data_6UPY
# 
_entry.id   6UPY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.326 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UPY         
WWPDB D_1000244987 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UPY 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Oh, J.'   1 0000-0002-7625-2779 
'Wang, D.' 2 0000-0002-2829-1546 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                9338 
_citation.page_last                 9348 
_citation.title                     
'RNA polymerase II stalls on oxidative DNA damage via a torsion-latch mechanism involving lone pair-pi and CH-pi interactions.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1919904117 
_citation.pdbx_database_id_PubMed   32284409 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Oh, J.'        1 0000-0002-7625-2779 
primary 'Fleming, A.M.' 2 0000-0002-2000-0310 
primary 'Xu, J.'        3 ?                   
primary 'Chong, J.'     4 ?                   
primary 'Burrows, C.J.' 5 0000-0001-7253-8529 
primary 'Wang, D.'      6 0000-0002-2829-1546 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.920 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UPY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     168.536 
_cell.length_a_esd                 ? 
_cell.length_b                     223.125 
_cell.length_b_esd                 ? 
_cell.length_c                     193.062 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UPY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn RNA                                                          2934.831   1 ?       ? ? ? 
2  polymer     syn 'Template strand DNA'                                        8745.599   1 ?       ? ? ? 
3  polymer     syn 'Non-template strand DNA'                                    5663.694   1 ?       ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                191821.578 1 2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                138937.297 1 2.7.7.6 ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                35330.457  1 ?       ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 25117.094  1 ?       ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 17931.834  1 ?       ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 16525.363  1 ?       ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                14308.161  1 ?       ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8290.732   1 ?       ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'               13633.493  1 ?       ? ? ? 
13 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7729.969   1 ?       ? ? ? 
14 non-polymer syn 'ZINC ION'                                                   65.409     8 ?       ? ? ? 
15 non-polymer syn 'MAGNESIUM ION'                                              24.305     1 ?       ? ? ? 
16 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER'              505.208    1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4  'RNA polymerase II subunit B1,DNA-directed RNA polymerase III largest subunit,RNA polymerase II subunit B220' 
5  'RNA polymerase II subunit 2,B150,DNA-directed RNA polymerase II 140 kDa polypeptide' 
6  'RNA polymerase II subunit B3,B44.5,DNA-directed RNA polymerase II 45 kDa polypeptide' 
7  'RNA polymerases I,II,and III subunit ABC1,ABC27,DNA-directed RNA polymerases I,and III 27 kDa polypeptide' 
8  'RNA polymerases I,II,and III subunit ABC2,ABC23,DNA-directed RNA polymerases I,and III 23 kDa polypeptide' 
9  'RNA polymerases I,II,and III subunit ABC3,ABC14.4,ABC14.5,DNA-directed RNA polymerases I,and III 14.5 kDa polypeptide' 
10 
'RNA polymerase II subunit B9,B12.6,DNA-directed RNA polymerase II 14.2 kDa polypeptide,DNA-directed RNA polymerase II subunit 9' 
11 'RNA polymerases I,II,and III subunit ABC5,ABC10-beta,ABC8,DNA-directed RNA polymerases I,and III 8.3 kDa polypeptide' 
12 'RNA polymerase II subunit B11,B13.6,DNA-directed RNA polymerase II 13.6 kDa polypeptide' 
13 'RNA polymerases I,II,and III subunit ABC4,ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide      no no  AUCGAGAGG AUCGAGAGG R ? 
2  polydeoxyribonucleotide no yes 
;(DC)(DC)(DT)(DT)(DC)(DT)(DC)(DT)(DC)(DT)(DC)(DT)(DC)(DG)(DC)(DT)(DG)(DA)(G35)
(DC)(DC)(DT)(DC)(DT)(DC)(DG)(DA)(DT)(DG)
;
CCTTCTCTCTCTCGCTGAXCCTCTCGATG T ? 
3  polydeoxyribonucleotide no no  '(DT)(DC)(DA)(DG)(DC)(DG)(DA)(DG)(DA)(DG)(DA)(DG)(DA)(DG)(DA)(DA)(DG)(DG)' TCAGCGAGAGAGAGAAGG N 
? 
4  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
5  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
6  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
7  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
8  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
9  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
10 'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
11 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
12 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
13 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    A   n 
1  2    U   n 
1  3    C   n 
1  4    G   n 
1  5    A   n 
1  6    G   n 
1  7    A   n 
1  8    G   n 
1  9    G   n 
2  1    DC  n 
2  2    DC  n 
2  3    DT  n 
2  4    DT  n 
2  5    DC  n 
2  6    DT  n 
2  7    DC  n 
2  8    DT  n 
2  9    DC  n 
2  10   DT  n 
2  11   DC  n 
2  12   DT  n 
2  13   DC  n 
2  14   DG  n 
2  15   DC  n 
2  16   DT  n 
2  17   DG  n 
2  18   DA  n 
2  19   G35 n 
2  20   DC  n 
2  21   DC  n 
2  22   DT  n 
2  23   DC  n 
2  24   DT  n 
2  25   DC  n 
2  26   DG  n 
2  27   DA  n 
2  28   DT  n 
2  29   DG  n 
3  1    DT  n 
3  2    DC  n 
3  3    DA  n 
3  4    DG  n 
3  5    DC  n 
3  6    DG  n 
3  7    DA  n 
3  8    DG  n 
3  9    DA  n 
3  10   DG  n 
3  11   DA  n 
3  12   DG  n 
3  13   DA  n 
3  14   DG  n 
3  15   DA  n 
3  16   DA  n 
3  17   DG  n 
3  18   DG  n 
4  1    MET n 
4  2    VAL n 
4  3    GLY n 
4  4    GLN n 
4  5    GLN n 
4  6    TYR n 
4  7    SER n 
4  8    SER n 
4  9    ALA n 
4  10   PRO n 
4  11   LEU n 
4  12   ARG n 
4  13   THR n 
4  14   VAL n 
4  15   LYS n 
4  16   GLU n 
4  17   VAL n 
4  18   GLN n 
4  19   PHE n 
4  20   GLY n 
4  21   LEU n 
4  22   PHE n 
4  23   SER n 
4  24   PRO n 
4  25   GLU n 
4  26   GLU n 
4  27   VAL n 
4  28   ARG n 
4  29   ALA n 
4  30   ILE n 
4  31   SER n 
4  32   VAL n 
4  33   ALA n 
4  34   LYS n 
4  35   ILE n 
4  36   ARG n 
4  37   PHE n 
4  38   PRO n 
4  39   GLU n 
4  40   THR n 
4  41   MET n 
4  42   ASP n 
4  43   GLU n 
4  44   THR n 
4  45   GLN n 
4  46   THR n 
4  47   ARG n 
4  48   ALA n 
4  49   LYS n 
4  50   ILE n 
4  51   GLY n 
4  52   GLY n 
4  53   LEU n 
4  54   ASN n 
4  55   ASP n 
4  56   PRO n 
4  57   ARG n 
4  58   LEU n 
4  59   GLY n 
4  60   SER n 
4  61   ILE n 
4  62   ASP n 
4  63   ARG n 
4  64   ASN n 
4  65   LEU n 
4  66   LYS n 
4  67   CYS n 
4  68   GLN n 
4  69   THR n 
4  70   CYS n 
4  71   GLN n 
4  72   GLU n 
4  73   GLY n 
4  74   MET n 
4  75   ASN n 
4  76   GLU n 
4  77   CYS n 
4  78   PRO n 
4  79   GLY n 
4  80   HIS n 
4  81   PHE n 
4  82   GLY n 
4  83   HIS n 
4  84   ILE n 
4  85   ASP n 
4  86   LEU n 
4  87   ALA n 
4  88   LYS n 
4  89   PRO n 
4  90   VAL n 
4  91   PHE n 
4  92   HIS n 
4  93   VAL n 
4  94   GLY n 
4  95   PHE n 
4  96   ILE n 
4  97   ALA n 
4  98   LYS n 
4  99   ILE n 
4  100  LYS n 
4  101  LYS n 
4  102  VAL n 
4  103  CYS n 
4  104  GLU n 
4  105  CYS n 
4  106  VAL n 
4  107  CYS n 
4  108  MET n 
4  109  HIS n 
4  110  CYS n 
4  111  GLY n 
4  112  LYS n 
4  113  LEU n 
4  114  LEU n 
4  115  LEU n 
4  116  ASP n 
4  117  GLU n 
4  118  HIS n 
4  119  ASN n 
4  120  GLU n 
4  121  LEU n 
4  122  MET n 
4  123  ARG n 
4  124  GLN n 
4  125  ALA n 
4  126  LEU n 
4  127  ALA n 
4  128  ILE n 
4  129  LYS n 
4  130  ASP n 
4  131  SER n 
4  132  LYS n 
4  133  LYS n 
4  134  ARG n 
4  135  PHE n 
4  136  ALA n 
4  137  ALA n 
4  138  ILE n 
4  139  TRP n 
4  140  THR n 
4  141  LEU n 
4  142  CYS n 
4  143  LYS n 
4  144  THR n 
4  145  LYS n 
4  146  MET n 
4  147  VAL n 
4  148  CYS n 
4  149  GLU n 
4  150  THR n 
4  151  ASP n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  GLU n 
4  156  ASP n 
4  157  ASP n 
4  158  PRO n 
4  159  THR n 
4  160  GLN n 
4  161  LEU n 
4  162  VAL n 
4  163  SER n 
4  164  ARG n 
4  165  GLY n 
4  166  GLY n 
4  167  CYS n 
4  168  GLY n 
4  169  ASN n 
4  170  THR n 
4  171  GLN n 
4  172  PRO n 
4  173  THR n 
4  174  ILE n 
4  175  ARG n 
4  176  LYS n 
4  177  ASP n 
4  178  GLY n 
4  179  LEU n 
4  180  LYS n 
4  181  LEU n 
4  182  VAL n 
4  183  GLY n 
4  184  SER n 
4  185  TRP n 
4  186  LYS n 
4  187  LYS n 
4  188  ASP n 
4  189  ARG n 
4  190  ALA n 
4  191  THR n 
4  192  GLY n 
4  193  ASP n 
4  194  ALA n 
4  195  ASP n 
4  196  GLU n 
4  197  PRO n 
4  198  GLU n 
4  199  LEU n 
4  200  ARG n 
4  201  VAL n 
4  202  LEU n 
4  203  SER n 
4  204  THR n 
4  205  GLU n 
4  206  GLU n 
4  207  ILE n 
4  208  LEU n 
4  209  ASN n 
4  210  ILE n 
4  211  PHE n 
4  212  LYS n 
4  213  HIS n 
4  214  ILE n 
4  215  SER n 
4  216  VAL n 
4  217  LYS n 
4  218  ASP n 
4  219  PHE n 
4  220  THR n 
4  221  SER n 
4  222  LEU n 
4  223  GLY n 
4  224  PHE n 
4  225  ASN n 
4  226  GLU n 
4  227  VAL n 
4  228  PHE n 
4  229  SER n 
4  230  ARG n 
4  231  PRO n 
4  232  GLU n 
4  233  TRP n 
4  234  MET n 
4  235  ILE n 
4  236  LEU n 
4  237  THR n 
4  238  CYS n 
4  239  LEU n 
4  240  PRO n 
4  241  VAL n 
4  242  PRO n 
4  243  PRO n 
4  244  PRO n 
4  245  PRO n 
4  246  VAL n 
4  247  ARG n 
4  248  PRO n 
4  249  SER n 
4  250  ILE n 
4  251  SER n 
4  252  PHE n 
4  253  ASN n 
4  254  GLU n 
4  255  SER n 
4  256  GLN n 
4  257  ARG n 
4  258  GLY n 
4  259  GLU n 
4  260  ASP n 
4  261  ASP n 
4  262  LEU n 
4  263  THR n 
4  264  PHE n 
4  265  LYS n 
4  266  LEU n 
4  267  ALA n 
4  268  ASP n 
4  269  ILE n 
4  270  LEU n 
4  271  LYS n 
4  272  ALA n 
4  273  ASN n 
4  274  ILE n 
4  275  SER n 
4  276  LEU n 
4  277  GLU n 
4  278  THR n 
4  279  LEU n 
4  280  GLU n 
4  281  HIS n 
4  282  ASN n 
4  283  GLY n 
4  284  ALA n 
4  285  PRO n 
4  286  HIS n 
4  287  HIS n 
4  288  ALA n 
4  289  ILE n 
4  290  GLU n 
4  291  GLU n 
4  292  ALA n 
4  293  GLU n 
4  294  SER n 
4  295  LEU n 
4  296  LEU n 
4  297  GLN n 
4  298  PHE n 
4  299  HIS n 
4  300  VAL n 
4  301  ALA n 
4  302  THR n 
4  303  TYR n 
4  304  MET n 
4  305  ASP n 
4  306  ASN n 
4  307  ASP n 
4  308  ILE n 
4  309  ALA n 
4  310  GLY n 
4  311  GLN n 
4  312  PRO n 
4  313  GLN n 
4  314  ALA n 
4  315  LEU n 
4  316  GLN n 
4  317  LYS n 
4  318  SER n 
4  319  GLY n 
4  320  ARG n 
4  321  PRO n 
4  322  VAL n 
4  323  LYS n 
4  324  SER n 
4  325  ILE n 
4  326  ARG n 
4  327  ALA n 
4  328  ARG n 
4  329  LEU n 
4  330  LYS n 
4  331  GLY n 
4  332  LYS n 
4  333  GLU n 
4  334  GLY n 
4  335  ARG n 
4  336  ILE n 
4  337  ARG n 
4  338  GLY n 
4  339  ASN n 
4  340  LEU n 
4  341  MET n 
4  342  GLY n 
4  343  LYS n 
4  344  ARG n 
4  345  VAL n 
4  346  ASP n 
4  347  PHE n 
4  348  SER n 
4  349  ALA n 
4  350  ARG n 
4  351  THR n 
4  352  VAL n 
4  353  ILE n 
4  354  SER n 
4  355  GLY n 
4  356  ASP n 
4  357  PRO n 
4  358  ASN n 
4  359  LEU n 
4  360  GLU n 
4  361  LEU n 
4  362  ASP n 
4  363  GLN n 
4  364  VAL n 
4  365  GLY n 
4  366  VAL n 
4  367  PRO n 
4  368  LYS n 
4  369  SER n 
4  370  ILE n 
4  371  ALA n 
4  372  LYS n 
4  373  THR n 
4  374  LEU n 
4  375  THR n 
4  376  TYR n 
4  377  PRO n 
4  378  GLU n 
4  379  VAL n 
4  380  VAL n 
4  381  THR n 
4  382  PRO n 
4  383  TYR n 
4  384  ASN n 
4  385  ILE n 
4  386  ASP n 
4  387  ARG n 
4  388  LEU n 
4  389  THR n 
4  390  GLN n 
4  391  LEU n 
4  392  VAL n 
4  393  ARG n 
4  394  ASN n 
4  395  GLY n 
4  396  PRO n 
4  397  ASN n 
4  398  GLU n 
4  399  HIS n 
4  400  PRO n 
4  401  GLY n 
4  402  ALA n 
4  403  LYS n 
4  404  TYR n 
4  405  VAL n 
4  406  ILE n 
4  407  ARG n 
4  408  ASP n 
4  409  SER n 
4  410  GLY n 
4  411  ASP n 
4  412  ARG n 
4  413  ILE n 
4  414  ASP n 
4  415  LEU n 
4  416  ARG n 
4  417  TYR n 
4  418  SER n 
4  419  LYS n 
4  420  ARG n 
4  421  ALA n 
4  422  GLY n 
4  423  ASP n 
4  424  ILE n 
4  425  GLN n 
4  426  LEU n 
4  427  GLN n 
4  428  TYR n 
4  429  GLY n 
4  430  TRP n 
4  431  LYS n 
4  432  VAL n 
4  433  GLU n 
4  434  ARG n 
4  435  HIS n 
4  436  ILE n 
4  437  MET n 
4  438  ASP n 
4  439  ASN n 
4  440  ASP n 
4  441  PRO n 
4  442  VAL n 
4  443  LEU n 
4  444  PHE n 
4  445  ASN n 
4  446  ARG n 
4  447  GLN n 
4  448  PRO n 
4  449  SER n 
4  450  LEU n 
4  451  HIS n 
4  452  LYS n 
4  453  MET n 
4  454  SER n 
4  455  MET n 
4  456  MET n 
4  457  ALA n 
4  458  HIS n 
4  459  ARG n 
4  460  VAL n 
4  461  LYS n 
4  462  VAL n 
4  463  ILE n 
4  464  PRO n 
4  465  TYR n 
4  466  SER n 
4  467  THR n 
4  468  PHE n 
4  469  ARG n 
4  470  LEU n 
4  471  ASN n 
4  472  LEU n 
4  473  SER n 
4  474  VAL n 
4  475  THR n 
4  476  SER n 
4  477  PRO n 
4  478  TYR n 
4  479  ASN n 
4  480  ALA n 
4  481  ASP n 
4  482  PHE n 
4  483  ASP n 
4  484  GLY n 
4  485  ASP n 
4  486  GLU n 
4  487  MET n 
4  488  ASN n 
4  489  LEU n 
4  490  HIS n 
4  491  VAL n 
4  492  PRO n 
4  493  GLN n 
4  494  SER n 
4  495  GLU n 
4  496  GLU n 
4  497  THR n 
4  498  ARG n 
4  499  ALA n 
4  500  GLU n 
4  501  LEU n 
4  502  SER n 
4  503  GLN n 
4  504  LEU n 
4  505  CYS n 
4  506  ALA n 
4  507  VAL n 
4  508  PRO n 
4  509  LEU n 
4  510  GLN n 
4  511  ILE n 
4  512  VAL n 
4  513  SER n 
4  514  PRO n 
4  515  GLN n 
4  516  SER n 
4  517  ASN n 
4  518  LYS n 
4  519  PRO n 
4  520  CYS n 
4  521  MET n 
4  522  GLY n 
4  523  ILE n 
4  524  VAL n 
4  525  GLN n 
4  526  ASP n 
4  527  THR n 
4  528  LEU n 
4  529  CYS n 
4  530  GLY n 
4  531  ILE n 
4  532  ARG n 
4  533  LYS n 
4  534  LEU n 
4  535  THR n 
4  536  LEU n 
4  537  ARG n 
4  538  ASP n 
4  539  THR n 
4  540  PHE n 
4  541  ILE n 
4  542  GLU n 
4  543  LEU n 
4  544  ASP n 
4  545  GLN n 
4  546  VAL n 
4  547  LEU n 
4  548  ASN n 
4  549  MET n 
4  550  LEU n 
4  551  TYR n 
4  552  TRP n 
4  553  VAL n 
4  554  PRO n 
4  555  ASP n 
4  556  TRP n 
4  557  ASP n 
4  558  GLY n 
4  559  VAL n 
4  560  ILE n 
4  561  PRO n 
4  562  THR n 
4  563  PRO n 
4  564  ALA n 
4  565  ILE n 
4  566  ILE n 
4  567  LYS n 
4  568  PRO n 
4  569  LYS n 
4  570  PRO n 
4  571  LEU n 
4  572  TRP n 
4  573  SER n 
4  574  GLY n 
4  575  LYS n 
4  576  GLN n 
4  577  ILE n 
4  578  LEU n 
4  579  SER n 
4  580  VAL n 
4  581  ALA n 
4  582  ILE n 
4  583  PRO n 
4  584  ASN n 
4  585  GLY n 
4  586  ILE n 
4  587  HIS n 
4  588  LEU n 
4  589  GLN n 
4  590  ARG n 
4  591  PHE n 
4  592  ASP n 
4  593  GLU n 
4  594  GLY n 
4  595  THR n 
4  596  THR n 
4  597  LEU n 
4  598  LEU n 
4  599  SER n 
4  600  PRO n 
4  601  LYS n 
4  602  ASP n 
4  603  ASN n 
4  604  GLY n 
4  605  MET n 
4  606  LEU n 
4  607  ILE n 
4  608  ILE n 
4  609  ASP n 
4  610  GLY n 
4  611  GLN n 
4  612  ILE n 
4  613  ILE n 
4  614  PHE n 
4  615  GLY n 
4  616  VAL n 
4  617  VAL n 
4  618  GLU n 
4  619  LYS n 
4  620  LYS n 
4  621  THR n 
4  622  VAL n 
4  623  GLY n 
4  624  SER n 
4  625  SER n 
4  626  ASN n 
4  627  GLY n 
4  628  GLY n 
4  629  LEU n 
4  630  ILE n 
4  631  HIS n 
4  632  VAL n 
4  633  VAL n 
4  634  THR n 
4  635  ARG n 
4  636  GLU n 
4  637  LYS n 
4  638  GLY n 
4  639  PRO n 
4  640  GLN n 
4  641  VAL n 
4  642  CYS n 
4  643  ALA n 
4  644  LYS n 
4  645  LEU n 
4  646  PHE n 
4  647  GLY n 
4  648  ASN n 
4  649  ILE n 
4  650  GLN n 
4  651  LYS n 
4  652  VAL n 
4  653  VAL n 
4  654  ASN n 
4  655  PHE n 
4  656  TRP n 
4  657  LEU n 
4  658  LEU n 
4  659  HIS n 
4  660  ASN n 
4  661  GLY n 
4  662  PHE n 
4  663  SER n 
4  664  THR n 
4  665  GLY n 
4  666  ILE n 
4  667  GLY n 
4  668  ASP n 
4  669  THR n 
4  670  ILE n 
4  671  ALA n 
4  672  ASP n 
4  673  GLY n 
4  674  PRO n 
4  675  THR n 
4  676  MET n 
4  677  ARG n 
4  678  GLU n 
4  679  ILE n 
4  680  THR n 
4  681  GLU n 
4  682  THR n 
4  683  ILE n 
4  684  ALA n 
4  685  GLU n 
4  686  ALA n 
4  687  LYS n 
4  688  LYS n 
4  689  LYS n 
4  690  VAL n 
4  691  LEU n 
4  692  ASP n 
4  693  VAL n 
4  694  THR n 
4  695  LYS n 
4  696  GLU n 
4  697  ALA n 
4  698  GLN n 
4  699  ALA n 
4  700  ASN n 
4  701  LEU n 
4  702  LEU n 
4  703  THR n 
4  704  ALA n 
4  705  LYS n 
4  706  HIS n 
4  707  GLY n 
4  708  MET n 
4  709  THR n 
4  710  LEU n 
4  711  ARG n 
4  712  GLU n 
4  713  SER n 
4  714  PHE n 
4  715  GLU n 
4  716  ASP n 
4  717  ASN n 
4  718  VAL n 
4  719  VAL n 
4  720  ARG n 
4  721  PHE n 
4  722  LEU n 
4  723  ASN n 
4  724  GLU n 
4  725  ALA n 
4  726  ARG n 
4  727  ASP n 
4  728  LYS n 
4  729  ALA n 
4  730  GLY n 
4  731  ARG n 
4  732  LEU n 
4  733  ALA n 
4  734  GLU n 
4  735  VAL n 
4  736  ASN n 
4  737  LEU n 
4  738  LYS n 
4  739  ASP n 
4  740  LEU n 
4  741  ASN n 
4  742  ASN n 
4  743  VAL n 
4  744  LYS n 
4  745  GLN n 
4  746  MET n 
4  747  VAL n 
4  748  MET n 
4  749  ALA n 
4  750  GLY n 
4  751  SER n 
4  752  LYS n 
4  753  GLY n 
4  754  SER n 
4  755  PHE n 
4  756  ILE n 
4  757  ASN n 
4  758  ILE n 
4  759  ALA n 
4  760  GLN n 
4  761  MET n 
4  762  SER n 
4  763  ALA n 
4  764  CYS n 
4  765  VAL n 
4  766  GLY n 
4  767  GLN n 
4  768  GLN n 
4  769  SER n 
4  770  VAL n 
4  771  GLU n 
4  772  GLY n 
4  773  LYS n 
4  774  ARG n 
4  775  ILE n 
4  776  ALA n 
4  777  PHE n 
4  778  GLY n 
4  779  PHE n 
4  780  VAL n 
4  781  ASP n 
4  782  ARG n 
4  783  THR n 
4  784  LEU n 
4  785  PRO n 
4  786  HIS n 
4  787  PHE n 
4  788  SER n 
4  789  LYS n 
4  790  ASP n 
4  791  ASP n 
4  792  TYR n 
4  793  SER n 
4  794  PRO n 
4  795  GLU n 
4  796  SER n 
4  797  LYS n 
4  798  GLY n 
4  799  PHE n 
4  800  VAL n 
4  801  GLU n 
4  802  ASN n 
4  803  SER n 
4  804  TYR n 
4  805  LEU n 
4  806  ARG n 
4  807  GLY n 
4  808  LEU n 
4  809  THR n 
4  810  PRO n 
4  811  GLN n 
4  812  GLU n 
4  813  PHE n 
4  814  PHE n 
4  815  PHE n 
4  816  HIS n 
4  817  ALA n 
4  818  MET n 
4  819  GLY n 
4  820  GLY n 
4  821  ARG n 
4  822  GLU n 
4  823  GLY n 
4  824  LEU n 
4  825  ILE n 
4  826  ASP n 
4  827  THR n 
4  828  ALA n 
4  829  VAL n 
4  830  LYS n 
4  831  THR n 
4  832  ALA n 
4  833  GLU n 
4  834  THR n 
4  835  GLY n 
4  836  TYR n 
4  837  ILE n 
4  838  GLN n 
4  839  ARG n 
4  840  ARG n 
4  841  LEU n 
4  842  VAL n 
4  843  LYS n 
4  844  ALA n 
4  845  LEU n 
4  846  GLU n 
4  847  ASP n 
4  848  ILE n 
4  849  MET n 
4  850  VAL n 
4  851  HIS n 
4  852  TYR n 
4  853  ASP n 
4  854  ASN n 
4  855  THR n 
4  856  THR n 
4  857  ARG n 
4  858  ASN n 
4  859  SER n 
4  860  LEU n 
4  861  GLY n 
4  862  ASN n 
4  863  VAL n 
4  864  ILE n 
4  865  GLN n 
4  866  PHE n 
4  867  ILE n 
4  868  TYR n 
4  869  GLY n 
4  870  GLU n 
4  871  ASP n 
4  872  GLY n 
4  873  MET n 
4  874  ASP n 
4  875  ALA n 
4  876  ALA n 
4  877  HIS n 
4  878  ILE n 
4  879  GLU n 
4  880  LYS n 
4  881  GLN n 
4  882  SER n 
4  883  LEU n 
4  884  ASP n 
4  885  THR n 
4  886  ILE n 
4  887  GLY n 
4  888  GLY n 
4  889  SER n 
4  890  ASP n 
4  891  ALA n 
4  892  ALA n 
4  893  PHE n 
4  894  GLU n 
4  895  LYS n 
4  896  ARG n 
4  897  TYR n 
4  898  ARG n 
4  899  VAL n 
4  900  ASP n 
4  901  LEU n 
4  902  LEU n 
4  903  ASN n 
4  904  THR n 
4  905  ASP n 
4  906  HIS n 
4  907  THR n 
4  908  LEU n 
4  909  ASP n 
4  910  PRO n 
4  911  SER n 
4  912  LEU n 
4  913  LEU n 
4  914  GLU n 
4  915  SER n 
4  916  GLY n 
4  917  SER n 
4  918  GLU n 
4  919  ILE n 
4  920  LEU n 
4  921  GLY n 
4  922  ASP n 
4  923  LEU n 
4  924  LYS n 
4  925  LEU n 
4  926  GLN n 
4  927  VAL n 
4  928  LEU n 
4  929  LEU n 
4  930  ASP n 
4  931  GLU n 
4  932  GLU n 
4  933  TYR n 
4  934  LYS n 
4  935  GLN n 
4  936  LEU n 
4  937  VAL n 
4  938  LYS n 
4  939  ASP n 
4  940  ARG n 
4  941  LYS n 
4  942  PHE n 
4  943  LEU n 
4  944  ARG n 
4  945  GLU n 
4  946  VAL n 
4  947  PHE n 
4  948  VAL n 
4  949  ASP n 
4  950  GLY n 
4  951  GLU n 
4  952  ALA n 
4  953  ASN n 
4  954  TRP n 
4  955  PRO n 
4  956  LEU n 
4  957  PRO n 
4  958  VAL n 
4  959  ASN n 
4  960  ILE n 
4  961  ARG n 
4  962  ARG n 
4  963  ILE n 
4  964  ILE n 
4  965  GLN n 
4  966  ASN n 
4  967  ALA n 
4  968  GLN n 
4  969  GLN n 
4  970  THR n 
4  971  PHE n 
4  972  HIS n 
4  973  ILE n 
4  974  ASP n 
4  975  HIS n 
4  976  THR n 
4  977  LYS n 
4  978  PRO n 
4  979  SER n 
4  980  ASP n 
4  981  LEU n 
4  982  THR n 
4  983  ILE n 
4  984  LYS n 
4  985  ASP n 
4  986  ILE n 
4  987  VAL n 
4  988  LEU n 
4  989  GLY n 
4  990  VAL n 
4  991  LYS n 
4  992  ASP n 
4  993  LEU n 
4  994  GLN n 
4  995  GLU n 
4  996  ASN n 
4  997  LEU n 
4  998  LEU n 
4  999  VAL n 
4  1000 LEU n 
4  1001 ARG n 
4  1002 GLY n 
4  1003 LYS n 
4  1004 ASN n 
4  1005 GLU n 
4  1006 ILE n 
4  1007 ILE n 
4  1008 GLN n 
4  1009 ASN n 
4  1010 ALA n 
4  1011 GLN n 
4  1012 ARG n 
4  1013 ASP n 
4  1014 ALA n 
4  1015 VAL n 
4  1016 THR n 
4  1017 LEU n 
4  1018 PHE n 
4  1019 CYS n 
4  1020 CYS n 
4  1021 LEU n 
4  1022 LEU n 
4  1023 ARG n 
4  1024 SER n 
4  1025 ARG n 
4  1026 LEU n 
4  1027 ALA n 
4  1028 THR n 
4  1029 ARG n 
4  1030 ARG n 
4  1031 VAL n 
4  1032 LEU n 
4  1033 GLN n 
4  1034 GLU n 
4  1035 TYR n 
4  1036 ARG n 
4  1037 LEU n 
4  1038 THR n 
4  1039 LYS n 
4  1040 GLN n 
4  1041 ALA n 
4  1042 PHE n 
4  1043 ASP n 
4  1044 TRP n 
4  1045 VAL n 
4  1046 LEU n 
4  1047 SER n 
4  1048 ASN n 
4  1049 ILE n 
4  1050 GLU n 
4  1051 ALA n 
4  1052 GLN n 
4  1053 PHE n 
4  1054 LEU n 
4  1055 ARG n 
4  1056 SER n 
4  1057 VAL n 
4  1058 VAL n 
4  1059 HIS n 
4  1060 PRO n 
4  1061 GLY n 
4  1062 GLU n 
4  1063 MET n 
4  1064 VAL n 
4  1065 GLY n 
4  1066 VAL n 
4  1067 LEU n 
4  1068 ALA n 
4  1069 ALA n 
4  1070 GLN n 
4  1071 SER n 
4  1072 ILE n 
4  1073 GLY n 
4  1074 GLU n 
4  1075 PRO n 
4  1076 ALA n 
4  1077 THR n 
4  1078 GLN n 
4  1079 MET n 
4  1080 THR n 
4  1081 LEU n 
4  1082 ASN n 
4  1083 THR n 
4  1084 PHE n 
4  1085 HIS n 
4  1086 PHE n 
4  1087 ALA n 
4  1088 GLY n 
4  1089 VAL n 
4  1090 ALA n 
4  1091 SER n 
4  1092 LYS n 
4  1093 LYS n 
4  1094 VAL n 
4  1095 THR n 
4  1096 SER n 
4  1097 GLY n 
4  1098 VAL n 
4  1099 PRO n 
4  1100 ARG n 
4  1101 LEU n 
4  1102 LYS n 
4  1103 GLU n 
4  1104 ILE n 
4  1105 LEU n 
4  1106 ASN n 
4  1107 VAL n 
4  1108 ALA n 
4  1109 LYS n 
4  1110 ASN n 
4  1111 MET n 
4  1112 LYS n 
4  1113 THR n 
4  1114 PRO n 
4  1115 SER n 
4  1116 LEU n 
4  1117 THR n 
4  1118 VAL n 
4  1119 TYR n 
4  1120 LEU n 
4  1121 GLU n 
4  1122 PRO n 
4  1123 GLY n 
4  1124 HIS n 
4  1125 ALA n 
4  1126 ALA n 
4  1127 ASP n 
4  1128 GLN n 
4  1129 GLU n 
4  1130 GLN n 
4  1131 ALA n 
4  1132 LYS n 
4  1133 LEU n 
4  1134 ILE n 
4  1135 ARG n 
4  1136 SER n 
4  1137 ALA n 
4  1138 ILE n 
4  1139 GLU n 
4  1140 HIS n 
4  1141 THR n 
4  1142 THR n 
4  1143 LEU n 
4  1144 LYS n 
4  1145 SER n 
4  1146 VAL n 
4  1147 THR n 
4  1148 ILE n 
4  1149 ALA n 
4  1150 SER n 
4  1151 GLU n 
4  1152 ILE n 
4  1153 TYR n 
4  1154 TYR n 
4  1155 ASP n 
4  1156 PRO n 
4  1157 ASP n 
4  1158 PRO n 
4  1159 ARG n 
4  1160 SER n 
4  1161 THR n 
4  1162 VAL n 
4  1163 ILE n 
4  1164 PRO n 
4  1165 GLU n 
4  1166 ASP n 
4  1167 GLU n 
4  1168 GLU n 
4  1169 ILE n 
4  1170 ILE n 
4  1171 GLN n 
4  1172 LEU n 
4  1173 HIS n 
4  1174 PHE n 
4  1175 SER n 
4  1176 LEU n 
4  1177 LEU n 
4  1178 ASP n 
4  1179 GLU n 
4  1180 GLU n 
4  1181 ALA n 
4  1182 GLU n 
4  1183 GLN n 
4  1184 SER n 
4  1185 PHE n 
4  1186 ASP n 
4  1187 GLN n 
4  1188 GLN n 
4  1189 SER n 
4  1190 PRO n 
4  1191 TRP n 
4  1192 LEU n 
4  1193 LEU n 
4  1194 ARG n 
4  1195 LEU n 
4  1196 GLU n 
4  1197 LEU n 
4  1198 ASP n 
4  1199 ARG n 
4  1200 ALA n 
4  1201 ALA n 
4  1202 MET n 
4  1203 ASN n 
4  1204 ASP n 
4  1205 LYS n 
4  1206 ASP n 
4  1207 LEU n 
4  1208 THR n 
4  1209 MET n 
4  1210 GLY n 
4  1211 GLN n 
4  1212 VAL n 
4  1213 GLY n 
4  1214 GLU n 
4  1215 ARG n 
4  1216 ILE n 
4  1217 LYS n 
4  1218 GLN n 
4  1219 THR n 
4  1220 PHE n 
4  1221 LYS n 
4  1222 ASN n 
4  1223 ASP n 
4  1224 LEU n 
4  1225 PHE n 
4  1226 VAL n 
4  1227 ILE n 
4  1228 TRP n 
4  1229 SER n 
4  1230 GLU n 
4  1231 ASP n 
4  1232 ASN n 
4  1233 ASP n 
4  1234 GLU n 
4  1235 LYS n 
4  1236 LEU n 
4  1237 ILE n 
4  1238 ILE n 
4  1239 ARG n 
4  1240 CYS n 
4  1241 ARG n 
4  1242 VAL n 
4  1243 VAL n 
4  1244 ARG n 
4  1245 PRO n 
4  1246 LYS n 
4  1247 SER n 
4  1248 LEU n 
4  1249 ASP n 
4  1250 ALA n 
4  1251 GLU n 
4  1252 THR n 
4  1253 GLU n 
4  1254 ALA n 
4  1255 GLU n 
4  1256 GLU n 
4  1257 ASP n 
4  1258 HIS n 
4  1259 MET n 
4  1260 LEU n 
4  1261 LYS n 
4  1262 LYS n 
4  1263 ILE n 
4  1264 GLU n 
4  1265 ASN n 
4  1266 THR n 
4  1267 MET n 
4  1268 LEU n 
4  1269 GLU n 
4  1270 ASN n 
4  1271 ILE n 
4  1272 THR n 
4  1273 LEU n 
4  1274 ARG n 
4  1275 GLY n 
4  1276 VAL n 
4  1277 GLU n 
4  1278 ASN n 
4  1279 ILE n 
4  1280 GLU n 
4  1281 ARG n 
4  1282 VAL n 
4  1283 VAL n 
4  1284 MET n 
4  1285 MET n 
4  1286 LYS n 
4  1287 TYR n 
4  1288 ASP n 
4  1289 ARG n 
4  1290 LYS n 
4  1291 VAL n 
4  1292 PRO n 
4  1293 SER n 
4  1294 PRO n 
4  1295 THR n 
4  1296 GLY n 
4  1297 GLU n 
4  1298 TYR n 
4  1299 VAL n 
4  1300 LYS n 
4  1301 GLU n 
4  1302 PRO n 
4  1303 GLU n 
4  1304 TRP n 
4  1305 VAL n 
4  1306 LEU n 
4  1307 GLU n 
4  1308 THR n 
4  1309 ASP n 
4  1310 GLY n 
4  1311 VAL n 
4  1312 ASN n 
4  1313 LEU n 
4  1314 SER n 
4  1315 GLU n 
4  1316 VAL n 
4  1317 MET n 
4  1318 THR n 
4  1319 VAL n 
4  1320 PRO n 
4  1321 GLY n 
4  1322 ILE n 
4  1323 ASP n 
4  1324 PRO n 
4  1325 THR n 
4  1326 ARG n 
4  1327 ILE n 
4  1328 TYR n 
4  1329 THR n 
4  1330 ASN n 
4  1331 SER n 
4  1332 PHE n 
4  1333 ILE n 
4  1334 ASP n 
4  1335 ILE n 
4  1336 MET n 
4  1337 GLU n 
4  1338 VAL n 
4  1339 LEU n 
4  1340 GLY n 
4  1341 ILE n 
4  1342 GLU n 
4  1343 ALA n 
4  1344 GLY n 
4  1345 ARG n 
4  1346 ALA n 
4  1347 ALA n 
4  1348 LEU n 
4  1349 TYR n 
4  1350 LYS n 
4  1351 GLU n 
4  1352 VAL n 
4  1353 TYR n 
4  1354 ASN n 
4  1355 VAL n 
4  1356 ILE n 
4  1357 ALA n 
4  1358 SER n 
4  1359 ASP n 
4  1360 GLY n 
4  1361 SER n 
4  1362 TYR n 
4  1363 VAL n 
4  1364 ASN n 
4  1365 TYR n 
4  1366 ARG n 
4  1367 HIS n 
4  1368 MET n 
4  1369 ALA n 
4  1370 LEU n 
4  1371 LEU n 
4  1372 VAL n 
4  1373 ASP n 
4  1374 VAL n 
4  1375 MET n 
4  1376 THR n 
4  1377 THR n 
4  1378 GLN n 
4  1379 GLY n 
4  1380 GLY n 
4  1381 LEU n 
4  1382 THR n 
4  1383 SER n 
4  1384 VAL n 
4  1385 THR n 
4  1386 ARG n 
4  1387 HIS n 
4  1388 GLY n 
4  1389 PHE n 
4  1390 ASN n 
4  1391 ARG n 
4  1392 SER n 
4  1393 ASN n 
4  1394 THR n 
4  1395 GLY n 
4  1396 ALA n 
4  1397 LEU n 
4  1398 MET n 
4  1399 ARG n 
4  1400 CYS n 
4  1401 SER n 
4  1402 PHE n 
4  1403 GLU n 
4  1404 GLU n 
4  1405 THR n 
4  1406 VAL n 
4  1407 GLU n 
4  1408 ILE n 
4  1409 LEU n 
4  1410 PHE n 
4  1411 GLU n 
4  1412 ALA n 
4  1413 GLY n 
4  1414 ALA n 
4  1415 SER n 
4  1416 ALA n 
4  1417 GLU n 
4  1418 LEU n 
4  1419 ASP n 
4  1420 ASP n 
4  1421 CYS n 
4  1422 ARG n 
4  1423 GLY n 
4  1424 VAL n 
4  1425 SER n 
4  1426 GLU n 
4  1427 ASN n 
4  1428 VAL n 
4  1429 ILE n 
4  1430 LEU n 
4  1431 GLY n 
4  1432 GLN n 
4  1433 MET n 
4  1434 ALA n 
4  1435 PRO n 
4  1436 ILE n 
4  1437 GLY n 
4  1438 THR n 
4  1439 GLY n 
4  1440 ALA n 
4  1441 PHE n 
4  1442 ASP n 
4  1443 VAL n 
4  1444 MET n 
4  1445 ILE n 
4  1446 ASP n 
4  1447 GLU n 
4  1448 GLU n 
4  1449 SER n 
4  1450 LEU n 
4  1451 VAL n 
4  1452 LYS n 
4  1453 TYR n 
4  1454 MET n 
4  1455 PRO n 
4  1456 GLU n 
4  1457 GLN n 
4  1458 LYS n 
4  1459 ILE n 
4  1460 THR n 
4  1461 GLU n 
4  1462 ILE n 
4  1463 GLU n 
4  1464 ASP n 
4  1465 GLY n 
4  1466 GLN n 
4  1467 ASP n 
4  1468 GLY n 
4  1469 GLY n 
4  1470 VAL n 
4  1471 THR n 
4  1472 PRO n 
4  1473 TYR n 
4  1474 SER n 
4  1475 ASN n 
4  1476 GLU n 
4  1477 SER n 
4  1478 GLY n 
4  1479 LEU n 
4  1480 VAL n 
4  1481 ASN n 
4  1482 ALA n 
4  1483 ASP n 
4  1484 LEU n 
4  1485 ASP n 
4  1486 VAL n 
4  1487 LYS n 
4  1488 ASP n 
4  1489 GLU n 
4  1490 LEU n 
4  1491 MET n 
4  1492 PHE n 
4  1493 SER n 
4  1494 PRO n 
4  1495 LEU n 
4  1496 VAL n 
4  1497 ASP n 
4  1498 SER n 
4  1499 GLY n 
4  1500 SER n 
4  1501 ASN n 
4  1502 ASP n 
4  1503 ALA n 
4  1504 MET n 
4  1505 ALA n 
4  1506 GLY n 
4  1507 GLY n 
4  1508 PHE n 
4  1509 THR n 
4  1510 ALA n 
4  1511 TYR n 
4  1512 GLY n 
4  1513 GLY n 
4  1514 ALA n 
4  1515 ASP n 
4  1516 TYR n 
4  1517 GLY n 
4  1518 GLU n 
4  1519 ALA n 
4  1520 THR n 
4  1521 SER n 
4  1522 PRO n 
4  1523 PHE n 
4  1524 GLY n 
4  1525 ALA n 
4  1526 TYR n 
4  1527 GLY n 
4  1528 GLU n 
4  1529 ALA n 
4  1530 PRO n 
4  1531 THR n 
4  1532 SER n 
4  1533 PRO n 
4  1534 GLY n 
4  1535 PHE n 
4  1536 GLY n 
4  1537 VAL n 
4  1538 SER n 
4  1539 SER n 
4  1540 PRO n 
4  1541 GLY n 
4  1542 PHE n 
4  1543 SER n 
4  1544 PRO n 
4  1545 THR n 
4  1546 SER n 
4  1547 PRO n 
4  1548 THR n 
4  1549 TYR n 
4  1550 SER n 
4  1551 PRO n 
4  1552 THR n 
4  1553 SER n 
4  1554 PRO n 
4  1555 ALA n 
4  1556 TYR n 
4  1557 SER n 
4  1558 PRO n 
4  1559 THR n 
4  1560 SER n 
4  1561 PRO n 
4  1562 SER n 
4  1563 TYR n 
4  1564 SER n 
4  1565 PRO n 
4  1566 THR n 
4  1567 SER n 
4  1568 PRO n 
4  1569 SER n 
4  1570 TYR n 
4  1571 SER n 
4  1572 PRO n 
4  1573 THR n 
4  1574 SER n 
4  1575 PRO n 
4  1576 SER n 
4  1577 TYR n 
4  1578 SER n 
4  1579 PRO n 
4  1580 THR n 
4  1581 SER n 
4  1582 PRO n 
4  1583 SER n 
4  1584 TYR n 
4  1585 SER n 
4  1586 PRO n 
4  1587 THR n 
4  1588 SER n 
4  1589 PRO n 
4  1590 SER n 
4  1591 TYR n 
4  1592 SER n 
4  1593 PRO n 
4  1594 THR n 
4  1595 SER n 
4  1596 PRO n 
4  1597 SER n 
4  1598 TYR n 
4  1599 SER n 
4  1600 PRO n 
4  1601 THR n 
4  1602 SER n 
4  1603 PRO n 
4  1604 SER n 
4  1605 TYR n 
4  1606 SER n 
4  1607 PRO n 
4  1608 THR n 
4  1609 SER n 
4  1610 PRO n 
4  1611 SER n 
4  1612 TYR n 
4  1613 SER n 
4  1614 PRO n 
4  1615 THR n 
4  1616 SER n 
4  1617 PRO n 
4  1618 SER n 
4  1619 TYR n 
4  1620 SER n 
4  1621 PRO n 
4  1622 THR n 
4  1623 SER n 
4  1624 PRO n 
4  1625 SER n 
4  1626 TYR n 
4  1627 SER n 
4  1628 PRO n 
4  1629 THR n 
4  1630 SER n 
4  1631 PRO n 
4  1632 SER n 
4  1633 TYR n 
4  1634 SER n 
4  1635 PRO n 
4  1636 THR n 
4  1637 SER n 
4  1638 PRO n 
4  1639 SER n 
4  1640 TYR n 
4  1641 SER n 
4  1642 PRO n 
4  1643 THR n 
4  1644 SER n 
4  1645 PRO n 
4  1646 SER n 
4  1647 TYR n 
4  1648 SER n 
4  1649 PRO n 
4  1650 THR n 
4  1651 SER n 
4  1652 PRO n 
4  1653 SER n 
4  1654 TYR n 
4  1655 SER n 
4  1656 PRO n 
4  1657 THR n 
4  1658 SER n 
4  1659 PRO n 
4  1660 ALA n 
4  1661 TYR n 
4  1662 SER n 
4  1663 PRO n 
4  1664 THR n 
4  1665 SER n 
4  1666 PRO n 
4  1667 SER n 
4  1668 TYR n 
4  1669 SER n 
4  1670 PRO n 
4  1671 THR n 
4  1672 SER n 
4  1673 PRO n 
4  1674 SER n 
4  1675 TYR n 
4  1676 SER n 
4  1677 PRO n 
4  1678 THR n 
4  1679 SER n 
4  1680 PRO n 
4  1681 SER n 
4  1682 TYR n 
4  1683 SER n 
4  1684 PRO n 
4  1685 THR n 
4  1686 SER n 
4  1687 PRO n 
4  1688 SER n 
4  1689 TYR n 
4  1690 SER n 
4  1691 PRO n 
4  1692 THR n 
4  1693 SER n 
4  1694 PRO n 
4  1695 ASN n 
4  1696 TYR n 
4  1697 SER n 
4  1698 PRO n 
4  1699 THR n 
4  1700 SER n 
4  1701 PRO n 
4  1702 SER n 
4  1703 TYR n 
4  1704 SER n 
4  1705 PRO n 
4  1706 THR n 
4  1707 SER n 
4  1708 PRO n 
4  1709 GLY n 
4  1710 TYR n 
4  1711 SER n 
4  1712 PRO n 
4  1713 GLY n 
4  1714 SER n 
4  1715 PRO n 
4  1716 ALA n 
4  1717 TYR n 
4  1718 SER n 
4  1719 PRO n 
4  1720 LYS n 
4  1721 GLN n 
4  1722 ASP n 
4  1723 GLU n 
4  1724 GLN n 
4  1725 LYS n 
4  1726 HIS n 
4  1727 ASN n 
4  1728 GLU n 
4  1729 ASN n 
4  1730 GLU n 
4  1731 ASN n 
4  1732 SER n 
4  1733 ARG n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    LEU n 
5  5    ALA n 
5  6    ASN n 
5  7    SER n 
5  8    GLU n 
5  9    LYS n 
5  10   TYR n 
5  11   TYR n 
5  12   ASP n 
5  13   GLU n 
5  14   ASP n 
5  15   PRO n 
5  16   TYR n 
5  17   GLY n 
5  18   PHE n 
5  19   GLU n 
5  20   ASP n 
5  21   GLU n 
5  22   SER n 
5  23   ALA n 
5  24   PRO n 
5  25   ILE n 
5  26   THR n 
5  27   ALA n 
5  28   GLU n 
5  29   ASP n 
5  30   SER n 
5  31   TRP n 
5  32   ALA n 
5  33   VAL n 
5  34   ILE n 
5  35   SER n 
5  36   ALA n 
5  37   PHE n 
5  38   PHE n 
5  39   ARG n 
5  40   GLU n 
5  41   LYS n 
5  42   GLY n 
5  43   LEU n 
5  44   VAL n 
5  45   SER n 
5  46   GLN n 
5  47   GLN n 
5  48   LEU n 
5  49   ASP n 
5  50   SER n 
5  51   PHE n 
5  52   ASN n 
5  53   GLN n 
5  54   PHE n 
5  55   VAL n 
5  56   ASP n 
5  57   TYR n 
5  58   THR n 
5  59   LEU n 
5  60   GLN n 
5  61   ASP n 
5  62   ILE n 
5  63   ILE n 
5  64   CYS n 
5  65   GLU n 
5  66   ASP n 
5  67   SER n 
5  68   THR n 
5  69   LEU n 
5  70   ILE n 
5  71   LEU n 
5  72   GLU n 
5  73   GLN n 
5  74   LEU n 
5  75   ALA n 
5  76   GLN n 
5  77   HIS n 
5  78   THR n 
5  79   THR n 
5  80   GLU n 
5  81   SER n 
5  82   ASP n 
5  83   ASN n 
5  84   ILE n 
5  85   SER n 
5  86   ARG n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ILE n 
5  91   SER n 
5  92   PHE n 
5  93   GLY n 
5  94   LYS n 
5  95   ILE n 
5  96   TYR n 
5  97   VAL n 
5  98   THR n 
5  99   LYS n 
5  100  PRO n 
5  101  MET n 
5  102  VAL n 
5  103  ASN n 
5  104  GLU n 
5  105  SER n 
5  106  ASP n 
5  107  GLY n 
5  108  VAL n 
5  109  THR n 
5  110  HIS n 
5  111  ALA n 
5  112  LEU n 
5  113  TYR n 
5  114  PRO n 
5  115  GLN n 
5  116  GLU n 
5  117  ALA n 
5  118  ARG n 
5  119  LEU n 
5  120  ARG n 
5  121  ASN n 
5  122  LEU n 
5  123  THR n 
5  124  TYR n 
5  125  SER n 
5  126  SER n 
5  127  GLY n 
5  128  LEU n 
5  129  PHE n 
5  130  VAL n 
5  131  ASP n 
5  132  VAL n 
5  133  LYS n 
5  134  LYS n 
5  135  ARG n 
5  136  THR n 
5  137  TYR n 
5  138  GLU n 
5  139  ALA n 
5  140  ILE n 
5  141  ASP n 
5  142  VAL n 
5  143  PRO n 
5  144  GLY n 
5  145  ARG n 
5  146  GLU n 
5  147  LEU n 
5  148  LYS n 
5  149  TYR n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  ALA n 
5  154  GLU n 
5  155  GLU n 
5  156  SER n 
5  157  GLU n 
5  158  ASP n 
5  159  ASP n 
5  160  SER n 
5  161  GLU n 
5  162  SER n 
5  163  GLY n 
5  164  LYS n 
5  165  VAL n 
5  166  PHE n 
5  167  ILE n 
5  168  GLY n 
5  169  ARG n 
5  170  LEU n 
5  171  PRO n 
5  172  ILE n 
5  173  MET n 
5  174  LEU n 
5  175  ARG n 
5  176  SER n 
5  177  LYS n 
5  178  ASN n 
5  179  CYS n 
5  180  TYR n 
5  181  LEU n 
5  182  SER n 
5  183  GLU n 
5  184  ALA n 
5  185  THR n 
5  186  GLU n 
5  187  SER n 
5  188  ASP n 
5  189  LEU n 
5  190  TYR n 
5  191  LYS n 
5  192  LEU n 
5  193  LYS n 
5  194  GLU n 
5  195  CYS n 
5  196  PRO n 
5  197  PHE n 
5  198  ASP n 
5  199  MET n 
5  200  GLY n 
5  201  GLY n 
5  202  TYR n 
5  203  PHE n 
5  204  ILE n 
5  205  ILE n 
5  206  ASN n 
5  207  GLY n 
5  208  SER n 
5  209  GLU n 
5  210  LYS n 
5  211  VAL n 
5  212  LEU n 
5  213  ILE n 
5  214  ALA n 
5  215  GLN n 
5  216  GLU n 
5  217  ARG n 
5  218  SER n 
5  219  ALA n 
5  220  GLY n 
5  221  ASN n 
5  222  ILE n 
5  223  VAL n 
5  224  GLN n 
5  225  VAL n 
5  226  PHE n 
5  227  LYS n 
5  228  LYS n 
5  229  ALA n 
5  230  ALA n 
5  231  PRO n 
5  232  SER n 
5  233  PRO n 
5  234  ILE n 
5  235  SER n 
5  236  HIS n 
5  237  VAL n 
5  238  ALA n 
5  239  GLU n 
5  240  ILE n 
5  241  ARG n 
5  242  SER n 
5  243  ALA n 
5  244  LEU n 
5  245  GLU n 
5  246  LYS n 
5  247  GLY n 
5  248  SER n 
5  249  ARG n 
5  250  PHE n 
5  251  ILE n 
5  252  SER n 
5  253  THR n 
5  254  LEU n 
5  255  GLN n 
5  256  VAL n 
5  257  LYS n 
5  258  LEU n 
5  259  TYR n 
5  260  GLY n 
5  261  ARG n 
5  262  GLU n 
5  263  GLY n 
5  264  SER n 
5  265  SER n 
5  266  ALA n 
5  267  ARG n 
5  268  THR n 
5  269  ILE n 
5  270  LYS n 
5  271  ALA n 
5  272  THR n 
5  273  LEU n 
5  274  PRO n 
5  275  TYR n 
5  276  ILE n 
5  277  LYS n 
5  278  GLN n 
5  279  ASP n 
5  280  ILE n 
5  281  PRO n 
5  282  ILE n 
5  283  VAL n 
5  284  ILE n 
5  285  ILE n 
5  286  PHE n 
5  287  ARG n 
5  288  ALA n 
5  289  LEU n 
5  290  GLY n 
5  291  ILE n 
5  292  ILE n 
5  293  PRO n 
5  294  ASP n 
5  295  GLY n 
5  296  GLU n 
5  297  ILE n 
5  298  LEU n 
5  299  GLU n 
5  300  HIS n 
5  301  ILE n 
5  302  CYS n 
5  303  TYR n 
5  304  ASP n 
5  305  VAL n 
5  306  ASN n 
5  307  ASP n 
5  308  TRP n 
5  309  GLN n 
5  310  MET n 
5  311  LEU n 
5  312  GLU n 
5  313  MET n 
5  314  LEU n 
5  315  LYS n 
5  316  PRO n 
5  317  CYS n 
5  318  VAL n 
5  319  GLU n 
5  320  ASP n 
5  321  GLY n 
5  322  PHE n 
5  323  VAL n 
5  324  ILE n 
5  325  GLN n 
5  326  ASP n 
5  327  ARG n 
5  328  GLU n 
5  329  THR n 
5  330  ALA n 
5  331  LEU n 
5  332  ASP n 
5  333  PHE n 
5  334  ILE n 
5  335  GLY n 
5  336  ARG n 
5  337  ARG n 
5  338  GLY n 
5  339  THR n 
5  340  ALA n 
5  341  LEU n 
5  342  GLY n 
5  343  ILE n 
5  344  LYS n 
5  345  LYS n 
5  346  GLU n 
5  347  LYS n 
5  348  ARG n 
5  349  ILE n 
5  350  GLN n 
5  351  TYR n 
5  352  ALA n 
5  353  LYS n 
5  354  ASP n 
5  355  ILE n 
5  356  LEU n 
5  357  GLN n 
5  358  LYS n 
5  359  GLU n 
5  360  PHE n 
5  361  LEU n 
5  362  PRO n 
5  363  HIS n 
5  364  ILE n 
5  365  THR n 
5  366  GLN n 
5  367  LEU n 
5  368  GLU n 
5  369  GLY n 
5  370  PHE n 
5  371  GLU n 
5  372  SER n 
5  373  ARG n 
5  374  LYS n 
5  375  ALA n 
5  376  PHE n 
5  377  PHE n 
5  378  LEU n 
5  379  GLY n 
5  380  TYR n 
5  381  MET n 
5  382  ILE n 
5  383  ASN n 
5  384  ARG n 
5  385  LEU n 
5  386  LEU n 
5  387  LEU n 
5  388  CYS n 
5  389  ALA n 
5  390  LEU n 
5  391  ASP n 
5  392  ARG n 
5  393  LYS n 
5  394  ASP n 
5  395  GLN n 
5  396  ASP n 
5  397  ASP n 
5  398  ARG n 
5  399  ASP n 
5  400  HIS n 
5  401  PHE n 
5  402  GLY n 
5  403  LYS n 
5  404  LYS n 
5  405  ARG n 
5  406  LEU n 
5  407  ASP n 
5  408  LEU n 
5  409  ALA n 
5  410  GLY n 
5  411  PRO n 
5  412  LEU n 
5  413  LEU n 
5  414  ALA n 
5  415  GLN n 
5  416  LEU n 
5  417  PHE n 
5  418  LYS n 
5  419  THR n 
5  420  LEU n 
5  421  PHE n 
5  422  LYS n 
5  423  LYS n 
5  424  LEU n 
5  425  THR n 
5  426  LYS n 
5  427  ASP n 
5  428  ILE n 
5  429  PHE n 
5  430  ARG n 
5  431  TYR n 
5  432  MET n 
5  433  GLN n 
5  434  ARG n 
5  435  THR n 
5  436  VAL n 
5  437  GLU n 
5  438  GLU n 
5  439  ALA n 
5  440  HIS n 
5  441  ASP n 
5  442  PHE n 
5  443  ASN n 
5  444  MET n 
5  445  LYS n 
5  446  LEU n 
5  447  ALA n 
5  448  ILE n 
5  449  ASN n 
5  450  ALA n 
5  451  LYS n 
5  452  THR n 
5  453  ILE n 
5  454  THR n 
5  455  SER n 
5  456  GLY n 
5  457  LEU n 
5  458  LYS n 
5  459  TYR n 
5  460  ALA n 
5  461  LEU n 
5  462  ALA n 
5  463  THR n 
5  464  GLY n 
5  465  ASN n 
5  466  TRP n 
5  467  GLY n 
5  468  GLU n 
5  469  GLN n 
5  470  LYS n 
5  471  LYS n 
5  472  ALA n 
5  473  MET n 
5  474  SER n 
5  475  SER n 
5  476  ARG n 
5  477  ALA n 
5  478  GLY n 
5  479  VAL n 
5  480  SER n 
5  481  GLN n 
5  482  VAL n 
5  483  LEU n 
5  484  ASN n 
5  485  ARG n 
5  486  TYR n 
5  487  THR n 
5  488  TYR n 
5  489  SER n 
5  490  SER n 
5  491  THR n 
5  492  LEU n 
5  493  SER n 
5  494  HIS n 
5  495  LEU n 
5  496  ARG n 
5  497  ARG n 
5  498  THR n 
5  499  ASN n 
5  500  THR n 
5  501  PRO n 
5  502  ILE n 
5  503  GLY n 
5  504  ARG n 
5  505  ASP n 
5  506  GLY n 
5  507  LYS n 
5  508  LEU n 
5  509  ALA n 
5  510  LYS n 
5  511  PRO n 
5  512  ARG n 
5  513  GLN n 
5  514  LEU n 
5  515  HIS n 
5  516  ASN n 
5  517  THR n 
5  518  HIS n 
5  519  TRP n 
5  520  GLY n 
5  521  LEU n 
5  522  VAL n 
5  523  CYS n 
5  524  PRO n 
5  525  ALA n 
5  526  GLU n 
5  527  THR n 
5  528  PRO n 
5  529  GLU n 
5  530  GLY n 
5  531  GLN n 
5  532  ALA n 
5  533  CYS n 
5  534  GLY n 
5  535  LEU n 
5  536  VAL n 
5  537  LYS n 
5  538  ASN n 
5  539  LEU n 
5  540  SER n 
5  541  LEU n 
5  542  MET n 
5  543  SER n 
5  544  CYS n 
5  545  ILE n 
5  546  SER n 
5  547  VAL n 
5  548  GLY n 
5  549  THR n 
5  550  ASP n 
5  551  PRO n 
5  552  MET n 
5  553  PRO n 
5  554  ILE n 
5  555  ILE n 
5  556  THR n 
5  557  PHE n 
5  558  LEU n 
