   -29.888 35.814  1.00 151.18 ? 640  GLN A OE1   1 
ATOM   5806  N  NE2   . GLN D 4  640  ? 9.630   -29.316 36.810  1.00 164.14 ? 640  GLN A NE2   1 
ATOM   5807  N  N     . VAL D 4  641  ? 5.076   -32.214 40.467  1.00 87.89  ? 641  VAL A N     1 
ATOM   5808  C  CA    . VAL D 4  641  ? 3.784   -32.665 40.971  1.00 82.91  ? 641  VAL A CA    1 
ATOM   5809  C  C     . VAL D 4  641  ? 3.188   -31.627 41.914  1.00 74.55  ? 641  VAL A C     1 
ATOM   5810  O  O     . VAL D 4  641  ? 1.977   -31.387 41.906  1.00 80.48  ? 641  VAL A O     1 
ATOM   5811  C  CB    . VAL D 4  641  ? 3.930   -34.038 41.652  1.00 95.77  ? 641  VAL A CB    1 
ATOM   5812  C  CG1   . VAL D 4  641  ? 2.565   -34.636 41.963  1.00 107.86 ? 641  VAL A CG1   1 
ATOM   5813  C  CG2   . VAL D 4  641  ? 4.746   -34.983 40.774  1.00 109.41 ? 641  VAL A CG2   1 
ATOM   5814  N  N     . CYS D 4  642  ? 4.033   -30.967 42.711  1.00 65.35  ? 642  CYS A N     1 
ATOM   5815  C  CA    . CYS D 4  642  ? 3.550   -29.924 43.613  1.00 64.06  ? 642  CYS A CA    1 
ATOM   5816  C  C     . CYS D 4  642  ? 3.109   -28.681 42.846  1.00 74.43  ? 642  CYS A C     1 
ATOM   5817  O  O     . CYS D 4  642  ? 2.105   -28.043 43.197  1.00 88.26  ? 642  CYS A O     1 
ATOM   5818  C  CB    . CYS D 4  642  ? 4.638   -29.572 44.622  1.00 80.63  ? 642  CYS A CB    1 
ATOM   5819  S  SG    . CYS D 4  642  ? 3.999   -28.975 46.192  1.00 112.41 ? 642  CYS A SG    1 
ATOM   5820  N  N     . ALA D 4  643  ? 3.852   -28.322 41.796  1.00 75.15  ? 643  ALA A N     1 
ATOM   5821  C  CA    . ALA D 4  643  ? 3.497   -27.159 40.992  1.00 76.00  ? 643  ALA A CA    1 
ATOM   5822  C  C     . ALA D 4  643  ? 2.182   -27.382 40.247  1.00 94.59  ? 643  ALA A C     1 
ATOM   5823  O  O     . ALA D 4  643  ? 1.353   -26.466 40.150  1.00 95.31  ? 643  ALA A O     1 
ATOM   5824  C  CB    . ALA D 4  643  ? 4.633   -26.840 40.020  1.00 71.01  ? 643  ALA A CB    1 
ATOM   5825  N  N     . LYS D 4  644  ? 1.969   -28.593 39.718  1.00 91.88  ? 644  LYS A N     1 
ATOM   5826  C  CA    . LYS D 4  644  ? 0.673   -28.915 39.127  1.00 92.48  ? 644  LYS A CA    1 
ATOM   5827  C  C     . LYS D 4  644  ? -0.417  -29.028 40.190  1.00 84.64  ? 644  LYS A C     1 
ATOM   5828  O  O     . LYS D 4  644  ? -1.582  -28.715 39.915  1.00 87.31  ? 644  LYS A O     1 
ATOM   5829  C  CB    . LYS D 4  644  ? 0.768   -30.204 38.302  1.00 105.51 ? 644  LYS A CB    1 
ATOM   5830  C  CG    . LYS D 4  644  ? 1.685   -30.114 37.081  1.00 115.62 ? 644  LYS A CG    1 
ATOM   5831  C  CD    . LYS D 4  644  ? 1.235   -31.063 35.964  1.00 122.82 ? 644  LYS A CD    1 
ATOM   5832  C  CE    . LYS D 4  644  ? 1.315   -32.528 36.394  1.00 110.98 ? 644  LYS A CE    1 
ATOM   5833  N  NZ    . LYS D 4  644  ? 0.844   -33.454 35.323  1.00 97.06  ? 644  LYS A NZ    1 
ATOM   5834  N  N     . LEU D 4  645  ? -0.057  -29.448 41.408  1.00 89.06  ? 645  LEU A N     1 
ATOM   5835  C  CA    . LEU D 4  645  ? -1.004  -29.535 42.517  1.00 93.00  ? 645  LEU A CA    1 
ATOM   5836  C  C     . LEU D 4  645  ? -1.544  -28.162 42.904  1.00 67.08  ? 645  LEU A C     1 
ATOM   5837  O  O     . LEU D 4  645  ? -2.709  -28.040 43.307  1.00 61.30  ? 645  LEU A O     1 
ATOM   5838  C  CB    . LEU D 4  645  ? -0.293  -30.181 43.712  1.00 87.18  ? 645  LEU A CB    1 
ATOM   5839  C  CG    . LEU D 4  645  ? -0.753  -29.847 45.132  1.00 62.82  ? 645  LEU A CG    1 
ATOM   5840  C  CD1   . LEU D 4  645  ? -2.062  -30.543 45.450  1.00 63.33  ? 645  LEU A CD1   1 
ATOM   5841  C  CD2   . LEU D 4  645  ? 0.312   -30.119 46.168  1.00 70.62  ? 645  LEU A CD2   1 
ATOM   5842  N  N     . PHE D 4  646  ? -0.699  -27.131 42.790  1.00 68.27  ? 646  PHE A N     1 
ATOM   5843  C  CA    . PHE D 4  646  ? -1.147  -25.756 43.012  1.00 76.20  ? 646  PHE A CA    1 
ATOM   5844  C  C     . PHE D 4  646  ? -2.315  -25.404 42.096  1.00 81.26  ? 646  PHE A C     1 
ATOM   5845  O  O     . PHE D 4  646  ? -3.393  -25.006 42.564  1.00 80.27  ? 646  PHE A O     1 
ATOM   5846  C  CB    . PHE D 4  646  ? 0.015   -24.781 42.795  1.00 84.41  ? 646  PHE A CB    1 
ATOM   5847  C  CG    . PHE D 4  646  ? 0.834   -24.523 44.034  1.00 83.20  ? 646  PHE A CG    1 
ATOM   5848  C  CD1   . PHE D 4  646  ? 2.174   -24.878 44.076  1.00 94.81  ? 646  PHE A CD1   1 
ATOM   5849  C  CD2   . PHE D 4  646  ? 0.272   -23.923 45.150  1.00 72.40  ? 646  PHE A CD2   1 
ATOM   5850  C  CE1   . PHE D 4  646  ? 2.934   -24.651 45.210  1.00 96.70  ? 646  PHE A CE1   1 
ATOM   5851  C  CE2   . PHE D 4  646  ? 1.031   -23.694 46.287  1.00 93.67  ? 646  PHE A CE2   1 
ATOM   5852  C  CZ    . PHE D 4  646  ? 2.363   -24.060 46.313  1.00 103.37 ? 646  PHE A CZ    1 
ATOM   5853  N  N     . GLY D 4  647  ? -2.130  -25.593 40.786  1.00 86.85  ? 647  GLY A N     1 
ATOM   5854  C  CA    . GLY D 4  647  ? -3.194  -25.293 39.844  1.00 100.44 ? 647  GLY A CA    1 
ATOM   5855  C  C     . GLY D 4  647  ? -4.401  -26.198 40.001  1.00 88.73  ? 647  GLY A C     1 
ATOM   5856  O  O     . GLY D 4  647  ? -5.540  -25.753 39.840  1.00 113.95 ? 647  GLY A O     1 
ATOM   5857  N  N     . ASN D 4  648  ? -4.172  -27.473 40.328  1.00 61.46  ? 648  ASN A N     1 
ATOM   5858  C  CA    . ASN D 4  648  ? -5.286  -28.403 40.491  1.00 62.79  ? 648  ASN A CA    1 
ATOM   5859  C  C     . ASN D 4  648  ? -6.175  -28.010 41.672  1.00 71.97  ? 648  ASN A C     1 
ATOM   5860  O  O     . ASN D 4  648  ? -7.405  -28.124 41.592  1.00 79.57  ? 648  ASN A O     1 
ATOM   5861  C  CB    . ASN D 4  648  ? -4.763  -29.837 40.652  1.00 71.07  ? 648  ASN A CB    1 
ATOM   5862  C  CG    . ASN D 4  648  ? -4.089  -30.363 39.395  1.00 87.54  ? 648  ASN A CG    1 
ATOM   5863  O  OD1   . ASN D 4  648  ? -3.844  -29.614 38.446  1.00 102.52 ? 648  ASN A OD1   1 
ATOM   5864  N  ND2   . ASN D 4  648  ? -3.765  -31.651 39.391  1.00 102.50 ? 648  ASN A ND2   1 
ATOM   5865  N  N     . ILE D 4  649  ? -5.580  -27.542 42.776  1.00 76.27  ? 649  ILE A N     1 
ATOM   5866  C  CA    . ILE D 4  649  ? -6.401  -27.052 43.882  1.00 73.24  ? 649  ILE A CA    1 
ATOM   5867  C  C     . ILE D 4  649  ? -7.081  -25.748 43.494  1.00 86.13  ? 649  ILE A C     1 
ATOM   5868  O  O     . ILE D 4  649  ? -8.272  -25.541 43.781  1.00 86.40  ? 649  ILE A O     1 
ATOM   5869  C  CB    . ILE D 4  649  ? -5.562  -26.893 45.165  1.00 67.71  ? 649  ILE A CB    1 
ATOM   5870  C  CG1   . ILE D 4  649  ? -4.993  -28.238 45.613  1.00 64.76  ? 649  ILE A CG1   1 
ATOM   5871  C  CG2   . ILE D 4  649  ? -6.387  -26.269 46.299  1.00 60.59  ? 649  ILE A CG2   1 
ATOM   5872  C  CD1   . ILE D 4  649  ? -4.335  -28.191 46.980  1.00 78.55  ? 649  ILE A CD1   1 
ATOM   5873  N  N     . GLN D 4  650  ? -6.339  -24.860 42.821  1.00 100.56 ? 650  GLN A N     1 
ATOM   5874  C  CA    . GLN D 4  650  ? -6.847  -23.527 42.511  1.00 97.23  ? 650  GLN A CA    1 
ATOM   5875  C  C     . GLN D 4  650  ? -8.060  -23.580 41.589  1.00 87.55  ? 650  GLN A C     1 
ATOM   5876  O  O     . GLN D 4  650  ? -9.048  -22.875 41.821  1.00 78.59  ? 650  GLN A O     1 
ATOM   5877  C  CB    . GLN D 4  650  ? -5.735  -22.687 41.889  1.00 78.21  ? 650  GLN A CB    1 
ATOM   5878  C  CG    . GLN D 4  650  ? -4.780  -22.106 42.902  1.00 56.54  ? 650  GLN A CG    1 
ATOM   5879  C  CD    . GLN D 4  650  ? -4.028  -20.931 42.355  1.00 57.45  ? 650  GLN A CD    1 
ATOM   5880  O  OE1   . GLN D 4  650  ? -4.609  -20.043 41.727  1.00 88.14  ? 650  GLN A OE1   1 
ATOM   5881  N  NE2   . GLN D 4  650  ? -2.721  -20.919 42.569  1.00 55.89  ? 650  GLN A NE2   1 
ATOM   5882  N  N     . LYS D 4  651  ? -8.019  -24.437 40.564  1.00 78.40  ? 651  LYS A N     1 
ATOM   5883  C  CA    . LYS D 4  651  ? -9.121  -24.517 39.604  1.00 72.24  ? 651  LYS A CA    1 
ATOM   5884  C  C     . LYS D 4  651  ? -10.406 -25.008 40.265  1.00 70.16  ? 651  LYS A C     1 
ATOM   5885  O  O     . LYS D 4  651  ? -11.470 -24.397 40.095  1.00 100.35 ? 651  LYS A O     1 
ATOM   5886  C  CB    . LYS D 4  651  ? -8.715  -25.420 38.438  1.00 60.68  ? 651  LYS A CB    1 
ATOM   5887  C  CG    . LYS D 4  651  ? -7.613  -24.801 37.590  1.00 65.78  ? 651  LYS A CG    1 
ATOM   5888  C  CD    . LYS D 4  651  ? -6.739  -25.837 36.900  1.00 61.30  ? 651  LYS A CD    1 
ATOM   5889  C  CE    . LYS D 4  651  ? -5.511  -25.157 36.316  1.00 67.54  ? 651  LYS A CE    1 
ATOM   5890  N  NZ    . LYS D 4  651  ? -4.565  -26.117 35.703  1.00 77.40  ? 651  LYS A NZ    1 
ATOM   5891  N  N     . VAL D 4  652  ? -10.306 -26.066 41.072  1.00 60.84  ? 652  VAL A N     1 
ATOM   5892  C  CA    . VAL D 4  652  ? -11.476 -26.641 41.733  1.00 74.01  ? 652  VAL A CA    1 
ATOM   5893  C  C     . VAL D 4  652  ? -12.063 -25.667 42.751  1.00 81.73  ? 652  VAL A C     1 
ATOM   5894  O  O     . VAL D 4  652  ? -13.282 -25.431 42.775  1.00 77.96  ? 652  VAL A O     1 
ATOM   5895  C  CB    . VAL D 4  652  ? -11.106 -27.982 42.392  1.00 66.24  ? 652  VAL A CB    1 
ATOM   5896  C  CG1   . VAL D 4  652  ? -12.293 -28.559 43.125  1.00 63.34  ? 652  VAL A CG1   1 
ATOM   5897  C  CG2   . VAL D 4  652  ? -10.619 -28.959 41.351  1.00 63.47  ? 652  VAL A CG2   1 
ATOM   5898  N  N     . VAL D 4  653  ? -11.212 -25.088 43.608  1.00 85.49  ? 653  VAL A N     1 
ATOM   5899  C  CA    . VAL D 4  653  ? -11.724 -24.219 44.666  1.00 80.07  ? 653  VAL A CA    1 
ATOM   5900  C  C     . VAL D 4  653  ? -12.247 -22.908 44.084  1.00 83.21  ? 653  VAL A C     1 
ATOM   5901  O  O     . VAL D 4  653  ? -13.272 -22.386 44.538  1.00 89.32  ? 653  VAL A O     1 
ATOM   5902  C  CB    . VAL D 4  653  ? -10.646 -23.993 45.743  1.00 88.77  ? 653  VAL A CB    1 
ATOM   5903  C  CG1   . VAL D 4  653  ? -11.153 -23.075 46.847  1.00 94.81  ? 653  VAL A CG1   1 
ATOM   5904  C  CG2   . VAL D 4  653  ? -10.209 -25.323 46.351  1.00 95.51  ? 653  VAL A CG2   1 
ATOM   5905  N  N     . ASN D 4  654  ? -11.585 -22.372 43.049  1.00 75.36  ? 654  ASN A N     1 
ATOM   5906  C  CA    . ASN D 4  654  ? -12.078 -21.157 42.408  1.00 69.72  ? 654  ASN A CA    1 
ATOM   5907  C  C     . ASN D 4  654  ? -13.403 -21.404 41.691  1.00 81.95  ? 654  ASN A C     1 
ATOM   5908  O  O     . ASN D 4  654  ? -14.291 -20.546 41.725  1.00 96.44  ? 654  ASN A O     1 
ATOM   5909  C  CB    . ASN D 4  654  ? -11.026 -20.601 41.443  1.00 67.97  ? 654  ASN A CB    1 
ATOM   5910  C  CG    . ASN D 4  654  ? -9.862  -19.912 42.159  1.00 64.52  ? 654  ASN A CG    1 
ATOM   5911  O  OD1   . ASN D 4  654  ? -10.045 -18.895 42.835  1.00 56.19  ? 654  ASN A OD1   1 
ATOM   5912  N  ND2   . ASN D 4  654  ? -8.660  -20.449 41.989  1.00 66.64  ? 654  ASN A ND2   1 
ATOM   5913  N  N     . PHE D 4  655  ? -13.572 -22.579 41.069  1.00 81.12  ? 655  PHE A N     1 
ATOM   5914  C  CA    . PHE D 4  655  ? -14.851 -22.915 40.445  1.00 77.91  ? 655  PHE A CA    1 
ATOM   5915  C  C     . PHE D 4  655  ? -15.966 -23.022 41.486  1.00 82.47  ? 655  PHE A C     1 
ATOM   5916  O  O     . PHE D 4  655  ? -17.049 -22.435 41.319  1.00 93.11  ? 655  PHE A O     1 
ATOM   5917  C  CB    . PHE D 4  655  ? -14.713 -24.218 39.648  1.00 67.28  ? 655  PHE A CB    1 
ATOM   5918  C  CG    . PHE D 4  655  ? -15.993 -24.678 39.005  1.00 62.82  ? 655  PHE A CG    1 
ATOM   5919  C  CD1   . PHE D 4  655  ? -16.402 -24.153 37.796  1.00 84.32  ? 655  PHE A CD1   1 
ATOM   5920  C  CD2   . PHE D 4  655  ? -16.786 -25.640 39.613  1.00 63.37  ? 655  PHE A CD2   1 
ATOM   5921  C  CE1   . PHE D 4  655  ? -17.583 -24.574 37.207  1.00 93.99  ? 655  PHE A CE1   1 
ATOM   5922  C  CE2   . PHE D 4  655  ? -17.966 -26.057 39.031  1.00 74.54  ? 655  PHE A CE2   1 
ATOM   5923  C  CZ    . PHE D 4  655  ? -18.364 -25.525 37.829  1.00 83.55  ? 655  PHE A CZ    1 
ATOM   5924  N  N     . TRP D 4  656  ? -15.717 -23.777 42.569  1.00 64.76  ? 656  TRP A N     1 
ATOM   5925  C  CA    . TRP D 4  656  ? -16.730 -23.937 43.611  1.00 66.87  ? 656  TRP A CA    1 
ATOM   5926  C  C     . TRP D 4  656  ? -17.068 -22.606 44.274  1.00 89.91  ? 656  TRP A C     1 
ATOM   5927  O  O     . TRP D 4  656  ? -18.229 -22.353 44.617  1.00 101.72 ? 656  TRP A O     1 
ATOM   5928  C  CB    . TRP D 4  656  ? -16.277 -24.946 44.668  1.00 65.24  ? 656  TRP A CB    1 
ATOM   5929  C  CG    . TRP D 4  656  ? -17.371 -25.209 45.672  1.00 76.22  ? 656  TRP A CG    1 
ATOM   5930  C  CD1   . TRP D 4  656  ? -18.391 -26.106 45.554  1.00 87.75  ? 656  TRP A CD1   1 
ATOM   5931  C  CD2   . TRP D 4  656  ? -17.592 -24.515 46.912  1.00 75.74  ? 656  TRP A CD2   1 
ATOM   5932  N  NE1   . TRP D 4  656  ? -19.216 -26.037 46.653  1.00 81.06  ? 656  TRP A NE1   1 
ATOM   5933  C  CE2   . TRP D 4  656  ? -18.749 -25.065 47.498  1.00 78.14  ? 656  TRP A CE2   1 
ATOM   5934  C  CE3   . TRP D 4  656  ? -16.917 -23.492 47.587  1.00 70.76  ? 656  TRP A CE3   1 
ATOM   5935  C  CZ2   . TRP D 4  656  ? -19.247 -24.626 48.725  1.00 73.01  ? 656  TRP A CZ2   1 
ATOM   5936  C  CZ3   . TRP D 4  656  ? -17.415 -23.060 48.808  1.00 65.20  ? 656  TRP A CZ3   1 
ATOM   5937  C  CH2   . TRP D 4  656  ? -18.567 -23.628 49.364  1.00 61.54  ? 656  TRP A CH2   1 
ATOM   5938  N  N     . LEU D 4  657  ? -16.067 -21.740 44.462  1.00 90.32  ? 657  LEU A N     1 
ATOM   5939  C  CA    . LEU D 4  657  ? -16.308 -20.441 45.081  1.00 87.19  ? 657  LEU A CA    1 
ATOM   5940  C  C     . LEU D 4  657  ? -17.061 -19.514 44.133  1.00 89.70  ? 657  LEU A C     1 
ATOM   5941  O  O     . LEU D 4  657  ? -17.935 -18.752 44.566  1.00 104.58 ? 657  LEU A O     1 
ATOM   5942  C  CB    . LEU D 4  657  ? -14.974 -19.822 45.508  1.00 75.92  ? 657  LEU A CB    1 
ATOM   5943  C  CG    . LEU D 4  657  ? -14.996 -18.418 46.118  1.00 60.97  ? 657  LEU A CG    1 
ATOM   5944  C  CD1   . LEU D 4  657  ? -15.903 -18.403 47.336  1.00 56.99  ? 657  LEU A CD1   1 
ATOM   5945  C  CD2   . LEU D 4  657  ? -13.591 -17.921 46.452  1.00 54.57  ? 657  LEU A CD2   1 
ATOM   5946  N  N     . LEU D 4  658  ? -16.731 -19.566 42.837  1.00 75.30  ? 658  LEU A N     1 
ATOM   5947  C  CA    . LEU D 4  658  ? -17.416 -18.749 41.840  1.00 76.98  ? 658  LEU A CA    1 
ATOM   5948  C  C     . LEU D 4  658  ? -18.889 -19.112 41.745  1.00 92.84  ? 658  LEU A C     1 
ATOM   5949  O  O     . LEU D 4  658  ? -19.743 -18.233 41.575  1.00 97.32  ? 658  LEU A O     1 
ATOM   5950  C  CB    . LEU D 4  658  ? -16.730 -18.921 40.484  1.00 71.36  ? 658  LEU A CB    1 
ATOM   5951  C  CG    . LEU D 4  658  ? -17.516 -18.614 39.203  1.00 64.36  ? 658  LEU A CG    1 
ATOM   5952  C  CD1   . LEU D 4  658  ? -17.856 -17.133 39.049  1.00 57.62  ? 658  LEU A CD1   1 
ATOM   5953  C  CD2   . LEU D 4  658  ? -16.758 -19.144 37.990  1.00 69.74  ? 658  LEU A CD2   1 
ATOM   5954  N  N     . HIS D 4  659  ? -19.208 -20.399 41.851  1.00 103.54 ? 659  HIS A N     1 
ATOM   5955  C  CA    . HIS D 4  659  ? -20.612 -20.791 41.838  1.00 102.67 ? 659  HIS A CA    1 
ATOM   5956  C  C     . HIS D 4  659  ? -21.249 -20.770 43.223  1.00 96.76  ? 659  HIS A C     1 
ATOM   5957  O  O     . HIS D 4  659  ? -22.472 -20.918 43.328  1.00 87.63  ? 659  HIS A O     1 
ATOM   5958  C  CB    . HIS D 4  659  ? -20.765 -22.166 41.184  1.00 110.19 ? 659  HIS A CB    1 
ATOM   5959  C  CG    . HIS D 4  659  ? -20.523 -22.147 39.706  1.00 98.72  ? 659  HIS A CG    1 
ATOM   5960  N  ND1   . HIS D 4  659  ? -19.345 -21.693 39.151  1.00 101.00 ? 659  HIS A ND1   1 
ATOM   5961  C  CD2   . HIS D 4  659  ? -21.317 -22.501 38.667  1.00 102.24 ? 659  HIS A CD2   1 
ATOM   5962  C  CE1   . HIS D 4  659  ? -19.419 -21.775 37.835  1.00 100.41 ? 659  HIS A CE1   1 
ATOM   5963  N  NE2   . HIS D 4  659  ? -20.604 -22.264 37.517  1.00 105.84 ? 659  HIS A NE2   1 
ATOM   5964  N  N     . ASN D 4  660  ? -20.461 -20.561 44.279  1.00 95.44  ? 660  ASN A N     1 
ATOM   5965  C  CA    . ASN D 4  660  ? -21.008 -20.403 45.621  1.00 95.37  ? 660  ASN A CA    1 
ATOM   5966  C  C     . ASN D 4  660  ? -21.192 -18.932 45.983  1.00 74.72  ? 660  ASN A C     1 
ATOM   5967  O  O     . ASN D 4  660  ? -22.253 -18.542 46.477  1.00 59.93  ? 660  ASN A O     1 
ATOM   5968  C  CB    . ASN D 4  660  ? -20.102 -21.106 46.641  1.00 102.76 ? 660  ASN A CB    1 
ATOM   5969  C  CG    . ASN D 4  660  ? -20.726 -21.185 48.026  1.00 98.56  ? 660  ASN A CG    1 
ATOM   5970  O  OD1   . ASN D 4  660  ? -21.378 -22.174 48.369  1.00 109.62 ? 660  ASN A OD1   1 
ATOM   5971  N  ND2   . ASN D 4  660  ? -20.507 -20.156 48.837  1.00 79.26  ? 660  ASN A ND2   1 
ATOM   5972  N  N     . GLY D 4  661  ? -20.181 -18.110 45.743  1.00 90.52  ? 661  GLY A N     1 
ATOM   5973  C  CA    . GLY D 4  661  ? -20.296 -16.690 46.060  1.00 97.04  ? 661  GLY A CA    1 
ATOM   5974  C  C     . GLY D 4  661  ? -19.946 -16.389 47.504  1.00 102.66 ? 661  GLY A C     1 
ATOM   5975  O  O     . GLY D 4  661  ? -20.144 -17.201 48.409  1.00 106.86 ? 661  GLY A O     1 
ATOM   5976  N  N     . PHE D 4  662  ? -19.407 -15.187 47.720  1.00 108.65 ? 662  PHE A N     1 
ATOM   5977  C  CA    . PHE D 4  662  ? -18.957 -14.748 49.037  1.00 99.71  ? 662  PHE A CA    1 
ATOM   5978  C  C     . PHE D 4  662  ? -18.737 -13.238 48.986  1.00 101.99 ? 662  PHE A C     1 
ATOM   5979  O  O     . PHE D 4  662  ? -18.222 -12.723 47.992  1.00 92.67  ? 662  PHE A O     1 
ATOM   5980  C  CB    . PHE D 4  662  ? -17.655 -15.458 49.442  1.00 82.27  ? 662  PHE A CB    1 
ATOM   5981  C  CG    . PHE D 4  662  ? -17.094 -14.997 50.753  1.00 71.91  ? 662  PHE A CG    1 
ATOM   5982  C  CD1   . PHE D 4  662  ? -17.810 -15.171 51.927  1.00 59.24  ? 662  PHE A CD1   1 
ATOM   5983  C  CD2   . PHE D 4  662  ? -15.873 -14.344 50.807  1.00 68.70  ? 662  PHE A CD2   1 
ATOM   5984  C  CE1   . PHE D 4  662  ? -17.293 -14.740 53.132  1.00 59.10  ? 662  PHE A CE1   1 
ATOM   5985  C  CE2   . PHE D 4  662  ? -15.360 -13.899 52.012  1.00 61.33  ? 662  PHE A CE2   1 
ATOM   5986  C  CZ    . PHE D 4  662  ? -16.071 -14.100 53.173  1.00 63.97  ? 662  PHE A CZ    1 
ATOM   5987  N  N     . SER D 4  663  ? -19.103 -12.539 50.062  1.00 114.51 ? 663  SER A N     1 
ATOM   5988  C  CA    . SER D 4  663  ? -19.050 -11.079 50.092  1.00 118.38 ? 663  SER A CA    1 
ATOM   5989  C  C     . SER D 4  663  ? -18.685 -10.604 51.492  1.00 116.04 ? 663  SER A C     1 
ATOM   5990  O  O     . SER D 4  663  ? -18.361 -11.403 52.365  1.00 126.52 ? 663  SER A O     1 
ATOM   5991  C  CB    . SER D 4  663  ? -20.378 -10.471 49.646  1.00 130.52 ? 663  SER A CB    1 
ATOM   5992  O  OG    . SER D 4  663  ? -20.334 -10.194 48.261  1.00 143.67 ? 663  SER A OG    1 
ATOM   5993  N  N     . THR D 4  664  ? -18.707 -9.281  51.686  1.00 108.77 ? 664  THR A N     1 
ATOM   5994  C  CA    . THR D 4  664  ? -18.481 -8.666  52.996  1.00 107.02 ? 664  THR A CA    1 
ATOM   5995  C  C     . THR D 4  664  ? -19.118 -7.284  53.023  1.00 102.43 ? 664  THR A C     1 
ATOM   5996  O  O     . THR D 4  664  ? -18.811 -6.453  52.166  1.00 119.09 ? 664  THR A O     1 
ATOM   5997  C  CB    . THR D 4  664  ? -16.986 -8.567  53.322  1.00 108.97 ? 664  THR A CB    1 
ATOM   5998  O  OG1   . THR D 4  664  ? -16.435 -9.883  53.430  1.00 119.19 ? 664  THR A OG1   1 
ATOM   5999  C  CG2   . THR D 4  664  ? -16.754 -7.818  54.629  1.00 108.29 ? 664  THR A CG2   1 
ATOM   6000  N  N     . GLY D 4  665  ? -19.988 -7.034  54.008  1.00 90.47  ? 665  GLY A N     1 
ATOM   6001  C  CA    . GLY D 4  665  ? -20.601 -5.725  54.186  1.00 88.33  ? 665  GLY A CA    1 
ATOM   6002  C  C     . GLY D 4  665  ? -20.467 -5.148  55.587  1.00 88.27  ? 665  GLY A C     1 
ATOM   6003  O  O     . GLY D 4  665  ? -19.804 -5.748  56.440  1.00 100.88 ? 665  GLY A O     1 
ATOM   6004  N  N     . ILE D 4  666  ? -21.087 -3.987  55.842  1.00 75.24  ? 666  ILE A N     1 
ATOM   6005  C  CA    . ILE D 4  666  ? -21.070 -3.401  57.187  1.00 95.36  ? 666  ILE A CA    1 
ATOM   6006  C  C     . ILE D 4  666  ? -21.838 -4.232  58.205  1.00 113.10 ? 666  ILE A C     1 
ATOM   6007  O  O     . ILE D 4  666  ? -21.603 -4.091  59.411  1.00 129.08 ? 666  ILE A O     1 
ATOM   6008  C  CB    . ILE D 4  666  ? -21.589 -1.941  57.212  1.00 99.90  ? 666  ILE A CB    1 
ATOM   6009  C  CG1   . ILE D 4  666  ? -23.017 -1.795  56.642  1.00 97.77  ? 666  ILE A CG1   1 
ATOM   6010  C  CG2   . ILE D 4  666  ? -20.551 -0.960  56.661  1.00 48.92  ? 666  ILE A CG2   1 
ATOM   6011  C  CD1   . ILE D 4  666  ? -24.110 -2.641  57.298  1.00 100.01 ? 666  ILE A CD1   1 
ATOM   6012  N  N     . GLY D 4  667  ? -22.763 -5.083  57.759  1.00 101.19 ? 667  GLY A N     1 
ATOM   6013  C  CA    . GLY D 4  667  ? -23.430 -5.976  58.696  1.00 100.50 ? 667  GLY A CA    1 
ATOM   6014  C  C     . GLY D 4  667  ? -22.497 -6.975  59.348  1.00 88.74  ? 667  GLY A C     1 
ATOM   6015  O  O     . GLY D 4  667  ? -22.823 -7.512  60.412  1.00 77.93  ? 667  GLY A O     1 
ATOM   6016  N  N     . ASP D 4  668  ? -21.349 -7.244  58.719  1.00 87.09  ? 668  ASP A N     1 
ATOM   6017  C  CA    . ASP D 4  668  ? -20.296 -8.060  59.309  1.00 97.24  ? 668  ASP A CA    1 
ATOM   6018  C  C     . ASP D 4  668  ? -19.501 -7.318  60.371  1.00 93.54  ? 668  ASP A C     1 
ATOM   6019  O  O     . ASP D 4  668  ? -18.630 -7.927  61.001  1.00 98.51  ? 668  ASP A O     1 
ATOM   6020  C  CB    . ASP D 4  668  ? -19.351 -8.553  58.213  1.00 103.87 ? 668  ASP A CB    1 
ATOM   6021  C  CG    . ASP D 4  668  ? -20.083 -9.258  57.092  1.00 106.79 ? 668  ASP A CG    1 
ATOM   6022  O  OD1   . ASP D 4  668  ? -21.189 -9.787  57.335  1.00 102.29 ? 668  ASP A OD1   1 
ATOM   6023  O  OD2   . ASP D 4  668  ? -19.566 -9.266  55.962  1.00 105.23 ? 668  ASP A OD2   1 
ATOM   6024  N  N     . THR D 4  669  ? -19.759 -6.024  60.567  1.00 84.77  ? 669  THR A N     1 
ATOM   6025  C  CA    . THR D 4  669  ? -19.106 -5.240  61.605  1.00 76.24  ? 669  THR A CA    1 
ATOM   6026  C  C     . THR D 4  669  ? -20.050 -4.838  62.732  1.00 76.93  ? 669  THR A C     1 
ATOM   6027  O  O     . THR D 4  669  ? -19.621 -4.149  63.662  1.00 89.51  ? 669  THR A O     1 
ATOM   6028  C  CB    . THR D 4  669  ? -18.474 -3.976  61.006  1.00 68.21  ? 669  THR A CB    1 
ATOM   6029  O  OG1   . THR D 4  669  ? -19.507 -3.142  60.469  1.00 88.49  ? 669  THR A OG1   1 
ATOM   6030  C  CG2   . THR D 4  669  ? -17.488 -4.329  59.896  1.00 48.86  ? 669  THR A CG2   1 
ATOM   6031  N  N     . ILE D 4  670  ? -21.316 -5.243  62.680  1.00 77.99  ? 670  ILE A N     1 
ATOM   6032  C  CA    . ILE D 4  670  ? -22.319 -4.816  63.649  1.00 90.02  ? 670  ILE A CA    1 
ATOM   6033  C  C     . ILE D 4  670  ? -22.580 -5.956  64.626  1.00 84.37  ? 670  ILE A C     1 
ATOM   6034  O  O     . ILE D 4  670  ? -23.076 -7.020  64.235  1.00 94.62  ? 670  ILE A O     1 
ATOM   6035  C  CB    . ILE D 4  670  ? -23.615 -4.375  62.949  1.00 100.25 ? 670  ILE A CB    1 
ATOM   6036  C  CG1   . ILE D 4  670  ? -23.347 -3.104  62.137  1.00 105.92 ? 670  ILE A CG1   1 
ATOM   6037  C  CG2   . ILE D 4  670  ? -24.741 -4.165  63.958  1.00 101.71 ? 670  ILE A CG2   1 
ATOM   6038  C  CD1   . ILE D 4  670  ? -24.582 -2.417  61.608  1.00 109.94 ? 670  ILE A CD1   1 
ATOM   6039  N  N     . ALA D 4  671  ? -22.256 -5.733  65.901  1.00 69.01  ? 671  ALA A N     1 
ATOM   6040  C  CA    . ALA D 4  671  ? -22.599 -6.674  66.953  1.00 70.81  ? 671  ALA A CA    1 
ATOM   6041  C  C     . ALA D 4  671  ? -24.006 -6.375  67.470  1.00 79.30  ? 671  ALA A C     1 
ATOM   6042  O  O     . ALA D 4  671  ? -24.680 -5.449  67.010  1.00 93.17  ? 671  ALA A O     1 
ATOM   6043  C  CB    . ALA D 4  671  ? -21.569 -6.616  68.081  1.00 75.32  ? 671  ALA A CB    1 
ATOM   6044  N  N     . ASP D 4  672  ? -24.458 -7.170  68.441  1.00 75.68  ? 672  ASP A N     1 
ATOM   6045  C  CA    . ASP D 4  672  ? -25.779 -6.992  69.028  1.00 88.84  ? 672  ASP A CA    1 
ATOM   6046  C  C     . ASP D 4  672  ? -25.871 -5.677  69.799  1.00 106.51 ? 672  ASP A C     1 
ATOM   6047  O  O     . ASP D 4  672  ? -24.867 -5.051  70.153  1.00 113.07 ? 672  ASP A O     1 
ATOM   6048  C  CB    . ASP D 4  672  ? -26.119 -8.155  69.966  1.00 102.62 ? 672  ASP A CB    1 
ATOM   6049  C  CG    . ASP D 4  672  ? -26.316 -9.462  69.226  1.00 120.32 ? 672  ASP A CG    1 
ATOM   6050  O  OD1   . ASP D 4  672  ? -25.562 -9.720  68.266  1.00 133.02 ? 672  ASP A OD1   1 
ATOM   6051  O  OD2   . ASP D 4  672  ? -27.216 -10.238 69.610  1.00 124.92 ? 672  ASP A OD2   1 
ATOM   6052  N  N     . GLY D 4  673  ? -27.110 -5.248  70.025  1.00 115.42 ? 673  GLY A N     1 
ATOM   6053  C  CA    . GLY D 4  673  ? -27.411 -4.170  70.940  1.00 121.27 ? 673  GLY A CA    1 
ATOM   6054  C  C     . GLY D 4  673  ? -26.954 -4.445  72.363  1.00 127.56 ? 673  GLY A C     1 
ATOM   6055  O  O     . GLY D 4  673  ? -26.268 -3.621  72.983  1.00 155.34 ? 673  GLY A O     1 
ATOM   6056  N  N     . PRO D 4  674  ? -27.370 -5.593  72.927  1.00 95.44  ? 674  PRO A N     1 
ATOM   6057  C  CA    . PRO D 4  674  ? -26.810 -6.011  74.227  1.00 95.71  ? 674  PRO A CA    1 
ATOM   6058  C  C     . PRO D 4  674  ? -25.292 -6.118  74.255  1.00 86.54  ? 674  PRO A C     1 
ATOM   6059  O  O     . PRO D 4  674  ? -24.673 -5.770  75.271  1.00 117.68 ? 674  PRO A O     1 
ATOM   6060  C  CB    . PRO D 4  674  ? -27.477 -7.372  74.453  1.00 81.50  ? 674  PRO A CB    1 
ATOM   6061  C  CG    . PRO D 4  674  ? -28.809 -7.212  73.833  1.00 72.90  ? 674  PRO A CG    1 
ATOM   6062  C  CD    . PRO D 4  674  ? -28.615 -6.329  72.625  1.00 78.09  ? 674  PRO A CD    1 
ATOM   6063  N  N     . THR D 4  675  ? -24.670 -6.576  73.165  1.00 60.35  ? 675  THR A N     1 
ATOM   6064  C  CA    . THR D 4  675  ? -23.211 -6.671  73.134  1.00 78.91  ? 675  THR A CA    1 
ATOM   6065  C  C     . THR D 4  675  ? -22.557 -5.293  73.095  1.00 89.12  ? 675  THR A C     1 
ATOM   6066  O  O     . THR D 4  675  ? -21.523 -5.074  73.736  1.00 87.05  ? 675  THR A O     1 
ATOM   6067  C  CB    . THR D 4  675  ? -22.770 -7.518  71.943  1.00 75.44  ? 675  THR A CB    1 
ATOM   6068  O  OG1   . THR D 4  675  ? -23.509 -8.745  71.951  1.00 97.06  ? 675  THR A OG1   1 
ATOM   6069  C  CG2   . THR D 4  675  ? -21.276 -7.811  71.998  1.00 57.62  ? 675  THR A CG2   1 
ATOM   6070  N  N     . MET D 4  676  ? -23.157 -4.344  72.375  1.00 99.74  ? 676  MET A N     1 
ATOM   6071  C  CA    . MET D 4  676  ? -22.630 -2.981  72.371  1.00 103.05 ? 676  MET A CA    1 
ATOM   6072  C  C     . MET D 4  676  ? -22.792 -2.323  73.738  1.00 112.04 ? 676  MET A C     1 
ATOM   6073  O  O     . MET D 4  676  ? -21.898 -1.596  74.196  1.00 114.96 ? 676  MET A O     1 
ATOM   6074  C  CB    . MET D 4  676  ? -23.320 -2.157  71.285  1.00 93.33  ? 676  MET A CB    1 
ATOM   6075  C  CG    . MET D 4  676  ? -22.783 -2.423  69.888  1.00 99.44  ? 676  MET A CG    1 
ATOM   6076  S  SD    . MET D 4  676  ? -21.040 -1.973  69.705  1.00 105.34 ? 676  MET A SD    1 
ATOM   6077  C  CE    . MET D 4  676  ? -20.918 -1.843  67.920  1.00 112.86 ? 676  MET A CE    1 
ATOM   6078  N  N     . ARG D 4  677  ? -23.923 -2.579  74.407  1.00 110.33 ? 677  ARG A N     1 
ATOM   6079  C  CA    . ARG D 4  677  ? -24.134 -2.049  75.751  1.00 102.51 ? 677  ARG A CA    1 
ATOM   6080  C  C     . ARG D 4  677  ? -23.118 -2.623  76.737  1.00 105.89 ? 677  ARG A C     1 
ATOM   6081  O  O     . ARG D 4  677  ? -22.554 -1.889  77.557  1.00 117.94 ? 677  ARG A O     1 
ATOM   6082  C  CB    . ARG D 4  677  ? -25.566 -2.341  76.206  1.00 97.29  ? 677  ARG A CB    1 
ATOM   6083  C  CG    . ARG D 4  677  ? -25.898 -1.803  77.586  1.00 113.01 ? 677  ARG A CG    1 
ATOM   6084  C  CD    . ARG D 4  677  ? -27.393 -1.809  77.861  1.00 131.84 ? 677  ARG A CD    1 
ATOM   6085  N  NE    . ARG D 4  677  ? -27.687 -1.335  79.212  1.00 152.70 ? 677  ARG A NE    1 
ATOM   6086  C  CZ    . ARG D 4  677  ? -28.895 -0.970  79.630  1.00 155.72 ? 677  ARG A CZ    1 
ATOM   6087  N  NH1   . ARG D 4  677  ? -29.928 -1.025  78.799  1.00 160.65 ? 677  ARG A NH1   1 
ATOM   6088  N  NH2   . ARG D 4  677  ? -29.071 -0.546  80.877  1.00 140.76 ? 677  ARG A NH2   1 
ATOM   6089  N  N     . GLU D 4  678  ? -22.848 -3.931  76.649  1.00 99.23  ? 678  GLU A N     1 
ATOM   6090  C  CA    . GLU D 4  678  ? -21.834 -4.544  77.505  1.00 86.88  ? 678  GLU A CA    1 
ATOM   6091  C  C     . GLU D 4  678  ? -20.428 -4.037  77.176  1.00 98.78  ? 678  GLU A C     1 
ATOM   6092  O  O     . GLU D 4  678  ? -19.592 -3.894  78.079  1.00 114.21 ? 678  GLU A O     1 
ATOM   6093  C  CB    . GLU D 4  678  ? -21.904 -6.065  77.370  1.00 80.53  ? 678  GLU A CB    1 
ATOM   6094  C  CG    . GLU D 4  678  ? -20.975 -6.832  78.293  1.00 102.96 ? 678  GLU A CG    1 
ATOM   6095  C  CD    . GLU D 4  678  ? -21.217 -8.325  78.232  1.00 134.93 ? 678  GLU A CD    1 
ATOM   6096  O  OE1   . GLU D 4  678  ? -20.834 -9.038  79.185  1.00 146.02 ? 678  GLU A OE1   1 
ATOM   6097  O  OE2   . GLU D 4  678  ? -21.783 -8.785  77.217  1.00 143.10 ? 678  GLU A OE2   1 
ATOM   6098  N  N     . ILE D 4  679  ? -20.165 -3.715  75.907  1.00 93.39  ? 679  ILE A N     1 
ATOM   6099  C  CA    . ILE D 4  679  ? -18.849 -3.209  75.515  1.00 94.73  ? 679  ILE A CA    1 
ATOM   6100  C  C     . ILE D 4  679  ? -18.624 -1.803  76.074  1.00 97.22  ? 679  ILE A C     1 
ATOM   6101  O  O     . ILE D 4  679  ? -17.561 -1.499  76.639  1.00 95.35  ? 679  ILE A O     1 
ATOM   6102  C  CB    . ILE D 4  679  ? -18.709 -3.258  73.980  1.00 76.21  ? 679  ILE A CB    1 
ATOM   6103  C  CG1   . ILE D 4  679  ? -18.330 -4.677  73.532  1.00 69.01  ? 679  ILE A CG1   1 
ATOM   6104  C  CG2   . ILE D 4  679  ? -17.687 -2.241  73.476  1.00 64.00  ? 679  ILE A CG2   1 
ATOM   6105  C  CD1   . ILE D 4  679  ? -18.262 -4.874  72.031  1.00 53.85  ? 679  ILE A CD1   1 
ATOM   6106  N  N     . THR D 4  680  ? -19.633 -0.931  75.958  1.00 89.28  ? 680  THR A N     1 
ATOM   6107  C  CA    . THR D 4  680  ? -19.465 0.415   76.501  1.00 100.67 ? 680  THR A CA    1 
ATOM   6108  C  C     . THR D 4  680  ? -19.499 0.403   78.030  1.00 121.09 ? 680  THR A C     1 
ATOM   6109  O  O     . THR D 4  680  ? -18.884 1.266   78.663  1.00 130.61 ? 680  THR A O     1 
ATOM   6110  C  CB    . THR D 4  680  ? -20.512 1.381   75.920  1.00 98.73  ? 680  THR A CB    1 
ATOM   6111  O  OG1   . THR D 4  680  ? -20.239 2.716   76.369  1.00 111.61 ? 680  THR A OG1   1 
ATOM   6112  C  CG2   . THR D 4  680  ? -21.926 1.013   76.345  1.00 79.60  ? 680  THR A CG2   1 
ATOM   6113  N  N     . GLU D 4  681  ? -20.155 -0.594  78.639  1.00 127.49 ? 681  GLU A N     1 
ATOM   6114  C  CA    . GLU D 4  681  ? -20.074 -0.762  80.089  1.00 127.84 ? 681  GLU A CA    1 
ATOM   6115  C  C     . GLU D 4  681  ? -18.660 -1.156  80.513  1.00 131.15 ? 681  GLU A C     1 
ATOM   6116  O  O     . GLU D 4  681  ? -18.156 -0.680  81.542  1.00 137.23 ? 681  GLU A O     1 
ATOM   6117  C  CB    . GLU D 4  681  ? -21.108 -1.792  80.557  1.00 140.66 ? 681  GLU A CB    1 
ATOM   6118  C  CG    . GLU D 4  681  ? -20.886 -2.403  81.953  1.00 161.21 ? 681  GLU A CG    1 
ATOM   6119  C  CD    . GLU D 4  681  ? -20.136 -3.732  81.947  1.00 166.35 ? 681  GLU A CD    1 
ATOM   6120  O  OE1   . GLU D 4  681  ? -19.914 -4.292  83.043  1.00 166.20 ? 681  GLU A OE1   1 
ATOM   6121  O  OE2   . GLU D 4  681  ? -19.782 -4.224  80.858  1.00 163.68 ? 681  GLU A OE2   1 
ATOM   6122  N  N     . THR D 4  682  ? -18.011 -2.027  79.729  1.00 131.68 ? 682  THR A N     1 
ATOM   6123  C  CA    . THR D 4  682  ? -16.606 -2.367  79.965  1.00 133.25 ? 682  THR A CA    1 
ATOM   6124  C  C     . THR D 4  682  ? -15.702 -1.137  79.862  1.00 129.58 ? 682  THR A C     1 
ATOM   6125  O  O     . THR D 4  682  ? -14.818 -0.928  80.710  1.00 143.55 ? 682  THR A O     1 
ATOM   6126  C  CB    . THR D 4  682  ? -16.159 -3.443  78.968  1.00 131.67 ? 682  THR A CB    1 
ATOM   6127  O  OG1   . THR D 4  682  ? -16.981 -4.612  79.112  1.00 127.17 ? 682  THR A OG1   1 
ATOM   6128  C  CG2   . THR D 4  682  ? -14.692 -3.816  79.165  1.00 133.79 ? 682  THR A CG2   1 
ATOM   6129  N  N     . ILE D 4  683  ? -15.917 -0.308  78.834  1.00 116.51 ? 683  ILE A N     1 
ATOM   6130  C  CA    . ILE D 4  683  ? -15.126 0.919   78.691  1.00 116.06 ? 683  ILE A CA    1 
ATOM   6131  C  C     . ILE D 4  683  ? -15.379 1.868   79.865  1.00 121.44 ? 683  ILE A C     1 
ATOM   6132  O  O     . ILE D 4  683  ? -14.450 2.507   80.375  1.00 113.95 ? 683  ILE A O     1 
ATOM   6133  C  CB    . ILE D 4  683  ? -15.408 1.595   77.333  1.00 100.16 ? 683  ILE A CB    1 
ATOM   6134  C  CG1   . ILE D 4  683  ? -15.190 0.619   76.175  1.00 75.81  ? 683  ILE A CG1   1 
ATOM   6135  C  CG2   . ILE D 4  683  ? -14.510 2.807   77.125  1.00 93.49  ? 683  ILE A CG2   1 
ATOM   6136  C  CD1   . ILE D 4  683  ? -13.781 0.062   76.096  1.00 63.48  ? 683  ILE A CD1   1 
ATOM   6137  N  N     . ALA D 4  684  ? -16.628 1.938   80.341  1.00 133.56 ? 684  ALA A N     1 
ATOM   6138  C  CA    . ALA D 4  684  ? -16.960 2.817   81.461  1.00 136.57 ? 684  ALA A CA    1 
ATOM   6139  C  C     . ALA D 4  684  ? -16.305 2.354   82.764  1.00 128.20 ? 684  ALA A C     1 
ATOM   6140  O  O     . ALA D 4  684  ? -15.810 3.180   83.542  1.00 116.57 ? 684  ALA A O     1 
ATOM   6141  C  CB    . ALA D 4  684  ? -18.479 2.904   81.619  1.00 140.67 ? 684  ALA A CB    1 
ATOM   6142  N  N     . GLU D 4  685  ? -16.285 1.039   83.022  1.00 117.68 ? 685  GLU A N     1 
ATOM   6143  C  CA    . GLU D 4  685  ? -15.628 0.556   84.237  1.00 94.86  ? 685  GLU A CA    1 
ATOM   6144  C  C     . GLU D 4  685  ? -14.108 0.701   84.150  1.00 83.90  ? 685  GLU A C     1 
ATOM   6145  O  O     . GLU D 4  685  ? -13.448 0.915   85.178  1.00 98.99  ? 685  GLU A O     1 
ATOM   6146  C  CB    . GLU D 4  685  ? -16.036 -0.894  84.540  1.00 110.93 ? 685  GLU A CB    1 
ATOM   6147  C  CG    . GLU D 4  685  ? -15.347 -1.980  83.711  1.00 123.98 ? 685  GLU A CG    1 
ATOM   6148  C  CD    . GLU D 4  685  ? -15.848 -3.384  84.029  1.00 125.00 ? 685  GLU A CD    1 
ATOM   6149  O  OE1   . GLU D 4  685  ? -16.864 -3.513  84.745  1.00 126.37 ? 685  GLU A OE1   1 
ATOM   6150  O  OE2   . GLU D 4  685  ? -15.221 -4.360  83.563  1.00 116.98 ? 685  GLU A OE2   1 
ATOM   6151  N  N     . ALA D 4  686  ? -13.537 0.651   82.938  1.00 79.02  ? 686  ALA A N     1 
ATOM   6152  C  CA    . ALA D 4  686  ? -12.125 1.005   82.785  1.00 73.05  ? 686  ALA A CA    1 
ATOM   6153  C  C     . ALA D 4  686  ? -11.888 2.484   83.067  1.00 89.53  ? 686  ALA A C     1 
ATOM   6154  O  O     . ALA D 4  686  ? -10.862 2.857   83.652  1.00 106.96 ? 686  ALA A O     1 
ATOM   6155  C  CB    . ALA D 4  686  ? -11.635 0.662   81.382  1.00 59.27  ? 686  ALA A CB    1 
ATOM   6156  N  N     . LYS D 4  687  ? -12.824 3.340   82.645  1.00 93.99  ? 687  LYS A N     1 
ATOM   6157  C  CA    . LYS D 4  687  ? -12.722 4.768   82.940  1.00 112.65 ? 687  LYS A CA    1 
ATOM   6158  C  C     . LYS D 4  687  ? -12.778 5.031   84.443  1.00 116.94 ? 687  LYS A C     1 
ATOM   6159  O  O     . LYS D 4  687  ? -12.046 5.885   84.962  1.00 115.00 ? 687  LYS A O     1 
ATOM   6160  C  CB    . LYS D 4  687  ? -13.835 5.531   82.217  1.00 111.82 ? 687  LYS A CB    1 
ATOM   6161  C  CG    . LYS D 4  687  ? -13.647 5.647   80.708  1.00 93.40  ? 687  LYS A CG    1 
ATOM   6162  C  CD    . LYS D 4  687  ? -14.886 6.216   80.035  1.00 81.54  ? 687  LYS A CD    1 
ATOM   6163  C  CE    . LYS D 4  687  ? -14.646 7.630   79.539  1.00 77.19  ? 687  LYS A CE    1 
ATOM   6164  N  NZ    . LYS D 4  687  ? -13.647 7.686   78.440  1.00 73.30  ? 687  LYS A NZ    1 
ATOM   6165  N  N     . LYS D 4  688  ? -13.636 4.298   85.158  1.00 119.24 ? 688  LYS A N     1 
ATOM   6166  C  CA    . LYS D 4  688  ? -13.702 4.444   86.613  1.00 112.17 ? 688  LYS A CA    1 
ATOM   6167  C  C     . LYS D 4  688  ? -12.426 3.940   87.281  1.00 89.08  ? 688  LYS A C     1 
ATOM   6168  O  O     . LYS D 4  688  ? -11.968 4.527   88.271  1.00 98.50  ? 688  LYS A O     1 
ATOM   6169  C  CB    . LYS D 4  688  ? -14.924 3.712   87.172  1.00 129.06 ? 688  LYS A CB    1 
ATOM   6170  C  CG    . LYS D 4  688  ? -15.953 4.631   87.820  1.00 133.09 ? 688  LYS A CG    1 
ATOM   6171  C  CD    . LYS D 4  688  ? -16.452 5.664   86.822  1.00 134.43 ? 688  LYS A CD    1 
ATOM   6172  C  CE    . LYS D 4  688  ? -17.293 5.013   85.738  1.00 140.26 ? 688  LYS A CE    1 
ATOM   6173  N  NZ    . LYS D 4  688  ? -17.497 5.894   84.553  1.00 146.62 ? 688  LYS A NZ    1 
ATOM   6174  N  N     . LYS D 4  689  ? -11.846 2.852   86.755  1.00 79.68  ? 689  LYS A N     1 
ATOM   6175  C  CA    . LYS D 4  689  ? -10.537 2.391   87.225  1.00 95.73  ? 689  LYS A CA    1 
ATOM   6176  C  C     . LYS D 4  689  ? -9.474  3.477   87.068  1.00 90.18  ? 689  LYS A C     1 
ATOM   6177  O  O     . LYS D 4  689  ? -8.679  3.728   87.989  1.00 100.75 ? 689  LYS A O     1 
ATOM   6178  C  CB    . LYS D 4  689  ? -10.122 1.130   86.464  1.00 104.48 ? 689  LYS A CB    1 
ATOM   6179  C  CG    . LYS D 4  689  ? -10.328 -0.181  87.211  1.00 110.73 ? 689  LYS A CG    1 
ATOM   6180  C  CD    . LYS D 4  689  ? -9.603  -1.327  86.503  1.00 109.31 ? 689  LYS A CD    1 
ATOM   6181  C  CE    . LYS D 4  689  ? -9.869  -2.668  87.177  1.00 107.48 ? 689  LYS A CE    1 
ATOM   6182  N  NZ    . LYS D 4  689  ? -9.069  -3.769  86.565  1.00 91.17  ? 689  LYS A NZ    1 
ATOM   6183  N  N     . VAL D 4  690  ? -9.452  4.128   85.898  1.00 75.79  ? 690  VAL A N     1 
ATOM   6184  C  CA    . VAL D 4  690  ? -8.486  5.195   85.637  1.00 71.57  ? 690  VAL A CA    1 
ATOM   6185  C  C     . VAL D 4  690  ? -8.701  6.371   86.591  1.00 82.84  ? 690  VAL A C     1 
ATOM   6186  O  O     . VAL D 4  690  ? -7.738  6.924   87.136  1.00 75.41  ? 690  VAL A O     1 
ATOM   6187  C  CB    . VAL D 4  690  ? -8.566  5.628   84.161  1.00 62.55  ? 690  VAL A CB    1 
ATOM   6188  C  CG1   . VAL D 4  690  ? -7.749  6.884   83.911  1.00 52.25  ? 690  VAL A CG1   1 
ATOM   6189  C  CG2   . VAL D 4  690  ? -8.078  4.504   83.262  1.00 78.62  ? 690  VAL A CG2   1 
ATOM   6190  N  N     . LEU D 4  691  ? -9.966  6.752   86.830  1.00 85.99  ? 691  LEU A N     1 
ATOM   6191  C  CA    . LEU D 4  691  ? -10.263 7.843   87.765  1.00 67.76  ? 691  LEU A CA    1 
ATOM   6192  C  C     . LEU D 4  691  ? -9.805  7.525   89.180  1.00 83.82  ? 691  LEU A C     1 
ATOM   6193  O  O     . LEU D 4  691  ? -9.258  8.394   89.871  1.00 85.09  ? 691  LEU A O     1 
ATOM   6194  C  CB    . LEU D 4  691  ? -11.758 8.156   87.791  1.00 70.07  ? 691  LEU A CB    1 
ATOM   6195  C  CG    . LEU D 4  691  ? -12.176 9.552   87.331  1.00 85.64  ? 691  LEU A CG    1 
ATOM   6196  C  CD1   . LEU D 4  691  ? -13.613 9.854   87.756  1.00 84.84  ? 691  LEU A CD1   1 
ATOM   6197  C  CD2   . LEU D 4  691  ? -11.212 10.599  87.876  1.00 80.69  ? 691  LEU A CD2   1 
ATOM   6198  N  N     . ASP D 4  692  ? -10.043 6.291   89.639  1.00 98.13  ? 692  ASP A N     1 
ATOM   6199  C  CA    . ASP D 4  692  ? -9.670  5.919   91.004  1.00 70.94  ? 692  ASP A CA    1 
ATOM   6200  C  C     . ASP D 4  692  ? -8.154  5.872   91.178  1.00 61.82  ? 692  ASP A C     1 
ATOM   6201  O  O     . ASP D 4  692  ? -7.632  6.356   92.190  1.00 59.30  ? 692  ASP A O     1 
ATOM   6202  C  CB    . ASP D 4  692  ? -10.304 4.579   91.371  1.00 68.73  ? 692  ASP A CB    1 
ATOM   6203  C  CG    . ASP D 4  692  ? -11.824 4.643   91.400  1.00 78.58  ? 692  ASP A CG    1 
ATOM   6204  O  OD1   . ASP D 4  692  ? -12.380 5.744   91.187  1.00 73.95  ? 692  ASP A OD1   1 
ATOM   6205  O  OD2   . ASP D 4  692  ? -12.465 3.593   91.629  1.00 84.56  ? 692  ASP A OD2   1 
ATOM   6206  N  N     . VAL D 4  693  ? -7.431  5.308   90.197  1.00 60.35  ? 693  VAL A N     1 