5  559  SER n 
5  560  GLU n 
5  561  TRP n 
5  562  GLY n 
5  563  MET n 
5  564  GLU n 
5  565  PRO n 
5  566  LEU n 
5  567  GLU n 
5  568  ASP n 
5  569  TYR n 
5  570  VAL n 
5  571  PRO n 
5  572  HIS n 
5  573  GLN n 
5  574  SER n 
5  575  PRO n 
5  576  ASP n 
5  577  ALA n 
5  578  THR n 
5  579  ARG n 
5  580  VAL n 
5  581  PHE n 
5  582  VAL n 
5  583  ASN n 
5  584  GLY n 
5  585  VAL n 
5  586  TRP n 
5  587  HIS n 
5  588  GLY n 
5  589  VAL n 
5  590  HIS n 
5  591  ARG n 
5  592  ASN n 
5  593  PRO n 
5  594  ALA n 
5  595  ARG n 
5  596  LEU n 
5  597  MET n 
5  598  GLU n 
5  599  THR n 
5  600  LEU n 
5  601  ARG n 
5  602  THR n 
5  603  LEU n 
5  604  ARG n 
5  605  ARG n 
5  606  LYS n 
5  607  GLY n 
5  608  ASP n 
5  609  ILE n 
5  610  ASN n 
5  611  PRO n 
5  612  GLU n 
5  613  VAL n 
5  614  SER n 
5  615  MET n 
5  616  ILE n 
5  617  ARG n 
5  618  ASP n 
5  619  ILE n 
5  620  ARG n 
5  621  GLU n 
5  622  LYS n 
5  623  GLU n 
5  624  LEU n 
5  625  LYS n 
5  626  ILE n 
5  627  PHE n 
5  628  THR n 
5  629  ASP n 
5  630  ALA n 
5  631  GLY n 
5  632  ARG n 
5  633  VAL n 
5  634  TYR n 
5  635  ARG n 
5  636  PRO n 
5  637  LEU n 
5  638  PHE n 
5  639  ILE n 
5  640  VAL n 
5  641  GLU n 
5  642  ASP n 
5  643  ASP n 
5  644  GLU n 
5  645  SER n 
5  646  LEU n 
5  647  GLY n 
5  648  HIS n 
5  649  LYS n 
5  650  GLU n 
5  651  LEU n 
5  652  LYS n 
5  653  VAL n 
5  654  ARG n 
5  655  LYS n 
5  656  GLY n 
5  657  HIS n 
5  658  ILE n 
5  659  ALA n 
5  660  LYS n 
5  661  LEU n 
5  662  MET n 
5  663  ALA n 
5  664  THR n 
5  665  GLU n 
5  666  TYR n 
5  667  GLN n 
5  668  ASP n 
5  669  ILE n 
5  670  GLU n 
5  671  GLY n 
5  672  GLY n 
5  673  PHE n 
5  674  GLU n 
5  675  ASP n 
5  676  VAL n 
5  677  GLU n 
5  678  GLU n 
5  679  TYR n 
5  680  THR n 
5  681  TRP n 
5  682  SER n 
5  683  SER n 
5  684  LEU n 
5  685  LEU n 
5  686  ASN n 
5  687  GLU n 
5  688  GLY n 
5  689  LEU n 
5  690  VAL n 
5  691  GLU n 
5  692  TYR n 
5  693  ILE n 
5  694  ASP n 
5  695  ALA n 
5  696  GLU n 
5  697  GLU n 
5  698  GLU n 
5  699  GLU n 
5  700  SER n 
5  701  ILE n 
5  702  LEU n 
5  703  ILE n 
5  704  ALA n 
5  705  MET n 
5  706  GLN n 
5  707  PRO n 
5  708  GLU n 
5  709  ASP n 
5  710  LEU n 
5  711  GLU n 
5  712  PRO n 
5  713  ALA n 
5  714  GLU n 
5  715  ALA n 
5  716  ASN n 
5  717  GLU n 
5  718  GLU n 
5  719  ASN n 
5  720  ASP n 
5  721  LEU n 
5  722  ASP n 
5  723  VAL n 
5  724  ASP n 
5  725  PRO n 
5  726  ALA n 
5  727  LYS n 
5  728  ARG n 
5  729  ILE n 
5  730  ARG n 
5  731  VAL n 
5  732  SER n 
5  733  HIS n 
5  734  HIS n 
5  735  ALA n 
5  736  THR n 
5  737  THR n 
5  738  PHE n 
5  739  THR n 
5  740  HIS n 
5  741  CYS n 
5  742  GLU n 
5  743  ILE n 
5  744  HIS n 
5  745  PRO n 
5  746  SER n 
5  747  MET n 
5  748  ILE n 
5  749  LEU n 
5  750  GLY n 
5  751  VAL n 
5  752  ALA n 
5  753  ALA n 
5  754  SER n 
5  755  ILE n 
5  756  ILE n 
5  757  PRO n 
5  758  PHE n 
5  759  PRO n 
5  760  ASP n 
5  761  HIS n 
5  762  ASN n 
5  763  GLN n 
5  764  SER n 
5  765  PRO n 
5  766  ARG n 
5  767  ASN n 
5  768  THR n 
5  769  TYR n 
5  770  GLN n 
5  771  SER n 
5  772  ALA n 
5  773  MET n 
5  774  GLY n 
5  775  LYS n 
5  776  GLN n 
5  777  ALA n 
5  778  MET n 
5  779  GLY n 
5  780  VAL n 
5  781  PHE n 
5  782  LEU n 
5  783  THR n 
5  784  ASN n 
5  785  TYR n 
5  786  ASN n 
5  787  VAL n 
5  788  ARG n 
5  789  MET n 
5  790  ASP n 
5  791  THR n 
5  792  MET n 
5  793  ALA n 
5  794  ASN n 
5  795  ILE n 
5  796  LEU n 
5  797  TYR n 
5  798  TYR n 
5  799  PRO n 
5  800  GLN n 
5  801  LYS n 
5  802  PRO n 
5  803  LEU n 
5  804  GLY n 
5  805  THR n 
5  806  THR n 
5  807  ARG n 
5  808  ALA n 
5  809  MET n 
5  810  GLU n 
5  811  TYR n 
5  812  LEU n 
5  813  LYS n 
5  814  PHE n 
5  815  ARG n 
5  816  GLU n 
5  817  LEU n 
5  818  PRO n 
5  819  ALA n 
5  820  GLY n 
5  821  GLN n 
5  822  ASN n 
5  823  ALA n 
5  824  ILE n 
5  825  VAL n 
5  826  ALA n 
5  827  ILE n 
5  828  ALA n 
5  829  CYS n 
5  830  TYR n 
5  831  SER n 
5  832  GLY n 
5  833  TYR n 
5  834  ASN n 
5  835  GLN n 
5  836  GLU n 
5  837  ASP n 
5  838  SER n 
5  839  MET n 
5  840  ILE n 
5  841  MET n 
5  842  ASN n 
5  843  GLN n 
5  844  SER n 
5  845  SER n 
5  846  ILE n 
5  847  ASP n 
5  848  ARG n 
5  849  GLY n 
5  850  LEU n 
5  851  PHE n 
5  852  ARG n 
5  853  SER n 
5  854  LEU n 
5  855  PHE n 
5  856  PHE n 
5  857  ARG n 
5  858  SER n 
5  859  TYR n 
5  860  MET n 
5  861  ASP n 
5  862  GLN n 
5  863  GLU n 
5  864  LYS n 
5  865  LYS n 
5  866  TYR n 
5  867  GLY n 
5  868  MET n 
5  869  SER n 
5  870  ILE n 
5  871  THR n 
5  872  GLU n 
5  873  THR n 
5  874  PHE n 
5  875  GLU n 
5  876  LYS n 
5  877  PRO n 
5  878  GLN n 
5  879  ARG n 
5  880  THR n 
5  881  ASN n 
5  882  THR n 
5  883  LEU n 
5  884  ARG n 
5  885  MET n 
5  886  LYS n 
5  887  HIS n 
5  888  GLY n 
5  889  THR n 
5  890  TYR n 
5  891  ASP n 
5  892  LYS n 
5  893  LEU n 
5  894  ASP n 
5  895  ASP n 
5  896  ASP n 
5  897  GLY n 
5  898  LEU n 
5  899  ILE n 
5  900  ALA n 
5  901  PRO n 
5  902  GLY n 
5  903  VAL n 
5  904  ARG n 
5  905  VAL n 
5  906  SER n 
5  907  GLY n 
5  908  GLU n 
5  909  ASP n 
5  910  VAL n 
5  911  ILE n 
5  912  ILE n 
5  913  GLY n 
5  914  LYS n 
5  915  THR n 
5  916  THR n 
5  917  PRO n 
5  918  ILE n 
5  919  SER n 
5  920  PRO n 
5  921  ASP n 
5  922  GLU n 
5  923  GLU n 
5  924  GLU n 
5  925  LEU n 
5  926  GLY n 
5  927  GLN n 
5  928  ARG n 
5  929  THR n 
5  930  ALA n 
5  931  TYR n 
5  932  HIS n 
5  933  SER n 
5  934  LYS n 
5  935  ARG n 
5  936  ASP n 
5  937  ALA n 
5  938  SER n 
5  939  THR n 
5  940  PRO n 
5  941  LEU n 
5  942  ARG n 
5  943  SER n 
5  944  THR n 
5  945  GLU n 
5  946  ASN n 
5  947  GLY n 
5  948  ILE n 
5  949  VAL n 
5  950  ASP n 
5  951  GLN n 
5  952  VAL n 
5  953  LEU n 
5  954  VAL n 
5  955  THR n 
5  956  THR n 
5  957  ASN n 
5  958  GLN n 
5  959  ASP n 
5  960  GLY n 
5  961  LEU n 
5  962  LYS n 
5  963  PHE n 
5  964  VAL n 
5  965  LYS n 
5  966  VAL n 
5  967  ARG n 
5  968  VAL n 
5  969  ARG n 
5  970  THR n 
5  971  THR n 
5  972  LYS n 
5  973  ILE n 
5  974  PRO n 
5  975  GLN n 
5  976  ILE n 
5  977  GLY n 
5  978  ASP n 
5  979  LYS n 
5  980  PHE n 
5  981  ALA n 
5  982  SER n 
5  983  ARG n 
5  984  HIS n 
5  985  GLY n 
5  986  GLN n 
5  987  LYS n 
5  988  GLY n 
5  989  THR n 
5  990  ILE n 
5  991  GLY n 
5  992  ILE n 
5  993  THR n 
5  994  TYR n 
5  995  ARG n 
5  996  ARG n 
5  997  GLU n 
5  998  ASP n 
5  999  MET n 
5  1000 PRO n 
5  1001 PHE n 
5  1002 THR n 
5  1003 ALA n 
5  1004 GLU n 
5  1005 GLY n 
5  1006 ILE n 
5  1007 VAL n 
5  1008 PRO n 
5  1009 ASP n 
5  1010 LEU n 
5  1011 ILE n 
5  1012 ILE n 
5  1013 ASN n 
5  1014 PRO n 
5  1015 HIS n 
5  1016 ALA n 
5  1017 ILE n 
5  1018 PRO n 
5  1019 SER n 
5  1020 ARG n 
5  1021 MET n 
5  1022 THR n 
5  1023 VAL n 
5  1024 ALA n 
5  1025 HIS n 
5  1026 LEU n 
5  1027 ILE n 
5  1028 GLU n 
5  1029 CYS n 
5  1030 LEU n 
5  1031 LEU n 
5  1032 SER n 
5  1033 LYS n 
5  1034 VAL n 
5  1035 ALA n 
5  1036 ALA n 
5  1037 LEU n 
5  1038 SER n 
5  1039 GLY n 
5  1040 ASN n 
5  1041 GLU n 
5  1042 GLY n 
5  1043 ASP n 
5  1044 ALA n 
5  1045 SER n 
5  1046 PRO n 
5  1047 PHE n 
5  1048 THR n 
5  1049 ASP n 
5  1050 ILE n 
5  1051 THR n 
5  1052 VAL n 
5  1053 GLU n 
5  1054 GLY n 
5  1055 ILE n 
5  1056 SER n 
5  1057 LYS n 
5  1058 LEU n 
5  1059 LEU n 
5  1060 ARG n 
5  1061 GLU n 
5  1062 HIS n 
5  1063 GLY n 
5  1064 TYR n 
5  1065 GLN n 
5  1066 SER n 
5  1067 ARG n 
5  1068 GLY n 
5  1069 PHE n 
5  1070 GLU n 
5  1071 VAL n 
5  1072 MET n 
5  1073 TYR n 
5  1074 ASN n 
5  1075 GLY n 
5  1076 HIS n 
5  1077 THR n 
5  1078 GLY n 
5  1079 LYS n 
5  1080 LYS n 
5  1081 LEU n 
5  1082 MET n 
5  1083 ALA n 
5  1084 GLN n 
5  1085 ILE n 
5  1086 PHE n 
5  1087 PHE n 
5  1088 GLY n 
5  1089 PRO n 
5  1090 THR n 
5  1091 TYR n 
5  1092 TYR n 
5  1093 GLN n 
5  1094 ARG n 
5  1095 LEU n 
5  1096 ARG n 
5  1097 HIS n 
5  1098 MET n 
5  1099 VAL n 
5  1100 ASP n 
5  1101 ASP n 
5  1102 LYS n 
5  1103 ILE n 
5  1104 HIS n 
5  1105 ALA n 
5  1106 ARG n 
5  1107 ALA n 
5  1108 ARG n 
5  1109 GLY n 
5  1110 PRO n 
5  1111 MET n 
5  1112 GLN n 
5  1113 VAL n 
5  1114 LEU n 
5  1115 THR n 
5  1116 ARG n 
5  1117 GLN n 
5  1118 PRO n 
5  1119 VAL n 
5  1120 GLU n 
5  1121 GLY n 
5  1122 ARG n 
5  1123 SER n 
5  1124 ARG n 
5  1125 ASP n 
5  1126 GLY n 
5  1127 GLY n 
5  1128 LEU n 
5  1129 ARG n 
5  1130 PHE n 
5  1131 GLY n 
5  1132 GLU n 
5  1133 MET n 
5  1134 GLU n 
5  1135 ARG n 
5  1136 ASP n 
5  1137 CYS n 
5  1138 MET n 
5  1139 ILE n 
5  1140 ALA n 
5  1141 HIS n 
5  1142 GLY n 
5  1143 ALA n 
5  1144 ALA n 
5  1145 SER n 
5  1146 PHE n 
5  1147 LEU n 
5  1148 LYS n 
5  1149 GLU n 
5  1150 ARG n 
5  1151 LEU n 
5  1152 MET n 
5  1153 GLU n 
5  1154 ALA n 
5  1155 SER n 
5  1156 ASP n 
5  1157 ALA n 
5  1158 PHE n 
5  1159 ARG n 
5  1160 VAL n 
5  1161 HIS n 
5  1162 ILE n 
5  1163 CYS n 
5  1164 GLY n 
5  1165 ILE n 
5  1166 CYS n 
5  1167 GLY n 
5  1168 LEU n 
5  1169 MET n 
5  1170 THR n 
5  1171 VAL n 
5  1172 ILE n 
5  1173 ALA n 
5  1174 LYS n 
5  1175 LEU n 
5  1176 ASN n 
5  1177 HIS n 
5  1178 ASN n 
5  1179 GLN n 
5  1180 PHE n 
5  1181 GLU n 
5  1182 CYS n 
5  1183 LYS n 
5  1184 GLY n 
5  1185 CYS n 
5  1186 ASP n 
5  1187 ASN n 
5  1188 LYS n 
5  1189 ILE n 
5  1190 ASP n 
5  1191 ILE n 
5  1192 TYR n 
5  1193 GLN n 
5  1194 ILE n 
5  1195 HIS n 
5  1196 ILE n 
5  1197 PRO n 
5  1198 TYR n 
5  1199 ALA n 
5  1200 ALA n 
5  1201 LYS n 
5  1202 LEU n 
5  1203 LEU n 
5  1204 PHE n 
5  1205 GLN n 
5  1206 GLU n 
5  1207 LEU n 
5  1208 MET n 
5  1209 ALA n 
5  1210 MET n 
5  1211 ASN n 
5  1212 ILE n 
5  1213 THR n 
5  1214 PRO n 
5  1215 ARG n 
5  1216 LEU n 
5  1217 TYR n 
5  1218 THR n 
5  1219 ASP n 
5  1220 ARG n 
5  1221 SER n 
5  1222 ARG n 
5  1223 ASP n 
5  1224 PHE n 
6  1    MET n 
6  2    SER n 
6  3    GLU n 
6  4    GLU n 
6  5    GLY n 
6  6    PRO n 
6  7    GLN n 
6  8    VAL n 
6  9    LYS n 
6  10   ILE n 
6  11   ARG n 
6  12   GLU n 
6  13   ALA n 
6  14   SER n 
6  15   LYS n 
6  16   ASP n 
6  17   ASN n 
6  18   VAL n 
6  19   ASP n 
6  20   PHE n 
6  21   ILE n 
6  22   LEU n 
6  23   SER n 
6  24   ASN n 
6  25   VAL n 
6  26   ASP n 
6  27   LEU n 
6  28   ALA n 
6  29   MET n 
6  30   ALA n 
6  31   ASN n 
6  32   SER n 
6  33   LEU n 
6  34   ARG n 
6  35   ARG n 
6  36   VAL n 
6  37   MET n 
6  38   ILE n 
6  39   ALA n 
6  40   GLU n 
6  41   ILE n 
6  42   PRO n 
6  43   THR n 
6  44   LEU n 
6  45   ALA n 
6  46   ILE n 
6  47   ASP n 
6  48   SER n 
6  49   VAL n 
6  50   GLU n 
6  51   VAL n 
6  52   GLU n 
6  53   THR n 
6  54   ASN n 
6  55   THR n 
6  56   THR n 
6  57   VAL n 
6  58   LEU n 
6  59   ALA n 
6  60   ASP n 
6  61   GLU n 
6  62   PHE n 
6  63   ILE n 
6  64   ALA n 
6  65   HIS n 
6  66   ARG n 
6  67   LEU n 
6  68   GLY n 
6  69   LEU n 
6  70   ILE n 
6  71   PRO n 
6  72   LEU n 
6  73   GLN n 
6  74   SER n 
6  75   MET n 
6  76   ASP n 
6  77   ILE n 
6  78   GLU n 
6  79   GLN n 
6  80   LEU n 
6  81   GLU n 
6  82   TYR n 
6  83   SER n 
6  84   ARG n 
6  85   ASP n 
6  86   CYS n 
6  87   PHE n 
6  88   CYS n 
6  89   GLU n 
6  90   ASP n 
6  91   HIS n 
6  92   CYS n 
6  93   ASP n 
6  94   LYS n 
6  95   CYS n 
6  96   SER n 
6  97   VAL n 
6  98   VAL n 
6  99   LEU n 
6  100  THR n 
6  101  LEU n 
6  102  GLN n 
6  103  ALA n 
6  104  PHE n 
6  105  GLY n 
6  106  GLU n 
6  107  SER n 
6  108  GLU n 
6  109  SER n 
6  110  THR n 
6  111  THR n 
6  112  ASN n 
6  113  VAL n 
6  114  TYR n 
6  115  SER n 
6  116  LYS n 
6  117  ASP n 
6  118  LEU n 
6  119  VAL n 
6  120  ILE n 
6  121  VAL n 
6  122  SER n 
6  123  ASN n 
6  124  LEU n 
6  125  MET n 
6  126  GLY n 
6  127  ARG n 
6  128  ASN n 
6  129  ILE n 
6  130  GLY n 
6  131  HIS n 
6  132  PRO n 
6  133  ILE n 
6  134  ILE n 
6  135  GLN n 
6  136  ASP n 
6  137  LYS n 
6  138  GLU n 
6  139  GLY n 
6  140  ASN n 
6  141  GLY n 
6  142  VAL n 
6  143  LEU n 
6  144  ILE n 
6  145  CYS n 
6  146  LYS n 
6  147  LEU n 
6  148  ARG n 
6  149  LYS n 
6  150  GLY n 
6  151  GLN n 
6  152  GLU n 
6  153  LEU n 
6  154  LYS n 
6  155  LEU n 
6  156  THR n 
6  157  CYS n 
6  158  VAL n 
6  159  ALA n 
6  160  LYS n 
6  161  LYS n 
6  162  GLY n 
6  163  ILE n 
6  164  ALA n 
6  165  LYS n 
6  166  GLU n 
6  167  HIS n 
6  168  ALA n 
6  169  LYS n 
6  170  TRP n 
6  171  GLY n 
6  172  PRO n 
6  173  ALA n 
6  174  ALA n 
6  175  ALA n 
6  176  ILE n 
6  177  GLU n 
6  178  PHE n 
6  179  GLU n 
6  180  TYR n 
6  181  ASP n 
6  182  PRO n 
6  183  TRP n 
6  184  ASN n 
6  185  LYS n 
6  186  LEU n 
6  187  LYS n 
6  188  HIS n 
6  189  THR n 
6  190  ASP n 
6  191  TYR n 
6  192  TRP n 
6  193  TYR n 
6  194  GLU n 
6  195  GLN n 
6  196  ASP n 
6  197  SER n 
6  198  ALA n 
6  199  LYS n 
6  200  GLU n 
6  201  TRP n 
6  202  PRO n 
6  203  GLN n 
6  204  SER n 
6  205  LYS n 
6  206  ASN n 
6  207  CYS n 
6  208  GLU n 
6  209  TYR n 
6  210  GLU n 
6  211  ASP n 
6  212  PRO n 
6  213  PRO n 
6  214  ASN n 
6  215  GLU n 
6  216  GLY n 
6  217  ASP n 
6  218  PRO n 
6  219  PHE n 
6  220  ASP n 
6  221  TYR n 
6  222  LYS n 
6  223  ALA n 
6  224  GLN n 
6  225  ALA n 
6  226  ASP n 
6  227  THR n 
6  228  PHE n 
6  229  TYR n 
6  230  MET n 
6  231  ASN n 
6  232  VAL n 
6  233  GLU n 
6  234  SER n 
6  235  VAL n 
6  236  GLY n 
6  237  SER n 
6  238  ILE n 
6  239  PRO n 
6  240  VAL n 
6  241  ASP n 
6  242  GLN n 
6  243  VAL n 
6  244  VAL n 
6  245  VAL n 
6  246  ARG n 
6  247  GLY n 
6  248  ILE n 
6  249  ASP n 
6  250  THR n 
6  251  LEU n 
6  252  GLN n 
6  253  LYS n 
6  254  LYS n 
6  255  VAL n 
6  256  ALA n 
6  257  SER n 
6  258  ILE n 
6  259  LEU n 
6  260  LEU n 
6  261  ALA n 
6  262  LEU n 
6  263  THR n 
6  264  GLN n 
6  265  MET n 
6  266  ASP n 
6  267  GLN n 
6  268  ASP n 
6  269  LYS n 
6  270  VAL n 
6  271  ASN n 
6  272  PHE n 
6  273  ALA n 
6  274  SER n 
6  275  GLY n 
6  276  ASP n 
6  277  ASN n 
6  278  ASN n 
6  279  THR n 
6  280  ALA n 
6  281  SER n 
6  282  ASN n 
6  283  MET n 
6  284  LEU n 
6  285  GLY n 
6  286  SER n 
6  287  ASN n 
6  288  GLU n 
6  289  ASP n 
6  290  VAL n 
6  291  MET n 
6  292  MET n 
6  293  THR n 
6  294  GLY n 
6  295  ALA n 
6  296  GLU n 
6  297  GLN n 
6  298  ASP n 
6  299  PRO n 
6  300  TYR n 
6  301  SER n 
6  302  ASN n 
6  303  ALA n 
6  304  SER n 
6  305  GLN n 
6  306  MET n 
6  307  GLY n 
6  308  ASN n 
6  309  THR n 
6  310  GLY n 
6  311  SER n 
6  312  GLY n 
6  313  GLY n 
6  314  TYR n 
6  315  ASP n 
6  316  ASN n 
6  317  ALA n 
6  318  TRP n 
7  1    MET n 
7  2    ASP n 
7  3    GLN n 
7  4    GLU n 
7  5    ASN n 
7  6    GLU n 
7  7    ARG n 
7  8    ASN n 
7  9    ILE n 
7  10   SER n 
7  11   ARG n 
7  12   LEU n 
7  13   TRP n 
7  14   ARG n 
7  15   ALA n 
7  16   PHE n 
7  17   ARG n 
7  18   THR n 
7  19   VAL n 
7  20   LYS n 
7  21   GLU n 
7  22   MET n 
7  23   VAL n 
7  24   LYS n 
7  25   ASP n 
7  26   ARG n 
7  27   GLY n 
7  28   TYR n 
7  29   PHE n 
7  30   ILE n 
7  31   THR n 
7  32   GLN n 
7  33   GLU n 
7  34   GLU n 
7  35   VAL n 
7  36   GLU n 
7  37   LEU n 
7  38   PRO n 
7  39   LEU n 
7  40   GLU n 
7  41   ASP n 
7  42   PHE n 
7  43   LYS n 
7  44   ALA n 
7  45   LYS n 
7  46   TYR n 
7  47   CYS n 
7  48   ASP n 
7  49   SER n 
7  50   MET n 
7  51   GLY n 
7  52   ARG n 
7  53   PRO n 
7  54   GLN n 
7  55   ARG n 
7  56   LYS n 
7  57   MET n 
7  58   MET n 
7  59   SER n 
7  60   PHE n 
7  61   GLN n 
7  62   ALA n 
7  63   ASN n 
7  64   PRO n 
7  65   THR n 
7  66   GLU n 
7  67   GLU n 
7  68   SER n 
7  69   ILE n 
7  70   SER n 
7  71   LYS n 
7  72   PHE n 
7  73   PRO n 
7  74   ASP n 
7  75   MET n 
7  76   GLY n 
7  77   SER n 
7  78   LEU n 
7  79   TRP n 
7  80   VAL n 
7  81   GLU n 
7  82   PHE n 
7  83   CYS n 
7  84   ASP n 
7  85   GLU n 
7  86   PRO n 
7  87   SER n 
7  88   VAL n 
7  89   GLY n 
7  90   VAL n 
7  91   LYS n 
7  92   THR n 
7  93   MET n 
7  94   LYS n 
7  95   THR n 
7  96   PHE n 
7  97   VAL n 
7  98   ILE n 
7  99   HIS n 
7  100  ILE n 
7  101  GLN n 
7  102  GLU n 
7  103  LYS n 
7  104  ASN n 
7  105  PHE n 
7  106  GLN n 
7  107  THR n 
7  108  GLY n 
7  109  ILE n 
7  110  PHE n 
7  111  VAL n 
7  112  TYR n 
7  113  GLN n 
7  114  ASN n 
7  115  ASN n 
7  116  ILE n 
7  117  THR n 
7  118  PRO n 
7  119  SER n 
7  120  ALA n 
7  121  MET n 
7  122  LYS n 
7  123  LEU n 
7  124  VAL n 
7  125  PRO n 
7  126  SER n 
7  127  ILE n 
7  128  PRO n 
7  129  PRO n 
7  130  ALA n 
7  131  THR n 
7  132  ILE n 
7  133  GLU n 
7  134  THR n 
7  135  PHE n 
7  136  ASN n 
7  137  GLU n 
7  138  ALA n 
7  139  ALA n 
7  140  LEU n 
7  141  VAL n 
7  142  VAL n 
7  143  ASN n 
7  144  ILE n 
7  145  THR n 
7  146  HIS n 
7  147  HIS n 
7  148  GLU n 
7  149  LEU n 
7  150  VAL n 
7  151  PRO n 
7  152  LYS n 
7  153  HIS n 
7  154  ILE n 
7  155  ARG n 
7  156  LEU n 
7  157  SER n 
7  158  SER n 
7  159  ASP n 
7  160  GLU n 
7  161  LYS n 
7  162  ARG n 
7  163  GLU n 
7  164  LEU n 
7  165  LEU n 
7  166  LYS n 
7  167  ARG n 
7  168  TYR n 
7  169  ARG n 
7  170  LEU n 
7  171  LYS n 
7  172  GLU n 
7  173  SER n 
7  174  GLN n 
7  175  LEU n 
7  176  PRO n 
7  177  ARG n 
7  178  ILE n 
7  179  GLN n 
7  180  ARG n 
7  181  ALA n 
7  182  ASP n 
7  183  PRO n 
7  184  VAL n 
7  185  ALA n 
7  186  LEU n 
7  187  TYR n 
7  188  LEU n 
7  189  GLY n 
7  190  LEU n 
7  191  LYS n 
7  192  ARG n 
7  193  GLY n 
7  194  GLU n 
7  195  VAL n 
7  196  VAL n 
7  197  LYS n 
7  198  ILE n 
7  199  ILE n 
7  200  ARG n 
7  201  LYS n 
7  202  SER n 
7  203  GLU n 
7  204  THR n 
7  205  SER n 
7  206  GLY n 
7  207  ARG n 
7  208  TYR n 
7  209  ALA n 
7  210  SER n 
7  211  TYR n 
7  212  ARG n 
7  213  ILE n 
7  214  CYS n 
7  215  MET n 
8  1    MET n 
8  2    SER n 
8  3    ASP n 
8  4    TYR n 
8  5    GLU n 
8  6    GLU n 
8  7    ALA n 
8  8    PHE n 
8  9    ASN n 
8  10   ASP n 
8  11   GLY n 
8  12   ASN n 
8  13   GLU n 
8  14   ASN n 
8  15   PHE n 
8  16   GLU n 
8  17   ASP n 
8  18   PHE n 
8  19   ASP n 
8  20   VAL n 
8  21   GLU n 
8  22   HIS n 
8  23   PHE n 
8  24   SER n 
8  25   ASP n 
8  26   GLU n 
8  27   GLU n 
8  28   THR n 
8  29   TYR n 
8  30   GLU n 
8  31   GLU n 
8  32   LYS n 
8  33   PRO n 
8  34   GLN n 
8  35   PHE n 
8  36   LYS n 
8  37   ASP n 
8  38   GLY n 
8  39   GLU n 
8  40   THR n 
8  41   THR n 
8  42   ASP n 
8  43   ALA n 
8  44   ASN n 
8  45   GLY n 
8  46   LYS n 
8  47   THR n 
8  48   ILE n 
8  49   VAL n 
8  50   THR n 
8  51   GLY n 
8  52   GLY n 
8  53   ASN n 
8  54   GLY n 
8  55   PRO n 
8  56   GLU n 
8  57   ASP n 
8  58   PHE n 
8  59   GLN n 
8  60   GLN n 
8  61   HIS n 
8  62   GLU n 
8  63   GLN n 
8  64   ILE n 
8  65   ARG n 
8  66   ARG n 
8  67   LYS n 
8  68   THR n 
8  69   LEU n 
8  70   LYS n 
8  71   GLU n 
8  72   LYS n 
8  73   ALA n 
8  74   ILE n 
8  75   PRO n 
8  76   LYS n 
8  77   ASP n 
8  78   GLN n 
8  79   ARG n 
8  80   ALA n 
8  81   THR n 
8  82   THR n 
8  83   PRO n 
8  84   TYR n 
8  85   MET n 
8  86   THR n 
8  87   LYS n 
8  88   TYR n 
8  89   GLU n 
8  90   ARG n 
8  91   ALA n 
8  92   ARG n 
8  93   ILE n 
8  94   LEU n 
8  95   GLY n 
8  96   THR n 
8  97   ARG n 
8  98   ALA n 
8  99   LEU n 
8  100  GLN n 
8  101  ILE n 
8  102  SER n 
8  103  MET n 
8  104  ASN n 
8  105  ALA n 
8  106  PRO n 
8  107  VAL n 
8  108  PHE n 
8  109  VAL n 
8  110  ASP n 
8  111  LEU n 
8  112  GLU n 
8  113  GLY n 
8  114  GLU n 
8  115  THR n 
8  116  ASP n 
8  117  PRO n 
8  118  LEU n 
8  119  ARG n 
8  120  ILE n 
8  121  ALA n 
8  122  MET n 
8  123  LYS n 
8  124  GLU n 
8  125  LEU n 
8  126  ALA n 
8  127  GLU n 
8  128  LYS n 
8  129  LYS n 
8  130  ILE n 
8  131  PRO n 
8  132  LEU n 
8  133  VAL n 
8  134  ILE n 
8  135  ARG n 
8  136  ARG n 
8  137  TYR n 
8  138  LEU n 
8  139  PRO n 
8  140  ASP n 
8  141  GLY n 
8  142  SER n 
8  143  PHE n 
8  144  GLU n 
8  145  ASP n 
8  146  TRP n 
8  147  SER n 
8  148  VAL n 
8  149  GLU n 
8  150  GLU n 
8  151  LEU n 
8  152  ILE n 
8  153  VAL n 
8  154  ASP n 
8  155  LEU n 
9  1    MET n 
9  2    SER n 
9  3    ASN n 
9  4    THR n 
9  5    LEU n 
9  6    PHE n 
9  7    ASP n 
9  8    ASP n 
9  9    ILE n 
9  10   PHE n 
9  11   GLN n 
9  12   VAL n 
9  13   SER n 
9  14   GLU n 
9  15   VAL n 
9  16   ASP n 
9  17   PRO n 
9  18   GLY n 
9  19   ARG n 
9  20   TYR n 
9  21   ASN n 
9  22   LYS n 
9  23   VAL n 
9  24   CYS n 
9  25   ARG n 
9  26   ILE n 
9  27   GLU n 
9  28   ALA n 
9  29   ALA n 
9  30   SER n 
9  31   THR n 
9  32   THR n 
9  33   GLN n 
9  34   ASP n 
9  35   GLN n 
9  36   CYS n 
9  37   LYS n 
9  38   LEU n 
9  39   THR n 
9  40   LEU n 
9  41   ASP n 
9  42   ILE n 
9  43   ASN n 
9  44   VAL n 
9  45   GLU n 
9  46   LEU n 
9  47   PHE n 
9  48   PRO n 
9  49   VAL n 
9  50   ALA n 
9  51   ALA n 
9  52   GLN n 
9  53   ASP n 
9  54   SER n 
9  55   LEU n 
9  56   THR n 
9  57   VAL n 
9  58   THR n 
9  59   ILE n 
9  60   ALA n 
9  61   SER n 
9  62   SER n 
9  63   LEU n 
9  64   ASN n 
9  65   LEU n 
9  66   GLU n 
9  67   ASP n 
9  68   THR n 
9  69   PRO n 
9  70   ALA n 
9  71   ASN n 
9  72   ASP n 
9  73   SER n 
9  74   SER n 
9  75   ALA n 
9  76   THR n 
9  77   ARG n 
9  78   SER n 
9  79   TRP n 
9  80   ARG n 
9  81   PRO n 
9  82   PRO n 
9  83   GLN n 
9  84   ALA n 
9  85   GLY n 
9  86   ASP n 
9  87   ARG n 
9  88   SER n 
9  89   LEU n 
9  90   ALA n 
9  91   ASP n 
9  92   ASP n 
9  93   TYR n 
9  94   ASP n 
9  95   TYR n 
9  96   VAL n 
9  97   MET n 
9  98   TYR n 
9  99   GLY n 
9  100  THR n 
9  101  ALA n 
9  102  TYR n 
9  103  LYS n 
9  104  PHE n 
9  105  GLU n 
9  106  GLU n 
9  107  VAL n 
9  108  SER n 
9  109  LYS n 
9  110  ASP n 
9  111  LEU n 
9  112  ILE n 
9  113  ALA n 
9  114  VAL n 
9  115  TYR n 
9  116  TYR n 
9  117  SER n 
9  118  PHE n 
9  119  GLY n 
9  120  GLY n 
9  121  LEU n 
9  122  LEU n 
9  123  MET n 
9  124  ARG n 
9  125  LEU n 
9  126  GLU n 
9  127  GLY n 
9  128  ASN n 
9  129  TYR n 
9  130  ARG n 
9  131  ASN n 
9  132  LEU n 
9  133  ASN n 
9  134  ASN n 
9  135  LEU n 
9  136  LYS n 
9  137  GLN n 
9  138  GLU n 
9  139  ASN n 
9  140  ALA n 
9  141  TYR n 
9  142  LEU n 
9  143  LEU n 
9  144  ILE n 
9  145  ARG n 
9  146  ARG n 
10 1    MET n 
10 2    THR n 
10 3    THR n 
10 4    PHE n 
10 5    ARG n 
10 6    PHE n 
10 7    CYS n 
10 8    ARG n 
10 9    ASP n 
10 10   CYS n 
10 11   ASN n 
10 12   ASN n 
10 13   MET n 
10 14   LEU n 
10 15   TYR n 
10 16   PRO n 
10 17   ARG n 
10 18   GLU n 
10 19   ASP n 
10 20   LYS n 
10 21   GLU n 
10 22   ASN n 
10 23   ASN n 
10 24   ARG n 
10 25   LEU n 
10 26   LEU n 
10 27   PHE n 
10 28   GLU n 
10 29   CYS n 
10 30   ARG n 
10 31   THR n 
10 32   CYS n 
10 33   SER n 
10 34   TYR n 
10 35   VAL n 
10 36   GLU n 
10 37   GLU n 
10 38   ALA n 
10 39   GLY n 
10 40   SER n 
10 41   PRO n 
10 42   LEU n 
10 43   VAL n 
10 44   TYR n 
10 45   ARG n 
10 46   HIS n 
10 47   GLU n 
10 48   LEU n 
10 49   ILE n 
10 50   THR n 
10 51   ASN n 
10 52   ILE n 
10 53   GLY n 
10 54   GLU n 
10 55   THR n 
10 56   ALA n 
10 57   GLY n 
10 58   VAL n 
10 59   VAL n 
10 60   GLN n 
10 61   ASP n 
10 62   ILE n 
10 63   GLY n 
10 64   SER n 
10 65   ASP n 
10 66   PRO n 
10 67   THR n 
10 68   LEU n 
10 69   PRO n 
10 70   ARG n 
10 71   SER n 
10 72   ASP n 
10 73   ARG n 
10 74   GLU n 
10 75   CYS n 
10 76   PRO n 
10 77   LYS n 
10 78   CYS n 
10 79   HIS n 
10 80   SER n 
10 81   ARG n 
10 82   GLU n 
10 83   ASN n 
10 84   VAL n 
10 85   PHE n 
10 86   PHE n 
10 87   GLN n 
10 88   SER n 
10 89   GLN n 
10 90   GLN n 
10 91   ARG n 
10 92   ARG n 
10 93   LYS n 
10 94   ASP n 
10 95   THR n 
10 96   SER n 
10 97   MET n 
10 98   VAL n 
10 99   LEU n 
10 100  PHE n 
10 101  PHE n 
10 102  VAL n 
10 103  CYS n 
10 104  LEU n 
10 105  SER n 
10 106  CYS n 
10 107  SER n 
10 108  HIS n 
10 109  ILE n 
10 110  PHE n 
10 111  THR n 
10 112  SER n 
10 113  ASP n 
10 114  GLN n 
10 115  LYS n 
10 116  ASN n 
10 117  LYS n 
10 118  ARG n 
10 119  THR n 
10 120  GLN n 
10 121  PHE n 
10 122  SER n 
11 1    MET n 
11 2    ILE n 
11 3    VAL n 
11 4    PRO n 
11 5    VAL n 
11 6    ARG n 
11 7    CYS n 
11 8    PHE n 
11 9    SER n 
11 10   CYS n 
11 11   GLY n 
11 12   LYS n 
11 13   VAL n 
11 14   VAL n 
11 15   GLY n 
11 16   ASP n 
11 17   LYS n 
11 18   TRP n 
11 19   GLU n 
11 20   SER n 
11 21   TYR n 
11 22   LEU n 
11 23   ASN n 
11 24   LEU n 
11 25   LEU n 
11 26   GLN n 
11 27   GLU n 
11 28   ASP n 
11 29   GLU n 
11 30   LEU n 
11 31   ASP n 
11 32   GLU n 
11 33   GLY n 
11 34   THR n 
11 35   ALA n 
11 36   LEU n 
11 37   SER n 
11 38   ARG n 
11 39   LEU n 
11 40   GLY n 
11 41   LEU n 
11 42   LYS n 
11 43   ARG n 
11 44   TYR n 
11 45   CYS n 
11 46   CYS n 
11 47   ARG n 
11 48   ARG n 
11 49   MET n 
11 50   ILE n 
11 51   LEU n 
11 52   THR n 
11 53   HIS n 
11 54   VAL n 
11 55   ASP n 
11 56   LEU n 
11 57   ILE n 
11 58   GLU n 
11 59   LYS n 
11 60   PHE n 
11 61   LEU n 
11 62   ARG n 
11 63   TYR n 
11 64   ASN n 
11 65   PRO n 
11 66   LEU n 
11 67   GLU n 
11 68   LYS n 
11 69   ARG n 
11 70   ASP n 
12 1    MET n 
12 2    ASN n 
12 3    ALA n 
12 4    PRO n 
12 5    ASP n 
12 6    ARG n 
12 7    PHE n 
12 8    GLU n 
12 9    LEU n 
12 10   PHE n 
12 11   LEU n 
12 12   LEU n 
12 13   GLY n 
12 14   GLU n 
12 15   GLY n 
12 16   GLU n 
12 17   SER n 
12 18   LYS n 
12 19   LEU n 
12 20   LYS n 
12 21   ILE n 
12 22   ASP n 
12 23   PRO n 
12 24   ASP n 
12 25   THR n 
12 26   LYS n 
12 27   ALA n 
12 28   PRO n 
12 29   ASN n 
12 30   ALA n 
12 31   VAL n 
12 32   VAL n 
12 33   ILE n 
12 34   THR n 
12 35   PHE n 
12 36   GLU n 
12 37   LYS n 
12 38   GLU n 
12 39   ASP n 
12 40   HIS n 
12 41   THR n 
12 42   LEU n 
12 43   GLY n 
12 44   ASN n 
12 45   LEU n 
12 46   ILE n 
12 47   ARG n 
12 48   ALA n 
12 49   GLU n 
12 50   LEU n 
12 51   LEU n 
12 52   ASN n 
12 53   ASP n 
12 54   ARG n 
12 55   LYS n 
12 56   VAL n 
12 57   LEU n 
12 58   PHE n 
12 59   ALA n 
12 60   ALA n 
12 61   TYR n 
12 62   LYS n 
12 63   VAL n 
12 64   GLU n 
12 65   HIS n 
12 66   PRO n 
12 67   PHE n 
12 68   PHE n 
12 69   ALA n 
12 70   ARG n 
12 71   PHE n 
12 72   LYS n 
12 73   LEU n 
12 74   ARG n 
12 75   ILE n 
12 76   GLN n 
12 77   THR n 
12 78   THR n 
12 79   GLU n 
12 80   GLY n 
12 81   TYR n 
12 82   ASP n 
12 83   PRO n 
12 84   LYS n 
12 85   ASP n 
12 86   ALA n 
12 87   LEU n 
12 88   LYS n 
12 89   ASN n 
12 90   ALA n 
12 91   CYS n 
12 92   ASN n 
12 93   SER n 
12 94   ILE n 
12 95   ILE n 
12 96   ASN n 
12 97   LYS n 
12 98   LEU n 
12 99   GLY n 
12 100  ALA n 
12 101  LEU n 
12 102  LYS n 
12 103  THR n 
12 104  ASN n 
12 105  PHE n 
12 106  GLU n 
12 107  THR n 
12 108  GLU n 
12 109  TRP n 
12 110  ASN n 
12 111  LEU n 
12 112  GLN n 
12 113  THR n 
12 114  LEU n 
12 115  ALA n 
12 116  ALA n 
12 117  ASP n 
12 118  ASP n 
12 119  ALA n 
12 120  PHE n 
13 1    MET n 
13 2    SER n 
13 3    ARG n 
13 4    GLU n 
13 5    GLY n 
13 6    PHE n 
13 7    GLN n 
13 8    ILE n 
13 9    PRO n 
13 10   THR n 
13 11   ASN n 
13 12   LEU n 
13 13   ASP n 
13 14   ALA n 
13 15   ALA n 
13 16   ALA n 
13 17   ALA n 
13 18   GLY n 
13 19   THR n 
13 20   SER n 
13 21   GLN n 
13 22   ALA n 
13 23   ARG n 
13 24   THR n 
13 25   ALA n 
13 26   THR n 
13 27   LEU n 
13 28   LYS n 
13 29   TYR n 
13 30   ILE n 
13 31   CYS n 
13 32   ALA n 
13 33   GLU n 
13 34   CYS n 
13 35   SER n 
13 36   SER n 
13 37   LYS n 
13 38   LEU n 
13 39   SER n 
13 40   LEU n 
13 41   SER n 
13 42   ARG n 
13 43   THR n 
13 44   ASP n 
13 45   ALA n 
13 46   VAL n 
13 47   ARG n 
13 48   CYS n 
13 49   LYS n 
13 50   ASP n 
13 51   CYS n 
13 52   GLY n 
13 53   HIS n 
13 54   ARG n 
13 55   ILE n 
13 56   LEU n 
13 57   LEU n 
13 58   LYS n 
13 59   ALA n 
13 60   ARG n 
13 61   THR n 
13 62   LYS n 
13 63   ARG n 
13 64   LEU n 
13 65   VAL n 
13 66   GLN n 
13 67   PHE n 
13 68   GLU n 
13 69   ALA n 
13 70   ARG n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4  1 sample 1 1733 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 1224 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 318  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 215  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 155  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 146  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 122  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 120  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 9  'synthetic construct' ? 32630 ? 
2 1 sample 1 29 'synthetic construct' ? 32630 ? 
3 1 sample 1 18 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  PDB 6UPY        6UPY   ? 1  ? 1 
2  PDB 6UPY        6UPY   ? 2  ? 1 
3  PDB 6UPY        6UPY   ? 3  ? 1 
4  UNP RPB1_YEAST  P04050 ? 4  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 
5  UNP RPB2_YEAST  P08518 ? 5  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 
6  UNP RPB3_YEAST  P16370 ? 6  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 
7  UNP RPAB1_YEAST P20434 ? 7  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 
8  UNP RPAB2_YEAST P20435 ? 8  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 
9  UNP RPAB3_YEAST P20436 ? 9  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 
10 UNP RPB9_YEAST  P27999 ? 10 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 
11 UNP RPAB5_YEAST P22139 ? 11 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 
12 UNP RPB11_YEAST P38902 ? 12 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 
13 UNP RPAB4_YEAST P40422 ? 13 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6UPY R 1 ? 9    ? 6UPY   1 ? 9    ? 1 9    
2  2  6UPY T 1 ? 29   ? 6UPY   1 ? 29   ? 1 29   
3  3  6UPY N 1 ? 18   ? 6UPY   1 ? 18   ? 1 18   
4  4  6UPY A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
5  5  6UPY B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
6  6  6UPY C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
7  7  6UPY E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
8  8  6UPY F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
9  9  6UPY H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
10 10 6UPY I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
11 11 6UPY J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
12 12 6UPY K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
13 13 6UPY L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                                                                            
?                                               'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                                                                                 
?                                               'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER'                                                         
"ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                                                                                
?                                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
?                                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
?                                               'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                                                                             
?                                               'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                                                                                
?                                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                                    
?                                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                                     
?                                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                                    
?                                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                            
?                                               'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                                                                            
?                                               'C10 H14 N5 O8 P'   363.221 
G35 'DNA linking'       . '(5R)-5-carbamimidamido-1-(2-deoxy-5-O-phosphono-beta-D-erythro-pentofuranosyl)imidazolidine-2,4-dione' 
?                                               'C9 H16 N5 O8 P'    353.226 
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
?                                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
?                                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
?                                               'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                               
?                                               'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
?                                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                 
?                                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                  
?                                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
?                                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                                         
?                                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
?                                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                 
?                                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
?                                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
?                                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                              
?                                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                
?                                               'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                                                                              
?                                               'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                                                                                  
?                                               'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                                                                              
?                                               'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UPY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.66 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.39 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.150 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '390mM (NH4)2HPO4/NaH2PO4, pH 6.5, 5mM dioxane, 5mM DTT, 10-12% PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-09-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00003 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00003 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            89.890 
_reflns.entry_id                         6UPY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.290 
_reflns.d_resolution_low                 49.220 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       105549 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.700 
_reflns.pdbx_Rmerge_I_obs                0.450 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             8 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.482 
_reflns.pdbx_Rpim_I_all                  0.173 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         816457 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.986 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.290 
_reflns_shell.d_res_low                   3.350 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         40606 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5201 
_reflns_shell.percent_possible_all        99.300 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                4.436 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.800 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   0.700 
_reflns_shell.pdbx_Rrim_I_all             4.750 
_reflns_shell.pdbx_Rpim_I_all             1.694 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.278 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                393.930 
_refine.B_iso_mean                               110.0914 
_refine.B_iso_min                                25.230 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6UPY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.4000 
_refine.ls_d_res_low                             49.2180 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     95532 
_refine.ls_number_reflns_R_free                  1809 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.4900 
_refine.ls_percent_reflns_R_free                 1.8900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2283 
_refine.ls_R_factor_R_free                       0.2824 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2273 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6BLO 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 32.7400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.5300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.4000 
_refine_hist.d_res_low                        49.2180 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29013 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       3580 
_refine_hist.pdbx_B_iso_mean_ligand           171.89 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        27957 
_refine_hist.pdbx_number_atoms_nucleic_acid   1016 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.4000 3.4919  . . 138 7128 99.0000  . . . 0.4092 0.0000 0.3537 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4919 3.5946  . . 138 7154 99.0000  . . . 0.3880 0.0000 0.3324 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5946 3.7106  . . 138 7171 99.0000  . . . 0.3563 0.0000 0.3001 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7106 3.8432  . . 138 7158 99.0000  . . . 0.3534 0.0000 0.2906 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8432 3.9970  . . 140 7222 99.0000  . . . 0.3115 0.0000 0.2699 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9970 4.1788  . . 138 7160 100.0000 . . . 0.2988 0.0000 0.2363 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1788 4.3990  . . 140 7214 100.0000 . . . 0.2727 0.0000 0.2107 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3990 4.6744  . . 140 7226 100.0000 . . . 0.2814 0.0000 0.1995 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6744 5.0350  . . 138 7186 100.0000 . . . 0.2558 0.0000 0.1980 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0350 5.5411  . . 140 7241 100.0000 . . . 0.2831 0.0000 0.2087 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5411 6.3415  . . 140 7256 100.0000 . . . 0.3135 0.0000 0.2197 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3415 7.9841  . . 141 7267 100.0000 . . . 0.2618 0.0000 0.2086 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.9841 49.2180 . . 140 7340 100.0000 . . . 0.2048 0.0000 0.1832 . . . . . . . . . . . 
# 
_struct.entry_id                     6UPY 
_struct.title                        'RNA polymerase II elongation complex with 5-guanidinohydantoin lesion in state 2E' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase II subunit RPB2, DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4/RNA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UPY 
_struct_keywords.text            
'RNA polymerase II, 5-guanidinohydantoin, elongation complex, DNA lesion, TRANSCRIPTION, TRANSCRIPTION-RNA-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/RNA/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 14 ? 
P N N 15 ? 
Q N N 16 ? 
R N N 14 ? 
S N N 14 ? 
T N N 14 ? 
U N N 14 ? 
V N N 14 ? 
W N N 14 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER D 23   ? SER D 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   AA2 HIS D 92   ? GLY D 94   ? HIS A 92   GLY A 94   5 ? 3  
HELX_P HELX_P3   AA3 PHE D 95   ? GLU D 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P4   AA4 ASN D 119  ? ALA D 127  ? ASN A 119  ALA A 127  1 ? 9  
HELX_P HELX_P5   AA5 ASP D 130  ? LYS D 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P6   AA6 SER D 203  ? HIS D 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P7   AA7 SER D 215  ? GLY D 223  ? SER A 215  GLY A 223  1 ? 9  
HELX_P HELX_P8   AA8 ARG D 230  ? MET D 234  ? ARG A 230  MET A 234  5 ? 5  
HELX_P HELX_P9   AA9 PRO D 243  ? ARG D 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P10  AB1 ASP D 260  ? ASN D 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P11  AB2 ILE D 289  ? ASP D 305  ? ILE A 289  ASP A 305  1 ? 17 
HELX_P HELX_P12  AB3 SER D 324  ? LEU D 329  ? SER A 324  LEU A 329  1 ? 6  
HELX_P HELX_P13  AB4 GLY D 334  ? LEU D 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P14  AB5 LYS D 368  ? LEU D 374  ? LYS A 368  LEU A 374  1 ? 7  
HELX_P HELX_P15  AB6 ASN D 384  ? GLY D 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P16  AB7 VAL D 474  ? ASN D 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P17  AB8 SER D 494  ? LEU D 504  ? SER A 494  LEU A 504  1 ? 11 
HELX_P HELX_P18  AB9 PRO D 508  ? GLN D 510  ? PRO A 508  GLN A 510  5 ? 3  
HELX_P HELX_P19  AC1 PRO D 514  ? ASN D 517  ? PRO A 514  ASN A 517  5 ? 4  
HELX_P HELX_P20  AC2 ASP D 526  ? LEU D 536  ? ASP A 526  LEU A 536  1 ? 11 
HELX_P HELX_P21  AC3 GLU D 542  ? VAL D 553  ? GLU A 542  VAL A 553  1 ? 12 
HELX_P HELX_P22  AC4 GLY D 574  ? SER D 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P23  AC5 VAL D 580  ? ILE D 582  ? VAL A 580  ILE A 582  5 ? 3  
HELX_P HELX_P24  AC6 GLU D 618  ? GLY D 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P25  AC7 GLY D 628  ? LYS D 637  ? GLY A 628  LYS A 637  1 ? 10 
HELX_P HELX_P26  AC8 GLY D 638  ? GLY D 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P27  AC9 ASP D 672  ? ALA D 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P28  AD1 THR D 709  ? VAL D 735  ? THR A 709  VAL A 735  1 ? 27 
HELX_P HELX_P29  AD2 ASN D 741  ? ALA D 749  ? ASN A 741  ALA A 749  1 ? 9  
HELX_P HELX_P30  AD3 SER D 754  ? ALA D 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P31  AD4 SER D 793  ? GLY D 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P32  AD5 THR D 809  ? LEU D 845  ? THR A 809  LEU A 845  1 ? 37 
HELX_P HELX_P33  AD6 ILE D 867  ? ASP D 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P34  AD7 ASP D 874  ? ILE D 878  ? ASP A 874  ILE A 878  5 ? 5  
HELX_P HELX_P35  AD8 SER D 889  ? ARG D 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P36  AD9 ASP D 909  ? LEU D 913  ? ASP A 909  LEU A 913  5 ? 5  
HELX_P HELX_P37  AE1 ASP D 922  ? PHE D 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P38  AE2 ASN D 959  ? PHE D 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P39  AE3 THR D 982  ? ASN D 996  ? THR A 982  ASN A 996  1 ? 15 
HELX_P HELX_P40  AE4 ASN D 1004 ? VAL D 1015 ? ASN A 1004 VAL A 1015 1 ? 12 
HELX_P HELX_P41  AE5 VAL D 1015 ? LEU D 1026 ? VAL A 1015 LEU A 1026 1 ? 12 
HELX_P HELX_P42  AE6 ALA D 1027 ? GLU D 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P43  AE7 THR D 1038 ? VAL D 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P44  AE8 MET D 1063 ? MET D 1079 ? MET A 1063 MET A 1079 1 ? 17 
HELX_P HELX_P45  AE9 SER D 1096 ? ASN D 1106 ? SER A 1096 ASN A 1106 1 ? 11 
HELX_P HELX_P46  AF1 ASP D 1127 ? GLU D 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P47  AF2 LEU D 1143 ? VAL D 1146 ? LEU A 1143 VAL A 1146 1 ? 4  
HELX_P HELX_P48  AF3 ASP D 1166 ? LEU D 1172 ? ASP A 1166 LEU A 1172 1 ? 7  
HELX_P HELX_P49  AF4 ASP D 1198 ? LYS D 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P50  AF5 THR D 1208 ? LYS D 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P51  AF6 GLU D 1255 ? ASN D 1270 ? GLU A 1255 ASN A 1270 1 ? 16 
HELX_P HELX_P52  AF7 ASN D 1312 ? VAL D 1316 ? ASN A 1312 VAL A 1316 5 ? 5  
HELX_P HELX_P53  AF8 SER D 1331 ? GLY D 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P54  AF9 GLY D 1340 ? GLY D 1360 ? GLY A 1340 GLY A 1360 1 ? 21 
HELX_P HELX_P55  AG1 ASN D 1364 ? THR D 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P56  AG2 GLY D 1395 ? SER D 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P57  AG3 GLU D 1404 ? ALA D 1416 ? GLU A 1404 ALA A 1416 1 ? 13 
HELX_P HELX_P58  AG4 GLY D 1423 ? GLY D 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P59  AG5 ILE D 1436 ? ALA D 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P60  AG6 ASP E 29   ? GLY E 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P61  AG7 VAL E 44   ? TYR E 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P62  AG8 TYR E 57   ? CYS E 64   ? TYR B 57   CYS B 64   1 ? 8  
HELX_P HELX_P63  AG9 TYR E 113  ? ARG E 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P64  AH1 CYS E 179  ? GLU E 183  ? CYS B 179  GLU B 183  5 ? 5  
HELX_P HELX_P65  AH2 THR E 185  ? LEU E 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P66  AH3 ILE E 282  ? GLY E 290  ? ILE B 282  GLY B 290  1 ? 9  
HELX_P HELX_P67  AH4 PRO E 293  ? CYS E 302  ? PRO B 293  CYS B 302  1 ? 10 
HELX_P HELX_P68  AH5 ASP E 307  ? GLY E 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P69  AH6 ASP E 326  ? LEU E 331  ? ASP B 326  LEU B 331  1 ? 6  
HELX_P HELX_P70  AH7 GLU E 346  ? GLU E 359  ? GLU B 346  GLU B 359  1 ? 14 
HELX_P HELX_P71  AH8 PHE E 370  ? LEU E 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P72  AH9 HIS E 400  ? GLY E 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P73  AI1 LEU E 408  ? THR E 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P74  AI2 ALA E 450  ? GLY E 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P75  AI3 THR E 487  ? ARG E 496  ? THR B 487  ARG B 496  1 ? 10 
HELX_P HELX_P76  AI4 HIS E 515  ? TRP E 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P77  AI5 PRO E 551  ? GLU E 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P78  AI6 ASN E 592  ? GLY E 607  ? ASN B 592  GLY B 607  1 ? 16 
HELX_P HELX_P79  AI7 ARG E 654  ? ASP E 668  ? ARG B 654  ASP B 668  1 ? 15 
HELX_P HELX_P80  AI8 THR E 680  ? GLU E 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P81  AI9 GLU E 696  ? ILE E 701  ? GLU B 696  ILE B 701  5 ? 6  
HELX_P HELX_P82  AJ1 GLN E 706  ? LEU E 710  ? GLN B 706  LEU B 710  5 ? 5  
HELX_P HELX_P83  AJ2 HIS E 744  ? LEU E 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P84  AJ3 GLY E 750  ? ILE E 756  ? GLY B 750  ILE B 756  1 ? 7  
HELX_P HELX_P85  AJ4 PHE E 758  ? ASN E 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P86  AJ5 GLN E 763  ? GLY E 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P87  AJ6 LEU E 782  ? ASN E 786  ? LEU B 782  ASN B 786  5 ? 5  
HELX_P HELX_P88  AJ7 GLN E 843  ? ARG E 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P89  AJ8 HIS E 1015 ? MET E 1021 ? HIS B 1015 MET B 1021 1 ? 7  
HELX_P HELX_P90  AJ9 THR E 1022 ? GLY E 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P91  AK1 THR E 1051 ? HIS E 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P92  AK2 GLY E 1131 ? GLY E 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P93  AK3 ALA E 1143 ? MET E 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P94  AK4 TYR E 1198 ? MET E 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P95  AK5 ASP F 26   ? GLU F 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P96  AK6 ALA F 59   ? LEU F 69   ? ALA C 59   LEU C 69   1 ? 11 
HELX_P HELX_P97  AK7 TYR F 114  ? LEU F 118  ? TYR C 114  LEU C 118  5 ? 5  
HELX_P HELX_P98  AK8 HIS F 167  ? GLY F 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P99  AK9 ASP F 196  ? TRP F 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P100 AL1 SER F 204  ? GLU F 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P101 AL2 PRO F 239  ? GLN F 267  ? PRO C 239  GLN C 267  1 ? 29 
HELX_P HELX_P102 AL3 ASN G 5    ? ARG G 26   ? ASN E 5    ARG E 26   1 ? 22 
HELX_P HELX_P103 AL4 THR G 31   ? GLU G 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P104 AL5 PRO G 38   ? CYS G 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P105 AL6 GLN G 54   ? SER G 59   ? GLN E 54   SER E 59   5 ? 6  
HELX_P HELX_P106 AL7 THR G 65   ? PHE G 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P107 AL8 GLY G 89   ? ASN G 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P108 AL9 THR G 117  ? LEU G 123  ? THR E 117  LEU E 123  1 ? 7  
HELX_P HELX_P109 AM1 VAL G 124  ? ILE G 127  ? VAL E 124  ILE E 127  5 ? 4  
HELX_P HELX_P110 AM2 ASN G 143  ? HIS G 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P111 AM3 SER G 157  ? TYR G 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P112 AM4 ASP G 182  ? LEU G 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P113 AM5 THR H 86   ? MET H 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P114 AM6 ASP H 116  ? GLU H 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P115 AM7 VAL J 59   ? ASP J 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P116 AM8 ASP K 16   ? GLU K 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P117 AM9 ASP K 31   ? GLY K 40   ? ASP J 31   GLY J 40   1 ? 10 
HELX_P HELX_P118 AN1 ARG K 43   ? LEU K 51   ? ARG J 43   LEU J 51   1 ? 9  
HELX_P HELX_P119 AN2 LEU K 56   ? ARG K 62   ? LEU J 56   ARG J 62   1 ? 7  
HELX_P HELX_P120 AN3 ASP L 5    ? PHE L 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P121 AN4 ASP L 39   ? LEU L 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P122 AN5 ASP L 82   ? GLN L 112  ? ASP K 82   GLN K 112  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A G   9    "O3'" ? ? ? 1_555 P MG  .  MG ? ? R G   9    A MG  1803 1_555 ? ? ? ? ? ? ?            2.103 ? 
covale1  covale both ? B DA  18   "O3'" ? ? ? 1_555 B G35 19 P  ? ? T DA  18   T G35 19   1_555 ? ? ? ? ? ? ?            1.603 ? 
covale2  covale one  ? B G35 19   "O3'" ? ? ? 1_555 B DC  20 P  ? ? T G35 19   T DC  20   1_555 ? ? ? ? ? ? ?            1.614 ? 
metalc2  metalc ?    ? D CYS 67   SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 67   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.725 ? 
metalc3  metalc ?    ? D CYS 70   SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 70   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.503 ? 
metalc4  metalc ?    ? D CYS 77   SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 77   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.846 ? 
metalc5  metalc ?    ? D HIS 80   NE2   ? ? ? 1_555 O ZN  .  ZN ? ? A HIS 80   A ZN  1802 1_555 ? ? ? ? ? ? ?            1.960 ? 
metalc6  metalc ?    ? D CYS 107  SG    ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 107  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.631 ? 
metalc7  metalc ?    ? D CYS 110  SG    ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 110  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.521 ? 
metalc8  metalc ?    ? D CYS 148  SG    ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 148  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.524 ? 
metalc9  metalc ?    ? D CYS 167  SG    ? ? ? 1_555 N ZN  .  ZN ? ? A CYS 167  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.732 ? 
metalc10 metalc ?    ? D ASP 483  OD2   ? ? ? 1_555 P MG  .  MG ? ? A ASP 483  A MG  1803 1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc11 metalc ?    ? D ASP 485  OD1   ? ? ? 1_555 P MG  .  MG ? ? A ASP 485  A MG  1803 1_555 ? ? ? ? ? ? ?            2.172 ? 
metalc12 metalc ?    ? D ASP 485  OD2   ? ? ? 1_555 P MG  .  MG ? ? A ASP 485  A MG  1803 1_555 ? ? ? ? ? ? ?            2.101 ? 
metalc13 metalc ?    ? E CYS 1163 SG    ? ? ? 1_555 R ZN  .  ZN ? ? B CYS 1163 B ZN  1302 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc14 metalc ?    ? E CYS 1166 SG    ? ? ? 1_555 R ZN  .  ZN ? ? B CYS 1166 B ZN  1302 1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc15 metalc ?    ? E CYS 1182 SG    ? ? ? 1_555 R ZN  .  ZN ? ? B CYS 1182 B ZN  1302 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc16 metalc ?    ? E CYS 1185 SG    ? ? ? 1_555 R ZN  .  ZN ? ? B CYS 1185 B ZN  1302 1_555 ? ? ? ? ? ? ?            2.393 ? 
metalc17 metalc ?    ? F CYS 86   SG    ? ? ? 1_555 S ZN  .  ZN ? ? C CYS 86   C ZN  401  1_555 ? ? ? ? ? ? ?            2.515 ? 
metalc18 metalc ?    ? F CYS 88   SG    ? ? ? 1_555 S ZN  .  ZN ? ? C CYS 88   C ZN  401  1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc19 metalc ?    ? F CYS 92   N     ? ? ? 1_555 S ZN  .  ZN ? ? C CYS 92   C ZN  401  1_555 ? ? ? ? ? ? ?            2.645 ? 
metalc20 metalc ?    ? F CYS 92   SG    ? ? ? 1_555 S ZN  .  ZN ? ? C CYS 92   C ZN  401  1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc21 metalc ?    ? F CYS 95   SG    ? ? ? 1_555 S ZN  .  ZN ? ? C CYS 95   C ZN  401  1_555 ? ? ? ? ? ? ?            2.532 ? 
metalc22 metalc ?    ? J CYS 7    SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 7    I ZN  201  1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc23 metalc ?    ? J CYS 10   SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 10   I ZN  201  1_555 ? ? ? ? ? ? ?            2.533 ? 
metalc24 metalc ?    ? J CYS 29   SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 29   I ZN  201  1_555 ? ? ? ? ? ? ?            2.552 ? 
metalc25 metalc ?    ? J CYS 32   SG    ? ? ? 1_555 T ZN  .  ZN ? ? I CYS 32   I ZN  201  1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc26 metalc ?    ? J CYS 75   SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 75   I ZN  202  1_555 ? ? ? ? ? ? ?            2.417 ? 
metalc27 metalc ?    ? J CYS 78   SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 78   I ZN  202  1_555 ? ? ? ? ? ? ?            2.342 ? 
metalc28 metalc ?    ? J CYS 103  SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 103  I ZN  202  1_555 ? ? ? ? ? ? ?            2.499 ? 
metalc29 metalc ?    ? J CYS 106  SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 106  I ZN  202  1_555 ? ? ? ? ? ? ?            2.244 ? 
metalc30 metalc ?    ? K CYS 7    SG    ? ? ? 1_555 V ZN  .  ZN ? ? J CYS 7    J ZN  101  1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc31 metalc ?    ? K CYS 45   SG    ? ? ? 1_555 V ZN  .  ZN ? ? J CYS 45   J ZN  101  1_555 ? ? ? ? ? ? ?            2.678 ? 
metalc32 metalc ?    ? K CYS 46   SG    ? ? ? 1_555 V ZN  .  ZN ? ? J CYS 46   J ZN  101  1_555 ? ? ? ? ? ? ?            2.454 ? 
metalc33 metalc ?    ? M CYS 31   SG    ? ? ? 1_555 W ZN  .  ZN ? ? L CYS 31   L ZN  101  1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc34 metalc ?    ? M CYS 34   SG    ? ? ? 1_555 W ZN  .  ZN ? ? L CYS 34   L ZN  101  1_555 ? ? ? ? ? ? ?            2.515 ? 
metalc35 metalc ?    ? M CYS 48   SG    ? ? ? 1_555 W ZN  .  ZN ? ? L CYS 48   L ZN  101  1_555 ? ? ? ? ? ? ?            2.335 ? 
metalc36 metalc ?    ? M CYS 51   SG    ? ? ? 1_555 W ZN  .  ZN ? ? L CYS 51   L ZN  101  1_555 ? ? ? ? ? ? ?            2.305 ? 
hydrog1  hydrog ?    ? A A   1    N1    ? ? ? 1_555 B DT  28 N3 ? ? R A   1    T DT  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? A A   1    N6    ? ? ? 1_555 B DT  28 O4 ? ? R A   1    T DT  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? A U   2    N3    ? ? ? 1_555 B DA  27 N1 ? ? R U   2    T DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? A U   2    O4    ? ? ? 1_555 B DA  27 N6 ? ? R U   2    T DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? A C   3    N3    ? ? ? 1_555 B DG  26 N1 ? ? R C   3    T DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? A C   3    N4    ? ? ? 1_555 B DG  26 O6 ? ? R C   3    T DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? A C   3    O2    ? ? ? 1_555 B DG  26 N2 ? ? R C   3    T DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? A G   4    N1    ? ? ? 1_555 B DC  25 N3 ? ? R G   4    T DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? A G   4    N2    ? ? ? 1_555 B DC  25 O2 ? ? R G   4    T DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? A G   4    O6    ? ? ? 1_555 B DC  25 N4 ? ? R G   4    T DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? A A   5    N1    ? ? ? 1_555 B DT  24 N3 ? ? R A   5    T DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? A A   5    N6    ? ? ? 1_555 B DT  24 O4 ? ? R A   5    T DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? A G   6    N1    ? ? ? 1_555 B DC  23 N3 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? A G   6    N2    ? ? ? 1_555 B DC  23 O2 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? A G   6    O6    ? ? ? 1_555 B DC  23 N4 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? A A   7    N1    ? ? ? 1_555 B DT  22 N3 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? A A   7    N6    ? ? ? 1_555 B DT  22 O4 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? A G   8    N1    ? ? ? 1_555 B DC  21 N3 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? A G   8    N2    ? ? ? 1_555 B DC  21 O2 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? A G   8    O6    ? ? ? 1_555 B DC  21 N4 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? A G   9    N1    ? ? ? 1_555 B DC  21 N3 ? ? R G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? A G   9    N2    ? ? ? 1_555 B DC  21 O2 ? ? R G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? A G   9    O6    ? ? ? 1_555 B DC  21 N4 ? ? R G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DC  5    N3    ? ? ? 1_555 C DG  14 N1 ? ? T DC  5    N DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DC  5    N4    ? ? ? 1_555 C DG  14 O6 ? ? T DC  5    N DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DC  5    O2    ? ? ? 1_555 C DG  14 N2 ? ? T DC  5    N DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DT  6    N3    ? ? ? 1_555 C DA  13 N1 ? ? T DT  6    N DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DT  6    O4    ? ? ? 1_555 C DA  13 N6 ? ? T DT  6    N DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DC  7    N3    ? ? ? 1_555 C DG  12 N1 ? ? T DC  7    N DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? B DC  7    N4    ? ? ? 1_555 C DG  12 O6 ? ? T DC  7    N DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? B DC  7    O2    ? ? ? 1_555 C DG  12 N2 ? ? T DC  7    N DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? B DT  10   N3    ? ? ? 1_555 C DA  9  N1 ? ? T DT  10   N DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? B DT  10   O4    ? ? ? 1_555 C DA  9  N6 ? ? T DT  10   N DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? B DC  11   N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  11   N DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? B DC  11   N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  11   N DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? B DC  11   O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  11   N DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? B DT  12   N3    ? ? ? 1_555 C DA  7  N1 ? ? T DT  12   N DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? B DT  12   O4    ? ? ? 1_555 C DA  7  N6 ? ? T DT  12   N DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? B DC  13   N3    ? ? ? 1_555 C DG  6  N1 ? ? T DC  13   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? B DC  13   N4    ? ? ? 1_555 C DG  6  O6 ? ? T DC  13   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? B DC  13   O2    ? ? ? 1_555 C DG  6  N2 ? ? T DC  13   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? B DG  14   N2    ? ? ? 1_555 C DC  5  N3 ? ? T DG  14   N DC  5    1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog43 hydrog ?    ? B DC  15   N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  15   N DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? B DC  15   N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  15   N DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? B DC  15   O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  15   N DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? B DT  16   N3    ? ? ? 1_555 C DA  3  N1 ? ? T DT  16   N DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? B DT  16   O4    ? ? ? 1_555 C DA  3  N6 ? ? T DT  16   N DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? B DG  17   N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  17   N DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? B DG  17   N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  17   N DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? B DG  17   O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  17   N DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 399 D . ? HIS 399 A PRO 400 D ? PRO 400 A 1 3.88 
2 GLN 447 D . ? GLN 447 A PRO 448 D ? PRO 448 A 1 1.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 8 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 3 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 5 ? 
AC5 ? 3 ? 
AC6 ? 5 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 5 ? 
AD1 ? 7 ? 
AD2 ? 2 ? 
AD3 ? 8 ? 
AD4 ? 4 ? 
AD5 ? 2 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 4 ? 
AD9 ? 5 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 4 ? 
AE4 ? 4 ? 
AE5 ? 9 ? 
AE6 ? 3 ? 
AE7 ? 3 ? 
AE8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA5 6 7 ? anti-parallel 
AA5 7 8 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? parallel      
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC6 4 5 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? anti-parallel 
AD1 6 7 ? anti-parallel 
AD2 1 2 ? parallel      
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? parallel      
AD3 5 6 ? anti-parallel 
AD3 6 7 ? parallel      
AD3 7 8 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? parallel      
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AD9 4 5 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? parallel      
AE3 3 4 ? parallel      
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? parallel      
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE5 4 5 ? anti-parallel 
AE5 5 6 ? anti-parallel 
AE5 6 7 ? anti-parallel 
AE5 7 8 ? anti-parallel 
AE5 8 9 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU D 1418 ? ASP D 1419 ? LEU A 1418 ASP A 1419 
AA1 2 GLU D 16   ? GLN D 18   ? GLU A 16   GLN A 18   
AA1 3 ARG E 1215 ? TYR E 1217 ? ARG B 1215 TYR B 1217 
AA2 1 ILE D 84   ? VAL D 90   ? ILE A 84   VAL A 90   
AA2 2 LEU D 236  ? LEU D 239  ? LEU A 236  LEU A 239  
AA3 1 THR D 173  ? ASP D 177  ? THR A 173  ASP A 177  
AA3 2 LYS D 180  ? SER D 184  ? LYS A 180  SER A 184  
AA4 1 LYS D 343  ? VAL D 345  ? LYS A 343  VAL A 345  
AA4 2 LEU E 1128 ? PHE E 1130 ? LEU B 1128 PHE B 1130 
AA5 1 HIS E 1104 ? ARG E 1106 ? HIS B 1104 ARG B 1106 
AA5 2 SER D 348  ? ASP D 356  ? SER A 348  ASP A 356  
AA5 3 GLU D 486  ? HIS D 490  ? GLU A 486  HIS A 490  
AA5 4 PRO D 441  ? ASN D 445  ? PRO A 441  ASN A 445  
AA5 5 MET D 455  ? ILE D 463  ? MET A 455  ILE A 463  
AA5 6 GLN D 363  ? PRO D 367  ? GLN A 363  PRO A 367  
AA5 7 PHE D 468  ? ASN D 471  ? PHE A 468  ASN A 471  
AA5 8 SER D 348  ? ASP D 356  ? SER A 348  ASP A 356  
AA6 1 THR D 375  ? VAL D 379  ? THR A 375  VAL A 379  
AA6 2 LYS D 431  ? HIS D 435  ? LYS A 431  HIS A 435  
AA6 3 ALA D 402  ? ILE D 406  ? ALA A 402  ILE A 406  
AA6 4 ARG D 412  ? ASP D 414  ? ARG A 412  ASP A 414  
AA7 1 VAL D 512  ? SER D 513  ? VAL A 512  SER A 513  
AA7 2 LYS D 518  ? PRO D 519  ? LYS A 518  PRO A 519  
AA8 1 PHE D 540  ? ILE D 541  ? PHE A 540  ILE A 541  
AA8 2 TRP D 572  ? SER D 573  ? TRP A 572  SER A 573  
AA9 1 HIS D 587  ? ARG D 590  ? HIS A 587  ARG A 590  
AA9 2 MET D 605  ? ILE D 608  ? MET A 605  ILE A 608  
AA9 3 ILE D 612  ? PHE D 614  ? ILE A 612  PHE A 614  
AB1 1 GLY D 766  ? GLN D 767  ? GLY A 766  GLN A 767  
AB1 2 PHE D 799  ? VAL D 800  ? PHE A 799  VAL A 800  
AB2 1 MET D 849  ? VAL D 850  ? MET A 849  VAL A 850  
AB2 2 THR D 856  ? ARG D 857  ? THR A 856  ARG A 857  
AB3 1 GLU D 879  ? SER D 882  ? GLU A 879  SER A 882  
AB3 2 ASN D 953  ? LEU D 956  ? ASN A 953  LEU A 956  
AB4 1 ARG D 1281 ? TYR D 1287 ? ARG A 1281 TYR A 1287 
AB4 2 GLU D 1303 ? ASP D 1309 ? GLU A 1303 ASP A 1309 
AB4 3 LEU D 1116 ? TYR D 1119 ? LEU A 1116 TYR A 1119 
AB4 4 TYR D 1328 ? THR D 1329 ? TYR A 1328 THR A 1329 
AB5 1 THR D 1141 ? THR D 1142 ? THR A 1141 THR A 1142 
AB5 2 THR D 1272 ? ARG D 1274 ? THR A 1272 ARG A 1274 
AB6 1 LEU D 1224 ? TRP D 1228 ? LEU A 1224 TRP A 1228 
AB6 2 LEU D 1236 ? VAL D 1242 ? LEU A 1236 VAL A 1242 
AB6 3 TRP D 1191 ? LEU D 1197 ? TRP A 1191 LEU A 1197 
AB6 4 THR D 1147 ? TYR D 1154 ? THR A 1147 TYR A 1154 
AB6 5 LEU J 42   ? GLU J 47   ? LEU I 42   GLU I 47   
AB7 1 LYS D 1290 ? PRO D 1292 ? LYS A 1290 PRO A 1292 
AB7 2 TYR D 1298 ? LYS D 1300 ? TYR A 1298 LYS A 1300 
AB8 1 ASP D 1442 ? ILE D 1445 ? ASP A 1442 ILE A 1445 
AB8 2 LEU H 132  ? TYR H 137  ? LEU F 132  TYR F 137  
AB8 3 PHE H 143  ? SER H 147  ? PHE F 143  SER F 147  
AB9 1 GLU E 89   ? VAL E 97   ? GLU B 89   VAL B 97   
AB9 2 SER E 125  ? ARG E 135  ? SER B 125  ARG B 135  
AB9 3 VAL E 165  ? PRO E 171  ? VAL B 165  PRO B 171  
AC1 1 MET E 101  ? ASN E 103  ? MET B 101  ASN B 103  
AC1 2 THR E 109  ? ALA E 111  ? THR B 109  ALA B 111  
AC2 1 PHE E 203  ? ILE E 205  ? PHE B 203  ILE B 205  
AC2 2 SER E 208  ? LEU E 212  ? SER B 208  LEU B 212  
AC2 3 SER E 480  ? VAL E 482  ? SER B 480  VAL B 482  
AC3 1 LYS E 404  ? ASP E 407  ? LYS B 404  ASP B 407  
AC3 2 ALA E 214  ? SER E 218  ? ALA B 214  SER B 218  
AC3 3 ARG E 497  ? ASN E 499  ? ARG B 497  ASN B 499  
AC3 4 LYS E 537  ? ASN E 538  ? LYS B 537  ASN B 538  
AC4 1 VAL E 223  ? LYS E 227  ? VAL B 223  LYS B 227  
AC4 2 ILE E 234  ? SER E 242  ? ILE B 234  SER B 242  
AC4 3 SER E 252  ? TYR E 259  ? SER B 252  TYR B 259  
AC4 4 ILE E 269  ? THR E 272  ? ILE B 269  THR B 272  
AC4 5 ILE E 280  ? PRO E 281  ? ILE B 280  PRO B 281  
AC5 1 CYS E 544  ? ILE E 545  ? CYS B 544  ILE B 545  
AC5 2 VAL E 633  ? PHE E 638  ? VAL B 633  PHE B 638  
AC5 3 VAL E 690  ? ASP E 694  ? VAL B 690  ASP B 694  
AC6 1 GLU E 564  ? PRO E 565  ? GLU B 564  PRO B 565  
AC6 2 VAL E 585  ? HIS E 590  ? VAL B 585  HIS B 590  
AC6 3 THR E 578  ? VAL E 582  ? THR B 578  VAL B 582  
AC6 4 GLU E 623  ? PHE E 627  ? GLU B 623  PHE B 627  
AC6 5 SER E 614  ? ASP E 618  ? SER B 614  ASP B 618  
AC7 1 VAL E 640  ? ASP E 642  ? VAL B 640  ASP B 642  
AC7 2 LYS E 649  ? LEU E 651  ? LYS B 649  LEU B 651  
AC8 1 ILE E 703  ? ALA E 704  ? ILE B 703  ALA B 704  
AC8 2 HIS E 740  ? CYS E 741  ? HIS B 740  CYS B 741  
AC9 1 MET E 792  ? LEU E 796  ? MET B 792  LEU B 796  
AC9 2 SER E 853  ? GLN E 862  ? SER B 853  GLN B 862  
AC9 3 LYS E 962  ? LYS E 972  ? LYS B 962  LYS B 972  
AC9 4 ASN E 946  ? THR E 956  ? ASN B 946  THR B 956  
AC9 5 ARG E 904  ? SER E 906  ? ARG B 904  SER B 906  
AD1 1 MET E 792  ? LEU E 796  ? MET B 792  LEU B 796  
AD1 2 SER E 853  ? GLN E 862  ? SER B 853  GLN B 862  
AD1 3 LYS E 962  ? LYS E 972  ? LYS B 962  LYS B 972  
AD1 4 ASN E 946  ? THR E 956  ? ASN B 946  THR B 956  
AD1 5 LEU M 56   ? LYS M 58   ? LEU L 56   LYS L 58   
AD1 6 TYR M 29   ? ILE M 30   ? TYR L 29   ILE L 30   
AD1 7 LYS M 37   ? LEU M 38   ? LYS L 37   LEU L 38   
AD2 1 GLY E 804  ? THR E 805  ? GLY B 804  THR B 805  
AD2 2 GLY E 1042 ? ASP E 1043 ? GLY B 1042 ASP B 1043 
AD3 1 PHE E 1069 ? GLU E 1070 ? PHE B 1069 GLU B 1070 
AD3 2 ILE E 1085 ? ARG E 1094 ? ILE B 1085 ARG B 1094 
AD3 3 LYS E 979  ? ALA E 981  ? LYS B 979  ALA B 981  
AD3 4 LYS E 987  ? TYR E 994  ? LYS B 987  TYR B 994  
AD3 5 MET E 839  ? ASN E 842  ? MET B 839  ASN B 842  
AD3 6 LEU E 1010 ? ILE E 1012 ? LEU B 1010 ILE B 1012 
AD3 7 GLN E 821  ? ILE E 827  ? GLN B 821  ILE B 827  
AD3 8 ILE E 1085 ? ARG E 1094 ? ILE B 1085 ARG B 1094 
AD4 1 THR E 873  ? PHE E 874  ? THR B 873  PHE B 874  
AD4 2 LYS E 914  ? PRO E 917  ? LYS B 914  PRO B 917  
AD4 3 LYS E 934  ? ASP E 936  ? LYS B 934  ASP B 936  
AD4 4 THR E 882  ? LEU E 883  ? THR B 882  LEU B 883  
AD5 1 VAL E 910  ? ILE E 912  ? VAL B 910  ILE B 912  
AD5 2 THR E 939  ? PRO E 940  ? THR B 939  PRO B 940  
AD6 1 PHE E 1001 ? THR E 1002 ? PHE B 1001 THR B 1002 
AD6 2 MET E 1072 ? TYR E 1073 ? MET B 1072 TYR B 1073 
AD7 1 ALA E 1157 ? CYS E 1163 ? ALA B 1157 CYS B 1163 
AD7 2 ILE E 1191 ? PRO E 1197 ? ILE B 1191 PRO B 1197 
AD8 1 GLN F 7    ? ALA F 13   ? GLN C 7    ALA C 13   
AD8 2 ASN F 17   ? SER F 23   ? ASN C 17   SER C 23   
AD8 3 PHE F 228  ? GLU F 233  ? PHE C 228  GLU C 233  
AD8 4 GLU F 177  ? GLU F 179  ? GLU C 177  GLU C 179  
AD9 1 VAL F 119  ? ILE F 120  ? VAL C 119  ILE C 120  
AD9 2 VAL F 97   ? PHE F 104  ? VAL C 97   PHE C 104  
AD9 3 GLU F 152  ? ILE F 163  ? GLU C 152  ILE C 163  
AD9 4 PRO F 42   ? ASN F 54   ? PRO C 42   ASN C 54   
AD9 5 GLN M 66   ? PHE M 67   ? GLN L 66   PHE L 67   
AE1 1 LEU F 72   ? SER F 74   ? LEU C 72   SER C 74   
AE1 2 ILE F 129  ? PRO F 132  ? ILE C 129  PRO C 132  
AE2 1 THR F 111  ? VAL F 113  ? THR C 111  VAL C 113  
AE2 2 CYS F 145  ? LEU F 147  ? CYS C 145  LEU C 147  
AE3 1 PHE G 60   ? ALA G 62   ? PHE E 60   ALA E 62   
AE3 2 LEU G 78   ? VAL G 80   ? LEU E 78   VAL E 80   
AE3 3 THR G 107  ? TYR G 112  ? THR E 107  TYR E 112  
AE3 4 THR G 131  ? ASN G 136  ? THR E 131  ASN E 136  
AE4 1 LYS G 152  ? ARG G 155  ? LYS E 152  ARG E 155  
AE4 2 VAL G 195  ? LYS G 201  ? VAL E 195  LYS E 201  
AE4 3 ARG G 207  ? CYS G 214  ? ARG E 207  CYS E 214  
AE4 4 ARG G 177  ? ILE G 178  ? ARG E 177  ILE E 178  
AE5 1 TYR I 95   ? TYR I 98   ? TYR H 95   TYR H 98   
AE5 2 TYR I 141  ? ILE I 144  ? TYR H 141  ILE H 144  
AE5 3 SER I 54   ? ALA I 60   ? SER H 54   ALA H 60   
AE5 4 THR I 4    ? ASP I 16   ? THR H 4    ASP H 16   
AE5 5 VAL I 23   ? SER I 30   ? VAL H 23   SER H 30   
AE5 6 LYS I 37   ? ASN I 43   ? LYS H 37   ASN H 43   
AE5 7 LEU I 121  ? GLY I 127  ? LEU H 121  GLY H 127  
AE5 8 ILE I 112  ? PHE I 118  ? ILE H 112  PHE H 118  
AE5 9 THR I 100  ? GLU I 105  ? THR H 100  GLU H 105  
AE6 1 TYR J 15   ? ASP J 19   ? TYR I 15   ASP I 19   
AE6 2 ARG J 24   ? GLU J 28   ? ARG I 24   GLU I 28   
AE6 3 VAL J 35   ? GLU J 37   ? VAL I 35   GLU I 37   
AE7 1 ASN J 83   ? GLN J 87   ? ASN I 83   GLN I 87   
AE7 2 LEU J 99   ? CYS J 103  ? LEU I 99   CYS I 103  
AE7 3 ILE J 109  ? THR J 111  ? ILE I 109  THR I 111  
AE8 1 LEU L 19   ? PRO L 23   ? LEU K 19   PRO K 23   
AE8 2 ALA L 30   ? GLU L 36   ? ALA K 30   GLU K 36   
AE8 3 ARG L 70   ? THR L 77   ? ARG K 70   THR K 77   
AE8 4 VAL L 56   ? LYS L 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASP D 1419 ? O ASP A 1419 N VAL D 17   ? N VAL A 17   
AA1 2 3 N GLU D 16   ? N GLU A 16   O TYR E 1217 ? O TYR B 1217 
AA2 1 2 N ILE D 84   ? N ILE A 84   O LEU D 239  ? O LEU A 239  
AA3 1 2 N ARG D 175  ? N ARG A 175  O VAL D 182  ? O VAL A 182  
AA4 1 2 N LYS D 343  ? N LYS A 343  O PHE E 1130 ? O PHE B 1130 
AA5 1 2 O HIS E 1104 ? O HIS B 1104 N ARG D 350  ? N ARG A 350  
AA5 2 3 N ALA D 349  ? N ALA A 349  O LEU D 489  ? O LEU A 489  
AA5 3 4 O ASN D 488  ? O ASN A 488  N ASN D 445  ? N ASN A 445  
AA5 4 5 N PHE D 444  ? N PHE A 444  O MET D 456  ? O MET A 456  
AA5 5 6 O ILE D 463  ? O ILE A 463  N VAL D 366  ? N VAL A 366  
AA5 6 7 N GLY D 365  ? N GLY A 365  O ARG D 469  ? O ARG A 469  
AA5 7 8 O PHE D 468  ? O PHE A 468  N VAL D 352  ? N VAL A 352  
AA6 1 2 N GLU D 378  ? N GLU A 378  O VAL D 432  ? O VAL A 432  
AA6 2 3 O LYS D 431  ? O LYS A 431  N ILE D 406  ? N ILE A 406  
AA6 3 4 N VAL D 405  ? N VAL A 405  O ILE D 413  ? O ILE A 413  
AA7 1 2 N SER D 513  ? N SER A 513  O LYS D 518  ? O LYS A 518  
AA8 1 2 N ILE D 541  ? N ILE A 541  O TRP D 572  ? O TRP A 572  
AA9 1 2 N LEU D 588  ? N LEU A 588  O ILE D 607  ? O ILE A 607  
AA9 2 3 N LEU D 606  ? N LEU A 606  O ILE D 613  ? O ILE A 613  
AB1 1 2 N GLY D 766  ? N GLY A 766  O VAL D 800  ? O VAL A 800  
AB2 1 2 N MET D 849  ? N MET A 849  O ARG D 857  ? O ARG A 857  
AB3 1 2 N GLU D 879  ? N GLU A 879  O LEU D 956  ? O LEU A 956  
AB4 1 2 N VAL D 1283 ? N VAL A 1283 O GLU D 1307 ? O GLU A 1307 
AB4 2 3 O LEU D 1306 ? O LEU A 1306 N VAL D 1118 ? N VAL A 1118 
AB4 3 4 N THR D 1117 ? N THR A 1117 O TYR D 1328 ? O TYR A 1328 
AB5 1 2 N THR D 1141 ? N THR A 1141 O ARG D 1274 ? O ARG A 1274 
AB6 1 2 N PHE D 1225 ? N PHE A 1225 O ARG D 1241 ? O ARG A 1241 
AB6 2 3 O ILE D 1238 ? O ILE A 1238 N LEU D 1195 ? N LEU A 1195 
AB6 3 4 O GLU D 1196 ? O GLU A 1196 N ILE D 1148 ? N ILE A 1148 
AB6 4 5 N ILE D 1152 ? N ILE A 1152 O TYR J 44   ? O TYR I 44   
AB7 1 2 N VAL D 1291 ? N VAL A 1291 O VAL D 1299 ? O VAL A 1299 
AB8 1 2 N MET D 1444 ? N MET A 1444 O VAL H 133  ? O VAL F 133  
AB8 2 3 N ILE H 134  ? N ILE F 134  O TRP H 146  ? O TRP F 146  
AB9 1 2 N TYR E 96   ? N TYR B 96   O PHE E 129  ? O PHE B 129  
AB9 2 3 N LEU E 128  ? N LEU B 128  O ILE E 167  ? O ILE B 167  
AC1 1 2 N VAL E 102  ? N VAL B 102  O HIS E 110  ? O HIS B 110  
AC2 1 2 N PHE E 203  ? N PHE B 203  O LYS E 210  ? O LYS B 210  
AC2 2 3 N VAL E 211  ? N VAL B 211  O GLN E 481  ? O GLN B 481  
AC3 1 2 O ASP E 407  ? O ASP B 407  N GLN E 215  ? N GLN B 215  
AC3 2 3 N ALA E 214  ? N ALA B 214  O ASN E 499  ? O ASN B 499  
AC3 3 4 N THR E 498  ? N THR B 498  O LYS E 537  ? O LYS B 537  
AC4 1 2 N GLN E 224  ? N GLN B 224  O GLU E 239  ? O GLU B 239  
AC4 2 3 N SER E 242  ? N SER B 242  O SER E 252  ? O SER B 252  
AC4 3 4 N GLN E 255  ? N GLN B 255  O THR E 272  ? O THR B 272  
AC4 4 5 N ALA E 271  ? N ALA B 271  O ILE E 280  ? O ILE B 280  
AC5 1 2 N CYS E 544  ? N CYS B 544  O TYR E 634  ? O TYR B 634  
AC5 2 3 N ARG E 635  ? N ARG B 635  O ILE E 693  ? O ILE B 693  
AC6 1 2 N GLU E 564  ? N GLU B 564  O VAL E 589  ? O VAL B 589  
AC6 2 3 O HIS E 590  ? O HIS B 590  N THR E 578  ? N THR B 578  
AC6 3 4 N PHE E 581  ? N PHE B 581  O LEU E 624  ? O LEU B 624  
AC6 4 5 O PHE E 627  ? O PHE B 627  N SER E 614  ? N SER B 614  
AC7 1 2 N GLU E 641  ? N GLU B 641  O GLU E 650  ? O GLU B 650  
AC8 1 2 N ALA E 704  ? N ALA B 704  O HIS E 740  ? O HIS B 740  
AC9 1 2 N ALA E 793  ? N ALA B 793  O PHE E 856  ? O PHE B 856  
AC9 2 3 N PHE E 855  ? N PHE B 855  O THR E 970  ? O THR B 970  
AC9 3 4 O ARG E 969  ? O ARG B 969  N ILE E 948  ? N ILE B 948  
AC9 4 5 O GLY E 947  ? O GLY B 947  N VAL E 905  ? N VAL B 905  
AD1 1 2 N ALA E 793  ? N ALA B 793  O PHE E 856  ? O PHE B 856  
AD1 2 3 N PHE E 855  ? N PHE B 855  O THR E 970  ? O THR B 970  
AD1 3 4 O ARG E 969  ? O ARG B 969  N ILE E 948  ? N ILE B 948  
AD1 4 5 N VAL E 954  ? N VAL B 954  O LEU M 56   ? O LEU L 56   
AD1 5 6 O LEU M 57   ? O LEU L 57   N ILE M 30   ? N ILE L 30   
AD1 6 7 N TYR M 29   ? N TYR L 29   O LEU M 38   ? O LEU L 38   
AD2 1 2 N THR E 805  ? N THR B 805  O GLY E 1042 ? O GLY B 1042 
AD3 1 2 N GLU E 1070 ? N GLU B 1070 O ILE E 1085 ? O ILE B 1085 
AD3 2 3 O GLN E 1093 ? O GLN B 1093 N ALA E 981  ? N ALA B 981  
AD3 3 4 N PHE E 980  ? N PHE B 980  O GLY E 988  ? O GLY B 988  
AD3 4 5 O GLY E 991  ? O GLY B 991  N MET E 839  ? N MET B 839  
AD3 5 6 N ILE E 840  ? N ILE B 840  O ILE E 1011 ? O ILE B 1011 
AD3 6 7 O LEU E 1010 ? O LEU B 1010 N ALA E 826  ? N ALA B 826  
AD3 7 8 N ALA E 823  ? N ALA B 823  O THR E 1090 ? O THR B 1090 
AD4 1 2 N THR E 873  ? N THR B 873  O THR E 915  ? O THR B 915  
AD4 2 3 N THR E 916  ? N THR B 916  O ARG E 935  ? O ARG B 935  
AD4 3 4 O ASP E 936  ? O ASP B 936  N LEU E 883  ? N LEU B 883  
AD5 1 2 N ILE E 911  ? N ILE B 911  O THR E 939  ? O THR B 939  
AD6 1 2 N PHE E 1001 ? N PHE B 1001 O TYR E 1073 ? O TYR B 1073 
AD7 1 2 N ILE E 1162 ? N ILE B 1162 O TYR E 1192 ? O TYR B 1192 
AD8 1 2 N GLU F 12   ? N GLU C 12   O ASP F 19   ? O ASP C 19   
AD8 2 3 N LEU F 22   ? N LEU C 22   O PHE F 228  ? O PHE C 228  
AD8 3 4 O ASN F 231  ? O ASN C 231  N GLU F 177  ? N GLU C 177  
AD9 1 2 O VAL F 119  ? O VAL C 119  N THR F 100  ? N THR C 100  
AD9 2 3 N LEU F 99   ? N LEU C 99   O CYS F 157  ? O CYS C 157  
AD9 3 4 O THR F 156  ? O THR C 156  N GLU F 50   ? N GLU C 50   
AD9 4 5 N VAL F 49   ? N VAL C 49   O PHE M 67   ? O PHE L 67   
AE1 1 2 N GLN F 73   ? N GLN C 73   O GLY F 130  ? O GLY C 130  
AE2 1 2 N THR F 111  ? N THR C 111  O LEU F 147  ? O LEU C 147  
AE3 1 2 N PHE G 60   ? N PHE E 60   O VAL G 80   ? O VAL E 80   
AE3 2 3 N TRP G 79   ? N TRP E 79   O ILE G 109  ? O ILE E 109  
AE3 3 4 N PHE G 110  ? N PHE E 110  O PHE G 135  ? O PHE E 135  
AE4 1 2 N ILE G 154  ? N ILE E 154  O LYS G 197  ? O LYS E 197  
AE4 2 3 N VAL G 196  ? N VAL E 196  O ARG G 212  ? O ARG E 212  
AE4 3 4 O ILE G 213  ? O ILE E 213  N ILE G 178  ? N ILE E 178  
AE5 1 2 N MET I 97   ? N MET H 97   O LEU I 142  ? O LEU H 142  
AE5 2 3 O LEU I 143  ? O LEU H 143  N THR I 58   ? N THR H 58   
AE5 3 4 O ILE I 59   ? O ILE H 59   N LEU I 5    ? N LEU H 5    
AE5 4 5 N SER I 13   ? N SER H 13   O GLU I 27   ? O GLU H 27   
AE5 5 6 N ALA I 28   ? N ALA H 28   O LEU I 38   ? O LEU H 38   
AE5 6 7 N THR I 39   ? N THR H 39   O ARG I 124  ? O ARG H 124  
AE5 7 8 O LEU I 121  ? O LEU H 121  N PHE I 118  ? N PHE H 118  
AE5 8 9 O ALA I 113  ? O ALA H 113  N GLU I 105  ? N GLU H 105  
AE6 1 2 N ARG J 17   ? N ARG I 17   O LEU J 26   ? O LEU I 26   
AE6 2 3 N PHE J 27   ? N PHE I 27   O GLU J 36   ? O GLU I 36   
AE7 1 2 N PHE J 86   ? N PHE I 86   O PHE J 100  ? O PHE I 100  
AE7 2 3 N PHE J 101  ? N PHE I 101  O PHE J 110  ? O PHE I 110  
AE8 1 2 N ASP L 22   ? N ASP K 22   O VAL L 32   ? O VAL K 32   
AE8 2 3 N ILE L 33   ? N ILE K 33   O LEU L 73   ? O LEU K 73   
AE8 3 4 O GLN L 76   ? O GLN K 76   N LEU L 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  1801 ? 5 'binding site for residue ZN A 1801'  
AC2 Software A ZN  1802 ? 4 'binding site for residue ZN A 1802'  
AC3 Software A MG  1803 ? 4 'binding site for residue MG A 1803'  
AC4 Software B APC 1301 ? 5 'binding site for residue APC B 1301' 
AC5 Software B ZN  1302 ? 4 'binding site for residue ZN B 1302'  
AC6 Software C ZN  401  ? 4 'binding site for residue ZN C 401'   
AC7 Software I ZN  201  ? 4 'binding site for residue ZN I 201'   
AC8 Software I ZN  202  ? 5 'binding site for residue ZN I 202'   
AC9 Software J ZN  101  ? 4 'binding site for residue ZN J 101'   
AD1 Software L ZN  101  ? 5 'binding site for residue ZN L 101'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS D 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 5 MET D 108  ? MET A 108  . ? 1_555 ? 