ATOM   6207  C  CA    . VAL D 4  693  ? -5.966  5.326   90.254  1.00 67.03  ? 693  VAL A CA    1 
ATOM   6208  C  C     . VAL D 4  693  ? -5.432  6.757   90.158  1.00 72.56  ? 693  VAL A C     1 
ATOM   6209  O  O     . VAL D 4  693  ? -4.445  7.103   90.822  1.00 75.15  ? 693  VAL A O     1 
ATOM   6210  C  CB    . VAL D 4  693  ? -5.380  4.406   89.163  1.00 81.68  ? 693  VAL A CB    1 
ATOM   6211  C  CG1   . VAL D 4  693  ? -3.850  4.471   89.125  1.00 76.46  ? 693  VAL A CG1   1 
ATOM   6212  C  CG2   . VAL D 4  693  ? -5.814  2.968   89.408  1.00 103.65 ? 693  VAL A CG2   1 
ATOM   6213  N  N     . THR D 4  694  ? -6.096  7.620   89.377  1.00 91.02  ? 694  THR A N     1 
ATOM   6214  C  CA    . THR D 4  694  ? -5.686  9.021   89.276  1.00 90.15  ? 694  THR A CA    1 
ATOM   6215  C  C     . THR D 4  694  ? -5.860  9.748   90.605  1.00 94.50  ? 694  THR A C     1 
ATOM   6216  O  O     . THR D 4  694  ? -4.966  10.483  91.036  1.00 118.59 ? 694  THR A O     1 
ATOM   6217  C  CB    . THR D 4  694  ? -6.480  9.722   88.165  1.00 80.92  ? 694  THR A CB    1 
ATOM   6218  O  OG1   . THR D 4  694  ? -6.219  9.090   86.904  1.00 70.32  ? 694  THR A OG1   1 
ATOM   6219  C  CG2   . THR D 4  694  ? -6.094  11.190  88.056  1.00 78.60  ? 694  THR A CG2   1 
ATOM   6220  N  N     . LYS D 4  695  ? -6.992  9.534   91.280  1.00 87.75  ? 695  LYS A N     1 
ATOM   6221  C  CA    . LYS D 4  695  ? -7.217  10.168  92.576  1.00 87.65  ? 695  LYS A CA    1 
ATOM   6222  C  C     . LYS D 4  695  ? -6.263  9.622   93.637  1.00 88.85  ? 695  LYS A C     1 
ATOM   6223  O  O     . LYS D 4  695  ? -5.783  10.373  94.500  1.00 82.74  ? 695  LYS A O     1 
ATOM   6224  C  CB    . LYS D 4  695  ? -8.675  9.981   93.003  1.00 80.69  ? 695  LYS A CB    1 
ATOM   6225  C  CG    . LYS D 4  695  ? -9.649  10.950  92.337  1.00 81.90  ? 695  LYS A CG    1 
ATOM   6226  C  CD    . LYS D 4  695  ? -11.037 10.872  92.962  1.00 88.64  ? 695  LYS A CD    1 
ATOM   6227  C  CE    . LYS D 4  695  ? -11.841 9.715   92.388  1.00 97.27  ? 695  LYS A CE    1 
ATOM   6228  N  NZ    . LYS D 4  695  ? -13.309 9.911   92.566  1.00 95.46  ? 695  LYS A NZ    1 
ATOM   6229  N  N     . GLU D 4  696  ? -5.974  8.317   93.582  1.00 97.09  ? 696  GLU A N     1 
ATOM   6230  C  CA    . GLU D 4  696  ? -5.024  7.712   94.511  1.00 95.37  ? 696  GLU A CA    1 
ATOM   6231  C  C     . GLU D 4  696  ? -3.626  8.296   94.324  1.00 86.61  ? 696  GLU A C     1 
ATOM   6232  O  O     . GLU D 4  696  ? -2.917  8.560   95.303  1.00 100.67 ? 696  GLU A O     1 
ATOM   6233  C  CB    . GLU D 4  696  ? -5.025  6.194   94.312  1.00 104.50 ? 696  GLU A CB    1 
ATOM   6234  C  CG    . GLU D 4  696  ? -3.838  5.442   94.890  1.00 110.09 ? 696  GLU A CG    1 
ATOM   6235  C  CD    . GLU D 4  696  ? -4.025  3.937   94.806  1.00 114.13 ? 696  GLU A CD    1 
ATOM   6236  O  OE1   . GLU D 4  696  ? -5.186  3.485   94.696  1.00 113.26 ? 696  GLU A OE1   1 
ATOM   6237  O  OE2   . GLU D 4  696  ? -3.017  3.204   94.867  1.00 116.45 ? 696  GLU A OE2   1 
ATOM   6238  N  N     . ALA D 4  697  ? -3.226  8.533   93.070  1.00 74.81  ? 697  ALA A N     1 
ATOM   6239  C  CA    . ALA D 4  697  ? -1.938  9.168   92.810  1.00 68.43  ? 697  ALA A CA    1 
ATOM   6240  C  C     . ALA D 4  697  ? -1.952  10.648  93.169  1.00 66.20  ? 697  ALA A C     1 
ATOM   6241  O  O     . ALA D 4  697  ? -0.901  11.213  93.490  1.00 76.62  ? 697  ALA A O     1 
ATOM   6242  C  CB    . ALA D 4  697  ? -1.549  8.988   91.342  1.00 81.92  ? 697  ALA A CB    1 
ATOM   6243  N  N     . GLN D 4  698  ? -3.124  11.291  93.107  1.00 76.24  ? 698  GLN A N     1 
ATOM   6244  C  CA    . GLN D 4  698  ? -3.235  12.710  93.439  1.00 89.28  ? 698  GLN A CA    1 
ATOM   6245  C  C     . GLN D 4  698  ? -3.199  12.956  94.942  1.00 88.18  ? 698  GLN A C     1 
ATOM   6246  O  O     . GLN D 4  698  ? -2.742  14.020  95.380  1.00 80.38  ? 698  GLN A O     1 
ATOM   6247  C  CB    . GLN D 4  698  ? -4.529  13.294  92.859  1.00 91.15  ? 698  GLN A CB    1 
ATOM   6248  C  CG    . GLN D 4  698  ? -4.435  13.757  91.407  1.00 82.39  ? 698  GLN A CG    1 
ATOM   6249  C  CD    . GLN D 4  698  ? -5.785  14.176  90.844  1.00 83.89  ? 698  GLN A CD    1 
ATOM   6250  O  OE1   . GLN D 4  698  ? -6.824  14.009  91.493  1.00 76.96  ? 698  GLN A OE1   1 
ATOM   6251  N  NE2   . GLN D 4  698  ? -5.780  14.696  89.620  1.00 86.76  ? 698  GLN A NE2   1 
ATOM   6252  N  N     . ALA D 4  699  ? -3.679  12.003  95.741  1.00 85.30  ? 699  ALA A N     1 
ATOM   6253  C  CA    . ALA D 4  699  ? -3.629  12.111  97.194  1.00 80.64  ? 699  ALA A CA    1 
ATOM   6254  C  C     . ALA D 4  699  ? -2.291  11.663  97.779  1.00 83.97  ? 699  ALA A C     1 
ATOM   6255  O  O     . ALA D 4  699  ? -2.165  11.595  99.009  1.00 94.81  ? 699  ALA A O     1 
ATOM   6256  C  CB    . ALA D 4  699  ? -4.768  11.303  97.823  1.00 63.24  ? 699  ALA A CB    1 
ATOM   6257  N  N     . ASN D 4  700  ? -1.302  11.361  96.924  1.00 80.32  ? 700  ASN A N     1 
ATOM   6258  C  CA    . ASN D 4  700  ? 0.041   10.899  97.312  1.00 88.97  ? 700  ASN A CA    1 
ATOM   6259  C  C     . ASN D 4  700  ? -0.014  9.628   98.165  1.00 102.83 ? 700  ASN A C     1 
ATOM   6260  O  O     . ASN D 4  700  ? 0.861   9.382   99.000  1.00 104.69 ? 700  ASN A O     1 
ATOM   6261  C  CB    . ASN D 4  700  ? 0.843   12.000  98.027  1.00 84.87  ? 700  ASN A CB    1 
ATOM   6262  C  CG    . ASN D 4  700  ? 2.358   11.815  97.891  1.00 82.50  ? 700  ASN A CG    1 
ATOM   6263  O  OD1   . ASN D 4  700  ? 2.828   10.924  97.185  1.00 88.91  ? 700  ASN A OD1   1 
ATOM   6264  N  ND2   . ASN D 4  700  ? 3.121   12.659  98.575  1.00 89.97  ? 700  ASN A ND2   1 
ATOM   6265  N  N     . LEU D 4  701  ? -1.047  8.816   97.959  1.00 103.30 ? 701  LEU A N     1 
ATOM   6266  C  CA    . LEU D 4  701  ? -1.162  7.514   98.595  1.00 104.16 ? 701  LEU A CA    1 
ATOM   6267  C  C     . LEU D 4  701  ? -0.557  6.401   97.744  1.00 117.56 ? 701  LEU A C     1 
ATOM   6268  O  O     . LEU D 4  701  ? -0.653  5.227   98.121  1.00 129.05 ? 701  LEU A O     1 
ATOM   6269  C  CB    . LEU D 4  701  ? -2.636  7.202   98.892  1.00 93.49  ? 701  LEU A CB    1 
ATOM   6270  C  CG    . LEU D 4  701  ? -3.410  8.286   99.655  1.00 75.19  ? 701  LEU A CG    1 
ATOM   6271  C  CD1   . LEU D 4  701  ? -4.890  7.923   99.787  1.00 69.27  ? 701  LEU A CD1   1 
ATOM   6272  C  CD2   . LEU D 4  701  ? -2.788  8.570   101.020 1.00 67.47  ? 701  LEU A CD2   1 
ATOM   6273  N  N     . LEU D 4  702  ? 0.057   6.744   96.611  1.00 113.54 ? 702  LEU A N     1 
ATOM   6274  C  CA    . LEU D 4  702  ? 0.635   5.738   95.732  1.00 122.00 ? 702  LEU A CA    1 
ATOM   6275  C  C     . LEU D 4  702  ? 1.889   5.134   96.351  1.00 134.34 ? 702  LEU A C     1 
ATOM   6276  O  O     . LEU D 4  702  ? 2.666   5.815   97.025  1.00 133.22 ? 702  LEU A O     1 
ATOM   6277  C  CB    . LEU D 4  702  ? 0.972   6.333   94.359  1.00 116.10 ? 702  LEU A CB    1 
ATOM   6278  C  CG    . LEU D 4  702  ? 0.078   6.014   93.145  1.00 96.32  ? 702  LEU A CG    1 
ATOM   6279  C  CD1   . LEU D 4  702  ? 0.836   6.183   91.820  1.00 69.46  ? 702  LEU A CD1   1 
ATOM   6280  C  CD2   . LEU D 4  702  ? -0.530  4.622   93.231  1.00 96.75  ? 702  LEU A CD2   1 
ATOM   6281  N  N     . THR D 4  703  ? 2.072   3.838   96.118  1.00 145.52 ? 703  THR A N     1 
ATOM   6282  C  CA    . THR D 4  703  ? 3.274   3.129   96.528  1.00 151.14 ? 703  THR A CA    1 
ATOM   6283  C  C     . THR D 4  703  ? 4.247   3.125   95.355  1.00 150.13 ? 703  THR A C     1 
ATOM   6284  O  O     . THR D 4  703  ? 3.902   2.680   94.254  1.00 124.74 ? 703  THR A O     1 
ATOM   6285  C  CB    . THR D 4  703  ? 2.939   1.706   96.976  1.00 146.60 ? 703  THR A CB    1 
ATOM   6286  O  OG1   . THR D 4  703  ? 1.969   1.752   98.031  1.00 141.96 ? 703  THR A OG1   1 
ATOM   6287  C  CG2   . THR D 4  703  ? 4.184   0.988   97.477  1.00 145.80 ? 703  THR A CG2   1 
ATOM   6288  N  N     . ALA D 4  704  ? 5.448   3.648   95.586  1.00 167.07 ? 704  ALA A N     1 
ATOM   6289  C  CA    . ALA D 4  704  ? 6.451   3.726   94.534  1.00 165.84 ? 704  ALA A CA    1 
ATOM   6290  C  C     . ALA D 4  704  ? 7.009   2.339   94.249  1.00 172.05 ? 704  ALA A C     1 
ATOM   6291  O  O     . ALA D 4  704  ? 7.622   1.718   95.125  1.00 176.29 ? 704  ALA A O     1 
ATOM   6292  C  CB    . ALA D 4  704  ? 7.569   4.683   94.941  1.00 162.57 ? 704  ALA A CB    1 
ATOM   6293  N  N     . LYS D 4  705  ? 6.775   1.843   93.035  1.00 166.90 ? 705  LYS A N     1 
ATOM   6294  C  CA    . LYS D 4  705  ? 7.418   0.612   92.599  1.00 163.92 ? 705  LYS A CA    1 
ATOM   6295  C  C     . LYS D 4  705  ? 8.924   0.826   92.499  1.00 157.16 ? 705  LYS A C     1 
ATOM   6296  O  O     . LYS D 4  705  ? 9.385   1.914   92.143  1.00 162.88 ? 705  LYS A O     1 
ATOM   6297  C  CB    . LYS D 4  705  ? 6.856   0.164   91.249  1.00 158.34 ? 705  LYS A CB    1 
ATOM   6298  C  CG    . LYS D 4  705  ? 5.336   0.168   91.164  1.00 148.94 ? 705  LYS A CG    1 
ATOM   6299  C  CD    . LYS D 4  705  ? 4.866   -0.212  89.767  1.00 136.94 ? 705  LYS A CD    1 
ATOM   6300  C  CE    . LYS D 4  705  ? 3.356   -0.112  89.641  1.00 133.27 ? 705  LYS A CE    1 
ATOM   6301  N  NZ    . LYS D 4  705  ? 2.901   -0.494  88.276  1.00 139.18 ? 705  LYS A NZ    1 
ATOM   6302  N  N     . HIS D 4  706  ? 9.691   -0.213  92.834  1.00 136.83 ? 706  HIS A N     1 
ATOM   6303  C  CA    . HIS D 4  706  ? 11.143  -0.087  92.852  1.00 122.68 ? 706  HIS A CA    1 
ATOM   6304  C  C     . HIS D 4  706  ? 11.678  0.046   91.433  1.00 119.80 ? 706  HIS A C     1 
ATOM   6305  O  O     . HIS D 4  706  ? 11.274  -0.695  90.532  1.00 123.14 ? 706  HIS A O     1 
ATOM   6306  C  CB    . HIS D 4  706  ? 11.793  -1.284  93.547  1.00 116.29 ? 706  HIS A CB    1 
ATOM   6307  C  CG    . HIS D 4  706  ? 13.282  -1.162  93.686  1.00 120.49 ? 706  HIS A CG    1 
ATOM   6308  N  ND1   . HIS D 4  706  ? 13.885  -0.631  94.808  1.00 124.21 ? 706  HIS A ND1   1 
ATOM   6309  C  CD2   . HIS D 4  706  ? 14.286  -1.486  92.837  1.00 122.73 ? 706  HIS A CD2   1 
ATOM   6310  C  CE1   . HIS D 4  706  ? 15.196  -0.642  94.646  1.00 124.20 ? 706  HIS A CE1   1 
ATOM   6311  N  NE2   . HIS D 4  706  ? 15.465  -1.154  93.458  1.00 121.64 ? 706  HIS A NE2   1 
ATOM   6312  N  N     . GLY D 4  707  ? 12.579  1.005   91.235  1.00 124.56 ? 707  GLY A N     1 
ATOM   6313  C  CA    . GLY D 4  707  ? 13.192  1.242   89.949  1.00 120.19 ? 707  GLY A CA    1 
ATOM   6314  C  C     . GLY D 4  707  ? 12.467  2.219   89.050  1.00 115.83 ? 707  GLY A C     1 
ATOM   6315  O  O     . GLY D 4  707  ? 12.979  2.529   87.968  1.00 122.84 ? 707  GLY A O     1 
ATOM   6316  N  N     . MET D 4  708  ? 11.304  2.725   89.454  1.00 113.82 ? 708  MET A N     1 
ATOM   6317  C  CA    . MET D 4  708  ? 10.560  3.643   88.601  1.00 123.27 ? 708  MET A CA    1 
ATOM   6318  C  C     . MET D 4  708  ? 9.881   4.709   89.451  1.00 118.92 ? 708  MET A C     1 
ATOM   6319  O  O     . MET D 4  708  ? 9.619   4.512   90.642  1.00 125.48 ? 708  MET A O     1 
ATOM   6320  C  CB    . MET D 4  708  ? 9.533   2.898   87.735  1.00 131.47 ? 708  MET A CB    1 
ATOM   6321  C  CG    . MET D 4  708  ? 8.643   1.932   88.496  1.00 134.64 ? 708  MET A CG    1 
ATOM   6322  S  SD    . MET D 4  708  ? 7.173   1.499   87.544  1.00 135.41 ? 708  MET A SD    1 
ATOM   6323  C  CE    . MET D 4  708  ? 7.907   0.883   86.031  1.00 131.34 ? 708  MET A CE    1 
ATOM   6324  N  N     . THR D 4  709  ? 9.589   5.845   88.810  1.00 104.69 ? 709  THR A N     1 
ATOM   6325  C  CA    . THR D 4  709  ? 8.986   6.992   89.479  1.00 109.94 ? 709  THR A CA    1 
ATOM   6326  C  C     . THR D 4  709  ? 7.509   6.721   89.784  1.00 116.19 ? 709  THR A C     1 
ATOM   6327  O  O     . THR D 4  709  ? 6.950   5.674   89.441  1.00 134.05 ? 709  THR A O     1 
ATOM   6328  C  CB    . THR D 4  709  ? 9.130   8.254   88.621  1.00 113.07 ? 709  THR A CB    1 
ATOM   6329  O  OG1   . THR D 4  709  ? 8.239   8.186   87.499  1.00 105.52 ? 709  THR A OG1   1 
ATOM   6330  C  CG2   . THR D 4  709  ? 10.551  8.404   88.104  1.00 119.66 ? 709  THR A CG2   1 
ATOM   6331  N  N     . LEU D 4  710  ? 6.869   7.689   90.448  1.00 98.88  ? 710  LEU A N     1 
ATOM   6332  C  CA    . LEU D 4  710  ? 5.431   7.595   90.686  1.00 95.35  ? 710  LEU A CA    1 
ATOM   6333  C  C     . LEU D 4  710  ? 4.649   7.788   89.393  1.00 104.09 ? 710  LEU A C     1 
ATOM   6334  O  O     . LEU D 4  710  ? 3.703   7.039   89.111  1.00 108.29 ? 710  LEU A O     1 
ATOM   6335  C  CB    . LEU D 4  710  ? 4.994   8.625   91.732  1.00 88.19  ? 710  LEU A CB    1 
ATOM   6336  C  CG    . LEU D 4  710  ? 5.210   8.377   93.234  1.00 76.58  ? 710  LEU A CG    1 
ATOM   6337  C  CD1   . LEU D 4  710  ? 4.544   7.070   93.673  1.00 86.72  ? 710  LEU A CD1   1 
ATOM   6338  C  CD2   . LEU D 4  710  ? 6.682   8.424   93.656  1.00 67.72  ? 710  LEU A CD2   1 
ATOM   6339  N  N     . ARG D 4  711  ? 5.047   8.779   88.588  1.00 108.43 ? 711  ARG A N     1 
ATOM   6340  C  CA    . ARG D 4  711  ? 4.356   9.065   87.335  1.00 105.67 ? 711  ARG A CA    1 
ATOM   6341  C  C     . ARG D 4  711  ? 4.539   7.948   86.312  1.00 92.67  ? 711  ARG A C     1 
ATOM   6342  O  O     . ARG D 4  711  ? 3.625   7.686   85.521  1.00 83.64  ? 711  ARG A O     1 
ATOM   6343  C  CB    . ARG D 4  711  ? 4.853   10.392  86.759  1.00 107.84 ? 711  ARG A CB    1 
ATOM   6344  C  CG    . ARG D 4  711  ? 4.872   11.541  87.752  1.00 105.19 ? 711  ARG A CG    1 
ATOM   6345  C  CD    . ARG D 4  711  ? 5.298   12.828  87.065  1.00 116.19 ? 711  ARG A CD    1 
ATOM   6346  N  NE    . ARG D 4  711  ? 4.156   13.698  86.798  1.00 122.98 ? 711  ARG A NE    1 
ATOM   6347  C  CZ    . ARG D 4  711  ? 3.874   14.797  87.490  1.00 128.97 ? 711  ARG A CZ    1 
ATOM   6348  N  NH1   . ARG D 4  711  ? 4.663   15.176  88.486  1.00 125.42 ? 711  ARG A NH1   1 
ATOM   6349  N  NH2   . ARG D 4  711  ? 2.811   15.524  87.177  1.00 133.29 ? 711  ARG A NH2   1 
ATOM   6350  N  N     . GLU D 4  712  ? 5.710   7.294   86.306  1.00 82.75  ? 712  GLU A N     1 
ATOM   6351  C  CA    . GLU D 4  712  ? 5.923   6.143   85.430  1.00 82.66  ? 712  GLU A CA    1 
ATOM   6352  C  C     . GLU D 4  712  ? 4.975   5.005   85.778  1.00 98.85  ? 712  GLU A C     1 
ATOM   6353  O  O     . GLU D 4  712  ? 4.388   4.380   84.885  1.00 113.09 ? 712  GLU A O     1 
ATOM   6354  C  CB    . GLU D 4  712  ? 7.370   5.657   85.523  1.00 75.47  ? 712  GLU A CB    1 
ATOM   6355  C  CG    . GLU D 4  712  ? 8.375   6.449   84.709  1.00 88.57  ? 712  GLU A CG    1 
ATOM   6356  C  CD    . GLU D 4  712  ? 9.801   5.986   84.952  1.00 105.50 ? 712  GLU A CD    1 
ATOM   6357  O  OE1   . GLU D 4  712  ? 10.169  5.779   86.127  1.00 106.07 ? 712  GLU A OE1   1 
ATOM   6358  O  OE2   . GLU D 4  712  ? 10.550  5.814   83.967  1.00 112.83 ? 712  GLU A OE2   1 
ATOM   6359  N  N     . SER D 4  713  ? 4.816   4.729   87.075  1.00 99.01  ? 713  SER A N     1 
ATOM   6360  C  CA    . SER D 4  713  ? 3.884   3.700   87.525  1.00 117.19 ? 713  SER A CA    1 
ATOM   6361  C  C     . SER D 4  713  ? 2.445   4.073   87.187  1.00 128.13 ? 713  SER A C     1 
ATOM   6362  O  O     . SER D 4  713  ? 1.651   3.209   86.793  1.00 145.01 ? 713  SER A O     1 
ATOM   6363  C  CB    . SER D 4  713  ? 4.046   3.482   89.029  1.00 126.16 ? 713  SER A CB    1 
ATOM   6364  O  OG    . SER D 4  713  ? 5.369   3.088   89.352  1.00 135.52 ? 713  SER A OG    1 
ATOM   6365  N  N     . PHE D 4  714  ? 2.103   5.360   87.315  1.00 120.13 ? 714  PHE A N     1 
ATOM   6366  C  CA    . PHE D 4  714  ? 0.760   5.823   86.971  1.00 105.46 ? 714  PHE A CA    1 
ATOM   6367  C  C     . PHE D 4  714  ? 0.473   5.641   85.483  1.00 117.80 ? 714  PHE A C     1 
ATOM   6368  O  O     . PHE D 4  714  ? -0.582  5.108   85.103  1.00 121.11 ? 714  PHE A O     1 
ATOM   6369  C  CB    . PHE D 4  714  ? 0.597   7.292   87.369  1.00 83.51  ? 714  PHE A CB    1 
ATOM   6370  C  CG    . PHE D 4  714  ? -0.693  7.901   86.904  1.00 80.22  ? 714  PHE A CG    1 
ATOM   6371  C  CD1   . PHE D 4  714  ? -1.897  7.526   87.479  1.00 74.92  ? 714  PHE A CD1   1 
ATOM   6372  C  CD2   . PHE D 4  714  ? -0.711  8.828   85.872  1.00 84.16  ? 714  PHE A CD2   1 
ATOM   6373  C  CE1   . PHE D 4  714  ? -3.092  8.077   87.045  1.00 64.96  ? 714  PHE A CE1   1 
ATOM   6374  C  CE2   . PHE D 4  714  ? -1.910  9.380   85.436  1.00 75.39  ? 714  PHE A CE2   1 
ATOM   6375  C  CZ    . PHE D 4  714  ? -3.098  9.003   86.027  1.00 58.86  ? 714  PHE A CZ    1 
ATOM   6376  N  N     . GLU D 4  715  ? 1.403   6.089   84.629  1.00 120.14 ? 715  GLU A N     1 
ATOM   6377  C  CA    . GLU D 4  715  ? 1.248   5.934   83.184  1.00 109.25 ? 715  GLU A CA    1 
ATOM   6378  C  C     . GLU D 4  715  ? 1.174   4.466   82.789  1.00 106.93 ? 715  GLU A C     1 
ATOM   6379  O  O     . GLU D 4  715  ? 0.347   4.089   81.951  1.00 117.34 ? 715  GLU A O     1 
ATOM   6380  C  CB    . GLU D 4  715  ? 2.400   6.627   82.450  1.00 97.65  ? 715  GLU A CB    1 
ATOM   6381  C  CG    . GLU D 4  715  ? 2.254   8.137   82.338  1.00 108.61 ? 715  GLU A CG    1 
ATOM   6382  C  CD    . GLU D 4  715  ? 1.338   8.558   81.200  1.00 108.21 ? 715  GLU A CD    1 
ATOM   6383  O  OE1   . GLU D 4  715  ? 1.755   8.478   80.025  1.00 99.12  ? 715  GLU A OE1   1 
ATOM   6384  O  OE2   . GLU D 4  715  ? 0.192   8.963   81.485  1.00 106.72 ? 715  GLU A OE2   1 
ATOM   6385  N  N     . ASP D 4  716  ? 2.020   3.623   83.397  1.00 93.75  ? 716  ASP A N     1 
ATOM   6386  C  CA    . ASP D 4  716  ? 2.000   2.190   83.110  1.00 71.81  ? 716  ASP A CA    1 
ATOM   6387  C  C     . ASP D 4  716  ? 0.657   1.572   83.485  1.00 57.66  ? 716  ASP A C     1 
ATOM   6388  O  O     . ASP D 4  716  ? 0.075   0.817   82.693  1.00 65.80  ? 716  ASP A O     1 
ATOM   6389  C  CB    . ASP D 4  716  ? 3.166   1.508   83.839  1.00 83.06  ? 716  ASP A CB    1 
ATOM   6390  C  CG    . ASP D 4  716  ? 3.097   -0.018  83.797  1.00 125.94 ? 716  ASP A CG    1 
ATOM   6391  O  OD1   . ASP D 4  716  ? 2.436   -0.629  84.667  1.00 137.50 ? 716  ASP A OD1   1 
ATOM   6392  O  OD2   . ASP D 4  716  ? 3.703   -0.610  82.879  1.00 146.47 ? 716  ASP A OD2   1 
ATOM   6393  N  N     . ASN D 4  717  ? 0.121   1.925   84.662  1.00 65.57  ? 717  ASN A N     1 
ATOM   6394  C  CA    . ASN D 4  717  ? -1.152  1.357   85.107  1.00 84.43  ? 717  ASN A CA    1 
ATOM   6395  C  C     . ASN D 4  717  ? -2.312  1.796   84.220  1.00 89.63  ? 717  ASN A C     1 
ATOM   6396  O  O     . ASN D 4  717  ? -3.162  0.974   83.862  1.00 90.40  ? 717  ASN A O     1 
ATOM   6397  C  CB    . ASN D 4  717  ? -1.428  1.738   86.562  1.00 95.30  ? 717  ASN A CB    1 
ATOM   6398  C  CG    . ASN D 4  717  ? -0.577  0.958   87.538  1.00 101.93 ? 717  ASN A CG    1 
ATOM   6399  O  OD1   . ASN D 4  717  ? 0.510   0.489   87.195  1.00 105.38 ? 717  ASN A OD1   1 
ATOM   6400  N  ND2   . ASN D 4  717  ? -1.065  0.814   88.766  1.00 106.96 ? 717  ASN A ND2   1 
ATOM   6401  N  N     . VAL D 4  718  ? -2.360  3.079   83.841  1.00 92.78  ? 718  VAL A N     1 
ATOM   6402  C  CA    . VAL D 4  718  ? -3.468  3.554   83.010  1.00 92.98  ? 718  VAL A CA    1 
ATOM   6403  C  C     . VAL D 4  718  ? -3.372  2.985   81.587  1.00 89.46  ? 718  VAL A C     1 
ATOM   6404  O  O     . VAL D 4  718  ? -4.390  2.599   80.993  1.00 85.83  ? 718  VAL A O     1 
ATOM   6405  C  CB    . VAL D 4  718  ? -3.529  5.095   83.036  1.00 84.51  ? 718  VAL A CB    1 
ATOM   6406  C  CG1   . VAL D 4  718  ? -4.656  5.629   82.157  1.00 78.53  ? 718  VAL A CG1   1 
ATOM   6407  C  CG2   . VAL D 4  718  ? -3.738  5.589   84.464  1.00 78.77  ? 718  VAL A CG2   1 
ATOM   6408  N  N     . VAL D 4  719  ? -2.153  2.890   81.031  1.00 86.25  ? 719  VAL A N     1 
ATOM   6409  C  CA    . VAL D 4  719  ? -1.974  2.306   79.699  1.00 78.37  ? 719  VAL A CA    1 
ATOM   6410  C  C     . VAL D 4  719  ? -2.377  0.831   79.698  1.00 85.62  ? 719  VAL A C     1 
ATOM   6411  O  O     . VAL D 4  719  ? -3.085  0.364   78.791  1.00 95.03  ? 719  VAL A O     1 
ATOM   6412  C  CB    . VAL D 4  719  ? -0.518  2.506   79.222  1.00 50.49  ? 719  VAL A CB    1 
ATOM   6413  C  CG1   . VAL D 4  719  ? -0.151  1.528   78.100  1.00 73.12  ? 719  VAL A CG1   1 
ATOM   6414  C  CG2   . VAL D 4  719  ? -0.292  3.931   78.767  1.00 49.88  ? 719  VAL A CG2   1 
ATOM   6415  N  N     . ARG D 4  720  ? -1.959  0.081   80.728  1.00 77.29  ? 720  ARG A N     1 
ATOM   6416  C  CA    . ARG D 4  720  ? -2.342  -1.325  80.828  1.00 75.90  ? 720  ARG A CA    1 
ATOM   6417  C  C     . ARG D 4  720  ? -3.851  -1.473  81.024  1.00 82.63  ? 720  ARG A C     1 
ATOM   6418  O  O     . ARG D 4  720  ? -4.465  -2.397  80.474  1.00 103.55 ? 720  ARG A O     1 
ATOM   6419  C  CB    . ARG D 4  720  ? -1.574  -1.991  81.969  1.00 93.37  ? 720  ARG A CB    1 
ATOM   6420  C  CG    . ARG D 4  720  ? -1.397  -3.497  81.816  1.00 106.46 ? 720  ARG A CG    1 
ATOM   6421  C  CD    . ARG D 4  720  ? -1.006  -4.144  83.132  1.00 101.56 ? 720  ARG A CD    1 
ATOM   6422  N  NE    . ARG D 4  720  ? -2.162  -4.315  84.006  1.00 104.29 ? 720  ARG A NE    1 
ATOM   6423  C  CZ    . ARG D 4  720  ? -2.407  -3.570  85.081  1.00 98.78  ? 720  ARG A CZ    1 
ATOM   6424  N  NH1   . ARG D 4  720  ? -1.574  -2.590  85.419  1.00 88.56  ? 720  ARG A NH1   1 
ATOM   6425  N  NH2   . ARG D 4  720  ? -3.486  -3.802  85.816  1.00 96.25  ? 720  ARG A NH2   1 
ATOM   6426  N  N     . PHE D 4  721  ? -4.467  -0.544  81.772  1.00 66.13  ? 721  PHE A N     1 
ATOM   6427  C  CA    . PHE D 4  721  ? -5.918  -0.542  81.969  1.00 71.52  ? 721  PHE A CA    1 
ATOM   6428  C  C     . PHE D 4  721  ? -6.671  -0.368  80.653  1.00 63.54  ? 721  PHE A C     1 
ATOM   6429  O  O     . PHE D 4  721  ? -7.635  -1.092  80.370  1.00 69.52  ? 721  PHE A O     1 
ATOM   6430  C  CB    . PHE D 4  721  ? -6.314  0.578   82.935  1.00 95.70  ? 721  PHE A CB    1 
ATOM   6431  C  CG    . PHE D 4  721  ? -6.179  0.227   84.392  1.00 104.25 ? 721  PHE A CG    1 
ATOM   6432  C  CD1   . PHE D 4  721  ? -6.652  1.096   85.364  1.00 92.25  ? 721  PHE A CD1   1 
ATOM   6433  C  CD2   . PHE D 4  721  ? -5.593  -0.961  84.791  1.00 112.78 ? 721  PHE A CD2   1 
ATOM   6434  C  CE1   . PHE D 4  721  ? -6.541  0.785   86.700  1.00 89.27  ? 721  PHE A CE1   1 
ATOM   6435  C  CE2   . PHE D 4  721  ? -5.480  -1.270  86.129  1.00 119.51 ? 721  PHE A CE2   1 
ATOM   6436  C  CZ    . PHE D 4  721  ? -5.953  -0.396  87.083  1.00 113.37 ? 721  PHE A CZ    1 
ATOM   6437  N  N     . LEU D 4  722  ? -6.260  0.611   79.844  1.00 68.30  ? 722  LEU A N     1 
ATOM   6438  C  CA    . LEU D 4  722  ? -6.972  0.882   78.595  1.00 75.41  ? 722  LEU A CA    1 
ATOM   6439  C  C     . LEU D 4  722  ? -6.696  -0.185  77.532  1.00 81.07  ? 722  LEU A C     1 
ATOM   6440  O  O     . LEU D 4  722  ? -7.577  -0.481  76.707  1.00 86.30  ? 722  LEU A O     1 
ATOM   6441  C  CB    . LEU D 4  722  ? -6.617  2.285   78.089  1.00 76.64  ? 722  LEU A CB    1 
ATOM   6442  C  CG    . LEU D 4  722  ? -6.918  3.431   79.070  1.00 49.94  ? 722  LEU A CG    1 
ATOM   6443  C  CD1   . LEU D 4  722  ? -6.535  4.791   78.504  1.00 49.18  ? 722  LEU A CD1   1 
ATOM   6444  C  CD2   . LEU D 4  722  ? -8.391  3.426   79.489  1.00 50.41  ? 722  LEU A CD2   1 
ATOM   6445  N  N     . ASN D 4  723  ? -5.502  -0.794  77.547  1.00 75.35  ? 723  ASN A N     1 
ATOM   6446  C  CA    . ASN D 4  723  ? -5.247  -1.925  76.656  1.00 79.10  ? 723  ASN A CA    1 
ATOM   6447  C  C     . ASN D 4  723  ? -6.108  -3.134  77.025  1.00 78.92  ? 723  ASN A C     1 
ATOM   6448  O  O     . ASN D 4  723  ? -6.697  -3.772  76.138  1.00 77.00  ? 723  ASN A O     1 
ATOM   6449  C  CB    . ASN D 4  723  ? -3.756  -2.276  76.672  1.00 86.92  ? 723  ASN A CB    1 
ATOM   6450  C  CG    . ASN D 4  723  ? -2.884  -1.158  76.113  1.00 97.76  ? 723  ASN A CG    1 
ATOM   6451  O  OD1   . ASN D 4  723  ? -3.355  -0.041  75.886  1.00 90.27  ? 723  ASN A OD1   1 
ATOM   6452  N  ND2   . ASN D 4  723  ? -1.604  -1.449  75.906  1.00 115.59 ? 723  ASN A ND2   1 
ATOM   6453  N  N     . GLU D 4  724  ? -6.200  -3.455  78.328  1.00 79.54  ? 724  GLU A N     1 
ATOM   6454  C  CA    . GLU D 4  724  ? -7.135  -4.477  78.804  1.00 75.70  ? 724  GLU A CA    1 
ATOM   6455  C  C     . GLU D 4  724  ? -8.567  -4.157  78.392  1.00 75.44  ? 724  GLU A C     1 
ATOM   6456  O  O     . GLU D 4  724  ? -9.329  -5.059  78.026  1.00 96.03  ? 724  GLU A O     1 
ATOM   6457  C  CB    . GLU D 4  724  ? -7.051  -4.591  80.326  1.00 97.16  ? 724  GLU A CB    1 
ATOM   6458  C  CG    . GLU D 4  724  ? -5.831  -5.309  80.879  1.00 108.63 ? 724  GLU A CG    1 
ATOM   6459  C  CD    . GLU D 4  724  ? -5.868  -5.408  82.395  1.00 115.77 ? 724  GLU A CD    1 
ATOM   6460  O  OE1   . GLU D 4  724  ? -6.904  -5.044  82.994  1.00 117.16 ? 724  GLU A OE1   1 
ATOM   6461  O  OE2   . GLU D 4  724  ? -4.855  -5.824  82.992  1.00 121.63 ? 724  GLU A OE2   1 
ATOM   6462  N  N     . ALA D 4  725  ? -8.940  -2.872  78.440  1.00 76.44  ? 725  ALA A N     1 
ATOM   6463  C  CA    . ALA D 4  725  ? -10.289 -2.450  78.067  1.00 74.44  ? 725  ALA A CA    1 
ATOM   6464  C  C     . ALA D 4  725  ? -10.588 -2.748  76.603  1.00 73.67  ? 725  ALA A C     1 
ATOM   6465  O  O     . ALA D 4  725  ? -11.615 -3.365  76.283  1.00 75.37  ? 725  ALA A O     1 
ATOM   6466  C  CB    . ALA D 4  725  ? -10.462 -0.958  78.344  1.00 76.54  ? 725  ALA A CB    1 
ATOM   6467  N  N     . ARG D 4  726  ? -9.710  -2.297  75.695  1.00 72.66  ? 726  ARG A N     1 
ATOM   6468  C  CA    . ARG D 4  726  ? -9.986  -2.493  74.272  1.00 72.25  ? 726  ARG A CA    1 
ATOM   6469  C  C     . ARG D 4  726  ? -9.870  -3.962  73.874  1.00 83.46  ? 726  ARG A C     1 
ATOM   6470  O  O     . ARG D 4  726  ? -10.613 -4.418  72.995  1.00 81.59  ? 726  ARG A O     1 
ATOM   6471  C  CB    . ARG D 4  726  ? -9.070  -1.625  73.395  1.00 66.91  ? 726  ARG A CB    1 
ATOM   6472  C  CG    . ARG D 4  726  ? -7.617  -2.070  73.305  1.00 69.52  ? 726  ARG A CG    1 
ATOM   6473  C  CD    . ARG D 4  726  ? -7.224  -2.413  71.870  1.00 55.53  ? 726  ARG A CD    1 
ATOM   6474  N  NE    . ARG D 4  726  ? -5.909  -3.048  71.825  1.00 75.37  ? 726  ARG A NE    1 
ATOM   6475  C  CZ    . ARG D 4  726  ? -4.755  -2.387  71.799  1.00 91.18  ? 726  ARG A CZ    1 
ATOM   6476  N  NH1   . ARG D 4  726  ? -4.744  -1.056  71.811  1.00 77.34  ? 726  ARG A NH1   1 
ATOM   6477  N  NH2   . ARG D 4  726  ? -3.607  -3.055  71.764  1.00 107.86 ? 726  ARG A NH2   1 
ATOM   6478  N  N     . ASP D 4  727  ? -8.996  -4.733  74.539  1.00 86.72  ? 727  ASP A N     1 
ATOM   6479  C  CA    . ASP D 4  727  ? -8.910  -6.162  74.246  1.00 59.55  ? 727  ASP A CA    1 
ATOM   6480  C  C     . ASP D 4  727  ? -10.143 -6.905  74.746  1.00 64.15  ? 727  ASP A C     1 
ATOM   6481  O  O     . ASP D 4  727  ? -10.651 -7.800  74.059  1.00 95.16  ? 727  ASP A O     1 
ATOM   6482  C  CB    . ASP D 4  727  ? -7.635  -6.755  74.852  1.00 52.06  ? 727  ASP A CB    1 
ATOM   6483  C  CG    . ASP D 4  727  ? -6.364  -6.213  74.197  1.00 68.65  ? 727  ASP A CG    1 
ATOM   6484  O  OD1   . ASP D 4  727  ? -6.438  -5.206  73.460  1.00 63.56  ? 727  ASP A OD1   1 
ATOM   6485  O  OD2   . ASP D 4  727  ? -5.282  -6.789  74.436  1.00 89.92  ? 727  ASP A OD2   1 
ATOM   6486  N  N     . LYS D 4  728  ? -10.655 -6.536  75.928  1.00 61.93  ? 728  LYS A N     1 
ATOM   6487  C  CA    . LYS D 4  728  ? -11.857 -7.178  76.450  1.00 83.15  ? 728  LYS A CA    1 
ATOM   6488  C  C     . LYS D 4  728  ? -13.076 -6.820  75.609  1.00 97.75  ? 728  LYS A C     1 
ATOM   6489  O  O     . LYS D 4  728  ? -13.935 -7.675  75.358  1.00 110.99 ? 728  LYS A O     1 
ATOM   6490  C  CB    . LYS D 4  728  ? -12.074 -6.787  77.914  1.00 84.80  ? 728  LYS A CB    1 
ATOM   6491  C  CG    . LYS D 4  728  ? -13.279 -7.460  78.566  1.00 88.73  ? 728  LYS A CG    1 
ATOM   6492  C  CD    . LYS D 4  728  ? -13.381 -7.134  80.050  1.00 98.96  ? 728  LYS A CD    1 
ATOM   6493  C  CE    . LYS D 4  728  ? -14.763 -7.464  80.601  1.00 104.84 ? 728  LYS A CE    1 
ATOM   6494  N  NZ    . LYS D 4  728  ? -15.010 -8.934  80.652  1.00 116.29 ? 728  LYS A NZ    1 
ATOM   6495  N  N     . ALA D 4  729  ? -13.157 -5.570  75.145  1.00 88.39  ? 729  ALA A N     1 
ATOM   6496  C  CA    . ALA D 4  729  ? -14.256 -5.184  74.266  1.00 78.77  ? 729  ALA A CA    1 
ATOM   6497  C  C     . ALA D 4  729  ? -14.167 -5.902  72.924  1.00 82.74  ? 729  ALA A C     1 
ATOM   6498  O  O     . ALA D 4  729  ? -15.191 -6.344  72.384  1.00 80.57  ? 729  ALA A O     1 
ATOM   6499  C  CB    . ALA D 4  729  ? -14.263 -3.669  74.069  1.00 57.34  ? 729  ALA A CB    1 
ATOM   6500  N  N     . GLY D 4  730  ? -12.952 -6.044  72.379  1.00 84.91  ? 730  GLY A N     1 
ATOM   6501  C  CA    . GLY D 4  730  ? -12.793 -6.777  71.134  1.00 81.25  ? 730  GLY A CA    1 
ATOM   6502  C  C     . GLY D 4  730  ? -13.156 -8.244  71.258  1.00 79.97  ? 730  GLY A C     1 
ATOM   6503  O  O     . GLY D 4  730  ? -13.746 -8.827  70.346  1.00 88.05  ? 730  GLY A O     1 
ATOM   6504  N  N     . ARG D 4  731  ? -12.802 -8.866  72.383  1.00 69.41  ? 731  ARG A N     1 
ATOM   6505  C  CA    . ARG D 4  731  ? -13.197 -10.254 72.589  1.00 70.21  ? 731  ARG A CA    1 
ATOM   6506  C  C     . ARG D 4  731  ? -14.698 -10.374 72.837  1.00 77.92  ? 731  ARG A C     1 
ATOM   6507  O  O     . ARG D 4  731  ? -15.318 -11.359 72.413  1.00 104.43 ? 731  ARG A O     1 
ATOM   6508  C  CB    . ARG D 4  731  ? -12.389 -10.859 73.736  1.00 85.03  ? 731  ARG A CB    1 
ATOM   6509  C  CG    . ARG D 4  731  ? -10.996 -11.278 73.297  1.00 92.45  ? 731  ARG A CG    1 
ATOM   6510  C  CD    . ARG D 4  731  ? -9.969  -11.099 74.395  1.00 101.87 ? 731  ARG A CD    1 
ATOM   6511  N  NE    . ARG D 4  731  ? -8.632  -11.408 73.902  1.00 109.36 ? 731  ARG A NE    1 
ATOM   6512  C  CZ    . ARG D 4  731  ? -7.519  -11.247 74.608  1.00 121.32 ? 731  ARG A CZ    1 
ATOM   6513  N  NH1   . ARG D 4  731  ? -7.577  -10.776 75.847  1.00 127.39 ? 731  ARG A NH1   1 
ATOM   6514  N  NH2   . ARG D 4  731  ? -6.346  -11.554 74.072  1.00 124.89 ? 731  ARG A NH2   1 
ATOM   6515  N  N     . LEU D 4  732  ? -15.298 -9.371  73.490  1.00 61.44  ? 732  LEU A N     1 
ATOM   6516  C  CA    . LEU D 4  732  ? -16.752 -9.312  73.621  1.00 70.51  ? 732  LEU A CA    1 
ATOM   6517  C  C     . LEU D 4  732  ? -17.435 -9.215  72.264  1.00 74.01  ? 732  LEU A C     1 
ATOM   6518  O  O     . LEU D 4  732  ? -18.541 -9.739  72.085  1.00 81.29  ? 732  LEU A O     1 
ATOM   6519  C  CB    . LEU D 4  732  ? -17.153 -8.118  74.487  1.00 77.21  ? 732  LEU A CB    1 
ATOM   6520  C  CG    . LEU D 4  732  ? -17.352 -8.349  75.983  1.00 78.94  ? 732  LEU A CG    1 
ATOM   6521  C  CD1   . LEU D 4  732  ? -17.615 -7.020  76.682  1.00 71.28  ? 732  LEU A CD1   1 
ATOM   6522  C  CD2   . LEU D 4  732  ? -18.495 -9.335  76.213  1.00 91.36  ? 732  LEU A CD2   1 
ATOM   6523  N  N     . ALA D 4  733  ? -16.799 -8.536  71.310  1.00 72.44  ? 733  ALA A N     1 
ATOM   6524  C  CA    . ALA D 4  733  ? -17.320 -8.493  69.946  1.00 70.20  ? 733  ALA A CA    1 
ATOM   6525  C  C     . ALA D 4  733  ? -17.137 -9.835  69.240  1.00 77.14  ? 733  ALA A C     1 
ATOM   6526  O  O     . ALA D 4  733  ? -18.072 -10.351 68.615  1.00 73.30  ? 733  ALA A O     1 
ATOM   6527  C  CB    . ALA D 4  733  ? -16.633 -7.377  69.159  1.00 69.98  ? 733  ALA A CB    1 
ATOM   6528  N  N     . GLU D 4  734  ? -15.935 -10.418 69.339  1.00 86.89  ? 734  GLU A N     1 
ATOM   6529  C  CA    . GLU D 4  734  ? -15.616 -11.647 68.613  1.00 83.77  ? 734  GLU A CA    1 
ATOM   6530  C  C     . GLU D 4  734  ? -16.436 -12.837 69.108  1.00 83.42  ? 734  GLU A C     1 
ATOM   6531  O  O     . GLU D 4  734  ? -16.666 -13.785 68.347  1.00 86.42  ? 734  GLU A O     1 
ATOM   6532  C  CB    . GLU D 4  734  ? -14.121 -11.957 68.733  1.00 90.94  ? 734  GLU A CB    1 
ATOM   6533  C  CG    . GLU D 4  734  ? -13.602 -12.963 67.705  1.00 101.42 ? 734  GLU A CG    1 
ATOM   6534  C  CD    . GLU D 4  734  ? -12.139 -13.318 67.915  1.00 115.17 ? 734  GLU A CD    1 
ATOM   6535  O  OE1   . GLU D 4  734  ? -11.602 -13.036 69.010  1.00 117.03 ? 734  GLU A OE1   1 
ATOM   6536  O  OE2   . GLU D 4  734  ? -11.522 -13.870 66.979  1.00 120.30 ? 734  GLU A OE2   1 
ATOM   6537  N  N     . VAL D 4  735  ? -16.861 -12.819 70.376  1.00 89.28  ? 735  VAL A N     1 
ATOM   6538  C  CA    . VAL D 4  735  ? -17.834 -13.805 70.844  1.00 102.27 ? 735  VAL A CA    1 
ATOM   6539  C  C     . VAL D 4  735  ? -19.165 -13.615 70.122  1.00 112.31 ? 735  VAL A C     1 
ATOM   6540  O  O     . VAL D 4  735  ? -19.807 -14.586 69.699  1.00 125.88 ? 735  VAL A O     1 
ATOM   6541  C  CB    . VAL D 4  735  ? -18.000 -13.717 72.376  1.00 102.98 ? 735  VAL A CB    1 
ATOM   6542  C  CG1   . VAL D 4  735  ? -19.225 -14.503 72.851  1.00 99.42  ? 735  VAL A CG1   1 
ATOM   6543  C  CG2   . VAL D 4  735  ? -16.748 -14.224 73.087  1.00 104.41 ? 735  VAL A CG2   1 
ATOM   6544  N  N     . ASN D 4  736  ? -19.581 -12.357 69.936  1.00 110.56 ? 736  ASN A N     1 
ATOM   6545  C  CA    . ASN D 4  736  ? -20.898 -12.055 69.381  1.00 111.79 ? 736  ASN A CA    1 
ATOM   6546  C  C     . ASN D 4  736  ? -21.000 -12.329 67.884  1.00 112.73 ? 736  ASN A C     1 
ATOM   6547  O  O     . ASN D 4  736  ? -22.117 -12.407 67.358  1.00 114.27 ? 736  ASN A O     1 
ATOM   6548  C  CB    . ASN D 4  736  ? -21.258 -10.594 69.662  1.00 99.94  ? 736  ASN A CB    1 
ATOM   6549  C  CG    . ASN D 4  736  ? -22.731 -10.298 69.437  1.00 100.86 ? 736  ASN A CG    1 
ATOM   6550  O  OD1   . ASN D 4  736  ? -23.556 -10.433 70.345  1.00 104.87 ? 736  ASN A OD1   1 
ATOM   6551  N  ND2   . ASN D 4  736  ? -23.067 -9.880  68.222  1.00 102.21 ? 736  ASN A ND2   1 
ATOM   6552  N  N     . LEU D 4  737  ? -19.878 -12.473 67.186  1.00 107.77 ? 737  LEU A N     1 
ATOM   6553  C  CA    . LEU D 4  737  ? -19.929 -12.749 65.757  1.00 92.84  ? 737  LEU A CA    1 
ATOM   6554  C  C     . LEU D 4  737  ? -20.486 -14.141 65.489  1.00 104.30 ? 737  LEU A C     1 
ATOM   6555  O  O     . LEU D 4  737  ? -20.234 -15.089 66.239  1.00 124.82 ? 737  LEU A O     1 
ATOM   6556  C  CB    . LEU D 4  737  ? -18.541 -12.612 65.137  1.00 78.43  ? 737  LEU A CB    1 
ATOM   6557  C  CG    . LEU D 4  737  ? -17.948 -11.206 65.226  1.00 81.43  ? 737  LEU A CG    1 
ATOM   6558  C  CD1   . LEU D 4  737  ? -16.636 -11.142 64.466  1.00 91.53  ? 737  LEU A CD1   1 
ATOM   6559  C  CD2   . LEU D 4  737  ? -18.936 -10.155 64.717  1.00 60.01  ? 737  LEU A CD2   1 
ATOM   6560  N  N     . LYS D 4  738  ? -21.266 -14.252 64.418  1.00 87.15  ? 738  LYS A N     1 
ATOM   6561  C  CA    . LYS D 4  738  ? -21.855 -15.517 64.015  1.00 80.63  ? 738  LYS A CA    1 
ATOM   6562  C  C     . LYS D 4  738  ? -20.899 -16.287 63.107  1.00 79.93  ? 738  LYS A C     1 
ATOM   6563  O  O     . LYS D 4  738  ? -19.848 -15.789 62.697  1.00 81.88  ? 738  LYS A O     1 
ATOM   6564  C  CB    . LYS D 4  738  ? -23.195 -15.278 63.317  1.00 67.16  ? 738  LYS A CB    1 
ATOM   6565  C  CG    . LYS D 4  738  ? -24.022 -14.178 63.959  1.00 62.24  ? 738  LYS A CG    1 
ATOM   6566  C  CD    . LYS D 4  738  ? -25.392 -14.691 64.377  1.00 73.41  ? 738  LYS A CD    1 
ATOM   6567  C  CE    . LYS D 4  738  ? -26.252 -13.552 64.874  1.00 84.68  ? 738  LYS A CE    1 
ATOM   6568  N  NZ    . LYS D 4  738  ? -26.342 -12.486 63.847  1.00 90.02  ? 738  LYS A NZ    1 
ATOM   6569  N  N     . ASP D 4  739  ? -21.276 -17.531 62.800  1.00 76.34  ? 739  ASP A N     1 
ATOM   6570  C  CA    . ASP D 4  739  ? -20.472 -18.336 61.890  1.00 85.99  ? 739  ASP A CA    1 
ATOM   6571  C  C     . ASP D 4  739  ? -20.611 -17.885 60.444  1.00 85.69  ? 739  ASP A C     1 
ATOM   6572  O  O     . ASP D 4  739  ? -19.720 -18.165 59.633  1.00 74.78  ? 739  ASP A O     1 
ATOM   6573  C  CB    . ASP D 4  739  ? -20.847 -19.808 62.019  1.00 93.39  ? 739  ASP A CB    1 
ATOM   6574  C  CG    . ASP D 4  739  ? -20.549 -20.350 63.388  1.00 99.50  ? 739  ASP A CG    1 
ATOM   6575  O  OD1   . ASP D 4  739  ? -21.407 -20.210 64.286  1.00 115.45 ? 739  ASP A OD1   1 
ATOM   6576  O  OD2   . ASP D 4  739  ? -19.434 -20.878 63.574  1.00 95.66  ? 739  ASP A OD2   1 
ATOM   6577  N  N     . LEU D 4  740  ? -21.701 -17.188 60.107  1.00 89.39  ? 740  LEU A N     1 
ATOM   6578  C  CA    . LEU D 4  740  ? -21.866 -16.604 58.782  1.00 86.09  ? 740  LEU A CA    1 
ATOM   6579  C  C     . LEU D 4  740  ? -21.133 -15.281 58.615  1.00 71.12  ? 740  LEU A C     1 
ATOM   6580  O  O     . LEU D 4  740  ? -21.122 -14.748 57.501  1.00 62.65  ? 740  LEU A O     1 
ATOM   6581  C  CB    . LEU D 4  740  ? -23.351 -16.391 58.465  1.00 94.34  ? 740  LEU A CB    1 
ATOM   6582  C  CG    . LEU D 4  740  ? -24.232 -15.645 59.476  1.00 95.10  ? 740  LEU A CG    1 
ATOM   6583  C  CD1   . LEU D 4  740  ? -24.340 -14.141 59.200  1.00 77.08  ? 740  LEU A CD1   1 
ATOM   6584  C  CD2   . LEU D 4  740  ? -25.601 -16.284 59.519  1.00 108.96 ? 740  LEU A CD2   1 
ATOM   6585  N  N     . ASN D 4  741  ? -20.556 -14.733 59.686  1.00 84.95  ? 741  ASN A N     1 
ATOM   6586  C  CA    . ASN D 4  741  ? -19.896 -13.437 59.603  1.00 73.70  ? 741  ASN A CA    1 
ATOM   6587  C  C     . ASN D 4  741  ? -18.669 -13.546 58.712  1.00 71.07  ? 741  ASN A C     1 
ATOM   6588  O  O     . ASN D 4  741  ? -17.792 -14.381 58.945  1.00 78.75  ? 741  ASN A O     1 
ATOM   6589  C  CB    . ASN D 4  741  ? -19.489 -12.943 60.988  1.00 80.35  ? 741  ASN A CB    1 
ATOM   6590  C  CG    . ASN D 4  741  ? -18.898 -11.547 60.956  1.00 87.25  ? 741  ASN A CG    1 
ATOM   6591  O  OD1   . ASN D 4  741  ? -17.737 -11.342 60.580  1.00 84.82  ? 741  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN D 4  741  ? -19.691 -10.576 61.380  1.00 101.05 ? 741  ASN A ND2   1 
ATOM   6593  N  N     . ASN D 4  742  ? -18.608 -12.685 57.701  1.00 74.17  ? 742  ASN A N     1 
ATOM   6594  C  CA    . ASN D 4  742  ? -17.655 -12.871 56.618  1.00 82.19  ? 742  ASN A CA    1 
ATOM   6595  C  C     . ASN D 4  742  ? -16.248 -12.425 56.995  1.00 74.34  ? 742  ASN A C     1 
ATOM   6596  O  O     . ASN D 4  742  ? -15.268 -12.983 56.481  1.00 77.04  ? 742  ASN A O     1 
ATOM   6597  C  CB    . ASN D 4  742  ? -18.146 -12.125 55.382  1.00 90.42  ? 742  ASN A CB    1 
ATOM   6598  C  CG    . ASN D 4  742  ? -19.624 -12.399 55.074  1.00 86.59  ? 742  ASN A CG    1 
ATOM   6599  O  OD1   . ASN D 4  742  ? -20.503 -12.117 55.889  1.00 90.52  ? 742  ASN A OD1   1 
ATOM   6600  N  ND2   . ASN D 4  742  ? -19.893 -12.962 53.899  1.00 75.20  ? 742  ASN A ND2   1 
ATOM   6601  N  N     . VAL D 4  743  ? -16.122 -11.435 57.886  1.00 77.41  ? 743  VAL A N     1 
ATOM   6602  C  CA    . VAL D 4  743  ? -14.812 -11.119 58.447  1.00 81.17  ? 743  VAL A CA    1 
ATOM   6603  C  C     . VAL D 4  743  ? -14.334 -12.267 59.326  1.00 74.01  ? 743  VAL A C     1 
ATOM   6604  O  O     . VAL D 4  743  ? -13.156 -12.649 59.292  1.00 71.90  ? 743  VAL A O     1 
ATOM   6605  C  CB    . VAL D 4  743  ? -14.857 -9.787  59.221  1.00 85.59  ? 743  VAL A CB    1 
ATOM   6606  C  CG1   . VAL D 4  743  ? -13.446 -9.336  59.592  1.00 98.88  ? 743  VAL A CG1   1 
ATOM   6607  C  CG2   . VAL D 4  743  ? -15.568 -8.711  58.411  1.00 80.88  ? 743  VAL A CG2   1 