3  AC1 5 CYS D 110  ? CYS A 110  . ? 1_555 ? 
4  AC1 5 CYS D 148  ? CYS A 148  . ? 1_555 ? 
5  AC1 5 CYS D 167  ? CYS A 167  . ? 1_555 ? 
6  AC2 4 CYS D 67   ? CYS A 67   . ? 1_555 ? 
7  AC2 4 CYS D 70   ? CYS A 70   . ? 1_555 ? 
8  AC2 4 CYS D 77   ? CYS A 77   . ? 1_555 ? 
9  AC2 4 HIS D 80   ? HIS A 80   . ? 1_555 ? 
10 AC3 4 ASP D 481  ? ASP A 481  . ? 1_555 ? 
11 AC3 4 ASP D 483  ? ASP A 483  . ? 1_555 ? 
12 AC3 4 ASP D 485  ? ASP A 485  . ? 1_555 ? 
13 AC3 4 G   A 9    ? G   R 9    . ? 1_555 ? 
14 AC4 5 ASN D 479  ? ASN A 479  . ? 1_555 ? 
15 AC4 5 LYS D 752  ? LYS A 752  . ? 1_555 ? 
16 AC4 5 SER E 1019 ? SER B 1019 . ? 1_555 ? 
17 AC4 5 ARG E 1020 ? ARG B 1020 . ? 1_555 ? 
18 AC4 5 G   A 9    ? G   R 9    . ? 1_555 ? 
19 AC5 4 CYS E 1163 ? CYS B 1163 . ? 1_555 ? 
20 AC5 4 CYS E 1166 ? CYS B 1166 . ? 1_555 ? 
21 AC5 4 CYS E 1182 ? CYS B 1182 . ? 1_555 ? 
22 AC5 4 CYS E 1185 ? CYS B 1185 . ? 1_555 ? 
23 AC6 4 CYS F 86   ? CYS C 86   . ? 1_555 ? 
24 AC6 4 CYS F 88   ? CYS C 88   . ? 1_555 ? 
25 AC6 4 CYS F 92   ? CYS C 92   . ? 1_555 ? 
26 AC6 4 CYS F 95   ? CYS C 95   . ? 1_555 ? 
27 AC7 4 CYS J 7    ? CYS I 7    . ? 1_555 ? 
28 AC7 4 CYS J 10   ? CYS I 10   . ? 1_555 ? 
29 AC7 4 CYS J 29   ? CYS I 29   . ? 1_555 ? 
30 AC7 4 CYS J 32   ? CYS I 32   . ? 1_555 ? 
31 AC8 5 CYS J 75   ? CYS I 75   . ? 1_555 ? 
32 AC8 5 CYS J 78   ? CYS I 78   . ? 1_555 ? 
33 AC8 5 SER J 80   ? SER I 80   . ? 1_555 ? 
34 AC8 5 CYS J 103  ? CYS I 103  . ? 1_555 ? 
35 AC8 5 CYS J 106  ? CYS I 106  . ? 1_555 ? 
36 AC9 4 CYS K 7    ? CYS J 7    . ? 1_555 ? 
37 AC9 4 CYS K 10   ? CYS J 10   . ? 1_555 ? 
38 AC9 4 CYS K 45   ? CYS J 45   . ? 1_555 ? 
39 AC9 4 CYS K 46   ? CYS J 46   . ? 1_555 ? 
40 AD1 5 CYS M 31   ? CYS L 31   . ? 1_555 ? 
41 AD1 5 CYS M 34   ? CYS L 34   . ? 1_555 ? 
42 AD1 5 SER M 36   ? SER L 36   . ? 1_555 ? 
43 AD1 5 CYS M 48   ? CYS L 48   . ? 1_555 ? 
44 AD1 5 CYS M 51   ? CYS L 51   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UPY 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005933 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001145 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004482 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005275 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  OP3   . A   A 1  1    ? 23.928  10.276  27.149  1.00 215.93 ? 1    A   R OP3   1 
ATOM   2     P  P     . A   A 1  1    ? 22.871  11.254  27.490  1.00 215.34 ? 1    A   R P     1 
ATOM   3     O  OP1   . A   A 1  1    ? 21.570  10.541  27.472  1.00 217.28 ? 1    A   R OP1   1 
ATOM   4     O  OP2   . A   A 1  1    ? 23.043  12.428  26.599  1.00 218.76 ? 1    A   R OP2   1 
ATOM   5     O  "O5'" . A   A 1  1    ? 23.130  11.743  28.983  1.00 204.91 ? 1    A   R "O5'" 1 
ATOM   6     C  "C5'" . A   A 1  1    ? 24.436  11.713  29.538  1.00 204.12 ? 1    A   R "C5'" 1 
ATOM   7     C  "C4'" . A   A 1  1    ? 25.006  13.102  29.686  1.00 201.58 ? 1    A   R "C4'" 1 
ATOM   8     O  "O4'" . A   A 1  1    ? 24.565  13.930  28.578  1.00 203.76 ? 1    A   R "O4'" 1 
ATOM   9     C  "C3'" . A   A 1  1    ? 24.569  13.872  30.922  1.00 193.76 ? 1    A   R "C3'" 1 
ATOM   10    O  "O3'" . A   A 1  1    ? 25.315  13.525  32.073  1.00 176.49 ? 1    A   R "O3'" 1 
ATOM   11    C  "C2'" . A   A 1  1    ? 24.746  15.322  30.493  1.00 198.02 ? 1    A   R "C2'" 1 
ATOM   12    O  "O2'" . A   A 1  1    ? 26.113  15.702  30.558  1.00 201.75 ? 1    A   R "O2'" 1 
ATOM   13    C  "C1'" . A   A 1  1    ? 24.333  15.250  29.023  1.00 195.68 ? 1    A   R "C1'" 1 
ATOM   14    N  N9    . A   A 1  1    ? 22.903  15.560  28.834  1.00 180.94 ? 1    A   R N9    1 
ATOM   15    C  C8    . A   A 1  1    ? 21.920  14.718  28.378  1.00 174.70 ? 1    A   R C8    1 
ATOM   16    N  N7    . A   A 1  1    ? 20.734  15.272  28.311  1.00 172.01 ? 1    A   R N7    1 
ATOM   17    C  C5    . A   A 1  1    ? 20.949  16.570  28.751  1.00 169.69 ? 1    A   R C5    1 
ATOM   18    C  C6    . A   A 1  1    ? 20.085  17.667  28.914  1.00 161.88 ? 1    A   R C6    1 
ATOM   19    N  N6    . A   A 1  1    ? 18.778  17.629  28.640  1.00 153.58 ? 1    A   R N6    1 
ATOM   20    N  N1    . A   A 1  1    ? 20.616  18.822  29.373  1.00 162.86 ? 1    A   R N1    1 
ATOM   21    C  C2    . A   A 1  1    ? 21.926  18.860  29.647  1.00 165.17 ? 1    A   R C2    1 
ATOM   22    N  N3    . A   A 1  1    ? 22.838  17.897  29.534  1.00 163.45 ? 1    A   R N3    1 
ATOM   23    C  C4    . A   A 1  1    ? 22.280  16.763  29.075  1.00 168.30 ? 1    A   R C4    1 
ATOM   24    P  P     . U   A 1  2    ? 24.574  12.929  33.366  1.00 161.61 ? 2    U   R P     1 
ATOM   25    O  OP1   . U   A 1  2    ? 25.360  11.765  33.847  1.00 163.17 ? 2    U   R OP1   1 
ATOM   26    O  OP2   . U   A 1  2    ? 23.139  12.743  33.026  1.00 152.43 ? 2    U   R OP2   1 
ATOM   27    O  "O5'" . U   A 1  2    ? 24.678  14.102  34.439  1.00 157.68 ? 2    U   R "O5'" 1 
ATOM   28    C  "C5'" . U   A 1  2    ? 25.882  14.836  34.606  1.00 148.57 ? 2    U   R "C5'" 1 
ATOM   29    C  "C4'" . U   A 1  2    ? 25.612  16.209  35.166  1.00 145.72 ? 2    U   R "C4'" 1 
ATOM   30    O  "O4'" . U   A 1  2    ? 25.110  17.080  34.119  1.00 140.99 ? 2    U   R "O4'" 1 
ATOM   31    C  "C3'" . U   A 1  2    ? 24.548  16.282  36.249  1.00 148.41 ? 2    U   R "C3'" 1 
ATOM   32    O  "O3'" . U   A 1  2    ? 25.037  15.923  37.530  1.00 158.11 ? 2    U   R "O3'" 1 
ATOM   33    C  "C2'" . U   A 1  2    ? 24.078  17.728  36.161  1.00 144.68 ? 2    U   R "C2'" 1 
ATOM   34    O  "O2'" . U   A 1  2    ? 24.987  18.593  36.825  1.00 148.90 ? 2    U   R "O2'" 1 
ATOM   35    C  "C1'" . U   A 1  2    ? 24.172  17.990  34.656  1.00 134.87 ? 2    U   R "C1'" 1 
ATOM   36    N  N1    . U   A 1  2    ? 22.873  17.802  33.967  1.00 129.99 ? 2    U   R N1    1 
ATOM   37    C  C2    . U   A 1  2    ? 21.883  18.752  34.156  1.00 131.58 ? 2    U   R C2    1 
ATOM   38    O  O2    . U   A 1  2    ? 22.021  19.732  34.868  1.00 131.70 ? 2    U   R O2    1 
ATOM   39    N  N3    . U   A 1  2    ? 20.711  18.511  33.482  1.00 132.25 ? 2    U   R N3    1 
ATOM   40    C  C4    . U   A 1  2    ? 20.432  17.445  32.651  1.00 143.73 ? 2    U   R C4    1 
ATOM   41    O  O4    . U   A 1  2    ? 19.326  17.366  32.112  1.00 148.23 ? 2    U   R O4    1 
ATOM   42    C  C5    . U   A 1  2    ? 21.505  16.511  32.503  1.00 145.22 ? 2    U   R C5    1 
ATOM   43    C  C6    . U   A 1  2    ? 22.658  16.719  33.148  1.00 138.36 ? 2    U   R C6    1 
ATOM   44    P  P     . C   A 1  3    ? 24.055  15.256  38.614  1.00 175.77 ? 3    C   R P     1 
ATOM   45    O  OP1   . C   A 1  3    ? 24.866  14.925  39.813  1.00 191.41 ? 3    C   R OP1   1 
ATOM   46    O  OP2   . C   A 1  3    ? 23.265  14.193  37.942  1.00 192.75 ? 3    C   R OP2   1 
ATOM   47    O  "O5'" . C   A 1  3    ? 23.063  16.435  39.018  1.00 152.98 ? 3    C   R "O5'" 1 
ATOM   48    C  "C5'" . C   A 1  3    ? 23.538  17.569  39.728  1.00 140.30 ? 3    C   R "C5'" 1 
ATOM   49    C  "C4'" . C   A 1  3    ? 22.519  18.680  39.748  1.00 138.14 ? 3    C   R "C4'" 1 
ATOM   50    O  "O4'" . C   A 1  3    ? 22.171  19.060  38.390  1.00 144.70 ? 3    C   R "O4'" 1 
ATOM   51    C  "C3'" . C   A 1  3    ? 21.178  18.356  40.386  1.00 138.69 ? 3    C   R "C3'" 1 
ATOM   52    O  "O3'" . C   A 1  3    ? 21.200  18.395  41.803  1.00 132.38 ? 3    C   R "O3'" 1 
ATOM   53    C  "C2'" . C   A 1  3    ? 20.265  19.404  39.764  1.00 135.54 ? 3    C   R "C2'" 1 
ATOM   54    O  "O2'" . C   A 1  3    ? 20.444  20.664  40.394  1.00 128.17 ? 3    C   R "O2'" 1 
ATOM   55    C  "C1'" . C   A 1  3    ? 20.823  19.487  38.344  1.00 138.36 ? 3    C   R "C1'" 1 
ATOM   56    N  N1    . C   A 1  3    ? 20.064  18.629  37.403  1.00 130.19 ? 3    C   R N1    1 
ATOM   57    C  C2    . C   A 1  3    ? 18.798  19.053  36.981  1.00 127.86 ? 3    C   R C2    1 
ATOM   58    O  O2    . C   A 1  3    ? 18.343  20.129  37.398  1.00 139.88 ? 3    C   R O2    1 
ATOM   59    N  N3    . C   A 1  3    ? 18.085  18.283  36.127  1.00 117.97 ? 3    C   R N3    1 
ATOM   60    C  C4    . C   A 1  3    ? 18.588  17.130  35.689  1.00 123.66 ? 3    C   R C4    1 
ATOM   61    N  N4    . C   A 1  3    ? 17.850  16.405  34.845  1.00 127.02 ? 3    C   R N4    1 
ATOM   62    C  C5    . C   A 1  3    ? 19.873  16.671  36.099  1.00 127.78 ? 3    C   R C5    1 
ATOM   63    C  C6    . C   A 1  3    ? 20.568  17.442  36.948  1.00 130.37 ? 3    C   R C6    1 
ATOM   64    P  P     . G   A 1  4    ? 20.125  17.551  42.654  1.00 132.42 ? 4    G   R P     1 
ATOM   65    O  OP1   . G   A 1  4    ? 20.382  17.819  44.091  1.00 131.41 ? 4    G   R OP1   1 
ATOM   66    O  OP2   . G   A 1  4    ? 20.134  16.149  42.162  1.00 125.74 ? 4    G   R OP2   1 
ATOM   67    O  "O5'" . G   A 1  4    ? 18.719  18.211  42.283  1.00 133.57 ? 4    G   R "O5'" 1 
ATOM   68    C  "C5'" . G   A 1  4    ? 18.397  19.524  42.719  1.00 138.73 ? 4    G   R "C5'" 1 
ATOM   69    C  "C4'" . G   A 1  4    ? 17.189  20.087  42.005  1.00 125.81 ? 4    G   R "C4'" 1 
ATOM   70    O  "O4'" . G   A 1  4    ? 17.373  20.031  40.565  1.00 120.37 ? 4    G   R "O4'" 1 
ATOM   71    C  "C3'" . G   A 1  4    ? 15.874  19.362  42.226  1.00 109.24 ? 4    G   R "C3'" 1 
ATOM   72    O  "O3'" . G   A 1  4    ? 15.277  19.661  43.472  1.00 114.13 ? 4    G   R "O3'" 1 
ATOM   73    C  "C2'" . G   A 1  4    ? 15.057  19.809  41.023  1.00 101.97 ? 4    G   R "C2'" 1 
ATOM   74    O  "O2'" . G   A 1  4    ? 14.593  21.140  41.197  1.00 99.19  ? 4    G   R "O2'" 1 
ATOM   75    C  "C1'" . G   A 1  4    ? 16.126  19.810  39.933  1.00 114.37 ? 4    G   R "C1'" 1 
ATOM   76    N  N9    . G   A 1  4    ? 16.176  18.514  39.227  1.00 125.62 ? 4    G   R N9    1 
ATOM   77    C  C8    . G   A 1  4    ? 17.177  17.576  39.283  1.00 132.44 ? 4    G   R C8    1 
ATOM   78    N  N7    . G   A 1  4    ? 16.936  16.521  38.553  1.00 140.24 ? 4    G   R N7    1 
ATOM   79    C  C5    . G   A 1  4    ? 15.696  16.769  37.983  1.00 125.38 ? 4    G   R C5    1 
ATOM   80    C  C6    . G   A 1  4    ? 14.917  15.979  37.096  1.00 123.92 ? 4    G   R C6    1 
ATOM   81    O  O6    . G   A 1  4    ? 15.177  14.865  36.623  1.00 112.14 ? 4    G   R O6    1 
ATOM   82    N  N1    . G   A 1  4    ? 13.722  16.610  36.764  1.00 135.22 ? 4    G   R N1    1 
ATOM   83    C  C2    . G   A 1  4    ? 13.326  17.841  37.226  1.00 135.75 ? 4    G   R C2    1 
ATOM   84    N  N2    . G   A 1  4    ? 12.135  18.282  36.791  1.00 140.32 ? 4    G   R N2    1 
ATOM   85    N  N3    . G   A 1  4    ? 14.045  18.585  38.053  1.00 124.66 ? 4    G   R N3    1 
ATOM   86    C  C4    . G   A 1  4    ? 15.212  17.995  38.389  1.00 121.19 ? 4    G   R C4    1 
ATOM   87    P  P     . A   A 1  5    ? 15.141  18.506  44.580  1.00 127.55 ? 5    A   R P     1 
ATOM   88    O  OP1   . A   A 1  5    ? 15.256  19.144  45.917  1.00 124.16 ? 5    A   R OP1   1 
ATOM   89    O  OP2   . A   A 1  5    ? 16.069  17.404  44.213  1.00 131.96 ? 5    A   R OP2   1 
ATOM   90    O  "O5'" . A   A 1  5    ? 13.649  17.980  44.400  1.00 108.72 ? 5    A   R "O5'" 1 
ATOM   91    C  "C5'" . A   A 1  5    ? 12.553  18.780  44.813  1.00 99.53  ? 5    A   R "C5'" 1 
ATOM   92    C  "C4'" . A   A 1  5    ? 11.638  19.118  43.663  1.00 101.86 ? 5    A   R "C4'" 1 
ATOM   93    O  "O4'" . A   A 1  5    ? 12.366  19.073  42.409  1.00 102.90 ? 5    A   R "O4'" 1 
ATOM   94    C  "C3'" . A   A 1  5    ? 10.471  18.173  43.442  1.00 87.20  ? 5    A   R "C3'" 1 
ATOM   95    O  "O3'" . A   A 1  5    ? 9.395   18.429  44.322  1.00 80.91  ? 5    A   R "O3'" 1 
ATOM   96    C  "C2'" . A   A 1  5    ? 10.123  18.409  41.979  1.00 87.50  ? 5    A   R "C2'" 1 
ATOM   97    O  "O2'" . A   A 1  5    ? 9.359   19.595  41.829  1.00 88.32  ? 5    A   R "O2'" 1 
ATOM   98    C  "C1'" . A   A 1  5    ? 11.507  18.646  41.371  1.00 95.71  ? 5    A   R "C1'" 1 
ATOM   99    N  N9    . A   A 1  5    ? 12.068  17.429  40.747  1.00 106.06 ? 5    A   R N9    1 
ATOM   100   C  C8    . A   A 1  5    ? 13.315  16.888  40.949  1.00 104.32 ? 5    A   R C8    1 
ATOM   101   N  N7    . A   A 1  5    ? 13.548  15.804  40.250  1.00 94.86  ? 5    A   R N7    1 
ATOM   102   C  C5    . A   A 1  5    ? 12.377  15.613  39.532  1.00 106.02 ? 5    A   R C5    1 
ATOM   103   C  C6    . A   A 1  5    ? 11.990  14.628  38.603  1.00 107.05 ? 5    A   R C6    1 
ATOM   104   N  N6    . A   A 1  5    ? 12.773  13.614  38.229  1.00 105.96 ? 5    A   R N6    1 
ATOM   105   N  N1    . A   A 1  5    ? 10.754  14.718  38.063  1.00 104.49 ? 5    A   R N1    1 
ATOM   106   C  C2    . A   A 1  5    ? 9.967   15.733  38.437  1.00 87.33  ? 5    A   R C2    1 
ATOM   107   N  N3    . A   A 1  5    ? 10.220  16.717  39.297  1.00 95.72  ? 5    A   R N3    1 
ATOM   108   C  C4    . A   A 1  5    ? 11.457  16.606  39.821  1.00 107.57 ? 5    A   R C4    1 
ATOM   109   P  P     . G   A 1  6    ? 9.093   17.426  45.535  1.00 89.19  ? 6    G   R P     1 
ATOM   110   O  OP1   . G   A 1  6    ? 8.725   18.245  46.719  1.00 96.40  ? 6    G   R OP1   1 
ATOM   111   O  OP2   . G   A 1  6    ? 10.228  16.471  45.635  1.00 113.45 ? 6    G   R OP2   1 
ATOM   112   O  "O5'" . G   A 1  6    ? 7.800   16.630  45.052  1.00 97.80  ? 6    G   R "O5'" 1 
ATOM   113   C  "C5'" . G   A 1  6    ? 6.606   17.322  44.720  1.00 97.01  ? 6    G   R "C5'" 1 
ATOM   114   C  "C4'" . G   A 1  6    ? 5.831   16.603  43.645  1.00 84.98  ? 6    G   R "C4'" 1 
ATOM   115   O  "O4'" . G   A 1  6    ? 6.558   16.659  42.391  1.00 83.39  ? 6    G   R "O4'" 1 
ATOM   116   C  "C3'" . G   A 1  6    ? 5.598   15.118  43.874  1.00 76.26  ? 6    G   R "C3'" 1 
ATOM   117   O  "O3'" . G   A 1  6    ? 4.506   14.863  44.739  1.00 81.64  ? 6    G   R "O3'" 1 
ATOM   118   C  "C2'" . G   A 1  6    ? 5.388   14.593  42.461  1.00 76.03  ? 6    G   R "C2'" 1 
ATOM   119   O  "O2'" . G   A 1  6    ? 4.069   14.874  42.020  1.00 75.41  ? 6    G   R "O2'" 1 
ATOM   120   C  "C1'" . G   A 1  6    ? 6.360   15.464  41.665  1.00 85.63  ? 6    G   R "C1'" 1 
ATOM   121   N  N9    . G   A 1  6    ? 7.669   14.811  41.471  1.00 97.39  ? 6    G   R N9    1 
ATOM   122   C  C8    . G   A 1  6    ? 8.869   15.223  41.993  1.00 99.17  ? 6    G   R C8    1 
ATOM   123   N  N7    . G   A 1  6    ? 9.872   14.460  41.656  1.00 114.48 ? 6    G   R N7    1 
ATOM   124   C  C5    . G   A 1  6    ? 9.303   13.478  40.859  1.00 95.38  ? 6    G   R C5    1 
ATOM   125   C  C6    . G   A 1  6    ? 9.902   12.371  40.202  1.00 95.68  ? 6    G   R C6    1 
ATOM   126   O  O6    . G   A 1  6    ? 11.090  12.027  40.196  1.00 97.48  ? 6    G   R O6    1 
ATOM   127   N  N1    . G   A 1  6    ? 8.966   11.626  39.496  1.00 100.82 ? 6    G   R N1    1 
ATOM   128   C  C2    . G   A 1  6    ? 7.625   11.913  39.429  1.00 121.17 ? 6    G   R C2    1 
ATOM   129   N  N2    . G   A 1  6    ? 6.876   11.075  38.696  1.00 135.10 ? 6    G   R N2    1 
ATOM   130   N  N3    . G   A 1  6    ? 7.055   12.943  40.037  1.00 116.14 ? 6    G   R N3    1 
ATOM   131   C  C4    . G   A 1  6    ? 7.945   13.682  40.731  1.00 102.51 ? 6    G   R C4    1 
ATOM   132   P  P     . A   A 1  7    ? 4.469   13.526  45.629  1.00 100.39 ? 7    A   R P     1 
ATOM   133   O  OP1   . A   A 1  7    ? 3.270   13.599  46.503  1.00 101.95 ? 7    A   R OP1   1 
ATOM   134   O  OP2   . A   A 1  7    ? 5.807   13.329  46.242  1.00 118.60 ? 7    A   R OP2   1 
ATOM   135   O  "O5'" . A   A 1  7    ? 4.228   12.363  44.567  1.00 118.83 ? 7    A   R "O5'" 1 
ATOM   136   C  "C5'" . A   A 1  7    ? 3.008   12.282  43.846  1.00 99.52  ? 7    A   R "C5'" 1 
ATOM   137   C  "C4'" . A   A 1  7    ? 3.082   11.267  42.735  1.00 75.24  ? 7    A   R "C4'" 1 
ATOM   138   O  "O4'" . A   A 1  7    ? 4.190   11.576  41.849  1.00 87.15  ? 7    A   R "O4'" 1 
ATOM   139   C  "C3'" . A   A 1  7    ? 3.346   9.831   43.147  1.00 75.69  ? 7    A   R "C3'" 1 
ATOM   140   O  "O3'" . A   A 1  7    ? 2.197   9.174   43.648  1.00 80.30  ? 7    A   R "O3'" 1 
ATOM   141   C  "C2'" . A   A 1  7    ? 3.885   9.222   41.860  1.00 82.46  ? 7    A   R "C2'" 1 
ATOM   142   O  "O2'" . A   A 1  7    ? 2.826   8.969   40.946  1.00 76.12  ? 7    A   R "O2'" 1 
ATOM   143   C  "C1'" . A   A 1  7    ? 4.719   10.379  41.313  1.00 82.64  ? 7    A   R "C1'" 1 
ATOM   144   N  N9    . A   A 1  7    ? 6.142   10.264  41.688  1.00 77.62  ? 7    A   R N9    1 
ATOM   145   C  C8    . A   A 1  7    ? 6.883   11.099  42.486  1.00 82.95  ? 7    A   R C8    1 
ATOM   146   N  N7    . A   A 1  7    ? 8.133   10.726  42.623  1.00 98.12  ? 7    A   R N7    1 
ATOM   147   C  C5    . A   A 1  7    ? 8.224   9.567   41.867  1.00 84.18  ? 7    A   R C5    1 
ATOM   148   C  C6    . A   A 1  7    ? 9.290   8.688   41.606  1.00 84.96  ? 7    A   R C6    1 
ATOM   149   N  N6    . A   A 1  7    ? 10.518  8.851   42.102  1.00 95.56  ? 7    A   R N6    1 
ATOM   150   N  N1    . A   A 1  7    ? 9.051   7.624   40.810  1.00 84.78  ? 7    A   R N1    1 
ATOM   151   C  C2    . A   A 1  7    ? 7.817   7.465   40.316  1.00 86.71  ? 7    A   R C2    1 
ATOM   152   N  N3    . A   A 1  7    ? 6.735   8.223   40.488  1.00 89.68  ? 7    A   R N3    1 
ATOM   153   C  C4    . A   A 1  7    ? 7.006   9.271   41.285  1.00 78.99  ? 7    A   R C4    1 
ATOM   154   P  P     . G   A 1  8    ? 2.354   7.919   44.642  1.00 84.12  ? 8    G   R P     1 
ATOM   155   O  OP1   . G   A 1  8    ? 0.997   7.555   45.126  1.00 100.51 ? 8    G   R OP1   1 
ATOM   156   O  OP2   . G   A 1  8    ? 3.421   8.234   45.627  1.00 97.56  ? 8    G   R OP2   1 
ATOM   157   O  "O5'" . G   A 1  8    ? 2.880   6.742   43.703  1.00 101.82 ? 8    G   R "O5'" 1 
ATOM   158   C  "C5'" . G   A 1  8    ? 2.125   6.309   42.582  1.00 80.55  ? 8    G   R "C5'" 1 
ATOM   159   C  "C4'" . G   A 1  8    ? 2.811   5.182   41.854  1.00 78.61  ? 8    G   R "C4'" 1 
ATOM   160   O  "O4'" . G   A 1  8    ? 4.061   5.633   41.275  1.00 79.37  ? 8    G   R "O4'" 1 
ATOM   161   C  "C3'" . G   A 1  8    ? 3.224   4.000   42.706  1.00 79.57  ? 8    G   R "C3'" 1 
ATOM   162   O  "O3'" . G   A 1  8    ? 2.142   3.154   43.026  1.00 79.68  ? 8    G   R "O3'" 1 
ATOM   163   C  "C2'" . G   A 1  8    ? 4.293   3.342   41.851  1.00 81.18  ? 8    G   R "C2'" 1 
ATOM   164   O  "O2'" . G   A 1  8    ? 3.705   2.613   40.783  1.00 91.46  ? 8    G   R "O2'" 1 
ATOM   165   C  "C1'" . G   A 1  8    ? 4.993   4.569   41.267  1.00 80.93  ? 8    G   R "C1'" 1 
ATOM   166   N  N9    . G   A 1  8    ? 6.164   4.957   42.071  1.00 81.48  ? 8    G   R N9    1 
ATOM   167   C  C8    . G   A 1  8    ? 6.302   6.077   42.852  1.00 93.55  ? 8    G   R C8    1 
ATOM   168   N  N7    . G   A 1  8    ? 7.461   6.140   43.448  1.00 112.56 ? 8    G   R N7    1 
ATOM   169   C  C5    . G   A 1  8    ? 8.122   4.990   43.039  1.00 97.68  ? 8    G   R C5    1 
ATOM   170   C  C6    . G   A 1  8    ? 9.415   4.514   43.361  1.00 102.21 ? 8    G   R C6    1 
ATOM   171   O  O6    . G   A 1  8    ? 10.257  5.039   44.098  1.00 106.87 ? 8    G   R O6    1 
ATOM   172   N  N1    . G   A 1  8    ? 9.692   3.305   42.728  1.00 105.89 ? 8    G   R N1    1 
ATOM   173   C  C2    . G   A 1  8    ? 8.831   2.634   41.894  1.00 102.86 ? 8    G   R C2    1 
ATOM   174   N  N2    . G   A 1  8    ? 9.275   1.479   41.374  1.00 110.59 ? 8    G   R N2    1 
ATOM   175   N  N3    . G   A 1  8    ? 7.621   3.072   41.587  1.00 92.10  ? 8    G   R N3    1 
ATOM   176   C  C4    . G   A 1  8    ? 7.335   4.246   42.190  1.00 83.29  ? 8    G   R C4    1 
ATOM   177   P  P     . G   A 1  9    ? 1.461   3.267   44.474  1.00 76.05  ? 9    G   R P     1 
ATOM   178   O  OP1   . G   A 1  9    ? -0.004  3.357   44.253  1.00 88.06  ? 9    G   R OP1   1 
ATOM   179   O  OP2   . G   A 1  9    ? 2.142   4.347   45.237  1.00 85.86  ? 9    G   R OP2   1 
ATOM   180   O  "O5'" . G   A 1  9    ? 1.806   1.871   45.152  1.00 77.47  ? 9    G   R "O5'" 1 
ATOM   181   C  "C5'" . G   A 1  9    ? 1.542   0.664   44.462  1.00 78.36  ? 9    G   R "C5'" 1 
ATOM   182   C  "C4'" . G   A 1  9    ? 2.735   -0.259  44.452  1.00 80.29  ? 9    G   R "C4'" 1 
ATOM   183   O  "O4'" . G   A 1  9    ? 3.893   0.406   43.890  1.00 80.64  ? 9    G   R "O4'" 1 
ATOM   184   C  "C3'" . G   A 1  9    ? 3.231   -0.754  45.798  1.00 81.41  ? 9    G   R "C3'" 1 
ATOM   185   O  "O3'" . G   A 1  9    ? 2.423   -1.781  46.342  1.00 96.32  ? 9    G   R "O3'" 1 
ATOM   186   C  "C2'" . G   A 1  9    ? 4.655   -1.200  45.477  1.00 83.35  ? 9    G   R "C2'" 1 
ATOM   187   O  "O2'" . G   A 1  9    ? 4.667   -2.491  44.893  1.00 84.97  ? 9    G   R "O2'" 1 
ATOM   188   C  "C1'" . G   A 1  9    ? 5.068   -0.184  44.407  1.00 82.50  ? 9    G   R "C1'" 1 
ATOM   189   N  N9    . G   A 1  9    ? 5.973   0.848   44.946  1.00 96.84  ? 9    G   R N9    1 
ATOM   190   C  C8    . G   A 1  9    ? 5.697   2.019   45.612  1.00 105.95 ? 9    G   R C8    1 
ATOM   191   N  N7    . G   A 1  9    ? 6.779   2.671   45.960  1.00 110.27 ? 9    G   R N7    1 
ATOM   192   C  C5    . G   A 1  9    ? 7.824   1.876   45.506  1.00 101.59 ? 9    G   R C5    1 
ATOM   193   C  C6    . G   A 1  9    ? 9.229   2.050   45.586  1.00 95.72  ? 9    G   R C6    1 
ATOM   194   O  O6    . G   A 1  9    ? 9.857   2.985   46.097  1.00 94.29  ? 9    G   R O6    1 
ATOM   195   N  N1    . G   A 1  9    ? 9.913   0.991   44.989  1.00 87.37  ? 9    G   R N1    1 
ATOM   196   C  C2    . G   A 1  9    ? 9.323   -0.099  44.391  1.00 87.81  ? 9    G   R C2    1 
ATOM   197   N  N2    . G   A 1  9    ? 10.141  -1.025  43.867  1.00 90.30  ? 9    G   R N2    1 
ATOM   198   N  N3    . G   A 1  9    ? 8.015   -0.269  44.313  1.00 86.19  ? 9    G   R N3    1 
ATOM   199   C  C4    . G   A 1  9    ? 7.339   0.747   44.887  1.00 103.06 ? 9    G   R C4    1 
ATOM   200   P  P     . DT  B 2  4    ? 61.635  20.468  87.059  1.00 202.42 ? 4    DT  T P     1 
ATOM   201   O  OP1   . DT  B 2  4    ? 60.331  20.178  86.422  1.00 204.05 ? 4    DT  T OP1   1 
ATOM   202   O  OP2   . DT  B 2  4    ? 61.797  21.681  87.890  1.00 201.34 ? 4    DT  T OP2   1 
ATOM   203   O  "O5'" . DT  B 2  4    ? 62.770  20.474  85.929  1.00 206.73 ? 4    DT  T "O5'" 1 
ATOM   204   C  "C5'" . DT  B 2  4    ? 62.476  19.984  84.623  1.00 209.46 ? 4    DT  T "C5'" 1 
ATOM   205   C  "C4'" . DT  B 2  4    ? 62.895  18.530  84.478  1.00 218.16 ? 4    DT  T "C4'" 1 
ATOM   206   O  "O4'" . DT  B 2  4    ? 62.562  17.801  85.692  1.00 227.62 ? 4    DT  T "O4'" 1 
ATOM   207   C  "C3'" . DT  B 2  4    ? 62.215  17.772  83.334  1.00 217.38 ? 4    DT  T "C3'" 1 
ATOM   208   O  "O3'" . DT  B 2  4    ? 63.141  16.877  82.723  1.00 224.82 ? 4    DT  T "O3'" 1 
ATOM   209   C  "C2'" . DT  B 2  4    ? 61.107  17.014  84.055  1.00 217.95 ? 4    DT  T "C2'" 1 
ATOM   210   C  "C1'" . DT  B 2  4    ? 61.808  16.659  85.354  1.00 223.34 ? 4    DT  T "C1'" 1 
ATOM   211   N  N1    . DT  B 2  4    ? 60.873  16.341  86.476  1.00 217.13 ? 4    DT  T N1    1 
ATOM   212   C  C2    . DT  B 2  4    ? 61.133  15.254  87.281  1.00 216.10 ? 4    DT  T C2    1 
ATOM   213   O  O2    . DT  B 2  4    ? 62.100  14.528  87.133  1.00 220.42 ? 4    DT  T O2    1 
ATOM   214   N  N3    . DT  B 2  4    ? 60.214  15.046  88.276  1.00 205.98 ? 4    DT  T N3    1 
ATOM   215   C  C4    . DT  B 2  4    ? 59.084  15.798  88.540  1.00 194.61 ? 4    DT  T C4    1 
ATOM   216   O  O4    . DT  B 2  4    ? 58.318  15.531  89.460  1.00 190.77 ? 4    DT  T O4    1 
ATOM   217   C  C5    . DT  B 2  4    ? 58.869  16.921  87.657  1.00 190.81 ? 4    DT  T C5    1 
ATOM   218   C  C7    . DT  B 2  4    ? 57.676  17.810  87.845  1.00 181.96 ? 4    DT  T C7    1 
ATOM   219   C  C6    . DT  B 2  4    ? 59.762  17.133  86.678  1.00 203.38 ? 4    DT  T C6    1 
ATOM   220   P  P     . DC  B 2  5    ? 62.879  16.323  81.235  1.00 224.18 ? 5    DC  T P     1 
ATOM   221   O  OP1   . DC  B 2  5    ? 63.894  16.928  80.345  1.00 231.40 ? 5    DC  T OP1   1 
ATOM   222   O  OP2   . DC  B 2  5    ? 61.441  16.491  80.930  1.00 225.90 ? 5    DC  T OP2   1 
ATOM   223   O  "O5'" . DC  B 2  5    ? 63.167  14.752  81.353  1.00 226.52 ? 5    DC  T "O5'" 1 
ATOM   224   C  "C5'" . DC  B 2  5    ? 63.698  14.040  80.240  1.00 227.22 ? 5    DC  T "C5'" 1 
ATOM   225   C  "C4'" . DC  B 2  5    ? 63.187  12.610  80.217  1.00 228.20 ? 5    DC  T "C4'" 1 
ATOM   226   O  "O4'" . DC  B 2  5    ? 62.632  12.272  81.518  1.00 227.48 ? 5    DC  T "O4'" 1 
ATOM   227   C  "C3'" . DC  B 2  5    ? 62.072  12.342  79.207  1.00 228.17 ? 5    DC  T "C3'" 1 
ATOM   228   O  "O3'" . DC  B 2  5    ? 62.196  11.021  78.685  1.00 227.90 ? 5    DC  T "O3'" 1 
ATOM   229   C  "C2'" . DC  B 2  5    ? 60.821  12.484  80.060  1.00 224.38 ? 5    DC  T "C2'" 1 
ATOM   230   C  "C1'" . DC  B 2  5    ? 61.290  11.861  81.363  1.00 224.34 ? 5    DC  T "C1'" 1 
ATOM   231   N  N1    . DC  B 2  5    ? 60.509  12.309  82.547  1.00 222.46 ? 5    DC  T N1    1 
ATOM   232   C  C2    . DC  B 2  5    ? 59.235  11.780  82.772  1.00 226.73 ? 5    DC  T C2    1 
ATOM   233   O  O2    . DC  B 2  5    ? 58.783  10.942  81.983  1.00 229.99 ? 5    DC  T O2    1 
ATOM   234   N  N3    . DC  B 2  5    ? 58.531  12.197  83.853  1.00 222.66 ? 5    DC  T N3    1 
ATOM   235   C  C4    . DC  B 2  5    ? 59.055  13.101  84.681  1.00 213.79 ? 5    DC  T C4    1 
ATOM   236   N  N4    . DC  B 2  5    ? 58.324  13.484  85.733  1.00 205.53 ? 5    DC  T N4    1 
ATOM   237   C  C5    . DC  B 2  5    ? 60.351  13.651  84.467  1.00 212.19 ? 5    DC  T C5    1 
ATOM   238   C  C6    . DC  B 2  5    ? 61.036  13.234  83.398  1.00 216.13 ? 5    DC  T C6    1 
ATOM   239   P  P     . DT  B 2  6    ? 61.494  10.627  77.293  1.00 227.67 ? 6    DT  T P     1 
ATOM   240   O  OP1   . DT  B 2  6    ? 62.506  10.788  76.226  1.00 234.49 ? 6    DT  T OP1   1 
ATOM   241   O  OP2   . DT  B 2  6    ? 60.216  11.367  77.196  1.00 218.69 ? 6    DT  T OP2   1 
ATOM   242   O  "O5'" . DT  B 2  6    ? 61.164  9.066   77.456  1.00 219.51 ? 6    DT  T "O5'" 1 
ATOM   243   C  "C5'" . DT  B 2  6    ? 60.747  8.552   78.720  1.00 213.70 ? 6    DT  T "C5'" 1 
ATOM   244   C  "C4'" . DT  B 2  6    ? 59.463  7.747   78.591  1.00 213.34 ? 6    DT  T "C4'" 1 
ATOM   245   O  "O4'" . DT  B 2  6    ? 58.483  8.262   79.531  1.00 209.95 ? 6    DT  T "O4'" 1 
ATOM   246   C  "C3'" . DT  B 2  6    ? 58.773  7.837   77.236  1.00 216.14 ? 6    DT  T "C3'" 1 
ATOM   247   O  "O3'" . DT  B 2  6    ? 57.886  6.739   77.083  1.00 214.48 ? 6    DT  T "O3'" 1 
ATOM   248   C  "C2'" . DT  B 2  6    ? 57.983  9.119   77.409  1.00 213.78 ? 6    DT  T "C2'" 1 
ATOM   249   C  "C1'" . DT  B 2  6    ? 57.437  8.888   78.810  1.00 211.66 ? 6    DT  T "C1'" 1 
ATOM   250   N  N1    . DT  B 2  6    ? 57.042  10.126  79.518  1.00 214.85 ? 6    DT  T N1    1 
ATOM   251   C  C2    . DT  B 2  6    ? 56.249  10.026  80.630  1.00 219.82 ? 6    DT  T C2    1 
ATOM   252   O  O2    . DT  B 2  6    ? 55.858  8.960   81.073  1.00 220.54 ? 6    DT  T O2    1 
ATOM   253   N  N3    . DT  B 2  6    ? 55.934  11.221  81.218  1.00 222.47 ? 6    DT  T N3    1 
ATOM   254   C  C4    . DT  B 2  6    ? 56.321  12.481  80.807  1.00 223.75 ? 6    DT  T C4    1 
ATOM   255   O  O4    . DT  B 2  6    ? 55.984  13.499  81.403  1.00 227.58 ? 6    DT  T O4    1 
ATOM   256   C  C5    . DT  B 2  6    ? 57.152  12.517  79.625  1.00 218.93 ? 6    DT  T C5    1 
ATOM   257   C  C7    . DT  B 2  6    ? 57.634  13.829  79.082  1.00 219.17 ? 6    DT  T C7    1 
ATOM   258   C  C6    . DT  B 2  6    ? 57.468  11.350  79.043  1.00 215.31 ? 6    DT  T C6    1 
ATOM   259   P  P     . DC  B 2  7    ? 58.363  5.383   76.369  1.00 210.72 ? 7    DC  T P     1 
ATOM   260   O  OP1   . DC  B 2  7    ? 59.839  5.308   76.441  1.00 210.41 ? 7    DC  T OP1   1 
ATOM   261   O  OP2   . DC  B 2  7    ? 57.685  5.317   75.055  1.00 205.72 ? 7    DC  T OP2   1 
ATOM   262   O  "O5'" . DC  B 2  7    ? 57.730  4.240   77.291  1.00 204.75 ? 7    DC  T "O5'" 1 
ATOM   263   C  "C5'" . DC  B 2  7    ? 57.427  4.518   78.655  1.00 198.60 ? 7    DC  T "C5'" 1 
ATOM   264   C  "C4'" . DC  B 2  7    ? 55.925  4.593   78.872  1.00 191.92 ? 7    DC  T "C4'" 1 
ATOM   265   O  "O4'" . DC  B 2  7    ? 55.511  5.978   79.019  1.00 191.49 ? 7    DC  T "O4'" 1 
ATOM   266   C  "C3'" . DC  B 2  7    ? 55.071  4.016   77.734  1.00 192.70 ? 7    DC  T "C3'" 1 
ATOM   267   O  "O3'" . DC  B 2  7    ? 54.057  3.171   78.271  1.00 191.78 ? 7    DC  T "O3'" 1 
ATOM   268   C  "C2'" . DC  B 2  7    ? 54.472  5.262   77.081  1.00 192.58 ? 7    DC  T "C2'" 1 
ATOM   269   C  "C1'" . DC  B 2  7    ? 54.324  6.163   78.289  1.00 193.30 ? 7    DC  T "C1'" 1 
ATOM   270   N  N1    . DC  B 2  7    ? 54.167  7.608   77.958  1.00 197.47 ? 7    DC  T N1    1 
ATOM   271   C  C2    . DC  B 2  7    ? 53.476  8.439   78.842  1.00 205.33 ? 7    DC  T C2    1 
ATOM   272   O  O2    . DC  B 2  7    ? 53.021  7.956   79.884  1.00 211.43 ? 7    DC  T O2    1 
ATOM   273   N  N3    . DC  B 2  7    ? 53.329  9.750   78.535  1.00 201.87 ? 7    DC  T N3    1 
ATOM   274   C  C4    . DC  B 2  7    ? 53.838  10.230  77.399  1.00 196.22 ? 7    DC  T C4    1 
ATOM   275   N  N4    . DC  B 2  7    ? 53.668  11.530  77.139  1.00 193.79 ? 7    DC  T N4    1 
ATOM   276   C  C5    . DC  B 2  7    ? 54.543  9.396   76.480  1.00 191.05 ? 7    DC  T C5    1 
ATOM   277   C  C6    . DC  B 2  7    ? 54.679  8.103   76.795  1.00 192.19 ? 7    DC  T C6    1 
ATOM   278   P  P     . DT  B 2  8    ? 52.972  2.486   77.303  1.00 185.99 ? 8    DT  T P     1 
ATOM   279   O  OP1   . DT  B 2  8    ? 52.438  1.292   77.997  1.00 182.47 ? 8    DT  T OP1   1 
ATOM   280   O  OP2   . DT  B 2  8    ? 53.591  2.342   75.967  1.00 181.50 ? 8    DT  T OP2   1 
ATOM   281   O  "O5'" . DT  B 2  8    ? 51.806  3.577   77.193  1.00 170.21 ? 8    DT  T "O5'" 1 
ATOM   282   C  "C5'" . DT  B 2  8    ? 50.494  3.268   77.647  1.00 160.80 ? 8    DT  T "C5'" 1 
ATOM   283   C  "C4'" . DT  B 2  8    ? 50.300  3.705   79.088  1.00 160.25 ? 8    DT  T "C4'" 1 
ATOM   284   O  "O4'" . DT  B 2  8    ? 51.088  4.893   79.340  1.00 166.08 ? 8    DT  T "O4'" 1 
ATOM   285   C  "C3'" . DT  B 2  8    ? 48.859  4.037   79.461  1.00 167.37 ? 8    DT  T "C3'" 1 
ATOM   286   O  "O3'" . DT  B 2  8    ? 48.300  2.955   80.192  1.00 183.53 ? 8    DT  T "O3'" 1 
ATOM   287   C  "C2'" . DT  B 2  8    ? 48.967  5.289   80.331  1.00 163.82 ? 8    DT  T "C2'" 1 
ATOM   288   C  "C1'" . DT  B 2  8    ? 50.292  5.916   79.900  1.00 171.63 ? 8    DT  T "C1'" 1 
ATOM   289   N  N1    . DT  B 2  8    ? 50.167  7.033   78.895  1.00 177.36 ? 8    DT  T N1    1 
ATOM   290   C  C2    . DT  B 2  8    ? 49.514  8.199   79.243  1.00 170.60 ? 8    DT  T C2    1 
ATOM   291   O  O2    . DT  B 2  8    ? 49.000  8.383   80.334  1.00 166.30 ? 8    DT  T O2    1 
ATOM   292   N  N3    . DT  B 2  8    ? 49.475  9.148   78.255  1.00 167.08 ? 8    DT  T N3    1 
ATOM   293   C  C4    . DT  B 2  8    ? 50.021  9.060   76.986  1.00 166.47 ? 8    DT  T C4    1 
ATOM   294   O  O4    . DT  B 2  8    ? 49.929  9.967   76.165  1.00 165.94 ? 8    DT  T O4    1 
ATOM   295   C  C5    . DT  B 2  8    ? 50.695  7.820   76.690  1.00 172.38 ? 8    DT  T C5    1 
ATOM   296   C  C7    . DT  B 2  8    ? 51.322  7.608   75.344  1.00 167.03 ? 8    DT  T C7    1 
ATOM   297   C  C6    . DT  B 2  8    ? 50.740  6.881   77.647  1.00 178.15 ? 8    DT  T C6    1 
ATOM   298   P  P     . DC  B 2  9    ? 46.946  2.250   79.693  1.00 198.30 ? 9    DC  T P     1 
ATOM   299   O  OP1   . DC  B 2  9    ? 46.677  1.117   80.606  1.00 196.72 ? 9    DC  T OP1   1 
ATOM   300   O  OP2   . DC  B 2  9    ? 47.068  2.019   78.237  1.00 202.54 ? 9    DC  T OP2   1 
ATOM   301   O  "O5'" . DC  B 2  9    ? 45.824  3.365   79.919  1.00 201.53 ? 9    DC  T "O5'" 1 
ATOM   302   C  "C5'" . DC  B 2  9    ? 45.494  3.789   81.236  1.00 195.81 ? 9    DC  T "C5'" 1 
ATOM   303   C  "C4'" . DC  B 2  9    ? 44.699  5.080   81.197  1.00 185.53 ? 9    DC  T "C4'" 1 
ATOM   304   O  "O4'" . DC  B 2  9    ? 45.457  6.082   80.468  1.00 182.66 ? 9    DC  T "O4'" 1 
ATOM   305   C  "C3'" . DC  B 2  9    ? 43.344  4.981   80.492  1.00 184.73 ? 9    DC  T "C3'" 1 
ATOM   306   O  "O3'" . DC  B 2  9    ? 42.383  5.807   81.146  1.00 191.01 ? 9    DC  T "O3'" 1 
ATOM   307   C  "C2'" . DC  B 2  9    ? 43.656  5.492   79.092  1.00 181.00 ? 9    DC  T "C2'" 1 
ATOM   308   C  "C1'" . DC  B 2  9    ? 44.686  6.569   79.393  1.00 181.98 ? 9    DC  T "C1'" 1 
ATOM   309   N  N1    . DC  B 2  9    ? 45.583  6.862   78.245  1.00 187.12 ? 9    DC  T N1    1 
ATOM   310   C  C2    . DC  B 2  9    ? 46.291  8.068   78.207  1.00 189.50 ? 9    DC  T C2    1 
ATOM   311   O  O2    . DC  B 2  9    ? 46.170  8.870   79.141  1.00 184.67 ? 9    DC  T O2    1 
ATOM   312   N  N3    . DC  B 2  9    ? 47.094  8.322   77.144  1.00 193.61 ? 9    DC  T N3    1 
ATOM   313   C  C4    . DC  B 2  9    ? 47.199  7.429   76.157  1.00 189.93 ? 9    DC  T C4    1 
ATOM   314   N  N4    . DC  B 2  9    ? 48.002  7.722   75.130  1.00 184.06 ? 9    DC  T N4    1 
ATOM   315   C  C5    . DC  B 2  9    ? 46.481  6.199   76.178  1.00 188.68 ? 9    DC  T C5    1 
ATOM   316   C  C6    . DC  B 2  9    ? 45.691  5.961   77.228  1.00 186.00 ? 9    DC  T C6    1 
ATOM   317   P  P     . DT  B 2  10   ? 40.810  5.562   80.913  1.00 189.24 ? 10   DT  T P     1 
ATOM   318   O  OP1   . DT  B 2  10   ? 40.215  5.190   82.216  1.00 188.85 ? 10   DT  T OP1   1 
ATOM   319   O  OP2   . DT  B 2  10   ? 40.653  4.663   79.748  1.00 177.36 ? 10   DT  T OP2   1 
ATOM   320   O  "O5'" . DT  B 2  10   ? 40.252  7.001   80.491  1.00 185.19 ? 10   DT  T "O5'" 1 
ATOM   321   C  "C5'" . DT  B 2  10   ? 40.886  7.731   79.450  1.00 181.21 ? 10   DT  T "C5'" 1 
ATOM   322   C  "C4'" . DT  B 2  10   ? 41.474  9.028   79.979  1.00 174.51 ? 10   DT  T "C4'" 1 
ATOM   323   O  "O4'" . DT  B 2  10   ? 42.891  9.061   79.697  1.00 168.31 ? 10   DT  T "O4'" 1 
ATOM   324   C  "C3'" . DT  B 2  10   ? 40.863  10.292  79.385  1.00 172.86 ? 10   DT  T "C3'" 1 
ATOM   325   O  "O3'" . DT  B 2  10   ? 40.013  10.901  80.350  1.00 180.71 ? 10   DT  T "O3'" 1 
ATOM   326   C  "C2'" . DT  B 2  10   ? 42.058  11.193  79.055  1.00 167.88 ? 10   DT  T "C2'" 1 
ATOM   327   C  "C1'" . DT  B 2  10   ? 43.247  10.236  79.006  1.00 170.78 ? 10   DT  T "C1'" 1 
ATOM   328   N  N1    . DT  B 2  10   ? 43.698  9.866   77.619  1.00 176.87 ? 10   DT  T N1    1 
ATOM   329   C  C2    . DT  B 2  10   ? 44.678  10.616  77.011  1.00 182.01 ? 10   DT  T C2    1 
ATOM   330   O  O2    . DT  B 2  10   ? 45.199  11.584  77.535  1.00 179.33 ? 10   DT  T O2    1 
ATOM   331   N  N3    . DT  B 2  10   ? 45.028  10.192  75.756  1.00 187.09 ? 10   DT  T N3    1 
ATOM   332   C  C4    . DT  B 2  10   ? 44.512  9.112   75.063  1.00 182.58 ? 10   DT  T C4    1 
ATOM   333   O  O4    . DT  B 2  10   ? 44.892  8.813   73.934  1.00 172.75 ? 10   DT  T O4    1 
ATOM   334   C  C5    . DT  B 2  10   ? 43.491  8.364   75.758  1.00 180.69 ? 10   DT  T C5    1 
ATOM   335   C  C7    . DT  B 2  10   ? 42.854  7.172   75.108  1.00 176.85 ? 10   DT  T C7    1 
ATOM   336   C  C6    . DT  B 2  10   ? 43.142  8.769   76.989  1.00 179.58 ? 10   DT  T C6    1 
ATOM   337   P  P     . DC  B 2  11   ? 38.430  10.627  80.334  1.00 192.48 ? 11   DC  T P     1 
ATOM   338   O  OP1   . DC  B 2  11   ? 37.951  10.708  81.732  1.00 186.67 ? 11   DC  T OP1   1 
ATOM   339   O  OP2   . DC  B 2  11   ? 38.181  9.405   79.538  1.00 197.51 ? 11   DC  T OP2   1 
ATOM   340   O  "O5'" . DC  B 2  11   ? 37.843  11.869  79.521  1.00 203.85 ? 11   DC  T "O5'" 1 
ATOM   341   C  "C5'" . DC  B 2  11   ? 38.107  13.187  79.971  1.00 206.84 ? 11   DC  T "C5'" 1 
ATOM   342   C  "C4'" . DC  B 2  11   ? 38.488  14.093  78.814  1.00 215.18 ? 11   DC  T "C4'" 1 
ATOM   343   O  "O4'" . DC  B 2  11   ? 39.571  13.496  78.047  1.00 218.35 ? 11   DC  T "O4'" 1 
ATOM   344   C  "C3'" . DC  B 2  11   ? 37.365  14.377  77.804  1.00 220.88 ? 11   DC  T "C3'" 1 
ATOM   345   O  "O3'" . DC  B 2  11   ? 37.305  15.777  77.534  1.00 219.82 ? 11   DC  T "O3'" 1 
ATOM   346   C  "C2'" . DC  B 2  11   ? 37.805  13.592  76.569  1.00 221.58 ? 11   DC  T "C2'" 1 
ATOM   347   C  "C1'" . DC  B 2  11   ? 39.308  13.723  76.686  1.00 218.89 ? 11   DC  T "C1'" 1 
ATOM   348   N  N1    . DC  B 2  11   ? 40.069  12.750  75.855  1.00 213.97 ? 11   DC  T N1    1 
ATOM   349   C  C2    . DC  B 2  11   ? 40.778  13.211  74.741  1.00 215.84 ? 11   DC  T C2    1 
ATOM   350   O  O2    . DC  B 2  11   ? 40.766  14.420  74.478  1.00 217.49 ? 11   DC  T O2    1 
ATOM   351   N  N3    . DC  B 2  11   ? 41.464  12.322  73.985  1.00 213.38 ? 11   DC  T N3    1 
ATOM   352   C  C4    . DC  B 2  11   ? 41.452  11.027  74.302  1.00 205.51 ? 11   DC  T C4    1 
ATOM   353   N  N4    . DC  B 2  11   ? 42.140  10.188  73.522  1.00 197.55 ? 11   DC  T N4    1 
ATOM   354   C  C5    . DC  B 2  11   ? 40.731  10.536  75.430  1.00 202.38 ? 11   DC  T C5    1 
ATOM   355   C  C6    . DC  B 2  11   ? 40.057  11.424  76.170  1.00 207.08 ? 11   DC  T C6    1 
ATOM   356   P  P     . DT  B 2  12   ? 36.319  16.350  76.400  1.00 219.21 ? 12   DT  T P     1 
ATOM   357   O  OP1   . DT  B 2  12   ? 36.123  17.791  76.672  1.00 217.13 ? 12   DT  T OP1   1 
ATOM   358   O  OP2   . DT  B 2  12   ? 35.148  15.449  76.317  1.00 205.93 ? 12   DT  T OP2   1 
ATOM   359   O  "O5'" . DT  B 2  12   ? 37.149  16.193  75.039  1.00 217.32 ? 12   DT  T "O5'" 1 
ATOM   360   C  "C5'" . DT  B 2  12   ? 38.093  17.189  74.649  1.00 216.75 ? 12   DT  T "C5'" 1 
ATOM   361   C  "C4'" . DT  B 2  12   ? 38.209  17.261  73.134  1.00 213.79 ? 12   DT  T "C4'" 1 
ATOM   362   O  "O4'" . DT  B 2  12   ? 39.122  16.230  72.655  1.00 208.25 ? 12   DT  T "O4'" 1 
ATOM   363   C  "C3'" . DT  B 2  12   ? 36.897  17.027  72.372  1.00 208.54 ? 12   DT  T "C3'" 1 
ATOM   364   O  "O3'" . DT  B 2  12   ? 36.895  17.785  71.166  1.00 198.49 ? 12   DT  T "O3'" 1 
ATOM   365   C  "C2'" . DT  B 2  12   ? 37.003  15.544  72.049  1.00 206.62 ? 12   DT  T "C2'" 1 
ATOM   366   C  "C1'" . DT  B 2  12   ? 38.462  15.504  71.644  1.00 205.42 ? 12   DT  T "C1'" 1 
ATOM   367   N  N1    . DT  B 2  12   ? 39.047  14.136  71.531  1.00 198.10 ? 12   DT  T N1    1 
ATOM   368   C  C2    . DT  B 2  12   ? 40.147  13.952  70.728  1.00 195.73 ? 12   DT  T C2    1 
ATOM   369   O  O2    . DT  B 2  12   ? 40.684  14.859  70.116  1.00 200.04 ? 12   DT  T O2    1 
ATOM   370   N  N3    . DT  B 2  12   ? 40.611  12.665  70.675  1.00 189.75 ? 12   DT  T N3    1 
ATOM   371   C  C4    . DT  B 2  12   ? 40.088  11.562  71.321  1.00 188.13 ? 12   DT  T C4    1 
ATOM   372   O  O4    . DT  B 2  12   ? 40.577  10.443  71.210  1.00 185.23 ? 12   DT  T O4    1 
ATOM   373   C  C5    . DT  B 2  12   ? 38.926  11.821  72.141  1.00 187.52 ? 12   DT  T C5    1 
ATOM   374   C  C7    . DT  B 2  12   ? 38.270  10.701  72.893  1.00 181.84 ? 12   DT  T C7    1 
ATOM   375   C  C6    . DT  B 2  12   ? 38.464  13.081  72.202  1.00 193.12 ? 12   DT  T C6    1 
ATOM   376   P  P     . DC  B 2  13   ? 36.486  19.339  71.146  1.00 187.29 ? 13   DC  T P     1 
ATOM   377   O  OP1   . DC  B 2  13   ? 36.649  19.905  72.502  1.00 186.10 ? 13   DC  T OP1   1 
ATOM   378   O  OP2   . DC  B 2  13   ? 35.174  19.440  70.468  1.00 190.54 ? 13   DC  T OP2   1 
ATOM   379   O  "O5'" . DC  B 2  13   ? 37.576  19.986  70.170  1.00 189.07 ? 13   DC  T "O5'" 1 
ATOM   380   C  "C5'" . DC  B 2  13   ? 38.707  19.216  69.765  1.00 186.92 ? 13   DC  T "C5'" 1 
ATOM   381   C  "C4'" . DC  B 2  13   ? 38.725  19.025  68.258  1.00 189.44 ? 13   DC  T "C4'" 1 
ATOM   382   O  "O4'" . DC  B 2  13   ? 38.981  17.626  67.946  1.00 188.50 ? 13   DC  T "O4'" 1 
ATOM   383   C  "C3'" . DC  B 2  13   ? 37.419  19.359  67.548  1.00 198.49 ? 13   DC  T "C3'" 1 
ATOM   384   O  "O3'" . DC  B 2  13   ? 37.700  19.764  66.219  1.00 212.99 ? 13   DC  T "O3'" 1 
ATOM   385   C  "C2'" . DC  B 2  13   ? 36.705  18.017  67.568  1.00 197.46 ? 13   DC  T "C2'" 1 
ATOM   386   C  "C1'" . DC  B 2  13   ? 37.867  17.086  67.257  1.00 198.96 ? 13   DC  T "C1'" 1 
ATOM   387   N  N1    . DC  B 2  13   ? 37.655  15.683  67.714  1.00 209.18 ? 13   DC  T N1    1 
ATOM   388   C  C2    . DC  B 2  13   ? 38.468  14.663  67.212  1.00 214.81 ? 13   DC  T C2    1 
ATOM   389   O  O2    . DC  B 2  13   ? 39.353  14.944  66.394  1.00 215.61 ? 13   DC  T O2    1 
ATOM   390   N  N3    . DC  B 2  13   ? 38.263  13.390  67.638  1.00 210.92 ? 13   DC  T N3    1 
ATOM   391   C  C4    . DC  B 2  13   ? 37.297  13.129  68.521  1.00 198.36 ? 13   DC  T C4    1 
ATOM   392   N  N4    . DC  B 2  13   ? 37.132  11.862  68.913  1.00 187.02 ? 13   DC  T N4    1 
ATOM   393   C  C5    . DC  B 2  13   ? 36.458  14.156  69.040  1.00 198.28 ? 13   DC  T C5    1 
ATOM   394   C  C6    . DC  B 2  13   ? 36.668  15.405  68.612  1.00 205.48 ? 13   DC  T C6    1 
ATOM   395   P  P     . DG  B 2  14   ? 36.636  20.626  65.379  1.00 206.88 ? 14   DG  T P     1 
ATOM   396   O  OP1   . DG  B 2  14   ? 36.785  22.038  65.793  1.00 209.69 ? 14   DG  T OP1   1 
ATOM   397   O  OP2   . DG  B 2  14   ? 35.314  19.970  65.485  1.00 210.14 ? 14   DG  T OP2   1 
ATOM   398   O  "O5'" . DG  B 2  14   ? 37.139  20.468  63.869  1.00 209.49 ? 14   DG  T "O5'" 1 
ATOM   399   C  "C5'" . DG  B 2  14   ? 38.359  19.781  63.595  1.00 218.38 ? 14   DG  T "C5'" 1 
ATOM   400   C  "C4'" . DG  B 2  14   ? 38.096  18.479  62.855  1.00 227.46 ? 14   DG  T "C4'" 1 
ATOM   401   O  "O4'" . DG  B 2  14   ? 37.623  17.467  63.786  1.00 231.28 ? 14   DG  T "O4'" 1 
ATOM   402   C  "C3'" . DG  B 2  14   ? 37.039  18.563  61.748  1.00 228.67 ? 14   DG  T "C3'" 1 
ATOM   403   O  "O3'" . DG  B 2  14   ? 37.471  17.829  60.612  1.00 232.00 ? 14   DG  T "O3'" 1 
ATOM   404   C  "C2'" . DG  B 2  14   ? 35.822  17.907  62.394  1.00 227.14 ? 14   DG  T "C2'" 1 
ATOM   405   C  "C1'" . DG  B 2  14   ? 36.497  16.834  63.226  1.00 226.73 ? 14   DG  T "C1'" 1 
ATOM   406   N  N9    . DG  B 2  14   ? 35.663  16.298  64.299  1.00 217.20 ? 14   DG  T N9    1 
ATOM   407   C  C8    . DG  B 2  14   ? 34.689  16.962  65.005  1.00 212.98 ? 14   DG  T C8    1 
ATOM   408   N  N7    . DG  B 2  14   ? 34.104  16.220  65.905  1.00 210.16 ? 14   DG  T N7    1 
ATOM   409   C  C5    . DG  B 2  14   ? 34.727  14.984  65.785  1.00 212.36 ? 14   DG  T C5    1 
ATOM   410   C  C6    . DG  B 2  14   ? 34.510  13.779  66.497  1.00 210.06 ? 14   DG  T C6    1 
ATOM   411   O  O6    . DG  B 2  14   ? 33.702  13.561  67.410  1.00 202.21 ? 14   DG  T O6    1 
ATOM   412   N  N1    . DG  B 2  14   ? 35.358  12.764  66.061  1.00 213.00 ? 14   DG  T N1    1 
ATOM   413   C  C2    . DG  B 2  14   ? 36.293  12.895  65.061  1.00 210.13 ? 14   DG  T C2    1 
ATOM   414   N  N2    . DG  B 2  14   ? 37.018  11.804  64.776  1.00 208.50 ? 14   DG  T N2    1 
ATOM   415   N  N3    . DG  B 2  14   ? 36.503  14.017  64.385  1.00 208.97 ? 14   DG  T N3    1 
ATOM   416   C  C4    . DG  B 2  14   ? 35.687  15.016  64.799  1.00 213.07 ? 14   DG  T C4    1 
ATOM   417   P  P     . DC  B 2  15   ? 38.145  18.585  59.365  1.00 234.16 ? 15   DC  T P     1 
ATOM   418   O  OP1   . DC  B 2  15   ? 39.534  18.921  59.748  1.00 238.35 ? 15   DC  T OP1   1 
ATOM   419   O  OP2   . DC  B 2  15   ? 37.219  19.654  58.928  1.00 230.45 ? 15   DC  T OP2   1 
ATOM   420   O  "O5'" . DC  B 2  15   ? 38.187  17.468  58.221  1.00 229.13 ? 15   DC  T "O5'" 1 
ATOM   421   C  "C5'" . DC  B 2  15   ? 38.961  16.289  58.407  1.00 225.61 ? 15   DC  T "C5'" 1 
ATOM   422   C  "C4'" . DC  B 2  15   ? 38.130  15.052  58.122  1.00 227.44 ? 15   DC  T "C4'" 1 
ATOM   423   O  "O4'" . DC  B 2  15   ? 37.472  14.627  59.327  1.00 233.36 ? 15   DC  T "O4'" 1 
ATOM   424   C  "C3'" . DC  B 2  15   ? 37.012  15.254  57.103  1.00 231.24 ? 15   DC  T "C3'" 1 
ATOM   425   O  "O3'" . DC  B 2  15   ? 37.425  14.779  55.801  1.00 236.04 ? 15   DC  T "O3'" 1 
ATOM   426   C  "C2'" . DC  B 2  15   ? 35.806  14.481  57.679  1.00 227.95 ? 15   DC  T "C2'" 1 
ATOM   427   C  "C1'" . DC  B 2  15   ? 36.349  13.866  58.970  1.00 235.02 ? 15   DC  T "C1'" 1 
ATOM   428   N  N1    . DC  B 2  15   ? 35.378  13.892  60.103  1.00 241.11 ? 15   DC  T N1    1 
ATOM   429   C  C2    . DC  B 2  15   ? 35.051  12.702  60.760  1.00 247.65 ? 15   DC  T C2    1 
ATOM   430   O  O2    . DC  B 2  15   ? 35.575  11.644  60.388  1.00 252.36 ? 15   DC  T O2    1 
ATOM   431   N  N3    . DC  B 2  15   ? 34.168  12.740  61.790  1.00 242.29 ? 15   DC  T N3    1 
ATOM   432   C  C4    . DC  B 2  15   ? 33.626  13.901  62.161  1.00 232.34 ? 15   DC  T C4    1 
ATOM   433   N  N4    . DC  B 2  15   ? 32.760  13.891  63.180  1.00 224.72 ? 15   DC  T N4    1 
ATOM   434   C  C5    . DC  B 2  15   ? 33.945  15.123  61.501  1.00 233.21 ? 15   DC  T C5    1 
ATOM   435   C  C6    . DC  B 2  15   ? 34.818  15.073  60.489  1.00 237.73 ? 15   DC  T C6    1 
ATOM   436   P  P     . DT  B 2  16   ? 37.262  13.239  55.355  1.00 239.50 ? 16   DT  T P     1 
ATOM   437   O  OP1   . DT  B 2  16   ? 37.647  12.346  56.471  1.00 246.24 ? 16   DT  T OP1   1 
ATOM   438   O  OP2   . DT  B 2  16   ? 37.979  13.105  54.069  1.00 238.96 ? 16   DT  T OP2   1 
ATOM   439   O  "O5'" . DT  B 2  16   ? 35.702  13.093  55.029  1.00 233.12 ? 16   DT  T "O5'" 1 
ATOM   440   C  "C5'" . DT  B 2  16   ? 35.196  11.888  54.475  1.00 224.11 ? 16   DT  T "C5'" 1 
ATOM   441   C  "C4'" . DT  B 2  16   ? 34.904  10.869  55.562  1.00 214.72 ? 16   DT  T "C4'" 1 
ATOM   442   O  "O4'" . DT  B 2  16   ? 34.575  11.548  56.783  1.00 214.40 ? 16   DT  T "O4'" 1 
ATOM   443   C  "C3'" . DT  B 2  16   ? 33.706  9.970   55.292  1.00 204.42 ? 16   DT  T "C3'" 1 
ATOM   444   O  "O3'" . DT  B 2  16   ? 34.126  8.784   54.631  1.00 193.64 ? 16   DT  T "O3'" 1 
ATOM   445   C  "C2'" . DT  B 2  16   ? 33.155  9.658   56.696  1.00 207.70 ? 16   DT  T "C2'" 1 
ATOM   446   C  "C1'" . DT  B 2  16   ? 33.886  10.647  57.614  1.00 212.88 ? 16   DT  T "C1'" 1 
ATOM   447   N  N1    . DT  B 2  16   ? 32.975  11.420  58.513  1.00 213.39 ? 16   DT  T N1    1 
ATOM   448   C  C2    . DT  B 2  16   ? 32.405  10.787  59.594  1.00 215.63 ? 16   DT  T C2    1 
ATOM   449   O  O2    . DT  B 2  16   ? 32.602  9.615   59.862  1.00 221.36 ? 16   DT  T O2    1 
ATOM   450   N  N3    . DT  B 2  16   ? 31.590  11.579  60.358  1.00 206.72 ? 16   DT  T N3    1 
ATOM   451   C  C4    . DT  B 2  16   ? 31.292  12.914  60.154  1.00 198.35 ? 16   DT  T C4    1 
ATOM   452   O  O4    . DT  B 2  16   ? 30.546  13.540  60.900  1.00 190.09 ? 16   DT  T O4    1 
ATOM   453   C  C5    . DT  B 2  16   ? 31.924  13.518  59.004  1.00 202.37 ? 16   DT  T C5    1 
ATOM   454   C  C7    . DT  B 2  16   ? 31.677  14.962  58.681  1.00 201.70 ? 16   DT  T C7    1 
ATOM   455   C  C6    . DT  B 2  16   ? 32.725  12.751  58.248  1.00 208.59 ? 16   DT  T C6    1 
ATOM   456   P  P     . DG  B 2  17   ? 34.307  8.763   53.035  1.00 173.19 ? 17   DG  T P     1 
ATOM   457   O  OP1   . DG  B 2  17   ? 35.715  8.414   52.760  1.00 166.87 ? 17   DG  T OP1   1 
ATOM   458   O  OP2   . DG  B 2  17   ? 33.722  10.004  52.480  1.00 158.68 ? 17   DG  T OP2   1 
ATOM   459   O  "O5'" . DG  B 2  17   ? 33.377  7.560   52.554  1.00 159.47 ? 17   DG  T "O5'" 1 
ATOM   460   C  "C5'" . DG  B 2  17   ? 32.005  7.792   52.314  1.00 155.14 ? 17   DG  T "C5'" 1 
ATOM   461   C  "C4'" . DG  B 2  17   ? 31.154  7.229   53.435  1.00 154.39 ? 17   DG  T "C4'" 1 
ATOM   462   O  "O4'" . DG  B 2  17   ? 31.211  8.112   54.567  1.00 155.48 ? 17   DG  T "O4'" 1 
ATOM   463   C  "C3'" . DG  B 2  17   ? 29.678  7.115   53.110  1.00 152.11 ? 17   DG  T "C3'" 1 
ATOM   464   O  "O3'" . DG  B 2  17   ? 29.417  5.845   52.509  1.00 150.99 ? 17   DG  T "O3'" 1 
ATOM   465   C  "C2'" . DG  B 2  17   ? 29.001  7.238   54.486  1.00 152.06 ? 17   DG  T "C2'" 1 
ATOM   466   C  "C1'" . DG  B 2  17   ? 30.063  7.923   55.361  1.00 154.27 ? 17   DG  T "C1'" 1 
ATOM   467   N  N9    . DG  B 2  17   ? 29.650  9.222   55.901  1.00 154.56 ? 17   DG  T N9    1 
ATOM   468   C  C8    . DG  B 2  17   ? 30.073  10.463  55.489  1.00 155.45 ? 17   DG  T C8    1 
ATOM   469   N  N7    . DG  B 2  17   ? 29.540  11.446  56.162  1.00 155.61 ? 17   DG  T N7    1 
ATOM   470   C  C5    . DG  B 2  17   ? 28.710  10.818  57.082  1.00 154.73 ? 17   DG  T C5    1 
ATOM   471   C  C6    . DG  B 2  17   ? 27.871  11.370  58.080  1.00 154.96 ? 17   DG  T C6    1 
ATOM   472   O  O6    . DG  B 2  17   ? 27.690  12.565  58.358  1.00 155.05 ? 17   DG  T O6    1 
ATOM   473   N  N1    . DG  B 2  17   ? 27.201  10.380  58.795  1.00 162.07 ? 17   DG  T N1    1 
ATOM   474   C  C2    . DG  B 2  17   ? 27.326  9.029   58.573  1.00 153.15 ? 17   DG  T C2    1 
ATOM   475   N  N2    . DG  B 2  17   ? 26.598  8.226   59.364  1.00 152.20 ? 17   DG  T N2    1 
ATOM   476   N  N3    . DG  B 2  17   ? 28.108  8.498   57.641  1.00 154.19 ? 17   DG  T N3    1 
ATOM   477   C  C4    . DG  B 2  17   ? 28.768  9.449   56.936  1.00 154.08 ? 17   DG  T C4    1 
ATOM   478   P  P     . DA  B 2  18   ? 29.256  5.707   50.913  1.00 152.52 ? 18   DA  T P     1 
ATOM   479   O  OP1   . DA  B 2  18   ? 29.550  4.301   50.565  1.00 149.60 ? 18   DA  T OP1   1 
ATOM   480   O  OP2   . DA  B 2  18   ? 30.006  6.794   50.254  1.00 151.28 ? 18   DA  T OP2   1 
ATOM   481   O  "O5'" . DA  B 2  18   ? 27.702  5.976   50.652  1.00 158.26 ? 18   DA  T "O5'" 1 
ATOM   482   C  "C5'" . DA  B 2  18   ? 26.823  4.885   50.405  1.00 146.13 ? 18   DA  T "C5'" 1 
ATOM   483   C  "C4'" . DA  B 2  18   ? 26.227  4.367   51.702  1.00 146.02 ? 18   DA  T "C4'" 1 
ATOM   484   O  "O4'" . DA  B 2  18   ? 26.821  5.066   52.821  1.00 147.59 ? 18   DA  T "O4'" 1 
ATOM   485   C  "C3'" . DA  B 2  18   ? 24.725  4.564   51.837  1.00 164.33 ? 18   DA  T "C3'" 1 
ATOM   486   O  "O3'" . DA  B 2  18   ? 24.062  3.411   51.376  1.00 238.63 ? 18   DA  T "O3'" 1 
ATOM   487   C  "C2'" . DA  B 2  18   ? 24.534  4.739   53.339  1.00 145.04 ? 18   DA  T "C2'" 1 
ATOM   488   C  "C1'" . DA  B 2  18   ? 25.828  5.431   53.758  1.00 147.01 ? 18   DA  T "C1'" 1 
ATOM   489   N  N9    . DA  B 2  18   ? 25.734  6.890   53.797  1.00 152.44 ? 18   DA  T N9    1 
ATOM   490   C  C8    . DA  B 2  18   ? 26.064  7.769   52.801  1.00 154.29 ? 18   DA  T C8    1 
ATOM   491   N  N7    . DA  B 2  18   ? 25.883  9.030   53.126  1.00 152.88 ? 18   DA  T N7    1 
ATOM   492   C  C5    . DA  B 2  18   ? 25.403  8.972   54.425  1.00 150.03 ? 18   DA  T C5    1 
ATOM   493   C  C6    . DA  B 2  18   ? 25.015  9.971   55.340  1.00 148.64 ? 18   DA  T C6    1 
ATOM   494   N  N6    . DA  B 2  18   ? 25.053  11.279  55.065  1.00 150.77 ? 18   DA  T N6    1 
ATOM   495   N  N1    . DA  B 2  18   ? 24.583  9.571   56.554  1.00 148.66 ? 18   DA  T N1    1 
ATOM   496   C  C2    . DA  B 2  18   ? 24.545  8.262   56.827  1.00 148.23 ? 18   DA  T C2    1 
ATOM   497   N  N3    . DA  B 2  18   ? 24.884  7.235   56.052  1.00 152.40 ? 18   DA  T N3    1 
ATOM   498   C  C4    . DA  B 2  18   ? 25.308  7.662   54.853  1.00 151.75 ? 18   DA  T C4    1 
HETATM 499   P  P     . G35 B 2  19   ? 22.652  3.530   50.623  1.00 142.25 ? 19   G35 T P     1 
HETATM 500   C  C2    . G35 B 2  19   ? 14.637  4.063   50.266  1.00 172.56 ? 19   G35 T C2    1 
HETATM 501   N  N3    . G35 B 2  19   ? 14.875  2.700   49.708  1.00 184.30 ? 19   G35 T N3    1 
HETATM 502   C  C4    . G35 B 2  19   ? 15.503  1.638   50.523  1.00 176.17 ? 19   G35 T C4    1 
HETATM 503   C  C5    . G35 B 2  19   ? 14.644  0.449   50.510  1.00 157.25 ? 19   G35 T C5    1 
HETATM 504   O  O5    . G35 B 2  19   ? 13.509  0.412   50.818  1.00 146.31 ? 19   G35 T O5    1 
HETATM 505   N  N7    . G35 B 2  19   ? 15.438  -0.686  50.059  1.00 152.96 ? 19   G35 T N7    1 
HETATM 506   C  C8    . G35 B 2  19   ? 16.795  -0.202  49.780  1.00 161.79 ? 19   G35 T C8    1 
HETATM 507   O  O8    . G35 B 2  19   ? 17.695  -0.855  49.402  1.00 155.28 ? 19   G35 T O8    1 
HETATM 508   N  N9    . G35 B 2  19   ? 16.839  1.229   50.056  1.00 172.15 ? 19   G35 T N9    1 
HETATM 509   C  "C1'" . G35 B 2  19   ? 18.072  2.044   49.874  1.00 161.79 ? 19   G35 T "C1'" 1 
HETATM 510   N  N11   . G35 B 2  19   ? 14.975  4.325   51.437  1.00 170.85 ? 19   G35 T N11   1 
HETATM 511   N  N12   . G35 B 2  19   ? 14.004  5.117   49.432  1.00 160.58 ? 19   G35 T N12   1 
HETATM 512   C  "C2'" . G35 B 2  19   ? 17.832  3.484   49.309  1.00 151.47 ? 19   G35 T "C2'" 1 
HETATM 513   C  "C3'" . G35 B 2  19   ? 19.259  3.994   49.311  1.00 147.66 ? 19   G35 T "C3'" 1 
HETATM 514   O  "O3'" . G35 B 2  19   ? 19.995  3.563   48.066  1.00 143.35 ? 19   G35 T "O3'" 1 
HETATM 515   C  "C4'" . G35 B 2  19   ? 19.816  3.378   50.373  1.00 151.87 ? 19   G35 T "C4'" 1 
HETATM 516   O  "O4'" . G35 B 2  19   ? 18.728  2.326   50.956  1.00 157.25 ? 19   G35 T "O4'" 1 
HETATM 517   C  "C5'" . G35 B 2  19   ? 20.281  4.332   51.439  1.00 145.37 ? 19   G35 T "C5'" 1 
HETATM 518   O  "O5'" . G35 B 2  19   ? 21.611  4.030   51.781  1.00 138.37 ? 19   G35 T "O5'" 1 
HETATM 519   O  OP2   . G35 B 2  19   ? 22.764  4.547   49.525  1.00 159.03 ? 19   G35 T OP2   1 
HETATM 520   O  OP1   . G35 B 2  19   ? 22.334  2.159   50.077  1.00 149.50 ? 19   G35 T OP1   1 
ATOM   521   P  P     . DC  B 2  20   ? 19.241  3.373   46.652  1.00 188.58 ? 20   DC  T P     1 
ATOM   522   O  OP1   . DC  B 2  20   ? 20.292  3.268   45.619  1.00 175.94 ? 20   DC  T OP1   1 
ATOM   523   O  OP2   . DC  B 2  20   ? 18.193  4.406   46.489  1.00 188.83 ? 20   DC  T OP2   1 
ATOM   524   O  "O5'" . DC  B 2  20   ? 18.587  1.915   46.743  1.00 153.98 ? 20   DC  T "O5'" 1 
ATOM   525   C  "C5'" . DC  B 2  20   ? 19.424  0.757   46.702  1.00 135.00 ? 20   DC  T "C5'" 1 
ATOM   526   C  "C4'" . DC  B 2  20   ? 18.701  -0.420  46.067  1.00 111.59 ? 20   DC  T "C4'" 1 
ATOM   527   O  "O4'" . DC  B 2  20   ? 17.463  -0.659  46.772  1.00 102.20 ? 20   DC  T "O4'" 1 
ATOM   528   C  "C3'" . DC  B 2  20   ? 18.307  -0.227  44.610  1.00 128.45 ? 20   DC  T "C3'" 1 
ATOM   529   O  "O3'" . DC  B 2  20   ? 19.367  -0.681  43.767  1.00 152.36 ? 20   DC  T "O3'" 1 
ATOM   530   C  "C2'" . DC  B 2  20   ? 17.071  -1.117  44.477  1.00 117.16 ? 20   DC  T "C2'" 1 
ATOM   531   C  "C1'" . DC  B 2  20   ? 16.447  -1.049  45.870  1.00 113.02 ? 20   DC  T "C1'" 1 
ATOM   532   N  N1    . DC  B 2  20   ? 15.310  -0.082  45.995  1.00 135.89 ? 20   DC  T N1    1 
ATOM   533   C  C2    . DC  B 2  20   ? 14.067  -0.379  45.418  1.00 156.15 ? 20   DC  T C2    1 
ATOM   534   O  O2    . DC  B 2  20   ? 13.928  -1.437  44.793  1.00 165.86 ? 20   DC  T O2    1 
ATOM   535   N  N3    . DC  B 2  20   ? 13.050  0.509   45.558  1.00 157.13 ? 20   DC  T N3    1 
ATOM   536   C  C4    . DC  B 2  20   ? 13.239  1.638   46.243  1.00 157.19 ? 20   DC  T C4    1 
ATOM   537   N  N4    . DC  B 2  20   ? 12.210  2.484   46.357  1.00 160.67 ? 20   DC  T N4    1 
ATOM   538   C  C5    . DC  B 2  20   ? 14.493  1.953   46.835  1.00 150.25 ? 20   DC  T C5    1 
ATOM   539   C  C6    . DC  B 2  20   ? 15.487  1.072   46.696  1.00 140.47 ? 20   DC  T C6    1 
ATOM   540   P  P     . DC  B 2  21   ? 19.375  -0.353  42.191  1.00 148.54 ? 21   DC  T P     1 
ATOM   541   O  OP1   . DC  B 2  21   ? 19.605  -1.629  41.478  1.00 145.37 ? 21   DC  T OP1   1 
ATOM   542   O  OP2   . DC  B 2  21   ? 20.291  0.788   41.973  1.00 176.80 ? 21   DC  T OP2   1 
ATOM   543   O  "O5'" . DC  B 2  21   ? 17.891  0.153   41.881  1.00 126.77 ? 21   DC  T "O5'" 1 
ATOM   544   C  "C5'" . DC  B 2  21   ? 17.401  0.143   40.552  1.00 117.28 ? 21   DC  T "C5'" 1 
ATOM   545   C  "C4'" . DC  B 2  21   ? 16.141  -0.694  40.453  1.00 113.21 ? 21   DC  T "C4'" 1 
ATOM   546   O  "O4'" . DC  B 2  21   ? 15.509  -0.781  41.756  1.00 110.59 ? 21   DC  T "O4'" 1 
ATOM   547   C  "C3'" . DC  B 2  21   ? 15.074  -0.122  39.545  1.00 106.47 ? 21   DC  T "C3'" 1 
ATOM   548   O  "O3'" . DC  B 2  21   ? 15.310  -0.515  38.206  1.00 122.01 ? 21   DC  T "O3'" 1 
ATOM   549   C  "C2'" . DC  B 2  21   ? 13.813  -0.754  40.116  1.00 99.24  ? 21   DC  T "C2'" 1 
ATOM   550   C  "C1'" . DC  B 2  21   ? 14.101  -0.671  41.614  1.00 115.49 ? 21   DC  T "C1'" 1 
ATOM   551   N  N1    . DC  B 2  21   ? 13.658  0.618   42.239  1.00 131.57 ? 21   DC  T N1    1 
ATOM   552   C  C2    . DC  B 2  21   ? 12.295  0.851   42.462  1.00 136.04 ? 21   DC  T C2    1 
ATOM   553   O  O2    . DC  B 2  21   ? 11.474  -0.016  42.139  1.00 135.77 ? 21   DC  T O2    1 
ATOM   554   N  N3    . DC  B 2  21   ? 11.914  2.024   43.027  1.00 130.82 ? 21   DC  T N3    1 
ATOM   555   C  C4    . DC  B 2  21   ? 12.830  2.935   43.359  1.00 126.53 ? 21   DC  T C4    1 
ATOM   556   N  N4    . DC  B 2  21   ? 12.408  4.075   43.914  1.00 137.16 ? 21   DC  T N4    1 
ATOM   557   C  C5    . DC  B 2  21   ? 14.220  2.714   43.145  1.00 121.24 ? 21   DC  T C5    1 
ATOM   558   C  C6    . DC  B 2  21   ? 14.586  1.556   42.588  1.00 125.63 ? 21   DC  T C6    1 
ATOM   559   P  P     . DT  B 2  22   ? 15.400  0.603   37.057  1.00 131.62 ? 22   DT  T P     1 
ATOM   560   O  OP1   . DT  B 2  22   ? 15.715  -0.066  35.777  1.00 113.54 ? 22   DT  T OP1   1 
ATOM   561   O  OP2   . DT  B 2  22   ? 16.271  1.692   37.553  1.00 146.45 ? 22   DT  T OP2   1 
ATOM   562   O  "O5'" . DT  B 2  22   ? 13.911  1.166   36.977  1.00 121.52 ? 22   DT  T "O5'" 1 
ATOM   563   C  "C5'" . DT  B 2  22   ? 12.832  0.262   36.832  1.00 110.00 ? 22   DT  T "C5'" 1 
ATOM   564   C  "C4'" . DT  B 2  22   ? 11.510  0.991   36.901  1.00 95.97  ? 22   DT  T "C4'" 1 
ATOM   565   O  "O4'" . DT  B 2  22   ? 11.176  1.290   38.280  1.00 84.75  ? 22   DT  T "O4'" 1 
ATOM   566   C  "C3'" . DT  B 2  22   ? 11.492  2.345   36.233  1.00 106.30 ? 22   DT  T "C3'" 1 
ATOM   567   O  "O3'" . DT  B 2  22   ? 11.379  2.218   34.826  1.00 112.75 ? 22   DT  T "O3'" 1 
ATOM   568   C  "C2'" . DT  B 2  22   ? 10.242  2.941   36.862  1.00 108.07 ? 22   DT  T "C2'" 1 
ATOM   569   C  "C1'" . DT  B 2  22   ? 10.412  2.491   38.315  1.00 93.69  ? 22   DT  T "C1'" 1 
ATOM   570   N  N1    . DT  B 2  22   ? 11.126  3.505   39.151  1.00 94.39  ? 22   DT  T N1    1 
ATOM   571   C  C2    . DT  B 2  22   ? 10.398  4.497   39.764  1.00 105.26 ? 22   DT  T C2    1 
ATOM   572   O  O2    . DT  B 2  22   ? 9.186   4.586   39.679  1.00 108.03 ? 22   DT  T O2    1 
ATOM   573   N  N3    . DT  B 2  22   ? 11.142  5.386   40.494  1.00 115.36 ? 22   DT  T N3    1 
ATOM   574   C  C4    . DT  B 2  22   ? 12.514  5.386   40.661  1.00 121.35 ? 22   DT  T C4    1 
ATOM   575   O  O4    . DT  B 2  22   ? 13.092  6.231   41.339  1.00 115.03 ? 22   DT  T O4    1 
ATOM   576   C  C5    . DT  B 2  22   ? 13.219  4.323   39.983  1.00 119.34 ? 22   DT  T C5    1 
ATOM   577   C  C7    . DT  B 2  22   ? 14.712  4.220   40.087  1.00 124.60 ? 22   DT  T C7    1 
ATOM   578   C  C6    . DT  B 2  22   ? 12.500  3.446   39.268  1.00 95.63  ? 22   DT  T C6    1 
ATOM   579   P  P     . DC  B 2  23   ? 11.870  3.421   33.881  1.00 87.32  ? 23   DC  T P     1 
ATOM   580   O  OP1   . DC  B 2  23   ? 12.173  2.862   32.545  1.00 81.49  ? 23   DC  T OP1   1 
ATOM   581   O  OP2   . DC  B 2  23   ? 12.920  4.159   34.619  1.00 101.24 ? 23   DC  T OP2   1 
ATOM   582   O  "O5'" . DC  B 2  23   ? 10.583  4.364   33.784  1.00 80.76  ? 23   DC  T "O5'" 1 
ATOM   583   C  "C5'" . DC  B 2  23   ? 9.310   3.784   33.527  1.00 82.38  ? 23   DC  T "C5'" 1 
ATOM   584   C  "C4'" . DC  B 2  23   ? 8.190   4.722   33.935  1.00 88.59  ? 23   DC  T "C4'" 1 
ATOM   585   O  "O4'" . DC  B 2  23   ? 8.196   4.902   35.372  1.00 85.40  ? 23   DC  T "O4'" 1 
ATOM   586   C  "C3'" . DC  B 2  23   ? 8.296   6.129   33.386  1.00 89.02  ? 23   DC  T "C3'" 1 
ATOM   587   O  "O3'" . DC  B 2  23   ? 7.794   6.178   32.068  1.00 103.49 ? 23   DC  T "O3'" 1 
ATOM   588   C  "C2'" . DC  B 2  23   ? 7.403   6.891   34.353  1.00 80.88  ? 23   DC  T "C2'" 1 
ATOM   589   C  "C1'" . DC  B 2  23   ? 7.753   6.218   35.682  1.00 85.81  ? 23   DC  T "C1'" 1 
ATOM   590   N  N1    . DC  B 2  23   ? 8.829   6.934   36.439  1.00 80.86  ? 23   DC  T N1    1 
ATOM   591   C  C2    . DC  B 2  23   ? 8.503   8.071   37.186  1.00 83.94  ? 23   DC  T C2    1 
ATOM   592   O  O2    . DC  B 2  23   ? 7.328   8.455   37.213  1.00 81.43  ? 23   DC  T O2    1 
ATOM   593   N  N3    . DC  B 2  23   ? 9.485   8.718   37.865  1.00 94.14  ? 23   DC  T N3    1 
ATOM   594   C  C4    . DC  B 2  23   ? 10.740  8.270   37.811  1.00 84.08  ? 23   DC  T C4    1 
ATOM   595   N  N4    . DC  B 2  23   ? 11.673  8.939   38.495  1.00 82.54  ? 23   DC  T N4    1 
ATOM   596   C  C5    . DC  B 2  23   ? 11.094  7.115   37.052  1.00 81.52  ? 23   DC  T C5    1 
ATOM   597   C  C6    . DC  B 2  23   ? 10.117  6.485   36.387  1.00 80.99  ? 23   DC  T C6    1 
ATOM   598   P  P     . DT  B 2  24   ? 8.495   7.133   30.986  1.00 106.14 ? 24   DT  T P     1 
ATOM   599   O  OP1   . DT  B 2  24   ? 7.529   7.326   29.881  1.00 108.44 ? 24   DT  T OP1   1 
ATOM   600   O  OP2   . DT  B 2  24   ? 9.848   6.597   30.711  1.00 98.86  ? 24   DT  T OP2   1 
ATOM   601   O  "O5'" . DT  B 2  24   ? 8.688   8.514   31.765  1.00 94.81  ? 24   DT  T "O5'" 1 
ATOM   602   C  "C5'" . DT  B 2  24   ? 8.302   9.734   31.152  1.00 103.41 ? 24   DT  T "C5'" 1 
ATOM   603   C  "C4'" . DT  B 2  24   ? 7.049   10.286  31.804  1.00 100.01 ? 24   DT  T "C4'" 1 
ATOM   604   O  "O4'" . DT  B 2  24   ? 7.003   9.861   33.195  1.00 109.16 ? 24   DT  T "O4'" 1 
ATOM   605   C  "C3'" . DT  B 2  24   ? 6.964   11.806  31.830  1.00 85.56  ? 24   DT  T "C3'" 1 
ATOM   606   O  "O3'" . DT  B 2  24   ? 6.210   12.270  30.721  1.00 87.71  ? 24   DT  T "O3'" 1 
ATOM   607   C  "C2'" . DT  B 2  24   ? 6.246   12.080  33.145  1.00 85.30  ? 24   DT  T "C2'" 1 
ATOM   608   C  "C1'" . DT  B 2  24   ? 6.813   10.982  34.036  1.00 101.20 ? 24   DT  T "C1'" 1 
ATOM   609   N  N1    . DT  B 2  24   ? 8.137   11.327  34.679  1.00 108.03 ? 24   DT  T N1    1 
ATOM   610   C  C2    . DT  B 2  24   ? 8.230   12.416  35.524  1.00 111.98 ? 24   DT  T C2    1 
ATOM   611   O  O2    . DT  B 2  24   ? 7.291   13.146  35.790  1.00 105.02 ? 24   DT  T O2    1 
ATOM   612   N  N3    . DT  B 2  24   ? 9.480   12.624  36.050  1.00 120.42 ? 24   DT  T N3    1 
ATOM   613   C  C4    . DT  B 2  24   ? 10.619  11.870  35.830  1.00 109.43 ? 24   DT  T C4    1 
ATOM   614   O  O4    . DT  B 2  24   ? 11.698  12.140  36.351  1.00 105.02 ? 24   DT  T O4    1 
ATOM   615   C  C5    . DT  B 2  24   ? 10.452  10.746  34.942  1.00 100.82 ? 24   DT  T C5    1 
ATOM   616   C  C7    . DT  B 2  24   ? 11.617  9.856   34.626  1.00 96.97  ? 24   DT  T C7    1 
ATOM   617   C  C6    . DT  B 2  24   ? 9.235   10.529  34.421  1.00 106.26 ? 24   DT  T C6    1 
ATOM   618   P  P     . DC  B 2  25   ? 6.820   13.390  29.742  1.00 98.17  ? 25   DC  T P     1 
ATOM   619   O  OP1   . DC  B 2  25   ? 5.817   13.661  28.689  1.00 92.96  ? 25   DC  T OP1   1 
ATOM   620   O  OP2   . DC  B 2  25   ? 8.185   12.959  29.367  1.00 107.87 ? 25   DC  T OP2   1 
ATOM   621   O  "O5'" . DC  B 2  25   ? 6.953   14.686  30.670  1.00 90.36  ? 25   DC  T "O5'" 1 
ATOM   622   C  "C5'" . DC  B 2  25   ? 5.822   15.176  31.379  1.00 90.70  ? 25   DC  T "C5'" 1 
ATOM   623   C  "C4'" . DC  B 2  25   ? 6.218   16.325  32.285  1.00 97.40  ? 25   DC  T "C4'" 1 
ATOM   624   O  "O4'" . DC  B 2  25   ? 7.191   15.864  33.262  1.00 109.42 ? 25   DC  T "O4'" 1 
ATOM   625   C  "C3'" . DC  B 2  25   ? 6.856   17.512  31.564  1.00 106.56 ? 25   DC  T "C3'" 1 
ATOM   626   O  "O3'" . DC  B 2  25   ? 6.247   18.722  31.986  1.00 109.45 ? 25   DC  T "O3'" 1 
ATOM   627   C  "C2'" . DC  B 2  25   ? 8.330   17.443  31.971  1.00 104.92 ? 25   DC  T "C2'" 1 
ATOM   628   C  "C1'" . DC  B 2  25   ? 8.258   16.780  33.338  1.00 105.13 ? 25   DC  T "C1'" 1 
ATOM   629   N  N1    . DC  B 2  25   ? 9.504   16.033  33.697  1.00 100.19 ? 25   DC  T N1    1 
ATOM   630   C  C2    . DC  B 2  25   ? 10.414  16.589  34.607  1.00 112.38 ? 25   DC  T C2    1 
ATOM   631   O  O2    . DC  B 2  25   ? 10.168  17.690  35.110  1.00 128.10 ? 25   DC  T O2    1 
ATOM   632   N  N3    . DC  B 2  25   ? 11.542  15.898  34.913  1.00 101.16 ? 25   DC  T N3    1 
ATOM   633   C  C4    . DC  B 2  25   ? 11.771  14.711  34.349  1.00 91.45  ? 25   DC  T C4    1 
ATOM   634   N  N4    . DC  B 2  25   ? 12.895  14.067  34.681  1.00 94.06  ? 25   DC  T N4    1 
ATOM   635   C  C5    . DC  B 2  25   ? 10.859  14.133  33.419  1.00 88.26  ? 25   DC  T C5    1 
ATOM   636   C  C6    . DC  B 2  25   ? 9.752   14.821  33.125  1.00 94.16  ? 25   DC  T C6    1 
ATOM   637   P  P     . DG  B 2  26   ? 6.503   20.082  31.170  1.00 109.56 ? 26   DG  T P     1 
ATOM   638   O  OP1   . DG  B 2  26   ? 5.376   20.997  31.460  1.00 98.23  ? 26   DG  T OP1   1 
ATOM   639   O  OP2   . DG  B 2  26   ? 6.828   19.712  29.771  1.00 95.19  ? 26   DG  T OP2   1 
ATOM   640   O  "O5'" . DG  B 2  26   ? 7.802   20.698  31.867  1.00 108.85 ? 26   DG  T "O5'" 1 
ATOM   641   C  "C5'" . DG  B 2  26   ? 7.868   20.778  33.285  1.00 108.91 ? 26   DG  T "C5'" 1 
ATOM   642   C  "C4'" . DG  B 2  26   ? 9.199   21.348  33.733  1.00 112.91 ? 26   DG  T "C4'" 1 
ATOM   643   O  "O4'" . DG  B 2  26   ? 10.106  20.280  34.040  1.00 112.73 ? 26   DG  T "O4'" 1 
ATOM   644   C  "C3'" . DG  B 2  26   ? 9.926   22.170  32.686  1.00 118.38 ? 26   DG  T "C3'" 1 
ATOM   645   O  "O3'" . DG  B 2  26   ? 9.477   23.522  32.745  1.00 116.90 ? 26   DG  T "O3'" 1 
ATOM   646   C  "C2'" . DG  B 2  26   ? 11.400  22.038  33.101  1.00 125.91 ? 26   DG  T "C2'" 1 
ATOM   647   C  "C1'" . DG  B 2  26   ? 11.422  20.783  33.988  1.00 119.98 ? 26   DG  T "C1'" 1 
ATOM   648   N  N9    . DG  B 2  26   ? 12.306  19.729  33.499  1.00 119.19 ? 26   DG  T N9    1 
ATOM   649   C  C8    . DG  B 2  26   ? 11.994  18.730  32.610  1.00 124.30 ? 26   DG  T C8    1 
ATOM   650   N  N7    . DG  B 2  26   ? 12.990  17.924  32.363  1.00 135.22 ? 26   DG  T N7    1 
ATOM   651   C  C5    . DG  B 2  26   ? 14.028  18.421  33.140  1.00 122.83 ? 26   DG  T C5    1 
ATOM   652   C  C6    . DG  B 2  26   ? 15.359  17.962  33.288  1.00 127.33 ? 26   DG  T C6    1 
ATOM   653   O  O6    . DG  B 2  26   ? 15.901  16.991  32.741  1.00 114.77 ? 26   DG  T O6    1 
ATOM   654   N  N1    . DG  B 2  26   ? 16.082  18.756  34.176  1.00 142.00 ? 26   DG  T N1    1 
ATOM   655   C  C2    . DG  B 2  26   ? 15.582  19.854  34.836  1.00 144.63 ? 26   DG  T C2    1 
ATOM   656   N  N2    . DG  B 2  26   ? 16.429  20.496  35.651  1.00 147.83 ? 26   DG  T N2    1 
ATOM   657   N  N3    . DG  B 2  26   ? 14.338  20.293  34.706  1.00 138.64 ? 26   DG  T N3    1 
ATOM   658   C  C4    . DG  B 2  26   ? 13.621  19.531  33.846  1.00 125.74 ? 26   DG  T C4    1 
ATOM   659   P  P     . DA  B 2  27   ? 10.209  24.669  31.889  1.00 114.48 ? 27   DA  T P     1 
ATOM   660   O  OP1   . DA  B 2  27   ? 9.235   25.769  31.717  1.00 123.83 ? 27   DA  T OP1   1 
ATOM   661   O  OP2   . DA  B 2  27   ? 10.837  24.044  30.703  1.00 95.39  ? 27   DA  T OP2   1 
ATOM   662   O  "O5'" . DA  B 2  27   ? 11.369  25.185  32.860  1.00 98.65  ? 27   DA  T "O5'" 1 
ATOM   663   C  "C5'" . DA  B 2  27   ? 12.339  26.094  32.378  1.00 96.79  ? 27   DA  T "C5'" 1 
ATOM   664   C  "C4'" . DA  B 2  27   ? 13.680  25.850  33.041  1.00 95.50  ? 27   DA  T "C4'" 1 
ATOM   665   O  "O4'" . DA  B 2  27   ? 13.951  24.436  33.080  1.00 93.84  ? 27   DA  T "O4'" 1 
ATOM   666   C  "C3'" . DA  B 2  27   ? 14.867  26.478  32.317  1.00 96.64  ? 27   DA  T "C3'" 1 
ATOM   667   O  "O3'" . DA  B 2  27   ? 15.328  27.603  33.029  1.00 97.56  ? 27   DA  T "O3'" 1 
ATOM   668   C  "C2'" . DA  B 2  27   ? 15.935  25.372  32.264  1.00 95.44  ? 27   DA  T "C2'" 1 
ATOM   669   C  "C1'" . DA  B 2  27   ? 15.341  24.252  33.108  1.00 93.69  ? 27   DA  T "C1'" 1 
ATOM   670   N  N9    . DA  B 2  27   ? 15.646  22.925  32.587  1.00 104.93 ? 27   DA  T N9    1 
ATOM   671   C  C8    . DA  B 2  27   ? 14.794  22.077  31.937  1.00 108.16 ? 27   DA  T C8    1 
ATOM   672   N  N7    . DA  B 2  27   ? 15.349  20.945  31.574  1.00 110.97 ? 27   DA  T N7    1 
ATOM   673   C  C5    . DA  B 2  27   ? 16.659  21.062  32.013  1.00 111.21 ? 27   DA  T C5    1 
ATOM   674   C  C6    . DA  B 2  27   ? 17.768  20.196  31.937  1.00 124.72 ? 27   DA  T C6    1 
ATOM   675   N  N6    . DA  B 2  27   ? 17.723  18.990  31.364  1.00 146.74 ? 27   DA  T N6    1 
ATOM   676   N  N1    . DA  B 2  27   ? 18.930  20.619  32.475  1.00 112.56 ? 27   DA  T N1    1 
ATOM   677   C  C2    . DA  B 2  27   ? 18.972  21.826  33.049  1.00 111.33 ? 27   DA  T C2    1 
ATOM   678   N  N3    . DA  B 2  27   ? 17.999  22.727  33.181  1.00 105.48 ? 27   DA  T N3    1 
ATOM   679   C  C4    . DA  B 2  27   ? 16.858  22.277  32.637  1.00 105.82 ? 27   DA  T C4    1 
ATOM   680   P  P     . DT  B 2  28   ? 16.367  28.605  32.332  1.00 108.84 ? 28   DT  T P     1 
ATOM   681   O  OP1   . DT  B 2  28   ? 16.337  29.880  33.082  1.00 104.25 ? 28   DT  T OP1   1 
ATOM   682   O  OP2   . DT  B 2  28   ? 16.070  28.590  30.882  1.00 130.19 ? 28   DT  T OP2   1 
ATOM   683   O  "O5'" . DT  B 2  28   ? 17.789  27.900  32.547  1.00 114.65 ? 28   DT  T "O5'" 1 
ATOM   684   C  "C5'" . DT  B 2  28   ? 18.881  28.231  31.693  1.00 130.51 ? 28   DT  T "C5'" 1 
ATOM   685   C  "C4'" . DT  B 2  28   ? 20.147  27.515  32.126  1.00 121.18 ? 28   DT  T "C4'" 1 
ATOM   686   O  "O4'" . DT  B 2  28   ? 19.862  26.112  32.317  1.00 115.10 ? 28   DT  T "O4'" 1 
ATOM   687   C  "C3'" . DT  B 2  28   ? 21.278  27.552  31.113  1.00 115.21 ? 28   DT  T "C3'" 1 
ATOM   688   O  "O3'" . DT  B 2  28   ? 22.057  28.732  31.293  1.00 104.41 ? 28   DT  T "O3'" 1 
ATOM   689   C  "C2'" . DT  B 2  28   ? 22.078  26.298  31.458  1.00 110.72 ? 28   DT  T "C2'" 1 
ATOM   690   C  "C1'" . DT  B 2  28   ? 21.009  25.342  32.007  1.00 118.42 ? 28   DT  T "C1'" 1 
ATOM   691   N  N1    . DT  B 2  28   ? 20.603  24.254  31.058  1.00 124.99 ? 28   DT  T N1    1 
ATOM   692   C  C2    . DT  B 2  28   ? 21.533  23.320  30.652  1.00 131.74 ? 28   DT  T C2    1 
ATOM   693   O  O2    . DT  B 2  28   ? 22.697  23.327  31.013  1.00 140.25 ? 28   DT  T O2    1 
ATOM   694   N  N3    . DT  B 2  28   ? 21.049  22.369  29.793  1.00 124.87 ? 28   DT  T N3    1 
ATOM   695   C  C4    . DT  B 2  28   ? 19.757  22.253  29.315  1.00 127.72 ? 28   DT  T C4    1 
ATOM   696   O  O4    . DT  B 2  28   ? 19.420  21.360  28.545  1.00 136.21 ? 28   DT  T O4    1 
ATOM   697   C  C5    . DT  B 2  28   ? 18.832  23.257  29.784  1.00 125.67 ? 28   DT  T C5    1 
ATOM   698   C  C7    . DT  B 2  28   ? 17.402  23.234  29.331  1.00 125.00 ? 28   DT  T C7    1 
ATOM   699   C  C6    . DT  B 2  28   ? 19.294  24.196  30.624  1.00 117.88 ? 28   DT  T C6    1 
ATOM   700   P  P     . DC  C 3  2    ? 21.261  13.118  65.251  1.00 216.18 ? 2    DC  N P     1 
ATOM   701   O  OP1   . DC  C 3  2    ? 19.967  12.679  65.819  1.00 217.32 ? 2    DC  N OP1   1 
ATOM   702   O  OP2   . DC  C 3  2    ? 21.457  13.122  63.783  1.00 215.56 ? 2    DC  N OP2   1 
ATOM   703   O  "O5'" . DC  C 3  2    ? 22.431  12.257  65.922  1.00 212.11 ? 2    DC  N "O5'" 1 
ATOM   704   C  "C5'" . DC  C 3  2    ? 22.109  11.120  66.714  1.00 220.07 ? 2    DC  N "C5'" 1 
ATOM   705   C  "C4'" . DC  C 3  2    ? 22.606  9.845   66.056  1.00 228.99 ? 2    DC  N "C4'" 1 
ATOM   706   O  "O4'" . DC  C 3  2    ? 22.482  9.963   64.615  1.00 234.53 ? 2    DC  N "O4'" 1 
ATOM   707   C  "C3'" . DC  C 3  2    ? 24.072  9.530   66.290  1.00 228.66 ? 2    DC  N "C3'" 1 
ATOM   708   O  "O3'" . DC  C 3  2    ? 24.283  8.843   67.568  1.00 219.67 ? 2    DC  N "O3'" 1 
ATOM   709   C  "C2'" . DC  C 3  2    ? 24.418  8.667   65.081  1.00 232.85 ? 2    DC  N "C2'" 1 
ATOM   710   C  "C1'" . DC  C 3  2    ? 23.565  9.299   63.979  1.00 233.91 ? 2    DC  N "C1'" 1 
ATOM   711   N  N1    . DC  C 3  2    ? 24.311  10.288  63.135  1.00 233.74 ? 2    DC  N N1    1 
ATOM   712   C  C2    . DC  C 3  2    ? 25.179  9.833   62.133  1.00 232.44 ? 2    DC  N C2    1 
ATOM   713   O  O2    . DC  C 3  2    ? 25.317  8.616   61.960  1.00 232.99 ? 2    DC  N O2    1 
ATOM   714   N  N3    . DC  C 3  2    ? 25.845  10.744  61.379  1.00 225.85 ? 2    DC  N N3    1 
ATOM   715   C  C4    . DC  C 3  2    ? 25.670  12.049  61.596  1.00 217.20 ? 2    DC  N C4    1 
ATOM   716   N  N4    . DC  C 3  2    ? 26.348  12.908  60.828  1.00 205.76 ? 2    DC  N N4    1 
ATOM   717   C  C5    . DC  C 3  2    ? 24.791  12.530  62.610  1.00 223.45 ? 2    DC  N C5    1 
ATOM   718   C  C6    . DC  C 3  2    ? 24.139  11.624  63.347  1.00 230.24 ? 2    DC  N C6    1 
ATOM   719   P  P     . DA  C 3  3    ? 23.603  7.424   67.941  1.00 199.25 ? 3    DA  N P     1 
ATOM   720   O  OP1   . DA  C 3  3    ? 22.137  7.449   67.752  1.00 198.36 ? 3    DA  N OP1   1 
ATOM   721   O  OP2   . DA  C 3  3    ? 24.134  7.084   69.278  1.00 195.08 ? 3    DA  N OP2   1 
ATOM   722   O  "O5'" . DA  C 3  3    ? 24.253  6.369   66.931  1.00 193.62 ? 3    DA  N "O5'" 1 
ATOM   723   C  "C5'" . DA  C 3  3    ? 25.072  5.321   67.430  1.00 191.70 ? 3    DA  N "C5'" 1 
ATOM   724   C  "C4'" . DA  C 3  3    ? 26.396  5.274   66.691  1.00 189.67 ? 3    DA  N "C4'" 1 
ATOM   725   O  "O4'" . DA  C 3  3    ? 26.513  6.436   65.838  1.00 190.29 ? 3    DA  N "O4'" 1 
ATOM   726   C  "C3'" . DA  C 3  3    ? 27.634  5.266   67.592  1.00 188.22 ? 3    DA  N "C3'" 1 
ATOM   727   O  "O3'" . DA  C 3  3    ? 28.419  4.111   67.333  1.00 186.57 ? 3    DA  N "O3'" 1 
ATOM   728   C  "C2'" . DA  C 3  3    ? 28.381  6.556   67.231  1.00 188.18 ? 3    DA  N "C2'" 1 
ATOM   729   C  "C1'" . DA  C 3  3    ? 27.839  6.893   65.851  1.00 189.03 ? 3    DA  N "C1'" 1 
ATOM   730   N  N9    . DA  C 3  3    ? 27.836  8.330   65.572  1.00 190.34 ? 3    DA  N N9    1 
ATOM   731   C  C8    . DA  C 3  3    ? 27.519  9.334   66.445  1.00 191.76 ? 3    DA  N C8    1 
ATOM   732   N  N7    . DA  C 3  3    ? 27.602  10.536  65.926  1.00 193.02 ? 3    DA  N N7    1 
ATOM   733   C  C5    . DA  C 3  3    ? 28.005  10.309  64.621  1.00 192.36 ? 3    DA  N C5    1 
ATOM   734   C  C6    . DA  C 3  3    ? 28.276  11.179  63.545  1.00 193.30 ? 3    DA  N C6    1 
ATOM   735   N  N6    . DA  C 3  3    ? 28.172  12.510  63.629  1.00 195.22 ? 3    DA  N N6    1 
ATOM   736   N  N1    . DA  C 3  3    ? 28.658  10.627  62.375  1.00 192.45 ? 3    DA  N N1    1 
ATOM   737   C  C2    . DA  C 3  3    ? 28.760  9.295   62.293  1.00 190.77 ? 3    DA  N C2    1 
ATOM   738   N  N3    . DA  C 3  3    ? 28.534  8.376   63.233  1.00 192.03 ? 3    DA  N N3    1 
ATOM   739   C  C4    . DA  C 3  3    ? 28.155  8.954   64.384  1.00 190.68 ? 3    DA  N C4    1 
ATOM   740   P  P     . DG  C 3  4    ? 29.611  3.703   68.331  1.00 185.20 ? 4    DG  N P     1 
ATOM   741   O  OP1   . DG  C 3  4    ? 29.463  2.262   68.632  1.00 184.89 ? 4    DG  N OP1   1 
ATOM   742   O  OP2   . DG  C 3  4    ? 29.651  4.687   69.435  1.00 185.79 ? 4    DG  N OP2   1 
ATOM   743   O  "O5'" . DG  C 3  4    ? 30.922  3.898   67.445  1.00 183.92 ? 4    DG  N "O5'" 1 
ATOM   744   C  "C5'" . DG  C 3  4    ? 31.072  3.144   66.261  1.00 183.45 ? 4    DG  N "C5'" 1 
ATOM   745   C  "C4'" . DG  C 3  4    ? 31.732  3.963   65.171  1.00 183.35 ? 4    DG  N "C4'" 1 
ATOM   746   O  "O4'" . DG  C 3  4    ? 31.155  5.277   65.120  1.00 184.54 ? 4    DG  N "O4'" 1 
ATOM   747   C  "C3'" . DG  C 3  4    ? 33.219  4.217   65.364  1.00 182.43 ? 4    DG  N "C3'" 1 
ATOM   748   O  "O3'" . DG  C 3  4    ? 33.969  3.188   64.731  1.00 181.68 ? 4    DG  N "O3'" 1 
ATOM   749   C  "C2'" . DG  C 3  4    ? 33.446  5.583   64.687  1.00 183.17 ? 4    DG  N "C2'" 1 
ATOM   750   C  "C1'" . DG  C 3  4    ? 32.031  6.078   64.371  1.00 184.51 ? 4    DG  N "C1'" 1 
ATOM   751   N  N9    . DG  C 3  4    ? 31.815  7.484   64.701  1.00 185.70 ? 4    DG  N N9    1 
ATOM   752   C  C8    . DG  C 3  4    ? 31.004  7.998   65.682  1.00 186.66 ? 4    DG  N C8    1 
ATOM   753   N  N7    . DG  C 3  4    ? 31.015  9.302   65.736  1.00 187.88 ? 4    DG  N N7    1 
ATOM   754   C  C5    . DG  C 3  4    ? 31.895  9.674   64.728  1.00 187.69 ? 4    DG  N C5    1 
ATOM   755   C  C6    . DG  C 3  4    ? 32.315  10.958  64.310  1.00 188.90 ? 4    DG  N C6    1 
ATOM   756   O  O6    . DG  C 3  4    ? 31.978  12.061  64.763  1.00 190.40 ? 4    DG  N O6    1 
ATOM   757   N  N1    . DG  C 3  4    ? 33.219  10.885  63.252  1.00 188.54 ? 4    DG  N N1    1 
ATOM   758   C  C2    . DG  C 3  4    ? 33.659  9.716   62.674  1.00 187.20 ? 4    DG  N C2    1 
ATOM   759   N  N2    . DG  C 3  4    ? 34.531  9.840   61.664  1.00 187.35 ? 4    DG  N N2    1 
ATOM   760   N  N3    . DG  C 3  4    ? 33.272  8.510   63.057  1.00 186.06 ? 4    DG  N N3    1 
ATOM   761   C  C4    . DG  C 3  4    ? 32.395  8.565   64.085  1.00 186.37 ? 4    DG  N C4    1 
ATOM   762   P  P     . DC  C 3  5    ? 34.713  2.072   65.614  1.00 180.82 ? 5    DC  N P     1 
ATOM   763   O  OP1   . DC  C 3  5    ? 34.776  0.831   64.811  1.00 180.71 ? 5    DC  N OP1   1 
ATOM   764   O  OP2   . DC  C 3  5    ? 34.061  2.051   66.942  1.00 181.00 ? 5    DC  N OP2   1 
ATOM   765   O  "O5'" . DC  C 3  5    ? 36.194  2.648   65.800  1.00 180.34 ? 5    DC  N "O5'" 1 
ATOM   766   C  "C5'" . DC  C 3  5    ? 37.204  2.345   64.842  1.00 180.25 ? 5    DC  N "C5'" 1 
ATOM   767   C  "C4'" . DC  C 3  5    ? 37.286  3.421   63.772  1.00 180.92 ? 5    DC  N "C4'" 1 
ATOM   768   O  "O4'" . DC  C 3  5    ? 36.374  4.488   64.086  1.00 181.45 ? 5    DC  N "O4'" 1 
ATOM   769   C  "C3'" . DC  C 3  5    ? 38.633  4.104   63.658  1.00 181.06 ? 5    DC  N "C3'" 1 
ATOM   770   O  "O3'" . DC  C 3  5    ? 39.480  3.354   62.805  1.00 181.22 ? 5    DC  N "O3'" 1 
ATOM   771   C  "C2'" . DC  C 3  5    ? 38.280  5.461   63.041  1.00 183.97 ? 5    DC  N "C2'" 1 
ATOM   772   C  "C1'" . DC  C 3  5    ? 36.824  5.679   63.470  1.00 188.44 ? 5    DC  N "C1'" 1 
ATOM   773   N  N1    . DC  C 3  5    ? 36.635  6.815   64.426  1.00 190.59 ? 5    DC  N N1    1 
ATOM   774   C  C2    . DC  C 3  5    ? 36.450  8.111   63.931  1.00 187.23 ? 5    DC  N C2    1 
ATOM   775   O  O2    . DC  C 3  5    ? 36.455  8.296   62.708  1.00 189.31 ? 5    DC  N O2    1 
ATOM   776   N  N3    . DC  C 3  5    ? 36.273  9.130   64.809  1.00 184.39 ? 5    DC  N N3    1 
ATOM   777   C  C4    . DC  C 3  5    ? 36.273  8.889   66.120  1.00 183.67 ? 5    DC  N C4    1 
ATOM   778   N  N4    . DC  C 3  5    ? 36.093  9.924   66.945  1.00 184.40 ? 5    DC  N N4    1 
ATOM   779   C  C5    . DC  C 3  5    ? 36.457  7.576   66.644  1.00 182.38 ? 5    DC  N C5    1 
ATOM   780   C  C6    . DC  C 3  5    ? 36.632  6.578   65.770  1.00 182.77 ? 5    DC  N C6    1 
ATOM   781   P  P     . DG  C 3  6    ? 41.032  3.172   63.173  1.00 181.62 ? 6    DG  N P     1 
ATOM   782   O  OP1   . DG  C 3  6    ? 41.647  2.318   62.134  1.00 186.74 ? 6    DG  N OP1   1 
ATOM   783   O  OP2   . DG  C 3  6    ? 41.112  2.789   64.601  1.00 180.79 ? 6    DG  N OP2   1 
ATOM   784   O  "O5'" . DG  C 3  6    ? 41.632  4.643   63.034  1.00 182.31 ? 6    DG  N "O5'" 1 
ATOM   785   C  "C5'" . DG  C 3  6    ? 41.581  5.317   61.785  1.00 183.43 ? 6    DG  N "C5'" 1 
ATOM   786   C  "C4'" . DG  C 3  6    ? 42.087  6.736   61.933  1.00 185.32 ? 6    DG  N "C4'" 1 
ATOM   787   O  "O4'" . DG  C 3  6    ? 41.181  7.486   62.787  1.00 183.94 ? 6    DG  N "O4'" 1 
ATOM   788   C  "C3'" . DG  C 3  6    ? 43.467  6.854   62.581  1.00 189.90 ? 6    DG  N "C3'" 1 
ATOM   789   O  "O3'" . DG  C 3  6    ? 44.206  7.888   61.959  1.00 200.54 ? 6    DG  N "O3'" 1 
ATOM   790   C  "C2'" . DG  C 3  6    ? 43.132  7.207   64.025  1.00 183.29 ? 6    DG  N "C2'" 1 
ATOM   791   C  "C1'" . DG  C 3  6    ? 41.917  8.091   63.826  1.00 183.76 ? 6    DG  N "C1'" 1 
ATOM   792   N  N9    . DG  C 3  6    ? 41.073  8.196   65.009  1.00 183.01 ? 6    DG  N N9    1 
ATOM   793   C  C8    . DG  C 3  6    ? 40.670  7.175   65.836  1.00 181.89 ? 6    DG  N C8    1 
ATOM   794   N  N7    . DG  C 3  6    ? 39.921  7.574   66.826  1.00 181.73 ? 6    DG  N N7    1 
ATOM   795   C  C5    . DG  C 3  6    ? 39.824  8.948   66.644  1.00 182.80 ? 6    DG  N C5    1 
ATOM   796   C  C6    . DG  C 3  6    ? 39.140  9.924   67.406  1.00 194.61 ? 6    DG  N C6    1 
ATOM   797   O  O6    . DG  C 3  6    ? 38.458  9.760   68.428  1.00 193.60 ? 6    DG  N O6    1 
ATOM   798   N  N1    . DG  C 3  6    ? 39.301  11.201  66.872  1.00 207.80 ? 6    DG  N N1    1 
ATOM   799   C  C2    . DG  C 3  6    ? 40.033  11.496  65.745  1.00 210.68 ? 6    DG  N C2    1 
ATOM   800   N  N2    . DG  C 3  6    ? 40.076  12.785  65.382  1.00 214.31 ? 6    DG  N N2    1 
ATOM   801   N  N3    . DG  C 3  6    ? 40.678  10.591  65.025  1.00 201.31 ? 6    DG  N N3    1 
ATOM   802   C  C4    . DG  C 3  6    ? 40.530  9.344   65.531  1.00 184.96 ? 6    DG  N C4    1 
ATOM   803   P  P     . DA  C 3  7    ? 45.792  7.993   62.185  1.00 209.11 ? 7    DA  N P     1 
ATOM   804   O  OP1   . DA  C 3  7    ? 46.418  6.847   61.490  1.00 214.38 ? 7    DA  N OP1   1 
ATOM   805   O  OP2   . DA  C 3  7    ? 46.048  8.207   63.628  1.00 208.10 ? 7    DA  N OP2   1 
ATOM   806   O  "O5'" . DA  C 3  7    ? 46.190  9.345   61.437  1.00 210.00 ? 7    DA  N "O5'" 1 
ATOM   807   C  "C5'" . DA  C 3  7    ? 46.963  10.313  62.114  1.00 204.73 ? 7    DA  N "C5'" 1 
ATOM   808   C  "C4'" . DA  C 3  7    ? 46.098  11.439  62.643  1.00 203.88 ? 7    DA  N "C4'" 1 
ATOM   809   O  "O4'" . DA  C 3  7    ? 44.839  10.930  63.148  1.00 201.67 ? 7    DA  N "O4'" 1 
ATOM   810   C  "C3'" . DA  C 3  7    ? 46.658  12.168  63.835  1.00 203.23 ? 7    DA  N "C3'" 1 
ATOM   811   O  "O3'" . DA  C 3  7    ? 47.710  13.029  63.450  1.00 202.86 ? 7    DA  N "O3'" 1 
ATOM   812   C  "C2'" . DA  C 3  7    ? 45.422  12.930  64.285  1.00 204.99 ? 7    DA  N "C2'" 1 
ATOM   813   C  "C1'" . DA  C 3  7    ? 44.348  11.850  64.124  1.00 203.22 ? 7    DA  N "C1'" 1 
ATOM   814   N  N9    . DA  C 3  7    ? 44.072  11.140  65.372  1.00 202.91 ? 7    DA  N N9    1 
ATOM   815   C  C8    . DA  C 3  7    ? 44.455  9.872   65.711  1.00 198.92 ? 7    DA  N C8    1 
ATOM   816   N  N7    . DA  C 3  7    ? 44.071  9.508   66.914  1.00 199.47 ? 7    DA  N N7    1 
ATOM   817   C  C5    . DA  C 3  7    ? 43.399  10.619  67.399  1.00 200.06 ? 7    DA  N C5    1 
ATOM   818   C  C6    . DA  C 3  7    ? 42.748  10.881  68.623  1.00 206.75 ? 7    DA  N C6    1 
ATOM   819   N  N6    . DA  C 3  7    ? 42.671  9.995   69.622  1.00 212.42 ? 7    DA  N N6    1 
ATOM   820   N  N1    . DA  C 3  7    ? 42.179  12.094  68.782  1.00 204.90 ? 7    DA  N N1    1 
ATOM   821   C  C2    . DA  C 3  7    ? 42.259  12.980  67.783  1.00 204.56 ? 7    DA  N C2    1 
ATOM   822   N  N3    . DA  C 3  7    ? 42.839  12.849  66.592  1.00 204.42 ? 7    DA  N N3    1 
ATOM   823   C  C4    . DA  C 3  7    ? 43.396  11.634  66.463  1.00 201.79 ? 7    DA  N C4    1 
ATOM   824   P  P     . DG  C 3  8    ? 48.919  13.301  64.473  1.00 208.92 ? 8    DG  N P     1 
ATOM   825   O  OP1   . DG  C 3  8    ? 50.176  12.861  63.828  1.00 209.67 ? 8    DG  N OP1   1 
ATOM   826   O  OP2   . DG  C 3  8    ? 48.529  12.731  65.783  1.00 206.72 ? 8    DG  N OP2   1 
ATOM   827   O  "O5'" . DG  C 3  8    ? 48.935  14.891  64.621  1.00 210.67 ? 8    DG  N "O5'" 1 
ATOM   828   C  "C5'" . DG  C 3  8    ? 47.728  15.623  64.473  1.00 209.26 ? 8    DG  N "C5'" 1 