ATOM   6608  N  N     . LYS D 4  744  ? -15.251 -12.856 60.103  1.00 69.92  ? 744  LYS A N     1 
ATOM   6609  C  CA    . LYS D 4  744  ? -14.916 -14.034 60.896  1.00 65.18  ? 744  LYS A CA    1 
ATOM   6610  C  C     . LYS D 4  744  ? -14.593 -15.231 60.010  1.00 78.39  ? 744  LYS A C     1 
ATOM   6611  O  O     . LYS D 4  744  ? -13.723 -16.032 60.360  1.00 86.18  ? 744  LYS A O     1 
ATOM   6612  C  CB    . LYS D 4  744  ? -16.061 -14.371 61.861  1.00 59.80  ? 744  LYS A CB    1 
ATOM   6613  C  CG    . LYS D 4  744  ? -15.720 -15.458 62.880  1.00 77.58  ? 744  LYS A CG    1 
ATOM   6614  C  CD    . LYS D 4  744  ? -16.809 -15.627 63.929  1.00 88.28  ? 744  LYS A CD    1 
ATOM   6615  C  CE    . LYS D 4  744  ? -16.591 -16.891 64.751  1.00 92.39  ? 744  LYS A CE    1 
ATOM   6616  N  NZ    . LYS D 4  744  ? -15.272 -16.881 65.442  1.00 94.58  ? 744  LYS A NZ    1 
ATOM   6617  N  N     . GLN D 4  745  ? -15.260 -15.359 58.856  1.00 82.32  ? 745  GLN A N     1 
ATOM   6618  C  CA    . GLN D 4  745  ? -14.936 -16.445 57.931  1.00 81.84  ? 745  GLN A CA    1 
ATOM   6619  C  C     . GLN D 4  745  ? -13.551 -16.262 57.328  1.00 76.65  ? 745  GLN A C     1 
ATOM   6620  O  O     . GLN D 4  745  ? -12.810 -17.237 57.143  1.00 99.80  ? 745  GLN A O     1 
ATOM   6621  C  CB    . GLN D 4  745  ? -15.985 -16.547 56.822  1.00 55.79  ? 745  GLN A CB    1 
ATOM   6622  C  CG    . GLN D 4  745  ? -17.341 -17.066 57.279  1.00 73.40  ? 745  GLN A CG    1 
ATOM   6623  C  CD    . GLN D 4  745  ? -18.297 -17.297 56.125  1.00 88.30  ? 745  GLN A CD    1 
ATOM   6624  O  OE1   . GLN D 4  745  ? -17.878 -17.511 54.986  1.00 105.42 ? 745  GLN A OE1   1 
ATOM   6625  N  NE2   . GLN D 4  745  ? -19.588 -17.255 56.412  1.00 96.30  ? 745  GLN A NE2   1 
ATOM   6626  N  N     . MET D 4  746  ? -13.184 -15.022 57.018  1.00 72.11  ? 746  MET A N     1 
ATOM   6627  C  CA    . MET D 4  746  ? -11.861 -14.773 56.465  1.00 83.46  ? 746  MET A CA    1 
ATOM   6628  C  C     . MET D 4  746  ? -10.780 -14.969 57.519  1.00 90.09  ? 746  MET A C     1 
ATOM   6629  O  O     . MET D 4  746  ? -9.668  -15.408 57.196  1.00 84.03  ? 746  MET A O     1 
ATOM   6630  C  CB    . MET D 4  746  ? -11.830 -13.367 55.881  1.00 86.89  ? 746  MET A CB    1 
ATOM   6631  C  CG    . MET D 4  746  ? -12.481 -13.305 54.515  1.00 71.93  ? 746  MET A CG    1 
ATOM   6632  S  SD    . MET D 4  746  ? -12.337 -11.691 53.755  1.00 56.29  ? 746  MET A SD    1 
ATOM   6633  C  CE    . MET D 4  746  ? -13.615 -10.819 54.651  1.00 72.28  ? 746  MET A CE    1 
ATOM   6634  N  N     . VAL D 4  747  ? -11.096 -14.662 58.779  1.00 104.47 ? 747  VAL A N     1 
ATOM   6635  C  CA    . VAL D 4  747  ? -10.174 -14.941 59.876  1.00 96.56  ? 747  VAL A CA    1 
ATOM   6636  C  C     . VAL D 4  747  ? -10.015 -16.448 60.066  1.00 103.69 ? 747  VAL A C     1 
ATOM   6637  O  O     . VAL D 4  747  ? -8.893  -16.960 60.176  1.00 112.39 ? 747  VAL A O     1 
ATOM   6638  C  CB    . VAL D 4  747  ? -10.656 -14.238 61.162  1.00 82.88  ? 747  VAL A CB    1 
ATOM   6639  C  CG1   . VAL D 4  747  ? -10.011 -14.841 62.398  1.00 86.92  ? 747  VAL A CG1   1 
ATOM   6640  C  CG2   . VAL D 4  747  ? -10.366 -12.732 61.090  1.00 87.56  ? 747  VAL A CG2   1 
ATOM   6641  N  N     . MET D 4  748  ? -11.134 -17.185 60.064  1.00 102.45 ? 748  MET A N     1 
ATOM   6642  C  CA    . MET D 4  748  ? -11.109 -18.624 60.329  1.00 94.51  ? 748  MET A CA    1 
ATOM   6643  C  C     . MET D 4  748  ? -10.448 -19.401 59.195  1.00 84.20  ? 748  MET A C     1 
ATOM   6644  O  O     . MET D 4  748  ? -9.831  -20.448 59.438  1.00 83.24  ? 748  MET A O     1 
ATOM   6645  C  CB    . MET D 4  748  ? -12.533 -19.137 60.564  1.00 91.37  ? 748  MET A CB    1 
ATOM   6646  C  CG    . MET D 4  748  ? -13.106 -18.831 61.947  1.00 102.95 ? 748  MET A CG    1 
ATOM   6647  S  SD    . MET D 4  748  ? -14.606 -19.772 62.317  1.00 114.50 ? 748  MET A SD    1 
ATOM   6648  C  CE    . MET D 4  748  ? -15.712 -19.168 61.043  1.00 88.77  ? 748  MET A CE    1 
ATOM   6649  N  N     . ALA D 4  749  ? -10.566 -18.914 57.960  1.00 75.80  ? 749  ALA A N     1 
ATOM   6650  C  CA    . ALA D 4  749  ? -9.814  -19.491 56.854  1.00 75.91  ? 749  ALA A CA    1 
ATOM   6651  C  C     . ALA D 4  749  ? -8.362  -19.030 56.832  1.00 71.89  ? 749  ALA A C     1 
ATOM   6652  O  O     . ALA D 4  749  ? -7.539  -19.653 56.149  1.00 56.70  ? 749  ALA A O     1 
ATOM   6653  C  CB    . ALA D 4  749  ? -10.488 -19.143 55.523  1.00 85.72  ? 749  ALA A CB    1 
ATOM   6654  N  N     . GLY D 4  750  ? -8.027  -17.974 57.573  1.00 84.85  ? 750  GLY A N     1 
ATOM   6655  C  CA    . GLY D 4  750  ? -6.685  -17.432 57.540  1.00 89.65  ? 750  GLY A CA    1 
ATOM   6656  C  C     . GLY D 4  750  ? -6.368  -16.674 56.275  1.00 86.49  ? 750  GLY A C     1 
ATOM   6657  O  O     . GLY D 4  750  ? -5.193  -16.425 55.987  1.00 73.98  ? 750  GLY A O     1 
ATOM   6658  N  N     . SER D 4  751  ? -7.398  -16.302 55.509  1.00 98.47  ? 751  SER A N     1 
ATOM   6659  C  CA    . SER D 4  751  ? -7.191  -15.630 54.230  1.00 104.39 ? 751  SER A CA    1 
ATOM   6660  C  C     . SER D 4  751  ? -6.699  -14.203 54.431  1.00 107.27 ? 751  SER A C     1 
ATOM   6661  O  O     . SER D 4  751  ? -5.668  -13.809 53.872  1.00 107.37 ? 751  SER A O     1 
ATOM   6662  C  CB    . SER D 4  751  ? -8.488  -15.636 53.416  1.00 103.11 ? 751  SER A CB    1 
ATOM   6663  O  OG    . SER D 4  751  ? -9.509  -14.903 54.075  1.00 100.94 ? 751  SER A OG    1 
ATOM   6664  N  N     . LYS D 4  752  ? -7.432  -13.411 55.215  1.00 112.56 ? 752  LYS A N     1 
ATOM   6665  C  CA    . LYS D 4  752  ? -7.037  -12.044 55.527  1.00 104.41 ? 752  LYS A CA    1 
ATOM   6666  C  C     . LYS D 4  752  ? -7.761  -11.596 56.791  1.00 88.17  ? 752  LYS A C     1 
ATOM   6667  O  O     . LYS D 4  752  ? -8.894  -12.010 57.052  1.00 85.65  ? 752  LYS A O     1 
ATOM   6668  C  CB    . LYS D 4  752  ? -7.351  -11.086 54.369  1.00 91.21  ? 752  LYS A CB    1 
ATOM   6669  C  CG    . LYS D 4  752  ? -6.656  -9.743  54.480  1.00 79.73  ? 752  LYS A CG    1 
ATOM   6670  C  CD    . LYS D 4  752  ? -5.142  -9.909  54.438  1.00 82.66  ? 752  LYS A CD    1 
ATOM   6671  C  CE    . LYS D 4  752  ? -4.606  -9.805  53.015  1.00 83.67  ? 752  LYS A CE    1 
ATOM   6672  N  NZ    . LYS D 4  752  ? -4.414  -8.379  52.595  1.00 81.74  ? 752  LYS A NZ    1 
ATOM   6673  N  N     . GLY D 4  753  ? -7.105  -10.739 57.560  1.00 82.36  ? 753  GLY A N     1 
ATOM   6674  C  CA    . GLY D 4  753  ? -7.705  -10.197 58.756  1.00 95.01  ? 753  GLY A CA    1 
ATOM   6675  C  C     . GLY D 4  753  ? -7.235  -10.911 60.015  1.00 99.56  ? 753  GLY A C     1 
ATOM   6676  O  O     . GLY D 4  753  ? -6.719  -12.033 59.986  1.00 97.88  ? 753  GLY A O     1 
ATOM   6677  N  N     . SER D 4  754  ? -7.417  -10.229 61.143  1.00 91.86  ? 754  SER A N     1 
ATOM   6678  C  CA    . SER D 4  754  ? -7.021  -10.741 62.443  1.00 75.81  ? 754  SER A CA    1 
ATOM   6679  C  C     . SER D 4  754  ? -8.005  -10.221 63.484  1.00 69.37  ? 754  SER A C     1 
ATOM   6680  O  O     . SER D 4  754  ? -8.963  -9.511  63.163  1.00 72.70  ? 754  SER A O     1 
ATOM   6681  C  CB    . SER D 4  754  ? -5.580  -10.343 62.780  1.00 67.27  ? 754  SER A CB    1 
ATOM   6682  O  OG    . SER D 4  754  ? -5.351  -8.976  62.490  1.00 79.45  ? 754  SER A OG    1 
ATOM   6683  N  N     . PHE D 4  755  ? -7.751  -10.581 64.745  1.00 77.46  ? 755  PHE A N     1 
ATOM   6684  C  CA    . PHE D 4  755  ? -8.659  -10.219 65.829  1.00 88.19  ? 755  PHE A CA    1 
ATOM   6685  C  C     . PHE D 4  755  ? -8.645  -8.717  66.087  1.00 97.13  ? 755  PHE A C     1 
ATOM   6686  O  O     . PHE D 4  755  ? -9.694  -8.119  66.367  1.00 109.78 ? 755  PHE A O     1 
ATOM   6687  C  CB    . PHE D 4  755  ? -8.277  -10.981 67.102  1.00 98.50  ? 755  PHE A CB    1 
ATOM   6688  C  CG    . PHE D 4  755  ? -8.736  -10.316 68.374  1.00 101.09 ? 755  PHE A CG    1 
ATOM   6689  C  CD1   . PHE D 4  755  ? -10.081 -10.283 68.706  1.00 101.61 ? 755  PHE A CD1   1 
ATOM   6690  C  CD2   . PHE D 4  755  ? -7.829  -9.700  69.224  1.00 96.52  ? 755  PHE A CD2   1 
ATOM   6691  C  CE1   . PHE D 4  755  ? -10.507 -9.675  69.868  1.00 93.51  ? 755  PHE A CE1   1 
ATOM   6692  C  CE2   . PHE D 4  755  ? -8.261  -9.079  70.388  1.00 89.86  ? 755  PHE A CE2   1 
ATOM   6693  C  CZ    . PHE D 4  755  ? -9.601  -9.068  70.706  1.00 84.72  ? 755  PHE A CZ    1 
ATOM   6694  N  N     . ILE D 4  756  ? -7.465  -8.093  66.001  1.00 100.13 ? 756  ILE A N     1 
ATOM   6695  C  CA    . ILE D 4  756  ? -7.326  -6.683  66.358  1.00 87.78  ? 756  ILE A CA    1 
ATOM   6696  C  C     . ILE D 4  756  ? -8.108  -5.806  65.385  1.00 69.54  ? 756  ILE A C     1 
ATOM   6697  O  O     . ILE D 4  756  ? -8.637  -4.760  65.777  1.00 59.30  ? 756  ILE A O     1 
ATOM   6698  C  CB    . ILE D 4  756  ? -5.830  -6.303  66.436  1.00 91.99  ? 756  ILE A CB    1 
ATOM   6699  C  CG1   . ILE D 4  756  ? -5.638  -4.835  66.840  1.00 93.34  ? 756  ILE A CG1   1 
ATOM   6700  C  CG2   . ILE D 4  756  ? -5.106  -6.606  65.120  1.00 86.37  ? 756  ILE A CG2   1 
ATOM   6701  C  CD1   . ILE D 4  756  ? -4.197  -4.456  67.176  1.00 94.38  ? 756  ILE A CD1   1 
ATOM   6702  N  N     . ASN D 4  757  ? -8.250  -6.247  64.126  1.00 81.63  ? 757  ASN A N     1 
ATOM   6703  C  CA    . ASN D 4  757  ? -9.059  -5.519  63.148  1.00 74.03  ? 757  ASN A CA    1 
ATOM   6704  C  C     . ASN D 4  757  ? -10.536 -5.530  63.531  1.00 76.54  ? 757  ASN A C     1 
ATOM   6705  O  O     . ASN D 4  757  ? -11.219 -4.503  63.416  1.00 81.55  ? 757  ASN A O     1 
ATOM   6706  C  CB    . ASN D 4  757  ? -8.858  -6.113  61.748  1.00 59.10  ? 757  ASN A CB    1 
ATOM   6707  C  CG    . ASN D 4  757  ? -7.396  -6.099  61.298  1.00 62.99  ? 757  ASN A CG    1 
ATOM   6708  O  OD1   . ASN D 4  757  ? -6.662  -5.142  61.557  1.00 74.29  ? 757  ASN A OD1   1 
ATOM   6709  N  ND2   . ASN D 4  757  ? -6.975  -7.156  60.606  1.00 54.81  ? 757  ASN A ND2   1 
ATOM   6710  N  N     . ILE D 4  758  ? -11.036 -6.678  64.008  1.00 78.24  ? 758  ILE A N     1 
ATOM   6711  C  CA    . ILE D 4  758  ? -12.409 -6.765  64.503  1.00 84.42  ? 758  ILE A CA    1 
ATOM   6712  C  C     . ILE D 4  758  ? -12.590 -5.885  65.735  1.00 73.51  ? 758  ILE A C     1 
ATOM   6713  O  O     . ILE D 4  758  ? -13.612 -5.199  65.880  1.00 74.97  ? 758  ILE A O     1 
ATOM   6714  C  CB    . ILE D 4  758  ? -12.782 -8.235  64.793  1.00 78.88  ? 758  ILE A CB    1 
ATOM   6715  C  CG1   . ILE D 4  758  ? -12.280 -9.161  63.675  1.00 79.07  ? 758  ILE A CG1   1 
ATOM   6716  C  CG2   . ILE D 4  758  ? -14.284 -8.391  65.019  1.00 64.61  ? 758  ILE A CG2   1 
ATOM   6717  C  CD1   . ILE D 4  758  ? -12.609 -10.636 63.885  1.00 72.54  ? 758  ILE A CD1   1 
ATOM   6718  N  N     . ALA D 4  759  ? -11.595 -5.885  66.630  1.00 64.37  ? 759  ALA A N     1 
ATOM   6719  C  CA    . ALA D 4  759  ? -11.659 -5.058  67.834  1.00 69.00  ? 759  ALA A CA    1 
ATOM   6720  C  C     . ALA D 4  759  ? -11.757 -3.575  67.486  1.00 78.87  ? 759  ALA A C     1 
ATOM   6721  O  O     . ALA D 4  759  ? -12.632 -2.859  67.992  1.00 54.39  ? 759  ALA A O     1 
ATOM   6722  C  CB    . ALA D 4  759  ? -10.433 -5.326  68.708  1.00 56.81  ? 759  ALA A CB    1 
ATOM   6723  N  N     . GLN D 4  760  ? -10.880 -3.106  66.595  1.00 90.76  ? 760  GLN A N     1 
ATOM   6724  C  CA    . GLN D 4  760  ? -10.859 -1.696  66.217  1.00 65.36  ? 760  GLN A CA    1 
ATOM   6725  C  C     . GLN D 4  760  ? -12.088 -1.300  65.404  1.00 85.80  ? 760  GLN A C     1 
ATOM   6726  O  O     . GLN D 4  760  ? -12.565 -0.165  65.519  1.00 115.83 ? 760  GLN A O     1 
ATOM   6727  C  CB    . GLN D 4  760  ? -9.573  -1.391  65.444  1.00 51.68  ? 760  GLN A CB    1 
ATOM   6728  C  CG    . GLN D 4  760  ? -8.296  -1.605  66.250  1.00 51.93  ? 760  GLN A CG    1 
ATOM   6729  C  CD    . GLN D 4  760  ? -7.064  -1.026  65.579  1.00 63.24  ? 760  GLN A CD    1 
ATOM   6730  O  OE1   . GLN D 4  760  ? -6.956  0.181   65.380  1.00 90.05  ? 760  GLN A OE1   1 
ATOM   6731  N  NE2   . GLN D 4  760  ? -6.127  -1.894  65.220  1.00 59.59  ? 760  GLN A NE2   1 
ATOM   6732  N  N     . MET D 4  761  ? -12.625 -2.211  64.591  1.00 65.29  ? 761  MET A N     1 
ATOM   6733  C  CA    . MET D 4  761  ? -13.757 -1.832  63.756  1.00 69.48  ? 761  MET A CA    1 
ATOM   6734  C  C     . MET D 4  761  ? -15.073 -1.852  64.530  1.00 65.94  ? 761  MET A C     1 
ATOM   6735  O  O     . MET D 4  761  ? -15.862 -0.905  64.436  1.00 66.52  ? 761  MET A O     1 
ATOM   6736  C  CB    . MET D 4  761  ? -13.823 -2.747  62.535  1.00 73.59  ? 761  MET A CB    1 
ATOM   6737  C  CG    . MET D 4  761  ? -12.792 -2.418  61.475  1.00 54.10  ? 761  MET A CG    1 
ATOM   6738  S  SD    . MET D 4  761  ? -13.315 -2.975  59.844  1.00 72.12  ? 761  MET A SD    1 
ATOM   6739  C  CE    . MET D 4  761  ? -13.120 -4.759  59.969  1.00 93.79  ? 761  MET A CE    1 
ATOM   6740  N  N     . SER D 4  762  ? -15.328 -2.901  65.309  1.00 65.98  ? 762  SER A N     1 
ATOM   6741  C  CA    . SER D 4  762  ? -16.635 -3.064  65.935  1.00 67.94  ? 762  SER A CA    1 
ATOM   6742  C  C     . SER D 4  762  ? -16.705 -2.528  67.358  1.00 74.22  ? 762  SER A C     1 
ATOM   6743  O  O     . SER D 4  762  ? -17.682 -1.858  67.708  1.00 78.15  ? 762  SER A O     1 
ATOM   6744  C  CB    . SER D 4  762  ? -17.041 -4.541  65.937  1.00 83.85  ? 762  SER A CB    1 
ATOM   6745  O  OG    . SER D 4  762  ? -17.506 -4.938  64.660  1.00 92.43  ? 762  SER A OG    1 
ATOM   6746  N  N     . ALA D 4  763  ? -15.696 -2.802  68.187  1.00 66.25  ? 763  ALA A N     1 
ATOM   6747  C  CA    . ALA D 4  763  ? -15.774 -2.519  69.617  1.00 57.97  ? 763  ALA A CA    1 
ATOM   6748  C  C     . ALA D 4  763  ? -15.088 -1.212  70.006  1.00 77.67  ? 763  ALA A C     1 
ATOM   6749  O  O     . ALA D 4  763  ? -15.746 -0.283  70.489  1.00 88.28  ? 763  ALA A O     1 
ATOM   6750  C  CB    . ALA D 4  763  ? -15.158 -3.688  70.395  1.00 56.98  ? 763  ALA A CB    1 
ATOM   6751  N  N     . CYS D 4  764  ? -13.775 -1.120  69.780  1.00 81.13  ? 764  CYS A N     1 
ATOM   6752  C  CA    . CYS D 4  764  ? -12.978 0.025   70.207  1.00 76.86  ? 764  CYS A CA    1 
ATOM   6753  C  C     . CYS D 4  764  ? -11.594 -0.026  69.568  1.00 87.10  ? 764  CYS A C     1 
ATOM   6754  O  O     . CYS D 4  764  ? -10.901 -1.043  69.665  1.00 120.20 ? 764  CYS A O     1 
ATOM   6755  C  CB    . CYS D 4  764  ? -12.855 0.042   71.738  1.00 68.31  ? 764  CYS A CB    1 
ATOM   6756  S  SG    . CYS D 4  764  ? -11.680 1.222   72.404  1.00 70.75  ? 764  CYS A SG    1 
ATOM   6757  N  N     . VAL D 4  765  ? -11.182 1.066   68.920  1.00 82.15  ? 765  VAL A N     1 
ATOM   6758  C  CA    . VAL D 4  765  ? -9.841  1.130   68.340  1.00 84.98  ? 765  VAL A CA    1 
ATOM   6759  C  C     . VAL D 4  765  ? -8.773  1.160   69.433  1.00 88.34  ? 765  VAL A C     1 
ATOM   6760  O  O     . VAL D 4  765  ? -7.763  0.457   69.341  1.00 100.36 ? 765  VAL A O     1 
ATOM   6761  C  CB    . VAL D 4  765  ? -9.753  2.308   67.346  1.00 73.05  ? 765  VAL A CB    1 
ATOM   6762  C  CG1   . VAL D 4  765  ? -10.305 3.528   67.954  1.00 61.36  ? 765  VAL A CG1   1 
ATOM   6763  C  CG2   . VAL D 4  765  ? -8.311  2.594   66.938  1.00 63.19  ? 765  VAL A CG2   1 
ATOM   6764  N  N     . GLY D 4  766  ? -8.992  1.924   70.505  1.00 81.08  ? 766  GLY A N     1 
ATOM   6765  C  CA    . GLY D 4  766  ? -8.177  1.829   71.697  1.00 85.57  ? 766  GLY A CA    1 
ATOM   6766  C  C     . GLY D 4  766  ? -7.332  3.070   71.921  1.00 92.14  ? 766  GLY A C     1 
ATOM   6767  O  O     . GLY D 4  766  ? -7.807  4.208   71.705  1.00 96.26  ? 766  GLY A O     1 
ATOM   6768  N  N     . GLN D 4  767  ? -6.090  2.871   72.333  1.00 101.13 ? 767  GLN A N     1 
ATOM   6769  C  CA    . GLN D 4  767  ? -5.218  3.934   72.819  1.00 97.76  ? 767  GLN A CA    1 
ATOM   6770  C  C     . GLN D 4  767  ? -4.120  4.215   71.793  1.00 75.98  ? 767  GLN A C     1 
ATOM   6771  O  O     . GLN D 4  767  ? -3.385  3.302   71.398  1.00 67.48  ? 767  GLN A O     1 
ATOM   6772  C  CB    . GLN D 4  767  ? -4.622  3.546   74.178  1.00 90.51  ? 767  GLN A CB    1 
ATOM   6773  C  CG    . GLN D 4  767  ? -3.494  4.435   74.676  1.00 54.73  ? 767  GLN A CG    1 
ATOM   6774  C  CD    . GLN D 4  767  ? -3.942  5.852   74.960  1.00 77.56  ? 767  GLN A CD    1 
ATOM   6775  O  OE1   . GLN D 4  767  ? -4.703  6.106   75.895  1.00 73.74  ? 767  GLN A OE1   1 
ATOM   6776  N  NE2   . GLN D 4  767  ? -3.474  6.787   74.146  1.00 89.75  ? 767  GLN A NE2   1 
ATOM   6777  N  N     . GLN D 4  768  ? -4.016  5.475   71.365  1.00 66.72  ? 768  GLN A N     1 
ATOM   6778  C  CA    . GLN D 4  768  ? -2.972  5.881   70.430  1.00 65.80  ? 768  GLN A CA    1 
ATOM   6779  C  C     . GLN D 4  768  ? -1.656  6.142   71.158  1.00 58.55  ? 768  GLN A C     1 
ATOM   6780  O  O     . GLN D 4  768  ? -1.632  6.553   72.322  1.00 54.25  ? 768  GLN A O     1 
ATOM   6781  C  CB    . GLN D 4  768  ? -3.400  7.123   69.643  1.00 59.94  ? 768  GLN A CB    1 
ATOM   6782  C  CG    . GLN D 4  768  ? -3.736  6.834   68.178  1.00 75.57  ? 768  GLN A CG    1 
ATOM   6783  C  CD    . GLN D 4  768  ? -4.759  5.731   68.010  1.00 83.35  ? 768  GLN A CD    1 
ATOM   6784  O  OE1   . GLN D 4  768  ? -5.807  5.750   68.649  1.00 98.13  ? 768  GLN A OE1   1 
ATOM   6785  N  NE2   . GLN D 4  768  ? -4.460  4.762   67.152  1.00 70.50  ? 768  GLN A NE2   1 
ATOM   6786  N  N     . SER D 4  769  ? -0.549  5.888   70.459  1.00 68.29  ? 769  SER A N     1 
ATOM   6787  C  CA    . SER D 4  769  ? 0.779   5.889   71.062  1.00 76.40  ? 769  SER A CA    1 
ATOM   6788  C  C     . SER D 4  769  ? 1.730   6.689   70.186  1.00 72.22  ? 769  SER A C     1 
ATOM   6789  O  O     . SER D 4  769  ? 1.808   6.455   68.975  1.00 67.55  ? 769  SER A O     1 
ATOM   6790  C  CB    . SER D 4  769  ? 1.317   4.456   71.257  1.00 92.82  ? 769  SER A CB    1 
ATOM   6791  O  OG    . SER D 4  769  ? 1.814   3.894   70.050  1.00 104.05 ? 769  SER A OG    1 
ATOM   6792  N  N     . VAL D 4  770  ? 2.447   7.629   70.800  1.00 90.33  ? 770  VAL A N     1 
ATOM   6793  C  CA    . VAL D 4  770  ? 3.473   8.422   70.129  1.00 95.52  ? 770  VAL A CA    1 
ATOM   6794  C  C     . VAL D 4  770  ? 4.788   8.230   70.876  1.00 96.08  ? 770  VAL A C     1 
ATOM   6795  O  O     . VAL D 4  770  ? 4.875   8.529   72.075  1.00 90.83  ? 770  VAL A O     1 
ATOM   6796  C  CB    . VAL D 4  770  ? 3.099   9.911   70.048  1.00 90.02  ? 770  VAL A CB    1 
ATOM   6797  C  CG1   . VAL D 4  770  ? 4.206   10.694  69.366  1.00 84.94  ? 770  VAL A CG1   1 
ATOM   6798  C  CG2   . VAL D 4  770  ? 1.794   10.090  69.287  1.00 94.44  ? 770  VAL A CG2   1 
ATOM   6799  N  N     . GLU D 4  771  ? 5.803   7.726   70.159  1.00 93.36  ? 771  GLU A N     1 
ATOM   6800  C  CA    . GLU D 4  771  ? 7.153   7.476   70.682  1.00 73.74  ? 771  GLU A CA    1 
ATOM   6801  C  C     . GLU D 4  771  ? 7.131   6.559   71.905  1.00 75.47  ? 771  GLU A C     1 
ATOM   6802  O  O     . GLU D 4  771  ? 7.940   6.706   72.825  1.00 82.31  ? 771  GLU A O     1 
ATOM   6803  C  CB    . GLU D 4  771  ? 7.879   8.789   70.993  1.00 63.06  ? 771  GLU A CB    1 
ATOM   6804  C  CG    . GLU D 4  771  ? 8.616   9.393   69.803  1.00 87.37  ? 771  GLU A CG    1 
ATOM   6805  C  CD    . GLU D 4  771  ? 9.557   10.517  70.205  1.00 110.34 ? 771  GLU A CD    1 
ATOM   6806  O  OE1   . GLU D 4  771  ? 9.527   10.925  71.386  1.00 116.74 ? 771  GLU A OE1   1 
ATOM   6807  O  OE2   . GLU D 4  771  ? 10.320  11.000  69.341  1.00 113.88 ? 771  GLU A OE2   1 
ATOM   6808  N  N     . GLY D 4  772  ? 6.195   5.606   71.921  1.00 70.91  ? 772  GLY A N     1 
ATOM   6809  C  CA    . GLY D 4  772  ? 6.036   4.692   73.030  1.00 74.24  ? 772  GLY A CA    1 
ATOM   6810  C  C     . GLY D 4  772  ? 5.136   5.181   74.150  1.00 75.19  ? 772  GLY A C     1 
ATOM   6811  O  O     . GLY D 4  772  ? 4.715   4.366   74.983  1.00 97.30  ? 772  GLY A O     1 
ATOM   6812  N  N     . LYS D 4  773  ? 4.824   6.474   74.201  1.00 54.15  ? 773  LYS A N     1 
ATOM   6813  C  CA    . LYS D 4  773  ? 4.001   7.046   75.257  1.00 57.52  ? 773  LYS A CA    1 
ATOM   6814  C  C     . LYS D 4  773  ? 2.655   7.482   74.684  1.00 63.39  ? 773  LYS A C     1 
ATOM   6815  O  O     . LYS D 4  773  ? 2.425   7.444   73.472  1.00 72.71  ? 773  LYS A O     1 
ATOM   6816  C  CB    . LYS D 4  773  ? 4.714   8.229   75.927  1.00 71.86  ? 773  LYS A CB    1 
ATOM   6817  C  CG    . LYS D 4  773  ? 6.123   7.923   76.414  1.00 77.39  ? 773  LYS A CG    1 
ATOM   6818  C  CD    . LYS D 4  773  ? 6.656   9.003   77.346  1.00 86.86  ? 773  LYS A CD    1 
ATOM   6819  C  CE    . LYS D 4  773  ? 5.786   9.100   78.593  1.00 100.90 ? 773  LYS A CE    1 
ATOM   6820  N  NZ    . LYS D 4  773  ? 6.316   10.051  79.608  1.00 109.05 ? 773  LYS A NZ    1 
ATOM   6821  N  N     . ARG D 4  774  ? 1.766   7.935   75.572  1.00 57.52  ? 774  ARG A N     1 
ATOM   6822  C  CA    . ARG D 4  774  ? 0.480   8.486   75.158  1.00 55.22  ? 774  ARG A CA    1 
ATOM   6823  C  C     . ARG D 4  774  ? 0.685   9.851   74.487  1.00 77.94  ? 774  ARG A C     1 
ATOM   6824  O  O     . ARG D 4  774  ? 1.812   10.310  74.275  1.00 93.48  ? 774  ARG A O     1 
ATOM   6825  C  CB    . ARG D 4  774  ? -0.452  8.601   76.363  1.00 57.98  ? 774  ARG A CB    1 
ATOM   6826  C  CG    . ARG D 4  774  ? -0.671  7.292   77.099  1.00 55.64  ? 774  ARG A CG    1 
ATOM   6827  C  CD    . ARG D 4  774  ? -1.045  7.550   78.556  1.00 71.93  ? 774  ARG A CD    1 
ATOM   6828  N  NE    . ARG D 4  774  ? -2.392  8.088   78.735  1.00 81.06  ? 774  ARG A NE    1 
ATOM   6829  C  CZ    . ARG D 4  774  ? -2.877  8.511   79.902  1.00 77.08  ? 774  ARG A CZ    1 
ATOM   6830  N  NH1   . ARG D 4  774  ? -2.124  8.492   80.996  1.00 58.22  ? 774  ARG A NH1   1 
ATOM   6831  N  NH2   . ARG D 4  774  ? -4.114  8.980   79.973  1.00 85.88  ? 774  ARG A NH2   1 
ATOM   6832  N  N     . ILE D 4  775  ? -0.425  10.505  74.137  1.00 82.97  ? 775  ILE A N     1 
ATOM   6833  C  CA    . ILE D 4  775  ? -0.353  11.780  73.423  1.00 91.65  ? 775  ILE A CA    1 
ATOM   6834  C  C     . ILE D 4  775  ? 0.262   12.826  74.346  1.00 101.17 ? 775  ILE A C     1 
ATOM   6835  O  O     . ILE D 4  775  ? -0.293  13.147  75.404  1.00 98.84  ? 775  ILE A O     1 
ATOM   6836  C  CB    . ILE D 4  775  ? -1.737  12.213  72.923  1.00 90.80  ? 775  ILE A CB    1 
ATOM   6837  C  CG1   . ILE D 4  775  ? -2.301  11.166  71.967  1.00 77.61  ? 775  ILE A CG1   1 
ATOM   6838  C  CG2   . ILE D 4  775  ? -1.672  13.560  72.213  1.00 96.03  ? 775  ILE A CG2   1 
ATOM   6839  C  CD1   . ILE D 4  775  ? -1.493  10.976  70.724  1.00 98.60  ? 775  ILE A CD1   1 
ATOM   6840  N  N     . ALA D 4  776  ? 1.430   13.335  73.956  1.00 99.38  ? 776  ALA A N     1 
ATOM   6841  C  CA    . ALA D 4  776  ? 2.212   14.221  74.802  1.00 104.62 ? 776  ALA A CA    1 
ATOM   6842  C  C     . ALA D 4  776  ? 1.574   15.605  74.881  1.00 91.26  ? 776  ALA A C     1 
ATOM   6843  O  O     . ALA D 4  776  ? 0.793   16.010  74.017  1.00 81.25  ? 776  ALA A O     1 
ATOM   6844  C  CB    . ALA D 4  776  ? 3.640   14.335  74.268  1.00 116.09 ? 776  ALA A CB    1 
ATOM   6845  N  N     . PHE D 4  777  ? 1.932   16.341  75.936  1.00 97.92  ? 777  PHE A N     1 
ATOM   6846  C  CA    . PHE D 4  777  ? 1.437   17.702  76.147  1.00 80.14  ? 777  PHE A CA    1 
ATOM   6847  C  C     . PHE D 4  777  ? 2.157   18.635  75.174  1.00 76.40  ? 777  PHE A C     1 
ATOM   6848  O  O     . PHE D 4  777  ? 3.134   19.313  75.506  1.00 70.14  ? 777  PHE A O     1 
ATOM   6849  C  CB    . PHE D 4  777  ? 1.631   18.131  77.600  1.00 74.00  ? 777  PHE A CB    1 
ATOM   6850  C  CG    . PHE D 4  777  ? 0.558   17.633  78.542  1.00 73.60  ? 777  PHE A CG    1 
ATOM   6851  C  CD1   . PHE D 4  777  ? 0.701   17.753  79.914  1.00 84.41  ? 777  PHE A CD1   1 
ATOM   6852  C  CD2   . PHE D 4  777  ? -0.600  17.052  78.055  1.00 80.78  ? 777  PHE A CD2   1 
ATOM   6853  C  CE1   . PHE D 4  777  ? -0.294  17.297  80.780  1.00 82.50  ? 777  PHE A CE1   1 
ATOM   6854  C  CE2   . PHE D 4  777  ? -1.591  16.602  78.916  1.00 81.58  ? 777  PHE A CE2   1 
ATOM   6855  C  CZ    . PHE D 4  777  ? -1.436  16.725  80.275  1.00 67.47  ? 777  PHE A CZ    1 
ATOM   6856  N  N     . GLY D 4  778  ? 1.658   18.653  73.932  1.00 80.28  ? 778  GLY A N     1 
ATOM   6857  C  CA    . GLY D 4  778  ? 2.195   19.564  72.932  1.00 75.90  ? 778  GLY A CA    1 
ATOM   6858  C  C     . GLY D 4  778  ? 1.879   21.013  73.234  1.00 70.72  ? 778  GLY A C     1 
ATOM   6859  O  O     . GLY D 4  778  ? 2.652   21.910  72.879  1.00 68.22  ? 778  GLY A O     1 
ATOM   6860  N  N     . PHE D 4  779  ? 0.737   21.264  73.870  1.00 63.73  ? 779  PHE A N     1 
ATOM   6861  C  CA    . PHE D 4  779  ? 0.439   22.563  74.446  1.00 85.32  ? 779  PHE A CA    1 
ATOM   6862  C  C     . PHE D 4  779  ? 0.941   22.611  75.888  1.00 101.11 ? 779  PHE A C     1 
ATOM   6863  O  O     . PHE D 4  779  ? 1.361   21.602  76.460  1.00 109.61 ? 779  PHE A O     1 
ATOM   6864  C  CB    . PHE D 4  779  ? -1.061  22.858  74.381  1.00 94.75  ? 779  PHE A CB    1 
ATOM   6865  C  CG    . PHE D 4  779  ? -1.547  23.250  73.010  1.00 103.43 ? 779  PHE A CG    1 
ATOM   6866  C  CD1   . PHE D 4  779  ? -2.892  23.444  72.758  1.00 86.68  ? 779  PHE A CD1   1 
ATOM   6867  C  CD2   . PHE D 4  779  ? -0.651  23.422  71.965  1.00 102.37 ? 779  PHE A CD2   1 
ATOM   6868  C  CE1   . PHE D 4  779  ? -3.316  23.817  71.498  1.00 75.96  ? 779  PHE A CE1   1 
ATOM   6869  C  CE2   . PHE D 4  779  ? -1.089  23.782  70.714  1.00 81.04  ? 779  PHE A CE2   1 
ATOM   6870  C  CZ    . PHE D 4  779  ? -2.415  23.973  70.479  1.00 78.53  ? 779  PHE A CZ    1 
ATOM   6871  N  N     . VAL D 4  780  ? 0.898   23.805  76.475  1.00 97.75  ? 780  VAL A N     1 
ATOM   6872  C  CA    . VAL D 4  780  ? 1.318   23.966  77.862  1.00 99.09  ? 780  VAL A CA    1 
ATOM   6873  C  C     . VAL D 4  780  ? 0.293   23.277  78.767  1.00 103.85 ? 780  VAL A C     1 
ATOM   6874  O  O     . VAL D 4  780  ? -0.859  23.706  78.875  1.00 110.60 ? 780  VAL A O     1 
ATOM   6875  C  CB    . VAL D 4  780  ? 1.535   25.444  78.225  1.00 104.16 ? 780  VAL A CB    1 
ATOM   6876  C  CG1   . VAL D 4  780  ? 0.236   26.254  78.192  1.00 109.43 ? 780  VAL A CG1   1 
ATOM   6877  C  CG2   . VAL D 4  780  ? 2.216   25.575  79.581  1.00 114.37 ? 780  VAL A CG2   1 
ATOM   6878  N  N     . ASP D 4  781  ? 0.711   22.152  79.362  1.00 94.18  ? 781  ASP A N     1 
ATOM   6879  C  CA    . ASP D 4  781  ? -0.054  21.353  80.324  1.00 89.51  ? 781  ASP A CA    1 
ATOM   6880  C  C     . ASP D 4  781  ? -1.358  20.794  79.752  1.00 83.89  ? 781  ASP A C     1 
ATOM   6881  O  O     . ASP D 4  781  ? -2.274  20.458  80.510  1.00 78.03  ? 781  ASP A O     1 
ATOM   6882  C  CB    . ASP D 4  781  ? -0.329  22.144  81.612  1.00 105.13 ? 781  ASP A CB    1 
ATOM   6883  C  CG    . ASP D 4  781  ? 0.951   22.599  82.298  1.00 119.02 ? 781  ASP A CG    1 
ATOM   6884  O  OD1   . ASP D 4  781  ? 2.047   22.309  81.772  1.00 119.97 ? 781  ASP A OD1   1 
ATOM   6885  O  OD2   . ASP D 4  781  ? 0.867   23.255  83.360  1.00 124.28 ? 781  ASP A OD2   1 
ATOM   6886  N  N     . ARG D 4  782  ? -1.452  20.660  78.431  1.00 89.99  ? 782  ARG A N     1 
ATOM   6887  C  CA    . ARG D 4  782  ? -2.610  20.042  77.797  1.00 86.30  ? 782  ARG A CA    1 
ATOM   6888  C  C     . ARG D 4  782  ? -2.197  19.580  76.404  1.00 86.88  ? 782  ARG A C     1 
ATOM   6889  O  O     . ARG D 4  782  ? -1.134  19.944  75.895  1.00 80.50  ? 782  ARG A O     1 
ATOM   6890  C  CB    . ARG D 4  782  ? -3.801  21.005  77.717  1.00 81.19  ? 782  ARG A CB    1 
ATOM   6891  C  CG    . ARG D 4  782  ? -3.433  22.412  77.273  1.00 74.38  ? 782  ARG A CG    1 
ATOM   6892  C  CD    . ARG D 4  782  ? -4.649  23.321  77.273  1.00 65.11  ? 782  ARG A CD    1 
ATOM   6893  N  NE    . ARG D 4  782  ? -4.339  24.633  76.716  1.00 76.48  ? 782  ARG A NE    1 
ATOM   6894  C  CZ    . ARG D 4  782  ? -5.251  25.565  76.452  1.00 80.46  ? 782  ARG A CZ    1 
ATOM   6895  N  NH1   . ARG D 4  782  ? -6.536  25.330  76.699  1.00 70.35  ? 782  ARG A NH1   1 
ATOM   6896  N  NH2   . ARG D 4  782  ? -4.883  26.727  75.924  1.00 85.66  ? 782  ARG A NH2   1 
ATOM   6897  N  N     . THR D 4  783  ? -3.061  18.769  75.792  1.00 87.04  ? 783  THR A N     1 
ATOM   6898  C  CA    . THR D 4  783  ? -2.836  18.209  74.462  1.00 86.37  ? 783  THR A CA    1 
ATOM   6899  C  C     . THR D 4  783  ? -3.553  18.978  73.360  1.00 90.45  ? 783  THR A C     1 
ATOM   6900  O  O     . THR D 4  783  ? -3.006  19.145  72.263  1.00 67.23  ? 783  THR A O     1 
ATOM   6901  C  CB    . THR D 4  783  ? -3.300  16.755  74.427  1.00 72.65  ? 783  THR A CB    1 
ATOM   6902  O  OG1   . THR D 4  783  ? -4.575  16.662  75.080  1.00 64.21  ? 783  THR A OG1   1 
ATOM   6903  C  CG2   . THR D 4  783  ? -2.304  15.858  75.143  1.00 74.69  ? 783  THR A CG2   1 
ATOM   6904  N  N     . LEU D 4  784  ? -4.768  19.437  73.641  1.00 105.21 ? 784  LEU A N     1 
ATOM   6905  C  CA    . LEU D 4  784  ? -5.642  20.190  72.758  1.00 100.94 ? 784  LEU A CA    1 
ATOM   6906  C  C     . LEU D 4  784  ? -6.188  21.396  73.510  1.00 87.22  ? 784  LEU A C     1 
ATOM   6907  O  O     . LEU D 4  784  ? -6.371  21.334  74.732  1.00 94.02  ? 784  LEU A O     1 
ATOM   6908  C  CB    . LEU D 4  784  ? -6.793  19.300  72.259  1.00 105.52 ? 784  LEU A CB    1 
ATOM   6909  C  CG    . LEU D 4  784  ? -6.501  18.323  71.113  1.00 102.69 ? 784  LEU A CG    1 
ATOM   6910  C  CD1   . LEU D 4  784  ? -7.781  18.018  70.355  1.00 122.00 ? 784  LEU A CD1   1 
ATOM   6911  C  CD2   . LEU D 4  784  ? -5.443  18.856  70.147  1.00 91.05  ? 784  LEU A CD2   1 
ATOM   6912  N  N     . PRO D 4  785  ? -6.462  22.505  72.818  1.00 54.58  ? 785  PRO A N     1 
ATOM   6913  C  CA    . PRO D 4  785  ? -6.934  23.711  73.505  1.00 57.57  ? 785  PRO A CA    1 
ATOM   6914  C  C     . PRO D 4  785  ? -8.404  23.681  73.894  1.00 70.75  ? 785  PRO A C     1 
ATOM   6915  O  O     . PRO D 4  785  ? -8.925  24.710  74.335  1.00 73.29  ? 785  PRO A O     1 
ATOM   6916  C  CB    . PRO D 4  785  ? -6.656  24.803  72.467  1.00 51.52  ? 785  PRO A CB    1 
ATOM   6917  C  CG    . PRO D 4  785  ? -6.925  24.130  71.193  1.00 67.96  ? 785  PRO A CG    1 
ATOM   6918  C  CD    . PRO D 4  785  ? -6.518  22.683  71.356  1.00 67.67  ? 785  PRO A CD    1 
ATOM   6919  N  N     . HIS D 4  786  ? -9.072  22.536  73.720  1.00 68.19  ? 786  HIS A N     1 
ATOM   6920  C  CA    . HIS D 4  786  ? -10.425 22.292  74.199  1.00 61.71  ? 786  HIS A CA    1 
ATOM   6921  C  C     . HIS D 4  786  ? -10.434 21.613  75.561  1.00 77.31  ? 786  HIS A C     1 
ATOM   6922  O  O     . HIS D 4  786  ? -11.513 21.396  76.126  1.00 82.53  ? 786  HIS A O     1 
ATOM   6923  C  CB    . HIS D 4  786  ? -11.204 21.431  73.197  1.00 55.77  ? 786  HIS A CB    1 
ATOM   6924  C  CG    . HIS D 4  786  ? -11.022 21.853  71.769  1.00 69.26  ? 786  HIS A CG    1 
ATOM   6925  N  ND1   . HIS D 4  786  ? -9.892  21.536  71.040  1.00 69.31  ? 786  HIS A ND1   1 
ATOM   6926  C  CD2   . HIS D 4  786  ? -11.798 22.609  70.954  1.00 74.24  ? 786  HIS A CD2   1 
ATOM   6927  C  CE1   . HIS D 4  786  ? -9.999  22.049  69.828  1.00 72.59  ? 786  HIS A CE1   1 
ATOM   6928  N  NE2   . HIS D 4  786  ? -11.142 22.709  69.752  1.00 71.71  ? 786  HIS A NE2   1 
ATOM   6929  N  N     . PHE D 4  787  ? -9.259  21.271  76.086  1.00 79.98  ? 787  PHE A N     1 
ATOM   6930  C  CA    . PHE D 4  787  ? -9.106  20.645  77.387  1.00 86.96  ? 787  PHE A CA    1 
ATOM   6931  C  C     . PHE D 4  787  ? -8.544  21.659  78.376  1.00 85.58  ? 787  PHE A C     1 
ATOM   6932  O  O     . PHE D 4  787  ? -7.752  22.539  78.014  1.00 65.04  ? 787  PHE A O     1 
ATOM   6933  C  CB    . PHE D 4  787  ? -8.176  19.424  77.300  1.00 88.93  ? 787  PHE A CB    1 
ATOM   6934  C  CG    . PHE D 4  787  ? -8.712  18.314  76.439  1.00 83.51  ? 787  PHE A CG    1 
ATOM   6935  C  CD1   . PHE D 4  787  ? -7.875  17.595  75.598  1.00 85.08  ? 787  PHE A CD1   1 
ATOM   6936  C  CD2   . PHE D 4  787  ? -10.060 17.996  76.460  1.00 88.47  ? 787  PHE A CD2   1 
ATOM   6937  C  CE1   . PHE D 4  787  ? -8.378  16.577  74.796  1.00 89.14  ? 787  PHE A CE1   1 
ATOM   6938  C  CE2   . PHE D 4  787  ? -10.565 16.980  75.662  1.00 88.67  ? 787  PHE A CE2   1 
ATOM   6939  C  CZ    . PHE D 4  787  ? -9.723  16.272  74.834  1.00 92.61  ? 787  PHE A CZ    1 
ATOM   6940  N  N     . SER D 4  788  ? -8.971  21.535  79.630  1.00 79.23  ? 788  SER A N     1 
ATOM   6941  C  CA    . SER D 4  788  ? -8.328  22.285  80.692  1.00 75.70  ? 788  SER A CA    1 
ATOM   6942  C  C     . SER D 4  788  ? -6.892  21.788  80.886  1.00 83.06  ? 788  SER A C     1 
ATOM   6943  O  O     . SER D 4  788  ? -6.527  20.673  80.495  1.00 80.15  ? 788  SER A O     1 
ATOM   6944  C  CB    . SER D 4  788  ? -9.130  22.172  81.994  1.00 91.28  ? 788  SER A CB    1 
ATOM   6945  O  OG    . SER D 4  788  ? -10.515 22.372  81.763  1.00 94.28  ? 788  SER A OG    1 
ATOM   6946  N  N     . LYS D 4  789  ? -6.069  22.650  81.478  1.00 90.87  ? 789  LYS A N     1 
ATOM   6947  C  CA    . LYS D 4  789  ? -4.677  22.311  81.732  1.00 79.79  ? 789  LYS A CA    1 
ATOM   6948  C  C     . LYS D 4  789  ? -4.562  21.228  82.798  1.00 89.41  ? 789  LYS A C     1 
ATOM   6949  O  O     . LYS D 4  789  ? -5.411  21.106  83.686  1.00 94.92  ? 789  LYS A O     1 
ATOM   6950  C  CB    . LYS D 4  789  ? -3.893  23.551  82.166  1.00 68.08  ? 789  LYS A CB    1 
ATOM   6951  C  CG    . LYS D 4  789  ? -3.562  24.498  81.023  1.00 59.62  ? 789  LYS A CG    1 
ATOM   6952  C  CD    . LYS D 4  789  ? -2.665  25.635  81.482  1.00 57.30  ? 789  LYS A CD    1 
ATOM   6953  C  CE    . LYS D 4  789  ? -2.181  26.464  80.307  1.00 70.77  ? 789  LYS A CE    1 
ATOM   6954  N  NZ    . LYS D 4  789  ? -1.420  27.662  80.758  1.00 91.65  ? 789  LYS A NZ    1 
ATOM   6955  N  N     . ASP D 4  790  ? -3.483  20.447  82.695  1.00 89.28  ? 790  ASP A N     1 
ATOM   6956  C  CA    . ASP D 4  790  ? -3.186  19.328  83.589  1.00 86.55  ? 790  ASP A CA    1 
ATOM   6957  C  C     . ASP D 4  790  ? -4.353  18.337  83.643  1.00 83.34  ? 790  ASP A C     1 
ATOM   6958  O  O     . ASP D 4  790  ? -4.907  18.045  84.704  1.00 84.25  ? 790  ASP A O     1 
ATOM   6959  C  CB    . ASP D 4  790  ? -2.811  19.819  84.997  1.00 82.63  ? 790  ASP A CB    1 
ATOM   6960  C  CG    . ASP D 4  790  ? -1.490  20.581  85.024  1.00 86.87  ? 790  ASP A CG    1 
ATOM   6961  O  OD1   . ASP D 4  790  ? -1.496  21.820  84.846  1.00 90.71  ? 790  ASP A OD1   1 
ATOM   6962  O  OD2   . ASP D 4  790  ? -0.435  19.930  85.187  1.00 90.83  ? 790  ASP A OD2   1 
ATOM   6963  N  N     . ASP D 4  791  ? -4.731  17.834  82.468  1.00 88.28  ? 791  ASP A N     1 
ATOM   6964  C  CA    . ASP D 4  791  ? -5.779  16.826  82.338  1.00 101.60 ? 791  ASP A CA    1 
ATOM   6965  C  C     . ASP D 4  791  ? -5.112  15.527  81.900  1.00 107.99 ? 791  ASP A C     1 
ATOM   6966  O  O     . ASP D 4  791  ? -4.651  15.417  80.759  1.00 105.88 ? 791  ASP A O     1 
ATOM   6967  C  CB    . ASP D 4  791  ? -6.849  17.254  81.334  1.00 103.62 ? 791  ASP A CB    1 
ATOM   6968  C  CG    . ASP D 4  791  ? -8.087  16.363  81.379  1.00 92.79  ? 791  ASP A CG    1 
ATOM   6969  O  OD1   . ASP D 4  791  ? -8.189  15.519  82.296  1.00 88.68  ? 791  ASP A OD1   1 
ATOM   6970  O  OD2   . ASP D 4  791  ? -8.950  16.481  80.483  1.00 82.63  ? 791  ASP A OD2   1 
ATOM   6971  N  N     . TYR D 4  792  ? -5.048  14.554  82.814  1.00 114.10 ? 792  TYR A N     1 
ATOM   6972  C  CA    . TYR D 4  792  ? -4.445  13.252  82.551  1.00 104.51 ? 792  TYR A CA    1 
ATOM   6973  C  C     . TYR D 4  792  ? -5.490  12.173  82.275  1.00 108.16 ? 792  TYR A C     1 
ATOM   6974  O  O     . TYR D 4  792  ? -5.187  10.980  82.382  1.00 104.58 ? 792  TYR A O     1 
ATOM   6975  C  CB    . TYR D 4  792  ? -3.536  12.853  83.722  1.00 90.33  ? 792  TYR A CB    1 
ATOM   6976  C  CG    . TYR D 4  792  ? -2.234  13.636  83.734  1.00 86.67  ? 792  TYR A CG    1 
ATOM   6977  C  CD1   . TYR D 4  792  ? -2.130  14.844  84.410  1.00 77.34  ? 792  TYR A CD1   1 
ATOM   6978  C  CD2   . TYR D 4  792  ? -1.116  13.178  83.044  1.00 95.87  ? 792  TYR A CD2   1 
ATOM   6979  C  CE1   . TYR D 4  792  ? -0.946  15.573  84.405  1.00 76.24  ? 792  TYR A CE1   1 
ATOM   6980  C  CE2   . TYR D 4  792  ? 0.074   13.901  83.037  1.00 90.72  ? 792  TYR A CE2   1 
ATOM   6981  C  CZ    . TYR D 4  792  ? 0.152   15.097  83.719  1.00 84.01  ? 792  TYR A CZ    1 
ATOM   6982  O  OH    . TYR D 4  792  ? 1.327   15.821  83.716  1.00 84.71  ? 792  TYR A OH    1 
ATOM   6983  N  N     . SER D 4  793  ? -6.703  12.576  81.887  1.00 111.54 ? 793  SER A N     1 
ATOM   6984  C  CA    . SER D 4  793  ? -7.809  11.664  81.624  1.00 100.22 ? 793  SER A CA    1 
ATOM   6985  C  C     . SER D 4  793  ? -7.519  10.840  80.366  1.00 100.05 ? 793  SER A C     1 
ATOM   6986  O  O     . SER D 4  793  ? -6.595  11.159  79.612  1.00 117.67 ? 793  SER A O     1 
ATOM   6987  C  CB    . SER D 4  793  ? -9.105  12.468  81.489  1.00 107.99 ? 793  SER A CB    1 
ATOM   6988  O  OG    . SER D 4  793  ? -8.971  13.526  80.555  1.00 108.24 ? 793  SER A OG    1 
ATOM   6989  N  N     . PRO D 4  794  ? -8.271  9.751   80.121  1.00 100.47 ? 794  PRO A N     1 
ATOM   6990  C  CA    . PRO D 4  794  ? -8.038  8.988   78.876  1.00 92.08  ? 794  PRO A CA    1 
ATOM   6991  C  C     . PRO D 4  794  ? -8.291  9.779   77.597  1.00 87.07  ? 794  PRO A C     1 
ATOM   6992  O  O     . PRO D 4  794  ? -7.503  9.670   76.647  1.00 78.62  ? 794  PRO A O     1 
ATOM   6993  C  CB    . PRO D 4  794  ? -9.001  7.798   79.013  1.00 96.68  ? 794  PRO A CB    1 
ATOM   6994  C  CG    . PRO D 4  794  ? -9.180  7.630   80.475  1.00 100.82 ? 794  PRO A CG    1 
ATOM   6995  C  CD    . PRO D 4  794  ? -9.169  9.013   81.039  1.00 104.51 ? 794  PRO A CD    1 
ATOM   6996  N  N     . GLU D 4  795  ? -9.357  10.589  77.558  1.00 94.67  ? 795  GLU A N     1 
ATOM   6997  C  CA    . GLU D 4  795  ? -9.664  11.398  76.377  1.00 75.67  ? 795  GLU A CA    1 
ATOM   6998  C  C     . GLU D 4  795  ? -8.617  12.479  76.133  1.00 66.34  ? 795  GLU A C     1 
ATOM   6999  O  O     . GLU D 4  795  ? -8.359  12.840  74.979  1.00 87.63  ? 795  GLU A O     1 
ATOM   7000  C  CB    . GLU D 4  795  ? -11.042 12.050  76.530  1.00 72.12  ? 795  GLU A CB    1 
ATOM   7001  C  CG    . GLU D 4  795  ? -12.114 11.154  77.140  1.00 109.28 ? 795  GLU A CG    1 
ATOM   7002  C  CD    . GLU D 4  795  ? -12.265 11.329  78.647  1.00 129.19 ? 795  GLU A CD    1 
ATOM   7003  O  OE1   . GLU D 4  795  ? -11.238 11.329  79.353  1.00 133.19 ? 795  GLU A OE1   1 
ATOM   7004  O  OE2   . GLU D 4  795  ? -13.410 11.465  79.128  1.00 137.22 ? 795  GLU A OE2   1 
ATOM   7005  N  N     . SER D 4  796  ? -8.013  13.007  77.201  1.00 58.03  ? 796  SER A N     1 
ATOM   7006  C  CA    . SER D 4  796  ? -7.050  14.095  77.057  1.00 59.48  ? 796  SER A CA    1 
ATOM   7007  C  C     . SER D 4  796  ? -5.727  13.591  76.488  1.00 54.90  ? 796  SER A C     1 
ATOM   7008  O  O     . SER D 4  796  ? -5.097  14.272  75.672  1.00 54.06  ? 796  SER A O     1 