ATOM   829   C  "C4'" . DG  C 3  8    ? 47.170  16.040  65.823  1.00 202.85 ? 8    DG  N "C4'" 1 
ATOM   830   O  "O4'" . DG  C 3  8    ? 46.506  14.935  66.460  1.00 194.93 ? 8    DG  N "O4'" 1 
ATOM   831   C  "C3'" . DG  C 3  8    ? 48.205  16.517  66.842  1.00 210.49 ? 8    DG  N "C3'" 1 
ATOM   832   O  "O3'" . DG  C 3  8    ? 48.248  17.943  66.847  1.00 218.67 ? 8    DG  N "O3'" 1 
ATOM   833   C  "C2'" . DG  C 3  8    ? 47.701  15.945  68.187  1.00 201.12 ? 8    DG  N "C2'" 1 
ATOM   834   C  "C1'" . DG  C 3  8    ? 46.385  15.268  67.814  1.00 194.14 ? 8    DG  N "C1'" 1 
ATOM   835   N  N9    . DG  C 3  8    ? 46.098  14.064  68.592  1.00 192.06 ? 8    DG  N N9    1 
ATOM   836   C  C8    . DG  C 3  8    ? 46.694  12.831  68.477  1.00 191.02 ? 8    DG  N C8    1 
ATOM   837   N  N7    . DG  C 3  8    ? 46.227  11.949  69.319  1.00 189.48 ? 8    DG  N N7    1 
ATOM   838   C  C5    . DG  C 3  8    ? 45.260  12.644  70.038  1.00 191.00 ? 8    DG  N C5    1 
ATOM   839   C  C6    . DG  C 3  8    ? 44.415  12.212  71.089  1.00 202.52 ? 8    DG  N C6    1 
ATOM   840   O  O6    . DG  C 3  8    ? 44.348  11.090  71.611  1.00 200.25 ? 8    DG  N O6    1 
ATOM   841   N  N1    . DG  C 3  8    ? 43.581  13.237  71.533  1.00 208.98 ? 8    DG  N N1    1 
ATOM   842   C  C2    . DG  C 3  8    ? 43.570  14.516  71.028  1.00 209.72 ? 8    DG  N C2    1 
ATOM   843   N  N2    . DG  C 3  8    ? 42.700  15.371  71.586  1.00 211.97 ? 8    DG  N N2    1 
ATOM   844   N  N3    . DG  C 3  8    ? 44.356  14.930  70.045  1.00 203.96 ? 8    DG  N N3    1 
ATOM   845   C  C4    . DG  C 3  8    ? 45.172  13.946  69.601  1.00 192.99 ? 8    DG  N C4    1 
ATOM   846   P  P     . DA  C 3  9    ? 48.943  18.744  68.056  1.00 215.60 ? 9    DA  N P     1 
ATOM   847   O  OP1   . DA  C 3  9    ? 49.266  20.096  67.549  1.00 213.53 ? 9    DA  N OP1   1 
ATOM   848   O  OP2   . DA  C 3  9    ? 50.024  17.908  68.627  1.00 213.93 ? 9    DA  N OP2   1 
ATOM   849   O  "O5'" . DA  C 3  9    ? 47.776  18.875  69.140  1.00 217.53 ? 9    DA  N "O5'" 1 
ATOM   850   C  "C5'" . DA  C 3  9    ? 48.096  19.099  70.496  1.00 222.63 ? 9    DA  N "C5'" 1 
ATOM   851   C  "C4'" . DA  C 3  9    ? 46.944  18.697  71.395  1.00 223.40 ? 9    DA  N "C4'" 1 
ATOM   852   O  "O4'" . DA  C 3  9    ? 46.522  17.357  71.068  1.00 219.66 ? 9    DA  N "O4'" 1 
ATOM   853   C  "C3'" . DA  C 3  9    ? 47.288  18.643  72.868  1.00 231.73 ? 9    DA  N "C3'" 1 
ATOM   854   O  "O3'" . DA  C 3  9    ? 47.147  19.937  73.443  1.00 251.68 ? 9    DA  N "O3'" 1 
ATOM   855   C  "C2'" . DA  C 3  9    ? 46.251  17.662  73.416  1.00 224.17 ? 9    DA  N "C2'" 1 
ATOM   856   C  "C1'" . DA  C 3  9    ? 46.001  16.727  72.225  1.00 226.91 ? 9    DA  N "C1'" 1 
ATOM   857   N  N9    . DA  C 3  9    ? 46.619  15.406  72.359  1.00 242.13 ? 9    DA  N N9    1 
ATOM   858   C  C8    . DA  C 3  9    ? 47.779  14.975  71.777  1.00 244.48 ? 9    DA  N C8    1 
ATOM   859   N  N7    . DA  C 3  9    ? 48.089  13.732  72.070  1.00 245.02 ? 9    DA  N N7    1 
ATOM   860   C  C5    . DA  C 3  9    ? 47.058  13.319  72.898  1.00 240.70 ? 9    DA  N C5    1 
ATOM   861   C  C6    . DA  C 3  9    ? 46.796  12.097  73.552  1.00 239.03 ? 9    DA  N C6    1 
ATOM   862   N  N6    . DA  C 3  9    ? 47.593  11.027  73.463  1.00 233.95 ? 9    DA  N N6    1 
ATOM   863   N  N1    . DA  C 3  9    ? 45.679  12.019  74.305  1.00 241.72 ? 9    DA  N N1    1 
ATOM   864   C  C2    . DA  C 3  9    ? 44.883  13.092  74.393  1.00 242.46 ? 9    DA  N C2    1 
ATOM   865   N  N3    . DA  C 3  9    ? 45.025  14.289  73.827  1.00 242.15 ? 9    DA  N N3    1 
ATOM   866   C  C4    . DA  C 3  9    ? 46.143  14.338  73.086  1.00 242.84 ? 9    DA  N C4    1 
ATOM   867   P  P     . DG  C 3  10   ? 48.434  20.882  73.634  1.00 265.70 ? 10   DG  N P     1 
ATOM   868   O  OP1   . DG  C 3  10   ? 48.111  22.198  73.039  1.00 271.38 ? 10   DG  N OP1   1 
ATOM   869   O  OP2   . DG  C 3  10   ? 49.621  20.133  73.166  1.00 270.42 ? 10   DG  N OP2   1 
ATOM   870   O  "O5'" . DG  C 3  10   ? 48.558  21.053  75.219  1.00 264.23 ? 10   DG  N "O5'" 1 
ATOM   871   C  "C5'" . DG  C 3  10   ? 47.507  21.671  75.949  1.00 262.22 ? 10   DG  N "C5'" 1 
ATOM   872   C  "C4'" . DG  C 3  10   ? 46.722  20.642  76.743  1.00 260.90 ? 10   DG  N "C4'" 1 
ATOM   873   O  "O4'" . DG  C 3  10   ? 46.829  19.342  76.095  1.00 265.69 ? 10   DG  N "O4'" 1 
ATOM   874   C  "C3'" . DG  C 3  10   ? 47.212  20.414  78.166  1.00 254.66 ? 10   DG  N "C3'" 1 
ATOM   875   O  "O3'" . DG  C 3  10   ? 46.118  19.973  78.974  1.00 250.95 ? 10   DG  N "O3'" 1 
ATOM   876   C  "C2'" . DG  C 3  10   ? 48.239  19.310  77.959  1.00 256.90 ? 10   DG  N "C2'" 1 
ATOM   877   C  "C1'" . DG  C 3  10   ? 47.495  18.440  76.959  1.00 262.28 ? 10   DG  N "C1'" 1 
ATOM   878   N  N9    . DG  C 3  10   ? 48.361  17.569  76.166  1.00 258.60 ? 10   DG  N N9    1 
ATOM   879   C  C8    . DG  C 3  10   ? 49.415  17.945  75.369  1.00 257.90 ? 10   DG  N C8    1 
ATOM   880   N  N7    . DG  C 3  10   ? 50.003  16.942  74.777  1.00 256.97 ? 10   DG  N N7    1 
ATOM   881   C  C5    . DG  C 3  10   ? 49.297  15.828  75.213  1.00 253.35 ? 10   DG  N C5    1 
ATOM   882   C  C6    . DG  C 3  10   ? 49.476  14.457  74.910  1.00 239.83 ? 10   DG  N C6    1 
ATOM   883   O  O6    . DG  C 3  10   ? 50.325  13.938  74.171  1.00 231.76 ? 10   DG  N O6    1 
ATOM   884   N  N1    . DG  C 3  10   ? 48.543  13.659  75.566  1.00 234.68 ? 10   DG  N N1    1 
ATOM   885   C  C2    . DG  C 3  10   ? 47.560  14.126  76.406  1.00 234.75 ? 10   DG  N C2    1 
ATOM   886   N  N2    . DG  C 3  10   ? 46.753  13.203  76.948  1.00 231.19 ? 10   DG  N N2    1 
ATOM   887   N  N3    . DG  C 3  10   ? 47.382  15.406  76.699  1.00 243.64 ? 10   DG  N N3    1 
ATOM   888   C  C4    . DG  C 3  10   ? 48.283  16.198  76.069  1.00 254.21 ? 10   DG  N C4    1 
ATOM   889   P  P     . DA  C 3  11   ? 46.372  19.291  80.407  1.00 246.75 ? 11   DA  N P     1 
ATOM   890   O  OP1   . DA  C 3  11   ? 45.076  19.284  81.122  1.00 245.18 ? 11   DA  N OP1   1 
ATOM   891   O  OP2   . DA  C 3  11   ? 47.554  19.931  81.025  1.00 245.93 ? 11   DA  N OP2   1 
ATOM   892   O  "O5'" . DA  C 3  11   ? 46.752  17.778  80.053  1.00 250.95 ? 11   DA  N "O5'" 1 
ATOM   893   C  "C5'" . DA  C 3  11   ? 45.736  16.800  79.914  1.00 251.23 ? 11   DA  N "C5'" 1 
ATOM   894   C  "C4'" . DA  C 3  11   ? 45.917  15.691  80.936  1.00 252.42 ? 11   DA  N "C4'" 1 
ATOM   895   O  "O4'" . DA  C 3  11   ? 46.883  14.729  80.450  1.00 248.98 ? 11   DA  N "O4'" 1 
ATOM   896   C  "C3'" . DA  C 3  11   ? 46.430  16.140  82.295  1.00 253.37 ? 11   DA  N "C3'" 1 
ATOM   897   O  "O3'" . DA  C 3  11   ? 45.907  15.298  83.303  1.00 244.12 ? 11   DA  N "O3'" 1 
ATOM   898   C  "C2'" . DA  C 3  11   ? 47.947  15.989  82.165  1.00 253.57 ? 11   DA  N "C2'" 1 
ATOM   899   C  "C1'" . DA  C 3  11   ? 48.094  14.834  81.175  1.00 250.81 ? 11   DA  N "C1'" 1 
ATOM   900   N  N9    . DA  C 3  11   ? 49.179  15.027  80.218  1.00 251.50 ? 11   DA  N N9    1 
ATOM   901   C  C8    . DA  C 3  11   ? 49.955  16.142  80.060  1.00 252.15 ? 11   DA  N C8    1 
ATOM   902   N  N7    . DA  C 3  11   ? 50.856  16.030  79.112  1.00 251.63 ? 11   DA  N N7    1 
ATOM   903   C  C5    . DA  C 3  11   ? 50.654  14.754  78.613  1.00 251.79 ? 11   DA  N C5    1 
ATOM   904   C  C6    . DA  C 3  11   ? 51.288  14.022  77.589  1.00 252.04 ? 11   DA  N C6    1 
ATOM   905   N  N6    . DA  C 3  11   ? 52.298  14.502  76.856  1.00 250.35 ? 11   DA  N N6    1 
ATOM   906   N  N1    . DA  C 3  11   ? 50.840  12.773  77.347  1.00 253.45 ? 11   DA  N N1    1 
ATOM   907   C  C2    . DA  C 3  11   ? 49.830  12.296  78.084  1.00 252.47 ? 11   DA  N C2    1 
ATOM   908   N  N3    . DA  C 3  11   ? 49.157  12.887  79.067  1.00 250.09 ? 11   DA  N N3    1 
ATOM   909   C  C4    . DA  C 3  11   ? 49.623  14.124  79.284  1.00 251.88 ? 11   DA  N C4    1 
ATOM   910   P  P     . DG  C 3  12   ? 45.949  15.747  84.845  1.00 226.35 ? 12   DG  N P     1 
ATOM   911   O  OP1   . DG  C 3  12   ? 44.552  15.952  85.287  1.00 214.29 ? 12   DG  N OP1   1 
ATOM   912   O  OP2   . DG  C 3  12   ? 46.930  16.845  84.994  1.00 212.26 ? 12   DG  N OP2   1 
ATOM   913   O  "O5'" . DG  C 3  12   ? 46.534  14.457  85.581  1.00 213.69 ? 12   DG  N "O5'" 1 
ATOM   914   C  "C5'" . DG  C 3  12   ? 46.017  13.174  85.261  1.00 200.27 ? 12   DG  N "C5'" 1 
ATOM   915   C  "C4'" . DG  C 3  12   ? 47.065  12.102  85.483  1.00 193.20 ? 12   DG  N "C4'" 1 
ATOM   916   O  "O4'" . DG  C 3  12   ? 47.924  12.000  84.317  1.00 188.55 ? 12   DG  N "O4'" 1 
ATOM   917   C  "C3'" . DG  C 3  12   ? 47.996  12.348  86.676  1.00 198.44 ? 12   DG  N "C3'" 1 
ATOM   918   O  "O3'" . DG  C 3  12   ? 48.108  11.163  87.443  1.00 204.31 ? 12   DG  N "O3'" 1 
ATOM   919   C  "C2'" . DG  C 3  12   ? 49.325  12.712  86.014  1.00 193.26 ? 12   DG  N "C2'" 1 
ATOM   920   C  "C1'" . DG  C 3  12   ? 49.252  11.874  84.754  1.00 187.62 ? 12   DG  N "C1'" 1 
ATOM   921   N  N9    . DG  C 3  12   ? 50.149  12.318  83.693  1.00 188.20 ? 12   DG  N N9    1 
ATOM   922   C  C8    . DG  C 3  12   ? 50.499  13.609  83.383  1.00 191.44 ? 12   DG  N C8    1 
ATOM   923   N  N7    . DG  C 3  12   ? 51.329  13.694  82.379  1.00 194.00 ? 12   DG  N N7    1 
ATOM   924   C  C5    . DG  C 3  12   ? 51.542  12.374  82.003  1.00 193.52 ? 12   DG  N C5    1 
ATOM   925   C  C6    . DG  C 3  12   ? 52.349  11.835  80.972  1.00 196.59 ? 12   DG  N C6    1 
ATOM   926   O  O6    . DG  C 3  12   ? 53.061  12.439  80.157  1.00 196.63 ? 12   DG  N O6    1 
ATOM   927   N  N1    . DG  C 3  12   ? 52.278  10.445  80.937  1.00 200.31 ? 12   DG  N N1    1 
ATOM   928   C  C2    . DG  C 3  12   ? 51.523  9.675   81.790  1.00 202.55 ? 12   DG  N C2    1 
ATOM   929   N  N2    . DG  C 3  12   ? 51.582  8.350   81.605  1.00 202.84 ? 12   DG  N N2    1 
ATOM   930   N  N3    . DG  C 3  12   ? 50.765  10.167  82.757  1.00 201.14 ? 12   DG  N N3    1 
ATOM   931   C  C4    . DG  C 3  12   ? 50.823  11.517  82.804  1.00 192.87 ? 12   DG  N C4    1 
ATOM   932   P  P     . DA  C 3  13   ? 48.524  11.232  88.993  1.00 210.12 ? 13   DA  N P     1 
ATOM   933   O  OP1   . DA  C 3  13   ? 47.294  11.046  89.794  1.00 206.50 ? 13   DA  N OP1   1 
ATOM   934   O  OP2   . DA  C 3  13   ? 49.360  12.437  89.194  1.00 203.72 ? 13   DA  N OP2   1 
ATOM   935   O  "O5'" . DA  C 3  13   ? 49.456  9.948   89.184  1.00 210.23 ? 13   DA  N "O5'" 1 
ATOM   936   C  "C5'" . DA  C 3  13   ? 49.001  8.677   88.740  1.00 210.23 ? 13   DA  N "C5'" 1 
ATOM   937   C  "C4'" . DA  C 3  13   ? 50.108  7.927   88.022  1.00 211.73 ? 13   DA  N "C4'" 1 
ATOM   938   O  "O4'" . DA  C 3  13   ? 50.632  8.747   86.941  1.00 203.73 ? 13   DA  N "O4'" 1 
ATOM   939   C  "C3'" . DA  C 3  13   ? 51.312  7.559   88.893  1.00 219.94 ? 13   DA  N "C3'" 1 
ATOM   940   O  "O3'" . DA  C 3  13   ? 51.773  6.258   88.550  1.00 240.24 ? 13   DA  N "O3'" 1 
ATOM   941   C  "C2'" . DA  C 3  13   ? 52.334  8.628   88.523  1.00 208.99 ? 13   DA  N "C2'" 1 
ATOM   942   C  "C1'" . DA  C 3  13   ? 52.035  8.802   87.046  1.00 201.96 ? 13   DA  N "C1'" 1 
ATOM   943   N  N9    . DA  C 3  13   ? 52.502  10.068  86.493  1.00 194.42 ? 13   DA  N N9    1 
ATOM   944   C  C8    . DA  C 3  13   ? 52.274  11.324  86.984  1.00 193.29 ? 13   DA  N C8    1 
ATOM   945   N  N7    . DA  C 3  13   ? 52.825  12.278  86.269  1.00 193.33 ? 13   DA  N N7    1 
ATOM   946   C  C5    . DA  C 3  13   ? 53.457  11.599  85.242  1.00 194.48 ? 13   DA  N C5    1 
ATOM   947   C  C6    . DA  C 3  13   ? 54.224  12.035  84.144  1.00 191.96 ? 13   DA  N C6    1 
ATOM   948   N  N6    . DA  C 3  13   ? 54.490  13.321  83.895  1.00 188.56 ? 13   DA  N N6    1 
ATOM   949   N  N1    . DA  C 3  13   ? 54.707  11.094  83.309  1.00 197.43 ? 13   DA  N N1    1 
ATOM   950   C  C2    . DA  C 3  13   ? 54.437  9.808   83.561  1.00 193.62 ? 13   DA  N C2    1 
ATOM   951   N  N3    . DA  C 3  13   ? 53.732  9.279   84.555  1.00 191.36 ? 13   DA  N N3    1 
ATOM   952   C  C4    . DA  C 3  13   ? 53.266  10.237  85.367  1.00 193.75 ? 13   DA  N C4    1 
ATOM   953   P  P     . DG  C 3  14   ? 52.541  5.355   89.635  1.00 252.84 ? 14   DG  N P     1 
ATOM   954   O  OP1   . DG  C 3  14   ? 52.260  3.937   89.321  1.00 262.30 ? 14   DG  N OP1   1 
ATOM   955   O  OP2   . DG  C 3  14   ? 52.214  5.887   90.977  1.00 252.91 ? 14   DG  N OP2   1 
ATOM   956   O  "O5'" . DG  C 3  14   ? 54.086  5.652   89.353  1.00 248.88 ? 14   DG  N "O5'" 1 
ATOM   957   C  "C5'" . DG  C 3  14   ? 55.008  4.578   89.238  1.00 245.22 ? 14   DG  N "C5'" 1 
ATOM   958   C  "C4'" . DG  C 3  14   ? 55.152  4.132   87.791  1.00 241.99 ? 14   DG  N "C4'" 1 
ATOM   959   O  "O4'" . DG  C 3  14   ? 54.462  5.065   86.922  1.00 241.67 ? 14   DG  N "O4'" 1 
ATOM   960   C  "C3'" . DG  C 3  14   ? 56.593  4.049   87.295  1.00 238.71 ? 14   DG  N "C3'" 1 
ATOM   961   O  "O3'" . DG  C 3  14   ? 57.025  2.685   87.287  1.00 236.96 ? 14   DG  N "O3'" 1 
ATOM   962   C  "C2'" . DG  C 3  14   ? 56.535  4.626   85.879  1.00 237.23 ? 14   DG  N "C2'" 1 
ATOM   963   C  "C1'" . DG  C 3  14   ? 55.343  5.575   85.947  1.00 239.33 ? 14   DG  N "C1'" 1 
ATOM   964   N  N9    . DG  C 3  14   ? 55.683  6.949   86.309  1.00 241.51 ? 14   DG  N N9    1 
ATOM   965   C  C8    . DG  C 3  14   ? 55.335  7.606   87.463  1.00 238.58 ? 14   DG  N C8    1 
ATOM   966   N  N7    . DG  C 3  14   ? 55.763  8.835   87.514  1.00 237.94 ? 14   DG  N N7    1 
ATOM   967   C  C5    . DG  C 3  14   ? 56.437  9.007   86.314  1.00 240.47 ? 14   DG  N C5    1 
ATOM   968   C  C6    . DG  C 3  14   ? 57.116  10.138  85.809  1.00 240.34 ? 14   DG  N C6    1 
ATOM   969   O  O6    . DG  C 3  14   ? 57.258  11.248  86.341  1.00 238.40 ? 14   DG  N O6    1 
ATOM   970   N  N1    . DG  C 3  14   ? 57.664  9.890   84.554  1.00 241.12 ? 14   DG  N N1    1 
ATOM   971   C  C2    . DG  C 3  14   ? 57.569  8.698   83.875  1.00 239.11 ? 14   DG  N C2    1 
ATOM   972   N  N2    . DG  C 3  14   ? 58.162  8.649   82.674  1.00 236.44 ? 14   DG  N N2    1 
ATOM   973   N  N3    . DG  C 3  14   ? 56.934  7.630   84.338  1.00 240.08 ? 14   DG  N N3    1 
ATOM   974   C  C4    . DG  C 3  14   ? 56.396  7.856   85.559  1.00 241.75 ? 14   DG  N C4    1 
ATOM   975   P  P     . DA  C 3  15   ? 57.486  1.968   88.652  1.00 234.43 ? 15   DA  N P     1 
ATOM   976   O  OP1   . DA  C 3  15   ? 58.420  0.878   88.290  1.00 235.47 ? 15   DA  N OP1   1 
ATOM   977   O  OP2   . DA  C 3  15   ? 56.274  1.628   89.429  1.00 236.01 ? 15   DA  N OP2   1 
ATOM   978   O  "O5'" . DA  C 3  15   ? 58.268  3.118   89.442  1.00 236.15 ? 15   DA  N "O5'" 1 
ATOM   979   C  "C5'" . DA  C 3  15   ? 59.692  3.113   89.501  1.00 235.31 ? 15   DA  N "C5'" 1 
ATOM   980   C  "C4'" . DA  C 3  15   ? 60.302  3.349   88.129  1.00 232.78 ? 15   DA  N "C4'" 1 
ATOM   981   O  "O4'" . DA  C 3  15   ? 59.688  4.514   87.514  1.00 230.80 ? 15   DA  N "O4'" 1 
ATOM   982   C  "C3'" . DA  C 3  15   ? 61.803  3.623   88.142  1.00 234.67 ? 15   DA  N "C3'" 1 
ATOM   983   O  "O3'" . DA  C 3  15   ? 62.420  3.038   87.005  1.00 230.13 ? 15   DA  N "O3'" 1 
ATOM   984   C  "C2'" . DA  C 3  15   ? 61.866  5.142   88.090  1.00 238.11 ? 15   DA  N "C2'" 1 
ATOM   985   C  "C1'" . DA  C 3  15   ? 60.683  5.461   87.191  1.00 233.66 ? 15   DA  N "C1'" 1 
ATOM   986   N  N9    . DA  C 3  15   ? 60.147  6.798   87.413  1.00 227.63 ? 15   DA  N N9    1 
ATOM   987   C  C8    . DA  C 3  15   ? 59.036  7.133   88.134  1.00 225.49 ? 15   DA  N C8    1 
ATOM   988   N  N7    . DA  C 3  15   ? 58.801  8.423   88.174  1.00 223.94 ? 15   DA  N N7    1 
ATOM   989   C  C5    . DA  C 3  15   ? 59.832  8.971   87.428  1.00 225.41 ? 15   DA  N C5    1 
ATOM   990   C  C6    . DA  C 3  15   ? 60.156  10.299  87.088  1.00 227.60 ? 15   DA  N C6    1 
ATOM   991   N  N6    . DA  C 3  15   ? 59.435  11.355  87.475  1.00 229.00 ? 15   DA  N N6    1 
ATOM   992   N  N1    . DA  C 3  15   ? 61.255  10.500  86.331  1.00 226.37 ? 15   DA  N N1    1 
ATOM   993   C  C2    . DA  C 3  15   ? 61.975  9.441   85.945  1.00 222.28 ? 15   DA  N C2    1 
ATOM   994   N  N3    . DA  C 3  15   ? 61.770  8.150   86.202  1.00 220.86 ? 15   DA  N N3    1 
ATOM   995   C  C4    . DA  C 3  15   ? 60.672  7.983   86.956  1.00 224.43 ? 15   DA  N C4    1 
ATOM   996   P  P     . DA  C 3  16   ? 63.981  2.658   87.048  1.00 226.11 ? 16   DA  N P     1 
ATOM   997   O  OP1   . DA  C 3  16   ? 64.305  1.947   85.792  1.00 225.20 ? 16   DA  N OP1   1 
ATOM   998   O  OP2   . DA  C 3  16   ? 64.236  2.001   88.350  1.00 223.76 ? 16   DA  N OP2   1 
ATOM   999   O  "O5'" . DA  C 3  16   ? 64.727  4.077   87.053  1.00 226.12 ? 16   DA  N "O5'" 1 
ATOM   1000  C  "C5'" . DA  C 3  16   ? 64.643  4.935   85.915  1.00 219.59 ? 16   DA  N "C5'" 1 
ATOM   1001  C  "C4'" . DA  C 3  16   ? 65.378  6.245   86.160  1.00 212.97 ? 16   DA  N "C4'" 1 
ATOM   1002  O  "O4'" . DA  C 3  16   ? 64.484  7.214   86.733  1.00 212.56 ? 16   DA  N "O4'" 1 
ATOM   1003  C  "C3'" . DA  C 3  16   ? 66.541  6.162   87.144  1.00 204.62 ? 16   DA  N "C3'" 1 
ATOM   1004  O  "O3'" . DA  C 3  16   ? 67.761  5.968   86.439  1.00 196.27 ? 16   DA  N "O3'" 1 
ATOM   1005  C  "C2'" . DA  C 3  16   ? 66.518  7.522   87.874  1.00 205.14 ? 16   DA  N "C2'" 1 
ATOM   1006  C  "C1'" . DA  C 3  16   ? 65.269  8.219   87.322  1.00 211.35 ? 16   DA  N "C1'" 1 
ATOM   1007  N  N9    . DA  C 3  16   ? 64.478  8.912   88.342  1.00 212.35 ? 16   DA  N N9    1 
ATOM   1008  C  C8    . DA  C 3  16   ? 63.317  8.481   88.924  1.00 207.38 ? 16   DA  N C8    1 
ATOM   1009  N  N7    . DA  C 3  16   ? 62.827  9.317   89.811  1.00 203.81 ? 16   DA  N N7    1 
ATOM   1010  C  C5    . DA  C 3  16   ? 63.729  10.369  89.813  1.00 205.82 ? 16   DA  N C5    1 
ATOM   1011  C  C6    . DA  C 3  16   ? 63.779  11.578  90.539  1.00 192.94 ? 16   DA  N C6    1 
ATOM   1012  N  N6    . DA  C 3  16   ? 62.859  11.936  91.442  1.00 184.48 ? 16   DA  N N6    1 
ATOM   1013  N  N1    . DA  C 3  16   ? 64.817  12.408  90.301  1.00 187.70 ? 16   DA  N N1    1 
ATOM   1014  C  C2    . DA  C 3  16   ? 65.736  12.048  89.398  1.00 193.19 ? 16   DA  N C2    1 
ATOM   1015  N  N3    . DA  C 3  16   ? 65.795  10.942  88.656  1.00 202.85 ? 16   DA  N N3    1 
ATOM   1016  C  C4    . DA  C 3  16   ? 64.752  10.137  88.913  1.00 209.40 ? 16   DA  N C4    1 
ATOM   1017  N  N     . GLY D 4  3    ? 30.351  -8.466  15.321  1.00 114.96 ? 3    GLY A N     1 
ATOM   1018  C  CA    . GLY D 4  3    ? 30.674  -7.820  16.582  1.00 137.35 ? 3    GLY A CA    1 
ATOM   1019  C  C     . GLY D 4  3    ? 32.023  -7.127  16.574  1.00 139.21 ? 3    GLY A C     1 
ATOM   1020  O  O     . GLY D 4  3    ? 32.099  -5.898  16.541  1.00 141.60 ? 3    GLY A O     1 
ATOM   1021  N  N     . GLN D 4  4    ? 33.092  -7.920  16.618  1.00 130.79 ? 4    GLN A N     1 
ATOM   1022  C  CA    . GLN D 4  4    ? 34.450  -7.406  16.526  1.00 114.70 ? 4    GLN A CA    1 
ATOM   1023  C  C     . GLN D 4  4    ? 35.265  -8.314  15.615  1.00 119.95 ? 4    GLN A C     1 
ATOM   1024  O  O     . GLN D 4  4    ? 34.889  -9.456  15.343  1.00 132.44 ? 4    GLN A O     1 
ATOM   1025  C  CB    . GLN D 4  4    ? 35.121  -7.294  17.901  1.00 122.80 ? 4    GLN A CB    1 
ATOM   1026  C  CG    . GLN D 4  4    ? 34.579  -6.170  18.771  1.00 135.40 ? 4    GLN A CG    1 
ATOM   1027  C  CD    . GLN D 4  4    ? 35.471  -5.869  19.962  1.00 138.84 ? 4    GLN A CD    1 
ATOM   1028  O  OE1   . GLN D 4  4    ? 36.696  -5.933  19.865  1.00 144.87 ? 4    GLN A OE1   1 
ATOM   1029  N  NE2   . GLN D 4  4    ? 34.858  -5.539  21.093  1.00 127.68 ? 4    GLN A NE2   1 
ATOM   1030  N  N     . GLN D 4  5    ? 36.395  -7.786  15.148  1.00 124.26 ? 5    GLN A N     1 
ATOM   1031  C  CA    . GLN D 4  5    ? 37.230  -8.506  14.201  1.00 133.66 ? 5    GLN A CA    1 
ATOM   1032  C  C     . GLN D 4  5    ? 37.891  -9.718  14.854  1.00 132.93 ? 5    GLN A C     1 
ATOM   1033  O  O     . GLN D 4  5    ? 38.080  -9.784  16.073  1.00 140.61 ? 5    GLN A O     1 
ATOM   1034  C  CB    . GLN D 4  5    ? 38.306  -7.586  13.620  1.00 142.01 ? 5    GLN A CB    1 
ATOM   1035  C  CG    . GLN D 4  5    ? 37.855  -6.757  12.428  1.00 148.62 ? 5    GLN A CG    1 
ATOM   1036  C  CD    . GLN D 4  5    ? 38.708  -7.007  11.194  1.00 151.77 ? 5    GLN A CD    1 
ATOM   1037  O  OE1   . GLN D 4  5    ? 39.867  -6.597  11.133  1.00 149.81 ? 5    GLN A OE1   1 
ATOM   1038  N  NE2   . GLN D 4  5    ? 38.136  -7.687  10.205  1.00 150.27 ? 5    GLN A NE2   1 
ATOM   1039  N  N     . TYR D 4  6    ? 38.236  -10.689 14.014  1.00 130.71 ? 6    TYR A N     1 
ATOM   1040  C  CA    . TYR D 4  6    ? 39.025  -11.833 14.452  1.00 133.39 ? 6    TYR A CA    1 
ATOM   1041  C  C     . TYR D 4  6    ? 40.433  -11.373 14.814  1.00 138.40 ? 6    TYR A C     1 
ATOM   1042  O  O     . TYR D 4  6    ? 41.060  -10.616 14.068  1.00 135.31 ? 6    TYR A O     1 
ATOM   1043  C  CB    . TYR D 4  6    ? 39.058  -12.889 13.346  1.00 141.53 ? 6    TYR A CB    1 
ATOM   1044  C  CG    . TYR D 4  6    ? 39.895  -14.115 13.637  1.00 150.43 ? 6    TYR A CG    1 
ATOM   1045  C  CD1   . TYR D 4  6    ? 39.329  -15.247 14.207  1.00 156.94 ? 6    TYR A CD1   1 
ATOM   1046  C  CD2   . TYR D 4  6    ? 41.244  -14.154 13.309  1.00 152.43 ? 6    TYR A CD2   1 
ATOM   1047  C  CE1   . TYR D 4  6    ? 40.088  -16.376 14.465  1.00 162.12 ? 6    TYR A CE1   1 
ATOM   1048  C  CE2   . TYR D 4  6    ? 42.011  -15.275 13.563  1.00 157.19 ? 6    TYR A CE2   1 
ATOM   1049  C  CZ    . TYR D 4  6    ? 41.428  -16.385 14.140  1.00 161.17 ? 6    TYR A CZ    1 
ATOM   1050  O  OH    . TYR D 4  6    ? 42.189  -17.504 14.393  1.00 158.74 ? 6    TYR A OH    1 
ATOM   1051  N  N     . SER D 4  7    ? 40.928  -11.821 15.966  1.00 145.13 ? 7    SER A N     1 
ATOM   1052  C  CA    . SER D 4  7    ? 42.226  -11.404 16.478  1.00 144.41 ? 7    SER A CA    1 
ATOM   1053  C  C     . SER D 4  7    ? 43.201  -12.573 16.481  1.00 147.72 ? 7    SER A C     1 
ATOM   1054  O  O     . SER D 4  7    ? 42.846  -13.692 16.866  1.00 141.73 ? 7    SER A O     1 
ATOM   1055  C  CB    . SER D 4  7    ? 42.103  -10.830 17.892  1.00 128.29 ? 7    SER A CB    1 
ATOM   1056  O  OG    . SER D 4  7    ? 43.378  -10.507 18.419  1.00 122.54 ? 7    SER A OG    1 
ATOM   1057  N  N     . SER D 4  8    ? 44.439  -12.302 16.056  1.00 150.59 ? 8    SER A N     1 
ATOM   1058  C  CA    . SER D 4  8    ? 45.463  -13.341 16.038  1.00 147.74 ? 8    SER A CA    1 
ATOM   1059  C  C     . SER D 4  8    ? 45.921  -13.705 17.442  1.00 151.10 ? 8    SER A C     1 
ATOM   1060  O  O     . SER D 4  8    ? 46.311  -14.853 17.687  1.00 144.68 ? 8    SER A O     1 
ATOM   1061  C  CB    . SER D 4  8    ? 46.658  -12.890 15.199  1.00 148.15 ? 8    SER A CB    1 
ATOM   1062  O  OG    . SER D 4  8    ? 47.754  -13.779 15.341  1.00 143.69 ? 8    SER A OG    1 
ATOM   1063  N  N     . ALA D 4  9    ? 45.895  -12.751 18.365  1.00 158.34 ? 9    ALA A N     1 
ATOM   1064  C  CA    . ALA D 4  9    ? 46.296  -13.037 19.731  1.00 162.42 ? 9    ALA A CA    1 
ATOM   1065  C  C     . ALA D 4  9    ? 45.292  -13.984 20.384  1.00 159.26 ? 9    ALA A C     1 
ATOM   1066  O  O     . ALA D 4  9    ? 44.084  -13.867 20.156  1.00 160.76 ? 9    ALA A O     1 
ATOM   1067  C  CB    . ALA D 4  9    ? 46.403  -11.746 20.542  1.00 165.53 ? 9    ALA A CB    1 
ATOM   1068  N  N     . PRO D 4  10   ? 45.758  -14.940 21.181  1.00 145.70 ? 10   PRO A N     1 
ATOM   1069  C  CA    . PRO D 4  10   ? 44.837  -15.854 21.860  1.00 130.58 ? 10   PRO A CA    1 
ATOM   1070  C  C     . PRO D 4  10   ? 44.176  -15.195 23.062  1.00 128.59 ? 10   PRO A C     1 
ATOM   1071  O  O     . PRO D 4  10   ? 44.640  -14.186 23.597  1.00 123.52 ? 10   PRO A O     1 
ATOM   1072  C  CB    . PRO D 4  10   ? 45.740  -17.014 22.302  1.00 123.69 ? 10   PRO A CB    1 
ATOM   1073  C  CG    . PRO D 4  10   ? 47.032  -16.828 21.550  1.00 124.53 ? 10   PRO A CG    1 
ATOM   1074  C  CD    . PRO D 4  10   ? 47.159  -15.356 21.337  1.00 130.43 ? 10   PRO A CD    1 
ATOM   1075  N  N     . LEU D 4  11   ? 43.069  -15.799 23.484  1.00 132.06 ? 11   LEU A N     1 
ATOM   1076  C  CA    . LEU D 4  11   ? 42.273  -15.315 24.603  1.00 130.34 ? 11   LEU A CA    1 
ATOM   1077  C  C     . LEU D 4  11   ? 42.480  -16.220 25.810  1.00 139.04 ? 11   LEU A C     1 
ATOM   1078  O  O     . LEU D 4  11   ? 42.399  -17.447 25.693  1.00 139.20 ? 11   LEU A O     1 
ATOM   1079  C  CB    . LEU D 4  11   ? 40.790  -15.252 24.226  1.00 119.57 ? 11   LEU A CB    1 
ATOM   1080  C  CG    . LEU D 4  11   ? 39.762  -15.435 25.346  1.00 125.82 ? 11   LEU A CG    1 
ATOM   1081  C  CD1   . LEU D 4  11   ? 39.698  -14.210 26.245  1.00 138.05 ? 11   LEU A CD1   1 
ATOM   1082  C  CD2   . LEU D 4  11   ? 38.391  -15.742 24.760  1.00 117.74 ? 11   LEU A CD2   1 
ATOM   1083  N  N     . ARG D 4  12   ? 42.750  -15.612 26.964  1.00 138.23 ? 12   ARG A N     1 
ATOM   1084  C  CA    . ARG D 4  12   ? 42.918  -16.352 28.208  1.00 150.35 ? 12   ARG A CA    1 
ATOM   1085  C  C     . ARG D 4  12   ? 42.185  -15.627 29.324  1.00 154.82 ? 12   ARG A C     1 
ATOM   1086  O  O     . ARG D 4  12   ? 42.366  -14.419 29.506  1.00 141.84 ? 12   ARG A O     1 
ATOM   1087  C  CB    . ARG D 4  12   ? 44.399  -16.520 28.569  1.00 153.22 ? 12   ARG A CB    1 
ATOM   1088  C  CG    . ARG D 4  12   ? 45.163  -17.440 27.636  1.00 156.28 ? 12   ARG A CG    1 
ATOM   1089  C  CD    . ARG D 4  12   ? 46.659  -17.195 27.717  1.00 156.31 ? 12   ARG A CD    1 
ATOM   1090  N  NE    . ARG D 4  12   ? 47.387  -18.002 26.742  1.00 158.11 ? 12   ARG A NE    1 
ATOM   1091  C  CZ    . ARG D 4  12   ? 48.021  -19.133 27.032  1.00 160.70 ? 12   ARG A CZ    1 
ATOM   1092  N  NH1   . ARG D 4  12   ? 48.016  -19.599 28.274  1.00 159.86 ? 12   ARG A NH1   1 
ATOM   1093  N  NH2   . ARG D 4  12   ? 48.656  -19.803 26.080  1.00 163.95 ? 12   ARG A NH2   1 
ATOM   1094  N  N     . THR D 4  13   ? 41.350  -16.367 30.052  1.00 171.01 ? 13   THR A N     1 
ATOM   1095  C  CA    . THR D 4  13   ? 40.615  -15.811 31.181  1.00 177.12 ? 13   THR A CA    1 
ATOM   1096  C  C     . THR D 4  13   ? 41.576  -15.199 32.191  1.00 170.74 ? 13   THR A C     1 
ATOM   1097  O  O     . THR D 4  13   ? 42.529  -15.848 32.632  1.00 183.77 ? 13   THR A O     1 
ATOM   1098  C  CB    . THR D 4  13   ? 39.775  -16.907 31.845  1.00 191.43 ? 13   THR A CB    1 
ATOM   1099  O  OG1   . THR D 4  13   ? 39.224  -17.765 30.837  1.00 206.85 ? 13   THR A OG1   1 
ATOM   1100  C  CG2   . THR D 4  13   ? 38.640  -16.298 32.651  1.00 188.94 ? 13   THR A CG2   1 
ATOM   1101  N  N     . VAL D 4  14   ? 41.330  -13.933 32.541  1.00 137.26 ? 14   VAL A N     1 
ATOM   1102  C  CA    . VAL D 4  14   ? 42.199  -13.239 33.485  1.00 123.39 ? 14   VAL A CA    1 
ATOM   1103  C  C     . VAL D 4  14   ? 42.123  -13.922 34.841  1.00 140.55 ? 14   VAL A C     1 
ATOM   1104  O  O     . VAL D 4  14   ? 41.033  -14.162 35.378  1.00 148.48 ? 14   VAL A O     1 
ATOM   1105  C  CB    . VAL D 4  14   ? 41.813  -11.756 33.580  1.00 96.43  ? 14   VAL A CB    1 
ATOM   1106  C  CG1   . VAL D 4  14   ? 42.533  -11.093 34.744  1.00 87.98  ? 14   VAL A CG1   1 
ATOM   1107  C  CG2   . VAL D 4  14   ? 42.141  -11.047 32.284  1.00 106.24 ? 14   VAL A CG2   1 
ATOM   1108  N  N     . LYS D 4  15   ? 43.286  -14.239 35.405  1.00 141.75 ? 15   LYS A N     1 
ATOM   1109  C  CA    . LYS D 4  15   ? 43.373  -15.002 36.642  1.00 142.65 ? 15   LYS A CA    1 
ATOM   1110  C  C     . LYS D 4  15   ? 43.743  -14.150 37.846  1.00 148.90 ? 15   LYS A C     1 
ATOM   1111  O  O     . LYS D 4  15   ? 43.116  -14.275 38.900  1.00 151.98 ? 15   LYS A O     1 
ATOM   1112  C  CB    . LYS D 4  15   ? 44.388  -16.142 36.478  1.00 139.23 ? 15   LYS A CB    1 
ATOM   1113  N  N     . GLU D 4  16   ? 44.750  -13.287 37.722  1.00 151.59 ? 16   GLU A N     1 
ATOM   1114  C  CA    . GLU D 4  16   ? 45.203  -12.450 38.824  1.00 140.83 ? 16   GLU A CA    1 
ATOM   1115  C  C     . GLU D 4  16   ? 45.374  -11.013 38.351  1.00 137.24 ? 16   GLU A C     1 
ATOM   1116  O  O     . GLU D 4  16   ? 45.590  -10.755 37.164  1.00 144.18 ? 16   GLU A O     1 
ATOM   1117  C  CB    . GLU D 4  16   ? 46.529  -12.961 39.414  1.00 129.34 ? 16   GLU A CB    1 
ATOM   1118  C  CG    . GLU D 4  16   ? 47.717  -12.835 38.469  1.00 138.07 ? 16   GLU A CG    1 
ATOM   1119  C  CD    . GLU D 4  16   ? 49.032  -13.234 39.115  1.00 145.69 ? 16   GLU A CD    1 
ATOM   1120  O  OE1   . GLU D 4  16   ? 49.760  -12.341 39.599  1.00 143.79 ? 16   GLU A OE1   1 
ATOM   1121  O  OE2   . GLU D 4  16   ? 49.341  -14.443 39.140  1.00 156.58 ? 16   GLU A OE2   1 
ATOM   1122  N  N     . VAL D 4  17   ? 45.267  -10.078 39.295  1.00 113.29 ? 17   VAL A N     1 
ATOM   1123  C  CA    . VAL D 4  17   ? 45.503  -8.660  39.042  1.00 113.53 ? 17   VAL A CA    1 
ATOM   1124  C  C     . VAL D 4  17   ? 46.423  -8.122  40.131  1.00 142.53 ? 17   VAL A C     1 
ATOM   1125  O  O     . VAL D 4  17   ? 46.136  -8.270  41.325  1.00 116.57 ? 17   VAL A O     1 
ATOM   1126  C  CB    . VAL D 4  17   ? 44.194  -7.847  38.980  1.00 103.70 ? 17   VAL A CB    1 
ATOM   1127  C  CG1   . VAL D 4  17   ? 43.284  -8.176  40.146  1.00 95.43  ? 17   VAL A CG1   1 
ATOM   1128  C  CG2   . VAL D 4  17   ? 44.494  -6.353  38.948  1.00 103.48 ? 17   VAL A CG2   1 
ATOM   1129  N  N     . GLN D 4  18   ? 47.533  -7.513  39.718  1.00 194.23 ? 18   GLN A N     1 
ATOM   1130  C  CA    . GLN D 4  18   ? 48.494  -6.904  40.631  1.00 196.48 ? 18   GLN A CA    1 
ATOM   1131  C  C     . GLN D 4  18   ? 48.340  -5.390  40.542  1.00 183.65 ? 18   GLN A C     1 
ATOM   1132  O  O     . GLN D 4  18   ? 48.628  -4.786  39.503  1.00 181.97 ? 18   GLN A O     1 
ATOM   1133  C  CB    . GLN D 4  18   ? 49.925  -7.342  40.310  1.00 214.88 ? 18   GLN A CB    1 
ATOM   1134  C  CG    . GLN D 4  18   ? 50.325  -7.263  38.838  1.00 231.26 ? 18   GLN A CG    1 
ATOM   1135  C  CD    . GLN D 4  18   ? 49.909  -8.485  38.043  1.00 243.72 ? 18   GLN A CD    1 
ATOM   1136  O  OE1   . GLN D 4  18   ? 48.843  -8.509  37.432  1.00 250.22 ? 18   GLN A OE1   1 
ATOM   1137  N  NE2   . GLN D 4  18   ? 50.756  -9.509  38.044  1.00 245.12 ? 18   GLN A NE2   1 
ATOM   1138  N  N     . PHE D 4  19   ? 47.870  -4.783  41.626  1.00 156.72 ? 19   PHE A N     1 
ATOM   1139  C  CA    . PHE D 4  19   ? 47.790  -3.336  41.696  1.00 123.42 ? 19   PHE A CA    1 
ATOM   1140  C  C     . PHE D 4  19   ? 49.181  -2.747  41.908  1.00 125.88 ? 19   PHE A C     1 
ATOM   1141  O  O     . PHE D 4  19   ? 50.157  -3.458  42.162  1.00 135.17 ? 19   PHE A O     1 
ATOM   1142  C  CB    . PHE D 4  19   ? 46.846  -2.905  42.815  1.00 117.86 ? 19   PHE A CB    1 
ATOM   1143  C  CG    . PHE D 4  19   ? 45.395  -3.053  42.469  1.00 116.12 ? 19   PHE A CG    1 
ATOM   1144  C  CD1   . PHE D 4  19   ? 44.499  -3.566  43.390  1.00 116.26 ? 19   PHE A CD1   1 
ATOM   1145  C  CD2   . PHE D 4  19   ? 44.926  -2.676  41.223  1.00 115.13 ? 19   PHE A CD2   1 
ATOM   1146  C  CE1   . PHE D 4  19   ? 43.161  -3.704  43.073  1.00 118.76 ? 19   PHE A CE1   1 
ATOM   1147  C  CE2   . PHE D 4  19   ? 43.589  -2.810  40.901  1.00 115.17 ? 19   PHE A CE2   1 
ATOM   1148  C  CZ    . PHE D 4  19   ? 42.705  -3.325  41.827  1.00 117.63 ? 19   PHE A CZ    1 
ATOM   1149  N  N     . GLY D 4  20   ? 49.268  -1.429  41.790  1.00 121.54 ? 20   GLY A N     1 
ATOM   1150  C  CA    . GLY D 4  20   ? 50.536  -0.756  41.991  1.00 132.77 ? 20   GLY A CA    1 
ATOM   1151  C  C     . GLY D 4  20   ? 50.457  0.681   41.534  1.00 130.38 ? 20   GLY A C     1 
ATOM   1152  O  O     . GLY D 4  20   ? 49.471  1.123   40.938  1.00 133.61 ? 20   GLY A O     1 
ATOM   1153  N  N     . LEU D 4  21   ? 51.526  1.409   41.829  1.00 134.70 ? 21   LEU A N     1 
ATOM   1154  C  CA    . LEU D 4  21   ? 51.652  2.797   41.419  1.00 134.64 ? 21   LEU A CA    1 
ATOM   1155  C  C     . LEU D 4  21   ? 52.290  2.890   40.039  1.00 129.82 ? 21   LEU A C     1 
ATOM   1156  O  O     . LEU D 4  21   ? 52.917  1.947   39.550  1.00 128.32 ? 21   LEU A O     1 
ATOM   1157  C  CB    . LEU D 4  21   ? 52.480  3.587   42.432  1.00 151.15 ? 21   LEU A CB    1 
ATOM   1158  C  CG    . LEU D 4  21   ? 51.669  4.250   43.543  1.00 153.68 ? 21   LEU A CG    1 
ATOM   1159  C  CD1   . LEU D 4  21   ? 52.521  5.257   44.300  1.00 151.54 ? 21   LEU A CD1   1 
ATOM   1160  C  CD2   . LEU D 4  21   ? 50.435  4.909   42.953  1.00 149.15 ? 21   LEU A CD2   1 
ATOM   1161  N  N     . PHE D 4  22   ? 52.126  4.052   39.413  1.00 137.14 ? 22   PHE A N     1 
ATOM   1162  C  CA    . PHE D 4  22   ? 52.629  4.285   38.067  1.00 138.16 ? 22   PHE A CA    1 
ATOM   1163  C  C     . PHE D 4  22   ? 53.897  5.124   38.122  1.00 134.29 ? 22   PHE A C     1 
ATOM   1164  O  O     . PHE D 4  22   ? 53.937  6.163   38.791  1.00 120.23 ? 22   PHE A O     1 
ATOM   1165  C  CB    . PHE D 4  22   ? 51.575  4.971   37.198  1.00 142.83 ? 22   PHE A CB    1 
ATOM   1166  C  CG    . PHE D 4  22   ? 51.465  4.388   35.819  1.00 150.12 ? 22   PHE A CG    1 
ATOM   1167  C  CD1   . PHE D 4  22   ? 50.231  4.225   35.213  1.00 145.18 ? 22   PHE A CD1   1 
ATOM   1168  C  CD2   . PHE D 4  22   ? 52.601  3.989   35.134  1.00 152.01 ? 22   PHE A CD2   1 
ATOM   1169  C  CE1   . PHE D 4  22   ? 50.134  3.681   33.945  1.00 144.31 ? 22   PHE A CE1   1 
ATOM   1170  C  CE2   . PHE D 4  22   ? 52.510  3.446   33.867  1.00 144.86 ? 22   PHE A CE2   1 
ATOM   1171  C  CZ    . PHE D 4  22   ? 51.276  3.291   33.272  1.00 144.56 ? 22   PHE A CZ    1 
ATOM   1172  N  N     . SER D 4  23   ? 54.922  4.669   37.418  1.00 137.63 ? 23   SER A N     1 
ATOM   1173  C  CA    . SER D 4  23   ? 56.216  5.333   37.328  1.00 149.74 ? 23   SER A CA    1 
ATOM   1174  C  C     . SER D 4  23   ? 56.187  6.388   36.230  1.00 145.97 ? 23   SER A C     1 
ATOM   1175  O  O     . SER D 4  23   ? 55.787  6.082   35.101  1.00 150.10 ? 23   SER A O     1 
ATOM   1176  C  CB    . SER D 4  23   ? 57.315  4.322   37.035  1.00 165.23 ? 23   SER A CB    1 
ATOM   1177  O  OG    . SER D 4  23   ? 58.333  4.892   36.232  1.00 175.52 ? 23   SER A OG    1 
ATOM   1178  N  N     . PRO D 4  24   ? 56.590  7.629   36.520  1.00 142.49 ? 24   PRO A N     1 
ATOM   1179  C  CA    . PRO D 4  24   ? 56.682  8.630   35.443  1.00 137.95 ? 24   PRO A CA    1 
ATOM   1180  C  C     . PRO D 4  24   ? 57.592  8.201   34.306  1.00 144.04 ? 24   PRO A C     1 
ATOM   1181  O  O     . PRO D 4  24   ? 57.305  8.511   33.143  1.00 152.79 ? 24   PRO A O     1 
ATOM   1182  C  CB    . PRO D 4  24   ? 57.217  9.872   36.169  1.00 131.71 ? 24   PRO A CB    1 
ATOM   1183  C  CG    . PRO D 4  24   ? 56.788  9.693   37.587  1.00 127.06 ? 24   PRO A CG    1 
ATOM   1184  C  CD    . PRO D 4  24   ? 56.849  8.214   37.847  1.00 131.52 ? 24   PRO A CD    1 
ATOM   1185  N  N     . GLU D 4  25   ? 58.680  7.486   34.608  1.00 148.27 ? 25   GLU A N     1 
ATOM   1186  C  CA    . GLU D 4  25   ? 59.545  6.970   33.550  1.00 153.48 ? 25   GLU A CA    1 
ATOM   1187  C  C     . GLU D 4  25   ? 58.785  6.013   32.640  1.00 164.00 ? 25   GLU A C     1 
ATOM   1188  O  O     . GLU D 4  25   ? 58.956  6.039   31.415  1.00 156.90 ? 25   GLU A O     1 
ATOM   1189  C  CB    . GLU D 4  25   ? 60.769  6.275   34.151  1.00 147.99 ? 25   GLU A CB    1 
ATOM   1190  C  CG    . GLU D 4  25   ? 61.489  7.061   35.242  1.00 150.51 ? 25   GLU A CG    1 
ATOM   1191  C  CD    . GLU D 4  25   ? 60.914  6.817   36.625  1.00 164.47 ? 25   GLU A CD    1 
ATOM   1192  O  OE1   . GLU D 4  25   ? 59.687  6.615   36.736  1.00 170.16 ? 25   GLU A OE1   1 
ATOM   1193  O  OE2   . GLU D 4  25   ? 61.691  6.828   37.604  1.00 170.56 ? 25   GLU A OE2   1 
ATOM   1194  N  N     . GLU D 4  26   ? 57.940  5.158   33.221  1.00 170.94 ? 26   GLU A N     1 
ATOM   1195  C  CA    . GLU D 4  26   ? 57.093  4.294   32.408  1.00 170.51 ? 26   GLU A CA    1 
ATOM   1196  C  C     . GLU D 4  26   ? 55.986  5.083   31.718  1.00 166.92 ? 26   GLU A C     1 
ATOM   1197  O  O     . GLU D 4  26   ? 55.554  4.707   30.623  1.00 174.77 ? 26   GLU A O     1 
ATOM   1198  C  CB    . GLU D 4  26   ? 56.495  3.178   33.267  1.00 166.81 ? 26   GLU A CB    1 
ATOM   1199  C  CG    . GLU D 4  26   ? 55.848  2.059   32.466  1.00 165.43 ? 26   GLU A CG    1 
ATOM   1200  C  CD    . GLU D 4  26   ? 55.800  0.747   33.224  1.00 163.76 ? 26   GLU A CD    1 
ATOM   1201  O  OE1   . GLU D 4  26   ? 55.618  0.778   34.459  1.00 162.53 ? 26   GLU A OE1   1 
ATOM   1202  O  OE2   . GLU D 4  26   ? 55.952  -0.316  32.586  1.00 168.61 ? 26   GLU A OE2   1 
ATOM   1203  N  N     . VAL D 4  27   ? 55.521  6.173   32.336  1.00 155.86 ? 27   VAL A N     1 
ATOM   1204  C  CA    . VAL D 4  27   ? 54.456  6.980   31.740  1.00 133.06 ? 27   VAL A CA    1 
ATOM   1205  C  C     . VAL D 4  27   ? 54.909  7.555   30.403  1.00 129.36 ? 27   VAL A C     1 
ATOM   1206  O  O     . VAL D 4  27   ? 54.200  7.461   29.393  1.00 123.21 ? 27   VAL A O     1 
ATOM   1207  C  CB    . VAL D 4  27   ? 54.012  8.089   32.712  1.00 124.00 ? 27   VAL A CB    1 
ATOM   1208  C  CG1   . VAL D 4  27   ? 53.212  9.155   31.977  1.00 119.54 ? 27   VAL A CG1   1 
ATOM   1209  C  CG2   . VAL D 4  27   ? 53.191  7.503   33.853  1.00 117.06 ? 27   VAL A CG2   1 
ATOM   1210  N  N     . ARG D 4  28   ? 56.099  8.161   30.375  1.00 132.60 ? 28   ARG A N     1 
ATOM   1211  C  CA    . ARG D 4  28   ? 56.631  8.676   29.118  1.00 141.89 ? 28   ARG A CA    1 
ATOM   1212  C  C     . ARG D 4  28   ? 56.931  7.552   28.137  1.00 147.01 ? 28   ARG A C     1 
ATOM   1213  O  O     . ARG D 4  28   ? 56.814  7.740   26.921  1.00 144.23 ? 28   ARG A O     1 
ATOM   1214  C  CB    . ARG D 4  28   ? 57.890  9.501   29.380  1.00 146.51 ? 28   ARG A CB    1 
ATOM   1215  C  CG    . ARG D 4  28   ? 57.826  10.317  30.657  1.00 146.39 ? 28   ARG A CG    1 
ATOM   1216  C  CD    . ARG D 4  28   ? 58.086  11.787  30.406  1.00 150.02 ? 28   ARG A CD    1 
ATOM   1217  N  NE    . ARG D 4  28   ? 57.937  12.568  31.630  1.00 154.20 ? 28   ARG A NE    1 
ATOM   1218  C  CZ    . ARG D 4  28   ? 58.875  12.674  32.565  1.00 156.86 ? 28   ARG A CZ    1 
ATOM   1219  N  NH1   . ARG D 4  28   ? 60.033  12.046  32.419  1.00 151.44 ? 28   ARG A NH1   1 
ATOM   1220  N  NH2   . ARG D 4  28   ? 58.655  13.407  33.648  1.00 161.74 ? 28   ARG A NH2   1 
ATOM   1221  N  N     . ALA D 4  29   ? 57.315  6.380   28.645  1.00 152.95 ? 29   ALA A N     1 
ATOM   1222  C  CA    . ALA D 4  29   ? 57.560  5.228   27.789  1.00 162.93 ? 29   ALA A CA    1 
ATOM   1223  C  C     . ALA D 4  29   ? 56.276  4.596   27.267  1.00 163.70 ? 29   ALA A C     1 
ATOM   1224  O  O     . ALA D 4  29   ? 56.341  3.794   26.330  1.00 159.28 ? 29   ALA A O     1 
ATOM   1225  C  CB    . ALA D 4  29   ? 58.385  4.187   28.549  1.00 161.30 ? 29   ALA A CB    1 
ATOM   1226  N  N     . ILE D 4  30   ? 55.120  4.942   27.834  1.00 165.24 ? 30   ILE A N     1 
ATOM   1227  C  CA    . ILE D 4  30   ? 53.850  4.308   27.492  1.00 164.25 ? 30   ILE A CA    1 
ATOM   1228  C  C     . ILE D 4  30   ? 52.892  5.269   26.805  1.00 170.25 ? 30   ILE A C     1 
ATOM   1229  O  O     . ILE D 4  30   ? 51.754  4.885   26.495  1.00 159.85 ? 30   ILE A O     1 
ATOM   1230  C  CB    . ILE D 4  30   ? 53.193  3.685   28.742  1.00 162.00 ? 30   ILE A CB    1 
ATOM   1231  C  CG1   . ILE D 4  30   ? 52.263  2.528   28.367  1.00 159.74 ? 30   ILE A CG1   1 
ATOM   1232  C  CG2   . ILE D 4  30   ? 52.448  4.744   29.556  1.00 162.54 ? 30   ILE A CG2   1 
ATOM   1233  C  CD1   . ILE D 4  30   ? 52.906  1.491   27.483  1.00 161.24 ? 30   ILE A CD1   1 
ATOM   1234  N  N     . SER D 4  31   ? 53.324  6.495   26.523  1.00 173.64 ? 31   SER A N     1 
ATOM   1235  C  CA    . SER D 4  31   ? 52.464  7.527   25.958  1.00 178.28 ? 31   SER A CA    1 
ATOM   1236  C  C     . SER D 4  31   ? 52.976  7.922   24.582  1.00 174.88 ? 31   SER A C     1 
ATOM   1237  O  O     . SER D 4  31   ? 54.112  8.388   24.448  1.00 178.04 ? 31   SER A O     1 
ATOM   1238  C  CB    . SER D 4  31   ? 52.409  8.748   26.874  1.00 184.34 ? 31   SER A CB    1 
ATOM   1239  O  OG    . SER D 4  31   ? 52.160  9.924   26.126  1.00 187.74 ? 31   SER A OG    1 
ATOM   1240  N  N     . VAL D 4  32   ? 52.130  7.746   23.563  1.00 167.44 ? 32   VAL A N     1 
ATOM   1241  C  CA    . VAL D 4  32   ? 52.522  8.056   22.189  1.00 170.51 ? 32   VAL A CA    1 
ATOM   1242  C  C     . VAL D 4  32   ? 52.394  9.535   21.863  1.00 167.63 ? 32   VAL A C     1 
ATOM   1243  O  O     . VAL D 4  32   ? 52.840  9.965   20.790  1.00 171.50 ? 32   VAL A O     1 
ATOM   1244  C  CB    . VAL D 4  32   ? 51.666  7.251   21.190  1.00 166.53 ? 32   VAL A CB    1 
ATOM   1245  C  CG1   . VAL D 4  32   ? 52.355  7.151   19.832  1.00 162.09 ? 32   VAL A CG1   1 
ATOM   1246  C  CG2   . VAL D 4  32   ? 51.338  5.874   21.743  1.00 170.29 ? 32   VAL A CG2   1 
ATOM   1247  N  N     . ALA D 4  33   ? 51.816  10.333  22.758  1.00 161.02 ? 33   ALA A N     1 
ATOM   1248  C  CA    . ALA D 4  33   ? 51.443  11.706  22.450  1.00 155.68 ? 33   ALA A CA    1 
ATOM   1249  C  C     . ALA D 4  33   ? 52.026  12.674  23.469  1.00 149.98 ? 33   ALA A C     1 
ATOM   1250  O  O     . ALA D 4  33   ? 51.987  12.423  24.677  1.00 152.06 ? 33   ALA A O     1 
ATOM   1251  C  CB    . ALA D 4  33   ? 49.919  11.863  22.406  1.00 156.57 ? 33   ALA A CB    1 
ATOM   1252  N  N     . LYS D 4  34   ? 52.552  13.789  22.964  1.00 154.54 ? 34   LYS A N     1 
ATOM   1253  C  CA    . LYS D 4  34   ? 53.042  14.901  23.770  1.00 154.68 ? 34   LYS A CA    1 
ATOM   1254  C  C     . LYS D 4  34   ? 52.154  16.102  23.468  1.00 168.07 ? 34   LYS A C     1 
ATOM   1255  O  O     . LYS D 4  34   ? 52.091  16.556  22.321  1.00 183.03 ? 34   LYS A O     1 
ATOM   1256  C  CB    . LYS D 4  34   ? 54.513  15.201  23.463  1.00 152.14 ? 34   LYS A CB    1 
ATOM   1257  C  CG    . LYS D 4  34   ? 55.333  13.984  23.040  1.00 154.84 ? 34   LYS A CG    1 
ATOM   1258  C  CD    . LYS D 4  34   ? 55.355  13.812  21.522  1.00 158.62 ? 34   LYS A CD    1 
ATOM   1259  C  CE    . LYS D 4  34   ? 56.016  12.503  21.114  1.00 152.78 ? 34   LYS A CE    1 
ATOM   1260  N  NZ    . LYS D 4  34   ? 56.019  12.325  19.635  1.00 138.14 ? 34   LYS A NZ    1 
ATOM   1261  N  N     . ILE D 4  35   ? 51.481  16.618  24.497  1.00 155.32 ? 35   ILE A N     1 
ATOM   1262  C  CA    . ILE D 4  35   ? 50.256  17.393  24.308  1.00 155.94 ? 35   ILE A CA    1 
ATOM   1263  C  C     . ILE D 4  35   ? 50.394  18.844  24.762  1.00 161.78 ? 35   ILE A C     1 
ATOM   1264  O  O     . ILE D 4  35   ? 49.432  19.431  25.271  1.00 150.18 ? 35   ILE A O     1 
ATOM   1265  C  CB    . ILE D 4  35   ? 49.079  16.703  25.025  1.00 147.85 ? 35   ILE A CB    1 
ATOM   1266  C  CG1   . ILE D 4  35   ? 49.439  16.369  26.474  1.00 153.27 ? 35   ILE A CG1   1 
ATOM   1267  C  CG2   . ILE D 4  35   ? 48.686  15.429  24.294  1.00 141.06 ? 35   ILE A CG2   1 
ATOM   1268  C  CD1   . ILE D 4  35   ? 48.962  17.377  27.492  1.00 155.02 ? 35   ILE A CD1   1 
ATOM   1269  N  N     . ARG D 4  36   ? 51.582  19.433  24.567  1.00 174.28 ? 36   ARG A N     1 
ATOM   1270  C  CA    . ARG D 4  36   ? 51.868  20.775  25.079  1.00 180.83 ? 36   ARG A CA    1 
ATOM   1271  C  C     . ARG D 4  36   ? 50.752  21.776  24.793  1.00 184.33 ? 36   ARG A C     1 
ATOM   1272  O  O     . ARG D 4  36   ? 50.505  22.674  25.606  1.00 184.23 ? 36   ARG A O     1 
ATOM   1273  C  CB    . ARG D 4  36   ? 53.178  21.301  24.489  1.00 181.49 ? 36   ARG A CB    1 
ATOM   1274  C  CG    . ARG D 4  36   ? 54.404  20.469  24.806  1.00 178.87 ? 36   ARG A CG    1 
ATOM   1275  C  CD    . ARG D 4  36   ? 55.469  20.668  23.738  1.00 175.91 ? 36   ARG A CD    1 
ATOM   1276  N  NE    . ARG D 4  36   ? 54.933  20.475  22.394  1.00 178.75 ? 36   ARG A NE    1 
ATOM   1277  C  CZ    . ARG D 4  36   ? 54.719  19.286  21.841  1.00 175.35 ? 36   ARG A CZ    1 
ATOM   1278  N  NH1   . ARG D 4  36   ? 54.229  19.200  20.612  1.00 172.41 ? 36   ARG A NH1   1 
ATOM   1279  N  NH2   . ARG D 4  36   ? 55.005  18.183  22.516  1.00 171.42 ? 36   ARG A NH2   1 
ATOM   1280  N  N     . PHE D 4  37   ? 50.068  21.643  23.655  1.00 179.78 ? 37   PHE A N     1 
ATOM   1281  C  CA    . PHE D 4  37   ? 49.015  22.643  23.493  1.00 176.10 ? 37   PHE A CA    1 
ATOM   1282  C  C     . PHE D 4  37   ? 47.715  22.158  24.137  1.00 169.49 ? 37   PHE A C     1 
ATOM   1283  O  O     . PHE D 4  37   ? 47.332  20.999  23.962  1.00 175.49 ? 37   PHE A O     1 
ATOM   1284  C  CB    . PHE D 4  37   ? 48.781  22.949  22.015  1.00 180.94 ? 37   PHE A CB    1 
ATOM   1285  C  CG    . PHE D 4  37   ? 50.041  22.966  21.193  1.00 186.45 ? 37   PHE A CG    1 
ATOM   1286  C  CD1   . PHE D 4  37   ? 50.483  21.819  20.555  1.00 186.75 ? 37   PHE A CD1   1 
ATOM   1287  C  CD2   . PHE D 4  37   ? 50.793  24.124  21.073  1.00 189.82 ? 37   PHE A CD2   1 
ATOM   1288  C  CE1   . PHE D 4  37   ? 51.646  21.824  19.808  1.00 187.79 ? 37   PHE A CE1   1 
ATOM   1289  C  CE2   . PHE D 4  37   ? 51.958  24.135  20.323  1.00 190.94 ? 37   PHE A CE2   1 
ATOM   1290  C  CZ    . PHE D 4  37   ? 52.384  22.982  19.690  1.00 189.54 ? 37   PHE A CZ    1 
ATOM   1291  N  N     . PRO D 4  38   ? 47.021  23.025  24.882  1.00 135.34 ? 38   PRO A N     1 
ATOM   1292  C  CA    . PRO D 4  38   ? 45.809  22.603  25.600  1.00 125.56 ? 38   PRO A CA    1 
ATOM   1293  C  C     . PRO D 4  38   ? 44.489  22.783  24.861  1.00 137.75 ? 38   PRO A C     1 
ATOM   1294  O  O     . PRO D 4  38   ? 43.465  22.295  25.350  1.00 131.53 ? 38   PRO A O     1 
ATOM   1295  C  CB    . PRO D 4  38   ? 45.835  23.513  26.836  1.00 112.72 ? 38   PRO A CB    1 
ATOM   1296  C  CG    . PRO D 4  38   ? 46.429  24.786  26.328  1.00 114.52 ? 38   PRO A CG    1 
ATOM   1297  C  CD    . PRO D 4  38   ? 47.409  24.401  25.230  1.00 119.47 ? 38   PRO A CD    1 
ATOM   1298  N  N     . GLU D 4  39   ? 44.477  23.468  23.720  1.00 153.16 ? 39   GLU A N     1 
ATOM   1299  C  CA    . GLU D 4  39   ? 43.219  23.771  23.054  1.00 166.90 ? 39   GLU A CA    1 
ATOM   1300  C  C     . GLU D 4  39   ? 42.612  22.507  22.451  1.00 169.84 ? 39   GLU A C     1 
ATOM   1301  O  O     . GLU D 4  39   ? 43.321  21.591  22.025  1.00 173.32 ? 39   GLU A O     1 
ATOM   1302  C  CB    . GLU D 4  39   ? 43.440  24.828  21.972  1.00 170.21 ? 39   GLU A CB    1 
ATOM   1303  C  CG    . GLU D 4  39   ? 43.702  26.219  22.531  1.00 162.29 ? 39   GLU A CG    1 
ATOM   1304  C  CD    . GLU D 4  39   ? 42.875  27.290  21.852  1.00 159.42 ? 39   GLU A CD    1 
ATOM   1305  O  OE1   . GLU D 4  39   ? 42.251  28.105  22.567  1.00 156.11 ? 39   GLU A OE1   1 
ATOM   1306  O  OE2   . GLU D 4  39   ? 42.855  27.317  20.604  1.00 159.14 ? 39   GLU A OE2   1 
ATOM   1307  N  N     . THR D 4  40   ? 41.277  22.473  22.409  1.00 170.26 ? 40   THR A N     1 
ATOM   1308  C  CA    . THR D 4  40   ? 40.567  21.248  22.054  1.00 161.17 ? 40   THR A CA    1 
ATOM   1309  C  C     . THR D 4  40   ? 40.646  20.967  20.554  1.00 153.24 ? 40   THR A C     1 
ATOM   1310  O  O     . THR D 4  40   ? 41.261  19.984  20.122  1.00 133.26 ? 40   THR A O     1 
ATOM   1311  C  CB    . THR D 4  40   ? 39.104  21.344  22.512  1.00 151.06 ? 40   THR A CB    1 
ATOM   1312  O  OG1   . THR D 4  40   ? 38.404  22.273  21.673  1.00 152.68 ? 40   THR A OG1   1 
ATOM   1313  C  CG2   . THR D 4  40   ? 39.039  21.814  23.953  1.00 137.11 ? 40   THR A CG2   1 
ATOM   1314  N  N     . MET D 4  41   ? 40.053  21.832  19.746  1.00 154.50 ? 41   MET A N     1 
ATOM   1315  C  CA    . MET D 4  41   ? 39.988  21.649  18.307  1.00 145.04 ? 41   MET A CA    1 
ATOM   1316  C  C     . MET D 4  41   ? 41.125  22.416  17.645  1.00 159.39 ? 41   MET A C     1 
ATOM   1317  O  O     . MET D 4  41   ? 41.994  22.993  18.311  1.00 143.87 ? 41   MET A O     1 
ATOM   1318  C  CB    . MET D 4  41   ? 38.621  22.099  17.784  1.00 131.47 ? 41   MET A CB    1 
ATOM   1319  N  N     . ASP D 4  42   ? 41.126  22.428  16.316  1.00 176.29 ? 42   ASP A N     1 
ATOM   1320  C  CA    . ASP D 4  42   ? 42.162  23.147  15.597  1.00 193.21 ? 42   ASP A CA    1 
ATOM   1321  C  C     . ASP D 4  42   ? 41.979  24.652  15.764  1.00 202.67 ? 42   ASP A C     1 
ATOM   1322  O  O     . ASP D 4  42   ? 40.906  25.145  16.129  1.00 203.53 ? 42   ASP A O     1 
ATOM   1323  C  CB    . ASP D 4  42   ? 42.156  22.772  14.116  1.00 189.71 ? 42   ASP A CB    1 
ATOM   1324  C  CG    . ASP D 4  42   ? 41.155  23.575  13.315  1.00 181.70 ? 42   ASP A CG    1 
ATOM   1325  O  OD1   . ASP D 4  42   ? 39.954  23.560  13.660  1.00 180.02 ? 42   ASP A OD1   1 
ATOM   1326  O  OD2   . ASP D 4  42   ? 41.573  24.229  12.338  1.00 176.10 ? 42   ASP A OD2   1 
ATOM   1327  N  N     . GLU D 4  43   ? 43.052  25.383  15.485  1.00 209.90 ? 43   GLU A N     1 
ATOM   1328  C  CA    . GLU D 4  43   ? 43.100  26.825  15.686  1.00 212.65 ? 43   GLU A CA    1 
ATOM   1329  C  C     . GLU D 4  43   ? 42.347  27.534  14.561  1.00 223.73 ? 43   GLU A C     1 
ATOM   1330  O  O     . GLU D 4  43   ? 41.636  26.914  13.765  1.00 209.86 ? 43   GLU A O     1 
ATOM   1331  C  CB    . GLU D 4  43   ? 44.554  27.286  15.785  1.00 210.11 ? 43   GLU A CB    1 
ATOM   1332  C  CG    . GLU D 4  43   ? 45.355  27.184  14.484  1.00 205.80 ? 43   GLU A CG    1 
ATOM   1333  C  CD    . GLU D 4  43   ? 45.691  25.754  14.084  1.00 197.83 ? 43   GLU A CD    1 
ATOM   1334  O  OE1   . GLU D 4  43   ? 44.762  24.963  13.819  1.00 194.66 ? 43   GLU A OE1   1 
ATOM   1335  O  OE2   . GLU D 4  43   ? 46.893  25.424  14.037  1.00 193.91 ? 43   GLU A OE2   1 
ATOM   1336  N  N     . THR D 4  44   ? 42.490  28.860  14.504  1.00 251.00 ? 44   THR A N     1 
ATOM   1337  C  CA    . THR D 4  44   ? 41.874  29.708  13.479  1.00 264.07 ? 44   THR A CA    1 
ATOM   1338  C  C     . THR D 4  44   ? 40.349  29.632  13.504  1.00 269.34 ? 44   THR A C     1 
ATOM   1339  O  O     . THR D 4  44   ? 39.695  29.794  12.470  1.00 282.11 ? 44   THR A O     1 
ATOM   1340  C  CB    . THR D 4  44   ? 42.396  29.377  12.073  1.00 263.92 ? 44   THR A CB    1 
ATOM   1341  O  OG1   . THR D 4  44   ? 42.001  28.050  11.703  1.00 265.15 ? 44   THR A OG1   1 
ATOM   1342  C  CG2   . THR D 4  44   ? 43.914  29.478  12.027  1.00 260.83 ? 44   THR A CG2   1 
ATOM   1343  N  N     . GLN D 4  45   ? 39.779  29.394  14.687  1.00 248.32 ? 45   GLN A N     1 
ATOM   1344  C  CA    . GLN D 4  45   ? 38.332  29.446  14.904  1.00 224.65 ? 45   GLN A CA    1 
ATOM   1345  C  C     . GLN D 4  45   ? 37.589  28.518  13.942  1.00 209.84 ? 45   GLN A C     1 
ATOM   1346  O  O     . GLN D 4  45   ? 36.584  28.884  13.328  1.00 214.35 ? 45   GLN A O     1 
ATOM   1347  C  CB    . GLN D 4  45   ? 37.823  30.887  14.794  1.00 216.78 ? 45   GLN A CB    1 
ATOM   1348  C  CG    . GLN D 4  45   ? 38.621  31.886  15.634  1.00 205.30 ? 45   GLN A CG    1 
ATOM   1349  C  CD    . GLN D 4  45   ? 38.255  33.331  15.348  1.00 192.77 ? 45   GLN A CD    1 
ATOM   1350  O  OE1   . GLN D 4  45   ? 39.016  34.062  14.714  1.00 185.92 ? 45   GLN A OE1   1 
ATOM   1351  N  NE2   . GLN D 4  45   ? 37.086  33.751  15.819  1.00 188.34 ? 45   GLN A NE2   1 
ATOM   1352  N  N     . THR D 4  46   ? 38.105  27.295  13.813  1.00 190.85 ? 46   THR A N     1 
ATOM   1353  C  CA    . THR D 4  46   ? 37.557  26.312  12.887  1.00 170.40 ? 46   THR A CA    1 
ATOM   1354  C  C     . THR D 4  46   ? 37.271  24.999  13.604  1.00 159.97 ? 46   THR A C     1 
ATOM   1355  O  O     . THR D 4  46   ? 37.307  24.937  14.838  1.00 140.30 ? 46   THR A O     1 
ATOM   1356  C  CB    . THR D 4  46   ? 38.513  26.087  11.711  1.00 168.01 ? 46   THR A CB    1 
ATOM   1357  O  OG1   . THR D 4  46   ? 39.860  26.010  12.193  1.00 167.36 ? 46   THR A OG1   1 
ATOM   1358  C  CG2   . THR D 4  46   ? 38.403  27.229  10.711  1.00 168.23 ? 46   THR A CG2   1 
ATOM   1359  N  N     . ARG D 4  47   ? 36.969  23.949  12.841  1.00 169.95 ? 47   ARG A N     1 
ATOM   1360  C  CA    . ARG D 4  47   ? 36.704  22.622  13.388  1.00 180.93 ? 47   ARG A CA    1 
ATOM   1361  C  C     . ARG D 4  47   ? 37.658  21.620  12.747  1.00 189.55 ? 47   ARG A C     1 
ATOM   1362  O  O     . ARG D 4  47   ? 37.518  21.289  11.564  1.00 179.39 ? 47   ARG A O     1 
ATOM   1363  C  CB    . ARG D 4  47   ? 35.247  22.211  13.162  1.00 181.15 ? 47   ARG A CB    1 
ATOM   1364  C  CG    . ARG D 4  47   ? 34.705  22.507  11.772  1.00 184.26 ? 47   ARG A CG    1 
ATOM   1365  C  CD    . ARG D 4  47   ? 33.191  22.556  11.767  1.00 181.96 ? 47   ARG A CD    1 
ATOM   1366  N  NE    . ARG D 4  47   ? 32.690  23.622  10.907  1.00 182.82 ? 47   ARG A NE    1 
ATOM   1367  C  CZ    . ARG D 4  47   ? 32.285  24.808  11.344  1.00 177.08 ? 47   ARG A CZ    1 
ATOM   1368  N  NH1   . ARG D 4  47   ? 32.316  25.089  12.640  1.00 170.47 ? 47   ARG A NH1   1 
ATOM   1369  N  NH2   . ARG D 4  47   ? 31.844  25.715  10.484  1.00 177.34 ? 47   ARG A NH2   1 
ATOM   1370  N  N     . ALA D 4  48   ? 38.624  21.145  13.526  1.00 204.27 ? 48   ALA A N     1 
ATOM   1371  C  CA    . ALA D 4  48   ? 39.521  20.053  13.147  1.00 207.56 ? 48   ALA A CA    1 
ATOM   1372  C  C     . ALA D 4  48   ? 40.261  19.614  14.407  1.00 208.62 ? 48   ALA A C     1 
ATOM   1373  O  O     . ALA D 4  48   ? 39.934  20.049  15.517  1.00 208.06 ? 48   ALA A O     1 
ATOM   1374  C  CB    . ALA D 4  48   ? 40.481  20.467  12.029  1.00 203.41 ? 48   ALA A CB    1 
ATOM   1375  N  N     . LYS D 4  49   ? 41.260  18.753  14.242  1.00 192.84 ? 49   LYS A N     1 
ATOM   1376  C  CA    . LYS D 4  49   ? 42.064  18.283  15.358  1.00 172.35 ? 49   LYS A CA    1 
ATOM   1377  C  C     . LYS D 4  49   ? 43.364  19.076  15.440  1.00 181.69 ? 49   LYS A C     1 
ATOM   1378  O  O     . LYS D 4  49   ? 43.722  19.837  14.539  1.00 194.03 ? 49   LYS A O     1 
ATOM   1379  C  CB    . LYS D 4  49   ? 42.342  16.778  15.234  1.00 160.80 ? 49   LYS A CB    1 
ATOM   1380  C  CG    . LYS D 4  49   ? 42.508  16.272  13.805  1.00 151.92 ? 49   LYS A CG    1 
ATOM   1381  C  CD    . LYS D 4  49   ? 43.830  16.709  13.194  1.00 149.02 ? 49   LYS A CD    1 
ATOM   1382  C  CE    . LYS D 4  49   ? 43.968  16.226  11.762  1.00 155.48 ? 49   LYS A CE    1 
ATOM   1383  N  NZ    . LYS D 4  49   ? 45.291  16.590  11.181  1.00 164.70 ? 49   LYS A NZ    1 
ATOM   1384  N  N     . ILE D 4  50   ? 44.071  18.891  16.551  1.00 169.42 ? 50   ILE A N     1 
ATOM   1385  C  CA    . ILE D 4  50   ? 45.309  19.611  16.807  1.00 165.23 ? 50   ILE A CA    1 
ATOM   1386  C  C     . ILE D 4  50   ? 46.322  18.641  17.399  1.00 151.02 ? 50   ILE A C     1 
ATOM   1387  O  O     . ILE D 4  50   ? 45.966  17.697  18.110  1.00 150.02 ? 50   ILE A O     1 
ATOM   1388  C  CB    . ILE D 4  50   ? 45.073  20.818  17.752  1.00 161.65 ? 50   ILE A CB    1 
ATOM   1389  C  CG1   . ILE D 4  50   ? 46.355  21.635  17.947  1.00 158.42 ? 50   ILE A CG1   1 
ATOM   1390  C  CG2   . ILE D 4  50   ? 44.504  20.356  19.091  1.00 149.25 ? 50   ILE A CG2   1 
ATOM   1391  C  CD1   . ILE D 4  50   ? 46.201  22.804  18.895  1.00 152.89 ? 50   ILE A CD1   1 
ATOM   1392  N  N     . GLY D 4  51   ? 47.600  18.879  17.106  1.00 140.63 ? 51   GLY A N     1 
ATOM   1393  C  CA    . GLY D 4  51   ? 48.648  18.141  17.787  1.00 141.35 ? 51   GLY A CA    1 
ATOM   1394  C  C     . GLY D 4  51   ? 48.733  18.413  19.274  1.00 158.46 ? 51   GLY A C     1 
ATOM   1395  O  O     . GLY D 4  51   ? 49.547  17.782  19.957  1.00 159.02 ? 51   GLY A O     1 
ATOM   1396  N  N     . GLY D 4  52   ? 47.913  19.324  19.784  1.00 158.57 ? 52   GLY A N     1 
ATOM   1397  C  CA    . GLY D 4  52   ? 47.871  19.642  21.192  1.00 157.82 ? 52   GLY A CA    1 
ATOM   1398  C  C     . GLY D 4  52   ? 47.046  18.649  21.984  1.00 159.63 ? 52   GLY A C     1 
ATOM   1399  O  O     . GLY D 4  52   ? 47.303  17.445  21.943  1.00 174.40 ? 52   GLY A O     1 
ATOM   1400  N  N     . LEU D 4  53   ? 46.054  19.175  22.708  1.00 157.95 ? 53   LEU A N     1 
ATOM   1401  C  CA    . LEU D 4  53   ? 45.283  18.462  23.721  1.00 146.50 ? 53   LEU A CA    1 
ATOM   1402  C  C     . LEU D 4  53   ? 44.962  17.020  23.369  1.00 142.83 ? 53   LEU A C     1 
ATOM   1403  O  O     . LEU D 4  53   ? 45.252  16.119  24.160  1.00 139.95 ? 53   LEU A O     1 
ATOM   1404  C  CB    . LEU D 4  53   ? 43.967  19.194  24.003  1.00 141.32 ? 53   LEU A CB    1 
ATOM   1405  C  CG    . LEU D 4  53   ? 42.907  18.362  24.738  1.00 140.43 ? 53   LEU A CG    1 
ATOM   1406  C  CD1   . LEU D 4  53   ? 43.304  18.155  26.185  1.00 132.50 ? 53   LEU A CD1   1 
ATOM   1407  C  CD2   . LEU D 4  53   ? 41.553  19.031  24.670  1.00 145.33 ? 53   LEU A CD2   1 
ATOM   1408  N  N     . ASN D 4  54   ? 44.365  16.779  22.204  1.00 139.68 ? 54   ASN A N     1 
ATOM   1409  C  CA    . ASN D 4  54   ? 43.961  15.427  21.855  1.00 136.27 ? 54   ASN A CA    1 
ATOM   1410  C  C     . ASN D 4  54   ? 44.165  15.187  20.367  1.00 132.44 ? 54   ASN A C     1 
ATOM   1411  O  O     . ASN D 4  54   ? 44.307  16.117  19.570  1.00 134.63 ? 54   ASN A O     1 
ATOM   1412  C  CB    . ASN D 4  54   ? 42.502  15.150  22.253  1.00 130.06 ? 54   ASN A CB    1 
ATOM   1413  C  CG    . ASN D 4  54   ? 41.533  15.407  21.121  1.00 130.83 ? 54   ASN A CG    1 
ATOM   1414  O  OD1   . ASN D 4  54   ? 41.276  14.531  20.294  1.00 131.08 ? 54   ASN A OD1   1 
ATOM   1415  N  ND2   . ASN D 4  54   ? 40.995  16.619  21.072  1.00 144.64 ? 54   ASN A ND2   1 
ATOM   1416  N  N     . ASP D 4  55   ? 44.170  13.900  20.015  1.00 136.04 ? 55   ASP A N     1 
ATOM   1417  C  CA    . ASP D 4  55   ? 44.408  13.315  18.697  1.00 134.17 ? 55   ASP A CA    1 
ATOM   1418  C  C     . ASP D 4  55   ? 45.740  13.673  18.037  1.00 149.94 ? 55   ASP A C     1 
ATOM   1419  O  O     . ASP D 4  55   ? 45.748  13.961  16.833  1.00 152.51 ? 55   ASP A O     1 
ATOM   1420  C  CB    . ASP D 4  55   ? 43.268  13.703  17.751  1.00 124.05 ? 55   ASP A CB    1 
ATOM   1421  N  N     . PRO D 4  56   ? 46.894  13.670  18.752  1.00 158.27 ? 56   PRO A N     1 
ATOM   1422  C  CA    . PRO D 4  56   ? 48.165  13.488  18.040  1.00 167.21 ? 56   PRO A CA    1 
ATOM   1423  C  C     . PRO D 4  56   ? 48.489  12.010  17.922  1.00 194.87 ? 56   PRO A C     1 
ATOM   1424  O  O     . PRO D 4  56   ? 48.868  11.386  18.918  1.00 187.33 ? 56   PRO A O     1 
ATOM   1425  C  CB    . PRO D 4  56   ? 49.177  14.238  18.913  1.00 159.53 ? 56   PRO A CB    1 
ATOM   1426  C  CG    . PRO D 4  56   ? 48.514  14.382  20.269  1.00 167.74 ? 56   PRO A CG    1 
ATOM   1427  C  CD    . PRO D 4  56   ? 47.136  13.776  20.200  1.00 163.88 ? 56   PRO A CD    1 
ATOM   1428  N  N     . ARG D 4  57   ? 48.372  11.446  16.722  1.00 224.20 ? 57   ARG A N     1 
ATOM   1429  C  CA    . ARG D 4  57   ? 48.444  10.000  16.526  1.00 227.45 ? 57   ARG A CA    1 
ATOM   1430  C  C     . ARG D 4  57   ? 47.515  9.290   17.515  1.00 209.42 ? 57   ARG A C     1 
ATOM   1431  O  O     . ARG D 4  57   ? 47.925  8.456   18.324  1.00 207.64 ? 57   ARG A O     1 
ATOM   1432  C  CB    . ARG D 4  57   ? 49.886  9.495   16.648  1.00 236.70 ? 57   ARG A CB    1 
ATOM   1433  N  N     . LEU D 4  58   ? 46.242  9.666   17.445  1.00 173.08 ? 58   LEU A N     1 
ATOM   1434  C  CA    . LEU D 4  58   ? 45.218  9.181   18.358  1.00 159.09 ? 58   LEU A CA    1 
ATOM   1435  C  C     . LEU D 4  58   ? 43.893  9.063   17.625  1.00 181.94 ? 58   LEU A C     1 
ATOM   1436  O  O     . LEU D 4  58   ? 43.760  9.453   16.463  1.00 171.55 ? 58   LEU A O     1 
ATOM   1437  C  CB    . LEU D 4  58   ? 45.102  10.084  19.593  1.00 130.40 ? 58   LEU A CB    1 
ATOM   1438  C  CG    . LEU D 4  58   ? 45.399  9.436   20.941  1.00 102.00 ? 58   LEU A CG    1 
ATOM   1439  C  CD1   . LEU D 4  58   ? 44.941  10.298  22.082  1.00 89.39  ? 58   LEU A CD1   1 
ATOM   1440  C  CD2   . LEU D 4  58   ? 44.587  8.167   20.975  1.00 89.23  ? 58   LEU A CD2   1 
ATOM   1441  N  N     . GLY D 4  59   ? 42.909  8.517   18.333  1.00 200.42 ? 59   GLY A N     1 
ATOM   1442  C  CA    . GLY D 4  59   ? 41.628  8.237   17.717  1.00 201.12 ? 59   GLY A CA    1 
ATOM   1443  C  C     . GLY D 4  59   ? 40.869  9.507   17.389  1.00 193.39 ? 59   GLY A C     1 
ATOM   1444  O  O     . GLY D 4  59   ? 40.922  10.501  18.116  1.00 191.37 ? 59   GLY A O     1 
ATOM   1445  N  N     . SER D 4  60   ? 40.162  9.468   16.268  1.00 191.48 ? 60   SER A N     1 
ATOM   1446  C  CA    . SER D 4  60   ? 39.262  10.546  15.906  1.00 183.62 ? 60   SER A CA    1 
ATOM   1447  C  C     . SER D 4  60   ? 37.911  10.344  16.585  1.00 171.64 ? 60   SER A C     1 
ATOM   1448  O  O     . SER D 4  60   ? 37.631  9.300   17.183  1.00 166.55 ? 60   SER A O     1 
ATOM   1449  C  CB    . SER D 4  60   ? 39.094  10.618  14.389  1.00 187.31 ? 60   SER A CB    1 
ATOM   1450  O  OG    . SER D 4  60   ? 38.584  9.400   13.877  1.00 189.24 ? 60   SER A OG    1 
ATOM   1451  N  N     . ILE D 4  61   ? 37.068  11.371  16.496  1.00 167.52 ? 61   ILE A N     1 
ATOM   1452  C  CA    . ILE D 4  61   ? 35.708  11.311  17.010  1.00 159.22 ? 61   ILE A CA    1 
ATOM   1453  C  C     . ILE D 4  61   ? 34.674  11.505  15.909  1.00 166.55 ? 61   ILE A C     1 
ATOM   1454  O  O     . ILE D 4  61   ? 33.471  11.465  16.184  1.00 158.52 ? 61   ILE A O     1 
ATOM   1455  C  CB    . ILE D 4  61   ? 35.489  12.331  18.149  1.00 140.71 ? 61   ILE A CB    1 
ATOM   1456  C  CG1   . ILE D 4  61   ? 36.696  12.365  19.093  1.00 131.22 ? 61   ILE A CG1   1 
ATOM   1457  C  CG2   . ILE D 4  61   ? 34.275  11.959  18.989  1.00 127.46 ? 61   ILE A CG2   1 
ATOM   1458  C  CD1   . ILE D 4  61   ? 37.724  13.447  18.775  1.00 128.31 ? 61   ILE A CD1   1 
ATOM   1459  N  N     . ASP D 4  62   ? 35.110  11.687  14.662  1.00 175.23 ? 62   ASP A N     1 
ATOM   1460  C  CA    . ASP D 4  62   ? 34.221  11.827  13.518  1.00 187.29 ? 62   ASP A CA    1 
ATOM   1461  C  C     . ASP D 4  62   ? 33.871  10.480  12.887  1.00 177.50 ? 62   ASP A C     1 
ATOM   1462  O  O     . ASP D 4  62   ? 33.455  10.439  11.723  1.00 184.87 ? 62   ASP A O     1 
ATOM   1463  C  CB    . ASP D 4  62   ? 34.858  12.758  12.480  1.00 200.59 ? 62   ASP A CB    1 
ATOM   1464  C  CG    . ASP D 4  62   ? 33.860  13.276  11.458  1.00 203.36 ? 62   ASP A CG    1 
ATOM   1465  O  OD1   . ASP D 4  62   ? 32.949  14.036  11.848  1.00 202.43 ? 62   ASP A OD1   1 
ATOM   1466  O  OD2   . ASP D 4  62   ? 33.988  12.923  10.265  1.00 203.85 ? 62   ASP A OD2   1 
ATOM   1467  N  N     . ARG D 4  63   ? 34.030  9.384   13.632  1.00 162.61 ? 63   ARG A N     1 
ATOM   1468  C  CA    . ARG D 4  63   ? 33.804  8.029   13.122  1.00 148.47 ? 63   ARG A CA    1 
ATOM   1469  C  C     . ARG D 4  63   ? 34.643  7.767   11.872  1.00 146.59 ? 63   ARG A C     1 
ATOM   1470  O  O     . ARG D 4  63   ? 34.147  7.300   10.844  1.00 140.99 ? 63   ARG A O     1 
ATOM   1471  C  CB    . ARG D 4  63   ? 32.319  7.773   12.850  1.00 142.83 ? 63   ARG A CB    1 
ATOM   1472  C  CG    . ARG D 4  63   ? 31.429  7.865   14.078  1.00 144.02 ? 63   ARG A CG    1 
ATOM   1473  C  CD    . ARG D 4  63   ? 30.775  9.233   14.189  1.00 150.86 ? 63   ARG A CD    1 
ATOM   1474  N  NE    . ARG D 4  63   ? 29.817  9.467   13.110  1.00 158.89 ? 63   ARG A NE    1 
ATOM   1475  C  CZ    . ARG D 4  63   ? 28.571  9.003   13.101  1.00 157.07 ? 63   ARG A CZ    1 
ATOM   1476  N  NH1   . ARG D 4  63   ? 28.124  8.274   14.115  1.00 158.18 ? 63   ARG A NH1   1 
ATOM   1477  N  NH2   . ARG D 4  63   ? 27.772  9.267   12.076  1.00 151.28 ? 63   ARG A NH2   1 
ATOM   1478  N  N     . ASN D 4  64   ? 35.933  8.076   11.969  1.00 151.76 ? 64   ASN A N     1 
ATOM   1479  C  CA    . ASN D 4  64   ? 36.880  7.881   10.882  1.00 159.96 ? 64   ASN A CA    1 
ATOM   1480  C  C     . ASN D 4  64   ? 37.831  6.748   11.240  1.00 172.48 ? 64   ASN A C     1 
ATOM   1481  O  O     . ASN D 4  64   ? 38.397  6.729   12.339  1.00 163.81 ? 64   ASN A O     1 
ATOM   1482  C  CB    . ASN D 4  64   ? 37.656  9.169   10.597  1.00 148.23 ? 64   ASN A CB    1 
ATOM   1483  C  CG    . ASN D 4  64   ? 36.746  10.321  10.213  1.00 144.29 ? 64   ASN A CG    1 
ATOM   1484  O  OD1   . ASN D 4  64   ? 35.585  10.115  9.858   1.00 141.25 ? 64   ASN A OD1   1 
ATOM   1485  N  ND2   . ASN D 4  64   ? 37.268  11.540  10.283  1.00 141.37 ? 64   ASN A ND2   1 
ATOM   1486  N  N     . LEU D 4  65   ? 38.002  5.808   10.305  1.00 175.55 ? 65   LEU A N     1 
ATOM   1487  C  CA    . LEU D 4  65   ? 38.828  4.631   10.558  1.00 162.71 ? 65   LEU A CA    1 
ATOM   1488  C  C     . LEU D 4  65   ? 40.264  5.008   10.898  1.00 170.61 ? 65   LEU A C     1 
ATOM   1489  O  O     . LEU D 4  65   ? 40.951  4.263   11.606  1.00 154.08 ? 65   LEU A O     1 
ATOM   1490  C  CB    . LEU D 4  65   ? 38.795  3.704   9.341   1.00 151.36 ? 65   LEU A CB    1 
ATOM   1491  C  CG    . LEU D 4  65   ? 38.684  2.197   9.583   1.00 139.67 ? 65   LEU A CG    1 
ATOM   1492  C  CD1   . LEU D 4  65   ? 37.321  1.838   10.159  1.00 124.99 ? 65   LEU A CD1   1 
ATOM   1493  C  CD2   . LEU D 4  65   ? 38.945  1.424   8.296   1.00 132.73 ? 65   LEU A CD2   1 
ATOM   1494  N  N     . LYS D 4  66   ? 40.731  6.154   10.410  1.00 196.44 ? 66   LYS A N     1 
ATOM   1495  C  CA    . LYS D 4  66   ? 42.099  6.586   10.666  1.00 200.87 ? 66   LYS A CA    1 
ATOM   1496  C  C     . LYS D 4  66   ? 42.265  6.968   12.132  1.00 193.23 ? 66   LYS A C     1 
ATOM   1497  O  O     . LYS D 4  66   ? 41.591  7.876   12.630  1.00 194.22 ? 66   LYS A O     1 
ATOM   1498  C  CB    . LYS D 4  66   ? 42.463  7.751   9.751   1.00 203.05 ? 66   LYS A CB    1 
ATOM   1499  C  CG    . LYS D 4  66   ? 42.085  7.513   8.297   1.00 192.99 ? 66   LYS A CG    1 
ATOM   1500  C  CD    . LYS D 4  66   ? 42.506  8.666   7.401   1.00 182.78 ? 66   LYS A CD    1 
ATOM   1501  C  CE    . LYS D 4  66   ? 41.872  8.545   6.024   1.00 175.12 ? 66   LYS A CE    1 
ATOM   1502  N  NZ    . LYS D 4  66   ? 42.158  7.228   5.395   1.00 174.45 ? 66   LYS A NZ    1 
ATOM   1503  N  N     . CYS D 4  67   ? 43.165  6.266   12.817  1.00 173.03 ? 67   CYS A N     1 
ATOM   1504  C  CA    . CYS D 4  67   ? 43.410  6.484   14.240  1.00 159.11 ? 67   CYS A CA    1 
ATOM   1505  C  C     . CYS D 4  67   ? 44.829  6.012   14.523  1.00 175.33 ? 67   CYS A C     1 
ATOM   1506  O  O     . CYS D 4  67   ? 45.093  4.807   14.475  1.00 183.78 ? 67   CYS A O     1 
ATOM   1507  C  CB    . CYS D 4  67   ? 42.397  5.727   15.092  1.00 164.13 ? 67   CYS A CB    1 
ATOM   1508  S  SG    . CYS D 4  67   ? 42.978  5.362   16.765  1.00 184.80 ? 67   CYS A SG    1 
ATOM   1509  N  N     . GLN D 4  68   ? 45.742  6.949   14.777  1.00 191.98 ? 68   GLN A N     1 
ATOM   1510  C  CA    . GLN D 4  68   ? 47.150  6.644   15.021  1.00 199.85 ? 68   GLN A CA    1 
ATOM   1511  C  C     . GLN D 4  68   ? 47.773  5.861   13.864  1.00 233.22 ? 68   GLN A C     1 
ATOM   1512  O  O     . GLN D 4  68   ? 48.878  5.324   14.001  1.00 221.63 ? 68   GLN A O     1 
ATOM   1513  C  CB    . GLN D 4  68   ? 47.318  5.886   16.355  1.00 175.78 ? 68   GLN A CB    1 
ATOM   1514  C  CG    . GLN D 4  68   ? 48.735  5.789   16.922  1.00 161.23 ? 68   GLN A CG    1 
ATOM   1515  C  CD    . GLN D 4  68   ? 49.337  4.404   16.761  1.00 152.56 ? 68   GLN A CD    1 
ATOM   1516  O  OE1   . GLN D 4  68   ? 48.759  3.533   16.113  1.00 144.72 ? 68   GLN A OE1   1 
ATOM   1517  N  NE2   . GLN D 4  68   ? 50.509  4.196   17.350  1.00 155.93 ? 68   GLN A NE2   1 
ATOM   1518  N  N     . THR D 4  69   ? 47.098  5.821   12.712  1.00 264.49 ? 69   THR A N     1 
ATOM   1519  C  CA    . THR D 4  69   ? 47.404  4.887   11.628  1.00 264.91 ? 69   THR A CA    1 
ATOM   1520  C  C     . THR D 4  69   ? 47.354  3.442   12.124  1.00 265.81 ? 69   THR A C     1 
ATOM   1521  O  O     . THR D 4  69   ? 48.109  2.584   11.660  1.00 275.62 ? 69   THR A O     1 
ATOM   1522  C  CB    . THR D 4  69   ? 48.757  5.195   10.972  1.00 258.76 ? 69   THR A CB    1 
ATOM   1523  O  OG1   . THR D 4  69   ? 48.974  6.611   10.974  1.00 257.37 ? 69   THR A OG1   1 
ATOM   1524  C  CG2   . THR D 4  69   ? 48.779  4.708   9.527   1.00 251.96 ? 69   THR A CG2   1 
ATOM   1525  N  N     . CYS D 4  70   ? 46.458  3.160   13.070  1.00 238.64 ? 70   CYS A N     1 
ATOM   1526  C  CA    . CYS D 4  70   ? 46.342  1.833   13.657  1.00 218.17 ? 70   CYS A CA    1 
ATOM   1527  C  C     . CYS D 4  70   ? 45.182  1.029   13.081  1.00 208.62 ? 70   CYS A C     1 
ATOM   1528  O  O     . CYS D 4  70   ? 44.902  -0.066  13.573  1.00 207.98 ? 70   CYS A O     1 
ATOM   1529  C  CB    . CYS D 4  70   ? 46.222  1.928   15.183  1.00 212.88 ? 70   CYS A CB    1 
ATOM   1530  S  SG    . CYS D 4  70   ? 44.548  2.124   15.838  1.00 212.96 ? 70   CYS A SG    1 
ATOM   1531  N  N     . GLN D 4  71   ? 44.503  1.544   12.054  1.00 203.00 ? 71   GLN A N     1 
ATOM   1532  C  CA    . GLN D 4  71   ? 43.551  0.761   11.263  1.00 204.90 ? 71   GLN A CA    1 
ATOM   1533  C  C     . GLN D 4  71   ? 42.373  0.261   12.103  1.00 203.93 ? 71   GLN A C     1 
ATOM   1534  O  O     . GLN D 4  71   ? 41.761  -0.762  11.785  1.00 207.77 ? 71   GLN A O     1 
ATOM   1535  C  CB    . GLN D 4  71   ? 44.261  -0.415  10.581  1.00 205.12 ? 71   GLN A CB    1 
ATOM   1536  C  CG    . GLN D 4  71   ? 43.575  -0.981  9.349   1.00 194.10 ? 71   GLN A CG    1 
ATOM   1537  C  CD    . GLN D 4  71   ? 44.321  -2.169  8.776   1.00 181.88 ? 71   GLN A CD    1 
ATOM   1538  O  OE1   . GLN D 4  71   ? 45.540  -2.277  8.914   1.00 181.02 ? 71   GLN A OE1   1 
ATOM   1539  N  NE2   . GLN D 4  71   ? 43.593  -3.064  8.122   1.00 171.92 ? 71   GLN A NE2   1 
ATOM   1540  N  N     . GLU D 4  72   ? 42.038  0.969   13.179  1.00 175.72 ? 72   GLU A N     1 
ATOM   1541  C  CA    . GLU D 4  72   ? 40.956  0.572   14.070  1.00 139.32 ? 72   GLU A CA    1 
ATOM   1542  C  C     . GLU D 4  72   ? 39.864  1.632   14.071  1.00 117.28 ? 72   GLU A C     1 
ATOM   1543  O  O     . GLU D 4  72   ? 40.152  2.834   14.113  1.00 99.74  ? 72   GLU A O     1 
ATOM   1544  C  CB    . GLU D 4  72   ? 41.461  0.340   15.499  1.00 141.25 ? 72   GLU A CB    1 
ATOM   1545  C  CG    . GLU D 4  72   ? 42.485  -0.778  15.647  1.00 148.83 ? 72   GLU A CG    1 
ATOM   1546  C  CD    . GLU D 4  72   ? 42.263  -1.925  14.677  1.00 156.19 ? 72   GLU A CD    1 
ATOM   1547  O  OE1   . GLU D 4  72   ? 43.180  -2.222  13.882  1.00 159.76 ? 72   GLU A OE1   1 
ATOM   1548  O  OE2   . GLU D 4  72   ? 41.171  -2.534  14.710  1.00 155.58 ? 72   GLU A OE2   1 
ATOM   1549  N  N     . GLY D 4  73   ? 38.612  1.179   14.028  1.00 107.53 ? 73   GLY A N     1 
ATOM   1550  C  CA    . GLY D 4  73   ? 37.476  2.074   14.001  1.00 97.03  ? 73   GLY A CA    1 
ATOM   1551  C  C     . GLY D 4  73   ? 37.167  2.671   15.360  1.00 89.27  ? 73   GLY A C     1 
ATOM   1552  O  O     . GLY D 4  73   ? 37.866  2.459   16.350  1.00 91.99  ? 73   GLY A O     1 
ATOM   1553  N  N     . MET D 4  74   ? 36.082  3.448   15.397  1.00 106.57 ? 74   MET A N     1 
ATOM   1554  C  CA    . MET D 4  74   ? 35.669  4.085   16.643  1.00 118.39 ? 74   MET A CA    1 
ATOM   1555  C  C     . MET D 4  74   ? 35.196  3.050   17.658  1.00 121.29 ? 74   MET A C     1 
ATOM   1556  O  O     . MET D 4  74   ? 35.463  3.181   18.859  1.00 123.91 ? 74   MET A O     1 
ATOM   1557  C  CB    . MET D 4  74   ? 34.573  5.114   16.363  1.00 112.90 ? 74   MET A CB    1 
ATOM   1558  C  CG    . MET D 4  74   ? 34.729  6.433   17.110  1.00 112.64 ? 74   MET A CG    1 
ATOM   1559  S  SD    . MET D 4  74   ? 34.367  6.308   18.871  1.00 124.17 ? 74   MET A SD    1 
ATOM   1560  C  CE    . MET D 4  74   ? 32.645  5.815   18.838  1.00 112.92 ? 74   MET A CE    1 
ATOM   1561  N  N     . ASN D 4  75   ? 34.496  2.012   17.194  1.00 110.60 ? 75   ASN A N     1 
ATOM   1562  C  CA    . ASN D 4  75   ? 34.067  0.940   18.088  1.00 118.65 ? 75   ASN A CA    1 
ATOM   1563  C  C     . ASN D 4  75   ? 35.247  0.128   18.611  1.00 124.90 ? 75   ASN A C     1 
ATOM   1564  O  O     . ASN D 4  75   ? 35.191  -0.394  19.731  1.00 96.10  ? 75   ASN A O     1 
ATOM   1565  C  CB    . ASN D 4  75   ? 33.071  0.025   17.366  1.00 107.53 ? 75   ASN A CB    1 
ATOM   1566  C  CG    . ASN D 4  75   ? 33.001  -1.366  17.978  1.00 102.31 ? 75   ASN A CG    1 
ATOM   1567  O  OD1   . ASN D 4  75   ? 33.761  -2.261  17.603  1.00 98.11  ? 75   ASN A OD1   1 
ATOM   1568  N  ND2   . ASN D 4  75   ? 32.086  -1.554  18.923  1.00 104.51 ? 75   ASN A ND2   1 
ATOM   1569  N  N     . GLU D 4  76   ? 36.318  0.015   17.826  1.00 151.26 ? 76   GLU A N     1 
ATOM   1570  C  CA    . GLU D 4  76   ? 37.421  -0.888  18.134  1.00 154.98 ? 76   GLU A CA    1 
ATOM   1571  C  C     . GLU D 4  76   ? 38.578  -0.231  18.870  1.00 155.91 ? 76   GLU A C     1 
ATOM   1572  O  O     . GLU D 4  76   ? 39.227  -0.896  19.684  1.00 151.94 ? 76   GLU A O     1 
ATOM   1573  C  CB    . GLU D 4  76   ? 37.959  -1.523  16.848  1.00 152.26 ? 76   GLU A CB    1 
ATOM   1574  C  CG    . GLU D 4  76   ? 38.834  -2.733  17.096  1.00 157.37 ? 76   GLU A CG    1 
ATOM   1575  C  CD    . GLU D 4  76   ? 38.156  -3.755  17.981  1.00 162.72 ? 76   GLU A CD    1 
ATOM   1576  O  OE1   . GLU D 4  76   ? 36.956  -4.027  17.761  1.00 161.61 ? 76   GLU A OE1   1 
ATOM   1577  O  OE2   . GLU D 4  76   ? 38.819  -4.280  18.900  1.00 168.07 ? 76   GLU A OE2   1 
ATOM   1578  N  N     . CYS D 4  77   ? 38.863  1.036   18.604  1.00 134.52 ? 77   CYS A N     1 
ATOM   1579  C  CA    . CYS D 4  77   ? 39.980  1.704   19.267  1.00 111.77 ? 77   CYS A CA    1 
ATOM   1580  C  C     . CYS D 4  77   ? 39.711  1.807   20.761  1.00 122.06 ? 77   CYS A C     1 
ATOM   1581  O  O     . CYS D 4  77   ? 38.808  2.550   21.164  1.00 103.78 ? 77   CYS A O     1 
ATOM   1582  C  CB    . CYS D 4  77   ? 40.204  3.103   18.674  1.00 102.08 ? 77   CYS A CB    1 
ATOM   1583  S  SG    . CYS D 4  77   ? 41.384  4.135   19.604  1.00 97.97  ? 77   CYS A SG    1 
ATOM   1584  N  N     . PRO D 4  78   ? 40.475  1.120   21.612  1.00 151.47 ? 78   PRO A N     1 
ATOM   1585  C  CA    . PRO D 4  78   ? 40.278  1.214   23.064  1.00 153.22 ? 78   PRO A CA    1 
ATOM   1586  C  C     . PRO D 4  78   ? 40.804  2.494   23.696  1.00 144.55 ? 78   PRO A C     1 
ATOM   1587  O  O     . PRO D 4  78   ? 40.919  2.554   24.921  1.00 142.31 ? 78   PRO A O     1 
ATOM   1588  C  CB    . PRO D 4  78   ? 41.072  -0.000  23.574  1.00 160.65 ? 78   PRO A CB    1 
ATOM   1589  C  CG    . PRO D 4  78   ? 42.202  -0.133  22.608  1.00 160.50 ? 78   PRO A CG    1 
ATOM   1590  C  CD    . PRO D 4  78   ? 41.650  0.303   21.264  1.00 158.65 ? 78   PRO A CD    1 
ATOM   1591  N  N     . GLY D 4  79   ? 41.124  3.519   22.915  1.00 131.57 ? 79   GLY A N     1 
ATOM   1592  C  CA    . GLY D 4  79   ? 41.797  4.686   23.463  1.00 126.16 ? 79   GLY A CA    1 
ATOM   1593  C  C     . GLY D 4  79   ? 43.291  4.448   23.584  1.00 120.19 ? 79   GLY A C     1 
ATOM   1594  O  O     . GLY D 4  79   ? 43.706  3.441   24.163  1.00 116.74 ? 79   GLY A O     1 
ATOM   1595  N  N     . HIS D 4  80   ? 44.110  5.338   23.036  1.00 128.32 ? 80   HIS A N     1 
ATOM   1596  C  CA    . HIS D 4  80   ? 45.555  5.221   23.145  1.00 123.62 ? 80   HIS A CA    1 
ATOM   1597  C  C     . HIS D 4  80   ? 46.045  6.362   24.023  1.00 128.86 ? 80   HIS A C     1 
ATOM   1598  O  O     . HIS D 4  80   ? 45.578  7.500   23.892  1.00 129.38 ? 80   HIS A O     1 
ATOM   1599  C  CB    . HIS D 4  80   ? 46.228  5.279   21.775  1.00 131.29 ? 80   HIS A CB    1 
ATOM   1600  C  CG    . HIS D 4  80   ? 45.524  4.475   20.730  1.00 128.60 ? 80   HIS A CG    1 
ATOM   1601  N  ND1   . HIS D 4  80   ? 45.147  3.164   20.927  1.00 122.24 ? 80   HIS A ND1   1 
ATOM   1602  C  CD2   . HIS D 4  80   ? 45.090  4.811   19.493  1.00 122.25 ? 80   HIS A CD2   1 
ATOM   1603  C  CE1   . HIS D 4  80   ? 44.531  2.720   19.847  1.00 124.88 ? 80   HIS A CE1   1 
ATOM   1604  N  NE2   . HIS D 4  80   ? 44.483  3.701   18.963  1.00 136.03 ? 80   HIS A NE2   1 
ATOM   1605  N  N     . PHE D 4  81   ? 46.958  6.052   24.935  1.00 139.73 ? 81   PHE A N     1 
ATOM   1606  C  CA    . PHE D 4  81   ? 47.206  6.919   26.076  1.00 140.45 ? 81   PHE A CA    1 
ATOM   1607  C  C     . PHE D 4  81   ? 48.248  7.985   25.756  1.00 138.11 ? 81   PHE A C     1 
ATOM   1608  O  O     . PHE D 4  81   ? 49.129  7.792   24.914  1.00 132.20 ? 81   PHE A O     1 
ATOM   1609  C  CB    . PHE D 4  81   ? 47.654  6.093   27.283  1.00 127.83 ? 81   PHE A CB    1 
ATOM   1610  C  CG    . PHE D 4  81   ? 46.986  6.493   28.564  1.00 127.66 ? 81   PHE A CG    1 
ATOM   1611  C  CD1   . PHE D 4  81   ? 46.067  5.653   29.168  1.00 119.68 ? 81   PHE A CD1   1 
ATOM   1612  C  CD2   . PHE D 4  81   ? 47.255  7.716   29.151  1.00 136.98 ? 81   PHE A CD2   1 
ATOM   1613  C  CE1   . PHE D 4  81   ? 45.441  6.016   30.345  1.00 118.62 ? 81   PHE A CE1   1 
ATOM   1614  C  CE2   . PHE D 4  81   ? 46.628  8.084   30.326  1.00 141.29 ? 81   PHE A CE2   1 
ATOM   1615  C  CZ    . PHE D 4  81   ? 45.722  7.233   30.925  1.00 127.39 ? 81   PHE A CZ    1 
ATOM   1616  N  N     . GLY D 4  82   ? 48.123  9.123   26.439  1.00 140.95 ? 82   GLY A N     1 
ATOM   1617  C  CA    . GLY D 4  82   ? 49.062  10.215  26.329  1.00 133.05 ? 82   GLY A CA    1 
ATOM   1618  C  C     . GLY D 4  82   ? 49.627  10.598  27.688  1.00 129.86 ? 82   GLY A C     1 
ATOM   1619  O  O     . GLY D 4  82   ? 49.297  10.005  28.718  1.00 125.26 ? 82   GLY A O     1 
ATOM   1620  N  N     . HIS D 4  83   ? 50.491  11.612  27.668  1.00 129.48 ? 83   HIS A N     1 
ATOM   1621  C  CA    . HIS D 4  83   ? 51.137  12.087  28.884  1.00 144.99 ? 83   HIS A CA    1 
ATOM   1622  C  C     . HIS D 4  83   ? 51.376  13.585  28.775  1.00 152.74 ? 83   HIS A C     1 
ATOM   1623  O  O     . HIS D 4  83   ? 51.264  14.177  27.700  1.00 155.90 ? 83   HIS A O     1 
ATOM   1624  C  CB    . HIS D 4  83   ? 52.463  11.366  29.139  1.00 154.86 ? 83   HIS A CB    1 
ATOM   1625  C  CG    . HIS D 4  83   ? 53.573  11.805  28.233  1.00 159.47 ? 83   HIS A CG    1 
ATOM   1626  N  ND1   . HIS D 4  83   ? 53.450  11.828  26.860  1.00 161.09 ? 83   HIS A ND1   1 
ATOM   1627  C  CD2   . HIS D 4  83   ? 54.825  12.242  28.506  1.00 159.83 ? 83   HIS A CD2   1 
ATOM   1628  C  CE1   . HIS D 4  83   ? 54.580  12.256  26.326  1.00 161.50 ? 83   HIS A CE1   1 
ATOM   1629  N  NE2   . HIS D 4  83   ? 55.430  12.514  27.303  1.00 159.76 ? 83   HIS A NE2   1 
ATOM   1630  N  N     . ILE D 4  84   ? 51.724  14.191  29.908  1.00 162.18 ? 84   ILE A N     1 
ATOM   1631  C  CA    . ILE D 4  84   ? 52.063  15.608  29.978  1.00 173.10 ? 84   ILE A CA    1 
ATOM   1632  C  C     . ILE D 4  84   ? 53.200  15.784  30.976  1.00 173.53 ? 84   ILE A C     1 
ATOM   1633  O  O     . ILE D 4  84   ? 53.160  15.225  32.077  1.00 181.34 ? 84   ILE A O     1 
ATOM   1634  C  CB    . ILE D 4  84   ? 50.849  16.476  30.370  1.00 180.89 ? 84   ILE A CB    1 
ATOM   1635  C  CG1   . ILE D 4  84   ? 51.287  17.898  30.730  1.00 190.42 ? 84   ILE A CG1   1 
ATOM   1636  C  CG2   . ILE D 4  84   ? 50.070  15.848  31.513  1.00 180.22 ? 84   ILE A CG2   1 
ATOM   1637  C  CD1   . ILE D 4  84   ? 50.136  18.842  30.992  1.00 190.59 ? 84   ILE A CD1   1 
ATOM   1638  N  N     . ASP D 4  85   ? 54.215  16.553  30.589  1.00 168.50 ? 85   ASP A N     1 
ATOM   1639  C  CA    . ASP D 4  85   ? 55.344  16.852  31.462  1.00 160.16 ? 85   ASP A CA    1 
ATOM   1640  C  C     . ASP D 4  85   ? 55.023  18.087  32.295  1.00 158.23 ? 85   ASP A C     1 
ATOM   1641  O  O     . ASP D 4  85   ? 54.715  19.151  31.746  1.00 154.42 ? 85   ASP A O     1 
ATOM   1642  C  CB    . ASP D 4  85   ? 56.617  17.070  30.646  1.00 155.38 ? 85   ASP A CB    1 
ATOM   1643  C  CG    . ASP D 4  85   ? 57.191  15.776  30.103  1.00 149.11 ? 85   ASP A CG    1 
ATOM   1644  O  OD1   . ASP D 4  85   ? 57.567  14.908  30.917  1.00 144.68 ? 85   ASP A OD1   1 
ATOM   1645  O  OD2   . ASP D 4  85   ? 57.264  15.624  28.865  1.00 148.38 ? 85   ASP A OD2   1 
ATOM   1646  N  N     . LEU D 4  86   ? 55.095  17.946  33.615  1.00 163.62 ? 86   LEU A N     1 
ATOM   1647  C  CA    . LEU D 4  86   ? 54.871  19.051  34.535  1.00 170.10 ? 86   LEU A CA    1 
ATOM   1648  C  C     . LEU D 4  86   ? 56.208  19.658  34.937  1.00 181.63 ? 86   LEU A C     1 
ATOM   1649  O  O     . LEU D 4  86   ? 57.164  18.937  35.236  1.00 187.10 ? 86   LEU A O     1 
ATOM   1650  C  CB    . LEU D 4  86   ? 54.113  18.584  35.780  1.00 168.42 ? 86   LEU A CB    1 
ATOM   1651  C  CG    . LEU D 4  86   ? 52.887  17.699  35.542  1.00 165.79 ? 86   LEU A CG    1 
ATOM   1652  C  CD1   . LEU D 4  86   ? 52.387  17.101  36.849  1.00 159.77 ? 86   LEU A CD1   1 
ATOM   1653  C  CD2   . LEU D 4  86   ? 51.783  18.485  34.852  1.00 164.59 ? 86   LEU A CD2   1 
ATOM   1654  N  N     . ALA D 4  87   ? 56.272  20.991  34.933  1.00 176.94 ? 87   ALA A N     1 
ATOM   1655  C  CA    . ALA D 4  87   ? 57.506  21.668  35.318  1.00 190.12 ? 87   ALA A CA    1 
ATOM   1656  C  C     . ALA D 4  87   ? 57.800  21.485  36.802  1.00 201.42 ? 87   ALA A C     1 
ATOM   1657  O  O     . ALA D 4  87   ? 58.964  21.349  37.198  1.00 210.59 ? 87   ALA A O     1 
ATOM   1658  C  CB    . ALA D 4  87   ? 57.424  23.153  34.965  1.00 185.39 ? 87   ALA A CB    1 
ATOM   1659  N  N     . LYS D 4  88   ? 56.762  21.475  37.636  1.00 192.85 ? 88   LYS A N     1 
ATOM   1660  C  CA    . LYS D 4  88   ? 56.913  21.329  39.071  1.00 183.24 ? 88   LYS A CA    1 
ATOM   1661  C  C     . LYS D 4  88   ? 56.185  20.083  39.554  1.00 174.04 ? 88   LYS A C     1 
ATOM   1662  O  O     . LYS D 4  88   ? 54.993  19.916  39.258  1.00 180.93 ? 88   LYS A O     1 
ATOM   1663  C  CB    . LYS D 4  88   ? 56.372  22.567  39.803  1.00 177.23 ? 88   LYS A CB    1 
ATOM   1664  C  CG    . LYS D 4  88   ? 56.632  22.573  41.299  1.00 175.79 ? 88   LYS A CG    1 
ATOM   1665  C  CD    . LYS D 4  88   ? 56.632  23.991  41.836  1.00 172.73 ? 88   LYS A CD    1 
ATOM   1666  C  CE    . LYS D 4  88   ? 57.649  24.838  41.088  1.00 172.10 ? 88   LYS A CE    1 
ATOM   1667  N  NZ    . LYS D 4  88   ? 57.659  26.252  41.538  1.00 174.19 ? 88   LYS A NZ    1 
ATOM   1668  N  N     . PRO D 4  89   ? 56.856  19.187  40.279  1.00 154.16 ? 89   PRO A N     1 
ATOM   1669  C  CA    . PRO D 4  89   ? 56.155  18.032  40.851  1.00 141.53 ? 89   PRO A CA    1 
ATOM   1670  C  C     . PRO D 4  89   ? 55.094  18.480  41.845  1.00 142.20 ? 89   PRO A C     1 
ATOM   1671  O  O     . PRO D 4  89   ? 55.175  19.565  42.427  1.00 132.78 ? 89   PRO A O     1 
ATOM   1672  C  CB    . PRO D 4  89   ? 57.273  17.242  41.542  1.00 132.40 ? 89   PRO A CB    1 
ATOM   1673  C  CG    . PRO D 4  89   ? 58.529  17.684  40.854  1.00 132.81 ? 89   PRO A CG    1 
ATOM   1674  C  CD    . PRO D 4  89   ? 58.309  19.124  40.504  1.00 136.99 ? 89   PRO A CD    1 
ATOM   1675  N  N     . VAL D 4  90   ? 54.082  17.631  42.032  1.00 151.29 ? 90   VAL A N     1 
ATOM   1676  C  CA    . VAL D 4  90   ? 52.935  17.952  42.872  1.00 158.38 ? 90   VAL A CA    1 
ATOM   1677  C  C     . VAL D 4  90   ? 52.486  16.710  43.632  1.00 164.17 ? 90   VAL A C     1 
ATOM   1678  O  O     . VAL D 4  90   ? 52.970  15.599  43.409  1.00 148.19 ? 90   VAL A O     1 
ATOM   1679  C  CB    . VAL D 4  90   ? 51.761  18.541  42.063  1.00 153.97 ? 90   VAL A CB    1 
ATOM   1680  C  CG1   . VAL D 4  90   ? 51.977  20.024  41.834  1.00 144.90 ? 90   VAL A CG1   1 