ATOM   7009  C  CB    . SER D 4  796  ? -6.842  14.788  78.413  1.00 81.98  ? 796  SER A CB    1 
ATOM   7010  O  OG    . SER D 4  796  ? -5.722  15.662  78.424  1.00 97.39  ? 796  SER A OG    1 
ATOM   7011  N  N     . LYS D 4  797  ? -5.300  12.392  76.880  1.00 69.18  ? 797  LYS A N     1 
ATOM   7012  C  CA    . LYS D 4  797  ? -4.003  11.868  76.474  1.00 89.40  ? 797  LYS A CA    1 
ATOM   7013  C  C     . LYS D 4  797  ? -4.103  10.856  75.334  1.00 88.06  ? 797  LYS A C     1 
ATOM   7014  O  O     . LYS D 4  797  ? -3.128  10.145  75.065  1.00 86.14  ? 797  LYS A O     1 
ATOM   7015  C  CB    . LYS D 4  797  ? -3.285  11.253  77.678  1.00 117.17 ? 797  LYS A CB    1 
ATOM   7016  C  CG    . LYS D 4  797  ? -2.850  12.269  78.742  1.00 107.90 ? 797  LYS A CG    1 
ATOM   7017  C  CD    . LYS D 4  797  ? -1.446  12.784  78.461  1.00 90.57  ? 797  LYS A CD    1 
ATOM   7018  C  CE    . LYS D 4  797  ? -0.374  11.817  78.924  1.00 85.32  ? 797  LYS A CE    1 
ATOM   7019  N  NZ    . LYS D 4  797  ? 0.980   12.420  78.781  1.00 85.83  ? 797  LYS A NZ    1 
ATOM   7020  N  N     . GLY D 4  798  ? -5.257  10.761  74.679  1.00 86.66  ? 798  GLY A N     1 
ATOM   7021  C  CA    . GLY D 4  798  ? -5.376  10.068  73.415  1.00 78.01  ? 798  GLY A CA    1 
ATOM   7022  C  C     . GLY D 4  798  ? -5.991  8.682   73.408  1.00 79.01  ? 798  GLY A C     1 
ATOM   7023  O  O     . GLY D 4  798  ? -5.654  7.886   72.519  1.00 62.48  ? 798  GLY A O     1 
ATOM   7024  N  N     . PHE D 4  799  ? -6.874  8.359   74.355  1.00 92.15  ? 799  PHE A N     1 
ATOM   7025  C  CA    . PHE D 4  799  ? -7.646  7.125   74.262  1.00 86.34  ? 799  PHE A CA    1 
ATOM   7026  C  C     . PHE D 4  799  ? -8.850  7.352   73.357  1.00 89.54  ? 799  PHE A C     1 
ATOM   7027  O  O     . PHE D 4  799  ? -9.576  8.342   73.511  1.00 95.22  ? 799  PHE A O     1 
ATOM   7028  C  CB    . PHE D 4  799  ? -8.112  6.638   75.638  1.00 83.73  ? 799  PHE A CB    1 
ATOM   7029  C  CG    . PHE D 4  799  ? -8.834  5.307   75.601  1.00 72.31  ? 799  PHE A CG    1 
ATOM   7030  C  CD1   . PHE D 4  799  ? -8.181  4.159   75.173  1.00 61.04  ? 799  PHE A CD1   1 
ATOM   7031  C  CD2   . PHE D 4  799  ? -10.169 5.205   75.982  1.00 77.03  ? 799  PHE A CD2   1 
ATOM   7032  C  CE1   . PHE D 4  799  ? -8.845  2.941   75.128  1.00 58.01  ? 799  PHE A CE1   1 
ATOM   7033  C  CE2   . PHE D 4  799  ? -10.837 3.981   75.938  1.00 56.81  ? 799  PHE A CE2   1 
ATOM   7034  C  CZ    . PHE D 4  799  ? -10.171 2.854   75.511  1.00 56.69  ? 799  PHE A CZ    1 
ATOM   7035  N  N     . VAL D 4  800  ? -9.062  6.433   72.412  1.00 90.09  ? 800  VAL A N     1 
ATOM   7036  C  CA    . VAL D 4  800  ? -10.130 6.571   71.426  1.00 74.80  ? 800  VAL A CA    1 
ATOM   7037  C  C     . VAL D 4  800  ? -11.204 5.525   71.679  1.00 64.61  ? 800  VAL A C     1 
ATOM   7038  O  O     . VAL D 4  800  ? -11.121 4.396   71.178  1.00 58.87  ? 800  VAL A O     1 
ATOM   7039  C  CB    . VAL D 4  800  ? -9.592  6.448   69.992  1.00 52.36  ? 800  VAL A CB    1 
ATOM   7040  C  CG1   . VAL D 4  800  ? -10.652 6.883   69.013  1.00 51.99  ? 800  VAL A CG1   1 
ATOM   7041  C  CG2   . VAL D 4  800  ? -8.332  7.266   69.830  1.00 57.23  ? 800  VAL A CG2   1 
ATOM   7042  N  N     . GLU D 4  801  ? -12.235 5.918   72.433  1.00 71.72  ? 801  GLU A N     1 
ATOM   7043  C  CA    . GLU D 4  801  ? -13.242 4.973   72.903  1.00 76.88  ? 801  GLU A CA    1 
ATOM   7044  C  C     . GLU D 4  801  ? -14.107 4.450   71.762  1.00 79.59  ? 801  GLU A C     1 
ATOM   7045  O  O     . GLU D 4  801  ? -14.391 3.246   71.691  1.00 72.89  ? 801  GLU A O     1 
ATOM   7046  C  CB    . GLU D 4  801  ? -14.112 5.639   73.971  1.00 69.87  ? 801  GLU A CB    1 
ATOM   7047  C  CG    . GLU D 4  801  ? -15.408 4.904   74.269  1.00 79.58  ? 801  GLU A CG    1 
ATOM   7048  C  CD    . GLU D 4  801  ? -16.174 5.542   75.405  1.00 107.33 ? 801  GLU A CD    1 
ATOM   7049  O  OE1   . GLU D 4  801  ? -17.136 4.918   75.901  1.00 119.45 ? 801  GLU A OE1   1 
ATOM   7050  O  OE2   . GLU D 4  801  ? -15.819 6.679   75.791  1.00 113.13 ? 801  GLU A OE2   1 
ATOM   7051  N  N     . ASN D 4  802  ? -14.544 5.334   70.869  1.00 96.96  ? 802  ASN A N     1 
ATOM   7052  C  CA    . ASN D 4  802  ? -15.423 4.916   69.785  1.00 87.99  ? 802  ASN A CA    1 
ATOM   7053  C  C     . ASN D 4  802  ? -14.673 4.035   68.787  1.00 84.37  ? 802  ASN A C     1 
ATOM   7054  O  O     . ASN D 4  802  ? -13.441 4.012   68.730  1.00 68.96  ? 802  ASN A O     1 
ATOM   7055  C  CB    . ASN D 4  802  ? -16.032 6.130   69.076  1.00 66.87  ? 802  ASN A CB    1 
ATOM   7056  C  CG    . ASN D 4  802  ? -17.060 6.860   69.932  1.00 67.46  ? 802  ASN A CG    1 
ATOM   7057  O  OD1   . ASN D 4  802  ? -18.166 6.356   70.152  1.00 68.20  ? 802  ASN A OD1   1 
ATOM   7058  N  ND2   . ASN D 4  802  ? -16.712 8.055   70.399  1.00 67.98  ? 802  ASN A ND2   1 
ATOM   7059  N  N     . SER D 4  803  ? -15.447 3.289   68.010  1.00 85.94  ? 803  SER A N     1 
ATOM   7060  C  CA    . SER D 4  803  ? -14.930 2.374   67.008  1.00 72.47  ? 803  SER A CA    1 
ATOM   7061  C  C     . SER D 4  803  ? -14.985 3.012   65.620  1.00 75.83  ? 803  SER A C     1 
ATOM   7062  O  O     . SER D 4  803  ? -15.528 4.103   65.425  1.00 79.47  ? 803  SER A O     1 
ATOM   7063  C  CB    . SER D 4  803  ? -15.727 1.066   67.042  1.00 58.74  ? 803  SER A CB    1 
ATOM   7064  O  OG    . SER D 4  803  ? -17.118 1.333   67.143  1.00 53.89  ? 803  SER A OG    1 
ATOM   7065  N  N     . TYR D 4  804  ? -14.400 2.310   64.645  1.00 73.18  ? 804  TYR A N     1 
ATOM   7066  C  CA    . TYR D 4  804  ? -14.460 2.776   63.262  1.00 72.05  ? 804  TYR A CA    1 
ATOM   7067  C  C     . TYR D 4  804  ? -15.881 2.715   62.715  1.00 80.55  ? 804  TYR A C     1 
ATOM   7068  O  O     . TYR D 4  804  ? -16.224 3.465   61.795  1.00 76.25  ? 804  TYR A O     1 
ATOM   7069  C  CB    . TYR D 4  804  ? -13.519 1.945   62.389  1.00 64.25  ? 804  TYR A CB    1 
ATOM   7070  C  CG    . TYR D 4  804  ? -12.052 2.218   62.617  1.00 64.66  ? 804  TYR A CG    1 
ATOM   7071  C  CD1   . TYR D 4  804  ? -11.086 1.362   62.117  1.00 89.07  ? 804  TYR A CD1   1 
ATOM   7072  C  CD2   . TYR D 4  804  ? -11.630 3.336   63.315  1.00 73.65  ? 804  TYR A CD2   1 
ATOM   7073  C  CE1   . TYR D 4  804  ? -9.739  1.601   62.318  1.00 88.76  ? 804  TYR A CE1   1 
ATOM   7074  C  CE2   . TYR D 4  804  ? -10.283 3.584   63.518  1.00 82.22  ? 804  TYR A CE2   1 
ATOM   7075  C  CZ    . TYR D 4  804  ? -9.343  2.709   63.014  1.00 83.29  ? 804  TYR A CZ    1 
ATOM   7076  O  OH    . TYR D 4  804  ? -7.999  2.927   63.198  1.00 87.58  ? 804  TYR A OH    1 
ATOM   7077  N  N     . LEU D 4  805  ? -16.710 1.827   63.266  1.00 91.38  ? 805  LEU A N     1 
ATOM   7078  C  CA    . LEU D 4  805  ? -18.120 1.779   62.894  1.00 91.08  ? 805  LEU A CA    1 
ATOM   7079  C  C     . LEU D 4  805  ? -18.877 2.963   63.489  1.00 87.65  ? 805  LEU A C     1 
ATOM   7080  O  O     . LEU D 4  805  ? -19.667 3.617   62.798  1.00 83.16  ? 805  LEU A O     1 
ATOM   7081  C  CB    . LEU D 4  805  ? -18.729 0.446   63.351  1.00 95.37  ? 805  LEU A CB    1 
ATOM   7082  C  CG    . LEU D 4  805  ? -20.185 0.019   63.075  1.00 76.68  ? 805  LEU A CG    1 
ATOM   7083  C  CD1   . LEU D 4  805  ? -21.178 0.446   64.172  1.00 64.28  ? 805  LEU A CD1   1 
ATOM   7084  C  CD2   . LEU D 4  805  ? -20.650 0.481   61.696  1.00 88.01  ? 805  LEU A CD2   1 
ATOM   7085  N  N     . ARG D 4  806  ? -18.639 3.260   64.769  1.00 78.40  ? 806  ARG A N     1 
ATOM   7086  C  CA    . ARG D 4  806  ? -19.422 4.294   65.439  1.00 80.45  ? 806  ARG A CA    1 
ATOM   7087  C  C     . ARG D 4  806  ? -19.017 5.693   64.986  1.00 71.35  ? 806  ARG A C     1 
ATOM   7088  O  O     . ARG D 4  806  ? -19.876 6.571   64.838  1.00 74.32  ? 806  ARG A O     1 
ATOM   7089  C  CB    . ARG D 4  806  ? -19.291 4.149   66.955  1.00 98.67  ? 806  ARG A CB    1 
ATOM   7090  C  CG    . ARG D 4  806  ? -19.981 2.906   67.501  1.00 106.03 ? 806  ARG A CG    1 
ATOM   7091  C  CD    . ARG D 4  806  ? -19.677 2.675   68.975  1.00 99.75  ? 806  ARG A CD    1 
ATOM   7092  N  NE    . ARG D 4  806  ? -20.658 3.314   69.848  1.00 93.11  ? 806  ARG A NE    1 
ATOM   7093  C  CZ    . ARG D 4  806  ? -21.849 2.798   70.141  1.00 98.53  ? 806  ARG A CZ    1 
ATOM   7094  N  NH1   . ARG D 4  806  ? -22.675 3.449   70.948  1.00 97.82  ? 806  ARG A NH1   1 
ATOM   7095  N  NH2   . ARG D 4  806  ? -22.223 1.636   69.623  1.00 110.53 ? 806  ARG A NH2   1 
ATOM   7096  N  N     . GLY D 4  807  ? -17.733 5.920   64.759  1.00 69.79  ? 807  GLY A N     1 
ATOM   7097  C  CA    . GLY D 4  807  ? -17.247 7.231   64.350  1.00 71.19  ? 807  GLY A CA    1 
ATOM   7098  C  C     . GLY D 4  807  ? -16.452 7.924   65.446  1.00 77.85  ? 807  GLY A C     1 
ATOM   7099  O  O     . GLY D 4  807  ? -16.863 7.967   66.613  1.00 79.67  ? 807  GLY A O     1 
ATOM   7100  N  N     . LEU D 4  808  ? -15.310 8.490   65.059  1.00 82.85  ? 808  LEU A N     1 
ATOM   7101  C  CA    . LEU D 4  808  ? -14.400 9.154   65.984  1.00 81.74  ? 808  LEU A CA    1 
ATOM   7102  C  C     . LEU D 4  808  ? -14.786 10.616  66.181  1.00 86.73  ? 808  LEU A C     1 
ATOM   7103  O  O     . LEU D 4  808  ? -15.230 11.290  65.247  1.00 89.40  ? 808  LEU A O     1 
ATOM   7104  C  CB    . LEU D 4  808  ? -12.958 9.059   65.470  1.00 65.81  ? 808  LEU A CB    1 
ATOM   7105  C  CG    . LEU D 4  808  ? -12.167 7.750   65.647  1.00 49.96  ? 808  LEU A CG    1 
ATOM   7106  C  CD1   . LEU D 4  808  ? -12.608 6.657   64.701  1.00 49.80  ? 808  LEU A CD1   1 
ATOM   7107  C  CD2   . LEU D 4  808  ? -10.664 7.991   65.480  1.00 49.53  ? 808  LEU A CD2   1 
ATOM   7108  N  N     . THR D 4  809  ? -14.613 11.106  67.410  1.00 93.03  ? 809  THR A N     1 
ATOM   7109  C  CA    . THR D 4  809  ? -14.791 12.521  67.688  1.00 94.79  ? 809  THR A CA    1 
ATOM   7110  C  C     . THR D 4  809  ? -13.637 13.303  67.042  1.00 93.26  ? 809  THR A C     1 
ATOM   7111  O  O     . THR D 4  809  ? -12.638 12.707  66.627  1.00 89.92  ? 809  THR A O     1 
ATOM   7112  C  CB    . THR D 4  809  ? -14.860 12.747  69.205  1.00 97.63  ? 809  THR A CB    1 
ATOM   7113  O  OG1   . THR D 4  809  ? -13.541 12.725  69.758  1.00 97.81  ? 809  THR A OG1   1 
ATOM   7114  C  CG2   . THR D 4  809  ? -15.711 11.666  69.879  1.00 110.88 ? 809  THR A CG2   1 
ATOM   7115  N  N     . PRO D 4  810  ? -13.780 14.633  66.883  1.00 69.80  ? 810  PRO A N     1 
ATOM   7116  C  CA    . PRO D 4  810  ? -12.669 15.428  66.305  1.00 62.03  ? 810  PRO A CA    1 
ATOM   7117  C  C     . PRO D 4  810  ? -11.336 15.299  67.030  1.00 64.42  ? 810  PRO A C     1 
ATOM   7118  O  O     . PRO D 4  810  ? -10.285 15.173  66.379  1.00 50.74  ? 810  PRO A O     1 
ATOM   7119  C  CB    . PRO D 4  810  ? -13.207 16.865  66.384  1.00 49.15  ? 810  PRO A CB    1 
ATOM   7120  C  CG    . PRO D 4  810  ? -14.680 16.697  66.280  1.00 49.39  ? 810  PRO A CG    1 
ATOM   7121  C  CD    . PRO D 4  810  ? -15.029 15.425  66.965  1.00 59.42  ? 810  PRO A CD    1 
ATOM   7122  N  N     . GLN D 4  811  ? -11.355 15.340  68.365  1.00 78.23  ? 811  GLN A N     1 
ATOM   7123  C  CA    . GLN D 4  811  ? -10.139 15.119  69.141  1.00 70.63  ? 811  GLN A CA    1 
ATOM   7124  C  C     . GLN D 4  811  ? -9.591  13.717  68.902  1.00 82.28  ? 811  GLN A C     1 
ATOM   7125  O  O     . GLN D 4  811  ? -8.384  13.542  68.685  1.00 82.16  ? 811  GLN A O     1 
ATOM   7126  C  CB    . GLN D 4  811  ? -10.432 15.342  70.630  1.00 55.04  ? 811  GLN A CB    1 
ATOM   7127  C  CG    . GLN D 4  811  ? -11.161 16.655  70.952  1.00 51.29  ? 811  GLN A CG    1 
ATOM   7128  C  CD    . GLN D 4  811  ? -12.637 16.449  71.233  1.00 62.06  ? 811  GLN A CD    1 
ATOM   7129  O  OE1   . GLN D 4  811  ? -13.193 15.392  70.936  1.00 89.67  ? 811  GLN A OE1   1 
ATOM   7130  N  NE2   . GLN D 4  811  ? -13.280 17.460  71.807  1.00 53.01  ? 811  GLN A NE2   1 
ATOM   7131  N  N     . GLU D 4  812  ? -10.479 12.713  68.929  1.00 86.21  ? 812  GLU A N     1 
ATOM   7132  C  CA    . GLU D 4  812  ? -10.097 11.329  68.662  1.00 67.29  ? 812  GLU A CA    1 
ATOM   7133  C  C     . GLU D 4  812  ? -9.509  11.176  67.267  1.00 57.87  ? 812  GLU A C     1 
ATOM   7134  O  O     . GLU D 4  812  ? -8.519  10.453  67.078  1.00 49.60  ? 812  GLU A O     1 
ATOM   7135  C  CB    . GLU D 4  812  ? -11.314 10.416  68.820  1.00 64.23  ? 812  GLU A CB    1 
ATOM   7136  C  CG    . GLU D 4  812  ? -11.708 10.117  70.262  1.00 83.50  ? 812  GLU A CG    1 
ATOM   7137  C  CD    . GLU D 4  812  ? -12.987 9.296   70.363  1.00 87.66  ? 812  GLU A CD    1 
ATOM   7138  O  OE1   . GLU D 4  812  ? -13.395 8.690   69.348  1.00 90.26  ? 812  GLU A OE1   1 
ATOM   7139  O  OE2   . GLU D 4  812  ? -13.583 9.253   71.460  1.00 81.38  ? 812  GLU A OE2   1 
ATOM   7140  N  N     . PHE D 4  813  ? -10.104 11.862  66.282  1.00 52.99  ? 813  PHE A N     1 
ATOM   7141  C  CA    . PHE D 4  813  ? -9.579  11.836  64.921  1.00 56.36  ? 813  PHE A CA    1 
ATOM   7142  C  C     . PHE D 4  813  ? -8.184  12.447  64.854  1.00 59.09  ? 813  PHE A C     1 
ATOM   7143  O  O     . PHE D 4  813  ? -7.294  11.910  64.179  1.00 47.84  ? 813  PHE A O     1 
ATOM   7144  C  CB    . PHE D 4  813  ? -10.529 12.567  63.967  1.00 66.18  ? 813  PHE A CB    1 
ATOM   7145  C  CG    . PHE D 4  813  ? -10.057 12.575  62.531  1.00 84.27  ? 813  PHE A CG    1 
ATOM   7146  C  CD1   . PHE D 4  813  ? -10.216 11.451  61.734  1.00 100.86 ? 813  PHE A CD1   1 
ATOM   7147  C  CD2   . PHE D 4  813  ? -9.448  13.695  61.983  1.00 76.50  ? 813  PHE A CD2   1 
ATOM   7148  C  CE1   . PHE D 4  813  ? -9.775  11.445  60.420  1.00 94.93  ? 813  PHE A CE1   1 
ATOM   7149  C  CE2   . PHE D 4  813  ? -9.006  13.688  60.666  1.00 71.09  ? 813  PHE A CE2   1 
ATOM   7150  C  CZ    . PHE D 4  813  ? -9.173  12.563  59.889  1.00 76.40  ? 813  PHE A CZ    1 
ATOM   7151  N  N     . PHE D 4  814  ? -7.968  13.564  65.562  1.00 69.97  ? 814  PHE A N     1 
ATOM   7152  C  CA    . PHE D 4  814  ? -6.660  14.213  65.503  1.00 66.77  ? 814  PHE A CA    1 
ATOM   7153  C  C     . PHE D 4  814  ? -5.589  13.385  66.200  1.00 72.16  ? 814  PHE A C     1 
ATOM   7154  O  O     . PHE D 4  814  ? -4.455  13.295  65.713  1.00 72.73  ? 814  PHE A O     1 
ATOM   7155  C  CB    . PHE D 4  814  ? -6.713  15.623  66.093  1.00 53.60  ? 814  PHE A CB    1 
ATOM   7156  C  CG    . PHE D 4  814  ? -5.456  16.414  65.839  1.00 55.99  ? 814  PHE A CG    1 
ATOM   7157  C  CD1   . PHE D 4  814  ? -5.072  16.717  64.545  1.00 54.76  ? 814  PHE A CD1   1 
ATOM   7158  C  CD2   . PHE D 4  814  ? -4.650  16.834  66.879  1.00 71.26  ? 814  PHE A CD2   1 
ATOM   7159  C  CE1   . PHE D 4  814  ? -3.916  17.426  64.296  1.00 47.39  ? 814  PHE A CE1   1 
ATOM   7160  C  CE2   . PHE D 4  814  ? -3.485  17.551  66.627  1.00 72.65  ? 814  PHE A CE2   1 
ATOM   7161  C  CZ    . PHE D 4  814  ? -3.122  17.838  65.334  1.00 65.33  ? 814  PHE A CZ    1 
ATOM   7162  N  N     . PHE D 4  815  ? -5.929  12.767  67.332  1.00 74.32  ? 815  PHE A N     1 
ATOM   7163  C  CA    . PHE D 4  815  ? -4.973  11.896  68.012  1.00 75.80  ? 815  PHE A CA    1 
ATOM   7164  C  C     . PHE D 4  815  ? -4.658  10.661  67.170  1.00 75.01  ? 815  PHE A C     1 
ATOM   7165  O  O     . PHE D 4  815  ? -3.500  10.216  67.112  1.00 63.23  ? 815  PHE A O     1 
ATOM   7166  C  CB    . PHE D 4  815  ? -5.515  11.489  69.387  1.00 79.88  ? 815  PHE A CB    1 
ATOM   7167  C  CG    . PHE D 4  815  ? -5.756  12.648  70.324  1.00 70.26  ? 815  PHE A CG    1 
ATOM   7168  C  CD1   . PHE D 4  815  ? -6.805  12.618  71.238  1.00 70.77  ? 815  PHE A CD1   1 
ATOM   7169  C  CD2   . PHE D 4  815  ? -4.932  13.765  70.295  1.00 51.01  ? 815  PHE A CD2   1 
ATOM   7170  C  CE1   . PHE D 4  815  ? -7.029  13.690  72.101  1.00 62.70  ? 815  PHE A CE1   1 
ATOM   7171  C  CE2   . PHE D 4  815  ? -5.155  14.832  71.157  1.00 51.03  ? 815  PHE A CE2   1 
ATOM   7172  C  CZ    . PHE D 4  815  ? -6.202  14.792  72.058  1.00 51.60  ? 815  PHE A CZ    1 
ATOM   7173  N  N     . HIS D 4  816  ? -5.676  10.104  66.499  1.00 77.89  ? 816  HIS A N     1 
ATOM   7174  C  CA    . HIS D 4  816  ? -5.450  8.965   65.618  1.00 76.69  ? 816  HIS A CA    1 
ATOM   7175  C  C     . HIS D 4  816  ? -4.534  9.351   64.458  1.00 76.44  ? 816  HIS A C     1 
ATOM   7176  O  O     . HIS D 4  816  ? -3.628  8.590   64.098  1.00 85.24  ? 816  HIS A O     1 
ATOM   7177  C  CB    . HIS D 4  816  ? -6.793  8.426   65.116  1.00 76.27  ? 816  HIS A CB    1 
ATOM   7178  C  CG    . HIS D 4  816  ? -6.717  7.061   64.496  1.00 89.24  ? 816  HIS A CG    1 
ATOM   7179  N  ND1   . HIS D 4  816  ? -5.535  6.357   64.379  1.00 95.46  ? 816  HIS A ND1   1 
ATOM   7180  C  CD2   . HIS D 4  816  ? -7.675  6.283   63.935  1.00 94.17  ? 816  HIS A CD2   1 
ATOM   7181  C  CE1   . HIS D 4  816  ? -5.771  5.201   63.785  1.00 100.27 ? 816  HIS A CE1   1 
ATOM   7182  N  NE2   . HIS D 4  816  ? -7.060  5.133   63.503  1.00 96.65  ? 816  HIS A NE2   1 
ATOM   7183  N  N     . ALA D 4  817  ? -4.728  10.550  63.890  1.00 55.79  ? 817  ALA A N     1 
ATOM   7184  C  CA    . ALA D 4  817  ? -3.833  11.026  62.837  1.00 68.65  ? 817  ALA A CA    1 
ATOM   7185  C  C     . ALA D 4  817  ? -2.424  11.262  63.361  1.00 76.05  ? 817  ALA A C     1 
ATOM   7186  O  O     . ALA D 4  817  ? -1.441  11.035  62.641  1.00 76.67  ? 817  ALA A O     1 
ATOM   7187  C  CB    . ALA D 4  817  ? -4.383  12.310  62.217  1.00 88.18  ? 817  ALA A CB    1 
ATOM   7188  N  N     . MET D 4  818  ? -2.315  11.703  64.611  1.00 86.85  ? 818  MET A N     1 
ATOM   7189  C  CA    . MET D 4  818  ? -1.014  11.926  65.221  1.00 91.67  ? 818  MET A CA    1 
ATOM   7190  C  C     . MET D 4  818  ? -0.262  10.611  65.390  1.00 79.04  ? 818  MET A C     1 
ATOM   7191  O  O     . MET D 4  818  ? 0.961   10.556  65.202  1.00 75.38  ? 818  MET A O     1 
ATOM   7192  C  CB    . MET D 4  818  ? -1.215  12.631  66.557  1.00 93.53  ? 818  MET A CB    1 
ATOM   7193  C  CG    . MET D 4  818  ? -0.014  13.347  67.079  1.00 82.53  ? 818  MET A CG    1 
ATOM   7194  S  SD    . MET D 4  818  ? -0.384  14.173  68.636  1.00 76.08  ? 818  MET A SD    1 
ATOM   7195  C  CE    . MET D 4  818  ? -2.025  14.812  68.327  1.00 49.49  ? 818  MET A CE    1 
ATOM   7196  N  N     . GLY D 4  819  ? -0.982  9.539   65.727  1.00 78.10  ? 819  GLY A N     1 
ATOM   7197  C  CA    . GLY D 4  819  ? -0.352  8.227   65.779  1.00 98.17  ? 819  GLY A CA    1 
ATOM   7198  C  C     . GLY D 4  819  ? -0.010  7.682   64.403  1.00 103.88 ? 819  GLY A C     1 
ATOM   7199  O  O     . GLY D 4  819  ? 1.067   7.104   64.199  1.00 110.52 ? 819  GLY A O     1 
ATOM   7200  N  N     . GLY D 4  820  ? -0.918  7.860   63.438  1.00 100.84 ? 820  GLY A N     1 
ATOM   7201  C  CA    . GLY D 4  820  ? -0.698  7.328   62.104  1.00 91.35  ? 820  GLY A CA    1 
ATOM   7202  C  C     . GLY D 4  820  ? 0.449   7.993   61.370  1.00 87.88  ? 820  GLY A C     1 
ATOM   7203  O  O     . GLY D 4  820  ? 1.116   7.352   60.547  1.00 85.19  ? 820  GLY A O     1 
ATOM   7204  N  N     . ARG D 4  821  ? 0.700   9.276   61.657  1.00 95.68  ? 821  ARG A N     1 
ATOM   7205  C  CA    . ARG D 4  821  ? 1.865   9.941   61.081  1.00 102.59 ? 821  ARG A CA    1 
ATOM   7206  C  C     . ARG D 4  821  ? 3.159   9.276   61.536  1.00 103.94 ? 821  ARG A C     1 
ATOM   7207  O  O     . ARG D 4  821  ? 4.048   9.013   60.716  1.00 94.35  ? 821  ARG A O     1 
ATOM   7208  C  CB    . ARG D 4  821  ? 1.877   11.421  61.455  1.00 101.46 ? 821  ARG A CB    1 
ATOM   7209  C  CG    . ARG D 4  821  ? 3.142   12.142  61.002  1.00 92.66  ? 821  ARG A CG    1 
ATOM   7210  C  CD    . ARG D 4  821  ? 2.959   12.754  59.625  1.00 73.03  ? 821  ARG A CD    1 
ATOM   7211  N  NE    . ARG D 4  821  ? 2.701   14.186  59.743  1.00 89.25  ? 821  ARG A NE    1 
ATOM   7212  C  CZ    . ARG D 4  821  ? 1.686   14.815  59.161  1.00 95.86  ? 821  ARG A CZ    1 
ATOM   7213  N  NH1   . ARG D 4  821  ? 0.815   14.136  58.428  1.00 117.40 ? 821  ARG A NH1   1 
ATOM   7214  N  NH2   . ARG D 4  821  ? 1.531   16.123  59.332  1.00 80.03  ? 821  ARG A NH2   1 
ATOM   7215  N  N     . GLU D 4  822  ? 3.275   8.995   62.841  1.00 111.25 ? 822  GLU A N     1 
ATOM   7216  C  CA    . GLU D 4  822  ? 4.427   8.258   63.357  1.00 111.87 ? 822  GLU A CA    1 
ATOM   7217  C  C     . GLU D 4  822  ? 4.514   6.865   62.744  1.00 105.31 ? 822  GLU A C     1 
ATOM   7218  O  O     . GLU D 4  822  ? 5.615   6.360   62.491  1.00 94.67  ? 822  GLU A O     1 
ATOM   7219  C  CB    . GLU D 4  822  ? 4.360   8.165   64.883  1.00 105.95 ? 822  GLU A CB    1 
ATOM   7220  C  CG    . GLU D 4  822  ? 5.530   7.410   65.506  1.00 94.75  ? 822  GLU A CG    1 
ATOM   7221  C  CD    . GLU D 4  822  ? 5.398   7.253   67.003  1.00 97.68  ? 822  GLU A CD    1 
ATOM   7222  O  OE1   . GLU D 4  822  ? 5.679   8.232   67.723  1.00 108.51 ? 822  GLU A OE1   1 
ATOM   7223  O  OE2   . GLU D 4  822  ? 5.007   6.159   67.461  1.00 97.30  ? 822  GLU A OE2   1 
ATOM   7224  N  N     . GLY D 4  823  ? 3.362   6.237   62.486  1.00 105.07 ? 823  GLY A N     1 
ATOM   7225  C  CA    . GLY D 4  823  ? 3.370   4.946   61.803  1.00 100.00 ? 823  GLY A CA    1 
ATOM   7226  C  C     . GLY D 4  823  ? 3.972   5.006   60.407  1.00 95.25  ? 823  GLY A C     1 
ATOM   7227  O  O     . GLY D 4  823  ? 4.790   4.160   60.035  1.00 98.89  ? 823  GLY A O     1 
ATOM   7228  N  N     . LEU D 4  824  ? 3.595   6.025   59.627  1.00 95.13  ? 824  LEU A N     1 
ATOM   7229  C  CA    . LEU D 4  824  ? 4.136   6.179   58.272  1.00 83.75  ? 824  LEU A CA    1 
ATOM   7230  C  C     . LEU D 4  824  ? 5.609   6.591   58.289  1.00 89.27  ? 824  LEU A C     1 
ATOM   7231  O  O     . LEU D 4  824  ? 6.391   6.184   57.409  1.00 77.17  ? 824  LEU A O     1 
ATOM   7232  C  CB    . LEU D 4  824  ? 3.307   7.199   57.495  1.00 60.22  ? 824  LEU A CB    1 
ATOM   7233  C  CG    . LEU D 4  824  ? 1.813   6.872   57.425  1.00 67.68  ? 824  LEU A CG    1 
ATOM   7234  C  CD1   . LEU D 4  824  ? 1.069   7.957   56.701  1.00 46.62  ? 824  LEU A CD1   1 
ATOM   7235  C  CD2   . LEU D 4  824  ? 1.556   5.515   56.770  1.00 96.19  ? 824  LEU A CD2   1 
ATOM   7236  N  N     . ILE D 4  825  ? 6.003   7.403   59.278  1.00 95.07  ? 825  ILE A N     1 
ATOM   7237  C  CA    . ILE D 4  825  ? 7.411   7.761   59.445  1.00 87.77  ? 825  ILE A CA    1 
ATOM   7238  C  C     . ILE D 4  825  ? 8.236   6.523   59.776  1.00 93.28  ? 825  ILE A C     1 
ATOM   7239  O  O     . ILE D 4  825  ? 9.320   6.315   59.215  1.00 100.05 ? 825  ILE A O     1 
ATOM   7240  C  CB    . ILE D 4  825  ? 7.567   8.854   60.523  1.00 86.04  ? 825  ILE A CB    1 
ATOM   7241  C  CG1   . ILE D 4  825  ? 6.947   10.171  60.055  1.00 96.95  ? 825  ILE A CG1   1 
ATOM   7242  C  CG2   . ILE D 4  825  ? 9.032   9.086   60.879  1.00 89.16  ? 825  ILE A CG2   1 
ATOM   7243  C  CD1   . ILE D 4  825  ? 7.439   10.630  58.717  1.00 121.01 ? 825  ILE A CD1   1 
ATOM   7244  N  N     . ASP D 4  826  ? 7.729   5.678   60.682  1.00 87.94  ? 826  ASP A N     1 
ATOM   7245  C  CA    . ASP D 4  826  ? 8.420   4.443   61.037  1.00 101.13 ? 826  ASP A CA    1 
ATOM   7246  C  C     . ASP D 4  826  ? 8.492   3.481   59.857  1.00 106.96 ? 826  ASP A C     1 
ATOM   7247  O  O     . ASP D 4  826  ? 9.502   2.792   59.698  1.00 109.73 ? 826  ASP A O     1 
ATOM   7248  C  CB    . ASP D 4  826  ? 7.725   3.773   62.231  1.00 120.39 ? 826  ASP A CB    1 
ATOM   7249  C  CG    . ASP D 4  826  ? 8.695   3.397   63.353  1.00 124.67 ? 826  ASP A CG    1 
ATOM   7250  O  OD1   . ASP D 4  826  ? 9.898   3.208   63.070  1.00 128.50 ? 826  ASP A OD1   1 
ATOM   7251  O  OD2   . ASP D 4  826  ? 8.250   3.267   64.516  1.00 121.28 ? 826  ASP A OD2   1 
ATOM   7252  N  N     . THR D 4  827  ? 7.452   3.439   59.012  1.00 112.29 ? 827  THR A N     1 
ATOM   7253  C  CA    . THR D 4  827  ? 7.491   2.604   57.807  1.00 109.61 ? 827  THR A CA    1 
ATOM   7254  C  C     . THR D 4  827  ? 8.591   3.060   56.849  1.00 115.11 ? 827  THR A C     1 
ATOM   7255  O  O     . THR D 4  827  ? 9.400   2.245   56.374  1.00 126.16 ? 827  THR A O     1 
ATOM   7256  C  CB    . THR D 4  827  ? 6.132   2.623   57.094  1.00 91.56  ? 827  THR A CB    1 
ATOM   7257  O  OG1   . THR D 4  827  ? 5.080   2.316   58.020  1.00 104.99 ? 827  THR A OG1   1 
ATOM   7258  C  CG2   . THR D 4  827  ? 6.108   1.612   55.955  1.00 74.33  ? 827  THR A CG2   1 
ATOM   7259  N  N     . ALA D 4  828  ? 8.634   4.368   56.558  1.00 105.24 ? 828  ALA A N     1 
ATOM   7260  C  CA    . ALA D 4  828  ? 9.652   4.904   55.655  1.00 91.27  ? 828  ALA A CA    1 
ATOM   7261  C  C     . ALA D 4  828  ? 11.065  4.735   56.220  1.00 104.41 ? 828  ALA A C     1 
ATOM   7262  O  O     . ALA D 4  828  ? 12.002  4.393   55.483  1.00 109.42 ? 828  ALA A O     1 
ATOM   7263  C  CB    . ALA D 4  828  ? 9.361   6.374   55.368  1.00 75.43  ? 828  ALA A CB    1 
ATOM   7264  N  N     . VAL D 4  829  ? 11.231  4.958   57.531  1.00 111.92 ? 829  VAL A N     1 
ATOM   7265  C  CA    . VAL D 4  829  ? 12.533  4.815   58.183  1.00 117.95 ? 829  VAL A CA    1 
ATOM   7266  C  C     . VAL D 4  829  ? 12.977  3.353   58.199  1.00 140.75 ? 829  VAL A C     1 
ATOM   7267  O  O     . VAL D 4  829  ? 14.152  3.046   57.948  1.00 149.28 ? 829  VAL A O     1 
ATOM   7268  C  CB    . VAL D 4  829  ? 12.470  5.424   59.600  1.00 110.71 ? 829  VAL A CB    1 
ATOM   7269  C  CG1   . VAL D 4  829  ? 13.601  4.915   60.497  1.00 118.68 ? 829  VAL A CG1   1 
ATOM   7270  C  CG2   . VAL D 4  829  ? 12.502  6.950   59.529  1.00 115.22 ? 829  VAL A CG2   1 
ATOM   7271  N  N     . LYS D 4  830  ? 12.046  2.430   58.479  1.00 155.03 ? 830  LYS A N     1 
ATOM   7272  C  CA    . LYS D 4  830  ? 12.344  1.000   58.454  1.00 156.22 ? 830  LYS A CA    1 
ATOM   7273  C  C     . LYS D 4  830  ? 12.819  0.559   57.076  1.00 159.93 ? 830  LYS A C     1 
ATOM   7274  O  O     . LYS D 4  830  ? 13.827  -0.146  56.958  1.00 169.00 ? 830  LYS A O     1 
ATOM   7275  C  CB    . LYS D 4  830  ? 11.107  0.202   58.878  1.00 150.62 ? 830  LYS A CB    1 
ATOM   7276  C  CG    . LYS D 4  830  ? 11.182  -0.447  60.259  1.00 143.75 ? 830  LYS A CG    1 
ATOM   7277  C  CD    . LYS D 4  830  ? 11.262  0.586   61.372  1.00 135.67 ? 830  LYS A CD    1 
ATOM   7278  C  CE    . LYS D 4  830  ? 11.016  -0.038  62.739  1.00 125.15 ? 830  LYS A CE    1 
ATOM   7279  N  NZ    . LYS D 4  830  ? 11.185  0.956   63.838  1.00 124.40 ? 830  LYS A NZ    1 
ATOM   7280  N  N     . THR D 4  831  ? 12.118  0.990   56.018  1.00 147.84 ? 831  THR A N     1 
ATOM   7281  C  CA    . THR D 4  831  ? 12.521  0.624   54.659  1.00 127.85 ? 831  THR A CA    1 
ATOM   7282  C  C     . THR D 4  831  ? 13.901  1.190   54.314  1.00 117.28 ? 831  THR A C     1 
ATOM   7283  O  O     . THR D 4  831  ? 14.782  0.464   53.820  1.00 109.18 ? 831  THR A O     1 
ATOM   7284  C  CB    . THR D 4  831  ? 11.474  1.108   53.649  1.00 114.78 ? 831  THR A CB    1 
ATOM   7285  O  OG1   . THR D 4  831  ? 11.186  2.492   53.882  1.00 127.22 ? 831  THR A OG1   1 
ATOM   7286  C  CG2   . THR D 4  831  ? 10.179  0.308   53.770  1.00 98.95  ? 831  THR A CG2   1 
ATOM   7287  N  N     . ALA D 4  832  ? 14.116  2.481   54.606  1.00 127.90 ? 832  ALA A N     1 
ATOM   7288  C  CA    . ALA D 4  832  ? 15.365  3.143   54.235  1.00 139.53 ? 832  ALA A CA    1 
ATOM   7289  C  C     . ALA D 4  832  ? 16.563  2.574   54.990  1.00 124.50 ? 832  ALA A C     1 
ATOM   7290  O  O     . ALA D 4  832  ? 17.666  2.494   54.437  1.00 125.13 ? 832  ALA A O     1 
ATOM   7291  C  CB    . ALA D 4  832  ? 15.250  4.647   54.481  1.00 164.32 ? 832  ALA A CB    1 
ATOM   7292  N  N     . GLU D 4  833  ? 16.373  2.181   56.254  1.00 115.96 ? 833  GLU A N     1 
ATOM   7293  C  CA    . GLU D 4  833  ? 17.475  1.593   57.008  1.00 115.56 ? 833  GLU A CA    1 
ATOM   7294  C  C     . GLU D 4  833  ? 17.699  0.130   56.635  1.00 107.43 ? 833  GLU A C     1 
ATOM   7295  O  O     . GLU D 4  833  ? 18.850  -0.326  56.566  1.00 104.81 ? 833  GLU A O     1 
ATOM   7296  C  CB    . GLU D 4  833  ? 17.224  1.730   58.515  1.00 123.29 ? 833  GLU A CB    1 
ATOM   7297  C  CG    . GLU D 4  833  ? 17.977  2.891   59.170  1.00 125.00 ? 833  GLU A CG    1 
ATOM   7298  C  CD    . GLU D 4  833  ? 17.823  2.932   60.683  1.00 119.16 ? 833  GLU A CD    1 
ATOM   7299  O  OE1   . GLU D 4  833  ? 16.778  2.481   61.200  1.00 118.24 ? 833  GLU A OE1   1 
ATOM   7300  O  OE2   . GLU D 4  833  ? 18.756  3.417   61.357  1.00 118.61 ? 833  GLU A OE2   1 
ATOM   7301  N  N     . THR D 4  834  ? 16.618  -0.622  56.377  1.00 99.52  ? 834  THR A N     1 
ATOM   7302  C  CA    . THR D 4  834  ? 16.763  -2.053  56.136  1.00 85.98  ? 834  THR A CA    1 
ATOM   7303  C  C     . THR D 4  834  ? 17.344  -2.334  54.758  1.00 81.91  ? 834  THR A C     1 
ATOM   7304  O  O     . THR D 4  834  ? 18.004  -3.364  54.575  1.00 88.77  ? 834  THR A O     1 
ATOM   7305  C  CB    . THR D 4  834  ? 15.421  -2.776  56.295  1.00 82.69  ? 834  THR A CB    1 
ATOM   7306  O  OG1   . THR D 4  834  ? 14.670  -2.192  57.365  1.00 84.87  ? 834  THR A OG1   1 
ATOM   7307  C  CG2   . THR D 4  834  ? 15.667  -4.225  56.643  1.00 89.62  ? 834  THR A CG2   1 
ATOM   7308  N  N     . GLY D 4  835  ? 17.128  -1.440  53.785  1.00 83.48  ? 835  GLY A N     1 
ATOM   7309  C  CA    . GLY D 4  835  ? 17.821  -1.590  52.512  1.00 94.07  ? 835  GLY A CA    1 
ATOM   7310  C  C     . GLY D 4  835  ? 19.332  -1.550  52.668  1.00 74.62  ? 835  GLY A C     1 
ATOM   7311  O  O     . GLY D 4  835  ? 20.049  -2.406  52.133  1.00 73.26  ? 835  GLY A O     1 
ATOM   7312  N  N     . TYR D 4  836  ? 19.827  -0.589  53.453  1.00 60.20  ? 836  TYR A N     1 
ATOM   7313  C  CA    . TYR D 4  836  ? 21.255  -0.495  53.739  1.00 83.23  ? 836  TYR A CA    1 
ATOM   7314  C  C     . TYR D 4  836  ? 21.744  -1.684  54.561  1.00 100.33 ? 836  TYR A C     1 
ATOM   7315  O  O     . TYR D 4  836  ? 22.856  -2.179  54.339  1.00 112.56 ? 836  TYR A O     1 
ATOM   7316  C  CB    . TYR D 4  836  ? 21.548  0.817   54.472  1.00 92.82  ? 836  TYR A CB    1 
ATOM   7317  C  CG    . TYR D 4  836  ? 23.020  1.157   54.576  1.00 90.69  ? 836  TYR A CG    1 
ATOM   7318  C  CD1   . TYR D 4  836  ? 23.918  0.733   53.607  1.00 97.55  ? 836  TYR A CD1   1 
ATOM   7319  C  CD2   . TYR D 4  836  ? 23.508  1.904   55.638  1.00 84.12  ? 836  TYR A CD2   1 
ATOM   7320  C  CE1   . TYR D 4  836  ? 25.258  1.039   53.694  1.00 94.71  ? 836  TYR A CE1   1 
ATOM   7321  C  CE2   . TYR D 4  836  ? 24.853  2.215   55.732  1.00 97.35  ? 836  TYR A CE2   1 
ATOM   7322  C  CZ    . TYR D 4  836  ? 25.721  1.779   54.759  1.00 105.31 ? 836  TYR A CZ    1 
ATOM   7323  O  OH    . TYR D 4  836  ? 27.056  2.090   54.856  1.00 128.71 ? 836  TYR A OH    1 
ATOM   7324  N  N     . ILE D 4  837  ? 20.932  -2.141  55.522  1.00 93.18  ? 837  ILE A N     1 
ATOM   7325  C  CA    . ILE D 4  837  ? 21.302  -3.290  56.354  1.00 82.92  ? 837  ILE A CA    1 
ATOM   7326  C  C     . ILE D 4  837  ? 21.478  -4.542  55.494  1.00 89.51  ? 837  ILE A C     1 
ATOM   7327  O  O     . ILE D 4  837  ? 22.467  -5.283  55.630  1.00 80.91  ? 837  ILE A O     1 
ATOM   7328  C  CB    . ILE D 4  837  ? 20.251  -3.505  57.463  1.00 79.04  ? 837  ILE A CB    1 
ATOM   7329  C  CG1   . ILE D 4  837  ? 20.430  -2.494  58.603  1.00 76.32  ? 837  ILE A CG1   1 
ATOM   7330  C  CG2   . ILE D 4  837  ? 20.279  -4.936  58.001  1.00 79.36  ? 837  ILE A CG2   1 
ATOM   7331  C  CD1   . ILE D 4  837  ? 19.389  -2.623  59.714  1.00 61.91  ? 837  ILE A CD1   1 
ATOM   7332  N  N     . GLN D 4  838  ? 20.522  -4.788  54.588  1.00 95.94  ? 838  GLN A N     1 
ATOM   7333  C  CA    . GLN D 4  838  ? 20.616  -5.929  53.681  1.00 80.72  ? 838  GLN A CA    1 
ATOM   7334  C  C     . GLN D 4  838  ? 21.815  -5.796  52.754  1.00 71.88  ? 838  GLN A C     1 
ATOM   7335  O  O     . GLN D 4  838  ? 22.516  -6.781  52.497  1.00 73.68  ? 838  GLN A O     1 
ATOM   7336  C  CB    . GLN D 4  838  ? 19.322  -6.079  52.871  1.00 81.37  ? 838  GLN A CB    1 
ATOM   7337  C  CG    . GLN D 4  838  ? 19.199  -7.397  52.080  1.00 81.64  ? 838  GLN A CG    1 
ATOM   7338  C  CD    . GLN D 4  838  ? 19.699  -7.287  50.641  1.00 91.97  ? 838  GLN A CD    1 
ATOM   7339  O  OE1   . GLN D 4  838  ? 20.138  -6.224  50.200  1.00 107.81 ? 838  GLN A OE1   1 
ATOM   7340  N  NE2   . GLN D 4  838  ? 19.649  -8.400  49.909  1.00 76.74  ? 838  GLN A NE2   1 
ATOM   7341  N  N     . ARG D 4  839  ? 22.068  -4.583  52.243  1.00 76.05  ? 839  ARG A N     1 
ATOM   7342  C  CA    . ARG D 4  839  ? 23.200  -4.383  51.342  1.00 76.46  ? 839  ARG A CA    1 
ATOM   7343  C  C     . ARG D 4  839  ? 24.532  -4.663  52.035  1.00 66.04  ? 839  ARG A C     1 
ATOM   7344  O  O     . ARG D 4  839  ? 25.418  -5.303  51.452  1.00 51.57  ? 839  ARG A O     1 
ATOM   7345  C  CB    . ARG D 4  839  ? 23.177  -2.964  50.780  1.00 81.44  ? 839  ARG A CB    1 
ATOM   7346  C  CG    . ARG D 4  839  ? 23.805  -2.882  49.410  1.00 83.49  ? 839  ARG A CG    1 
ATOM   7347  C  CD    . ARG D 4  839  ? 24.202  -1.471  49.028  1.00 77.93  ? 839  ARG A CD    1 
ATOM   7348  N  NE    . ARG D 4  839  ? 25.643  -1.265  49.150  1.00 64.22  ? 839  ARG A NE    1 
ATOM   7349  C  CZ    . ARG D 4  839  ? 26.537  -1.657  48.243  1.00 57.12  ? 839  ARG A CZ    1 
ATOM   7350  N  NH1   . ARG D 4  839  ? 26.155  -2.306  47.147  1.00 59.18  ? 839  ARG A NH1   1 
ATOM   7351  N  NH2   . ARG D 4  839  ? 27.823  -1.411  48.433  1.00 51.90  ? 839  ARG A NH2   1 
ATOM   7352  N  N     . ARG D 4  840  ? 24.683  -4.201  53.284  1.00 67.56  ? 840  ARG A N     1 
ATOM   7353  C  CA    . ARG D 4  840  ? 25.910  -4.455  54.040  1.00 68.05  ? 840  ARG A CA    1 
ATOM   7354  C  C     . ARG D 4  840  ? 26.068  -5.936  54.376  1.00 82.94  ? 840  ARG A C     1 
ATOM   7355  O  O     . ARG D 4  840  ? 27.180  -6.480  54.291  1.00 81.42  ? 840  ARG A O     1 
ATOM   7356  C  CB    . ARG D 4  840  ? 25.925  -3.620  55.320  1.00 59.29  ? 840  ARG A CB    1 
ATOM   7357  C  CG    . ARG D 4  840  ? 25.966  -2.123  55.106  1.00 79.26  ? 840  ARG A CG    1 
ATOM   7358  C  CD    . ARG D 4  840  ? 26.519  -1.399  56.324  1.00 103.58 ? 840  ARG A CD    1 
ATOM   7359  N  NE    . ARG D 4  840  ? 25.998  -1.960  57.568  1.00 104.46 ? 840  ARG A NE    1 
ATOM   7360  C  CZ    . ARG D 4  840  ? 24.845  -1.602  58.127  1.00 91.64  ? 840  ARG A CZ    1 
ATOM   7361  N  NH1   . ARG D 4  840  ? 24.074  -0.682  57.559  1.00 80.94  ? 840  ARG A NH1   1 
ATOM   7362  N  NH2   . ARG D 4  840  ? 24.459  -2.168  59.263  1.00 96.15  ? 840  ARG A NH2   1 
ATOM   7363  N  N     . LEU D 4  841  ? 24.970  -6.597  54.769  1.00 73.07  ? 841  LEU A N     1 
ATOM   7364  C  CA    . LEU D 4  841  ? 24.989  -8.041  54.998  1.00 52.75  ? 841  LEU A CA    1 
ATOM   7365  C  C     . LEU D 4  841  ? 25.463  -8.800  53.761  1.00 64.27  ? 841  LEU A C     1 
ATOM   7366  O  O     . LEU D 4  841  ? 26.363  -9.654  53.841  1.00 81.79  ? 841  LEU A O     1 
ATOM   7367  C  CB    . LEU D 4  841  ? 23.595  -8.522  55.404  1.00 52.36  ? 841  LEU A CB    1 
ATOM   7368  C  CG    . LEU D 4  841  ? 23.155  -8.442  56.863  1.00 53.39  ? 841  LEU A CG    1 
ATOM   7369  C  CD1   . LEU D 4  841  ? 21.742  -8.999  57.043  1.00 52.29  ? 841  LEU A CD1   1 
ATOM   7370  C  CD2   . LEU D 4  841  ? 24.138  -9.225  57.703  1.00 71.41  ? 841  LEU A CD2   1 
ATOM   7371  N  N     . VAL D 4  842  ? 24.862  -8.498  52.603  1.00 60.01  ? 842  VAL A N     1 
ATOM   7372  C  CA    . VAL D 4  842  ? 25.192  -9.236  51.390  1.00 57.35  ? 842  VAL A CA    1 
ATOM   7373  C  C     . VAL D 4  842  ? 26.626  -8.949  50.962  1.00 60.73  ? 842  VAL A C     1 
ATOM   7374  O  O     . VAL D 4  842  ? 27.387  -9.870  50.640  1.00 60.59  ? 842  VAL A O     1 
ATOM   7375  C  CB    . VAL D 4  842  ? 24.191  -8.922  50.266  1.00 51.16  ? 842  VAL A CB    1 
ATOM   7376  C  CG1   . VAL D 4  842  ? 24.628  -9.622  49.011  1.00 56.75  ? 842  VAL A CG1   1 
ATOM   7377  C  CG2   . VAL D 4  842  ? 22.792  -9.380  50.645  1.00 57.27  ? 842  VAL A CG2   1 
ATOM   7378  N  N     . LYS D 4  843  ? 27.042  -7.682  51.000  1.00 79.84  ? 843  LYS A N     1 
ATOM   7379  C  CA    . LYS D 4  843  ? 28.402  -7.371  50.583  1.00 87.22  ? 843  LYS A CA    1 
ATOM   7380  C  C     . LYS D 4  843  ? 29.443  -7.890  51.570  1.00 83.64  ? 843  LYS A C     1 
ATOM   7381  O  O     . LYS D 4  843  ? 30.611  -8.040  51.192  1.00 59.23  ? 843  LYS A O     1 
ATOM   7382  C  CB    . LYS D 4  843  ? 28.552  -5.864  50.369  1.00 82.13  ? 843  LYS A CB    1 
ATOM   7383  C  CG    . LYS D 4  843  ? 28.502  -5.481  48.898  1.00 82.48  ? 843  LYS A CG    1 
ATOM   7384  C  CD    . LYS D 4  843  ? 29.619  -6.190  48.138  1.00 101.29 ? 843  LYS A CD    1 
ATOM   7385  C  CE    . LYS D 4  843  ? 29.683  -5.782  46.676  1.00 108.01 ? 843  LYS A CE    1 
ATOM   7386  N  NZ    . LYS D 4  843  ? 30.727  -6.563  45.946  1.00 120.25 ? 843  LYS A NZ    1 
ATOM   7387  N  N     . ALA D 4  844  ? 29.041  -8.202  52.807  1.00 105.42 ? 844  ALA A N     1 
ATOM   7388  C  CA    . ALA D 4  844  ? 29.955  -8.842  53.747  1.00 101.18 ? 844  ALA A CA    1 
ATOM   7389  C  C     . ALA D 4  844  ? 30.068  -10.345 53.510  1.00 92.98  ? 844  ALA A C     1 
ATOM   7390  O  O     . ALA D 4  844  ? 31.163  -10.908 53.627  1.00 96.76  ? 844  ALA A O     1 
ATOM   7391  C  CB    . ALA D 4  844  ? 29.503  -8.571  55.179  1.00 103.93 ? 844  ALA A CB    1 
ATOM   7392  N  N     . LEU D 4  845  ? 28.960  -11.020 53.190  1.00 90.93  ? 845  LEU A N     1 
ATOM   7393  C  CA    . LEU D 4  845  ? 28.987  -12.471 53.032  1.00 73.91  ? 845  LEU A CA    1 
ATOM   7394  C  C     . LEU D 4  845  ? 28.930  -12.918 51.569  1.00 90.90  ? 845  LEU A C     1 
ATOM   7395  O  O     . LEU D 4  845  ? 28.572  -14.068 51.296  1.00 103.21 ? 845  LEU A O     1 
ATOM   7396  C  CB    . LEU D 4  845  ? 27.842  -13.117 53.814  1.00 66.63  ? 845  LEU A CB    1 
ATOM   7397  C  CG    . LEU D 4  845  ? 27.426  -12.516 55.159  1.00 69.05  ? 845  LEU A CG    1 
ATOM   7398  C  CD1   . LEU D 4  845  ? 26.212  -13.250 55.717  1.00 82.00  ? 845  LEU A CD1   1 
ATOM   7399  C  CD2   . LEU D 4  845  ? 28.559  -12.545 56.158  1.00 72.96  ? 845  LEU A CD2   1 
ATOM   7400  N  N     . GLU D 4  846  ? 29.297  -12.051 50.621  1.00 108.24 ? 846  GLU A N     1 
ATOM   7401  C  CA    . GLU D 4  846  ? 29.062  -12.358 49.211  1.00 101.75 ? 846  GLU A CA    1 
ATOM   7402  C  C     . GLU D 4  846  ? 29.965  -13.464 48.676  1.00 89.44  ? 846  GLU A C     1 
ATOM   7403  O  O     . GLU D 4  846  ? 29.647  -14.055 47.639  1.00 89.13  ? 846  GLU A O     1 
ATOM   7404  C  CB    . GLU D 4  846  ? 29.233  -11.103 48.350  1.00 97.77  ? 846  GLU A CB    1 
ATOM   7405  C  CG    . GLU D 4  846  ? 30.664  -10.651 48.191  1.00 99.94  ? 846  GLU A CG    1 
ATOM   7406  C  CD    . GLU D 4  846  ? 30.817  -9.637  47.088  1.00 96.82  ? 846  GLU A CD    1 
ATOM   7407  O  OE1   . GLU D 4  846  ? 29.786  -9.135  46.595  1.00 107.70 ? 846  GLU A OE1   1 
ATOM   7408  O  OE2   . GLU D 4  846  ? 31.966  -9.364  46.685  1.00 98.70  ? 846  GLU A OE2   1 
ATOM   7409  N  N     . ASP D 4  847  ? 31.066  -13.769 49.354  1.00 76.42  ? 847  ASP A N     1 
ATOM   7410  C  CA    . ASP D 4  847  ? 32.050  -14.704 48.834  1.00 95.23  ? 847  ASP A CA    1 
ATOM   7411  C  C     . ASP D 4  847  ? 31.985  -16.060 49.521  1.00 108.23 ? 847  ASP A C     1 
ATOM   7412  O  O     . ASP D 4  847  ? 32.891  -16.881 49.349  1.00 104.19 ? 847  ASP A O     1 
ATOM   7413  C  CB    . ASP D 4  847  ? 33.443  -14.106 48.983  1.00 108.35 ? 847  ASP A CB    1 
ATOM   7414  C  CG    . ASP D 4  847  ? 34.291  -14.306 47.757  1.00 122.61 ? 847  ASP A CG    1 
ATOM   7415  O  OD1   . ASP D 4  847  ? 34.132  -15.333 47.065  1.00 120.98 ? 847  ASP A OD1   1 
ATOM   7416  O  OD2   . ASP D 4  847  ? 35.104  -13.409 47.475  1.00 139.40 ? 847  ASP A OD2   1 
ATOM   7417  N  N     . ILE D 4  848  ? 30.946  -16.308 50.305  1.00 113.42 ? 848  ILE A N     1 
ATOM   7418  C  CA    . ILE D 4  848  ? 30.888  -17.486 51.156  1.00 106.29 ? 848  ILE A CA    1 
ATOM   7419  C  C     . ILE D 4  848  ? 30.135  -18.582 50.408  1.00 104.53 ? 848  ILE A C     1 
ATOM   7420  O  O     . ILE D 4  848  ? 28.929  -18.466 50.166  1.00 108.58 ? 848  ILE A O     1 
ATOM   7421  C  CB    . ILE D 4  848  ? 30.225  -17.166 52.499  1.00 107.18 ? 848  ILE A CB    1 
ATOM   7422  C  CG1   . ILE D 4  848  ? 31.014  -16.084 53.242  1.00 105.25 ? 848  ILE A CG1   1 
ATOM   7423  C  CG2   . ILE D 4  848  ? 30.146  -18.387 53.336  1.00 89.13  ? 848  ILE A CG2   1 
ATOM   7424  C  CD1   . ILE D 4  848  ? 32.442  -16.467 53.525  1.00 104.97 ? 848  ILE A CD1   1 
ATOM   7425  N  N     . MET D 4  849  ? 30.848  -19.644 50.032  1.00 98.52  ? 849  MET A N     1 
ATOM   7426  C  CA    . MET D 4  849  ? 30.225  -20.813 49.429  1.00 87.79  ? 849  MET A CA    1 
ATOM   7427  C  C     . MET D 4  849  ? 30.871  -22.079 49.974  1.00 84.47  ? 849  MET A C     1 
ATOM   7428  O  O     . MET D 4  849  ? 31.994  -22.068 50.486  1.00 93.02  ? 849  MET A O     1 
ATOM   7429  C  CB    . MET D 4  849  ? 30.318  -20.812 47.892  1.00 83.10  ? 849  MET A CB    1 
ATOM   7430  C  CG    . MET D 4  849  ? 31.630  -21.341 47.315  1.00 86.16  ? 849  MET A CG    1 
ATOM   7431  S  SD    . MET D 4  849  ? 31.564  -21.573 45.518  1.00 85.38  ? 849  MET A SD    1 
ATOM   7432  C  CE    . MET D 4  849  ? 33.263  -22.026 45.149  1.00 83.62  ? 849  MET A CE    1 
ATOM   7433  N  N     . VAL D 4  850  ? 30.133  -23.177 49.856  1.00 79.22  ? 850  VAL A N     1 
ATOM   7434  C  CA    . VAL D 4  850  ? 30.631  -24.494 50.233  1.00 70.32  ? 850  VAL A CA    1 
ATOM   7435  C  C     . VAL D 4  850  ? 31.547  -24.994 49.120  1.00 77.73  ? 850  VAL A C     1 
ATOM   7436  O  O     . VAL D 4  850  ? 31.124  -25.119 47.966  1.00 105.51 ? 850  VAL A O     1 
ATOM   7437  C  CB    . VAL D 4  850  ? 29.467  -25.464 50.484  1.00 66.24  ? 850  VAL A CB    1 
ATOM   7438  C  CG1   . VAL D 4  850  ? 29.975  -26.874 50.739  1.00 80.26  ? 850  VAL A CG1   1 
ATOM   7439  C  CG2   . VAL D 4  850  ? 28.596  -24.969 51.649  1.00 71.10  ? 850  VAL A CG2   1 
ATOM   7440  N  N     . HIS D 4  851  ? 32.814  -25.253 49.458  1.00 67.55  ? 851  HIS A N     1 
ATOM   7441  C  CA    . HIS D 4  851  ? 33.755  -25.831 48.509  1.00 68.21  ? 851  HIS A CA    1 
ATOM   7442  C  C     . HIS D 4  851  ? 33.558  -27.345 48.454  1.00 68.43  ? 851  HIS A C     1 
ATOM   7443  O  O     . HIS D 4  851  ? 32.689  -27.910 49.128  1.00 68.06  ? 851  HIS A O     1 
ATOM   7444  C  CB    . HIS D 4  851  ? 35.191  -25.472 48.887  1.00 68.80  ? 851  HIS A CB    1 
ATOM   7445  C  CG    . HIS D 4  851  ? 35.598  -24.090 48.471  1.00 80.06  ? 851  HIS A CG    1 
ATOM   7446  N  ND1   . HIS D 4  851  ? 35.027  -22.950 49.002  1.00 81.98  ? 851  HIS A ND1   1 
ATOM   7447  C  CD2   . HIS D 4  851  ? 36.495  -23.668 47.547  1.00 83.70  ? 851  HIS A CD2   1 
ATOM   7448  C  CE1   . HIS D 4  851  ? 35.573  -21.887 48.440  1.00 82.33  ? 851  HIS A CE1   1 
ATOM   7449  N  NE2   . HIS D 4  851  ? 36.464  -22.295 47.553  1.00 87.43  ? 851  HIS A NE2   1 
ATOM   7450  N  N     . TYR D 4  852  ? 34.385  -28.030 47.655  1.00 71.58  ? 852  TYR A N     1 
ATOM   7451  C  CA    . TYR D 4  852  ? 34.247  -29.481 47.504  1.00 86.74  ? 852  TYR A CA    1 
ATOM   7452  C  C     . TYR D 4  852  ? 34.929  -30.267 48.624  1.00 94.13  ? 852  TYR A C     1 
ATOM   7453  O  O     . TYR D 4  852  ? 35.616  -31.258 48.365  1.00 90.56  ? 852  TYR A O     1 
ATOM   7454  C  CB    . TYR D 4  852  ? 34.809  -29.889 46.143  1.00 94.90  ? 852  TYR A CB    1 
ATOM   7455  C  CG    . TYR D 4  852  ? 33.874  -29.648 44.980  1.00 96.02  ? 852  TYR A CG    1 
ATOM   7456  C  CD1   . TYR D 4  852  ? 33.879  -28.443 44.290  1.00 104.49 ? 852  TYR A CD1   1 
ATOM   7457  C  CD2   . TYR D 4  852  ? 33.001  -30.637 44.555  1.00 99.07  ? 852  TYR A CD2   1 
ATOM   7458  C  CE1   . TYR D 4  852  ? 33.018  -28.225 43.217  1.00 110.27 ? 852  TYR A CE1   1 
ATOM   7459  C  CE2   . TYR D 4  852  ? 32.137  -30.426 43.493  1.00 108.16 ? 852  TYR A CE2   1 
ATOM   7460  C  CZ    . TYR D 4  852  ? 32.153  -29.226 42.826  1.00 110.20 ? 852  TYR A CZ    1 
ATOM   7461  O  OH    . TYR D 4  852  ? 31.291  -29.037 41.771  1.00 108.45 ? 852  TYR A OH    1 
ATOM   7462  N  N     . ASP D 4  853  ? 34.754  -29.832 49.882  1.00 99.09  ? 853  ASP A N     1 
ATOM   7463  C  CA    . ASP D 4  853  ? 35.060  -30.656 51.047  1.00 96.62  ? 853  ASP A CA    1 
ATOM   7464  C  C     . ASP D 4  853  ? 34.107  -30.355 52.202  1.00 94.66  ? 853  ASP A C     1 
ATOM   7465  O  O     . ASP D 4  853  ? 34.418  -30.711 53.346  1.00 106.19 ? 853  ASP A O     1 
ATOM   7466  C  CB    . ASP D 4  853  ? 36.526  -30.471 51.502  1.00 104.80 ? 853  ASP A CB    1 
ATOM   7467  C  CG    . ASP D 4  853  ? 36.942  -29.017 51.560  1.00 100.61 ? 853  ASP A CG    1 
ATOM   7468  O  OD1   . ASP D 4  853  ? 36.075  -28.145 51.365  1.00 102.82 ? 853  ASP A OD1   1 
ATOM   7469  O  OD2   . ASP D 4  853  ? 38.130  -28.732 51.824  1.00 99.23  ? 853  ASP A OD2   1 
ATOM   7470  N  N     . ASN D 4  854  ? 32.986  -29.674 51.932  1.00 77.41  ? 854  ASN A N     1 
ATOM   7471  C  CA    . ASN D 4  854  ? 32.022  -29.123 52.886  1.00 85.89  ? 854  ASN A CA    1 
ATOM   7472  C  C     . ASN D 4  854  ? 32.610  -28.027 53.772  1.00 96.43  ? 854  ASN A C     1 
ATOM   7473  O  O     . ASN D 4  854  ? 31.960  -27.610 54.741  1.00 109.19 ? 854  ASN A O     1 
ATOM   7474  C  CB    . ASN D 4  854  ? 31.375  -30.212 53.762  1.00 97.26  ? 854  ASN A CB    1 
ATOM   7475  C  CG    . ASN D 4  854  ? 30.217  -30.908 53.074  1.00 105.58 ? 854  ASN A CG    1 
ATOM   7476  O  OD1   . ASN D 4  854  ? 30.386  -31.553 52.040  1.00 120.00 ? 854  ASN A OD1   1 
ATOM   7477  N  ND2   . ASN D 4  854  ? 29.030  -30.793 53.659  1.00 99.59  ? 854  ASN A ND2   1 
ATOM   7478  N  N     . THR D 4  855  ? 33.811  -27.529 53.465  1.00 95.42  ? 855  THR A N     1 
ATOM   7479  C  CA    . THR D 4  855  ? 34.392  -26.425 54.226  1.00 104.11 ? 855  THR A CA    1 
ATOM   7480  C  C     . THR D 4  855  ? 33.799  -25.119 53.703  1.00 108.63 ? 855  THR A C     1 
ATOM   7481  O  O     . THR D 4  855  ? 34.076  -24.711 52.570  1.00 115.71 ? 855  THR A O     1 
ATOM   7482  C  CB    . THR D 4  855  ? 35.921  -26.414 54.143  1.00 92.70  ? 855  THR A CB    1 
ATOM   7483  O  OG1   . THR D 4  855  ? 36.348  -26.310 52.778  1.00 95.52  ? 855  THR A OG1   1 
ATOM   7484  C  CG2   . THR D 4  855  ? 36.510  -27.679 54.753  1.00 79.00  ? 855  THR A CG2   1 
ATOM   7485  N  N     . THR D 4  856  ? 32.943  -24.494 54.511  1.00 104.72 ? 856  THR A N     1 
ATOM   7486  C  CA    . THR D 4  856  ? 32.416  -23.164 54.234  1.00 95.24  ? 856  THR A CA    1 
ATOM   7487  C  C     . THR D 4  856  ? 33.550  -22.146 54.218  1.00 81.75  ? 856  THR A C     1 
ATOM   7488  O  O     . THR D 4  856  ? 34.145  -21.855 55.259  1.00 88.02  ? 856  THR A O     1 
ATOM   7489  C  CB    . THR D 4  856  ? 31.356  -22.800 55.282  1.00 98.95  ? 856  THR A CB    1 
ATOM   7490  O  OG1   . THR D 4  856  ? 30.232  -23.680 55.153  1.00 118.94 ? 856  THR A OG1   1 
ATOM   7491  C  CG2   . THR D 4  856  ? 30.907  -21.382 55.144  1.00 83.38  ? 856  THR A CG2   1 
ATOM   7492  N  N     . ARG D 4  857  ? 33.870  -21.613 53.040  1.00 83.62  ? 857  ARG A N     1 
ATOM   7493  C  CA    . ARG D 4  857  ? 35.054  -20.782 52.867  1.00 99.16  ? 857  ARG A CA    1 
ATOM   7494  C  C     . ARG D 4  857  ? 34.704  -19.528 52.072  1.00 116.93 ? 857  ARG A C     1 
ATOM   7495  O  O     . ARG D 4  857  ? 33.577  -19.346 51.599  1.00 125.34 ? 857  ARG A O     1 
ATOM   7496  C  CB    . ARG D 4  857  ? 36.181  -21.548 52.158  1.00 110.18 ? 857  ARG A CB    1 
ATOM   7497  C  CG    . ARG D 4  857  ? 36.757  -22.733 52.922  1.00 109.43 ? 857  ARG A CG    1 
ATOM   7498  C  CD    . ARG D 4  857  ? 38.163  -23.048 52.429  1.00 103.14 ? 857  ARG A CD    1 
ATOM   7499  N  NE    . ARG D 4  857  ? 38.623  -24.373 52.833  1.00 108.05 ? 857  ARG A NE    1 
ATOM   7500  C  CZ    . ARG D 4  857  ? 39.899  -24.752 52.833  1.00 111.79 ? 857  ARG A CZ    1 
ATOM   7501  N  NH1   . ARG D 4  857  ? 40.851  -23.901 52.468  1.00 98.11  ? 857  ARG A NH1   1 
ATOM   7502  N  NH2   . ARG D 4  857  ? 40.227  -25.979 53.212  1.00 119.87 ? 857  ARG A NH2   1 
ATOM   7503  N  N     . ASN D 4  858  ? 35.703  -18.661 51.935  1.00 116.27 ? 858  ASN A N     1 
ATOM   7504  C  CA    . ASN D 4  858  ? 35.668  -17.456 51.116  1.00 108.55 ? 858  ASN A CA    1 
ATOM   7505  C  C     . ASN D 4  858  ? 36.763  -17.545 50.051  1.00 112.17 ? 858  ASN A C     1 
ATOM   7506  O  O     . ASN D 4  858  ? 37.371  -18.600 49.842  1.00 125.76 ? 858  ASN A O     1 
ATOM   7507  C  CB    . ASN D 4  858  ? 35.810  -16.202 51.984  1.00 100.70 ? 858  ASN A CB    1 
ATOM   7508  C  CG    . ASN D 4  858  ? 37.145  -16.133 52.694  1.00 109.10 ? 858  ASN A CG    1 
ATOM   7509  O  OD1   . ASN D 4  858  ? 38.165  -15.778 52.105  1.00 98.40  ? 858  ASN A OD1   1 
ATOM   7510  N  ND2   . ASN D 4  858  ? 37.142  -16.468 53.976  1.00 133.86 ? 858  ASN A ND2   1 
ATOM   7511  N  N     . SER D 4  859  ? 36.999  -16.415 49.375  1.00 102.00 ? 859  SER A N     1 
ATOM   7512  C  CA    . SER D 4  859  ? 37.970  -16.350 48.282  1.00 102.38 ? 859  SER A CA    1 
ATOM   7513  C  C     . SER D 4  859  ? 39.401  -16.618 48.742  1.00 95.33  ? 859  SER A C     1 
ATOM   7514  O  O     . SER D 4  859  ? 40.209  -17.150 47.971  1.00 90.77  ? 859  SER A O     1 
ATOM   7515  C  CB    . SER D 4  859  ? 37.889  -14.980 47.606  1.00 96.31  ? 859  SER A CB    1 
ATOM   7516  O  OG    . SER D 4  859  ? 37.685  -13.945 48.563  1.00 72.02  ? 859  SER A OG    1 
ATOM   7517  N  N     . LEU D 4  860  ? 39.741  -16.247 49.976  1.00 91.92  ? 860  LEU A N     1 
ATOM   7518  C  CA    . LEU D 4  860  ? 41.096  -16.480 50.460  1.00 103.88 ? 860  LEU A CA    1 
ATOM   7519  C  C     . LEU D 4  860  ? 41.340  -17.944 50.791  1.00 99.99  ? 860  LEU A C     1 
ATOM   7520  O  O     . LEU D 4  860  ? 42.495  -18.385 50.795  1.00 104.56 ? 860  LEU A O     1 
ATOM   7521  C  CB    . LEU D 4  860  ? 41.388  -15.629 51.699  1.00 105.99 ? 860  LEU A CB    1 
ATOM   7522  C  CG    . LEU D 4  860  ? 41.725  -14.147 51.520  1.00 92.56  ? 860  LEU A CG    1 
ATOM   7523  C  CD1   . LEU D 4  860  ? 42.756  -13.940 50.403  1.00 82.18  ? 860  LEU A CD1   1 
ATOM   7524  C  CD2   . LEU D 4  860  ? 40.478  -13.305 51.308  1.00 98.13  ? 860  LEU A CD2   1 
ATOM   7525  N  N     . GLY D 4  861  ? 40.283  -18.700 51.056  1.00 88.08  ? 861  GLY A N     1 
ATOM   7526  C  CA    . GLY D 4  861  ? 40.409  -20.028 51.607  1.00 95.82  ? 861  GLY A CA    1 
ATOM   7527  C  C     . GLY D 4  861  ? 40.310  -20.085 53.111  1.00 109.87 ? 861  GLY A C     1 
ATOM   7528  O  O     . GLY D 4  861  ? 40.545  -21.153 53.686  1.00 128.90 ? 861  GLY A O     1 
ATOM   7529  N  N     . ASN D 4  862  ? 39.995  -18.967 53.765  1.00 113.93 ? 862  ASN A N     1 
ATOM   7530  C  CA    . ASN D 4  862  ? 39.773  -18.978 55.204  1.00 113.51 ? 862  ASN A CA    1 
ATOM   7531  C  C     . ASN D 4  862  ? 38.484  -19.726 55.528  1.00 109.13 ? 862  ASN A C     1 
ATOM   7532  O  O     . ASN D 4  862  ? 37.466  -19.569 54.846  1.00 119.36 ? 862  ASN A O     1 
ATOM   7533  C  CB    . ASN D 4  862  ? 39.714  -17.551 55.764  1.00 115.55 ? 862  ASN A CB    1 
ATOM   7534  C  CG    . ASN D 4  862  ? 41.019  -16.786 55.579  1.00 122.75 ? 862  ASN A CG    1 
ATOM   7535  O  OD1   . ASN D 4  862  ? 41.953  -17.268 54.936  1.00 122.49 ? 862  ASN A OD1   1 
ATOM   7536  N  ND2   . ASN D 4  862  ? 41.090  -15.590 56.158  1.00 130.42 ? 862  ASN A ND2   1 
ATOM   7537  N  N     . VAL D 4  863  ? 38.535  -20.551 56.569  1.00 94.45  ? 863  VAL A N     1 
ATOM   7538  C  CA    . VAL D 4  863  ? 37.413  -21.402 56.947  1.00 83.92  ? 863  VAL A CA    1 
ATOM   7539  C  C     . VAL D 4  863  ? 36.510  -20.621 57.895  1.00 78.04  ? 863  VAL A C     1 
ATOM   7540  O  O     . VAL D 4  863  ? 36.949  -20.163 58.957  1.00 100.03 ? 863  VAL A O     1 
ATOM   7541  C  CB    . VAL D 4  863  ? 37.894  -22.712 57.592  1.00 80.23  ? 863  VAL A CB    1 
ATOM   7542  C  CG1   . VAL D 4  863  ? 36.716  -23.635 57.854  1.00 72.63  ? 863  VAL A CG1   1 
ATOM   7543  C  CG2   . VAL D 4  863  ? 38.948  -23.402 56.711  1.00 83.80  ? 863  VAL A CG2   1 
ATOM   7544  N  N     . ILE D 4  864  ? 35.250  -20.449 57.499  1.00 70.48  ? 864  ILE A N     1 
ATOM   7545  C  CA    . ILE D 4  864  ? 34.237  -19.829 58.344  1.00 74.82  ? 864  ILE A CA    1 
ATOM   7546  C  C     . ILE D 4  864  ? 33.623  -20.923 59.205  1.00 94.97  ? 864  ILE A C     1 
ATOM   7547  O  O     . ILE D 4  864  ? 33.652  -20.854 60.439  1.00 121.52 ? 864  ILE A O     1 
ATOM   7548  C  CB    . ILE D 4  864  ? 33.168  -19.115 57.500  1.00 81.24  ? 864  ILE A CB    1 
ATOM   7549  C  CG1   . ILE D 4  864  ? 33.823  -18.321 56.366  1.00 104.92 ? 864  ILE A CG1   1 
ATOM   7550  C  CG2   . ILE D 4  864  ? 32.325  -18.219 58.366  1.00 74.12  ? 864  ILE A CG2   1 
ATOM   7551  C  CD1   . ILE D 4  864  ? 34.674  -17.157 56.821  1.00 122.27 ? 864  ILE A CD1   1 
ATOM   7552  N  N     . GLN D 4  865  ? 33.067  -21.941 58.551  1.00 91.85  ? 865  GLN A N     1 
ATOM   7553  C  CA    . GLN D 4  865  ? 32.598  -23.162 59.188  1.00 92.37  ? 865  GLN A CA    1 
ATOM   7554  C  C     . GLN D 4  865  ? 33.294  -24.341 58.520  1.00 115.86 ? 865  GLN A C     1 
ATOM   7555  O  O     . GLN D 4  865  ? 33.442  -24.366 57.295  1.00 140.13 ? 865  GLN A O     1 
ATOM   7556  C  CB    . GLN D 4  865  ? 31.070  -23.317 59.057  1.00 91.62  ? 865  GLN A CB    1 
ATOM   7557  C  CG    . GLN D 4  865  ? 30.249  -22.085 59.459  1.00 93.45  ? 865  GLN A CG    1 
ATOM   7558  C  CD    . GLN D 4  865  ? 28.756  -22.244 59.163  1.00 89.71  ? 865  GLN A CD    1 
ATOM   7559  O  OE1   . GLN D 4  865  ? 28.360  -23.012 58.281  1.00 67.87  ? 865  GLN A OE1   1 
ATOM   7560  N  NE2   . GLN D 4  865  ? 27.927  -21.491 59.881  1.00 91.31  ? 865  GLN A NE2   1 
ATOM   7561  N  N     . PHE D 4  866  ? 33.731  -25.317 59.322  1.00 114.75 ? 866  PHE A N     1 
ATOM   7562  C  CA    . PHE D 4  866  ? 34.362  -26.503 58.745  1.00 102.41 ? 866  PHE A CA    1 
ATOM   7563  C  C     . PHE D 4  866  ? 33.327  -27.425 58.104  1.00 101.48 ? 866  PHE A C     1 
ATOM   7564  O  O     . PHE D 4  866  ? 33.622  -28.096 57.107  1.00 103.83 ? 866  PHE A O     1 
ATOM   7565  C  CB    . PHE D 4  866  ? 35.168  -27.245 59.817  1.00 98.04  ? 866  PHE A CB    1 
ATOM   7566  C  CG    . PHE D 4  866  ? 36.329  -26.448 60.361  1.00 86.07  ? 866  PHE A CG    1 
ATOM   7567  C  CD1   . PHE D 4  866  ? 36.163  -25.614 61.457  1.00 83.84  ? 866  PHE A CD1   1 
ATOM   7568  C  CD2   . PHE D 4  866  ? 37.578  -26.511 59.759  1.00 75.65  ? 866  PHE A CD2   1 
ATOM   7569  C  CE1   . PHE D 4  866  ? 37.222  -24.871 61.950  1.00 85.99  ? 866  PHE A CE1   1 
ATOM   7570  C  CE2   . PHE D 4  866  ? 38.638  -25.762 60.245  1.00 71.19  ? 866  PHE A CE2   1 
ATOM   7571  C  CZ    . PHE D 4  866  ? 38.458  -24.946 61.341  1.00 86.50  ? 866  PHE A CZ    1 
ATOM   7572  N  N     . ILE D 4  867  ? 32.120  -27.480 58.669  1.00 102.66 ? 867  ILE A N     1 
ATOM   7573  C  CA    . ILE D 4  867  ? 30.970  -28.157 58.077  1.00 94.44  ? 867  ILE A CA    1 
ATOM   7574  C  C     . ILE D 4  867  ? 29.838  -27.135 58.032  1.00 92.37  ? 867  ILE A C     1 
ATOM   7575  O  O     . ILE D 4  867  ? 29.581  -26.458 59.034  1.00 93.84  ? 867  ILE A O     1 
ATOM   7576  C  CB    . ILE D 4  867  ? 30.552  -29.401 58.890  1.00 86.05  ? 867  ILE A CB    1 
ATOM   7577  C  CG1   . ILE D 4  867  ? 31.771  -30.279 59.226  1.00 108.73 ? 867  ILE A CG1   1 
ATOM   7578  C  CG2   . ILE D 4  867  ? 29.581  -30.227 58.090  1.00 67.04  ? 867  ILE A CG2   1 
ATOM   7579  C  CD1   . ILE D 4  867  ? 31.772  -30.929 60.625  1.00 100.73 ? 867  ILE A CD1   1 
ATOM   7580  N  N     . TYR D 4  868  ? 29.177  -27.006 56.876  1.00 82.41  ? 868  TYR A N     1 
ATOM   7581  C  CA    . TYR D 4  868  ? 28.198  -25.935 56.692  1.00 83.01  ? 868  TYR A CA    1 
ATOM   7582  C  C     . TYR D 4  868  ? 26.971  -26.139 57.577  1.00 74.39  ? 868  TYR A C     1 
ATOM   7583  O  O     . TYR D 4  868  ? 26.355  -27.208 57.575  1.00 65.73  ? 868  TYR A O     1 
ATOM   7584  C  CB    . TYR D 4  868  ? 27.766  -25.826 55.225  1.00 96.79  ? 868  TYR A CB    1 
ATOM   7585  C  CG    . TYR D 4  868  ? 26.499  -24.997 55.037  1.00 99.28  ? 868  TYR A CG    1 
ATOM   7586  C  CD1   . TYR D 4  868  ? 26.536  -23.615 55.097  1.00 101.26 ? 868  TYR A CD1   1 
ATOM   7587  C  CD2   . TYR D 4  868  ? 25.272  -25.599 54.797  1.00 84.08  ? 868  TYR A CD2   1 
ATOM   7588  C  CE1   . TYR D 4  868  ? 25.382  -22.863 54.943  1.00 94.90  ? 868  TYR A CE1   1 
ATOM   7589  C  CE2   . TYR D 4  868  ? 24.117  -24.852 54.622  1.00 64.98  ? 868  TYR A CE2   1 
ATOM   7590  C  CZ    . TYR D 4  868  ? 24.180  -23.482 54.694  1.00 74.34  ? 868  TYR A CZ    1 
ATOM   7591  O  OH    . TYR D 4  868  ? 23.048  -22.711 54.531  1.00 78.06  ? 868  TYR A OH    1 
ATOM   7592  N  N     . GLY D 4  869  ? 26.601  -25.092 58.316  1.00 78.72  ? 869  GLY A N     1 
ATOM   7593  C  CA    . GLY D 4  869  ? 25.521  -25.200 59.278  1.00 78.92  ? 869  GLY A CA    1 
ATOM   7594  C  C     . GLY D 4  869  ? 25.819  -26.120 60.437  1.00 73.33  ? 869  GLY A C     1 
ATOM   7595  O  O     . GLY D 4  869  ? 24.894  -26.544 61.136  1.00 67.58  ? 869  GLY A O     1 
ATOM   7596  N  N     . GLU D 4  870  ? 27.096  -26.455 60.644  1.00 73.48  ? 870  GLU A N     1 
ATOM   7597  C  CA    . GLU D 4  870  ? 27.637  -27.379 61.637  1.00 77.86  ? 870  GLU A CA    1 
ATOM   7598  C  C     . GLU D 4  870  ? 27.193  -28.828 61.407  1.00 89.31  ? 870  GLU A C     1 
ATOM   7599  O  O     . GLU D 4  870  ? 27.549  -29.698 62.211  1.00 108.68 ? 870  GLU A O     1 
ATOM   7600  C  CB    . GLU D 4  870  ? 27.326  -26.913 63.074  1.00 76.71  ? 870  GLU A CB    1 
ATOM   7601  C  CG    . GLU D 4  870  ? 27.805  -25.469 63.294  1.00 86.61  ? 870  GLU A CG    1 
ATOM   7602  C  CD    . GLU D 4  870  ? 27.369  -24.854 64.610  1.00 102.74 ? 870  GLU A CD    1 
ATOM   7603  O  OE1   . GLU D 4  870  ? 26.855  -25.591 65.477  1.00 112.89 ? 870  GLU A OE1   1 
ATOM   7604  O  OE2   . GLU D 4  870  ? 27.548  -23.624 64.775  1.00 95.10  ? 870  GLU A OE2   1 
ATOM   7605  N  N     . ASP D 4  871  ? 26.465  -29.126 60.321  1.00 77.40  ? 871  ASP A N     1 
ATOM   7606  C  CA    . ASP D 4  871  ? 26.123  -30.503 59.967  1.00 80.96  ? 871  ASP A CA    1 
ATOM   7607  C  C     . ASP D 4  871  ? 26.261  -30.818 58.479  1.00 76.67  ? 871  ASP A C     1 
ATOM   7608  O  O     . ASP D 4  871  ? 26.089  -31.984 58.103  1.00 77.69  ? 871  ASP A O     1 
ATOM   7609  C  CB    . ASP D 4  871  ? 24.690  -30.859 60.417  1.00 83.10  ? 871  ASP A CB    1 
ATOM   7610  C  CG    . ASP D 4  871  ? 23.612  -30.040 59.714  1.00 71.06  ? 871  ASP A CG    1 
ATOM   7611  O  OD1   . ASP D 4  871  ? 23.918  -28.968 59.154  1.00 73.79  ? 871  ASP A OD1   1 
ATOM   7612  O  OD2   . ASP D 4  871  ? 22.439  -30.474 59.729  1.00 66.11  ? 871  ASP A OD2   1 
ATOM   7613  N  N     . GLY D 4  872  ? 26.553  -29.837 57.630  1.00 79.52  ? 872  GLY A N     1 
ATOM   7614  C  CA    . GLY D 4  872  ? 26.765  -30.062 56.210  1.00 79.12  ? 872  GLY A CA    1 
ATOM   7615  C  C     . GLY D 4  872  ? 25.546  -30.509 55.436  1.00 73.55  ? 872  GLY A C     1 
ATOM   7616  O  O     . GLY D 4  872  ? 25.670  -31.341 54.530  1.00 102.14 ? 872  GLY A O     1 
ATOM   7617  N  N     . MET D 4  873  ? 24.364  -29.993 55.771  1.00 71.68  ? 873  MET A N     1 
ATOM   7618  C  CA    . MET D 4  873  ? 23.149  -30.355 55.057  1.00 73.95  ? 873  MET A CA    1 
ATOM   7619  C  C     . MET D 4  873  ? 22.401  -29.103 54.620  1.00 79.67  ? 873  MET A C     1 
ATOM   7620  O  O     . MET D 4  873  ? 22.474  -28.053 55.263  1.00 87.98  ? 873  MET A O     1 
ATOM   7621  C  CB    . MET D 4  873  ? 22.219  -31.243 55.900  1.00 66.05  ? 873  MET A CB    1 
ATOM   7622  C  CG    . MET D 4  873  ? 22.842  -32.535 56.360  1.00 91.96  ? 873  MET A CG    1 
ATOM   7623  S  SD    . MET D 4  873  ? 21.694  -33.905 56.221  1.00 101.31 ? 873  MET A SD    1 
ATOM   7624  C  CE    . MET D 4  873  ? 21.329  -33.911 54.495  1.00 115.45 ? 873  MET A CE    1 
ATOM   7625  N  N     . ASP D 4  874  ? 21.692  -29.230 53.500  1.00 75.48  ? 874  ASP A N     1 
ATOM   7626  C  CA    . ASP D 4  874  ? 20.930  -28.131 52.932  1.00 76.85  ? 874  ASP A CA    1 
ATOM   7627  C  C     . ASP D 4  874  ? 19.676  -27.878 53.758  1.00 81.99  ? 874  ASP A C     1 
ATOM   7628  O  O     . ASP D 4  874  ? 18.974  -28.814 54.156  1.00 90.70  ? 874  ASP A O     1 
ATOM   7629  C  CB    . ASP D 4  874  ? 20.562  -28.458 51.482  1.00 82.32  ? 874  ASP A CB    1 
ATOM   7630  C  CG    . ASP D 4  874  ? 20.168  -27.235 50.666  1.00 82.03  ? 874  ASP A CG    1 
ATOM   7631  O  OD1   . ASP D 4  874  ? 19.253  -26.496 51.080  1.00 87.86  ? 874  ASP A OD1   1 
ATOM   7632  O  OD2   . ASP D 4  874  ? 20.761  -27.028 49.586  1.00 82.10  ? 874  ASP A OD2   1 
ATOM   7633  N  N     . ALA D 4  875  ? 19.389  -26.595 53.998  1.00 72.44  ? 875  ALA A N     1 
ATOM   7634  C  CA    . ALA D 4  875  ? 18.201  -26.200 54.746  1.00 77.49  ? 875  ALA A CA    1 
ATOM   7635  C  C     . ALA D 4  875  ? 16.903  -26.439 53.981  1.00 86.42  ? 875  ALA A C     1 
ATOM   7636  O  O     . ALA D 4  875  ? 15.824  -26.325 54.577  1.00 81.18  ? 875  ALA A O     1 
ATOM   7637  C  CB    . ALA D 4  875  ? 18.300  -24.728 55.134  1.00 65.12  ? 875  ALA A CB    1 
ATOM   7638  N  N     . ALA D 4  876  ? 16.975  -26.762 52.686  1.00 80.20  ? 876  ALA A N     1 
ATOM   7639  C  CA    . ALA D 4  876  ? 15.769  -27.094 51.935  1.00 68.86  ? 876  ALA A CA    1 
ATOM   7640  C  C     . ALA D 4  876  ? 15.184  -28.421 52.404  1.00 92.00  ? 876  ALA A C     1 
ATOM   7641  O  O     . ALA D 4  876  ? 13.965  -28.547 52.582  1.00 97.81  ? 876  ALA A O     1 
ATOM   7642  C  CB    . ALA D 4  876  ? 16.079  -27.135 50.438  1.00 66.05  ? 876  ALA A CB    1 
ATOM   7643  N  N     . HIS D 4  877  ? 16.040  -29.423 52.610  1.00 100.63 ? 877  HIS A N     1 
ATOM   7644  C  CA    . HIS D 4  877  ? 15.595  -30.773 52.956  1.00 105.89 ? 877  HIS A CA    1 
ATOM   7645  C  C     . HIS D 4  877  ? 15.649  -30.984 54.475  1.00 102.45 ? 877  HIS A C     1 
ATOM   7646  O  O     . HIS D 4  877  ? 16.296  -31.904 54.975  1.00 135.07 ? 877  HIS A O     1 
ATOM   7647  C  CB    . HIS D 4  877  ? 16.455  -31.812 52.233  1.00 116.68 ? 877  HIS A CB    1 
ATOM   7648  C  CG    . HIS D 4  877  ? 16.982  -31.367 50.894  1.00 104.74 ? 877  HIS A CG    1 
ATOM   7649  N  ND1   . HIS D 4  877  ? 16.366  -31.683 49.701  1.00 84.66  ? 877  HIS A ND1   1 
ATOM   7650  C  CD2   . HIS D 4  877  ? 18.099  -30.674 50.563  1.00 97.80  ? 877  HIS A CD2   1 
ATOM   7651  C  CE1   . HIS D 4  877  ? 17.059  -31.176 48.698  1.00 84.64  ? 877  HIS A CE1   1 
ATOM   7652  N  NE2   . HIS D 4  877  ? 18.116  -30.561 49.194  1.00 90.79  ? 877  HIS A NE2   1 
ATOM   7653  N  N     . ILE D 4  878  ? 14.954  -30.118 55.219  1.00 87.70  ? 878  ILE A N     1 
ATOM   7654  C  CA    . ILE D 4  878  ? 15.017  -30.098 56.684  1.00 70.53  ? 878  ILE A CA    1 
ATOM   7655  C  C     . ILE D 4  878  ? 13.631  -29.779 57.240  1.00 87.84  ? 878  ILE A C     1 
ATOM   7656  O  O     . ILE D 4  878  ? 13.021  -28.773 56.862  1.00 119.92 ? 878  ILE A O     1 
ATOM   7657  C  CB    . ILE D 4  878  ? 16.058  -29.079 57.197  1.00 66.26  ? 878  ILE A CB    1 
ATOM   7658  C  CG1   . ILE D 4  878  ? 17.475  -29.654 57.093  1.00 72.19  ? 878  ILE A CG1   1 
ATOM   7659  C  CG2   . ILE D 4  878  ? 15.768  -28.661 58.634  1.00 73.87  ? 878  ILE A CG2   1 
ATOM   7660  C  CD1   . ILE D 4  878  ? 18.566  -28.772 57.684  1.00 96.66  ? 878  ILE A CD1   1 
ATOM   7661  N  N     . GLU D 4  879  ? 13.138  -30.630 58.145  1.00 67.50  ? 879  GLU A N     1 
ATOM   7662  C  CA    . GLU D 4  879  ? 11.813  -30.494 58.737  1.00 74.33  ? 879  GLU A CA    1 
ATOM   7663  C  C     . GLU D 4  879  ? 11.909  -30.592 60.257  1.00 90.02  ? 879  GLU A C     1 
ATOM   7664  O  O     . GLU D 4  879  ? 12.900  -31.067 60.811  1.00 67.99  ? 879  GLU A O     1 
ATOM   7665  C  CB    . GLU D 4  879  ? 10.848  -31.575 58.222  1.00 68.64  ? 879  GLU A CB    1 
ATOM   7666  C  CG    . GLU D 4  879  ? 10.836  -31.741 56.719  1.00 68.63  ? 879  GLU A CG    1 
ATOM   7667  C  CD    . GLU D 4  879  ? 9.989   -32.908 56.276  1.00 90.59  ? 879  GLU A CD    1 
ATOM   7668  O  OE1   . GLU D 4  879  ? 10.371  -33.565 55.286  1.00 103.19 ? 879  GLU A OE1   1 
ATOM   7669  O  OE2   . GLU D 4  879  ? 8.956   -33.186 56.924  1.00 95.39  ? 879  GLU A OE2   1 
ATOM   7670  N  N     . LYS D 4  880  ? 10.851  -30.152 60.933  1.00 94.80  ? 880  LYS A N     1 
ATOM   7671  C  CA    . LYS D 4  880  ? 10.794  -30.215 62.389  1.00 83.78  ? 880  LYS A CA    1 
ATOM   7672  C  C     . LYS D 4  880  ? 10.466  -31.636 62.837  1.00 95.39  ? 880  LYS A C     1 
ATOM   7673  O  O     . LYS D 4  880  ? 9.379   -32.150 62.549  1.00 97.92  ? 880  LYS A O     1 
ATOM   7674  C  CB    . LYS D 4  880  ? 9.753   -29.230 62.917  1.00 99.02  ? 880  LYS A CB    1 
ATOM   7675  C  CG    . LYS D 4  880  ? 9.399   -29.410 64.381  1.00 99.26  ? 880  LYS A CG    1 
ATOM   7676  C  CD    . LYS D 4  880  ? 8.158   -28.610 64.728  1.00 97.10  ? 880  LYS A CD    1 
ATOM   7677  C  CE    . LYS D 4  880  ? 8.399   -27.121 64.522  1.00 95.09  ? 880  LYS A CE    1 
ATOM   7678  N  NZ    . LYS D 4  880  ? 9.478   -26.595 65.405  1.00 95.46  ? 880  LYS A NZ    1 
ATOM   7679  N  N     . GLN D 4  881  ? 11.398  -32.271 63.541  1.00 115.12 ? 881  GLN A N     1 
ATOM   7680  C  CA    . GLN D 4  881  ? 11.213  -33.615 64.061  1.00 96.23  ? 881  GLN A CA    1 
ATOM   7681  C  C     . GLN D 4  881  ? 11.211  -33.597 65.583  1.00 95.81  ? 881  GLN A C     1 
ATOM   7682  O  O     . GLN D 4  881  ? 12.029  -32.913 66.207  1.00 97.61  ? 881  GLN A O     1 
ATOM   7683  C  CB    . GLN D 4  881  ? 12.308  -34.550 63.563  1.00 75.41  ? 881  GLN A CB    1 
ATOM   7684  C  CG    . GLN D 4  881  ? 12.536  -34.494 62.071  1.00 69.21  ? 881  GLN A CG    1 
ATOM   7685  C  CD    . GLN D 4  881  ? 12.407  -35.854 61.440  1.00 80.24  ? 881  GLN A CD    1 
ATOM   7686  O  OE1   . GLN D 4  881  ? 11.418  -36.566 61.645  1.00 71.65  ? 881  GLN A OE1   1 
ATOM   7687  N  NE2   . GLN D 4  881  ? 13.434  -36.252 60.708  1.00 83.54  ? 881  GLN A NE2   1 
ATOM   7688  N  N     . SER D 4  882  ? 10.275  -34.340 66.173  1.00 98.58  ? 882  SER A N     1 
ATOM   7689  C  CA    . SER D 4  882  ? 10.242  -34.514 67.618  1.00 82.49  ? 882  SER A CA    1 
ATOM   7690  C  C     . SER D 4  882  ? 11.198  -35.627 68.023  1.00 85.23  ? 882  SER A C     1 
ATOM   7691  O  O     . SER D 4  882  ? 11.352  -36.625 67.311  1.00 102.74 ? 882  SER A O     1 
ATOM   7692  C  CB    . SER D 4  882  ? 8.825   -34.843 68.100  1.00 79.64  ? 882  SER A CB    1 
ATOM   7693  O  OG    . SER D 4  882  ? 8.480   -36.197 67.841  1.00 93.68  ? 882  SER A OG    1 
ATOM   7694  N  N     . LEU D 4  883  ? 11.843  -35.449 69.171  1.00 91.61  ? 883  LEU A N     1 
ATOM   7695  C  CA    . LEU D 4  883  ? 12.802  -36.411 69.709  1.00 98.62  ? 883  LEU A CA    1 
ATOM   7696  C  C     . LEU D 4  883  ? 12.192  -37.005 70.980  1.00 106.78 ? 883  LEU A C     1 
ATOM   7697  O  O     . LEU D 4  883  ? 12.165  -36.357 72.033  1.00 104.61 ? 883  LEU A O     1 
ATOM   7698  C  CB    . LEU D 4  883  ? 14.157  -35.742 69.958  1.00 80.07  ? 883  LEU A CB    1 
ATOM   7699  C  CG    . LEU D 4  883  ? 15.135  -35.662 68.769  1.00 70.35  ? 883  LEU A CG    1 
ATOM   7700  C  CD1   . LEU D 4  883  ? 14.737  -34.600 67.777  1.00 69.86  ? 883  LEU A CD1   1 
ATOM   7701  C  CD2   . LEU D 4  883  ? 16.562  -35.403 69.222  1.00 70.09  ? 883  LEU A CD2   1 
ATOM   7702  N  N     . ASP D 4  884  ? 11.696  -38.245 70.874  1.00 108.29 ? 884  ASP A N     1 
ATOM   7703  C  CA    . ASP D 4  884  ? 10.928  -38.874 71.947  1.00 109.00 ? 884  ASP A CA    1 
ATOM   7704  C  C     . ASP D 4  884  ? 11.772  -39.251 73.155  1.00 109.81 ? 884  ASP A C     1 
ATOM   7705  O  O     . ASP D 4  884  ? 11.205  -39.598 74.197  1.00 112.12 ? 884  ASP A O     1 
ATOM   7706  C  CB    . ASP D 4  884  ? 10.217  -40.126 71.423  1.00 113.10 ? 884  ASP A CB    1 
ATOM   7707  C  CG    . ASP D 4  884  ? 9.164   -39.811 70.379  1.00 119.97 ? 884  ASP A CG    1 
ATOM   7708  O  OD1   . ASP D 4  884  ? 8.238   -39.026 70.676  1.00 128.01 ? 884  ASP A OD1   1 
ATOM   7709  O  OD2   . ASP D 4  884  ? 9.264   -40.346 69.256  1.00 126.24 ? 884  ASP A OD2   1 
ATOM   7710  N  N     . THR D 4  885  ? 13.098  -39.199 73.041  1.00 111.73 ? 885  THR A N     1 
ATOM   7711  C  CA    . THR D 4  885  ? 13.968  -39.533 74.160  1.00 117.16 ? 885  THR A CA    1 
ATOM   7712  C  C     . THR D 4  885  ? 14.099  -38.399 75.178  1.00 118.53 ? 885  THR A C     1 
ATOM   7713  O  O     . THR D 4  885  ? 14.428  -38.672 76.336  1.00 135.84 ? 885  THR A O     1 
ATOM   7714  C  CB    . THR D 4  885  ? 15.354  -39.936 73.638  1.00 109.04 ? 885  THR A CB    1 
ATOM   7715  O  OG1   . THR D 4  885  ? 15.703  -39.110 72.520  1.00 125.71 ? 885  THR A OG1   1 
ATOM   7716  C  CG2   . THR D 4  885  ? 15.364  -41.387 73.194  1.00 87.28  ? 885  THR A CG2   1 
ATOM   7717  N  N     . ILE D 4  886  ? 13.828  -37.151 74.783  1.00 96.40  ? 886  ILE A N     1 
ATOM   7718  C  CA    . ILE D 4  886  ? 14.092  -36.001 75.654  1.00 88.67  ? 886  ILE A CA    1 
ATOM   7719  C  C     . ILE D 4  886  ? 13.134  -35.970 76.843  1.00 103.36 ? 886  ILE A C     1 
ATOM   7720  O  O     . ILE D 4  886  ? 13.559  -35.840 77.998  1.00 111.82 ? 886  ILE A O     1 
ATOM   7721  C  CB    . ILE D 4  886  ? 14.037  -34.691 74.843  1.00 85.11  ? 886  ILE A CB    1 
ATOM   7722  C  CG1   . ILE D 4  886  ? 15.378  -34.453 74.148  1.00 81.61  ? 886  ILE A CG1   1 
ATOM   7723  C  CG2   . ILE D 4  886  ? 13.632  -33.484 75.710  1.00 83.83  ? 886  ILE A CG2   1 
ATOM   7724  C  CD1   . ILE D 4  886  ? 16.376  -33.739 75.035  1.00 78.42  ? 886  ILE A CD1   1 
ATOM   7725  N  N     . GLY D 4  887  ? 11.831  -36.078 76.589  1.00 110.39 ? 887  GLY A N     1 
ATOM   7726  C  CA    . GLY D 4  887  ? 10.846  -35.866 77.627  1.00 99.59  ? 887  GLY A CA    1 
ATOM   7727  C  C     . GLY D 4  887  ? 10.464  -37.147 78.343  1.00 92.65  ? 887  GLY A C     1 
ATOM   7728  O  O     . GLY D 4  887  ? 10.958  -38.236 78.052  1.00 85.46  ? 887  GLY A O     1 
ATOM   7729  N  N     . GLY D 4  888  ? 9.573   -36.993 79.313  1.00 100.30 ? 888  GLY A N     1 
ATOM   7730  C  CA    . GLY D 4  888  ? 8.975   -38.117 79.998  1.00 104.43 ? 888  GLY A CA    1 
ATOM   7731  C  C     . GLY D 4  888  ? 9.862   -38.701 81.084  1.00 102.59 ? 888  GLY A C     1 
ATOM   7732  O  O     . GLY D 4  888  ? 11.075  -38.492 81.134  1.00 88.24  ? 888  GLY A O     1 
ATOM   7733  N  N     . SER D 4  889  ? 9.223   -39.462 81.969  1.00 113.28 ? 889  SER A N     1 
ATOM   7734  C  CA    . SER D 4  889  ? 9.910   -40.126 83.062  1.00 117.20 ? 889  SER A CA    1 
ATOM   7735  C  C     . SER D 4  889  ? 10.846  -41.212 82.539  1.00 119.08 ? 889  SER A C     1 
ATOM   7736  O  O     . SER D 4  889  ? 10.698  -41.720 81.422  1.00 123.84 ? 889  SER A O     1 
ATOM   7737  C  CB    . SER D 4  889  ? 8.897   -40.745 84.025  1.00 122.25 ? 889  SER A CB    1 
ATOM   7738  O  OG    . SER D 4  889  ? 8.155   -41.771 83.380  1.00 116.50 ? 889  SER A OG    1 
ATOM   7739  N  N     . ASP D 4  890  ? 11.827  -41.566 83.377  1.00 120.77 ? 890  ASP A N     1 
ATOM   7740  C  CA    . ASP D 4  890  ? 12.661  -42.729 83.089  1.00 126.84 ? 890  ASP A CA    1 
ATOM   7741  C  C     . ASP D 4  890  ? 11.842  -44.014 83.093  1.00 120.43 ? 890  ASP A C     1 
ATOM   7742  O  O     . ASP D 4  890  ? 12.195  -44.975 82.403  1.00 101.90 ? 890  ASP A O     1 
ATOM   7743  C  CB    . ASP D 4  890  ? 13.808  -42.827 84.100  1.00 129.99 ? 890  ASP A CB    1 
ATOM   7744  C  CG    . ASP D 4  890  ? 14.866  -41.757 83.893  1.00 118.92 ? 890  ASP A CG    1 
ATOM   7745  O  OD1   . ASP D 4  890  ? 14.570  -40.567 84.136  1.00 110.90 ? 890  ASP A OD1   1 
ATOM   7746  O  OD2   . ASP D 4  890  ? 15.993  -42.109 83.483  1.00 111.61 ? 890  ASP A OD2   1 
ATOM   7747  N  N     . ALA D 4  891  ? 10.736  -44.041 83.843  1.00 131.13 ? 891  ALA A N     1 
ATOM   7748  C  CA    . ALA D 4  891  ? 9.898   -45.235 83.905  1.00 143.21 ? 891  ALA A CA    1 
ATOM   7749  C  C     . ALA D 4  891  ? 9.134   -45.451 82.600  1.00 146.46 ? 891  ALA A C     1 
ATOM   7750  O  O     . ALA D 4  891  ? 9.066   -46.575 82.091  1.00 146.61 ? 891  ALA A O     1 
ATOM   7751  C  CB    . ALA D 4  891  ? 8.936   -45.133 85.090  1.00 156.06 ? 891  ALA A CB    1 
ATOM   7752  N  N     . ALA D 4  892  ? 8.550   -44.384 82.042  1.00 142.21 ? 892  ALA A N     1 
ATOM   7753  C  CA    . ALA D 4  892  ? 7.836   -44.503 80.770  1.00 121.29 ? 892  ALA A CA    1 
ATOM   7754  C  C     . ALA D 4  892  ? 8.801   -44.757 79.613  1.00 112.20 ? 892  ALA A C     1 
ATOM   7755  O  O     . ALA D 4  892  ? 8.484   -45.510 78.680  1.00 109.91 ? 892  ALA A O     1 
ATOM   7756  C  CB    . ALA D 4  892  ? 7.007   -43.244 80.520  1.00 107.09 ? 892  ALA A CB    1 
ATOM   7757  N  N     . PHE D 4  893  ? 9.986   -44.136 79.668  1.00 100.50 ? 893  PHE A N     1 
ATOM   7758  C  CA    . PHE D 4  893  ? 11.057  -44.412 78.711  1.00 89.11  ? 893  PHE A CA    1 
ATOM   7759  C  C     . PHE D 4  893  ? 11.491  -45.878 78.773  1.00 102.82 ? 893  PHE A C     1 
ATOM   7760  O  O     . PHE D 4  893  ? 11.711  -46.518 77.734  1.00 117.27 ? 893  PHE A O     1 
ATOM   7761  C  CB    . PHE D 4  893  ? 12.233  -43.470 79.000  1.00 78.46  ? 893  PHE A CB    1 
ATOM   7762  C  CG    . PHE D 4  893  ? 13.519  -43.835 78.304  1.00 77.75  ? 893  PHE A CG    1 
ATOM   7763  C  CD1   . PHE D 4  893  ? 13.696  -43.584 76.958  1.00 76.89  ? 893  PHE A CD1   1 
ATOM   7764  C  CD2   . PHE D 4  893  ? 14.553  -44.434 78.999  1.00 78.03  ? 893  PHE A CD2   1 
ATOM   7765  C  CE1   . PHE D 4  893  ? 14.887  -43.915 76.321  1.00 83.65  ? 893  PHE A CE1   1 
ATOM   7766  C  CE2   . PHE D 4  893  ? 15.739  -44.775 78.361  1.00 77.49  ? 893  PHE A CE2   1 
ATOM   7767  C  CZ    . PHE D 4  893  ? 15.902  -44.512 77.024  1.00 76.66  ? 893  PHE A CZ    1 
ATOM   7768  N  N     . GLU D 4  894  ? 11.605  -46.428 79.986  1.00 99.44  ? 894  GLU A N     1 
ATOM   7769  C  CA    . GLU D 4  894  ? 11.920  -47.846 80.149  1.00 100.84 ? 894  GLU A CA    1 
ATOM   7770  C  C     . GLU D 4  894  ? 10.799  -48.725 79.610  1.00 97.79  ? 894  GLU A C     1 
ATOM   7771  O  O     . GLU D 4  894  ? 11.059  -49.731 78.943  1.00 106.86 ? 894  GLU A O     1 
ATOM   7772  C  CB    . GLU D 4  894  ? 12.188  -48.149 81.628  1.00 109.76 ? 894  GLU A CB    1 
ATOM   7773  C  CG    . GLU D 4  894  ? 13.058  -49.371 81.903  1.00 97.14  ? 894  GLU A CG    1 
ATOM   7774  C  CD    . GLU D 4  894  ? 13.234  -49.626 83.387  1.00 100.69 ? 894  GLU A CD    1 
ATOM   7775  O  OE1   . GLU D 4  894  ? 12.238  -49.496 84.131  1.00 103.57 ? 894  GLU A OE1   1 
ATOM   7776  O  OE2   . GLU D 4  894  ? 14.359  -49.970 83.810  1.00 110.65 ? 894  GLU A OE2   1 
ATOM   7777  N  N     . LYS D 4  895  ? 9.543   -48.359 79.888  1.00 88.04  ? 895  LYS A N     1 
ATOM   7778  C  CA    . LYS D 4  895  ? 8.412   -49.157 79.421  1.00 99.29  ? 895  LYS A CA    1 
ATOM   7779  C  C     . LYS D 4  895  ? 8.346   -49.185 77.899  1.00 86.54  ? 895  LYS A C     1 
ATOM   7780  O  O     . LYS D 4  895  ? 8.002   -50.212 77.301  1.00 83.04  ? 895  LYS A O     1 
ATOM   7781  C  CB    . LYS D 4  895  ? 7.108   -48.617 80.012  1.00 107.63 ? 895  LYS A CB    1 
ATOM   7782  C  CG    . LYS D 4  895  ? 5.859   -49.390 79.592  1.00 111.34 ? 895  LYS A CG    1 
ATOM   7783  C  CD    . LYS D 4  895  ? 4.634   -48.961 80.383  1.00 122.72 ? 895  LYS A CD    1 
ATOM   7784  C  CE    . LYS D 4  895  ? 3.439   -49.844 80.062  1.00 129.92 ? 895  LYS A CE    1 
ATOM   7785  N  NZ    . LYS D 4  895  ? 2.311   -49.589 80.999  1.00 137.69 ? 895  LYS A NZ    1 
ATOM   7786  N  N     . ARG D 4  896  ? 8.709   -48.078 77.256  1.00 96.17  ? 896  ARG A N     1 
ATOM   7787  C  CA    . ARG D 4  896  ? 8.654   -48.024 75.803  1.00 101.27 ? 896  ARG A CA    1 
ATOM   7788  C  C     . ARG D 4  896  ? 9.896   -48.589 75.119  1.00 89.82  ? 896  ARG A C     1 
ATOM   7789  O  O     . ARG D 4  896  ? 9.807   -48.973 73.947  1.00 101.26 ? 896  ARG A O     1 
ATOM   7790  C  CB    . ARG D 4  896  ? 8.423   -46.584 75.345  1.00 112.63 ? 896  ARG A CB    1 
ATOM   7791  C  CG    . ARG D 4  896  ? 6.984   -46.294 74.958  1.00 125.35 ? 896  ARG A CG    1 
ATOM   7792  C  CD    . ARG D 4  896  ? 6.839   -44.891 74.411  1.00 132.32 ? 896  ARG A CD    1 
ATOM   7793  N  NE    . ARG D 4  896  ? 8.005   -44.496 73.629  1.00 133.53 ? 896  ARG A NE    1 
ATOM   7794  C  CZ    . ARG D 4  896  ? 7.996   -43.533 72.718  1.00 140.37 ? 896  ARG A CZ    1 
ATOM   7795  N  NH1   . ARG D 4  896  ? 6.880   -42.864 72.467  1.00 144.76 ? 896  ARG A NH1   1 
ATOM   7796  N  NH2   . ARG D 4  896  ? 9.104   -43.239 72.056  1.00 143.94 ? 896  ARG A NH2   1 
ATOM   7797  N  N     . TYR D 4  897  ? 11.048  -48.658 75.800  1.00 83.16  ? 897  TYR A N     1 
ATOM   7798  C  CA    . TYR D 4  897  ? 12.283  -49.025 75.115  1.00 85.97  ? 897  TYR A CA    1 
ATOM   7799  C  C     . TYR D 4  897  ? 13.026  -50.227 75.699  1.00 96.76  ? 897  TYR A C     1 
ATOM   7800  O  O     . TYR D 4  897  ? 13.851  -50.817 74.989  1.00 79.85  ? 897  TYR A O     1 
ATOM   7801  C  CB    . TYR D 4  897  ? 13.251  -47.830 75.080  1.00 78.28  ? 897  TYR A CB    1 
ATOM   7802  C  CG    . TYR D 4  897  ? 12.821  -46.708 74.159  1.00 77.53  ? 897  TYR A CG    1 
ATOM   7803  C  CD1   . TYR D 4  897  ? 11.823  -45.818 74.534  1.00 99.02  ? 897  TYR A CD1   1 
ATOM   7804  C  CD2   . TYR D 4  897  ? 13.397  -46.547 72.912  1.00 87.79  ? 897  TYR A CD2   1 
ATOM   7805  C  CE1   . TYR D 4  897  ? 11.423  -44.788 73.697  1.00 111.25 ? 897  TYR A CE1   1 
ATOM   7806  C  CE2   . TYR D 4  897  ? 13.005  -45.516 72.065  1.00 111.14 ? 897  TYR A CE2   1 
ATOM   7807  C  CZ    . TYR D 4  897  ? 12.016  -44.642 72.464  1.00 112.63 ? 897  TYR A CZ    1 
ATOM   7808  O  OH    . TYR D 4  897  ? 11.618  -43.623 71.630  1.00 108.62 ? 897  TYR A OH    1 
ATOM   7809  N  N     . ARG D 4  898  ? 12.784  -50.603 76.953  1.00 109.14 ? 898  ARG A N     1 
ATOM   7810  C  CA    . ARG D 4  898  ? 13.484  -51.747 77.527  1.00 102.09 ? 898  ARG A CA    1 
ATOM   7811  C  C     . ARG D 4  898  ? 12.817  -53.033 77.061  1.00 95.54  ? 898  ARG A C     1 
ATOM   7812  O  O     . ARG D 4  898  ? 11.606  -53.216 77.239  1.00 87.41  ? 898  ARG A O     1 
ATOM   7813  C  CB    . ARG D 4  898  ? 13.508  -51.673 79.054  1.00 102.26 ? 898  ARG A CB    1 
ATOM   7814  C  CG    . ARG D 4  898  ? 14.113  -52.883 79.745  1.00 101.97 ? 898  ARG A CG    1 
ATOM   7815  C  CD    . ARG D 4  898  ? 15.548  -53.108 79.318  1.00 103.07 ? 898  ARG A CD    1 
ATOM   7816  N  NE    . ARG D 4  898  ? 16.318  -53.812 80.339  1.00 107.16 ? 898  ARG A NE    1 
ATOM   7817  C  CZ    . ARG D 4  898  ? 17.585  -54.179 80.188  1.00 108.67 ? 898  ARG A CZ    1 
ATOM   7818  N  NH1   . ARG D 4  898  ? 18.222  -53.914 79.053  1.00 90.19  ? 898  ARG A NH1   1 
ATOM   7819  N  NH2   . ARG D 4  898  ? 18.214  -54.819 81.166  1.00 122.59 ? 898  ARG A NH2   1 
ATOM   7820  N  N     . VAL D 4  899  ? 13.600  -53.911 76.445  1.00 92.50  ? 899  VAL A N     1 
ATOM   7821  C  CA    . VAL D 4  899  ? 13.193  -55.284 76.184  1.00 103.51 ? 899  VAL A CA    1 
ATOM   7822  C  C     . VAL D 4  899  ? 14.205  -56.180 76.882  1.00 113.06 ? 899  VAL A C     1 
ATOM   7823  O  O     . VAL D 4  899  ? 15.379  -56.225 76.489  1.00 110.98 ? 899  VAL A O     1 
ATOM   7824  C  CB    . VAL D 4  899  ? 13.113  -55.599 74.687  1.00 112.84 ? 899  VAL A CB    1 
ATOM   7825  C  CG1   . VAL D 4  899  ? 12.839  -57.078 74.484  1.00 132.83 ? 899  VAL A CG1   1 
ATOM   7826  C  CG2   . VAL D 4  899  ? 12.026  -54.776 74.040  1.00 110.67 ? 899  VAL A CG2   1 
ATOM   7827  N  N     . ASP D 4  900  ? 13.761  -56.873 77.929  1.00 115.18 ? 900  ASP A N     1 
ATOM   7828  C  CA    . ASP D 4  900  ? 14.595  -57.809 78.680  1.00 119.49 ? 900  ASP A CA    1 
ATOM   7829  C  C     . ASP D 4  900  ? 14.229  -59.209 78.191  1.00 109.08 ? 900  ASP A C     1 
ATOM   7830  O  O     . ASP D 4  900  ? 13.162  -59.731 78.520  1.00 105.65 ? 900  ASP A O     1 
ATOM   7831  C  CB    . ASP D 4  900  ? 14.375  -57.643 80.184  1.00 131.10 ? 900  ASP A CB    1 
ATOM   7832  C  CG    . ASP D 4  900  ? 15.557  -58.132 81.028  1.00 127.66 ? 900  ASP A CG    1 
ATOM   7833  O  OD1   . ASP D 4  900  ? 16.573  -58.577 80.456  1.00 129.36 ? 900  ASP A OD1   1 
ATOM   7834  O  OD2   . ASP D 4  900  ? 15.468  -58.067 82.275  1.00 116.26 ? 900  ASP A OD2   1 
ATOM   7835  N  N     . LEU D 4  901  ? 15.113  -59.803 77.379  1.00 111.28 ? 901  LEU A N     1 
ATOM   7836  C  CA    . LEU D 4  901  ? 14.922  -61.184 76.933  1.00 120.03 ? 901  LEU A CA    1 
ATOM   7837  C  C     . LEU D 4  901  ? 14.950  -62.168 78.094  1.00 121.86 ? 901  LEU A C     1 
ATOM   7838  O  O     . LEU D 4  901  ? 14.357  -63.250 78.006  1.00 117.31 ? 901  LEU A O     1 
ATOM   7839  C  CB    . LEU D 4  901  ? 16.000  -61.572 75.921  1.00 109.31 ? 901  LEU A CB    1 
ATOM   7840  C  CG    . LEU D 4  901  ? 15.976  -60.874 74.569  1.00 88.78  ? 901  LEU A CG    1 
ATOM   7841  C  CD1   . LEU D 4  901  ? 17.154  -61.346 73.724  1.00 87.23  ? 901  LEU A CD1   1 
ATOM   7842  C  CD2   . LEU D 4  901  ? 14.651  -61.131 73.872  1.00 91.76  ? 901  LEU A CD2   1 
ATOM   7843  N  N     . LEU D 4  902  ? 15.639  -61.820 79.177  1.00 116.24 ? 902  LEU A N     1 
ATOM   7844  C  CA    . LEU D 4  902  ? 15.787  -62.713 80.316  1.00 112.61 ? 902  LEU A CA    1 
ATOM   7845  C  C     . LEU D 4  902  ? 14.632  -62.609 81.306  1.00 123.21 ? 902  LEU A C     1 
ATOM   7846  O  O     . LEU D 4  902  ? 14.327  -63.592 81.992  1.00 142.91 ? 902  LEU A O     1 
ATOM   7847  C  CB    . LEU D 4  902  ? 17.121  -62.430 81.015  1.00 109.33 ? 902  LEU A CB    1 
ATOM   7848  C  CG    . LEU D 4  902  ? 18.280  -62.264 80.022  1.00 99.41  ? 902  LEU A CG    1 
ATOM   7849  C  CD1   . LEU D 4  902  ? 19.570  -61.853 80.722  1.00 109.66 ? 902  LEU A CD1   1 
ATOM   7850  C  CD2   . LEU D 4  902  ? 18.492  -63.526 79.194  1.00 94.04  ? 902  LEU A CD2   1 
ATOM   7851  N  N     . ASN D 4  903  ? 13.981  -61.452 81.397  1.00 121.41 ? 903  ASN A N     1 
ATOM   7852  C  CA    . ASN D 4  903  ? 12.806  -61.320 82.248  1.00 119.03 ? 903  ASN A CA    1 
ATOM   7853  C  C     . ASN D 4  903  ? 11.594  -61.957 81.575  1.00 107.18 ? 903  ASN A C     1 
ATOM   7854  O  O     . ASN D 4  903  ? 11.478  -61.979 80.348  1.00 102.02 ? 903  ASN A O     1 
ATOM   7855  C  CB    . ASN D 4  903  ? 12.533  -59.844 82.558  1.00 128.67 ? 903  ASN A CB    1 
ATOM   7856  C  CG    . ASN D 4  903  ? 11.440  -59.649 83.597  1.00 134.74 ? 903  ASN A CG    1 
ATOM   7857  O  OD1   . ASN D 4  903  ? 10.250  -59.774 83.303  1.00 141.38 ? 903  ASN A OD1   1 
ATOM   7858  N  ND2   . ASN D 4  903  ? 11.844  -59.355 84.826  1.00 130.10 ? 903  ASN A ND2   1 
ATOM   7859  N  N     . THR D 4  904  ? 10.687  -62.490 82.399  1.00 103.40 ? 904  THR A N     1 
ATOM   7860  C  CA    . THR D 4  904  ? 9.494   -63.141 81.865  1.00 108.71 ? 904  THR A CA    1 
ATOM   7861  C  C     . THR D 4  904  ? 8.509   -62.121 81.313  1.00 116.38 ? 904  THR A C     1 
ATOM   7862  O  O     . THR D 4  904  ? 7.892   -62.350 80.265  1.00 125.00 ? 904  THR A O     1 
ATOM   7863  C  CB    . THR D 4  904  ? 8.823   -63.989 82.946  1.00 120.71 ? 904  THR A CB    1 
ATOM   7864  O  OG1   . THR D 4  904  ? 9.801   -64.821 83.581  1.00 144.05 ? 904  THR A OG1   1 
ATOM   7865  C  CG2   . THR D 4  904  ? 7.729   -64.865 82.354  1.00 118.07 ? 904  THR A CG2   1 
ATOM   7866  N  N     . ASP D 4  905  ? 8.353   -60.989 81.999  1.00 114.58 ? 905  ASP A N     1 
ATOM   7867  C  CA    . ASP D 4  905  ? 7.336   -60.006 81.655  1.00 118.78 ? 905  ASP A CA    1 
ATOM   7868  C  C     . ASP D 4  905  ? 7.876   -58.840 80.835  1.00 118.47 ? 905  ASP A C     1 
ATOM   7869  O  O     . ASP D 4  905  ? 7.079   -58.073 80.279  1.00 123.67 ? 905  ASP A O     1 
ATOM   7870  C  CB    . ASP D 4  905  ? 6.672   -59.473 82.934  1.00 121.23 ? 905  ASP A CB    1 
ATOM   7871  C  CG    . ASP D 4  905  ? 5.901   -60.554 83.690  1.00 121.21 ? 905  ASP A CG    1 
ATOM   7872  O  OD1   . ASP D 4  905  ? 5.830   -61.701 83.196  1.00 117.07 ? 905  ASP A OD1   1 
ATOM   7873  O  OD2   . ASP D 4  905  ? 5.367   -60.257 84.781  1.00 120.76 ? 905  ASP A OD2   1 
ATOM   7874  N  N     . HIS D 4  906  ? 9.199   -58.688 80.735  1.00 117.24 ? 906  HIS A N     1 
ATOM   7875  C  CA    . HIS D 4  906  ? 9.805   -57.582 80.000  1.00 123.43 ? 906  HIS A CA    1 
ATOM   7876  C  C     . HIS D 4  906  ? 10.404  -58.026 78.665  1.00 111.15 ? 906  HIS A C     1 
ATOM   7877  O  O     . HIS D 4  906  ? 11.262  -57.334 78.107  1.00 93.44  ? 906  HIS A O     1 
ATOM   7878  C  CB    . HIS D 4  906  ? 10.855  -56.884 80.872  1.00 133.74 ? 906  HIS A CB    1 
ATOM   7879  C  CG    . HIS D 4  906  ? 10.276  -56.133 82.036  1.00 136.87 ? 906  HIS A CG    1 
ATOM   7880  N  ND1   . HIS D 4  906  ? 8.930   -56.143 82.334  1.00 138.30 ? 906  HIS A ND1   1 
ATOM   7881  C  CD2   . HIS D 4  906  ? 10.861  -55.340 82.966  1.00 135.99 ? 906  HIS A CD2   1 
ATOM   7882  C  CE1   . HIS D 4  906  ? 8.709   -55.392 83.398  1.00 138.19 ? 906  HIS A CE1   1 
ATOM   7883  N  NE2   . HIS D 4  906  ? 9.864   -54.893 83.801  1.00 139.11 ? 906  HIS A NE2   1 
ATOM   7884  N  N     . THR D 4  907  ? 9.957   -59.162 78.139  1.00 117.13 ? 907  THR A N     1 
ATOM   7885  C  CA    . THR D 4  907  ? 10.370  -59.666 76.838  1.00 112.27 ? 907  THR A CA    1 
ATOM   7886  C  C     . THR D 4  907  ? 9.309   -59.322 75.797  1.00 122.46 ? 907  THR A C     1 
ATOM   7887  O  O     . THR D 4  907  ? 8.149   -59.056 76.126  1.00 119.62 ? 907  THR A O     1 
ATOM   7888  C  CB    . THR D 4  907  ? 10.595  -61.186 76.902  1.00 101.48 ? 907  THR A CB    1 
ATOM   7889  O  OG1   . THR D 4  907  ? 11.242  -61.513 78.136  1.00 125.18 ? 907  THR A OG1   1 
ATOM   7890  C  CG2   . THR D 4  907  ? 11.479  -61.684 75.761  1.00 89.93  ? 907  THR A CG2   1 
ATOM   7891  N  N     . LEU D 4  908  ? 9.737   -59.285 74.537  1.00 130.41 ? 908  LEU A N     1 
ATOM   7892  C  CA    . LEU D 4  908  ? 8.825   -59.240 73.402  1.00 127.31 ? 908  LEU A CA    1 
ATOM   7893  C  C     . LEU D 4  908  ? 7.841   -60.400 73.460  1.00 130.94 ? 908  LEU A C     1 
ATOM   7894  O  O     . LEU D 4  908  ? 8.244   -61.565 73.539  1.00 154.40 ? 908  LEU A O     1 
ATOM   7895  C  CB    . LEU D 4  908  ? 9.626   -59.296 72.102  1.00 123.86 ? 908  LEU A CB    1 
ATOM   7896  C  CG    . LEU D 4  908  ? 10.549  -58.110 71.837  1.00 111.63 ? 908  LEU A CG    1 
ATOM   7897  C  CD1   . LEU D 4  908  ? 11.739  -58.542 71.001  1.00 104.48 ? 908  LEU A CD1   1 
ATOM   7898  C  CD2   . LEU D 4  908  ? 9.786   -56.974 71.165  1.00 116.97 ? 908  LEU A CD2   1 
ATOM   7899  N  N     . ASP D 4  909  ? 6.552   -60.069 73.442  1.00 109.99 ? 909  ASP A N     1 
ATOM   7900  C  CA    . ASP D 4  909  ? 5.506   -61.078 73.419  1.00 118.91 ? 909  ASP A CA    1 
ATOM   7901  C  C     . ASP D 4  909  ? 5.614   -61.898 72.131  1.00 117.60 ? 909  ASP A C     1 
ATOM   7902  O  O     . ASP D 4  909  ? 6.018   -61.376 71.087  1.00 123.66 ? 909  ASP A O     1 
ATOM   7903  C  CB    . ASP D 4  909  ? 4.138   -60.401 73.520  1.00 126.07 ? 909  ASP A CB    1 
ATOM   7904  C  CG    . ASP D 4  909  ? 3.096   -61.255 74.223  1.00 129.48 ? 909  ASP A CG    1 
ATOM   7905  O  OD1   . ASP D 4  909  ? 2.447   -62.087 73.554  1.00 131.61 ? 909  ASP A OD1   1 
ATOM   7906  O  OD2   . ASP D 4  909  ? 2.928   -61.093 75.450  1.00 128.15 ? 909  ASP A OD2   1 
ATOM   7907  N  N     . PRO D 4  910  ? 5.288   -63.195 72.180  1.00 116.58 ? 910  PRO A N     1 
ATOM   7908  C  CA    . PRO D 4  910  ? 5.318   -64.010 70.952  1.00 130.00 ? 910  PRO A CA    1 
ATOM   7909  C  C     . PRO D 4  910  ? 4.307   -63.592 69.886  1.00 144.06 ? 910  PRO A C     1 
ATOM   7910  O  O     . PRO D 4  910  ? 4.408   -64.073 68.749  1.00 150.29 ? 910  PRO A O     1 
ATOM   7911  C  CB    . PRO D 4  910  ? 5.034   -65.430 71.466  1.00 134.60 ? 910  PRO A CB    1 
ATOM   7912  C  CG    . PRO D 4  910  ? 4.404   -65.231 72.819  1.00 129.43 ? 910  PRO A CG    1 
ATOM   7913  C  CD    . PRO D 4  910  ? 5.087   -64.026 73.378  1.00 120.08 ? 910  PRO A CD    1 
ATOM   7914  N  N     . SER D 4  911  ? 3.342   -62.725 70.210  1.00 141.95 ? 911  SER A N     1 
ATOM   7915  C  CA    . SER D 4  911  ? 2.468   -62.145 69.197  1.00 132.63 ? 911  SER A CA    1 
ATOM   7916  C  C     . SER D 4  911  ? 3.187   -61.124 68.324  1.00 125.78 ? 911  SER A C     1 
ATOM   7917  O  O     . SER D 4  911  ? 2.674   -60.767 67.258  1.00 129.80 ? 911  SER A O     1 
ATOM   7918  C  CB    . SER D 4  911  ? 1.256   -61.491 69.864  1.00 132.76 ? 911  SER A CB    1 
ATOM   7919  O  OG    . SER D 4  911  ? 1.625   -60.308 70.555  1.00 128.52 ? 911  SER A OG    1 
ATOM   7920  N  N     . LEU D 4  912  ? 4.358   -60.650 68.750  1.00 114.11 ? 912  LEU A N     1 
ATOM   7921  C  CA    . LEU D 4  912  ? 5.112   -59.648 68.013  1.00 109.14 ? 912  LEU A CA    1 
ATOM   7922  C  C     . LEU D 4  912  ? 6.221   -60.240 67.148  1.00 108.36 ? 912  LEU A C     1 
ATOM   7923  O  O     . LEU D 4  912  ? 6.857   -59.496 66.394  1.00 107.43 ? 912  LEU A O     1 
ATOM   7924  C  CB    . LEU D 4  912  ? 5.717   -58.619 68.984  1.00 99.37  ? 912  LEU A CB    1 
ATOM   7925  C  CG    . LEU D 4  912  ? 4.857   -58.090 70.140  1.00 92.75  ? 912  LEU A CG    1 
ATOM   7926  C  CD1   . LEU D 4  912  ? 5.616   -57.018 70.908  1.00 87.86  ? 912  LEU A CD1   1 
ATOM   7927  C  CD2   . LEU D 4  912  ? 3.513   -57.546 69.654  1.00 97.72  ? 912  LEU A CD2   1 
ATOM   7928  N  N     . LEU D 4  913  ? 6.467   -61.546 67.231  1.00 116.61 ? 913  LEU A N     1 
ATOM   7929  C  CA    . LEU D 4  913  ? 7.550   -62.158 66.476  1.00 122.85 ? 913  LEU A CA    1 
ATOM   7930  C  C     . LEU D 4  913  ? 7.270   -63.633 66.225  1.00 121.65 ? 913  LEU A C     1 
ATOM   7931  O  O     . LEU D 4  913  ? 6.764   -64.341 67.100  1.00 115.48 ? 913  LEU A O     1 
ATOM   7932  C  CB    . LEU D 4  913  ? 8.892   -62.009 67.204  1.00 124.25 ? 913  LEU A CB    1 
ATOM   7933  C  CG    . LEU D 4  913  ? 9.942   -61.224 66.422  1.00 112.57 ? 913  LEU A CG    1 
ATOM   7934  C  CD1   . LEU D 4  913  ? 11.267  -61.181 67.170  1.00 92.21  ? 913  LEU A CD1   1 
ATOM   7935  C  CD2   . LEU D 4  913  ? 10.110  -61.841 65.041  1.00 122.17 ? 913  LEU A CD2   1 
ATOM   7936  N  N     . GLU D 4  914  ? 7.615   -64.087 65.015  1.00 123.30 ? 914  GLU A N     1 
ATOM   7937  C  CA    . GLU D 4  914  ? 7.686   -65.518 64.749  1.00 130.51 ? 914  GLU A CA    1 
ATOM   7938  C  C     . GLU D 4  914  ? 8.758   -66.173 65.604  1.00 151.21 ? 914  GLU A C     1 
ATOM   7939  O  O     . GLU D 4  914  ? 8.650   -67.358 65.945  1.00 170.46 ? 914  GLU A O     1 
ATOM   7940  C  CB    . GLU D 4  914  ? 7.971   -65.757 63.266  1.00 127.02 ? 914  GLU A CB    1 
ATOM   7941  C  CG    . GLU D 4  914  ? 6.810   -65.433 62.340  1.00 115.23 ? 914  GLU A CG    1 
ATOM   7942  C  CD    . GLU D 4  914  ? 7.212   -65.481 60.881  1.00 102.74 ? 914  GLU A CD    1 
ATOM   7943  O  OE1   . GLU D 4  914  ? 8.428   -65.532 60.599  1.00 101.42 ? 914  GLU A OE1   1 
ATOM   7944  O  OE2   . GLU D 4  914  ? 6.315   -65.459 60.014  1.00 105.06 ? 914  GLU A OE2   1 
ATOM   7945  N  N     . SER D 4  915  ? 9.797   -65.411 65.960  1.00 143.81 ? 915  SER A N     1 
ATOM   7946  C  CA    . SER D 4  915  ? 10.844  -65.838 66.878  1.00 137.89 ? 915  SER A CA    1 
ATOM   7947  C  C     . SER D 4  915  ? 10.532  -65.479 68.328  1.00 133.69 ? 915  SER A C     1 
ATOM   7948  O  O     . SER D 4  915  ? 11.460  -65.308 69.123  1.00 123.77 ? 915  SER A O     1 
ATOM   7949  C  CB    . SER D 4  915  ? 12.183  -65.223 66.464  1.00 120.38 ? 915  SER A CB    1 
ATOM   7950  O  OG    . SER D 4  915  ? 12.362  -65.271 65.060  1.00 117.19 ? 915  SER A OG    1 
ATOM   7951  N  N     . GLY D 4  916  ? 9.252   -65.356 68.690  1.00 133.67 ? 916  GLY A N     1 
ATOM   7952  C  CA    . GLY D 4  916  ? 8.908   -64.893 70.026  1.00 120.23 ? 916  GLY A CA    1 
ATOM   7953  C  C     . GLY D 4  916  ? 9.236   -65.897 71.117  1.00 123.73 ? 916  GLY A C     1 
ATOM   7954  O  O     . GLY D 4  916  ? 9.841   -65.545 72.134  1.00 126.63 ? 916  GLY A O     1 
ATOM   7955  N  N     . SER D 4  917  ? 8.847   -67.160 70.924  1.00 122.71 ? 917  SER A N     1 
ATOM   7956  C  CA    . SER D 4  917  ? 9.110   -68.178 71.936  1.00 112.42 ? 917  SER A CA    1 
ATOM   7957  C  C     . SER D 4  917  ? 10.560  -68.640 71.923  1.00 97.56  ? 917  SER A C     1 
ATOM   7958  O  O     . SER D 4  917  ? 11.108  -68.974 72.980  1.00 97.77  ? 917  SER A O     1 
ATOM   7959  C  CB    . SER D 4  917  ? 8.186   -69.380 71.732  1.00 124.38 ? 917  SER A CB    1 
ATOM   7960  O  OG    . SER D 4  917  ? 8.320   -69.915 70.426  1.00 138.15 ? 917  SER A OG    1 
ATOM   7961  N  N     . GLU D 4  918  ? 11.190  -68.669 70.746  1.00 98.76  ? 918  GLU A N     1 
ATOM   7962  C  CA    . GLU D 4  918  ? 12.574  -69.113 70.616  1.00 103.89 ? 918  GLU A CA    1 
ATOM   7963  C  C     . GLU D 4  918  ? 13.557  -68.136 71.258  1.00 108.25 ? 918  GLU A C     1 
ATOM   7964  O  O     . GLU D 4  918  ? 14.639  -68.554 71.688  1.00 113.08 ? 918  GLU A O     1 
ATOM   7965  C  CB    . GLU D 4  918  ? 12.893  -69.307 69.125  1.00 111.08 ? 918  GLU A CB    1 
ATOM   7966  C  CG    . GLU D 4  918  ? 14.308  -69.763 68.778  1.00 115.70 ? 918  GLU A CG    1 
ATOM   7967  C  CD    . GLU D 4  918  ? 14.602  -69.660 67.288  1.00 130.17 ? 918  GLU A CD    1 
ATOM   7968  O  OE1   . GLU D 4  918  ? 15.793  -69.620 66.918  1.00 133.57 ? 918  GLU A OE1   1 
ATOM   7969  O  OE2   . GLU D 4  918  ? 13.642  -69.592 66.488  1.00 133.55 ? 918  GLU A OE2   1 
ATOM   7970  N  N     . ILE D 4  919  ? 13.188  -66.853 71.369  1.00 108.07 ? 919  ILE A N     1 
ATOM   7971  C  CA    . ILE D 4  919  ? 14.122  -65.810 71.795  1.00 118.94 ? 919  ILE A CA    1 
ATOM   7972  C  C     . ILE D 4  919  ? 14.240  -65.671 73.311  1.00 122.56 ? 919  ILE A C     1 
ATOM   7973  O  O     . ILE D 4  919  ? 15.140  -64.957 73.785  1.00 116.93 ? 919  ILE A O     1 
ATOM   7974  C  CB    . ILE D 4  919  ? 13.723  -64.453 71.174  1.00 131.85 ? 919  ILE A CB    1 
ATOM   7975  C  CG1   . ILE D 4  919  ? 14.961  -63.623 70.836  1.00 135.74 ? 919  ILE A CG1   1 
ATOM   7976  C  CG2   . ILE D 4  919  ? 12.716  -63.694 72.051  1.00 136.04 ? 919  ILE A CG2   1 
ATOM   7977  C  CD1   . ILE D 4  919  ? 15.784  -64.260 69.747  1.00 144.10 ? 919  ILE A CD1   1 
ATOM   7978  N  N     . LEU D 4  920  ? 13.370  -66.327 74.084  1.00 132.33 ? 920  LEU A N     1 
ATOM   7979  C  CA    . LEU D 4  920  ? 13.420  -66.245 75.542  1.00 121.67 ? 920  LEU A CA    1 
ATOM   7980  C  C     . LEU D 4  920  ? 14.737  -66.798 76.080  1.00 111.63 ? 920  LEU A C     1 
ATOM   7981  O  O     . LEU D 4  920  ? 15.315  -67.739 75.529  1.00 117.76 ? 920  LEU A O     1 
ATOM   7982  C  CB    . LEU D 4  920  ? 12.248  -67.011 76.162  1.00 116.00 ? 920  LEU A CB    1 
ATOM   7983  C  CG    . LEU D 4  920  ? 11.254  -66.216 77.011  1.00 103.88 ? 920  LEU A CG    1 
ATOM   7984  C  CD1   . LEU D 4  920  ? 10.202  -67.138 77.606  1.00 105.59 ? 920  LEU A CD1   1 
ATOM   7985  C  CD2   . LEU D 4  920  ? 11.966  -65.451 78.109  1.00 94.19  ? 920  LEU A CD2   1 
ATOM   7986  N  N     . GLY D 4  921  ? 15.205  -66.207 77.176  1.00 103.88 ? 921  GLY A N     1 
ATOM   7987  C  CA    . GLY D 4  921  ? 16.574  -66.423 77.603  1.00 102.34 ? 921  GLY A CA    1 
ATOM   7988  C  C     . GLY D 4  921  ? 17.507  -65.793 76.591  1.00 117.38 ? 921  GLY A C     1 
ATOM   7989  O  O     . GLY D 4  921  ? 17.368  -64.602 76.288  1.00 137.16 ? 921  GLY A O     1 
ATOM   7990  N  N     . ASP D 4  922  ? 18.439  -66.587 76.051  1.00 116.45 ? 922  ASP A N     1 
ATOM   7991  C  CA    . ASP D 4  922  ? 19.301  -66.211 74.923  1.00 125.48 ? 922  ASP A CA    1 
ATOM   7992  C  C     . ASP D 4  922  ? 20.135  -64.967 75.257  1.00 134.74 ? 922  ASP A C     1 
ATOM   7993  O  O     . ASP D 4  922  ? 19.873  -63.854 74.789  1.00 145.90 ? 922  ASP A O     1 
ATOM   7994  C  CB    . ASP D 4  922  ? 18.483  -66.011 73.638  1.00 120.42 ? 922  ASP A CB    1 
ATOM   7995  C  CG    . ASP D 4  922  ? 19.300  -66.259 72.372  1.00 120.76 ? 922  ASP A CG    1 
ATOM   7996  O  OD1   . ASP D 4  922  ? 20.519  -65.989 72.369  1.00 117.95 ? 922  ASP A OD1   1 
ATOM   7997  O  OD2   . ASP D 4  922  ? 18.715  -66.725 71.369  1.00 123.97 ? 922  ASP A OD2   1 
ATOM   7998  N  N     . LEU D 4  923  ? 21.122  -65.196 76.132  1.00 128.58 ? 923  LEU A N     1 
ATOM   7999  C  CA    . LEU D 4  923  ? 22.056  -64.146 76.533  1.00 119.32 ? 923  LEU A CA    1 
ATOM   8000  C  C     . LEU D 4  923  ? 22.782  -63.532 75.338  1.00 118.22 ? 923  LEU A C     1 
ATOM   8001  O  O     . LEU D 4  923  ? 23.100  -62.334 75.349  1.00 134.48 ? 923  LEU A O     1 
ATOM   8002  C  CB    . LEU D 4  923  ? 23.084  -64.723 77.510  1.00 119.70 ? 923  LEU A CB    1 
ATOM   8003  C  CG    . LEU D 4  923  ? 22.594  -65.749 78.535  1.00 116.45 ? 923  LEU A CG    1 
ATOM   8004  C  CD1   . LEU D 4  923  ? 23.776  -66.504 79.119  1.00 111.32 ? 923  LEU A CD1   1 
ATOM   8005  C  CD2   . LEU D 4  923  ? 21.793  -65.087 79.637  1.00 127.39 ? 923  LEU A CD2   1 
ATOM   8006  N  N     . LYS D 4  924  ? 23.021  -64.330 74.290  1.00 106.58 ? 924  LYS A N     1 
ATOM   8007  C  CA    . LYS D 4  924  ? 23.807  -63.908 73.136  1.00 105.65 ? 924  LYS A CA    1 
ATOM   8008  C  C     . LYS D 4  924  ? 23.144  -62.797 72.327  1.00 111.24 ? 924  LYS A C     1 
ATOM   8009  O  O     . LYS D 4  924  ? 23.821  -62.147 71.520  1.00 104.85 ? 924  LYS A O     1 
ATOM   8010  C  CB    . LYS D 4  924  ? 24.072  -65.121 72.244  1.00 99.88  ? 924  LYS A CB    1 
ATOM   8011  C  CG    . LYS D 4  924  ? 25.426  -65.125 71.563  1.00 102.57 ? 924  LYS A CG    1 
ATOM   8012  C  CD    . LYS D 4  924  ? 25.643  -66.426 70.812  1.00 103.15 ? 924  LYS A CD    1 
ATOM   8013  C  CE    . LYS D 4  924  ? 25.562  -67.613 71.752  1.00 97.77  ? 924  LYS A CE    1 
ATOM   8014  N  NZ    . LYS D 4  924  ? 25.764  -68.888 71.020  1.00 108.46 ? 924  LYS A NZ    1 
ATOM   8015  N  N     . LEU D 4  925  ? 21.841  -62.569 72.508  1.00 113.62 ? 925  LEU A N     1 
ATOM   8016  C  CA    . LEU D 4  925  ? 21.159  -61.434 71.902  1.00 108.23 ? 925  LEU A CA    1 
ATOM   8017  C  C     . LEU D 4  925  ? 20.698  -60.406 72.924  1.00 111.59 ? 925  LEU A C     1 
ATOM   8018  O  O     . LEU D 4  925  ? 20.510  -59.232 72.568  1.00 131.25 ? 925  LEU A O     1 
ATOM   8019  C  CB    . LEU D 4  925  ? 19.956  -61.913 71.075  1.00 111.47 ? 925  LEU A CB    1 
ATOM   8020  C  CG    . LEU D 4  925  ? 20.294  -62.879 69.934  1.00 114.89 ? 925  LEU A CG    1 
ATOM   8021  C  CD1   . LEU D 4  925  ? 19.110  -63.046 69.019  1.00 121.52 ? 925  LEU A CD1   1 
ATOM   8022  C  CD2   . LEU D 4  925  ? 21.501  -62.402 69.136  1.00 125.41 ? 925  LEU A CD2   1 
ATOM   8023  N  N     . GLN D 4  926  ? 20.531  -60.813 74.185  1.00 98.83  ? 926  GLN A N     1 
ATOM   8024  C  CA    . GLN D 4  926  ? 20.290  -59.847 75.246  1.00 103.45 ? 926  GLN A CA    1 
ATOM   8025  C  C     . GLN D 4  926  ? 21.502  -58.949 75.471  1.00 101.30 ? 926  GLN A C     1 
ATOM   8026  O  O     . GLN D 4  926  ? 21.331  -57.805 75.905  1.00 110.92 ? 926  GLN A O     1 
ATOM   8027  C  CB    . GLN D 4  926  ? 19.882  -60.571 76.537  1.00 110.60 ? 926  GLN A CB    1 
ATOM   8028  C  CG    . GLN D 4  926  ? 19.520  -59.653 77.699  1.00 105.22 ? 926  GLN A CG    1 
ATOM   8029  C  CD    . GLN D 4  926  ? 18.483  -58.614 77.311  1.00 93.48  ? 926  GLN A CD    1 
ATOM   8030  O  OE1   . GLN D 4  926  ? 17.299  -58.909 77.214  1.00 85.82  ? 926  GLN A OE1   1 
ATOM   8031  N  NE2   . GLN D 4  926  ? 18.929  -57.382 77.111  1.00 112.43 ? 926  GLN A NE2   1 
ATOM   8032  N  N     . VAL D 4  927  ? 22.711  -59.411 75.125  1.00 100.48 ? 927  VAL A N     1 
ATOM   8033  C  CA    . VAL D 4  927  ? 23.878  -58.526 75.166  1.00 116.17 ? 927  VAL A CA    1 
ATOM   8034  C  C     . VAL D 4  927  ? 23.738  -57.396 74.139  1.00 125.85 ? 927  VAL A C     1 
ATOM   8035  O  O     . VAL D 4  927  ? 24.042  -56.230 74.432  1.00 125.37 ? 927  VAL A O     1 
ATOM   8036  C  CB    . VAL D 4  927  ? 25.180  -59.337 74.979  1.00 120.24 ? 927  VAL A CB    1 
ATOM   8037  C  CG1   . VAL D 4  927  ? 25.108  -60.252 73.770  1.00 113.76 ? 927  VAL A CG1   1 
ATOM   8038  C  CG2   . VAL D 4  927  ? 26.403  -58.419 74.892  1.00 122.46 ? 927  VAL A CG2   1 
ATOM   8039  N  N     . LEU D 4  928  ? 23.227  -57.712 72.941  1.00 124.61 ? 928  LEU A N     1 
ATOM   8040  C  CA    . LEU D 4  928  ? 23.009  -56.687 71.919  1.00 100.91 ? 928  LEU A CA    1 
ATOM   8041  C  C     . LEU D 4  928  ? 21.880  -55.741 72.306  1.00 86.68  ? 928  LEU A C     1 
ATOM   8042  O  O     . LEU D 4  928  ? 21.967  -54.531 72.061  1.00 106.87 ? 928  LEU A O     1 
ATOM   8043  C  CB    . LEU D 4  928  ? 22.707  -57.337 70.571  1.00 104.73 ? 928  LEU A CB    1 
ATOM   8044  C  CG    . LEU D 4  928  ? 23.877  -58.020 69.864  1.00 119.29 ? 928  LEU A CG    1 
ATOM   8045  C  CD1   . LEU D 4  928  ? 23.418  -58.603 68.532  1.00 120.10 ? 928  LEU A CD1   1 
ATOM   8046  C  CD2   . LEU D 4  928  ? 25.031  -57.038 69.671  1.00 117.51 ? 928  LEU A CD2   1 
ATOM   8047  N  N     . LEU D 4  929  ? 20.813  -56.276 72.909  1.00 81.87  ? 929  LEU A N     1 
ATOM   8048  C  CA    . LEU D 4  929  ? 19.728  -55.416 73.387  1.00 85.07  ? 929  LEU A CA    1 
ATOM   8049  C  C     . LEU D 4  929  ? 20.193  -54.484 74.509  1.00 110.64 ? 929  LEU A C     1 
ATOM   8050  O  O     . LEU D 4  929  ? 19.784  -53.315 74.566  1.00 113.65 ? 929  LEU A O     1 
ATOM   8051  C  CB    . LEU D 4  929  ? 18.548  -56.265 73.858  1.00 82.36  ? 929  LEU A CB    1 
ATOM   8052  C  CG    . LEU D 4  929  ? 17.737  -57.044 72.819  1.00 82.93  ? 929  LEU A CG    1 
ATOM   8053  C  CD1   . LEU D 4  929  ? 16.292  -57.121 73.263  1.00 83.42  ? 929  LEU A CD1   1 
ATOM   8054  C  CD2   . LEU D 4  929  ? 17.823  -56.433 71.429  1.00 97.58  ? 929  LEU A CD2   1 
ATOM   8055  N  N     . ASP D 4  930  ? 21.055  -54.979 75.406  1.00 118.40 ? 930  ASP A N     1 
ATOM   8056  C  CA    . ASP D 4  930  ? 21.588  -54.139 76.476  1.00 113.98 ? 930  ASP A CA    1 
ATOM   8057  C  C     . ASP D 4  930  ? 22.544  -53.084 75.934  1.00 125.16 ? 930  ASP A C     1 
ATOM   8058  O  O     . ASP D 4  930  ? 22.573  -51.955 76.436  1.00 140.90 ? 930  ASP A O     1 
ATOM   8059  C  CB    . ASP D 4  930  ? 22.285  -55.000 77.534  1.00 116.65 ? 930  ASP A CB    1 
ATOM   8060  C  CG    . ASP D 4  930  ? 21.305  -55.678 78.480  1.00 117.23 ? 930  ASP A CG    1 
ATOM   8061  O  OD1   . ASP D 4  930  ? 20.172  -55.172 78.613  1.00 117.39 ? 930  ASP A OD1   1 
ATOM   8062  O  OD2   . ASP D 4  930  ? 21.665  -56.705 79.099  1.00 107.92 ? 930  ASP A OD2   1 
ATOM   8063  N  N     . GLU D 4  931  ? 23.329  -53.428 74.905  1.00 123.97 ? 931  GLU A N     1 
ATOM   8064  C  CA    . GLU D 4  931  ? 24.187  -52.433 74.262  1.00 124.02 ? 931  GLU A CA    1 
ATOM   8065  C  C     . GLU D 4  931  ? 23.358  -51.345 73.583  1.00 104.27 ? 931  GLU A C     1 
ATOM   8066  O  O     . GLU D 4  931  ? 23.681  -50.151 73.681  1.00 100.97 ? 931  GLU A O     1 
ATOM   8067  C  CB    . GLU D 4  931  ? 25.110  -53.116 73.251  1.00 135.05 ? 931  GLU A CB    1 
ATOM   8068  C  CG    . GLU D 4  931  ? 25.865  -52.154 72.345  1.00 148.12 ? 931  GLU A CG    1 
ATOM   8069  C  CD    . GLU D 4  931  ? 26.776  -52.865 71.366  1.00 166.35 ? 931  GLU A CD    1 
ATOM   8070  O  OE1   . GLU D 4  931  ? 27.395  -53.876 71.757  1.00 172.47 ? 931  GLU A OE1   1 
ATOM   8071  O  OE2   . GLU D 4  931  ? 26.872  -52.415 70.204  1.00 172.39 ? 931  GLU A OE2   1 
ATOM   8072  N  N     . GLU D 4  932  ? 22.270  -51.744 72.910  1.00 92.90  ? 932  GLU A N     1 
ATOM   8073  C  CA    . GLU D 4  932  ? 21.354  -50.784 72.295  1.00 95.41  ? 932  GLU A CA    1 
ATOM   8074  C  C     . GLU D 4  932  ? 20.734  -49.860 73.338  1.00 112.81 ? 932  GLU A C     1 
ATOM   8075  O  O     . GLU D 4  932  ? 20.697  -48.636 73.155  1.00 133.26 ? 932  GLU A O     1 
ATOM   8076  C  CB    . GLU D 4  932  ? 20.262  -51.528 71.522  1.00 81.55  ? 932  GLU A CB    1 
ATOM   8077  C  CG    . GLU D 4  932  ? 18.998  -50.705 71.270  1.00 85.45  ? 932  GLU A CG    1 
ATOM   8078  C  CD    . GLU D 4  932  ? 17.919  -51.481 70.523  1.00 92.57  ? 932  GLU A CD    1 
ATOM   8079  O  OE1   . GLU D 4  932  ? 18.233  -52.053 69.456  1.00 87.67  ? 932  GLU A OE1   1 
ATOM   8080  O  OE2   . GLU D 4  932  ? 16.755  -51.497 70.981  1.00 78.34  ? 932  GLU A OE2   1 
ATOM   8081  N  N     . TYR D 4  933  ? 20.256  -50.433 74.449  1.00 102.21 ? 933  TYR A N     1 
ATOM   8082  C  CA    . TYR D 4  933  ? 19.630  -49.634 75.503  1.00 90.02  ? 933  TYR A CA    1 
ATOM   8083  C  C     . TYR D 4  933  ? 20.637  -48.709 76.184  1.00 93.27  ? 933  TYR A C     1 
ATOM   8084  O  O     . TYR D 4  933  ? 20.296  -47.578 76.546  1.00 95.10  ? 933  TYR A O     1 
ATOM   8085  C  CB    . TYR D 4  933  ? 18.954  -50.556 76.522  1.00 87.79  ? 933  TYR A CB    1 
ATOM   8086  C  CG    . TYR D 4  933  ? 18.016  -49.844 77.481  1.00 79.15  ? 933  TYR A CG    1 
ATOM   8087  C  CD1   . TYR D 4  933  ? 16.658  -49.756 77.215  1.00 95.27  ? 933  TYR A CD1   1 
ATOM   8088  C  CD2   . TYR D 4  933  ? 18.482  -49.288 78.664  1.00 79.30  ? 933  TYR A CD2   1 
ATOM   8089  C  CE1   . TYR D 4  933  ? 15.795  -49.104 78.087  1.00 92.93  ? 933  TYR A CE1   1 
ATOM   8090  C  CE2   . TYR D 4  933  ? 17.622  -48.641 79.543  1.00 95.17  ? 933  TYR A CE2   1 
ATOM   8091  C  CZ    . TYR D 4  933  ? 16.278  -48.556 79.248  1.00 86.81  ? 933  TYR A CZ    1 
ATOM   8092  O  OH    . TYR D 4  933  ? 15.410  -47.920 80.107  1.00 89.02  ? 933  TYR A OH    1 
ATOM   8093  N  N     . LYS D 4  934  ? 21.884  -49.161 76.356  1.00 108.05 ? 934  LYS A N     1 
ATOM   8094  C  CA    . LYS D 4  934  ? 22.908  -48.295 76.938  1.00 117.98 ? 934  LYS A CA    1 
ATOM   8095  C  C     . LYS D 4  934  ? 23.276  -47.153 75.997  1.00 117.53 ? 934  LYS A C     1 
ATOM   8096  O  O     . LYS D 4  934  ? 23.547  -46.036 76.460  1.00 128.34 ? 934  LYS A O     1 
ATOM   8097  C  CB    . LYS D 4  934  ? 24.146  -49.120 77.311  1.00 122.81 ? 934  LYS A CB    1 
ATOM   8098  C  CG    . LYS D 4  934  ? 23.991  -49.926 78.605  1.00 120.34 ? 934  LYS A CG    1 
ATOM   8099  C  CD    . LYS D 4  934  ? 25.195  -50.820 78.872  1.00 118.29 ? 934  LYS A CD    1 
ATOM   8100  C  CE    . LYS D 4  934  ? 24.959  -51.699 80.095  1.00 112.62 ? 934  LYS A CE    1 
ATOM   8101  N  NZ    . LYS D 4  934  ? 26.081  -52.649 80.351  1.00 102.47 ? 934  LYS A NZ    1 
ATOM   8102  N  N     . GLN D 4  935  ? 23.253  -47.400 74.679  1.00 102.79 ? 935  GLN A N     1 
ATOM   8103  C  CA    . GLN D 4  935  ? 23.491  -46.313 73.727  1.00 95.92  ? 935  GLN A CA    1 
ATOM   8104  C  C     . GLN D 4  935  ? 22.323  -45.326 73.676  1.00 83.25  ? 935  GLN A C     1 
ATOM   8105  O  O     . GLN D 4  935  ? 22.544  -44.122 73.501  1.00 74.13  ? 935  GLN A O     1 
ATOM   8106  C  CB    . GLN D 4  935  ? 23.774  -46.864 72.327  1.00 88.62  ? 935  GLN A CB    1 
ATOM   8107  C  CG    . GLN D 4  935  ? 24.405  -45.826 71.398  1.00 86.24  ? 935  GLN A CG    1 
ATOM   8108  C  CD    . GLN D 4  935  ? 25.741  -45.322 71.910  1.00 97.41  ? 935  GLN A CD    1 
ATOM   8109  O  OE1   . GLN D 4  935  ? 26.551  -46.094 72.425  1.00 107.81 ? 935  GLN A OE1   1 
ATOM   8110  N  NE2   . GLN D 4  935  ? 25.961  -44.012 71.808  1.00 93.75  ? 935  GLN A NE2   1 
ATOM   8111  N  N     . LEU D 4  936  ? 21.084  -45.806 73.847  1.00 75.10  ? 936  LEU A N     1 
ATOM   8112  C  CA    . LEU D 4  936  ? 19.944  -44.889 73.956  1.00 86.02  ? 936  LEU A CA    1 
ATOM   8113  C  C     . LEU D 4  936  ? 19.990  -44.078 75.253  1.00 102.04 ? 936  LEU A C     1 
ATOM   8114  O  O     . LEU D 4  936  ? 19.579  -42.911 75.274  1.00 111.71 ? 936  LEU A O     1 
ATOM   8115  C  CB    . LEU D 4  936  ? 18.618  -45.653 73.864  1.00 78.31  ? 936  LEU A CB    1 
ATOM   8116  C  CG    . LEU D 4  936  ? 18.312  -46.599 72.697  1.00 75.41  ? 936  LEU A CG    1 
ATOM   8117  C  CD1   . LEU D 4  936  ? 16.842  -46.958 72.657  1.00 75.87  ? 936  LEU A CD1   1 
ATOM   8118  C  CD2   . LEU D 4  936  ? 18.761  -46.035 71.359  1.00 86.55  ? 936  LEU A CD2   1 
ATOM   8119  N  N     . VAL D 4  937  ? 20.474  -44.682 76.345  1.00 102.36 ? 937  VAL A N     1 
ATOM   8120  C  CA    . VAL D 4  937  ? 20.635  -43.949 77.601  1.00 103.87 ? 937  VAL A CA    1 
ATOM   8121  C  C     . VAL D 4  937  ? 21.699  -42.861 77.453  1.00 100.91 ? 937  VAL A C     1 
ATOM   8122  O  O     . VAL D 4  937  ? 21.495  -41.710 77.866  1.00 94.76  ? 937  VAL A O     1 
ATOM   8123  C  CB    . VAL D 4  937  ? 20.962  -44.925 78.750  1.00 94.32  ? 937  VAL A CB    1 
ATOM   8124  C  CG1   . VAL D 4  937  ? 21.551  -44.197 79.967  1.00 115.77 ? 937  VAL A CG1   1 
ATOM   8125  C  CG2   . VAL D 4  937  ? 19.713  -45.700 79.154  1.00 77.59  ? 937  VAL A CG2   1 
ATOM   8126  N  N     . LYS D 4  938  ? 22.846  -43.213 76.851  1.00 101.38 ? 938  LYS A N     1 
ATOM   8127  C  CA    . LYS D 4  938  ? 23.879  -42.222 76.544  1.00 102.87 ? 938  LYS A CA    1 
ATOM   8128  C  C     . LYS D 4  938  ? 23.345  -41.127 75.623  1.00 112.43 ? 938  LYS A C     1 
ATOM   8129  O  O     . LYS D 4  938  ? 23.676  -39.945 75.789  1.00 125.26 ? 938  LYS A O     1 
ATOM   8130  C  CB    . LYS D 4  938  ? 25.099  -42.916 75.925  1.00 84.84  ? 938  LYS A CB    1 
ATOM   8131  C  CG    . LYS D 4  938  ? 26.047  -42.000 75.142  1.00 82.87  ? 938  LYS A CG    1 
ATOM   8132  C  CD    . LYS D 4  938  ? 27.384  -42.665 74.840  1.00 94.04  ? 938  LYS A CD    1 
ATOM   8133  C  CE    . LYS D 4  938  ? 28.216  -42.815 76.109  1.00 109.99 ? 938  LYS A CE    1 
ATOM   8134  N  NZ    . LYS D 4  938  ? 29.642  -43.171 75.847  1.00 109.46 ? 938  LYS A NZ    1 
ATOM   8135  N  N     . ASP D 4  939  ? 22.482  -41.496 74.673  1.00 104.87 ? 939  ASP A N     1 
ATOM   8136  C  CA    . ASP D 4  939  ? 21.898  -40.510 73.772  1.00 101.77 ? 939  ASP A CA    1 
ATOM   8137  C  C     . ASP D 4  939  ? 20.969  -39.555 74.510  1.00 97.42  ? 939  ASP A C     1 
ATOM   8138  O  O     . ASP D 4  939  ? 20.997  -38.350 74.254  1.00 107.58 ? 939  ASP A O     1 
ATOM   8139  C  CB    . ASP D 4  939  ? 21.149  -41.210 72.644  1.00 108.55 ? 939  ASP A CB    1 
ATOM   8140  C  CG    . ASP D 4  939  ? 22.057  -41.591 71.498  1.00 114.10 ? 939  ASP A CG    1 
ATOM   8141  O  OD1   . ASP D 4  939  ? 23.248  -41.204 71.531  1.00 98.20  ? 939  ASP A OD1   1 
ATOM   8142  O  OD2   . ASP D 4  939  ? 21.574  -42.246 70.552  1.00 72.26  ? 939  ASP A OD2   1 
ATOM   8143  N  N     . ARG D 4  940  ? 20.135  -40.071 75.419  1.00 91.80  ? 940  ARG A N     1 
ATOM   8144  C  CA    . ARG D 4  940  ? 19.260  -39.199 76.204  1.00 88.24  ? 940  ARG A CA    1 
ATOM   8145  C  C     . ARG D 4  940  ? 20.060  -38.279 77.122  1.00 99.90  ? 940  ARG A C     1 
ATOM   8146  O  O     . ARG D 4  940  ? 19.706  -37.104 77.295  1.00 87.28  ? 940  ARG A O     1 
ATOM   8147  C  CB    . ARG D 4  940  ? 18.270  -40.026 77.024  1.00 78.78  ? 940  ARG A CB    1 
ATOM   8148  C  CG    . ARG D 4  940  ? 17.257  -39.165 77.768  1.00 74.90  ? 940  ARG A CG    1 
ATOM   8149  C  CD    . ARG D 4  940  ? 16.510  -39.918 78.860  1.00 75.90  ? 940  ARG A CD    1 
ATOM   8150  N  NE    . ARG D 4  940  ? 15.079  -39.613 78.848  1.00 76.17  ? 940  ARG A NE    1 
ATOM   8151  C  CZ    . ARG D 4  940  ? 14.274  -39.752 79.900  1.00 77.09  ? 940  ARG A CZ    1 
ATOM   8152  N  NH1   . ARG D 4  940  ? 14.754  -40.182 81.059  1.00 95.83  ? 940  ARG A NH1   1 
ATOM   8153  N  NH2   . ARG D 4  940  ? 12.986  -39.450 79.800  1.00 77.38  ? 940  ARG A NH2   1 
ATOM   8154  N  N     . LYS D 4  941  ? 21.135  -38.801 77.724  1.00 119.66 ? 941  LYS A N     1 
ATOM   8155  C  CA    . LYS D 4  941  ? 22.036  -37.960 78.513  1.00 130.34 ? 941  LYS A CA    1 
ATOM   8156  C  C     . LYS D 4  941  ? 22.622  -36.838 77.663  1.00 113.83 ? 941  LYS A C     1 
ATOM   8157  O  O     . LYS D 4  941  ? 22.627  -35.668 78.071  1.00 128.99 ? 941  LYS A O     1 
ATOM   8158  C  CB    . LYS D 4  941  ? 23.152  -38.814 79.119  1.00 138.87 ? 941  LYS A CB    1 
ATOM   8159  C  CG    . LYS D 4  941  ? 24.387  -38.024 79.538  1.00 142.37 ? 941  LYS A CG    1 
ATOM   8160  C  CD    . LYS D 4  941  ? 24.262  -37.510 80.961  1.00 144.42 ? 941  LYS A CD    1 
ATOM   8161  C  CE    . LYS D 4  941  ? 24.394  -38.647 81.960  1.00 142.77 ? 941  LYS A CE    1 
ATOM   8162  N  NZ    . LYS D 4  941  ? 24.283  -38.178 83.369  1.00 138.09 ? 941  LYS A NZ    1 
ATOM   8163  N  N     . PHE D 4  942  ? 23.085  -37.182 76.456  1.00 89.57  ? 942  PHE A N     1 
ATOM   8164  C  CA    . PHE D 4  942  ? 23.663  -36.203 75.537  1.00 86.76  ? 942  PHE A CA    1 
ATOM   8165  C  C     . PHE D 4  942  ? 22.645  -35.137 75.137  1.00 79.28  ? 942  PHE A C     1 
ATOM   8166  O  O     . PHE D 4  942  ? 22.950  -33.937 75.128  1.00 93.59  ? 942  PHE A O     1 
ATOM   8167  C  CB    . PHE D 4  942  ? 24.203  -36.931 74.301  1.00 89.59  ? 942  PHE A CB    1 
ATOM   8168  C  CG    . PHE D 4  942  ? 24.789  -36.019 73.259  1.00 78.27  ? 942  PHE A CG    1 
ATOM   8169  C  CD1   . PHE D 4  942  ? 26.095  -35.571 73.372  1.00 86.24  ? 942  PHE A CD1   1 
ATOM   8170  C  CD2   . PHE D 4  942  ? 24.040  -35.622 72.161  1.00 70.81  ? 942  PHE A CD2   1 
ATOM   8171  C  CE1   . PHE D 4  942  ? 26.638  -34.732 72.417  1.00 100.19 ? 942  PHE A CE1   1 
ATOM   8172  C  CE2   . PHE D 4  942  ? 24.579  -34.782 71.206  1.00 93.00  ? 942  PHE A CE2   1 
ATOM   8173  C  CZ    . PHE D 4  942  ? 25.878  -34.338 71.334  1.00 106.37 ? 942  PHE A CZ    1 
ATOM   8174  N  N     . LEU D 4  943  ? 21.426  -35.563 74.804  1.00 77.16  ? 943  LEU A N     1 
ATOM   8175  C  CA    . LEU D 4  943  ? 20.408  -34.627 74.334  1.00 74.60  ? 943  LEU A CA    1 
ATOM   8176  C  C     . LEU D 4  943  ? 19.930  -33.710 75.454  1.00 72.18  ? 943  LEU A C     1 
ATOM   8177  O  O     . LEU D 4  943  ? 19.722  -32.511 75.232  1.00 76.45  ? 943  LEU A O     1 
ATOM   8178  C  CB    . LEU D 4  943  ? 19.233  -35.389 73.721  1.00 71.58  ? 943  LEU A CB    1 
ATOM   8179  C  CG    . LEU D 4  943  ? 19.489  -36.213 72.458  1.00 75.49  ? 943  LEU A CG    1 
ATOM   8180  C  CD1   . LEU D 4  943  ? 18.259  -37.017 72.063  1.00 71.31  ? 943  LEU A CD1   1 
ATOM   8181  C  CD2   . LEU D 4  943  ? 19.952  -35.325 71.324  1.00 81.50  ? 943  LEU A CD2   1 
ATOM   8182  N  N     . ARG D 4  944  ? 19.753  -34.245 76.663  1.00 72.97  ? 944  ARG A N     1 
ATOM   8183  C  CA    . ARG D 4  944  ? 19.381  -33.382 77.775  1.00 73.61  ? 944  ARG A CA    1 
ATOM   8184  C  C     . ARG D 4  944  ? 20.521  -32.445 78.156  1.00 73.72  ? 944  ARG A C     1 
ATOM   8185  O  O     . ARG D 4  944  ? 20.264  -31.339 78.646  1.00 74.04  ? 944  ARG A O     1 
ATOM   8186  C  CB    . ARG D 4  944  ? 18.938  -34.224 78.967  1.00 79.30  ? 944  ARG A CB    1 
ATOM   8187  C  CG    . ARG D 4  944  ? 17.598  -34.908 78.748  1.00 82.88  ? 944  ARG A CG    1 
ATOM   8188  C  CD    . ARG D 4  944  ? 16.897  -35.148 80.066  1.00 87.68  ? 944  ARG A CD    1 
ATOM   8189  N  NE    . ARG D 4  944  ? 15.576  -35.739 79.889  1.00 79.45  ? 944  ARG A NE    1 
ATOM   8190  C  CZ    . ARG D 4  944  ? 14.737  -35.987 80.890  1.00 105.22 ? 944  ARG A CZ    1 
ATOM   8191  N  NH1   . ARG D 4  944  ? 15.076  -35.691 82.138  1.00 115.46 ? 944  ARG A NH1   1 
ATOM   8192  N  NH2   . ARG D 4  944  ? 13.549  -36.525 80.645  1.00 120.09 ? 944  ARG A NH2   1 
ATOM   8193  N  N     . GLU D 4  945  ? 21.774  -32.856 77.920  1.00 94.63  ? 945  GLU A N     1 
ATOM   8194  C  CA    . GLU D 4  945  ? 22.892  -31.927 78.062  1.00 102.79 ? 945  GLU A CA    1 
ATOM   8195  C  C     . GLU D 4  945  ? 22.804  -30.794 77.048  1.00 106.00 ? 945  GLU A C     1 
ATOM   8196  O  O     . GLU D 4  945  ? 23.056  -29.632 77.388  1.00 127.85 ? 945  GLU A O     1 
ATOM   8197  C  CB    . GLU D 4  945  ? 24.230  -32.659 77.913  1.00 112.02 ? 945  GLU A CB    1 
ATOM   8198  C  CG    . GLU D 4  945  ? 24.735  -33.353 79.173  1.00 130.83 ? 945  GLU A CG    1 
ATOM   8199  C  CD    . GLU D 4  945  ? 26.208  -33.716 79.082  1.00 143.13 ? 945  GLU A CD    1 
ATOM   8200  O  OE1   . GLU D 4  945  ? 26.868  -33.286 78.109  1.00 143.44 ? 945  GLU A OE1   1 
ATOM   8201  O  OE2   . GLU D 4  945  ? 26.709  -34.419 79.986  1.00 146.20 ? 945  GLU A OE2   1 
ATOM   8202  N  N     . VAL D 4  946  ? 22.444  -31.108 75.804  1.00 97.30  ? 946  VAL A N     1 
ATOM   8203  C  CA    . VAL D 4  946  ? 22.447  -30.093 74.750  1.00 97.68  ? 946  VAL A CA    1 
ATOM   8204  C  C     . VAL D 4  946  ? 21.221  -29.188 74.856  1.00 105.21 ? 946  VAL A C     1 
ATOM   8205  O  O     . VAL D 4  946  ? 21.337  -27.963 74.981  1.00 98.56  ? 946  VAL A O     1 
ATOM   8206  C  CB    . VAL D 4  946  ? 22.543  -30.756 73.362  1.00 76.15  ? 946  VAL A CB    1 
ATOM   8207  C  CG1   . VAL D 4  946  ? 22.334  -29.728 72.268  1.00 70.08  ? 946  VAL A CG1   1 
ATOM   8208  C  CG2   . VAL D 4  946  ? 23.895  -31.434 73.187  1.00 74.31  ? 946  VAL A CG2   1 
ATOM   8209  N  N     . PHE D 4  947  ? 20.025  -29.778 74.810  1.00 109.78 ? 947  PHE A N     1 
ATOM   8210  C  CA    . PHE D 4  947  ? 18.777  -29.015 74.785  1.00 99.58  ? 947  PHE A CA    1 
ATOM   8211  C  C     . PHE D 4  947  ? 18.245  -28.933 76.215  1.00 109.94 ? 947  PHE A C     1 
ATOM   8212  O  O     . PHE D 4  947  ? 17.352  -29.675 76.629  1.00 119.23 ? 947  PHE A O     1 
ATOM   8213  C  CB    . PHE D 4  947  ? 17.790  -29.658 73.816  1.00 88.58  ? 947  PHE A CB    1 
ATOM   8214  C  CG    . PHE D 4  947  ? 18.294  -29.691 72.401  1.00 85.74  ? 947  PHE A CG    1 
ATOM   8215  C  CD1   . PHE D 4  947  ? 18.852  -30.841 71.876  1.00 78.76  ? 947  PHE A CD1   1 
ATOM   8216  C  CD2   . PHE D 4  947  ? 18.267  -28.551 71.616  1.00 99.97  ? 947  PHE A CD2   1 
ATOM   8217  C  CE1   . PHE D 4  947  ? 19.341  -30.859 70.579  1.00 90.16  ? 947  PHE A CE1   1 
ATOM   8218  C  CE2   . PHE D 4  947  ? 18.749  -28.566 70.313  1.00 85.19  ? 947  PHE A CE2   1 
ATOM   8219  C  CZ    . PHE D 4  947  ? 19.289  -29.716 69.800  1.00 88.76  ? 947  PHE A CZ    1 
ATOM   8220  N  N     . VAL D 4  948  ? 18.817  -27.988 76.970  1.00 106.66 ? 948  VAL A N     1 
ATOM   8221  C  CA    . VAL D 4  948  ? 18.615  -27.911 78.415  1.00 93.06  ? 948  VAL A CA    1 
ATOM   8222  C  C     . VAL D 4  948  ? 17.182  -27.522 78.759  1.00 90.22  ? 948  VAL A C     1 
ATOM   8223  O  O     . VAL D 4  948  ? 16.631  -27.991 79.765  1.00 87.91  ? 948  VAL A O     1 
ATOM   8224  C  CB    . VAL D 4  948  ? 19.635  -26.931 79.028  1.00 86.79  ? 948  VAL A CB    1 
ATOM   8225  C  CG1   . VAL D 4  948  ? 19.680  -27.063 80.543  1.00 95.16  ? 948  VAL A CG1   1 
ATOM   8226  C  CG2   . VAL D 4  948  ? 21.016  -27.176 78.431  1.00 74.10  ? 948  VAL A CG2   1 
ATOM   8227  N  N     . ASP D 4  949  ? 16.543  -26.686 77.934  1.00 88.08  ? 949  ASP A N     1 
ATOM   8228  C  CA    . ASP D 4  949  ? 15.146  -26.336 78.176  1.00 91.26  ? 949  ASP A CA    1 
ATOM   8229  C  C     . ASP D 4  949  ? 14.211  -27.525 77.985  1.00 92.21  ? 949  ASP A C     1 
ATOM   8230  O  O     . ASP D 4  949  ? 13.084  -27.500 78.494  1.00 99.13  ? 949  ASP A O     1 
ATOM   8231  C  CB    . ASP D 4  949  ? 14.729  -25.163 77.276  1.00 97.14  ? 949  ASP A CB    1 
ATOM   8232  C  CG    . ASP D 4  949  ? 15.196  -25.326 75.839  1.00 102.45 ? 949  ASP A CG    1 
ATOM   8233  O  OD1   . ASP D 4  949  ? 16.341  -25.783 75.628  1.00 100.74 ? 949  ASP A OD1   1 
ATOM   8234  O  OD2   . ASP D 4  949  ? 14.423  -24.981 74.919  1.00 102.12 ? 949  ASP A OD2   1 
ATOM   8235  N  N     . GLY D 4  950  ? 14.660  -28.570 77.291  1.00 85.65  ? 950  GLY A N     1 
ATOM   8236  C  CA    . GLY D 4  950  ? 13.878  -29.768 77.099  1.00 85.14  ? 950  GLY A CA    1 
ATOM   8237  C  C     . GLY D 4  950  ? 12.982  -29.776 75.883  1.00 114.34 ? 950  GLY A C     1 
ATOM   8238  O  O     . GLY D 4  950  ? 12.092  -30.631 75.803  1.00 119.92 ? 950  GLY A O     1 
ATOM   8239  N  N     . GLU D 4  951  ? 13.166  -28.849 74.945  1.00 137.09 ? 951  GLU A N     1 
ATOM   8240  C  CA    . GLU D 4  951  ? 12.379  -28.872 73.719  1.00 130.72 ? 951  GLU A CA    1 
ATOM   8241  C  C     . GLU D 4  951  ? 12.837  -30.023 72.834  1.00 123.90 ? 951  GLU A C     1 
ATOM   8242  O  O     . GLU D 4  951  ? 14.035  -30.190 72.584  1.00 119.23 ? 951  GLU A O     1 
ATOM   8243  C  CB    . GLU D 4  951  ? 12.497  -27.543 72.972  1.00 117.48 ? 951  GLU A CB    1 
ATOM   8244  C  CG    . GLU D 4  951  ? 11.445  -27.364 71.887  1.00 109.74 ? 951  GLU A CG    1 
ATOM   8245  C  CD    . GLU D 4  951  ? 10.042  -27.235 72.453  1.00 114.70 ? 951  GLU A CD    1 
ATOM   8246  O  OE1   . GLU D 4  951  ? 9.641   -26.109 72.816  1.00 122.92 ? 951  GLU A OE1   1 
ATOM   8247  O  OE2   . GLU D 4  951  ? 9.345   -28.268 72.556  1.00 107.37 ? 951  GLU A OE2   1 
ATOM   8248  N  N     . ALA D 4  952  ? 11.881  -30.831 72.376  1.00 116.96 ? 952  ALA A N     1 
ATOM   8249  C  CA    . ALA D 4  952  ? 12.183  -31.991 71.548  1.00 107.07 ? 952  ALA A CA    1 
ATOM   8250  C  C     . ALA D 4  952  ? 12.043  -31.723 70.056  1.00 108.24 ? 952  ALA A C     1 
ATOM   8251  O  O     . ALA D 4  952  ? 12.801  -32.291 69.263  1.00 111.71 ? 952  ALA A O     1 
ATOM   8252  C  CB    . ALA D 4  952  ? 11.280  -33.168 71.936  1.00 101.68 ? 952  ALA A CB    1 
ATOM   8253  N  N     . ASN D 4  953  ? 11.097  -30.873 69.658  1.00 99.12  ? 953  ASN A N     1 
ATOM   8254  C  CA    . ASN D 4  953  ? 10.870  -30.556 68.248  1.00 81.09  ? 953  ASN A CA    1 
ATOM   8255  C  C     . ASN D 4  953  ? 12.000  -29.668 67.738  1.00 76.50  ? 953  ASN A C     1 
ATOM   8256  O  O     . ASN D 4  953  ? 12.144  -28.525 68.185  1.00 96.10  ? 953  ASN A O     1 
ATOM   8257  C  CB    . ASN D 4  953  ? 9.521   -29.862 68.082  1.00 82.23  ? 953  ASN A CB    1 
ATOM   8258  C  CG    . ASN D 4  953  ? 8.440   -30.449 68.982  1.00 76.07  ? 953  ASN A CG    1 
ATOM   8259  O  OD1   . ASN D 4  953  ? 8.444   -31.644 69.283  1.00 72.42  ? 953  ASN A OD1   1 
ATOM   8260  N  ND2   . ASN D 4  953  ? 7.518   -29.601 69.431  1.00 72.76  ? 953  ASN A ND2   1 
ATOM   8261  N  N     . TRP D 4  954  ? 12.796  -30.181 66.799  1.00 80.84  ? 954  TRP A N     1 
ATOM   8262  C  CA    . TRP D 4  954  ? 13.961  -29.470 66.287  1.00 89.57  ? 954  TRP A CA    1 
ATOM   8263  C  C     . TRP D 4  954  ? 14.124  -29.720 64.794  1.00 104.39 ? 954  TRP A C     1 
ATOM   8264  O  O     . TRP D 4  954  ? 13.746  -30.786 64.294  1.00 110.36 ? 954  TRP A O     1 
ATOM   8265  C  CB    . TRP D 4  954  ? 15.239  -29.875 67.048  1.00 80.83  ? 954  TRP A CB    1 
ATOM   8266  C  CG    . TRP D 4  954  ? 15.236  -29.285 68.423  1.00 90.40  ? 954  TRP A CG    1 
ATOM   8267  C  CD1   . TRP D 4  954  ? 14.858  -29.899 69.580  1.00 102.32 ? 954  TRP A CD1   1 
ATOM   8268  C  CD2   . TRP D 4  954  ? 15.537  -27.928 68.772  1.00 102.18 ? 954  TRP A CD2   1 
ATOM   8269  N  NE1   . TRP D 4  954  ? 14.948  -29.021 70.635  1.00 109.69 ? 954  TRP A NE1   1 
ATOM   8270  C  CE2   . TRP D 4  954  ? 15.354  -27.802 70.163  1.00 109.23 ? 954  TRP A CE2   1 
ATOM   8271  C  CE3   . TRP D 4  954  ? 15.958  -26.811 68.045  1.00 104.71 ? 954  TRP A CE3   1 
ATOM   8272  C  CZ2   . TRP D 4  954  ? 15.581  -26.606 70.841  1.00 113.93 ? 954  TRP A CZ2   1 
ATOM   8273  C  CZ3   . TRP D 4  954  ? 16.179  -25.627 68.721  1.00 116.34 ? 954  TRP A CZ3   1 
ATOM   8274  C  CH2   . TRP D 4  954  ? 15.996  -25.534 70.104  1.00 117.66 ? 954  TRP A CH2   1 
ATOM   8275  N  N     . PRO D 4  955  ? 14.643  -28.739 64.051  1.00 115.65 ? 955  PRO A N     1 
ATOM   8276  C  CA    . PRO D 4  955  ? 14.803  -28.911 62.596  1.00 100.64 ? 955  PRO A CA    1 
ATOM   8277  C  C     . PRO D 4  955  ? 15.943  -29.872 62.281  1.00 80.14  ? 955  PRO A C     1 
ATOM   8278  O  O     . PRO D 4  955  ? 17.108  -29.613 62.589  1.00 66.91  ? 955  PRO A O     1 
ATOM   8279  C  CB    . PRO D 4  955  ? 15.099  -27.489 62.100  1.00 110.31 ? 955  PRO A CB    1 
ATOM   8280  C  CG    . PRO D 4  955  ? 15.669  -26.789 63.288  1.00 130.37 ? 955  PRO A CG    1 
ATOM   8281  C  CD    . PRO D 4  955  ? 14.952  -27.360 64.476  1.00 135.82 ? 955  PRO A CD    1 
ATOM   8282  N  N     . LEU D 4  956  ? 15.593  -30.985 61.657  1.00 93.01  ? 956  LEU A N     1 
ATOM   8283  C  CA    . LEU D 4  956  ? 16.516  -32.049 61.308  1.00 95.58  ? 956  LEU A CA    1 
ATOM   8284  C  C     . LEU D 4  956  ? 16.213  -32.572 59.909  1.00 89.40  ? 956  LEU A C     1 
ATOM   8285  O  O     . LEU D 4  956  ? 15.149  -32.290 59.347  1.00 67.41  ? 956  LEU A O     1 
ATOM   8286  C  CB    . LEU D 4  956  ? 16.429  -33.185 62.333  1.00 86.86  ? 956  LEU A CB    1 
ATOM   8287  C  CG    . LEU D 4  956  ? 17.333  -33.020 63.545  1.00 86.37  ? 956  LEU A CG    1 
ATOM   8288  C  CD1   . LEU D 4  956  ? 16.955  -34.012 64.631  1.00 107.38 ? 956  LEU A CD1   1 
ATOM   8289  C  CD2   . LEU D 4  956  ? 18.777  -33.211 63.103  1.00 78.82  ? 956  LEU A CD2   1 
ATOM   8290  N  N     . PRO D 4  957  ? 17.121  -33.343 59.327  1.00 87.63  ? 957  PRO A N     1 
ATOM   8291  C  CA    . PRO D 4  957  ? 16.817  -34.089 58.099  1.00 67.48  ? 957  PRO A CA    1 
ATOM   8292  C  C     . PRO D 4  957  ? 15.827  -35.223 58.309  1.00 70.33  ? 957  PRO A C     1 
ATOM   8293  O  O     . PRO D 4  957  ? 15.070  -35.240 59.285  1.00 82.74  ? 957  PRO A O     1 
ATOM   8294  C  CB    . PRO D 4  957  ? 18.188  -34.616 57.671  1.00 69.48  ? 957  PRO A CB    1 
ATOM   8295  C  CG    . PRO D 4  957  ? 19.088  -33.580 58.137  1.00 88.58  ? 957  PRO A CG    1 
ATOM   8296  C  CD    . PRO D 4  957  ? 18.570  -33.117 59.457  1.00 104.09 ? 957  PRO A CD    1 
ATOM   8297  N  N     . VAL D 4  958  ? 15.889  -36.194 57.398  1.00 68.48  ? 958  VAL A N     1 
ATOM   8298  C  CA    . VAL D 4  958  ? 14.816  -37.019 56.847  1.00 70.83  ? 958  VAL A CA    1 
ATOM   8299  C  C     . VAL D 4  958  ? 13.664  -37.341 57.793  1.00 69.61  ? 958  VAL A C     1 
ATOM   8300  O  O     . VAL D 4  958  ? 13.870  -37.894 58.878  1.00 79.46  ? 958  VAL A O     1 
ATOM   8301  C  CB    . VAL D 4  958  ? 15.451  -38.339 56.381  1.00 88.30  ? 958  VAL A CB    1 
ATOM   8302  C  CG1   . VAL D 4  958  ? 14.444  -39.204 55.666  1.00 128.18 ? 958  VAL A CG1   1 
ATOM   8303  C  CG2   . VAL D 4  958  ? 16.715  -38.074 55.571  1.00 69.24  ? 958  VAL A CG2   1 
ATOM   8304  N  N     . ASN D 4  959  ? 12.439  -37.031 57.360  1.00 69.92  ? 959  ASN A N     1 
ATOM   8305  C  CA    . ASN D 4  959  ? 11.258  -37.220 58.194  1.00 81.09  ? 959  ASN A CA    1 
ATOM   8306  C  C     . ASN D 4  959  ? 10.952  -38.708 58.304  1.00 92.86  ? 959  ASN A C     1 
ATOM   8307  O  O     . ASN D 4  959  ? 10.795  -39.395 57.290  1.00 109.16 ? 959  ASN A O     1 
ATOM   8308  C  CB    . ASN D 4  959  ? 10.066  -36.463 57.603  1.00 70.99  ? 959  ASN A CB    1 
ATOM   8309  C  CG    . ASN D 4  959  ? 8.844   -36.464 58.518  1.00 78.79  ? 959  ASN A CG    1 
ATOM   8310  O  OD1   . ASN D 4  959  ? 8.144   -37.471 58.649  1.00 90.68  ? 959  ASN A OD1   1 
ATOM   8311  N  ND2   . ASN D 4  959  ? 8.578   -35.324 59.144  1.00 80.68  ? 959  ASN A ND2   1 
ATOM   8312  N  N     . ILE D 4  960  ? 10.883  -39.209 59.535  1.00 84.73  ? 960  ILE A N     1 
ATOM   8313  C  CA    . ILE D 4  960  ? 10.697  -40.637 59.747  1.00 72.38  ? 960  ILE A CA    1 
ATOM   8314  C  C     . ILE D 4  960  ? 9.229   -41.000 59.969  1.00 74.31  ? 960  ILE A C     1 
ATOM   8315  O  O     . ILE D 4  960  ? 8.836   -42.140 59.684  1.00 99.59  ? 960  ILE A O     1 
ATOM   8316  C  CB    . ILE D 4  960  ? 11.614  -41.094 60.901  1.00 76.41  ? 960  ILE A CB    1 
ATOM   8317  C  CG1   . ILE D 4  960  ? 13.021  -40.528 60.673  1.00 71.39  ? 960  ILE A CG1   1 
ATOM   8318  C  CG2   . ILE D 4  960  ? 11.684  -42.613 61.022  1.00 73.05  ? 960  ILE A CG2   1 
ATOM   8319  C  CD1   . ILE D 4  960  ? 14.112  -41.144 61.526  1.00 71.37  ? 960  ILE A CD1   1 
ATOM   8320  N  N     . ARG D 4  961  ? 8.401   -40.061 60.441  1.00 74.31  ? 961  ARG A N     1 
ATOM   8321  C  CA    . ARG D 4  961  ? 6.964   -40.320 60.536  1.00 75.74  ? 961  ARG A CA    1 
ATOM   8322  C  C     . ARG D 4  961  ? 6.370   -40.587 59.159  1.00 90.96  ? 961  ARG A C     1 
ATOM   8323  O  O     . ARG D 4  961  ? 5.599   -41.539 58.970  1.00 90.58  ? 961  ARG A O     1 
ATOM   8324  C  CB    . ARG D 4  961  ? 6.245   -39.142 61.201  1.00 75.99  ? 961  ARG A CB    1 
ATOM   8325  C  CG    . ARG D 4  961  ? 6.324   -39.092 62.722  1.00 99.53  ? 961  ARG A CG    1 
ATOM   8326  C  CD    . ARG D 4  961  ? 7.343   -38.066 63.180  1.00 114.87 ? 961  ARG A CD    1 
ATOM   8327  N  NE    . ARG D 4  961  ? 6.738   -36.763 63.436  1.00 123.20 ? 961  ARG A NE    1 
ATOM   8328  C  CZ    . ARG D 4  961  ? 7.427   -35.684 63.792  1.00 106.41 ? 961  ARG A CZ    1 
ATOM   8329  N  NH1   . ARG D 4  961  ? 8.739   -35.768 63.943  1.00 71.65  ? 961  ARG A NH1   1 
ATOM   8330  N  NH2   . ARG D 4  961  ? 6.807   -34.525 63.994  1.00 72.35  ? 961  ARG A NH2   1 
ATOM   8331  N  N     . ARG D 4  962  ? 6.744   -39.764 58.177  1.00 105.07 ? 962  ARG A N     1 
ATOM   8332  C  CA    . ARG D 4  962  ? 6.239   -39.949 56.822  1.00 102.49 ? 962  ARG A CA    1 
ATOM   8333  C  C     . ARG D 4  962  ? 6.780   -41.232 56.202  1.00 108.06 ? 962  ARG A C     1 
ATOM   8334  O  O     . ARG D 4  962  ? 6.048   -41.929 55.495  1.00 130.36 ? 962  ARG A O     1 
ATOM   8335  C  CB    . ARG D 4  962  ? 6.592   -38.739 55.954  1.00 102.07 ? 962  ARG A CB    1 
ATOM   8336  C  CG    . ARG D 4  962  ? 5.769   -37.484 56.239  1.00 108.60 ? 962  ARG A CG    1 
ATOM   8337  C  CD    . ARG D 4  962  ? 5.748   -36.531 55.047  1.00 99.96  ? 962  ARG A CD    1 
ATOM   8338  N  NE    . ARG D 4  962  ? 6.934   -35.677 54.982  1.00 98.34  ? 962  ARG A NE    1 
ATOM   8339  C  CZ    . ARG D 4  962  ? 8.008   -35.939 54.240  1.00 106.45 ? 962  ARG A CZ    1 
ATOM   8340  N  NH1   . ARG D 4  962  ? 8.053   -37.030 53.483  1.00 106.06 ? 962  ARG A NH1   1 
ATOM   8341  N  NH2   . ARG D 4  962  ? 9.035   -35.106 54.238  1.00 70.81  ? 962  ARG A NH2   1 
ATOM   8342  N  N     . ILE D 4  963  ? 8.044   -41.576 56.481  1.00 86.25  ? 963  ILE A N     1 
ATOM   8343  C  CA    . ILE D 4  963  ? 8.615   -42.817 55.952  1.00 83.14  ? 963  ILE A CA    1 
ATOM   8344  C  C     . ILE D 4  963  ? 7.908   -44.033 56.547  1.00 91.92  ? 963  ILE A C     1 
ATOM   8345  O  O     . ILE D 4  963  ? 7.587   -44.993 55.833  1.00 97.17  ? 963  ILE A O     1 
ATOM   8346  C  CB    . ILE D 4  963  ? 10.140  -42.860 56.191  1.00 74.17  ? 963  ILE A CB    1 
ATOM   8347  C  CG1   . ILE D 4  963  ? 10.875  -41.971 55.184  1.00 73.41  ? 963  ILE A CG1   1 
ATOM   8348  C  CG2   . ILE D 4  963  ? 10.686  -44.294 56.105  1.00 74.88  ? 963  ILE A CG2   1 
ATOM   8349  C  CD1   . ILE D 4  963  ? 12.381  -42.164 55.173  1.00 72.90  ? 963  ILE A CD1   1 
ATOM   8350  N  N     . ILE D 4  964  ? 7.610   -43.994 57.847  1.00 98.16  ? 964  ILE A N     1 
ATOM   8351  C  CA    . ILE D 4  964  ? 6.947   -45.126 58.496  1.00 96.88  ? 964  ILE A CA    1 
ATOM   8352  C  C     . ILE D 4  964  ? 5.502   -45.251 58.022  1.00 105.37 ? 964  ILE A C     1 
ATOM   8353  O  O     . ILE D 4  964  ? 5.013   -46.364 57.786  1.00 114.71 ? 964  ILE A O     1 
ATOM   8354  C  CB    . ILE D 4  964  ? 7.067   -45.013 60.035  1.00 93.23  ? 964  ILE A CB    1 
ATOM   8355  C  CG1   . ILE D 4  964  ? 8.287   -45.790 60.565  1.00 82.37  ? 964  ILE A CG1   1 
ATOM   8356  C  CG2   . ILE D 4  964  ? 5.803   -45.502 60.771  1.00 78.01  ? 964  ILE A CG2   1 
ATOM   8357  C  CD1   . ILE D 4  964  ? 9.632   -45.459 59.940  1.00 75.79  ? 964  ILE A CD1   1 
ATOM   8358  N  N     . GLN D 4  965  ? 4.808   -44.124 57.824  1.00 94.01  ? 965  GLN A N     1 
ATOM   8359  C  CA    . GLN D 4  965  ? 3.434   -44.198 57.324  1.00 98.17  ? 965  GLN A CA    1 
ATOM   8360  C  C     . GLN D 4  965  ? 3.398   -44.652 55.864  1.00 99.16  ? 965  GLN A C     1 
ATOM   8361  O  O     . GLN D 4  965  ? 2.496   -45.399 55.458  1.00 80.87  ? 965  GLN A O     1 
ATOM   8362  C  CB    . GLN D 4  965  ? 2.739   -42.849 57.503  1.00 118.02 ? 965  GLN A CB    1 
ATOM   8363  C  CG    . GLN D 4  965  ? 1.220   -42.944 57.576  1.00 146.52 ? 965  GLN A CG    1 
ATOM   8364  C  CD    . GLN D 4  965  ? 0.582   -41.690 58.148  1.00 154.20 ? 965  GLN A CD    1 
ATOM   8365  O  OE1   . GLN D 4  965  ? 1.221   -40.931 58.877  1.00 149.89 ? 965  GLN A OE1   1 
ATOM   8366  N  NE2   . GLN D 4  965  ? -0.693  -41.476 57.833  1.00 152.03 ? 965  GLN A NE2   1 
ATOM   8367  N  N     . ASN D 4  966  ? 4.394   -44.234 55.069  1.00 115.48 ? 966  ASN A N     1 
ATOM   8368  C  CA    . ASN D 4  966  ? 4.515   -44.700 53.691  1.00 112.86 ? 966  ASN A CA    1 
ATOM   8369  C  C     . ASN D 4  966  ? 4.863   -46.181 53.630  1.00 119.57 ? 966  ASN A C     1 
ATOM   8370  O  O     . ASN D 4  966  ? 4.464   -46.867 52.687  1.00 132.24 ? 966  ASN A O     1 
ATOM   8371  C  CB    . ASN D 4  966  ? 5.580   -43.889 52.947  1.00 103.84 ? 966  ASN A CB    1 
ATOM   8372  C  CG    . ASN D 4  966  ? 5.148   -42.458 52.673  1.00 105.08 ? 966  ASN A CG    1 
ATOM   8373  O  OD1   . ASN D 4  966  ? 4.071   -42.029 53.089  1.00 103.10 ? 966  ASN A OD1   1 
ATOM   8374  N  ND2   . ASN D 4  966  ? 5.993   -41.710 51.977  1.00 114.84 ? 966  ASN A ND2   1 
ATOM   8375  N  N     . ALA D 4  967  ? 5.610   -46.685 54.615  1.00 101.06 ? 967  ALA A N     1 
ATOM   8376  C  CA    . ALA D 4  967  ? 5.908   -48.112 54.661  1.00 83.43  ? 967  ALA A CA    1 
ATOM   8377  C  C     . ALA D 4  967  ? 4.693   -48.913 55.113  1.00 87.68  ? 967  ALA A C     1 
ATOM   8378  O  O     . ALA D 4  967  ? 4.470   -50.033 54.637  1.00 105.98 ? 967  ALA A O     1 
ATOM   8379  C  CB    . ALA D 4  967  ? 7.102   -48.370 55.578  1.00 79.96  ? 967  ALA A CB    1 
ATOM   8380  N  N     . GLN D 4  968  ? 3.895   -48.354 56.031  1.00 88.84  ? 968  GLN A N     1 
ATOM   8381  C  CA    . GLN D 4  968  ? 2.648   -49.000 56.435  1.00 106.12 ? 968  GLN A CA    1 
ATOM   8382  C  C     . GLN D 4  968  ? 1.631   -49.028 55.303  1.00 131.05 ? 968  GLN A C     1 
ATOM   8383  O  O     . GLN D 4  968  ? 0.806   -49.949 55.235  1.00 143.06 ? 968  GLN A O     1 
ATOM   8384  C  CB    . GLN D 4  968  ? 2.043   -48.287 57.646  1.00 104.27 ? 968  GLN A CB    1 
ATOM   8385  C  CG    . GLN D 4  968  ? 2.784   -48.493 58.951  1.00 116.77 ? 968  GLN A CG    1 
ATOM   8386  C  CD    . GLN D 4  968  ? 2.073   -47.833 60.115  1.00 130.34 ? 968  GLN A CD    1 
ATOM   8387  O  OE1   . GLN D 4  968  ? 0.846   -47.886 60.219  1.00 147.97 ? 968  GLN A OE1   1 
ATOM   8388  N  NE2   . GLN D 4  968  ? 2.839   -47.187 60.989  1.00 118.54 ? 968  GLN A NE2   1 
ATOM   8389  N  N     . GLN D 4  969  ? 1.654   -48.031 54.419  1.00 129.72 ? 969  GLN A N     1 
ATOM   8390  C  CA    . GLN D 4  969  ? 0.691   -48.036 53.322  1.00 111.00 ? 969  GLN A CA    1 
ATOM   8391  C  C     . GLN D 4  969  ? 1.193   -48.819 52.109  1.00 111.67 ? 969  GLN A C     1 
ATOM   8392  O  O     . GLN D 4  969  ? 0.405   -49.537 51.482  1.00 123.92 ? 969  GLN A O     1 
ATOM   8393  C  CB    . GLN D 4  969  ? 0.327   -46.591 52.946  1.00 91.97  ? 969  GLN A CB    1 
ATOM   8394  C  CG    . GLN D 4  969  ? -1.121  -46.439 52.468  1.00 91.05  ? 969  GLN A CG    1 
ATOM   8395  C  CD    . GLN D 4  969  ? -1.253  -46.309 50.964  1.00 108.23 ? 969  GLN A CD    1 
ATOM   8396  O  OE1   . GLN D 4  969  ? -0.349  -45.814 50.289  1.00 107.31 ? 969  GLN A OE1   1 
ATOM   8397  N  NE2   . GLN D 4  969  ? -2.364  -46.801 50.423  1.00 122.21 ? 969  GLN A NE2   1 
ATOM   8398  N  N     . THR D 4  970  ? 2.489   -48.709 51.780  1.00 100.33 ? 970  THR A N     1 
ATOM   8399  C  CA    . THR D 4  970  ? 3.087   -49.376 50.624  1.00 111.61 ? 970  THR A CA    1 
ATOM   8400  C  C     . THR D 4  970  ? 3.009   -50.887 50.778  1.00 116.93 ? 970  THR A C     1 
ATOM   8401  O  O     . THR D 4  970  ? 2.335   -51.572 50.000  1.00 126.74 ? 970  THR A O     1 
ATOM   8402  C  CB    . THR D 4  970  ? 4.555   -48.950 50.442  1.00 102.83 ? 970  THR A CB    1 
ATOM   8403  O  OG1   . THR D 4  970  ? 4.653   -47.519 50.441  1.00 109.46 ? 970  THR A OG1   1 
ATOM   8404  C  CG2   . THR D 4  970  ? 5.125   -49.496 49.131  1.00 105.14 ? 970  THR A CG2   1 
ATOM   8405  N  N     . PHE D 4  971  ? 3.704   -51.405 51.785  1.00 112.84 ? 971  PHE A N     1 
ATOM   8406  C  CA    . PHE D 4  971  ? 3.510   -52.771 52.255  1.00 113.28 ? 971  PHE A CA    1 
ATOM   8407  C  C     . PHE D 4  971  ? 2.356   -52.741 53.249  1.00 130.62 ? 971  PHE A C     1 
ATOM   8408  O  O     . PHE D 4  971  ? 2.484   -52.157 54.330  1.00 153.62 ? 971  PHE A O     1 
ATOM   8409  C  CB    . PHE D 4  971  ? 4.789   -53.304 52.899  1.00 98.58  ? 971  PHE A CB    1 
ATOM   8410  C  CG    . PHE D 4  971  ? 6.057   -52.871 52.200  1.00 93.64  ? 971  PHE A CG    1 
ATOM   8411  C  CD1   . PHE D 4  971  ? 6.747   -51.738 52.609  1.00 92.20  ? 971  PHE A CD1   1 
ATOM   8412  C  CD2   . PHE D 4  971  ? 6.562   -53.600 51.135  1.00 101.71 ? 971  PHE A CD2   1 
ATOM   8413  C  CE1   . PHE D 4  971  ? 7.909   -51.343 51.965  1.00 84.69  ? 971  PHE A CE1   1 
ATOM   8414  C  CE2   . PHE D 4  971  ? 7.727   -53.205 50.492  1.00 97.13  ? 971  PHE A CE2   1 
ATOM   8415  C  CZ    . PHE D 4  971  ? 8.395   -52.079 50.909  1.00 84.02  ? 971  PHE A CZ    1 
ATOM   8416  N  N     . HIS D 4  972  ? 1.219   -53.333 52.880  1.00 129.45 ? 972  HIS A N     1 
ATOM   8417  C  CA    . HIS D 4  972  ? 0.017   -53.229 53.701  1.00 135.34 ? 972  HIS A CA    1 
ATOM   8418  C  C     . HIS D 4  972  ? 0.218   -53.991 55.009  1.00 145.50 ? 972  HIS A C     1 
ATOM   8419  O  O     . HIS D 4  972  ? 0.456   -55.203 55.006  1.00 145.90 ? 972  HIS A O     1 
ATOM   8420  C  CB    . HIS D 4  972  ? -1.198  -53.738 52.928  1.00 142.96 ? 972  HIS A CB    1 
ATOM   8421  C  CG    . HIS D 4  972  ? -1.798  -52.713 52.009  1.00 151.21 ? 972  HIS A CG    1 
ATOM   8422  N  ND1   . HIS D 4  972  ? -2.998  -52.087 52.273  1.00 152.90 ? 972  HIS A ND1   1 
ATOM   8423  C  CD2   . HIS D 4  972  ? -1.354  -52.193 50.839  1.00 151.37 ? 972  HIS A CD2   1 
ATOM   8424  C  CE1   . HIS D 4  972  ? -3.271  -51.233 51.302  1.00 149.53 ? 972  HIS A CE1   1 
ATOM   8425  N  NE2   . HIS D 4  972  ? -2.288  -51.277 50.421  1.00 147.86 ? 972  HIS A NE2   1 
ATOM   8426  N  N     . ILE D 4  973  ? 0.143   -53.263 56.124  1.00 148.09 ? 973  ILE A N     1 
ATOM   8427  C  CA    . ILE D 4  973  ? 0.597   -53.729 57.430  1.00 137.66 ? 973  ILE A CA    1 
ATOM   8428  C  C     . ILE D 4  973  ? -0.622  -54.083 58.269  1.00 142.21 ? 973  ILE A C     1 
ATOM   8429  O  O     . ILE D 4  973  ? -1.555  -53.280 58.396  1.00 128.31 ? 973  ILE A O     1 
ATOM   8430  C  CB    . ILE D 4  973  ? 1.470   -52.665 58.127  1.00 111.55 ? 973  ILE A CB    1 
ATOM   8431  C  CG1   . ILE D 4  973  ? 2.897   -52.675 57.563  1.00 86.23  ? 973  ILE A CG1   1 
ATOM   8432  C  CG2   . ILE D 4  973  ? 1.492   -52.840 59.646  1.00 125.96 ? 973  ILE A CG2   1 
ATOM   8433  C  CD1   . ILE D 4  973  ? 3.550   -54.046 57.521  1.00 89.44  ? 973  ILE A CD1   1 
ATOM   8434  N  N     . ASP D 4  974  ? -0.620  -55.292 58.821  1.00 159.38 ? 974  ASP A N     1 
ATOM   8435  C  CA    . ASP D 4  974  ? -1.637  -55.733 59.760  1.00 165.54 ? 974  ASP A CA    1 
ATOM   8436  C  C     . ASP D 4  974  ? -1.085  -55.649 61.177  1.00 165.48 ? 974  ASP A C     1 
ATOM   8437  O  O     . ASP D 4  974  ? 0.115   -55.823 61.407  1.00 151.88 ? 974  ASP A O     1 
ATOM   8438  C  CB    . ASP D 4  974  ? -2.087  -57.164 59.453  1.00 155.04 ? 974  ASP A CB    1 
ATOM   8439  C  CG    . ASP D 4  974  ? -0.927  -58.080 59.111  1.00 150.11 ? 974  ASP A CG    1 
ATOM   8440  O  OD1   . ASP D 4  974  ? 0.234   -57.618 59.145  1.00 149.64 ? 974  ASP A OD1   1 
ATOM   8441  O  OD2   . ASP D 4  974  ? -1.176  -59.263 58.805  1.00 145.63 ? 974  ASP A OD2   1 
ATOM   8442  N  N     . HIS D 4  975  ? -1.973  -55.365 62.127  1.00 176.95 ? 975  HIS A N     1 
ATOM   8443  C  CA    . HIS D 4  975  ? -1.585  -55.227 63.524  1.00 181.85 ? 975  HIS A CA    1 
ATOM   8444  C  C     . HIS D 4  975  ? -1.903  -56.476 64.338  1.00 178.88 ? 975  HIS A C     1 
ATOM   8445  O  O     . HIS D 4  975  ? -2.038  -56.395 65.564  1.00 177.73 ? 975  HIS A O     1 
ATOM   8446  C  CB    . HIS D 4  975  ? -2.251  -53.993 64.134  1.00 191.91 ? 975  HIS A CB    1 
ATOM   8447  C  CG    . HIS D 4  975  ? -1.632  -52.701 63.696  1.00 193.94 ? 975  HIS A CG    1 
ATOM   8448  N  ND1   . HIS D 4  975  ? -1.465  -52.369 62.368  1.00 192.78 ? 975  HIS A ND1   1 
ATOM   8449  C  CD2   . HIS D 4  975  ? -1.126  -51.666 64.408  1.00 191.60 ? 975  HIS A CD2   1 
ATOM   8450  C  CE1   . HIS D 4  975  ? -0.890  -51.183 62.281  1.00 188.22 ? 975  HIS A CE1   1 
ATOM   8451  N  NE2   . HIS D 4  975  ? -0.673  -50.735 63.505  1.00 189.51 ? 975  HIS A NE2   1 
ATOM   8452  N  N     . THR D 4  976  ? -2.029  -57.628 63.678  1.00 172.77 ? 976  THR A N     1 
ATOM   8453  C  CA    . THR D 4  976  ? -2.249  -58.906 64.343  1.00 162.36 ? 976  THR A CA    1 
ATOM   8454  C  C     . THR D 4  976  ? -1.101  -59.877 64.119  1.00 165.08 ? 976  THR A C     1 
ATOM   8455  O  O     . THR D 4  976  ? -0.546  -60.407 65.088  1.00 177.12 ? 976  THR A O     1 
ATOM   8456  C  CB    . THR D 4  976  ? -3.564  -59.548 63.861  1.00 147.55 ? 976  THR A CB    1 
ATOM   8457  O  OG1   . THR D 4  976  ? -3.391  -60.042 62.528  1.00 156.37 ? 976  THR A OG1   1 
ATOM   8458  C  CG2   . THR D 4  976  ? -4.710  -58.538 63.874  1.00 127.31 ? 976  THR A CG2   1 
ATOM   8459  N  N     . LYS D 4  977  ? -0.712  -60.113 62.854  1.00 157.76 ? 977  LYS A N     1 
ATOM   8460  C  CA    . LYS D 4  977  ? 0.285   -61.129 62.539  1.00 155.04 ? 977  LYS A CA    1 
ATOM   8461  C  C     . LYS D 4  977  ? 1.685   -60.640 62.911  1.00 160.36 ? 977  LYS A C     1 
ATOM   8462  O  O     . LYS D 4  977  ? 2.006   -59.463 62.719  1.00 172.29 ? 977  LYS A O     1 
ATOM   8463  C  CB    . LYS D 4  977  ? 0.230   -61.493 61.056  1.00 149.08 ? 977  LYS A CB    1 
ATOM   8464  C  CG    . LYS D 4  977  ? -1.117  -62.043 60.619  1.00 159.22 ? 977  LYS A CG    1 
ATOM   8465  C  CD    . LYS D 4  977  ? -1.086  -62.547 59.188  1.00 170.86 ? 977  LYS A CD    1 
ATOM   8466  C  CE    . LYS D 4  977  ? -2.442  -62.389 58.520  1.00 174.55 ? 977  LYS A CE    1 
ATOM   8467  N  NZ    . LYS D 4  977  ? -2.860  -60.960 58.461  1.00 173.79 ? 977  LYS A NZ    1 
ATOM   8468  N  N     . PRO D 4  978  ? 2.528   -61.519 63.447  1.00 143.79 ? 978  PRO A N     1 
ATOM   8469  C  CA    . PRO D 4  978  ? 3.861   -61.108 63.897  1.00 122.70 ? 978  PRO A CA    1 
ATOM   8470  C  C     . PRO D 4  978  ? 4.807   -60.893 62.722  1.00 109.38 ? 978  PRO A C     1 
ATOM   8471  O  O     . PRO D 4  978  ? 4.524   -61.247 61.576  1.00 124.09 ? 978  PRO A O     1 
ATOM   8472  C  CB    . PRO D 4  978  ? 4.324   -62.286 64.762  1.00 113.44 ? 978  PRO A CB    1 
ATOM   8473  C  CG    . PRO D 4  978  ? 3.100   -63.127 64.989  1.00 124.36 ? 978  PRO A CG    1 
ATOM   8474  C  CD    . PRO D 4  978  ? 2.243   -62.919 63.797  1.00 134.09 ? 978  PRO A CD    1 
ATOM   8475  N  N     . SER D 4  979  ? 5.961   -60.314 63.038  1.00 90.87  ? 979  SER A N     1 
ATOM   8476  C  CA    . SER D 4  979  ? 6.928   -59.934 62.023  1.00 93.78  ? 979  SER A CA    1 
ATOM   8477  C  C     . SER D 4  979  ? 7.764   -61.142 61.600  1.00 90.88  ? 979  SER A C     1 
ATOM   8478  O  O     . SER D 4  979  ? 7.532   -62.280 62.023  1.00 92.26  ? 979  SER A O     1 
ATOM   8479  C  CB    . SER D 4  979  ? 7.809   -58.797 62.543  1.00 93.39  ? 979  SER A CB    1 
ATOM   8480  O  OG    . SER D 4  979  ? 9.110   -58.838 61.989  1.00 91.24  ? 979  SER A OG    1 
ATOM   8481  N  N     . ASP D 4  980  ? 8.729   -60.885 60.717  1.00 94.52  ? 980  ASP A N     1 
ATOM   8482  C  CA    . ASP D 4  980  ? 9.761   -61.829 60.307  1.00 109.96 ? 980  ASP A CA    1 
ATOM   8483  C  C     . ASP D 4  980  ? 11.138  -61.190 60.459  1.00 110.62 ? 980  ASP A C     1 
ATOM   8484  O  O     . ASP D 4  980  ? 12.039  -61.398 59.642  1.00 115.95 ? 980  ASP A O     1 
ATOM   8485  C  CB    . ASP D 4  980  ? 9.536   -62.316 58.874  1.00 122.20 ? 980  ASP A CB    1 
ATOM   8486  C  CG    . ASP D 4  980  ? 9.130   -61.198 57.924  1.00 119.38 ? 980  ASP A CG    1 
ATOM   8487  O  OD1   . ASP D 4  980  ? 8.061   -60.586 58.129  1.00 114.57 ? 980  ASP A OD1   1 
ATOM   8488  O  OD2   . ASP D 4  980  ? 9.884   -60.930 56.965  1.00 120.64 ? 980  ASP A OD2   1 
ATOM   8489  N  N     . LEU D 4  981  ? 11.302  -60.388 61.510  1.00 108.01 ? 981  LEU A N     1 
ATOM   8490  C  CA    . LEU D 4  981  ? 12.541  -59.674 61.802  1.00 92.92  ? 981  LEU A CA    1 
ATOM   8491  C  C     . LEU D 4  981  ? 13.223  -60.318 63.002  1.00 107.61 ? 981  LEU A C     1 
ATOM   8492  O  O     . LEU D 4  981  ? 12.724  -60.222 64.128  1.00 121.07 ? 981  LEU A O     1 
ATOM   8493  C  CB    . LEU D 4  981  ? 12.268  -58.201 62.087  1.00 85.31  ? 981  LEU A CB    1 
ATOM   8494  C  CG    . LEU D 4  981  ? 12.249  -57.221 60.921  1.00 93.94  ? 981  LEU A CG    1 
ATOM   8495  C  CD1   . LEU D 4  981  ? 11.584  -55.912 61.325  1.00 83.40  ? 981  LEU A CD1   1 
ATOM   8496  C  CD2   . LEU D 4  981  ? 13.671  -56.980 60.446  1.00 102.48 ? 981  LEU A CD2   1 
ATOM   8497  N  N     . THR D 4  982  ? 14.368  -60.956 62.775  1.00 104.69 ? 982  THR A N     1 
ATOM   8498  C  CA    . THR D 4  982  ? 15.233  -61.289 63.897  1.00 110.81 ? 982  THR A CA    1 
ATOM   8499  C  C     . THR D 4  982  ? 15.778  -60.001 64.509  1.00 122.08 ? 982  THR A C     1 
ATOM   8500  O  O     . THR D 4  982  ? 15.889  -58.970 63.839  1.00 132.70 ? 982  THR A O     1 
ATOM   8501  C  CB    . THR D 4  982  ? 16.383  -62.198 63.449  1.00 114.08 ? 982  THR A CB    1 
ATOM   8502  O  OG1   . THR D 4  982  ? 15.926  -63.072 62.410  1.00 124.00 ? 982  THR A OG1   1 
ATOM   8503  C  CG2   . THR D 4  982  ? 16.903  -63.044 64.618  1.00 111.76 ? 982  THR A CG2   1 
ATOM   8504  N  N     . ILE D 4  983  ? 16.080  -60.064 65.808  1.00 113.20 ? 983  ILE A N     1 
ATOM   8505  C  CA    . ILE D 4  983  ? 16.686  -58.931 66.508  1.00 88.88  ? 983  ILE A CA    1 
ATOM   8506  C  C     . ILE D 4  983  ? 18.006  -58.544 65.849  1.00 88.26  ? 983  ILE A C     1 
ATOM   8507  O  O     . ILE D 4  983  ? 18.343  -57.351 65.736  1.00 108.40 ? 983  ILE A O     1 
ATOM   8508  C  CB    . ILE D 4  983  ? 16.840  -59.277 68.010  1.00 84.96  ? 983  ILE A CB    1 
ATOM   8509  C  CG1   . ILE D 4  983  ? 15.626  -58.800 68.830  1.00 84.51  ? 983  ILE A CG1   1 
ATOM   8510  C  CG2   . ILE D 4  983  ? 18.162  -58.775 68.604  1.00 83.87  ? 983  ILE A CG2   1 
ATOM   8511  C  CD1   . ILE D 4  983  ? 14.306  -59.472 68.498  1.00 85.56  ? 983  ILE A CD1   1 
ATOM   8512  N  N     . LYS D 4  984  ? 18.743  -59.552 65.360  1.00 86.52  ? 984  LYS A N     1 
ATOM   8513  C  CA    . LYS D 4  984  ? 19.993  -59.328 64.640  1.00 97.64  ? 984  LYS A CA    1 
ATOM   8514  C  C     . LYS D 4  984  ? 19.794  -58.414 63.438  1.00 115.76 ? 984  LYS A C     1 
ATOM   8515  O  O     . LYS D 4  984  ? 20.587  -57.486 63.230  1.00 114.74 ? 984  LYS A O     1 
ATOM   8516  C  CB    . LYS D 4  984  ? 20.577  -60.667 64.188  1.00 108.51 ? 984  LYS A CB    1 
ATOM   8517  C  CG    . LYS D 4  984  ? 21.410  -61.405 65.222  1.00 93.85  ? 984  LYS A CG    1 
ATOM   8518  C  CD    . LYS D 4  984  ? 22.690  -61.929 64.594  1.00 86.79  ? 984  LYS A CD    1 
ATOM   8519  C  CE    . LYS D 4  984  ? 23.371  -62.907 65.510  1.00 87.80  ? 984  LYS A CE    1 
ATOM   8520  N  NZ    . LYS D 4  984  ? 22.472  -64.063 65.760  1.00 96.60  ? 984  LYS A NZ    1 
ATOM   8521  N  N     . ASP D 4  985  ? 18.724  -58.644 62.659  1.00 142.53 ? 985  ASP A N     1 
ATOM   8522  C  CA    . ASP D 4  985  ? 18.457  -57.819 61.480  1.00 150.35 ? 985  ASP A CA    1 
ATOM   8523  C  C     . ASP D 4  985  ? 18.272  -56.358 61.863  1.00 140.40 ? 985  ASP A C     1 
ATOM   8524  O  O     . ASP D 4  985  ? 18.924  -55.476 61.296  1.00 147.70 ? 985  ASP A O     1 
ATOM   8525  C  CB    . ASP D 4  985  ? 17.216  -58.299 60.713  1.00 149.74 ? 985  ASP A CB    1 
ATOM   8526  C  CG    . ASP D 4  985  ? 17.060  -59.804 60.693  1.00 150.06 ? 985  ASP A CG    1 
ATOM   8527  O  OD1   . ASP D 4  985  ? 18.067  -60.520 60.519  1.00 158.22 ? 985  ASP A OD1   1 
ATOM   8528  O  OD2   . ASP D 4  985  ? 15.901  -60.263 60.782  1.00 146.20 ? 985  ASP A OD2   1 
ATOM   8529  N  N     . ILE D 4  986  ? 17.418  -56.098 62.862  1.00 105.04 ? 986  ILE A N     1 
ATOM   8530  C  CA    . ILE D 4  986  ? 17.096  -54.727 63.266  1.00 86.86  ? 986  ILE A CA    1 
ATOM   8531  C  C     . ILE D 4  986  ? 18.344  -54.005 63.766  1.00 79.55  ? 986  ILE A C     1 
ATOM   8532  O  O     . ILE D 4  986  ? 18.703  -52.929 63.259  1.00 86.61  ? 986  ILE A O     1 
ATOM   8533  C  CB    . ILE D 4  986  ? 15.985  -54.728 64.336  1.00 90.07  ? 986  ILE A CB    1 
ATOM   8534  C  CG1   . ILE D 4  986  ? 14.691  -55.354 63.794  1.00 81.47  ? 986  ILE A CG1   1 
ATOM   8535  C  CG2   . ILE D 4  986  ? 15.734  -53.313 64.875  1.00 79.32  ? 986  ILE A CG2   1 
ATOM   8536  C  CD1   . ILE D 4  986  ? 13.527  -55.331 64.785  1.00 81.81  ? 986  ILE A CD1   1 
ATOM   8537  N  N     . VAL D 4  987  ? 19.047  -54.607 64.734  1.00 79.75  ? 987  VAL A N     1 
ATOM   8538  C  CA    . VAL D 4  987  ? 20.151  -53.908 65.389  1.00 86.96  ? 987  VAL A CA    1 
ATOM   8539  C  C     . VAL D 4  987  ? 21.333  -53.744 64.435  1.00 97.68  ? 987  VAL A C     1 
ATOM   8540  O  O     . VAL D 4  987  ? 21.906  -52.650 64.313  1.00 116.64 ? 987  VAL A O     1 
ATOM   8541  C  CB    . VAL D 4  987  ? 20.556  -54.640 66.680  1.00 79.65  ? 987  VAL A CB    1 
ATOM   8542  C  CG1   . VAL D 4  987  ? 21.720  -53.926 67.362  1.00 79.01  ? 987  VAL A CG1   1 
ATOM   8543  C  CG2   . VAL D 4  987  ? 19.363  -54.742 67.625  1.00 79.93  ? 987  VAL A CG2   1 
ATOM   8544  N  N     . LEU D 4  988  ? 21.701  -54.816 63.720  1.00 86.61  ? 988  LEU A N     1 
ATOM   8545  C  CA    . LEU D 4  988  ? 22.847  -54.737 62.825  1.00 100.32 ? 988  LEU A CA    1 
ATOM   8546  C  C     . LEU D 4  988  ? 22.549  -53.874 61.600  1.00 109.05 ? 988  LEU A C     1 
ATOM   8547  O  O     . LEU D 4  988  ? 23.444  -53.172 61.112  1.00 102.49 ? 988  LEU A O     1 
ATOM   8548  C  CB    . LEU D 4  988  ? 23.266  -56.151 62.421  1.00 113.16 ? 988  LEU A CB    1 
ATOM   8549  C  CG    . LEU D 4  988  ? 24.754  -56.422 62.199  1.00 116.26 ? 988  LEU A CG    1 
ATOM   8550  C  CD1   . LEU D 4  988  ? 25.595  -55.674 63.226  1.00 115.06 ? 988  LEU A CD1   1 
ATOM   8551  C  CD2   . LEU D 4  988  ? 25.031  -57.919 62.257  1.00 107.41 ? 988  LEU A CD2   1 
ATOM   8552  N  N     . GLY D 4  989  ? 21.297  -53.858 61.128  1.00 114.74 ? 989  GLY A N     1 
ATOM   8553  C  CA    . GLY D 4  989  ? 20.945  -52.987 60.023  1.00 114.42 ? 989  GLY A CA    1 
ATOM   8554  C  C     . GLY D 4  989  ? 20.930  -51.520 60.405  1.00 111.99 ? 989  GLY A C     1 
ATOM   8555  O  O     . GLY D 4  989  ? 21.346  -50.671 59.615  1.00 136.43 ? 989  GLY A O     1 
ATOM   8556  N  N     . VAL D 4  990  ? 20.453  -51.195 61.615  1.00 92.23  ? 990  VAL A N     1 
ATOM   8557  C  CA    . VAL D 4  990  ? 20.517  -49.807 62.073  1.00 75.66  ? 990  VAL A CA    1 
ATOM   8558  C  C     . VAL D 4  990  ? 21.974  -49.373 62.250  1.00 75.25  ? 990  VAL A C     1 
ATOM   8559  O  O     . VAL D 4  990  ? 22.359  -48.263 61.851  1.00 74.44  ? 990  VAL A O     1 
ATOM   8560  C  CB    . VAL D 4  990  ? 19.692  -49.619 63.365  1.00 77.45  ? 990  VAL A CB    1 
ATOM   8561  C  CG1   . VAL D 4  990  ? 20.031  -48.305 64.056  1.00 85.22  ? 990  VAL A CG1   1 
ATOM   8562  C  CG2   . VAL D 4  990  ? 18.196  -49.654 63.070  1.00 75.82  ? 990  VAL A CG2   1 
ATOM   8563  N  N     . LYS D 4  991  ? 22.818  -50.252 62.809  1.00 76.00  ? 991  LYS A N     1 
ATOM   8564  C  CA    . LYS D 4  991  ? 24.221  -49.883 63.013  1.00 94.30  ? 991  LYS A CA    1 
ATOM   8565  C  C     . LYS D 4  991  ? 24.997  -49.792 61.698  1.00 97.29  ? 991  LYS A C     1 
ATOM   8566  O  O     . LYS D 4  991  ? 25.981  -49.047 61.617  1.00 81.34  ? 991  LYS A O     1 
ATOM   8567  C  CB    . LYS D 4  991  ? 24.898  -50.867 63.972  1.00 102.03 ? 991  LYS A CB    1 
ATOM   8568  C  CG    . LYS D 4  991  ? 24.402  -50.762 65.410  1.00 108.96 ? 991  LYS A CG    1 
ATOM   8569  C  CD    . LYS D 4  991  ? 25.160  -51.692 66.347  1.00 121.44 ? 991  LYS A CD    1 
ATOM   8570  C  CE    . LYS D 4  991  ? 26.630  -51.322 66.406  1.00 120.46 ? 991  LYS A CE    1 
ATOM   8571  N  NZ    . LYS D 4  991  ? 27.381  -52.153 67.383  1.00 113.58 ? 991  LYS A NZ    1 
ATOM   8572  N  N     . ASP D 4  992  ? 24.588  -50.534 60.667  1.00 115.37 ? 992  ASP A N     1 
ATOM   8573  C  CA    . ASP D 4  992  ? 25.206  -50.359 59.355  1.00 129.73 ? 992  ASP A CA    1 
ATOM   8574  C  C     . ASP D 4  992  ? 24.666  -49.121 58.641  1.00 122.09 ? 992  ASP A C     1 
ATOM   8575  O  O     . ASP D 4  992  ? 25.414  -48.446 57.914  1.00 130.62 ? 992  ASP A O     1 
ATOM   8576  C  CB    . ASP D 4  992  ? 24.995  -51.618 58.507  1.00 144.85 ? 992  ASP A CB    1 
ATOM   8577  C  CG    . ASP D 4  992  ? 25.343  -51.409 57.041  1.00 154.08 ? 992  ASP A CG    1 
ATOM   8578  O  OD1   . ASP D 4  992  ? 24.438  -51.074 56.246  1.00 154.51 ? 992  ASP A OD1   1 
ATOM   8579  O  OD2   . ASP D 4  992  ? 26.529  -51.574 56.686  1.00 156.15 ? 992  ASP A OD2   1 
ATOM   8580  N  N     . LEU D 4  993  ? 23.380  -48.806 58.842  1.00 107.04 ? 993  LEU A N     1 
ATOM   8581  C  CA    . LEU D 4  993  ? 22.799  -47.586 58.288  1.00 96.77  ? 993  LEU A CA    1 
ATOM   8582  C  C     . LEU D 4  993  ? 23.491  -46.347 58.835  1.00 102.28 ? 993  LEU A C     1 
ATOM   8583  O  O     . LEU D 4  993  ? 23.755  -45.396 58.090  1.00 108.98 ? 993  LEU A O     1 
ATOM   8584  C  CB    . LEU D 4  993  ? 21.300  -47.536 58.594  1.00 85.14  ? 993  LEU A CB    1 
ATOM   8585  C  CG    . LEU D 4  993  ? 20.552  -46.266 58.164  1.00 77.06  ? 993  LEU A CG    1 
ATOM   8586  C  CD1   . LEU D 4  993  ? 20.630  -46.066 56.658  1.00 95.57  ? 993  LEU A CD1   1 
ATOM   8587  C  CD2   . LEU D 4  993  ? 19.099  -46.257 58.655  1.00 73.42  ? 993  LEU A CD2   1 
ATOM   8588  N  N     . GLN D 4  994  ? 23.792  -46.343 60.139  1.00 100.29 ? 994  GLN A N     1 
ATOM   8589  C  CA    . GLN D 4  994  ? 24.565  -45.252 60.727  1.00 92.96  ? 994  GLN A CA    1 
ATOM   8590  C  C     . GLN D 4  994  ? 25.942  -45.138 60.086  1.00 88.23  ? 994  GLN A C     1 
ATOM   8591  O  O     . GLN D 4  994  ? 26.468  -44.028 59.932  1.00 91.55  ? 994  GLN A O     1 
ATOM   8592  C  CB    . GLN D 4  994  ? 24.715  -45.465 62.233  1.00 101.54 ? 994  GLN A CB    1 
ATOM   8593  C  CG    . GLN D 4  994  ? 23.426  -45.429 63.027  1.00 99.68  ? 994  GLN A CG    1 
ATOM   8594  C  CD    . GLN D 4  994  ? 23.661  -45.723 64.493  1.00 117.51 ? 994  GLN A CD    1 
ATOM   8595  O  OE1   . GLN D 4  994  ? 24.729  -45.434 65.036  1.00 130.25 ? 994  GLN A OE1   1 
ATOM   8596  N  NE2   . GLN D 4  994  ? 22.686  -46.353 65.128  1.00 119.29 ? 994  GLN A NE2   1 
ATOM   8597  N  N     . GLU D 4  995  ? 26.538  -46.275 59.711  1.00 88.19  ? 995  GLU A N     1 
ATOM   8598  C  CA    . GLU D 4  995  ? 27.817  -46.241 59.014  1.00 94.43  ? 995  GLU A CA    1 
ATOM   8599  C  C     . GLU D 4  995  ? 27.674  -45.642 57.623  1.00 88.39  ? 995  GLU A C     1 
ATOM   8600  O  O     . GLU D 4  995  ? 28.597  -44.970 57.149  1.00 81.80  ? 995  GLU A O     1 
ATOM   8601  C  CB    . GLU D 4  995  ? 28.424  -47.649 58.929  1.00 102.67 ? 995  GLU A CB    1 
ATOM   8602  C  CG    . GLU D 4  995  ? 28.984  -48.162 60.241  1.00 108.94 ? 995  GLU A CG    1 
ATOM   8603  C  CD    . GLU D 4  995  ? 30.216  -47.393 60.679  1.00 123.22 ? 995  GLU A CD    1 
ATOM   8604  O  OE1   . GLU D 4  995  ? 31.102  -47.146 59.834  1.00 131.22 ? 995  GLU A OE1   1 
ATOM   8605  O  OE2   . GLU D 4  995  ? 30.281  -47.005 61.865  1.00 129.35 ? 995  GLU A OE2   1 
ATOM   8606  N  N     . ASN D 4  996  ? 26.527  -45.851 56.968  1.00 97.90  ? 996  ASN A N     1 
ATOM   8607  C  CA    . ASN D 4  996  ? 26.364  -45.440 55.576  1.00 103.65 ? 996  ASN A CA    1 
ATOM   8608  C  C     . ASN D 4  996  ? 25.720  -44.065 55.387  1.00 100.73 ? 996  ASN A C     1 
ATOM   8609  O  O     . ASN D 4  996  ? 25.662  -43.588 54.246  1.00 95.65  ? 996  ASN A O     1 
ATOM   8610  C  CB    . ASN D 4  996  ? 25.557  -46.492 54.809  1.00 102.27 ? 996  ASN A CB    1 
ATOM   8611  C  CG    . ASN D 4  996  ? 26.445  -47.503 54.114  1.00 113.21 ? 996  ASN A CG    1 
ATOM   8612  O  OD1   . ASN D 4  996  ? 27.574  -47.188 53.731  1.00 103.88 ? 996  ASN A OD1   1 
ATOM   8613  N  ND2   . ASN D 4  996  ? 25.941  -48.720 53.936  1.00 135.05 ? 996  ASN A ND2   1 
ATOM   8614  N  N     . LEU D 4  997  ? 25.243  -43.414 56.450  1.00 92.68  ? 997  LEU A N     1 
ATOM   8615  C  CA    . LEU D 4  997  ? 24.792  -42.021 56.356  1.00 71.69  ? 997  LEU A CA    1 
ATOM   8616  C  C     . LEU D 4  997  ? 26.022  -41.138 56.205  1.00 86.83  ? 997  LEU A C     1 
ATOM   8617  O  O     . LEU D 4  997  ? 26.636  -40.728 57.191  1.00 111.10 ? 997  LEU A O     1 
ATOM   8618  C  CB    . LEU D 4  997  ? 23.981  -41.620 57.585  1.00 70.40  ? 997  LEU A CB    1 
ATOM   8619  C  CG    . LEU D 4  997  ? 22.669  -42.350 57.867  1.00 70.75  ? 997  LEU A CG    1 
ATOM   8620  C  CD1   . LEU D 4  997  ? 22.107  -41.986 59.232  1.00 76.53  ? 997  LEU A CD1   1 
ATOM   8621  C  CD2   . LEU D 4  997  ? 21.665  -42.028 56.787  1.00 81.41  ? 997  LEU A CD2   1 
ATOM   8622  N  N     . LEU D 4  998  ? 26.376  -40.824 54.966  1.00 93.92  ? 998  LEU A N     1 
ATOM   8623  C  CA    . LEU D 4  998  ? 27.653  -40.198 54.658  1.00 98.86  ? 998  LEU A CA    1 
ATOM   8624  C  C     . LEU D 4  998  ? 27.500  -38.690 54.499  1.00 88.91  ? 998  LEU A C     1 
ATOM   8625  O  O     . LEU D 4  998  ? 26.534  -38.209 53.900  1.00 72.20  ? 998  LEU A O     1 
ATOM   8626  C  CB    . LEU D 4  998  ? 28.246  -40.795 53.379  1.00 100.59 ? 998  LEU A CB    1 
ATOM   8627  C  CG    . LEU D 4  998  ? 29.343  -41.846 53.547  1.00 80.26  ? 998  LEU A CG    1 
ATOM   8628  C  CD1   . LEU D 4  998  ? 30.659  -41.157 53.834  1.00 71.92  ? 998  LEU A CD1   1 
ATOM   8629  C  CD2   . LEU D 4  998  ? 29.005  -42.842 54.640  1.00 74.72  ? 998  LEU A CD2   1 
ATOM   8630  N  N     . VAL D 4  999  ? 28.460  -37.948 55.058  1.00 82.92  ? 999  VAL A N     1 
ATOM   8631  C  CA    . VAL D 4  999  ? 28.607  -36.517 54.822  1.00 74.73  ? 999  VAL A CA    1 
ATOM   8632  C  C     . VAL D 4  999  ? 30.004  -36.181 54.303  1.00 78.35  ? 999  VAL A C     1 
ATOM   8633  O  O     . VAL D 4  999  ? 30.154  -35.466 53.304  1.00 85.62  ? 999  VAL A O     1 
ATOM   8634  C  CB    . VAL D 4  999  ? 28.273  -35.698 56.092  1.00 70.14  ? 999  VAL A CB    1 
ATOM   8635  C  CG1   . VAL D 4  999  ? 28.795  -34.267 55.983  1.00 78.41  ? 999  VAL A CG1   1 
ATOM   8636  C  CG2   . VAL D 4  999  ? 26.769  -35.697 56.337  1.00 67.96  ? 999  VAL A CG2   1 
ATOM   8637  N  N     . LEU D 4  1000 ? 31.041  -36.714 54.949  1.00 71.94  ? 1000 LEU A N     1 
ATOM   8638  C  CA    . LEU D 4  1000 ? 32.418  -36.550 54.499  1.00 78.97  ? 1000 LEU A CA    1 
ATOM   8639  C  C     . LEU D 4  1000 ? 33.047  -37.919 54.255  1.00 78.87  ? 1000 LEU A C     1 
ATOM   8640  O  O     . LEU D 4  1000 ? 32.706  -38.900 54.921  1.00 79.80  ? 1000 LEU A O     1 
ATOM   8641  C  CB    . LEU D 4  1000 ? 33.237  -35.746 55.511  1.00 81.14  ? 1000 LEU A CB    1 
ATOM   8642  C  CG    . LEU D 4  1000 ? 33.324  -34.268 55.122  1.00 76.85  ? 1000 LEU A CG    1 
ATOM   8643  C  CD1   . LEU D 4  1000 ? 33.716  -33.398 56.306  1.00 71.83  ? 1000 LEU A CD1   1 
ATOM   8644  C  CD2   . LEU D 4  1000 ? 34.288  -34.073 53.946  1.00 85.02  ? 1000 LEU A CD2   1 
ATOM   8645  N  N     . ARG D 4  1001 ? 33.976  -37.980 53.295  1.00 92.81  ? 1001 ARG A N     1 
ATOM   8646  C  CA    . ARG D 4  1001 ? 34.417  -39.256 52.740  1.00 123.16 ? 1001 ARG A CA    1 
ATOM   8647  C  C     . ARG D 4  1001 ? 35.896  -39.559 52.940  1.00 138.28 ? 1001 ARG A C     1 
ATOM   8648  O  O     . ARG D 4  1001 ? 36.375  -40.579 52.427  1.00 148.07 ? 1001 ARG A O     1 
ATOM   8649  C  CB    . ARG D 4  1001 ? 34.078  -39.305 51.243  1.00 133.23 ? 1001 ARG A CB    1 
ATOM   8650  C  CG    . ARG D 4  1001 ? 32.669  -39.793 50.982  1.00 121.55 ? 1001 ARG A CG    1 
ATOM   8651  C  CD    . ARG D 4  1001 ? 32.101  -39.187 49.703  1.00 107.27 ? 1001 ARG A CD    1 
ATOM   8652  N  NE    . ARG D 4  1001 ? 30.695  -38.787 49.833  1.00 102.77 ? 1001 ARG A NE    1 
ATOM   8653  C  CZ    . ARG D 4  1001 ? 29.661  -39.587 50.114  1.00 102.68 ? 1001 ARG A CZ    1 
ATOM   8654  N  NH1   . ARG D 4  1001 ? 29.797  -40.910 50.217  1.00 102.25 ? 1001 ARG A NH1   1 
ATOM   8655  N  NH2   . ARG D 4  1001 ? 28.450  -39.057 50.222  1.00 94.27  ? 1001 ARG A NH2   1 
ATOM   8656  N  N     . GLY D 4  1002 ? 36.634  -38.720 53.664  1.00 139.98 ? 1002 GLY A N     1 
ATOM   8657  C  CA    . GLY D 4  1002 ? 38.028  -39.019 53.932  1.00 132.17 ? 1002 GLY A CA    1 
ATOM   8658  C  C     . GLY D 4  1002 ? 38.188  -40.216 54.851  1.00 125.02 ? 1002 GLY A C     1 
ATOM   8659  O  O     . GLY D 4  1002 ? 37.383  -40.456 55.751  1.00 126.30 ? 1002 GLY A O     1 
ATOM   8660  N  N     . LYS D 4  1003 ? 39.243  -40.989 54.604  1.00 122.78 ? 1003 LYS A N     1 
ATOM   8661  C  CA    . LYS D 4  1003 ? 39.564  -42.152 55.421  1.00 126.25 ? 1003 LYS A CA    1 
ATOM   8662  C  C     . LYS D 4  1003 ? 40.528  -41.823 56.557  1.00 131.67 ? 1003 LYS A C     1 
ATOM   8663  O  O     . LYS D 4  1003 ? 40.968  -42.734 57.268  1.00 125.41 ? 1003 LYS A O     1 
ATOM   8664  C  CB    . LYS D 4  1003 ? 40.136  -43.271 54.543  1.00 120.56 ? 1003 LYS A CB    1 
ATOM   8665  C  CG    . LYS D 4  1003 ? 39.071  -44.111 53.845  1.00 116.40 ? 1003 LYS A CG    1 
ATOM   8666  C  CD    . LYS D 4  1003 ? 39.683  -45.101 52.865  1.00 119.50 ? 1003 LYS A CD    1 
ATOM   8667  C  CE    . LYS D 4  1003 ? 40.049  -44.412 51.557  1.00 119.34 ? 1003 LYS A CE    1 
ATOM   8668  N  NZ    . LYS D 4  1003 ? 40.550  -45.367 50.531  1.00 117.91 ? 1003 LYS A NZ    1 
ATOM   8669  N  N     . ASN D 4  1004 ? 40.859  -40.546 56.740  1.00 134.47 ? 1004 ASN A N     1 
ATOM   8670  C  CA    . ASN D 4  1004 ? 41.681  -40.118 57.860  1.00 124.97 ? 1004 ASN A CA    1 
ATOM   8671  C  C     . ASN D 4  1004 ? 40.857  -40.101 59.145  1.00 118.05 ? 1004 ASN A C     1 
ATOM   8672  O  O     . ASN D 4  1004 ? 39.623  -40.104 59.125  1.00 114.52 ? 1004 ASN A O     1 
ATOM   8673  C  CB    . ASN D 4  1004 ? 42.265  -38.729 57.601  1.00 125.16 ? 1004 ASN A CB    1 
ATOM   8674  C  CG    . ASN D 4  1004 ? 42.732  -38.552 56.172  1.00 130.72 ? 1004 ASN A CG    1 
ATOM   8675  O  OD1   . ASN D 4  1004 ? 42.325  -37.613 55.486  1.00 129.59 ? 1004 ASN A OD1   1 
ATOM   8676  N  ND2   . ASN D 4  1004 ? 43.586  -39.459 55.712  1.00 135.64 ? 1004 ASN A ND2   1 
ATOM   8677  N  N     . GLU D 4  1005 ? 41.562  -40.065 60.277  1.00 111.78 ? 1005 GLU A N     1 
ATOM   8678  C  CA    . GLU D 4  1005 ? 40.879  -40.127 61.564  1.00 120.08 ? 1005 GLU A CA    1 
ATOM   8679  C  C     . GLU D 4  1005 ? 40.116  -38.839 61.856  1.00 123.18 ? 1005 GLU A C     1 
ATOM   8680  O  O     . GLU D 4  1005 ? 39.007  -38.882 62.405  1.00 126.49 ? 1005 GLU A O     1 
ATOM   8681  C  CB    . GLU D 4  1005 ? 41.882  -40.418 62.678  1.00 137.91 ? 1005 GLU A CB    1 
ATOM   8682  C  CG    . GLU D 4  1005 ? 41.247  -41.008 63.925  1.00 150.80 ? 1005 GLU A CG    1 
ATOM   8683  C  CD    . GLU D 4  1005 ? 42.237  -41.179 65.055  1.00 160.16 ? 1005 GLU A CD    1 
ATOM   8684  O  OE1   . GLU D 4  1005 ? 43.130  -40.317 65.197  1.00 162.01 ? 1005 GLU A OE1   1 
ATOM   8685  O  OE2   . GLU D 4  1005 ? 42.128  -42.179 65.796  1.00 166.44 ? 1005 GLU A OE2   1 
ATOM   8686  N  N     . ILE D 4  1006 ? 40.684  -37.688 61.480  1.00 123.74 ? 1006 ILE A N     1 
ATOM   8687  C  CA    . ILE D 4  1006 ? 40.054  -36.404 61.779  1.00 114.00 ? 1006 ILE A CA    1 
ATOM   8688  C  C     . ILE D 4  1006 ? 38.753  -36.248 61.008  1.00 113.91 ? 1006 ILE A C     1 
ATOM   8689  O  O     . ILE D 4  1006 ? 37.739  -35.802 61.559  1.00 107.44 ? 1006 ILE A O     1 
ATOM   8690  C  CB    . ILE D 4  1006 ? 41.014  -35.244 61.469  1.00 104.56 ? 1006 ILE A CB    1 
ATOM   8691  C  CG1   . ILE D 4  1006 ? 42.456  -35.641 61.782  1.00 130.42 ? 1006 ILE A CG1   1 
ATOM   8692  C  CG2   . ILE D 4  1006 ? 40.595  -33.992 62.233  1.00 86.51  ? 1006 ILE A CG2   1 
ATOM   8693  C  CD1   . ILE D 4  1006 ? 43.459  -34.564 61.459  1.00 143.55 ? 1006 ILE A CD1   1 
ATOM   8694  N  N     . ILE D 4  1007 ? 38.758  -36.614 59.724  1.00 120.10 ? 1007 ILE A N     1 
ATOM   8695  C  CA    . ILE D 4  1007 ? 37.578  -36.407 58.895  1.00 118.95 ? 1007 ILE A CA    1 
ATOM   8696  C  C     . ILE D 4  1007 ? 36.486  -37.408 59.256  1.00 117.98 ? 1007 ILE A C     1 
ATOM   8697  O  O     . ILE D 4  1007 ? 35.298  -37.069 59.231  1.00 108.86 ? 1007 ILE A O     1 
ATOM   8698  C  CB    . ILE D 4  1007 ? 37.961  -36.477 57.406  1.00 118.23 ? 1007 ILE A CB    1 
ATOM   8699  C  CG1   . ILE D 4  1007 ? 39.271  -35.719 57.171  1.00 124.32 ? 1007 ILE A CG1   1 
ATOM   8700  C  CG2   . ILE D 4  1007 ? 36.851  -35.890 56.542  1.00 117.08 ? 1007 ILE A CG2   1 
ATOM   8701  C  CD1   . ILE D 4  1007 ? 39.677  -35.594 55.717  1.00 125.10 ? 1007 ILE A CD1   1 
ATOM   8702  N  N     . GLN D 4  1008 ? 36.860  -38.638 59.629  1.00 121.79 ? 1008 GLN A N     1 
ATOM   8703  C  CA    . GLN D 4  1008 ? 35.860  -39.598 60.093  1.00 116.46 ? 1008 GLN A CA    1 
ATOM   8704  C  C     . GLN D 4  1008 ? 35.289  -39.206 61.452  1.00 114.32 ? 1008 GLN A C     1 
ATOM   8705  O  O     . GLN D 4  1008 ? 34.101  -39.436 61.713  1.00 104.50 ? 1008 GLN A O     1 
ATOM   8706  C  CB    . GLN D 4  1008 ? 36.450  -41.011 60.146  1.00 107.36 ? 1008 GLN A CB    1 
ATOM   8707  C  CG    . GLN D 4  1008 ? 36.738  -41.617 58.777  1.00 105.28 ? 1008 GLN A CG    1 
ATOM   8708  C  CD    . GLN D 4  1008 ? 35.475  -41.991 58.019  1.00 106.11 ? 1008 GLN A CD    1 
ATOM   8709  O  OE1   . GLN D 4  1008 ? 34.442  -42.294 58.617  1.00 104.36 ? 1008 GLN A OE1   1 
ATOM   8710  N  NE2   . GLN D 4  1008 ? 35.549  -41.947 56.693  1.00 107.63 ? 1008 GLN A NE2   1 
ATOM   8711  N  N     . ASN D 4  1009 ? 36.108  -38.601 62.320  1.00 122.90 ? 1009 ASN A N     1 
ATOM   8712  C  CA    . ASN D 4  1009 ? 35.594  -38.069 63.581  1.00 127.87 ? 1009 ASN A CA    1 
ATOM   8713  C  C     . ASN D 4  1009 ? 34.650  -36.893 63.341  1.00 119.68 ? 1009 ASN A C     1 
ATOM   8714  O  O     . ASN D 4  1009 ? 33.612  -36.775 64.005  1.00 123.43 ? 1009 ASN A O     1 
ATOM   8715  C  CB    . ASN D 4  1009 ? 36.758  -37.663 64.487  1.00 130.67 ? 1009 ASN A CB    1 
ATOM   8716  C  CG    . ASN D 4  1009 ? 37.385  -38.851 65.211  1.00 135.52 ? 1009 ASN A CG    1 
ATOM   8717  O  OD1   . ASN D 4  1009 ? 37.164  -39.052 66.406  1.00 142.11 ? 1009 ASN A OD1   1 
ATOM   8718  N  ND2   . ASN D 4  1009 ? 38.162  -39.647 64.486  1.00 137.16 ? 1009 ASN A ND2   1 
ATOM   8719  N  N     . ALA D 4  1010 ? 34.982  -36.029 62.378  1.00 114.90 ? 1010 ALA A N     1 
ATOM   8720  C  CA    . ALA D 4  1010 ? 34.071  -34.957 61.982  1.00 116.87 ? 1010 ALA A CA    1 
ATOM   8721  C  C     . ALA D 4  1010 ? 32.790  -35.506 61.366  1.00 91.68  ? 1010 ALA A C     1 
ATOM   8722  O  O     . ALA D 4  1010 ? 31.728  -34.888 61.494  1.00 69.38  ? 1010 ALA A O     1 
ATOM   8723  C  CB    . ALA D 4  1010 ? 34.762  -34.013 60.998  1.00 125.40 ? 1010 ALA A CB    1 
ATOM   8724  N  N     . GLN D 4  1011 ? 32.876  -36.657 60.695  1.00 96.70  ? 1011 GLN A N     1 
ATOM   8725  C  CA    . GLN D 4  1011 ? 31.687  -37.286 60.129  1.00 96.67  ? 1011 GLN A CA    1 
ATOM   8726  C  C     . GLN D 4  1011 ? 30.785  -37.845 61.219  1.00 99.91  ? 1011 GLN A C     1 
ATOM   8727  O  O     . GLN D 4  1011 ? 29.558  -37.710 61.144  1.00 102.95 ? 1011 GLN A O     1 
ATOM   8728  C  CB    . GLN D 4  1011 ? 32.088  -38.393 59.153  1.00 86.25  ? 1011 GLN A CB    1 
ATOM   8729  C  CG    . GLN D 4  1011 ? 31.124  -38.588 57.987  1.00 87.31  ? 1011 GLN A CG    1 
ATOM   8730  C  CD    . GLN D 4  1011 ? 29.811  -39.244 58.381  1.00 87.54  ? 1011 GLN A CD    1 
ATOM   8731  O  OE1   . GLN D 4  1011 ? 28.760  -38.906 57.844  1.00 89.98  ? 1011 GLN A OE1   1 
ATOM   8732  N  NE2   . GLN D 4  1011 ? 29.870  -40.207 59.297  1.00 90.80  ? 1011 GLN A NE2   1 
ATOM   8733  N  N     . ARG D 4  1012 ? 31.376  -38.499 62.224  1.00 91.20  ? 1012 ARG A N     1 
ATOM   8734  C  CA    . ARG D 4  1012 ? 30.586  -38.974 63.357  1.00 100.26 ? 1012 ARG A CA    1 
ATOM   8735  C  C     . ARG D 4  1012 ? 29.990  -37.813 64.147  1.00 109.09 ? 1012 ARG A C     1 
ATOM   8736  O  O     . ARG D 4  1012 ? 28.894  -37.944 64.706  1.00 113.21 ? 1012 ARG A O     1 
ATOM   8737  C  CB    . ARG D 4  1012 ? 31.439  -39.855 64.274  1.00 106.45 ? 1012 ARG A CB    1 
ATOM   8738  C  CG    . ARG D 4  1012 ? 32.006  -41.108 63.623  1.00 102.27 ? 1012 ARG A CG    1 
ATOM   8739  C  CD    . ARG D 4  1012 ? 32.449  -42.101 64.682  1.00 120.45 ? 1012 ARG A CD    1 
ATOM   8740  N  NE    . ARG D 4  1012 ? 33.595  -42.895 64.252  1.00 142.81 ? 1012 ARG A NE    1 
ATOM   8741  C  CZ    . ARG D 4  1012 ? 34.859  -42.582 64.517  1.00 148.26 ? 1012 ARG A CZ    1 
ATOM   8742  N  NH1   . ARG D 4  1012 ? 35.140  -41.491 65.218  1.00 140.35 ? 1012 ARG A NH1   1 
ATOM   8743  N  NH2   . ARG D 4  1012 ? 35.843  -43.362 64.089  1.00 149.88 ? 1012 ARG A NH2   1 
ATOM   8744  N  N     . ASP D 4  1013 ? 30.690  -36.674 64.199  1.00 114.35 ? 1013 ASP A N     1 
ATOM   8745  C  CA    . ASP D 4  1013 ? 30.152  -35.499 64.880  1.00 115.13 ? 1013 ASP A CA    1 
ATOM   8746  C  C     . ASP D 4  1013 ? 29.023  -34.855 64.080  1.00 119.25 ? 1013 ASP A C     1 
ATOM   8747  O  O     . ASP D 4  1013 ? 28.049  -34.359 64.660  1.00 122.46 ? 1013 ASP A O     1 
ATOM   8748  C  CB    . ASP D 4  1013 ? 31.262  -34.479 65.139  1.00 116.87 ? 1013 ASP A CB    1 
ATOM   8749  C  CG    . ASP D 4  1013 ? 32.279  -34.960 66.161  1.00 109.49 ? 1013 ASP A CG    1 
ATOM   8750  O  OD1   . ASP D 4  1013 ? 31.891  -35.690 67.100  1.00 105.26 ? 1013 ASP A OD1   1 
ATOM   8751  O  OD2   . ASP D 4  1013 ? 33.467  -34.597 66.029  1.00 102.67 ? 1013 ASP A OD2   1 
ATOM   8752  N  N     . ALA D 4  1014 ? 29.135  -34.852 62.749  1.00 115.03 ? 1014 ALA A N     1 
ATOM   8753  C  CA    . ALA D 4  1014 ? 28.176  -34.164 61.891  1.00 99.13  ? 1014 ALA A CA    1 
ATOM   8754  C  C     . ALA D 4  1014 ? 26.837  -34.886 61.773  1.00 90.87  ? 1014 ALA A C     1 
ATOM   8755  O  O     . ALA D 4  1014 ? 25.848  -34.266 61.365  1.00 67.55  ? 1014 ALA A O     1 
ATOM   8756  C  CB    . ALA D 4  1014 ? 28.771  -33.969 60.493  1.00 86.83  ? 1014 ALA A CB    1 
ATOM   8757  N  N     . VAL D 4  1015 ? 26.783  -36.175 62.105  1.00 104.31 ? 1015 VAL A N     1 
ATOM   8758  C  CA    . VAL D 4  1015 ? 25.567  -36.972 61.993  1.00 97.46  ? 1015 VAL A CA    1 
ATOM   8759  C  C     . VAL D 4  1015 ? 25.013  -37.352 63.360  1.00 100.64 ? 1015 VAL A C     1 
ATOM   8760  O  O     . VAL D 4  1015 ? 24.045  -38.120 63.438  1.00 95.74  ? 1015 VAL A O     1 
ATOM   8761  C  CB    . VAL D 4  1015 ? 25.800  -38.225 61.132  1.00 80.83  ? 1015 VAL A CB    1 
ATOM   8762  C  CG1   . VAL D 4  1015 ? 26.423  -37.846 59.813  1.00 77.19  ? 1015 VAL A CG1   1 
ATOM   8763  C  CG2   . VAL D 4  1015 ? 26.692  -39.214 61.854  1.00 97.92  ? 1015 VAL A CG2   1 
ATOM   8764  N  N     . THR D 4  1016 ? 25.589  -36.804 64.441  1.00 95.75  ? 1016 THR A N     1 
ATOM   8765  C  CA    . THR D 4  1016 ? 25.322  -37.290 65.796  1.00 88.50  ? 1016 THR A CA    1 
ATOM   8766  C  C     . THR D 4  1016 ? 23.875  -37.041 66.215  1.00 85.04  ? 1016 THR A C     1 
ATOM   8767  O  O     . THR D 4  1016 ? 23.222  -37.941 66.757  1.00 70.74  ? 1016 THR A O     1 
ATOM   8768  C  CB    . THR D 4  1016 ? 26.293  -36.633 66.788  1.00 80.95  ? 1016 THR A CB    1 
ATOM   8769  O  OG1   . THR D 4  1016 ? 27.645  -36.934 66.420  1.00 84.39  ? 1016 THR A OG1   1 
ATOM   8770  C  CG2   . THR D 4  1016 ? 26.050  -37.112 68.219  1.00 71.18  ? 1016 THR A CG2   1 
ATOM   8771  N  N     . LEU D 4  1017 ? 23.353  -35.838 65.954  1.00 84.85  ? 1017 LEU A N     1 
ATOM   8772  C  CA    . LEU D 4  1017 ? 21.963  -35.535 66.292  1.00 83.35  ? 1017 LEU A CA    1 
ATOM   8773  C  C     . LEU D 4  1017 ? 20.984  -36.373 65.479  1.00 96.83  ? 1017 LEU A C     1 
ATOM   8774  O  O     . LEU D 4  1017 ? 20.009  -36.913 66.028  1.00 120.96 ? 1017 LEU A O     1 
ATOM   8775  C  CB    . LEU D 4  1017 ? 21.689  -34.048 66.085  1.00 73.02  ? 1017 LEU A CB    1 
ATOM   8776  C  CG    . LEU D 4  1017 ? 21.301  -33.289 67.346  1.00 86.33  ? 1017 LEU A CG    1 
ATOM   8777  C  CD1   . LEU D 4  1017 ? 21.043  -31.845 67.001  1.00 103.64 ? 1017 LEU A CD1   1 
ATOM   8778  C  CD2   . LEU D 4  1017 ? 20.040  -33.921 67.924  1.00 68.79  ? 1017 LEU A CD2   1 
ATOM   8779  N  N     . PHE D 4  1018 ? 21.227  -36.496 64.171  1.00 86.57  ? 1018 PHE A N     1 
ATOM   8780  C  CA    . PHE D 4  1018 ? 20.345  -37.302 63.333  1.00 84.94  ? 1018 PHE A CA    1 
ATOM   8781  C  C     . PHE D 4  1018 ? 20.440  -38.782 63.705  1.00 84.62  ? 1018 PHE A C     1 
ATOM   8782  O  O     . PHE D 4  1018 ? 19.430  -39.492 63.685  1.00 92.55  ? 1018 PHE A O     1 
ATOM   8783  C  CB    . PHE D 4  1018 ? 20.671  -37.091 61.854  1.00 95.99  ? 1018 PHE A CB    1 
ATOM   8784  C  CG    . PHE D 4  1018 ? 19.822  -37.922 60.924  1.00 85.74  ? 1018 PHE A CG    1 
ATOM   8785  C  CD1   . PHE D 4  1018 ? 18.442  -37.934 61.060  1.00 87.51  ? 1018 PHE A CD1   1 
ATOM   8786  C  CD2   . PHE D 4  1018 ? 20.399  -38.731 59.960  1.00 73.95  ? 1018 PHE A CD2   1 
ATOM   8787  C  CE1   . PHE D 4  1018 ? 17.654  -38.705 60.230  1.00 99.69  ? 1018 PHE A CE1   1 
ATOM   8788  C  CE2   . PHE D 4  1018 ? 19.606  -39.513 59.130  1.00 94.03  ? 1018 PHE A CE2   1 
ATOM   8789  C  CZ    . PHE D 4  1018 ? 18.236  -39.498 59.269  1.00 107.14 ? 1018 PHE A CZ    1 
ATOM   8790  N  N     . CYS D 4  1019 ? 21.637  -39.261 64.065  1.00 70.34  ? 1019 CYS A N     1 
ATOM   8791  C  CA    . CYS D 4  1019 ? 21.753  -40.640 64.534  1.00 70.62  ? 1019 CYS A CA    1 
ATOM   8792  C  C     . CYS D 4  1019 ? 21.044  -40.856 65.866  1.00 80.93  ? 1019 CYS A C     1 
ATOM   8793  O  O     . CYS D 4  1019 ? 20.479  -41.932 66.084  1.00 98.30  ? 1019 CYS A O     1 
ATOM   8794  C  CB    . CYS D 4  1019 ? 23.220  -41.066 64.640  1.00 91.93  ? 1019 CYS A CB    1 
ATOM   8795  S  SG    . CYS D 4  1019 ? 24.017  -41.402 63.053  1.00 93.66  ? 1019 CYS A SG    1 
ATOM   8796  N  N     . CYS D 4  1020 ? 21.054  -39.856 66.754  1.00 93.00  ? 1020 CYS A N     1 
ATOM   8797  C  CA    . CYS D 4  1020 ? 20.270  -39.932 67.989  1.00 99.01  ? 1020 CYS A CA    1 
ATOM   8798  C  C     . CYS D 4  1020 ? 18.785  -40.085 67.683  1.00 86.36  ? 1020 CYS A C     1 
ATOM   8799  O  O     . CYS D 4  1020 ? 18.101  -40.943 68.260  1.00 96.96  ? 1020 CYS A O     1 
ATOM   8800  C  CB    . CYS D 4  1020 ? 20.501  -38.684 68.846  1.00 100.90 ? 1020 CYS A CB    1 
ATOM   8801  S  SG    . CYS D 4  1020 ? 22.093  -38.563 69.678  1.00 98.52  ? 1020 CYS A SG    1 
ATOM   8802  N  N     . LEU D 4  1021 ? 18.275  -39.252 66.770  1.00 74.54  ? 1021 LEU A N     1 
ATOM   8803  C  CA    . LEU D 4  1021 ? 16.875  -39.351 66.355  1.00 77.51  ? 1021 LEU A CA    1 
ATOM   8804  C  C     . LEU D 4  1021 ? 16.570  -40.710 65.734  1.00 83.50  ? 1021 LEU A C     1 
ATOM   8805  O  O     . LEU D 4  1021 ? 15.519  -41.310 66.003  1.00 97.10  ? 1021 LEU A O     1 
ATOM   8806  C  CB    . LEU D 4  1021 ? 16.544  -38.232 65.367  1.00 75.29  ? 1021 LEU A CB    1 
ATOM   8807  C  CG    . LEU D 4  1021 ? 15.193  -38.325 64.653  1.00 75.19  ? 1021 LEU A CG    1 
ATOM   8808  C  CD1   . LEU D 4  1021 ? 14.041  -38.136 65.624  1.00 70.59  ? 1021 LEU A CD1   1 
ATOM   8809  C  CD2   . LEU D 4  1021 ? 15.115  -37.315 63.519  1.00 96.42  ? 1021 LEU A CD2   1 
ATOM   8810  N  N     . LEU D 4  1022 ? 17.497  -41.223 64.925  1.00 81.98  ? 1022 LEU A N     1 
ATOM   8811  C  CA    . LEU D 4  1022 ? 17.278  -42.477 64.212  1.00 82.56  ? 1022 LEU A CA    1 
ATOM   8812  C  C     . LEU D 4  1022 ? 17.244  -43.664 65.174  1.00 81.27  ? 1022 LEU A C     1 
ATOM   8813  O  O     . LEU D 4  1022 ? 16.362  -44.525 65.078  1.00 83.93  ? 1022 LEU A O     1 
ATOM   8814  C  CB    . LEU D 4  1022 ? 18.368  -42.636 63.150  1.00 81.94  ? 1022 LEU A CB    1 
ATOM   8815  C  CG    . LEU D 4  1022 ? 18.715  -43.997 62.555  1.00 82.53  ? 1022 LEU A CG    1 
ATOM   8816  C  CD1   . LEU D 4  1022 ? 17.556  -44.523 61.741  1.00 77.04  ? 1022 LEU A CD1   1 
ATOM   8817  C  CD2   . LEU D 4  1022 ? 19.978  -43.887 61.705  1.00 90.26  ? 1022 LEU A CD2   1 
ATOM   8818  N  N     . ARG D 4  1023 ? 18.191  -43.718 66.118  1.00 72.23  ? 1023 ARG A N     1 
ATOM   8819  C  CA    . ARG D 4  1023 ? 18.173  -44.766 67.135  1.00 72.99  ? 1023 ARG A CA    1 
ATOM   8820  C  C     . ARG D 4  1023 ? 16.951  -44.645 68.037  1.00 73.33  ? 1023 ARG A C     1 
ATOM   8821  O  O     . ARG D 4  1023 ? 16.437  -45.662 68.517  1.00 88.64  ? 1023 ARG A O     1 
ATOM   8822  C  CB    . ARG D 4  1023 ? 19.434  -44.702 67.999  1.00 76.17  ? 1023 ARG A CB    1 
ATOM   8823  C  CG    . ARG D 4  1023 ? 20.745  -44.870 67.272  1.00 72.77  ? 1023 ARG A CG    1 
ATOM   8824  C  CD    . ARG D 4  1023 ? 21.873  -44.354 68.159  1.00 75.32  ? 1023 ARG A CD    1 
ATOM   8825  N  NE    . ARG D 4  1023 ? 23.083  -44.023 67.412  1.00 81.82  ? 1023 ARG A NE    1 
ATOM   8826  C  CZ    . ARG D 4  1023 ? 24.009  -43.170 67.843  1.00 83.28  ? 1023 ARG A CZ    1 
ATOM   8827  N  NH1   . ARG D 4  1023 ? 23.864  -42.569 69.017  1.00 71.99  ? 1023 ARG A NH1   1 
ATOM   8828  N  NH2   . ARG D 4  1023 ? 25.076  -42.909 67.098  1.00 86.26  ? 1023 ARG A NH2   1 
ATOM   8829  N  N     . SER D 4  1024 ? 16.489  -43.417 68.304  1.00 89.55  ? 1024 SER A N     1 
ATOM   8830  C  CA    . SER D 4  1024 ? 15.296  -43.262 69.131  1.00 108.09 ? 1024 SER A CA    1 
ATOM   8831  C  C     . SER D 4  1024 ? 14.069  -43.819 68.421  1.00 99.05  ? 1024 SER A C     1 
ATOM   8832  O  O     . SER D 4  1024 ? 13.248  -44.506 69.040  1.00 74.54  ? 1024 SER A O     1 
ATOM   8833  C  CB    . SER D 4  1024 ? 15.083  -41.789 69.517  1.00 117.20 ? 1024 SER A CB    1 
ATOM   8834  O  OG    . SER D 4  1024 ? 14.845  -40.943 68.401  1.00 103.88 ? 1024 SER A OG    1 
ATOM   8835  N  N     . ARG D 4  1025 ? 13.946  -43.568 67.116  1.00 110.65 ? 1025 ARG A N     1 
ATOM   8836  C  CA    . ARG D 4  1025 ? 12.751  -43.986 66.393  1.00 102.28 ? 1025 ARG A CA    1 
ATOM   8837  C  C     . ARG D 4  1025 ? 12.846  -45.399 65.830  1.00 95.07  ? 1025 ARG A C     1 
ATOM   8838  O  O     . ARG D 4  1025 ? 11.807  -46.031 65.604  1.00 89.37  ? 1025 ARG A O     1 
ATOM   8839  C  CB    . ARG D 4  1025 ? 12.447  -43.011 65.255  1.00 93.82  ? 1025 ARG A CB    1 
ATOM   8840  C  CG    . ARG D 4  1025 ? 12.302  -41.569 65.699  1.00 88.18  ? 1025 ARG A CG    1 
ATOM   8841  C  CD    . ARG D 4  1025 ? 11.578  -40.752 64.649  1.00 113.36 ? 1025 ARG A CD    1 
ATOM   8842  N  NE    . ARG D 4  1025 ? 10.180  -40.565 65.016  1.00 133.48 ? 1025 ARG A NE    1 
ATOM   8843  C  CZ    . ARG D 4  1025 ? 9.717   -39.490 65.644  1.00 143.01 ? 1025 ARG A CZ    1 
ATOM   8844  N  NH1   . ARG D 4  1025 ? 10.538  -38.494 65.945  1.00 137.95 ? 1025 ARG A NH1   1 
ATOM   8845  N  NH2   . ARG D 4  1025 ? 8.434   -39.404 65.958  1.00 157.66 ? 1025 ARG A NH2   1 
ATOM   8846  N  N     . LEU D 4  1026 ? 14.050  -45.911 65.582  1.00 96.27  ? 1026 LEU A N     1 
ATOM   8847  C  CA    . LEU D 4  1026 ? 14.231  -47.275 65.089  1.00 96.06  ? 1026 LEU A CA    1 
ATOM   8848  C  C     . LEU D 4  1026 ? 14.780  -48.199 66.174  1.00 101.66 ? 1026 LEU A C     1 
ATOM   8849  O  O     . LEU D 4  1026 ? 15.624  -49.061 65.916  1.00 88.90  ? 1026 LEU A O     1 
ATOM   8850  C  CB    . LEU D 4  1026 ? 15.121  -47.300 63.851  1.00 85.18  ? 1026 LEU A CB    1 
ATOM   8851  C  CG    . LEU D 4  1026 ? 14.475  -46.763 62.565  1.00 80.54  ? 1026 LEU A CG    1 
ATOM   8852  C  CD1   . LEU D 4  1026 ? 15.184  -47.303 61.328  1.00 82.10  ? 1026 LEU A CD1   1 
ATOM   8853  C  CD2   . LEU D 4  1026 ? 12.976  -47.067 62.502  1.00 82.82  ? 1026 LEU A CD2   1 
ATOM   8854  N  N     . ALA D 4  1027 ? 14.310  -48.013 67.406  1.00 99.48  ? 1027 ALA A N     1 
ATOM   8855  C  CA    . ALA D 4  1027 ? 14.553  -48.980 68.463  1.00 76.69  ? 1027 ALA A CA    1 
ATOM   8856  C  C     . ALA D 4  1027 ? 13.756  -50.252 68.191  1.00 86.16  ? 1027 ALA A C     1 
ATOM   8857  O  O     . ALA D 4  1027 ? 12.763  -50.244 67.459  1.00 98.09  ? 1027 ALA A O     1 
ATOM   8858  C  CB    . ALA D 4  1027 ? 14.168  -48.390 69.819  1.00 84.62  ? 1027 ALA A CB    1 
ATOM   8859  N  N     . THR D 4  1028 ? 14.201  -51.354 68.804  1.00 89.78  ? 1028 THR A N     1 
ATOM   8860  C  CA    . THR D 4  1028 ? 13.646  -52.669 68.484  1.00 95.73  ? 1028 THR A CA    1 
ATOM   8861  C  C     . THR D 4  1028 ? 12.202  -52.797 68.961  1.00 91.04  ? 1028 THR A C     1 
ATOM   8862  O  O     . THR D 4  1028 ? 11.328  -53.271 68.218  1.00 81.08  ? 1028 THR A O     1 
ATOM   8863  C  CB    . THR D 4  1028 ? 14.518  -53.768 69.099  1.00 97.97  ? 1028 THR A CB    1 
ATOM   8864  O  OG1   . THR D 4  1028 ? 15.891  -53.549 68.743  1.00 92.77  ? 1028 THR A OG1   1 
ATOM   8865  C  CG2   . THR D 4  1028 ? 14.085  -55.147 68.611  1.00 103.93 ? 1028 THR A CG2   1 
ATOM   8866  N  N     . ARG D 4  1029 ? 11.935  -52.372 70.202  1.00 80.40  ? 1029 ARG A N     1 
ATOM   8867  C  CA    . ARG D 4  1029 ? 10.568  -52.375 70.708  1.00 81.11  ? 1029 ARG A CA    1 
ATOM   8868  C  C     . ARG D 4  1029 ? 9.699   -51.390 69.941  1.00 84.27  ? 1029 ARG A C     1 
ATOM   8869  O  O     . ARG D 4  1029 ? 8.523   -51.662 69.693  1.00 82.01  ? 1029 ARG A O     1 
ATOM   8870  C  CB    . ARG D 4  1029 ? 10.546  -52.050 72.201  1.00 81.22  ? 1029 ARG A CB    1 
ATOM   8871  C  CG    . ARG D 4  1029 ? 9.142   -51.991 72.798  1.00 91.22  ? 1029 ARG A CG    1 
ATOM   8872  C  CD    . ARG D 4  1029 ? 9.145   -52.399 74.251  1.00 96.39  ? 1029 ARG A CD    1 
ATOM   8873  N  NE    . ARG D 4  1029 ? 8.638   -53.758 74.417  1.00 99.21  ? 1029 ARG A NE    1 
ATOM   8874  C  CZ    . ARG D 4  1029 ? 8.798   -54.476 75.522  1.00 114.71 ? 1029 ARG A CZ    1 
ATOM   8875  N  NH1   . ARG D 4  1029 ? 9.450   -53.962 76.556  1.00 113.15 ? 1029 ARG A NH1   1 
ATOM   8876  N  NH2   . ARG D 4  1029 ? 8.315   -55.708 75.595  1.00 126.23 ? 1029 ARG A NH2   1 
ATOM   8877  N  N     . ARG D 4  1030 ? 10.263  -50.244 69.547  1.00 85.47  ? 1030 ARG A N     1 
ATOM   8878  C  CA    . ARG D 4  1030 ? 9.507   -49.285 68.746  1.00 79.66  ? 1030 ARG A CA    1 
ATOM   8879  C  C     . ARG D 4  1030 ? 9.186   -49.842 67.357  1.00 80.94  ? 1030 ARG A C     1 
ATOM   8880  O  O     . ARG D 4  1030 ? 8.083   -49.629 66.840  1.00 79.77  ? 1030 ARG A O     1 
ATOM   8881  C  CB    . ARG D 4  1030 ? 10.273  -47.966 68.642  1.00 82.16  ? 1030 ARG A CB    1 
ATOM   8882  C  CG    . ARG D 4  1030 ? 9.531   -46.895 67.850  1.00 112.65 ? 1030 ARG A CG    1 
ATOM   8883  C  CD    . ARG D 4  1030 ? 9.895   -45.488 68.277  1.00 118.70 ? 1030 ARG A CD    1 
ATOM   8884  N  NE    . ARG D 4  1030 ? 8.729   -44.776 68.787  1.00 116.81 ? 1030 ARG A NE    1 
ATOM   8885  C  CZ    . ARG D 4  1030 ? 8.661   -43.458 68.924  1.00 109.17 ? 1030 ARG A CZ    1 
ATOM   8886  N  NH1   . ARG D 4  1030 ? 9.691   -42.700 68.575  1.00 103.46 ? 1030 ARG A NH1   1 
ATOM   8887  N  NH2   . ARG D 4  1030 ? 7.560   -42.899 69.406  1.00 112.65 ? 1030 ARG A NH2   1 
ATOM   8888  N  N     . VAL D 4  1031 ? 10.123  -50.573 66.745  1.00 79.37  ? 1031 VAL A N     1 
ATOM   8889  C  CA    . VAL D 4  1031 ? 9.870   -51.151 65.424  1.00 80.93  ? 1031 VAL A CA    1 
ATOM   8890  C  C     . VAL D 4  1031 ? 8.804   -52.244 65.507  1.00 95.75  ? 1031 VAL A C     1 
ATOM   8891  O  O     . VAL D 4  1031 ? 7.815   -52.221 64.765  1.00 96.65  ? 1031 VAL A O     1 
ATOM   8892  C  CB    . VAL D 4  1031 ? 11.181  -51.674 64.800  1.00 82.45  ? 1031 VAL A CB    1 
ATOM   8893  C  CG1   . VAL D 4  1031 ? 10.904  -52.680 63.672  1.00 80.57  ? 1031 VAL A CG1   1 
ATOM   8894  C  CG2   . VAL D 4  1031 ? 12.030  -50.515 64.278  1.00 78.31  ? 1031 VAL A CG2   1 
ATOM   8895  N  N     . LEU D 4  1032 ? 8.971   -53.205 66.424  1.00 104.58 ? 1032 LEU A N     1 
ATOM   8896  C  CA    . LEU D 4  1032 ? 8.062   -54.353 66.437  1.00 102.12 ? 1032 LEU A CA    1 
ATOM   8897  C  C     . LEU D 4  1032 ? 6.744   -54.039 67.141  1.00 101.82 ? 1032 LEU A C     1 
ATOM   8898  O  O     . LEU D 4  1032 ? 5.666   -54.357 66.625  1.00 93.86  ? 1032 LEU A O     1 
ATOM   8899  C  CB    . LEU D 4  1032 ? 8.738   -55.562 67.087  1.00 92.03  ? 1032 LEU A CB    1 
ATOM   8900  C  CG    . LEU D 4  1032 ? 10.048  -56.004 66.435  1.00 83.94  ? 1032 LEU A CG    1 
ATOM   8901  C  CD1   . LEU D 4  1032 ? 10.597  -57.233 67.134  1.00 84.84  ? 1032 LEU A CD1   1 
ATOM   8902  C  CD2   . LEU D 4  1032 ? 9.842   -56.267 64.951  1.00 88.01  ? 1032 LEU A CD2   1 
ATOM   8903  N  N     . GLN D 4  1033 ? 6.812   -53.428 68.324  1.00 103.15 ? 1033 GLN A N     1 
ATOM   8904  C  CA    . GLN D 4  1033 ? 5.619   -53.204 69.134  1.00 109.25 ? 1033 GLN A CA    1 
ATOM   8905  C  C     . GLN D 4  1033 ? 4.740   -52.097 68.552  1.00 108.39 ? 1033 GLN A C     1 
ATOM   8906  O  O     . GLN D 4  1033 ? 3.509   -52.214 68.548  1.00 122.94 ? 1033 GLN A O     1 
ATOM   8907  C  CB    . GLN D 4  1033 ? 6.037   -52.878 70.572  1.00 113.67 ? 1033 GLN A CB    1 
ATOM   8908  C  CG    . GLN D 4  1033 ? 4.904   -52.500 71.509  1.00 123.69 ? 1033 GLN A CG    1 
ATOM   8909  C  CD    . GLN D 4  1033 ? 3.978   -53.664 71.788  1.00 126.60 ? 1033 GLN A CD    1 
ATOM   8910  O  OE1   . GLN D 4  1033 ? 4.271   -54.521 72.621  1.00 119.21 ? 1033 GLN A OE1   1 
ATOM   8911  N  NE2   . GLN D 4  1033 ? 2.851   -53.701 71.090  1.00 139.72 ? 1033 GLN A NE2   1 
ATOM   8912  N  N     . GLU D 4  1034 ? 5.346   -51.023 68.043  1.00 89.04  ? 1034 GLU A N     1 
ATOM   8913  C  CA    . GLU D 4  1034 ? 4.585   -49.881 67.544  1.00 89.22  ? 1034 GLU A CA    1 
ATOM   8914  C  C     . GLU D 4  1034 ? 4.376   -49.913 66.032  1.00 99.73  ? 1034 GLU A C     1 
ATOM   8915  O  O     . GLU D 4  1034 ? 3.249   -49.727 65.565  1.00 100.90 ? 1034 GLU A O     1 
ATOM   8916  C  CB    . GLU D 4  1034 ? 5.269   -48.567 67.953  1.00 99.95  ? 1034 GLU A CB    1 
ATOM   8917  C  CG    . GLU D 4  1034 ? 5.456   -48.382 69.457  1.00 100.00 ? 1034 GLU A CG    1 
ATOM   8918  C  CD    . GLU D 4  1034 ? 6.092   -47.045 69.805  1.00 96.64  ? 1034 GLU A CD    1 
ATOM   8919  O  OE1   . GLU D 4  1034 ? 5.464   -45.989 69.564  1.00 90.99  ? 1034 GLU A OE1   1 
ATOM   8920  O  OE2   . GLU D 4  1034 ? 7.232   -47.052 70.313  1.00 94.22  ? 1034 GLU A OE2   1 
ATOM   8921  N  N     . TYR D 4  1035 ? 5.438   -50.144 65.252  1.00 102.01 ? 1035 TYR A N     1 
ATOM   8922  C  CA    . TYR D 4  1035 ? 5.335   -50.050 63.795  1.00 98.12  ? 1035 TYR A CA    1 
ATOM   8923  C  C     . TYR D 4  1035 ? 4.923   -51.366 63.145  1.00 98.29  ? 1035 TYR A C     1 
ATOM   8924  O  O     . TYR D 4  1035 ? 4.310   -51.343 62.069  1.00 104.75 ? 1035 TYR A O     1 
ATOM   8925  C  CB    . TYR D 4  1035 ? 6.665   -49.594 63.169  1.00 80.38  ? 1035 TYR A CB    1 
ATOM   8926  C  CG    . TYR D 4  1035 ? 7.284   -48.306 63.701  1.00 96.14  ? 1035 TYR A CG    1 
ATOM   8927  C  CD1   . TYR D 4  1035 ? 8.634   -48.031 63.490  1.00 95.85  ? 1035 TYR A CD1   1 
ATOM   8928  C  CD2   . TYR D 4  1035 ? 6.528   -47.355 64.383  1.00 88.85  ? 1035 TYR A CD2   1 
ATOM   8929  C  CE1   . TYR D 4  1035 ? 9.217   -46.861 63.968  1.00 76.97  ? 1035 TYR A CE1   1 
ATOM   8930  C  CE2   . TYR D 4  1035 ? 7.105   -46.188 64.867  1.00 82.35  ? 1035 TYR A CE2   1 
ATOM   8931  C  CZ    . TYR D 4  1035 ? 8.448   -45.946 64.653  1.00 87.15  ? 1035 TYR A CZ    1 
ATOM   8932  O  OH    . TYR D 4  1035 ? 9.022   -44.786 65.127  1.00 98.15  ? 1035 TYR A OH    1 
ATOM   8933  N  N     . ARG D 4  1036 ? 5.260   -52.500 63.775  1.00 103.10 ? 1036 ARG A N     1 
ATOM   8934  C  CA    . ARG D 4  1036 ? 4.967   -53.849 63.267  1.00 100.30 ? 1036 ARG A CA    1 
ATOM   8935  C  C     . ARG D 4  1036 ? 5.571   -54.074 61.879  1.00 84.94  ? 1036 ARG A C     1 
ATOM   8936  O  O     . ARG D 4  1036 ? 4.955   -54.687 61.005  1.00 86.04  ? 1036 ARG A O     1 
ATOM   8937  C  CB    . ARG D 4  1036 ? 3.460   -54.131 63.259  1.00 120.53 ? 1036 ARG A CB    1 
ATOM   8938  C  CG    . ARG D 4  1036 ? 2.818   -54.190 64.638  1.00 129.69 ? 1036 ARG A CG    1 
ATOM   8939  C  CD    . ARG D 4  1036 ? 3.000   -55.556 65.287  1.00 136.99 ? 1036 ARG A CD    1 
ATOM   8940  N  NE    . ARG D 4  1036 ? 1.749   -56.060 65.847  1.00 144.30 ? 1036 ARG A NE    1 
ATOM   8941  C  CZ    . ARG D 4  1036 ? 1.260   -55.701 67.029  1.00 145.61 ? 1036 ARG A CZ    1 
ATOM   8942  N  NH1   . ARG D 4  1036 ? 1.920   -54.838 67.792  1.00 139.87 ? 1036 ARG A NH1   1 
ATOM   8943  N  NH2   . ARG D 4  1036 ? 0.112   -56.210 67.455  1.00 149.78 ? 1036 ARG A NH2   1 
ATOM   8944  N  N     . LEU D 4  1037 ? 6.797   -53.590 61.683  1.00 83.72  ? 1037 LEU A N     1 
ATOM   8945  C  CA    . LEU D 4  1037 ? 7.450   -53.686 60.383  1.00 92.08  ? 1037 LEU A CA    1 
ATOM   8946  C  C     . LEU D 4  1037 ? 7.851   -55.121 60.060  1.00 108.50 ? 1037 LEU A C     1 
ATOM   8947  O  O     . LEU D 4  1037 ? 8.278   -55.883 60.933  1.00 124.70 ? 1037 LEU A O     1 
ATOM   8948  C  CB    . LEU D 4  1037 ? 8.690   -52.786 60.333  1.00 82.02  ? 1037 LEU A CB    1 
ATOM   8949  C  CG    . LEU D 4  1037 ? 8.515   -51.274 60.492  1.00 83.77  ? 1037 LEU A CG    1 
ATOM   8950  C  CD1   . LEU D 4  1037 ? 9.775   -50.519 60.066  1.00 91.25  ? 1037 LEU A CD1   1 
ATOM   8951  C  CD2   . LEU D 4  1037 ? 7.305   -50.791 59.700  1.00 85.15  ? 1037 LEU A CD2   1 
ATOM   8952  N  N     . THR D 4  1038 ? 7.697   -55.484 58.789  1.00 105.40 ? 1038 THR A N     1 
ATOM   8953  C  CA    . THR D 4  1038 ? 8.271   -56.701 58.246  1.00 86.44  ? 1038 THR A CA    1 
ATOM   8954  C  C     . THR D 4  1038 ? 9.720   -56.448 57.829  1.00 93.61  ? 1038 THR A C     1 
ATOM   8955  O  O     . THR D 4  1038 ? 10.215  -55.317 57.865  1.00 110.80 ? 1038 THR A O     1 
ATOM   8956  C  CB    . THR D 4  1038 ? 7.446   -57.196 57.061  1.00 87.75  ? 1038 THR A CB    1 
ATOM   8957  O  OG1   . THR D 4  1038 ? 7.691   -56.349 55.930  1.00 95.48  ? 1038 THR A OG1   1 
ATOM   8958  C  CG2   . THR D 4  1038 ? 5.961   -57.170 57.398  1.00 88.58  ? 1038 THR A CG2   1 
ATOM   8959  N  N     . LYS D 4  1039 ? 10.411  -57.526 57.442  1.00 86.38  ? 1039 LYS A N     1 
ATOM   8960  C  CA    . LYS D 4  1039 ? 11.797  -57.405 56.990  1.00 88.69  ? 1039 LYS A CA    1 
ATOM   8961  C  C     . LYS D 4  1039 ? 11.886  -56.602 55.694  1.00 101.51 ? 1039 LYS A C     1 
ATOM   8962  O  O     . LYS D 4  1039 ? 12.781  -55.758 55.532  1.00 90.78  ? 1039 LYS A O     1 
ATOM   8963  C  CB    . LYS D 4  1039 ? 12.404  -58.803 56.823  1.00 89.69  ? 1039 LYS A CB    1 
ATOM   8964  C  CG    . LYS D 4  1039 ? 13.605  -58.889 55.889  1.00 99.27  ? 1039 LYS A CG    1 
ATOM   8965  C  CD    . LYS D 4  1039 ? 14.911  -58.561 56.594  1.00 101.52 ? 1039 LYS A CD    1 
ATOM   8966  C  CE    . LYS D 4  1039 ? 16.109  -58.831 55.687  1.00 100.39 ? 1039 LYS A CE    1 
ATOM   8967  N  NZ    . LYS D 4  1039 ? 17.403  -58.392 56.285  1.00 95.80  ? 1039 LYS A NZ    1 
ATOM   8968  N  N     . GLN D 4  1040 ? 10.941  -56.834 54.775  1.00 121.74 ? 1040 GLN A N     1 
ATOM   8969  C  CA    . GLN D 4  1040 ? 10.881  -56.091 53.517  1.00 122.88 ? 1040 GLN A CA    1 
ATOM   8970  C  C     . GLN D 4  1040 ? 10.668  -54.600 53.763  1.00 112.31 ? 1040 GLN A C     1 
ATOM   8971  O  O     . GLN D 4  1040 ? 11.382  -53.755 53.205  1.00 118.51 ? 1040 GLN A O     1 
ATOM   8972  C  CB    . GLN D 4  1040 ? 9.755   -56.657 52.654  1.00 122.54 ? 1040 GLN A CB    1 
ATOM   8973  C  CG    . GLN D 4  1040 ? 9.805   -56.279 51.190  1.00 113.50 ? 1040 GLN A CG    1 
ATOM   8974  C  CD    . GLN D 4  1040 ? 8.598   -56.800 50.440  1.00 112.78 ? 1040 GLN A CD    1 
ATOM   8975  O  OE1   . GLN D 4  1040 ? 7.521   -56.958 51.017  1.00 103.55 ? 1040 GLN A OE1   1 
ATOM   8976  N  NE2   . GLN D 4  1040 ? 8.773   -57.087 49.157  1.00 129.79 ? 1040 GLN A NE2   1 
ATOM   8977  N  N     . ALA D 4  1041 ? 9.682   -54.265 54.604  1.00 100.61 ? 1041 ALA A N     1 
ATOM   8978  C  CA    . ALA D 4  1041 ? 9.414   -52.872 54.944  1.00 107.78 ? 1041 ALA A CA    1 
ATOM   8979  C  C     . ALA D 4  1041 ? 10.581  -52.232 55.693  1.00 114.03 ? 1041 ALA A C     1 
ATOM   8980  O  O     . ALA D 4  1041 ? 10.868  -51.048 55.487  1.00 110.19 ? 1041 ALA A O     1 
ATOM   8981  C  CB    . ALA D 4  1041 ? 8.130   -52.775 55.772  1.00 94.54  ? 1041 ALA A CB    1 
ATOM   8982  N  N     . PHE D 4  1042 ? 11.280  -53.000 56.535  1.00 116.86 ? 1042 PHE A N     1 
ATOM   8983  C  CA    . PHE D 4  1042 ? 12.418  -52.462 57.281  1.00 110.08 ? 1042 PHE A CA    1 
ATOM   8984  C  C     . PHE D 4  1042 ? 13.585  -52.122 56.356  1.00 110.19 ? 1042 PHE A C     1 
ATOM   8985  O  O     . PHE D 4  1042 ? 14.201  -51.052 56.482  1.00 117.55 ? 1042 PHE A O     1 
ATOM   8986  C  CB    . PHE D 4  1042 ? 12.853  -53.456 58.363  1.00 111.56 ? 1042 PHE A CB    1 
ATOM   8987  C  CG    . PHE D 4  1042 ? 13.937  -52.936 59.264  1.00 107.03 ? 1042 PHE A CG    1 
ATOM   8988  C  CD1   . PHE D 4  1042 ? 13.634  -52.076 60.308  1.00 103.39 ? 1042 PHE A CD1   1 
ATOM   8989  C  CD2   . PHE D 4  1042 ? 15.258  -53.314 59.075  1.00 103.87 ? 1042 PHE A CD2   1 
ATOM   8990  C  CE1   . PHE D 4  1042 ? 14.630  -51.592 61.138  1.00 93.98  ? 1042 PHE A CE1   1 
ATOM   8991  C  CE2   . PHE D 4  1042 ? 16.258  -52.833 59.905  1.00 102.65 ? 1042 PHE A CE2   1 
ATOM   8992  C  CZ    . PHE D 4  1042 ? 15.942  -51.972 60.935  1.00 98.27  ? 1042 PHE A CZ    1 
ATOM   8993  N  N     . ASP D 4  1043 ? 13.914  -53.027 55.424  1.00 105.98 ? 1043 ASP A N     1 
ATOM   8994  C  CA    . ASP D 4  1043 ? 14.987  -52.743 54.473  1.00 107.80 ? 1043 ASP A CA    1 
ATOM   8995  C  C     . ASP D 4  1043 ? 14.608  -51.615 53.517  1.00 110.71 ? 1043 ASP A C     1 
ATOM   8996  O  O     . ASP D 4  1043 ? 15.477  -50.828 53.112  1.00 106.55 ? 1043 ASP A O     1 
ATOM   8997  C  CB    . ASP D 4  1043 ? 15.358  -54.014 53.703  1.00 121.29 ? 1043 ASP A CB    1 
ATOM   8998  C  CG    . ASP D 4  1043 ? 16.177  -54.994 54.540  1.00 130.88 ? 1043 ASP A CG    1 
ATOM   8999  O  OD1   . ASP D 4  1043 ? 15.630  -55.571 55.502  1.00 134.14 ? 1043 ASP A OD1   1 
ATOM   9000  O  OD2   . ASP D 4  1043 ? 17.373  -55.187 54.240  1.00 136.51 ? 1043 ASP A OD2   1 
ATOM   9001  N  N     . TRP D 4  1044 ? 13.317  -51.495 53.174  1.00 122.01 ? 1044 TRP A N     1 
ATOM   9002  C  CA    . TRP D 4  1044 ? 12.879  -50.351 52.377  1.00 126.57 ? 1044 TRP A CA    1 
ATOM   9003  C  C     . TRP D 4  1044 ? 13.011  -49.044 53.158  1.00 116.09 ? 1044 TRP A C     1 
ATOM   9004  O  O     . TRP D 4  1044 ? 13.384  -48.013 52.585  1.00 129.44 ? 1044 TRP A O     1 
ATOM   9005  C  CB    . TRP D 4  1044 ? 11.436  -50.545 51.910  1.00 129.24 ? 1044 TRP A CB    1 
ATOM   9006  C  CG    . TRP D 4  1044 ? 10.952  -49.433 51.017  1.00 124.30 ? 1044 TRP A CG    1 
ATOM   9007  C  CD1   . TRP D 4  1044 ? 11.353  -49.181 49.736  1.00 116.11 ? 1044 TRP A CD1   1 
ATOM   9008  C  CD2   . TRP D 4  1044 ? 10.026  -48.390 51.358  1.00 116.71 ? 1044 TRP A CD2   1 
ATOM   9009  N  NE1   . TRP D 4  1044 ? 10.713  -48.067 49.249  1.00 111.70 ? 1044 TRP A NE1   1 
ATOM   9010  C  CE2   . TRP D 4  1044 ? 9.896   -47.561 50.225  1.00 112.51 ? 1044 TRP A CE2   1 
ATOM   9011  C  CE3   . TRP D 4  1044 ? 9.286   -48.083 52.506  1.00 103.13 ? 1044 TRP A CE3   1 
ATOM   9012  C  CZ2   . TRP D 4  1044 ? 9.057   -46.450 50.205  1.00 106.57 ? 1044 TRP A CZ2   1 
ATOM   9013  C  CZ3   . TRP D 4  1044 ? 8.457   -46.973 52.481  1.00 98.43  ? 1044 TRP A CZ3   1 
ATOM   9014  C  CH2   . TRP D 4  1044 ? 8.349   -46.173 51.341  1.00 97.97  ? 1044 TRP A CH2   1 
ATOM   9015  N  N     . VAL D 4  1045 ? 12.705  -49.066 54.463  1.00 95.43  ? 1045 VAL A N     1 
ATOM   9016  C  CA