ATOM   1681  C  CG2   . VAL D 4  90   ? 51.606  17.807  40.738  1.00 154.79 ? 90   VAL A CG2   1 
ATOM   1682  N  N     . PHE D 4  91   ? 51.535  16.923  44.537  1.00 194.20 ? 91   PHE A N     1 
ATOM   1683  C  CA    . PHE D 4  91   ? 51.064  15.915  45.471  1.00 194.63 ? 91   PHE A CA    1 
ATOM   1684  C  C     . PHE D 4  91   ? 49.886  15.139  44.886  1.00 174.27 ? 91   PHE A C     1 
ATOM   1685  O  O     . PHE D 4  91   ? 49.260  15.545  43.904  1.00 176.03 ? 91   PHE A O     1 
ATOM   1686  C  CB    . PHE D 4  91   ? 50.640  16.559  46.796  1.00 206.33 ? 91   PHE A CB    1 
ATOM   1687  C  CG    . PHE D 4  91   ? 51.740  17.314  47.503  1.00 205.75 ? 91   PHE A CG    1 
ATOM   1688  C  CD1   . PHE D 4  91   ? 52.159  18.554  47.045  1.00 206.68 ? 91   PHE A CD1   1 
ATOM   1689  C  CD2   . PHE D 4  91   ? 52.336  16.792  48.641  1.00 199.15 ? 91   PHE A CD2   1 
ATOM   1690  C  CE1   . PHE D 4  91   ? 53.159  19.252  47.697  1.00 202.65 ? 91   PHE A CE1   1 
ATOM   1691  C  CE2   . PHE D 4  91   ? 53.338  17.487  49.297  1.00 199.03 ? 91   PHE A CE2   1 
ATOM   1692  C  CZ    . PHE D 4  91   ? 53.749  18.719  48.823  1.00 200.08 ? 91   PHE A CZ    1 
ATOM   1693  N  N     . HIS D 4  92   ? 49.586  14.008  45.516  1.00 148.36 ? 92   HIS A N     1 
ATOM   1694  C  CA    . HIS D 4  92   ? 48.398  13.218  45.228  1.00 124.45 ? 92   HIS A CA    1 
ATOM   1695  C  C     . HIS D 4  92   ? 47.450  13.305  46.416  1.00 122.67 ? 92   HIS A C     1 
ATOM   1696  O  O     . HIS D 4  92   ? 47.883  13.186  47.567  1.00 144.41 ? 92   HIS A O     1 
ATOM   1697  C  CB    . HIS D 4  92   ? 48.766  11.759  44.946  1.00 121.54 ? 92   HIS A CB    1 
ATOM   1698  C  CG    . HIS D 4  92   ? 47.759  11.034  44.112  1.00 125.50 ? 92   HIS A CG    1 
ATOM   1699  N  ND1   . HIS D 4  92   ? 46.506  10.704  44.580  1.00 128.62 ? 92   HIS A ND1   1 
ATOM   1700  C  CD2   . HIS D 4  92   ? 47.819  10.578  42.839  1.00 129.77 ? 92   HIS A CD2   1 
ATOM   1701  C  CE1   . HIS D 4  92   ? 45.837  10.075  43.631  1.00 131.27 ? 92   HIS A CE1   1 
ATOM   1702  N  NE2   . HIS D 4  92   ? 46.611  9.985   42.564  1.00 131.83 ? 92   HIS A NE2   1 
ATOM   1703  N  N     . VAL D 4  93   ? 46.161  13.521  46.138  1.00 111.00 ? 93   VAL A N     1 
ATOM   1704  C  CA    . VAL D 4  93   ? 45.179  13.667  47.214  1.00 113.08 ? 93   VAL A CA    1 
ATOM   1705  C  C     . VAL D 4  93   ? 45.108  12.396  48.049  1.00 130.25 ? 93   VAL A C     1 
ATOM   1706  O  O     . VAL D 4  93   ? 45.162  12.438  49.284  1.00 141.57 ? 93   VAL A O     1 
ATOM   1707  C  CB    . VAL D 4  93   ? 43.799  14.039  46.640  1.00 108.88 ? 93   VAL A CB    1 
ATOM   1708  C  CG1   . VAL D 4  93   ? 42.690  13.647  47.612  1.00 91.60  ? 93   VAL A CG1   1 
ATOM   1709  C  CG2   . VAL D 4  93   ? 43.736  15.523  46.342  1.00 108.77 ? 93   VAL A CG2   1 
ATOM   1710  N  N     . GLY D 4  94   ? 44.985  11.244  47.386  1.00 132.67 ? 94   GLY A N     1 
ATOM   1711  C  CA    . GLY D 4  94   ? 44.901  9.982   48.098  1.00 138.24 ? 94   GLY A CA    1 
ATOM   1712  C  C     . GLY D 4  94   ? 46.142  9.635   48.894  1.00 139.92 ? 94   GLY A C     1 
ATOM   1713  O  O     . GLY D 4  94   ? 46.086  8.758   49.762  1.00 144.87 ? 94   GLY A O     1 
ATOM   1714  N  N     . PHE D 4  95   ? 47.262  10.302  48.620  1.00 138.84 ? 95   PHE A N     1 
ATOM   1715  C  CA    . PHE D 4  95   ? 48.524  10.025  49.293  1.00 139.84 ? 95   PHE A CA    1 
ATOM   1716  C  C     . PHE D 4  95   ? 48.931  11.112  50.277  1.00 135.43 ? 95   PHE A C     1 
ATOM   1717  O  O     . PHE D 4  95   ? 49.959  10.961  50.945  1.00 121.50 ? 95   PHE A O     1 
ATOM   1718  C  CB    . PHE D 4  95   ? 49.640  9.822   48.259  1.00 140.87 ? 95   PHE A CB    1 
ATOM   1719  C  CG    . PHE D 4  95   ? 49.410  8.658   47.336  1.00 136.75 ? 95   PHE A CG    1 
ATOM   1720  C  CD1   . PHE D 4  95   ? 50.133  8.534   46.164  1.00 142.04 ? 95   PHE A CD1   1 
ATOM   1721  C  CD2   . PHE D 4  95   ? 48.483  7.677   47.650  1.00 127.06 ? 95   PHE A CD2   1 
ATOM   1722  C  CE1   . PHE D 4  95   ? 49.924  7.465   45.316  1.00 145.49 ? 95   PHE A CE1   1 
ATOM   1723  C  CE2   . PHE D 4  95   ? 48.269  6.609   46.807  1.00 123.29 ? 95   PHE A CE2   1 
ATOM   1724  C  CZ    . PHE D 4  95   ? 48.990  6.501   45.641  1.00 136.32 ? 95   PHE A CZ    1 
ATOM   1725  N  N     . ILE D 4  96   ? 48.161  12.202  50.381  1.00 126.86 ? 96   ILE A N     1 
ATOM   1726  C  CA    . ILE D 4  96   ? 48.489  13.276  51.321  1.00 123.43 ? 96   ILE A CA    1 
ATOM   1727  C  C     . ILE D 4  96   ? 48.662  12.718  52.727  1.00 128.77 ? 96   ILE A C     1 
ATOM   1728  O  O     . ILE D 4  96   ? 49.662  12.985  53.404  1.00 129.18 ? 96   ILE A O     1 
ATOM   1729  C  CB    . ILE D 4  96   ? 47.411  14.376  51.281  1.00 118.60 ? 96   ILE A CB    1 
ATOM   1730  C  CG1   . ILE D 4  96   ? 47.611  15.286  50.069  1.00 119.52 ? 96   ILE A CG1   1 
ATOM   1731  C  CG2   . ILE D 4  96   ? 47.417  15.193  52.569  1.00 107.64 ? 96   ILE A CG2   1 
ATOM   1732  C  CD1   . ILE D 4  96   ? 48.770  16.256  50.213  1.00 104.77 ? 96   ILE A CD1   1 
ATOM   1733  N  N     . ALA D 4  97   ? 47.686  11.932  53.186  1.00 136.39 ? 97   ALA A N     1 
ATOM   1734  C  CA    . ALA D 4  97   ? 47.797  11.313  54.504  1.00 147.35 ? 97   ALA A CA    1 
ATOM   1735  C  C     . ALA D 4  97   ? 49.017  10.403  54.586  1.00 150.63 ? 97   ALA A C     1 
ATOM   1736  O  O     . ALA D 4  97   ? 49.747  10.422  55.583  1.00 148.30 ? 97   ALA A O     1 
ATOM   1737  C  CB    . ALA D 4  97   ? 46.521  10.537  54.825  1.00 142.00 ? 97   ALA A CB    1 
ATOM   1738  N  N     . LYS D 4  98   ? 49.262  9.611   53.540  1.00 158.91 ? 98   LYS A N     1 
ATOM   1739  C  CA    . LYS D 4  98   ? 50.411  8.713   53.550  1.00 151.11 ? 98   LYS A CA    1 
ATOM   1740  C  C     . LYS D 4  98   ? 51.723  9.464   53.349  1.00 155.13 ? 98   LYS A C     1 
ATOM   1741  O  O     . LYS D 4  98   ? 52.752  9.055   53.898  1.00 168.11 ? 98   LYS A O     1 
ATOM   1742  C  CB    . LYS D 4  98   ? 50.247  7.629   52.482  1.00 136.64 ? 98   LYS A CB    1 
ATOM   1743  C  CG    . LYS D 4  98   ? 49.699  6.310   53.013  1.00 125.68 ? 98   LYS A CG    1 
ATOM   1744  C  CD    . LYS D 4  98   ? 50.193  5.136   52.184  1.00 119.72 ? 98   LYS A CD    1 
ATOM   1745  C  CE    . LYS D 4  98   ? 50.141  3.840   52.974  1.00 117.16 ? 98   LYS A CE    1 
ATOM   1746  N  NZ    . LYS D 4  98   ? 50.792  2.724   52.235  1.00 116.20 ? 98   LYS A NZ    1 
ATOM   1747  N  N     . ILE D 4  99   ? 51.711  10.554  52.578  1.00 134.92 ? 99   ILE A N     1 
ATOM   1748  C  CA    . ILE D 4  99   ? 52.946  11.294  52.323  1.00 133.94 ? 99   ILE A CA    1 
ATOM   1749  C  C     . ILE D 4  99   ? 53.466  11.935  53.605  1.00 130.72 ? 99   ILE A C     1 
ATOM   1750  O  O     . ILE D 4  99   ? 54.673  11.921  53.872  1.00 127.10 ? 99   ILE A O     1 
ATOM   1751  C  CB    . ILE D 4  99   ? 52.732  12.336  51.208  1.00 134.34 ? 99   ILE A CB    1 
ATOM   1752  C  CG1   . ILE D 4  99   ? 52.840  11.668  49.838  1.00 125.29 ? 99   ILE A CG1   1 
ATOM   1753  C  CG2   . ILE D 4  99   ? 53.740  13.472  51.315  1.00 144.96 ? 99   ILE A CG2   1 
ATOM   1754  C  CD1   . ILE D 4  99   ? 54.226  11.148  49.535  1.00 127.17 ? 99   ILE A CD1   1 
ATOM   1755  N  N     . LYS D 4  100  ? 52.574  12.502  54.422  1.00 130.48 ? 100  LYS A N     1 
ATOM   1756  C  CA    . LYS D 4  100  ? 53.029  13.086  55.679  1.00 135.32 ? 100  LYS A CA    1 
ATOM   1757  C  C     . LYS D 4  100  ? 53.450  12.005  56.667  1.00 151.48 ? 100  LYS A C     1 
ATOM   1758  O  O     . LYS D 4  100  ? 54.409  12.192  57.424  1.00 156.65 ? 100  LYS A O     1 
ATOM   1759  C  CB    . LYS D 4  100  ? 51.947  13.982  56.286  1.00 127.54 ? 100  LYS A CB    1 
ATOM   1760  C  CG    . LYS D 4  100  ? 50.666  13.288  56.705  1.00 125.28 ? 100  LYS A CG    1 
ATOM   1761  C  CD    . LYS D 4  100  ? 50.127  13.897  57.991  1.00 130.49 ? 100  LYS A CD    1 
ATOM   1762  C  CE    . LYS D 4  100  ? 49.186  12.942  58.698  1.00 132.99 ? 100  LYS A CE    1 
ATOM   1763  N  NZ    . LYS D 4  100  ? 48.198  12.361  57.749  1.00 130.13 ? 100  LYS A NZ    1 
ATOM   1764  N  N     . LYS D 4  101  ? 52.753  10.866  56.667  1.00 152.13 ? 101  LYS A N     1 
ATOM   1765  C  CA    . LYS D 4  101  ? 53.092  9.794   57.598  1.00 153.26 ? 101  LYS A CA    1 
ATOM   1766  C  C     . LYS D 4  101  ? 54.483  9.235   57.321  1.00 155.17 ? 101  LYS A C     1 
ATOM   1767  O  O     . LYS D 4  101  ? 55.264  9.013   58.253  1.00 167.24 ? 101  LYS A O     1 
ATOM   1768  C  CB    . LYS D 4  101  ? 52.041  8.686   57.539  1.00 149.78 ? 101  LYS A CB    1 
ATOM   1769  C  CG    . LYS D 4  101  ? 50.778  8.995   58.330  1.00 147.62 ? 101  LYS A CG    1 
ATOM   1770  C  CD    . LYS D 4  101  ? 49.890  7.769   58.461  1.00 138.62 ? 101  LYS A CD    1 
ATOM   1771  C  CE    . LYS D 4  101  ? 48.647  8.075   59.280  1.00 124.93 ? 101  LYS A CE    1 
ATOM   1772  N  NZ    . LYS D 4  101  ? 47.812  6.860   59.479  1.00 113.97 ? 101  LYS A NZ    1 
ATOM   1773  N  N     . VAL D 4  102  ? 54.814  9.000   56.048  1.00 146.47 ? 102  VAL A N     1 
ATOM   1774  C  CA    . VAL D 4  102  ? 56.164  8.545   55.725  1.00 142.89 ? 102  VAL A CA    1 
ATOM   1775  C  C     . VAL D 4  102  ? 57.175  9.657   55.987  1.00 154.71 ? 102  VAL A C     1 
ATOM   1776  O  O     . VAL D 4  102  ? 58.308  9.397   56.411  1.00 150.94 ? 102  VAL A O     1 
ATOM   1777  C  CB    . VAL D 4  102  ? 56.238  8.024   54.275  1.00 117.24 ? 102  VAL A CB    1 
ATOM   1778  C  CG1   . VAL D 4  102  ? 55.851  9.100   53.277  1.00 108.05 ? 102  VAL A CG1   1 
ATOM   1779  C  CG2   . VAL D 4  102  ? 57.629  7.485   53.966  1.00 113.52 ? 102  VAL A CG2   1 
ATOM   1780  N  N     . CYS D 4  103  ? 56.784  10.914  55.755  1.00 168.18 ? 103  CYS A N     1 
ATOM   1781  C  CA    . CYS D 4  103  ? 57.629  12.030  56.165  1.00 178.75 ? 103  CYS A CA    1 
ATOM   1782  C  C     . CYS D 4  103  ? 57.739  12.110  57.682  1.00 168.74 ? 103  CYS A C     1 
ATOM   1783  O  O     . CYS D 4  103  ? 58.723  12.643  58.207  1.00 174.23 ? 103  CYS A O     1 
ATOM   1784  C  CB    . CYS D 4  103  ? 57.093  13.345  55.595  1.00 203.24 ? 103  CYS A CB    1 
ATOM   1785  S  SG    . CYS D 4  103  ? 57.296  13.539  53.801  1.00 231.75 ? 103  CYS A SG    1 
ATOM   1786  N  N     . GLU D 4  104  ? 56.744  11.590  58.399  1.00 157.62 ? 104  GLU A N     1 
ATOM   1787  C  CA    . GLU D 4  104  ? 56.811  11.437  59.847  1.00 163.65 ? 104  GLU A CA    1 
ATOM   1788  C  C     . GLU D 4  104  ? 57.497  10.142  60.269  1.00 169.86 ? 104  GLU A C     1 
ATOM   1789  O  O     . GLU D 4  104  ? 57.623  9.886   61.471  1.00 164.40 ? 104  GLU A O     1 
ATOM   1790  C  CB    . GLU D 4  104  ? 55.400  11.502  60.449  1.00 157.92 ? 104  GLU A CB    1 
ATOM   1791  C  CG    . GLU D 4  104  ? 54.785  12.897  60.426  1.00 157.18 ? 104  GLU A CG    1 
ATOM   1792  C  CD    . GLU D 4  104  ? 53.299  12.899  60.740  1.00 161.09 ? 104  GLU A CD    1 
ATOM   1793  O  OE1   . GLU D 4  104  ? 52.667  11.826  60.645  1.00 162.70 ? 104  GLU A OE1   1 
ATOM   1794  O  OE2   . GLU D 4  104  ? 52.761  13.976  61.078  1.00 159.14 ? 104  GLU A OE2   1 
ATOM   1795  N  N     . CYS D 4  105  ? 57.939  9.323   59.312  1.00 173.77 ? 105  CYS A N     1 
ATOM   1796  C  CA    . CYS D 4  105  ? 58.619  8.063   59.600  1.00 173.52 ? 105  CYS A CA    1 
ATOM   1797  C  C     . CYS D 4  105  ? 60.048  8.020   59.069  1.00 165.10 ? 105  CYS A C     1 
ATOM   1798  O  O     . CYS D 4  105  ? 60.652  6.941   59.043  1.00 160.97 ? 105  CYS A O     1 
ATOM   1799  C  CB    . CYS D 4  105  ? 57.831  6.884   59.020  1.00 177.45 ? 105  CYS A CB    1 
ATOM   1800  S  SG    . CYS D 4  105  ? 56.264  6.529   59.835  1.00 174.06 ? 105  CYS A SG    1 
ATOM   1801  N  N     . VAL D 4  106  ? 60.607  9.154   58.641  1.00 168.61 ? 106  VAL A N     1 
ATOM   1802  C  CA    . VAL D 4  106  ? 61.942  9.186   58.053  1.00 176.62 ? 106  VAL A CA    1 
ATOM   1803  C  C     . VAL D 4  106  ? 62.533  10.572  58.273  1.00 195.33 ? 106  VAL A C     1 
ATOM   1804  O  O     . VAL D 4  106  ? 61.813  11.556  58.459  1.00 192.57 ? 106  VAL A O     1 
ATOM   1805  C  CB    . VAL D 4  106  ? 61.915  8.823   56.546  1.00 167.50 ? 106  VAL A CB    1 
ATOM   1806  C  CG1   . VAL D 4  106  ? 61.406  9.995   55.711  1.00 168.06 ? 106  VAL A CG1   1 
ATOM   1807  C  CG2   . VAL D 4  106  ? 63.283  8.362   56.071  1.00 163.68 ? 106  VAL A CG2   1 
ATOM   1808  N  N     . CYS D 4  107  ? 63.861  10.644  58.258  1.00 213.63 ? 107  CYS A N     1 
ATOM   1809  C  CA    . CYS D 4  107  ? 64.591  11.870  58.539  1.00 220.54 ? 107  CYS A CA    1 
ATOM   1810  C  C     . CYS D 4  107  ? 65.287  12.373  57.281  1.00 214.48 ? 107  CYS A C     1 
ATOM   1811  O  O     . CYS D 4  107  ? 65.600  11.599  56.373  1.00 210.47 ? 107  CYS A O     1 
ATOM   1812  C  CB    . CYS D 4  107  ? 65.617  11.646  59.656  1.00 228.40 ? 107  CYS A CB    1 
ATOM   1813  S  SG    . CYS D 4  107  ? 66.636  13.072  60.063  1.00 228.99 ? 107  CYS A SG    1 
ATOM   1814  N  N     . MET D 4  108  ? 65.519  13.684  57.231  1.00 213.85 ? 108  MET A N     1 
ATOM   1815  C  CA    . MET D 4  108  ? 66.183  14.282  56.085  1.00 212.50 ? 108  MET A CA    1 
ATOM   1816  C  C     . MET D 4  108  ? 67.689  14.034  56.146  1.00 222.61 ? 108  MET A C     1 
ATOM   1817  O  O     . MET D 4  108  ? 68.260  13.772  57.209  1.00 240.76 ? 108  MET A O     1 
ATOM   1818  C  CB    . MET D 4  108  ? 65.899  15.785  56.008  1.00 207.51 ? 108  MET A CB    1 
ATOM   1819  C  CG    . MET D 4  108  ? 66.574  16.620  57.089  1.00 213.11 ? 108  MET A CG    1 
ATOM   1820  S  SD    . MET D 4  108  ? 66.041  16.208  58.760  1.00 218.62 ? 108  MET A SD    1 
ATOM   1821  C  CE    . MET D 4  108  ? 64.277  16.491  58.637  1.00 208.09 ? 108  MET A CE    1 
ATOM   1822  N  N     . HIS D 4  109  ? 68.317  14.080  54.968  1.00 221.76 ? 109  HIS A N     1 
ATOM   1823  C  CA    . HIS D 4  109  ? 69.762  13.958  54.774  1.00 217.37 ? 109  HIS A CA    1 
ATOM   1824  C  C     . HIS D 4  109  ? 70.258  12.534  55.004  1.00 217.58 ? 109  HIS A C     1 
ATOM   1825  O  O     . HIS D 4  109  ? 71.421  12.226  54.722  1.00 213.11 ? 109  HIS A O     1 
ATOM   1826  C  CB    . HIS D 4  109  ? 70.528  14.929  55.683  1.00 210.76 ? 109  HIS A CB    1 
ATOM   1827  C  CG    . HIS D 4  109  ? 70.107  16.359  55.539  1.00 196.79 ? 109  HIS A CG    1 
ATOM   1828  N  ND1   . HIS D 4  109  ? 69.937  17.201  56.618  1.00 190.64 ? 109  HIS A ND1   1 
ATOM   1829  C  CD2   . HIS D 4  109  ? 69.815  17.094  54.440  1.00 192.65 ? 109  HIS A CD2   1 
ATOM   1830  C  CE1   . HIS D 4  109  ? 69.563  18.394  56.189  1.00 188.96 ? 109  HIS A CE1   1 
ATOM   1831  N  NE2   . HIS D 4  109  ? 69.481  18.355  54.872  1.00 191.94 ? 109  HIS A NE2   1 
ATOM   1832  N  N     . CYS D 4  110  ? 69.393  11.656  55.505  1.00 208.81 ? 110  CYS A N     1 
ATOM   1833  C  CA    . CYS D 4  110  ? 69.690  10.232  55.584  1.00 206.34 ? 110  CYS A CA    1 
ATOM   1834  C  C     . CYS D 4  110  ? 68.773  9.410   54.695  1.00 198.13 ? 110  CYS A C     1 
ATOM   1835  O  O     . CYS D 4  110  ? 69.235  8.515   53.980  1.00 194.21 ? 110  CYS A O     1 
ATOM   1836  C  CB    . CYS D 4  110  ? 69.584  9.736   57.034  1.00 215.45 ? 110  CYS A CB    1 
ATOM   1837  S  SG    . CYS D 4  110  ? 67.935  9.870   57.740  1.00 228.45 ? 110  CYS A SG    1 
ATOM   1838  N  N     . GLY D 4  111  ? 67.476  9.699   54.721  1.00 195.35 ? 111  GLY A N     1 
ATOM   1839  C  CA    . GLY D 4  111  ? 66.523  8.954   53.923  1.00 193.91 ? 111  GLY A CA    1 
ATOM   1840  C  C     . GLY D 4  111  ? 66.355  7.518   54.367  1.00 188.62 ? 111  GLY A C     1 
ATOM   1841  O  O     . GLY D 4  111  ? 66.252  6.620   53.522  1.00 189.91 ? 111  GLY A O     1 
ATOM   1842  N  N     . LYS D 4  112  ? 66.335  7.272   55.673  1.00 183.93 ? 112  LYS A N     1 
ATOM   1843  C  CA    . LYS D 4  112  ? 66.207  5.915   56.171  1.00 177.57 ? 112  LYS A CA    1 
ATOM   1844  C  C     . LYS D 4  112  ? 65.420  5.940   57.472  1.00 167.78 ? 112  LYS A C     1 
ATOM   1845  O  O     . LYS D 4  112  ? 65.451  6.926   58.214  1.00 163.55 ? 112  LYS A O     1 
ATOM   1846  C  CB    . LYS D 4  112  ? 67.590  5.267   56.356  1.00 179.36 ? 112  LYS A CB    1 
ATOM   1847  C  CG    . LYS D 4  112  ? 67.799  4.516   57.663  1.00 178.32 ? 112  LYS A CG    1 
ATOM   1848  C  CD    . LYS D 4  112  ? 69.262  4.163   57.901  1.00 181.91 ? 112  LYS A CD    1 
ATOM   1849  C  CE    . LYS D 4  112  ? 69.435  3.336   59.176  1.00 183.44 ? 112  LYS A CE    1 
ATOM   1850  N  NZ    . LYS D 4  112  ? 68.546  2.130   59.201  1.00 185.92 ? 112  LYS A NZ    1 
ATOM   1851  N  N     . LEU D 4  113  ? 64.689  4.852   57.715  1.00 167.27 ? 113  LEU A N     1 
ATOM   1852  C  CA    . LEU D 4  113  ? 63.985  4.654   58.974  1.00 159.71 ? 113  LEU A CA    1 
ATOM   1853  C  C     . LEU D 4  113  ? 64.905  4.882   60.170  1.00 180.17 ? 113  LEU A C     1 
ATOM   1854  O  O     . LEU D 4  113  ? 66.049  4.428   60.191  1.00 178.59 ? 113  LEU A O     1 
ATOM   1855  C  CB    . LEU D 4  113  ? 63.367  3.248   58.992  1.00 141.79 ? 113  LEU A CB    1 
ATOM   1856  C  CG    . LEU D 4  113  ? 64.167  2.068   58.405  1.00 137.86 ? 113  LEU A CG    1 
ATOM   1857  C  CD1   . LEU D 4  113  ? 65.336  1.640   59.284  1.00 149.21 ? 113  LEU A CD1   1 
ATOM   1858  C  CD2   . LEU D 4  113  ? 63.266  0.869   58.101  1.00 124.97 ? 113  LEU A CD2   1 
ATOM   1859  N  N     . LEU D 4  114  ? 64.387  5.611   61.164  1.00 190.11 ? 114  LEU A N     1 
ATOM   1860  C  CA    . LEU D 4  114  ? 65.204  6.037   62.296  1.00 195.18 ? 114  LEU A CA    1 
ATOM   1861  C  C     . LEU D 4  114  ? 65.584  4.871   63.200  1.00 199.46 ? 114  LEU A C     1 
ATOM   1862  O  O     . LEU D 4  114  ? 66.670  4.875   63.793  1.00 209.32 ? 114  LEU A O     1 
ATOM   1863  C  CB    . LEU D 4  114  ? 64.461  7.105   63.101  1.00 197.45 ? 114  LEU A CB    1 
ATOM   1864  C  CG    . LEU D 4  114  ? 63.563  8.056   62.304  1.00 202.15 ? 114  LEU A CG    1 
ATOM   1865  C  CD1   . LEU D 4  114  ? 62.847  9.039   63.213  1.00 203.87 ? 114  LEU A CD1   1 
ATOM   1866  C  CD2   . LEU D 4  114  ? 64.377  8.802   61.266  1.00 207.25 ? 114  LEU A CD2   1 
ATOM   1867  N  N     . LEU D 4  115  ? 64.712  3.876   63.318  1.00 186.37 ? 115  LEU A N     1 
ATOM   1868  C  CA    . LEU D 4  115  ? 64.922  2.746   64.208  1.00 174.83 ? 115  LEU A CA    1 
ATOM   1869  C  C     . LEU D 4  115  ? 65.158  1.482   63.388  1.00 168.60 ? 115  LEU A C     1 
ATOM   1870  O  O     . LEU D 4  115  ? 64.679  1.357   62.260  1.00 157.37 ? 115  LEU A O     1 
ATOM   1871  C  CB    . LEU D 4  115  ? 63.728  2.550   65.149  1.00 167.44 ? 115  LEU A CB    1 
ATOM   1872  C  CG    . LEU D 4  115  ? 63.377  3.702   66.102  1.00 160.42 ? 115  LEU A CG    1 
ATOM   1873  C  CD1   . LEU D 4  115  ? 64.632  4.328   66.694  1.00 161.74 ? 115  LEU A CD1   1 
ATOM   1874  C  CD2   . LEU D 4  115  ? 62.500  4.759   65.426  1.00 140.78 ? 115  LEU A CD2   1 
ATOM   1875  N  N     . ASP D 4  116  ? 65.889  0.541   63.972  1.00 177.74 ? 116  ASP A N     1 
ATOM   1876  C  CA    . ASP D 4  116  ? 66.305  -0.665  63.263  1.00 183.37 ? 116  ASP A CA    1 
ATOM   1877  C  C     . ASP D 4  116  ? 66.342  -1.821  64.256  1.00 192.76 ? 116  ASP A C     1 
ATOM   1878  O  O     . ASP D 4  116  ? 65.758  -1.742  65.340  1.00 169.01 ? 116  ASP A O     1 
ATOM   1879  C  CB    . ASP D 4  116  ? 67.662  -0.447  62.576  1.00 181.22 ? 116  ASP A CB    1 
ATOM   1880  C  CG    . ASP D 4  116  ? 67.824  -1.278  61.317  1.00 171.08 ? 116  ASP A CG    1 
ATOM   1881  O  OD1   . ASP D 4  116  ? 67.946  -0.686  60.225  1.00 165.63 ? 116  ASP A OD1   1 
ATOM   1882  O  OD2   . ASP D 4  116  ? 67.821  -2.524  61.415  1.00 165.38 ? 116  ASP A OD2   1 
ATOM   1883  N  N     . GLU D 4  117  ? 67.030  -2.902  63.880  1.00 216.47 ? 117  GLU A N     1 
ATOM   1884  C  CA    . GLU D 4  117  ? 67.162  -4.069  64.745  1.00 227.80 ? 117  GLU A CA    1 
ATOM   1885  C  C     . GLU D 4  117  ? 67.838  -3.751  66.074  1.00 227.71 ? 117  GLU A C     1 
ATOM   1886  O  O     . GLU D 4  117  ? 67.785  -4.582  66.990  1.00 241.49 ? 117  GLU A O     1 
ATOM   1887  C  CB    . GLU D 4  117  ? 67.946  -5.165  64.021  1.00 234.01 ? 117  GLU A CB    1 
ATOM   1888  C  CG    . GLU D 4  117  ? 69.450  -4.971  64.070  1.00 238.79 ? 117  GLU A CG    1 
ATOM   1889  C  CD    . GLU D 4  117  ? 70.140  -5.419  62.798  1.00 241.13 ? 117  GLU A CD    1 
ATOM   1890  O  OE1   . GLU D 4  117  ? 69.457  -5.526  61.757  1.00 241.69 ? 117  GLU A OE1   1 
ATOM   1891  O  OE2   . GLU D 4  117  ? 71.365  -5.659  62.838  1.00 242.23 ? 117  GLU A OE2   1 
ATOM   1892  N  N     . HIS D 4  118  ? 68.473  -2.583  66.202  1.00 218.23 ? 118  HIS A N     1 
ATOM   1893  C  CA    . HIS D 4  118  ? 69.076  -2.197  67.472  1.00 199.52 ? 118  HIS A CA    1 
ATOM   1894  C  C     . HIS D 4  118  ? 68.014  -2.066  68.556  1.00 194.52 ? 118  HIS A C     1 
ATOM   1895  O  O     . HIS D 4  118  ? 68.094  -2.708  69.610  1.00 192.63 ? 118  HIS A O     1 
ATOM   1896  C  CB    . HIS D 4  118  ? 69.851  -0.888  67.307  1.00 190.76 ? 118  HIS A CB    1 
ATOM   1897  C  CG    . HIS D 4  118  ? 70.958  -0.967  66.303  1.00 192.33 ? 118  HIS A CG    1 
ATOM   1898  N  ND1   . HIS D 4  118  ? 71.456  0.144   65.657  1.00 192.35 ? 118  HIS A ND1   1 
ATOM   1899  C  CD2   . HIS D 4  118  ? 71.666  -2.022  65.836  1.00 193.96 ? 118  HIS A CD2   1 
ATOM   1900  C  CE1   . HIS D 4  118  ? 72.419  -0.224  64.831  1.00 194.37 ? 118  HIS A CE1   1 
ATOM   1901  N  NE2   . HIS D 4  118  ? 72.568  -1.533  64.922  1.00 195.70 ? 118  HIS A NE2   1 
ATOM   1902  N  N     . ASN D 4  119  ? 66.999  -1.242  68.306  1.00 185.81 ? 119  ASN A N     1 
ATOM   1903  C  CA    . ASN D 4  119  ? 65.873  -1.136  69.224  1.00 183.81 ? 119  ASN A CA    1 
ATOM   1904  C  C     . ASN D 4  119  ? 64.986  -2.367  69.079  1.00 185.19 ? 119  ASN A C     1 
ATOM   1905  O  O     . ASN D 4  119  ? 64.486  -2.655  67.987  1.00 189.59 ? 119  ASN A O     1 
ATOM   1906  C  CB    . ASN D 4  119  ? 65.084  0.139   68.947  1.00 176.30 ? 119  ASN A CB    1 
ATOM   1907  C  CG    . ASN D 4  119  ? 63.970  0.362   69.948  1.00 174.49 ? 119  ASN A CG    1 
ATOM   1908  O  OD1   . ASN D 4  119  ? 62.937  -0.303  69.903  1.00 167.32 ? 119  ASN A OD1   1 
ATOM   1909  N  ND2   . ASN D 4  119  ? 64.178  1.302   70.863  1.00 176.81 ? 119  ASN A ND2   1 
ATOM   1910  N  N     . GLU D 4  120  ? 64.791  -3.094  70.182  1.00 183.28 ? 120  GLU A N     1 
ATOM   1911  C  CA    . GLU D 4  120  ? 64.033  -4.339  70.117  1.00 173.59 ? 120  GLU A CA    1 
ATOM   1912  C  C     . GLU D 4  120  ? 62.540  -4.090  69.945  1.00 167.87 ? 120  GLU A C     1 
ATOM   1913  O  O     . GLU D 4  120  ? 61.842  -4.920  69.350  1.00 180.85 ? 120  GLU A O     1 
ATOM   1914  C  CB    . GLU D 4  120  ? 64.289  -5.180  71.367  1.00 165.28 ? 120  GLU A CB    1 
ATOM   1915  C  CG    . GLU D 4  120  ? 65.740  -5.589  71.551  1.00 167.63 ? 120  GLU A CG    1 
ATOM   1916  C  CD    . GLU D 4  120  ? 65.896  -7.075  71.805  1.00 171.87 ? 120  GLU A CD    1 
ATOM   1917  O  OE1   . GLU D 4  120  ? 64.876  -7.796  71.772  1.00 166.20 ? 120  GLU A OE1   1 
ATOM   1918  O  OE2   . GLU D 4  120  ? 67.038  -7.523  72.038  1.00 176.52 ? 120  GLU A OE2   1 
ATOM   1919  N  N     . LEU D 4  121  ? 62.030  -2.966  70.454  1.00 140.26 ? 121  LEU A N     1 
ATOM   1920  C  CA    . LEU D 4  121  ? 60.609  -2.669  70.293  1.00 135.37 ? 121  LEU A CA    1 
ATOM   1921  C  C     . LEU D 4  121  ? 60.262  -2.420  68.830  1.00 141.28 ? 121  LEU A C     1 
ATOM   1922  O  O     . LEU D 4  121  ? 59.213  -2.867  68.350  1.00 127.23 ? 121  LEU A O     1 
ATOM   1923  C  CB    . LEU D 4  121  ? 60.220  -1.468  71.156  1.00 126.47 ? 121  LEU A CB    1 
ATOM   1924  C  CG    . LEU D 4  121  ? 58.782  -0.958  71.022  1.00 121.51 ? 121  LEU A CG    1 
ATOM   1925  C  CD1   . LEU D 4  121  ? 57.780  -2.079  71.265  1.00 114.14 ? 121  LEU A CD1   1 
ATOM   1926  C  CD2   . LEU D 4  121  ? 58.534  0.199   71.980  1.00 107.61 ? 121  LEU A CD2   1 
ATOM   1927  N  N     . MET D 4  122  ? 61.128  -1.709  68.105  1.00 156.39 ? 122  MET A N     1 
ATOM   1928  C  CA    . MET D 4  122  ? 60.930  -1.564  66.668  1.00 162.05 ? 122  MET A CA    1 
ATOM   1929  C  C     . MET D 4  122  ? 61.176  -2.882  65.947  1.00 170.21 ? 122  MET A C     1 
ATOM   1930  O  O     . MET D 4  122  ? 60.435  -3.240  65.024  1.00 154.96 ? 122  MET A O     1 
ATOM   1931  C  CB    . MET D 4  122  ? 61.848  -0.475  66.115  1.00 164.81 ? 122  MET A CB    1 
ATOM   1932  C  CG    . MET D 4  122  ? 61.734  -0.290  64.612  1.00 160.65 ? 122  MET A CG    1 
ATOM   1933  S  SD    . MET D 4  122  ? 60.045  0.081   64.109  1.00 159.80 ? 122  MET A SD    1 
ATOM   1934  C  CE    . MET D 4  122  ? 59.728  1.558   65.073  1.00 144.42 ? 122  MET A CE    1 
ATOM   1935  N  N     . ARG D 4  123  ? 62.215  -3.616  66.356  1.00 194.66 ? 123  ARG A N     1 
ATOM   1936  C  CA    . ARG D 4  123  ? 62.491  -4.914  65.749  1.00 201.72 ? 123  ARG A CA    1 
ATOM   1937  C  C     . ARG D 4  123  ? 61.333  -5.878  65.971  1.00 197.09 ? 123  ARG A C     1 
ATOM   1938  O  O     . ARG D 4  123  ? 61.026  -6.703  65.102  1.00 194.05 ? 123  ARG A O     1 
ATOM   1939  C  CB    . ARG D 4  123  ? 63.794  -5.488  66.308  1.00 207.70 ? 123  ARG A CB    1 
ATOM   1940  C  CG    . ARG D 4  123  ? 64.163  -6.854  65.747  1.00 206.85 ? 123  ARG A CG    1 
ATOM   1941  C  CD    . ARG D 4  123  ? 65.636  -7.170  65.961  1.00 204.55 ? 123  ARG A CD    1 
ATOM   1942  N  NE    . ARG D 4  123  ? 65.960  -7.426  67.360  1.00 203.82 ? 123  ARG A NE    1 
ATOM   1943  C  CZ    . ARG D 4  123  ? 65.986  -8.636  67.909  1.00 198.79 ? 123  ARG A CZ    1 
ATOM   1944  N  NH1   . ARG D 4  123  ? 65.708  -9.705  67.175  1.00 195.77 ? 123  ARG A NH1   1 
ATOM   1945  N  NH2   . ARG D 4  123  ? 66.294  -8.780  69.191  1.00 191.99 ? 123  ARG A NH2   1 
ATOM   1946  N  N     . GLN D 4  124  ? 60.673  -5.786  67.128  1.00 192.43 ? 124  GLN A N     1 
ATOM   1947  C  CA    . GLN D 4  124  ? 59.459  -6.564  67.348  1.00 176.65 ? 124  GLN A CA    1 
ATOM   1948  C  C     . GLN D 4  124  ? 58.366  -6.156  66.368  1.00 166.81 ? 124  GLN A C     1 
ATOM   1949  O  O     . GLN D 4  124  ? 57.643  -7.010  65.839  1.00 181.45 ? 124  GLN A O     1 
ATOM   1950  C  CB    . GLN D 4  124  ? 58.977  -6.392  68.788  1.00 170.05 ? 124  GLN A CB    1 
ATOM   1951  C  CG    . GLN D 4  124  ? 57.669  -7.106  69.094  1.00 166.34 ? 124  GLN A CG    1 
ATOM   1952  C  CD    . GLN D 4  124  ? 56.889  -6.437  70.207  1.00 170.80 ? 124  GLN A CD    1 
ATOM   1953  O  OE1   . GLN D 4  124  ? 57.275  -5.376  70.699  1.00 178.47 ? 124  GLN A OE1   1 
ATOM   1954  N  NE2   . GLN D 4  124  ? 55.779  -7.049  70.603  1.00 165.52 ? 124  GLN A NE2   1 
ATOM   1955  N  N     . ALA D 4  125  ? 58.232  -4.852  66.112  1.00 132.41 ? 125  ALA A N     1 
ATOM   1956  C  CA    . ALA D 4  125  ? 57.222  -4.380  65.172  1.00 104.10 ? 125  ALA A CA    1 
ATOM   1957  C  C     . ALA D 4  125  ? 57.556  -4.772  63.737  1.00 105.70 ? 125  ALA A C     1 
ATOM   1958  O  O     . ALA D 4  125  ? 56.647  -4.992  62.930  1.00 94.50  ? 125  ALA A O     1 
ATOM   1959  C  CB    . ALA D 4  125  ? 57.067  -2.863  65.288  1.00 95.30  ? 125  ALA A CB    1 
ATOM   1960  N  N     . LEU D 4  126  ? 58.846  -4.878  63.406  1.00 140.26 ? 126  LEU A N     1 
ATOM   1961  C  CA    . LEU D 4  126  ? 59.267  -5.212  62.050  1.00 152.38 ? 126  LEU A CA    1 
ATOM   1962  C  C     . LEU D 4  126  ? 58.994  -6.664  61.676  1.00 155.00 ? 126  LEU A C     1 
ATOM   1963  O  O     . LEU D 4  126  ? 59.067  -6.998  60.489  1.00 150.20 ? 126  LEU A O     1 
ATOM   1964  C  CB    . LEU D 4  126  ? 60.762  -4.919  61.877  1.00 151.62 ? 126  LEU A CB    1 
ATOM   1965  C  CG    . LEU D 4  126  ? 61.194  -3.450  61.854  1.00 142.77 ? 126  LEU A CG    1 
ATOM   1966  C  CD1   . LEU D 4  126  ? 62.575  -3.284  62.469  1.00 139.17 ? 126  LEU A CD1   1 
ATOM   1967  C  CD2   . LEU D 4  126  ? 61.160  -2.895  60.438  1.00 147.14 ? 126  LEU A CD2   1 
ATOM   1968  N  N     . ALA D 4  127  ? 58.682  -7.527  62.647  1.00 153.73 ? 127  ALA A N     1 
ATOM   1969  C  CA    . ALA D 4  127  ? 58.574  -8.957  62.365  1.00 149.64 ? 127  ALA A CA    1 
ATOM   1970  C  C     . ALA D 4  127  ? 57.363  -9.278  61.497  1.00 154.70 ? 127  ALA A C     1 
ATOM   1971  O  O     . ALA D 4  127  ? 57.440  -10.141 60.615  1.00 143.26 ? 127  ALA A O     1 
ATOM   1972  C  CB    . ALA D 4  127  ? 58.515  -9.744  63.674  1.00 144.07 ? 127  ALA A CB    1 
ATOM   1973  N  N     . ILE D 4  128  ? 56.234  -8.607  61.737  1.00 159.32 ? 128  ILE A N     1 
ATOM   1974  C  CA    . ILE D 4  128  ? 55.008  -8.924  61.014  1.00 166.33 ? 128  ILE A CA    1 
ATOM   1975  C  C     . ILE D 4  128  ? 55.167  -8.561  59.543  1.00 188.00 ? 128  ILE A C     1 
ATOM   1976  O  O     . ILE D 4  128  ? 55.713  -7.504  59.195  1.00 194.86 ? 128  ILE A O     1 
ATOM   1977  C  CB    . ILE D 4  128  ? 53.809  -8.202  61.655  1.00 154.40 ? 128  ILE A CB    1 
ATOM   1978  C  CG1   . ILE D 4  128  ? 52.531  -8.448  60.847  1.00 159.86 ? 128  ILE A CG1   1 
ATOM   1979  C  CG2   . ILE D 4  128  ? 54.089  -6.712  61.810  1.00 150.42 ? 128  ILE A CG2   1 
ATOM   1980  C  CD1   . ILE D 4  128  ? 52.131  -9.909  60.764  1.00 154.89 ? 128  ILE A CD1   1 
ATOM   1981  N  N     . LYS D 4  129  ? 54.693  -9.448  58.665  1.00 195.51 ? 129  LYS A N     1 
ATOM   1982  C  CA    . LYS D 4  129  ? 54.884  -9.311  57.227  1.00 191.89 ? 129  LYS A CA    1 
ATOM   1983  C  C     . LYS D 4  129  ? 53.750  -8.573  56.527  1.00 175.31 ? 129  LYS A C     1 
ATOM   1984  O  O     . LYS D 4  129  ? 53.924  -8.160  55.375  1.00 171.28 ? 129  LYS A O     1 
ATOM   1985  C  CB    . LYS D 4  129  ? 55.058  -10.694 56.585  1.00 197.98 ? 129  LYS A CB    1 
ATOM   1986  C  CG    . LYS D 4  129  ? 53.753  -11.446 56.368  1.00 196.59 ? 129  LYS A CG    1 
ATOM   1987  C  CD    . LYS D 4  129  ? 54.004  -12.869 55.899  1.00 192.80 ? 129  LYS A CD    1 
ATOM   1988  C  CE    . LYS D 4  129  ? 54.198  -13.807 57.079  1.00 188.71 ? 129  LYS A CE    1 
ATOM   1989  N  NZ    . LYS D 4  129  ? 54.269  -15.230 56.650  1.00 185.68 ? 129  LYS A NZ    1 
ATOM   1990  N  N     . ASP D 4  130  ? 52.603  -8.396  57.178  1.00 154.07 ? 130  ASP A N     1 
ATOM   1991  C  CA    . ASP D 4  130  ? 51.480  -7.706  56.554  1.00 157.08 ? 130  ASP A CA    1 
ATOM   1992  C  C     . ASP D 4  130  ? 51.755  -6.207  56.549  1.00 156.61 ? 130  ASP A C     1 
ATOM   1993  O  O     . ASP D 4  130  ? 51.892  -5.592  57.611  1.00 150.49 ? 130  ASP A O     1 
ATOM   1994  C  CB    . ASP D 4  130  ? 50.178  -8.025  57.287  1.00 159.69 ? 130  ASP A CB    1 
ATOM   1995  C  CG    . ASP D 4  130  ? 48.960  -7.377  56.640  1.00 159.30 ? 130  ASP A CG    1 
ATOM   1996  O  OD1   . ASP D 4  130  ? 48.850  -6.133  56.662  1.00 160.04 ? 130  ASP A OD1   1 
ATOM   1997  O  OD2   . ASP D 4  130  ? 48.108  -8.118  56.106  1.00 157.07 ? 130  ASP A OD2   1 
ATOM   1998  N  N     . SER D 4  131  ? 51.823  -5.623  55.349  1.00 157.23 ? 131  SER A N     1 
ATOM   1999  C  CA    . SER D 4  131  ? 52.197  -4.217  55.218  1.00 148.06 ? 131  SER A CA    1 
ATOM   2000  C  C     . SER D 4  131  ? 51.156  -3.294  55.842  1.00 157.21 ? 131  SER A C     1 
ATOM   2001  O  O     . SER D 4  131  ? 51.509  -2.278  56.452  1.00 155.56 ? 131  SER A O     1 
ATOM   2002  C  CB    . SER D 4  131  ? 52.403  -3.873  53.743  1.00 132.84 ? 131  SER A CB    1 
ATOM   2003  O  OG    . SER D 4  131  ? 53.313  -4.772  53.134  1.00 126.08 ? 131  SER A OG    1 
ATOM   2004  N  N     . LYS D 4  132  ? 49.870  -3.627  55.696  1.00 159.86 ? 132  LYS A N     1 
ATOM   2005  C  CA    . LYS D 4  132  ? 48.811  -2.776  56.232  1.00 149.85 ? 132  LYS A CA    1 
ATOM   2006  C  C     . LYS D 4  132  ? 48.926  -2.617  57.744  1.00 157.54 ? 132  LYS A C     1 
ATOM   2007  O  O     . LYS D 4  132  ? 48.740  -1.515  58.275  1.00 152.87 ? 132  LYS A O     1 
ATOM   2008  C  CB    . LYS D 4  132  ? 47.443  -3.349  55.862  1.00 130.93 ? 132  LYS A CB    1 
ATOM   2009  C  CG    . LYS D 4  132  ? 47.268  -3.641  54.383  1.00 128.71 ? 132  LYS A CG    1 
ATOM   2010  C  CD    . LYS D 4  132  ? 47.451  -2.380  53.558  1.00 142.90 ? 132  LYS A CD    1 
ATOM   2011  C  CE    . LYS D 4  132  ? 47.178  -2.640  52.090  1.00 150.50 ? 132  LYS A CE    1 
ATOM   2012  N  NZ    . LYS D 4  132  ? 47.165  -1.379  51.302  1.00 149.77 ? 132  LYS A NZ    1 
ATOM   2013  N  N     . LYS D 4  133  ? 49.226  -3.706  58.455  1.00 154.59 ? 133  LYS A N     1 
ATOM   2014  C  CA    . LYS D 4  133  ? 49.253  -3.657  59.913  1.00 139.89 ? 133  LYS A CA    1 
ATOM   2015  C  C     . LYS D 4  133  ? 50.567  -3.093  60.445  1.00 119.89 ? 133  LYS A C     1 
ATOM   2016  O  O     . LYS D 4  133  ? 50.561  -2.298  61.392  1.00 119.51 ? 133  LYS A O     1 
ATOM   2017  C  CB    . LYS D 4  133  ? 48.999  -5.051  60.489  1.00 149.87 ? 133  LYS A CB    1 
ATOM   2018  C  CG    . LYS D 4  133  ? 47.527  -5.441  60.538  1.00 160.03 ? 133  LYS A CG    1 
ATOM   2019  C  CD    . LYS D 4  133  ? 47.171  -6.479  59.482  1.00 161.98 ? 133  LYS A CD    1 
ATOM   2020  C  CE    . LYS D 4  133  ? 47.654  -7.866  59.885  1.00 154.32 ? 133  LYS A CE    1 
ATOM   2021  N  NZ    . LYS D 4  133  ? 47.311  -8.903  58.871  1.00 143.71 ? 133  LYS A NZ    1 
ATOM   2022  N  N     . ARG D 4  134  ? 51.700  -3.487  59.853  1.00 123.27 ? 134  ARG A N     1 
ATOM   2023  C  CA    . ARG D 4  134  ? 52.995  -3.053  60.371  1.00 118.93 ? 134  ARG A CA    1 
ATOM   2024  C  C     . ARG D 4  134  ? 53.174  -1.545  60.237  1.00 121.58 ? 134  ARG A C     1 
ATOM   2025  O  O     . ARG D 4  134  ? 53.762  -0.906  61.117  1.00 120.05 ? 134  ARG A O     1 
ATOM   2026  C  CB    . ARG D 4  134  ? 54.131  -3.784  59.651  1.00 107.99 ? 134  ARG A CB    1 
ATOM   2027  C  CG    . ARG D 4  134  ? 54.165  -3.539  58.151  1.00 103.38 ? 134  ARG A CG    1 
ATOM   2028  C  CD    . ARG D 4  134  ? 55.538  -3.777  57.559  1.00 108.88 ? 134  ARG A CD    1 
ATOM   2029  N  NE    . ARG D 4  134  ? 55.934  -5.180  57.596  1.00 127.05 ? 134  ARG A NE    1 
ATOM   2030  C  CZ    . ARG D 4  134  ? 56.897  -5.700  56.841  1.00 139.14 ? 134  ARG A CZ    1 
ATOM   2031  N  NH1   . ARG D 4  134  ? 57.200  -6.987  56.937  1.00 138.12 ? 134  ARG A NH1   1 
ATOM   2032  N  NH2   . ARG D 4  134  ? 57.554  -4.930  55.986  1.00 143.51 ? 134  ARG A NH2   1 
ATOM   2033  N  N     . PHE D 4  135  ? 52.668  -0.959  59.149  1.00 131.85 ? 135  PHE A N     1 
ATOM   2034  C  CA    . PHE D 4  135  ? 52.895  0.459   58.893  1.00 139.42 ? 135  PHE A CA    1 
ATOM   2035  C  C     . PHE D 4  135  ? 52.180  1.332   59.917  1.00 129.28 ? 135  PHE A C     1 
ATOM   2036  O  O     . PHE D 4  135  ? 52.707  2.373   60.327  1.00 129.53 ? 135  PHE A O     1 
ATOM   2037  C  CB    . PHE D 4  135  ? 52.449  0.808   57.470  1.00 145.18 ? 135  PHE A CB    1 
ATOM   2038  C  CG    . PHE D 4  135  ? 52.476  2.280   57.166  1.00 137.29 ? 135  PHE A CG    1 
ATOM   2039  C  CD1   . PHE D 4  135  ? 53.643  2.887   56.733  1.00 138.23 ? 135  PHE A CD1   1 
ATOM   2040  C  CD2   . PHE D 4  135  ? 51.333  3.053   57.295  1.00 131.99 ? 135  PHE A CD2   1 
ATOM   2041  C  CE1   . PHE D 4  135  ? 53.674  4.240   56.451  1.00 139.29 ? 135  PHE A CE1   1 
ATOM   2042  C  CE2   . PHE D 4  135  ? 51.358  4.406   57.014  1.00 134.75 ? 135  PHE A CE2   1 
ATOM   2043  C  CZ    . PHE D 4  135  ? 52.530  4.999   56.590  1.00 138.24 ? 135  PHE A CZ    1 
ATOM   2044  N  N     . ALA D 4  136  ? 50.983  0.925   60.344  1.00 121.22 ? 136  ALA A N     1 
ATOM   2045  C  CA    . ALA D 4  136  ? 50.240  1.713   61.323  1.00 117.19 ? 136  ALA A CA    1 
ATOM   2046  C  C     . ALA D 4  136  ? 50.965  1.762   62.663  1.00 129.27 ? 136  ALA A C     1 
ATOM   2047  O  O     . ALA D 4  136  ? 51.041  2.821   63.297  1.00 110.35 ? 136  ALA A O     1 
ATOM   2048  C  CB    . ALA D 4  136  ? 48.831  1.145   61.492  1.00 97.71  ? 136  ALA A CB    1 
ATOM   2049  N  N     . ALA D 4  137  ? 51.507  0.627   63.110  1.00 149.95 ? 137  ALA A N     1 
ATOM   2050  C  CA    . ALA D 4  137  ? 52.256  0.605   64.363  1.00 146.00 ? 137  ALA A CA    1 
ATOM   2051  C  C     . ALA D 4  137  ? 53.555  1.393   64.244  1.00 152.35 ? 137  ALA A C     1 
ATOM   2052  O  O     . ALA D 4  137  ? 53.877  2.207   65.117  1.00 153.25 ? 137  ALA A O     1 
ATOM   2053  C  CB    . ALA D 4  137  ? 52.538  -0.838  64.780  1.00 139.67 ? 137  ALA A CB    1 
ATOM   2054  N  N     . ILE D 4  138  ? 54.315  1.158   63.167  1.00 151.48 ? 138  ILE A N     1 
ATOM   2055  C  CA    . ILE D 4  138  ? 55.590  1.848   62.962  1.00 146.68 ? 138  ILE A CA    1 
ATOM   2056  C  C     . ILE D 4  138  ? 55.409  3.355   63.078  1.00 140.22 ? 138  ILE A C     1 
ATOM   2057  O  O     . ILE D 4  138  ? 56.131  4.032   63.820  1.00 137.46 ? 138  ILE A O     1 
ATOM   2058  C  CB    . ILE D 4  138  ? 56.196  1.463   61.600  1.00 145.36 ? 138  ILE A CB    1 
ATOM   2059  C  CG1   . ILE D 4  138  ? 56.695  0.016   61.615  1.00 136.60 ? 138  ILE A CG1   1 
ATOM   2060  C  CG2   . ILE D 4  138  ? 57.318  2.424   61.219  1.00 144.90 ? 138  ILE A CG2   1 
ATOM   2061  C  CD1   . ILE D 4  138  ? 57.000  -0.537  60.234  1.00 126.20 ? 138  ILE A CD1   1 
ATOM   2062  N  N     . TRP D 4  139  ? 54.438  3.902   62.342  1.00 147.98 ? 139  TRP A N     1 
ATOM   2063  C  CA    . TRP D 4  139  ? 54.196  5.340   62.391  1.00 168.28 ? 139  TRP A CA    1 
ATOM   2064  C  C     . TRP D 4  139  ? 53.775  5.782   63.788  1.00 189.69 ? 139  TRP A C     1 
ATOM   2065  O  O     . TRP D 4  139  ? 54.214  6.831   64.273  1.00 199.54 ? 139  TRP A O     1 
ATOM   2066  C  CB    . TRP D 4  139  ? 53.140  5.733   61.356  1.00 163.51 ? 139  TRP A CB    1 
ATOM   2067  C  CG    . TRP D 4  139  ? 52.559  7.092   61.598  1.00 163.19 ? 139  TRP A CG    1 
ATOM   2068  C  CD1   . TRP D 4  139  ? 53.013  8.280   61.103  1.00 167.13 ? 139  TRP A CD1   1 
ATOM   2069  C  CD2   . TRP D 4  139  ? 51.418  7.402   62.405  1.00 172.25 ? 139  TRP A CD2   1 
ATOM   2070  N  NE1   . TRP D 4  139  ? 52.225  9.312   61.555  1.00 178.85 ? 139  TRP A NE1   1 
ATOM   2071  C  CE2   . TRP D 4  139  ? 51.239  8.798   62.356  1.00 182.98 ? 139  TRP A CE2   1 
ATOM   2072  C  CE3   . TRP D 4  139  ? 50.532  6.634   63.167  1.00 173.75 ? 139  TRP A CE3   1 
ATOM   2073  C  CZ2   . TRP D 4  139  ? 50.210  9.441   63.039  1.00 190.40 ? 139  TRP A CZ2   1 
ATOM   2074  C  CZ3   . TRP D 4  139  ? 49.514  7.273   63.843  1.00 180.37 ? 139  TRP A CZ3   1 
ATOM   2075  C  CH2   . TRP D 4  139  ? 49.362  8.662   63.777  1.00 187.99 ? 139  TRP A CH2   1 
ATOM   2076  N  N     . THR D 4  140  ? 52.925  4.992   64.453  1.00 181.43 ? 140  THR A N     1 
ATOM   2077  C  CA    . THR D 4  140  ? 52.518  5.325   65.816  1.00 167.11 ? 140  THR A CA    1 
ATOM   2078  C  C     . THR D 4  140  ? 53.705  5.297   66.770  1.00 162.84 ? 140  THR A C     1 
ATOM   2079  O  O     . THR D 4  140  ? 53.701  5.996   67.790  1.00 158.56 ? 140  THR A O     1 
ATOM   2080  C  CB    . THR D 4  140  ? 51.427  4.361   66.295  1.00 156.38 ? 140  THR A CB    1 
ATOM   2081  O  OG1   . THR D 4  140  ? 50.483  4.140   65.240  1.00 159.24 ? 140  THR A OG1   1 
ATOM   2082  C  CG2   . THR D 4  140  ? 50.692  4.934   67.502  1.00 134.61 ? 140  THR A CG2   1 
ATOM   2083  N  N     . LEU D 4  141  ? 54.731  4.507   66.452  1.00 169.85 ? 141  LEU A N     1 
ATOM   2084  C  CA    . LEU D 4  141  ? 55.935  4.438   67.268  1.00 178.94 ? 141  LEU A CA    1 
ATOM   2085  C  C     . LEU D 4  141  ? 57.023  5.403   66.814  1.00 179.50 ? 141  LEU A C     1 
ATOM   2086  O  O     . LEU D 4  141  ? 57.887  5.762   67.622  1.00 178.83 ? 141  LEU A O     1 
ATOM   2087  C  CB    . LEU D 4  141  ? 56.495  3.010   67.266  1.00 178.23 ? 141  LEU A CB    1 
ATOM   2088  C  CG    . LEU D 4  141  ? 55.548  1.891   67.712  1.00 168.42 ? 141  LEU A CG    1 
ATOM   2089  C  CD1   . LEU D 4  141  ? 56.295  0.573   67.866  1.00 159.41 ? 141  LEU A CD1   1 
ATOM   2090  C  CD2   . LEU D 4  141  ? 54.824  2.262   68.999  1.00 162.88 ? 141  LEU A CD2   1 
ATOM   2091  N  N     . CYS D 4  142  ? 57.004  5.833   65.552  1.00 158.77 ? 142  CYS A N     1 
ATOM   2092  C  CA    . CYS D 4  142  ? 58.019  6.731   65.015  1.00 144.67 ? 142  CYS A CA    1 
ATOM   2093  C  C     . CYS D 4  142  ? 57.576  8.186   64.969  1.00 138.16 ? 142  CYS A C     1 
ATOM   2094  O  O     . CYS D 4  142  ? 58.362  9.042   64.552  1.00 133.75 ? 142  CYS A O     1 
ATOM   2095  C  CB    . CYS D 4  142  ? 58.435  6.287   63.608  1.00 138.15 ? 142  CYS A CB    1 
ATOM   2096  S  SG    . CYS D 4  142  ? 59.440  4.791   63.557  1.00 146.11 ? 142  CYS A SG    1 
ATOM   2097  N  N     . LYS D 4  143  ? 56.343  8.492   65.381  1.00 150.54 ? 143  LYS A N     1 
ATOM   2098  C  CA    . LYS D 4  143  ? 55.878  9.874   65.318  1.00 153.82 ? 143  LYS A CA    1 
ATOM   2099  C  C     . LYS D 4  143  ? 56.530  10.741  66.389  1.00 163.92 ? 143  LYS A C     1 
ATOM   2100  O  O     . LYS D 4  143  ? 56.743  11.939  66.168  1.00 171.04 ? 143  LYS A O     1 
ATOM   2101  C  CB    . LYS D 4  143  ? 54.353  9.927   65.439  1.00 149.49 ? 143  LYS A CB    1 
ATOM   2102  C  CG    . LYS D 4  143  ? 53.789  9.260   66.684  1.00 150.44 ? 143  LYS A CG    1 
ATOM   2103  C  CD    . LYS D 4  143  ? 52.270  9.172   66.621  1.00 142.83 ? 143  LYS A CD    1 
ATOM   2104  C  CE    . LYS D 4  143  ? 51.642  10.550  66.477  1.00 133.95 ? 143  LYS A CE    1 
ATOM   2105  N  NZ    . LYS D 4  143  ? 50.158  10.484  66.364  1.00 116.40 ? 143  LYS A NZ    1 
ATOM   2106  N  N     . THR D 4  144  ? 56.855  10.162  67.549  1.00 160.85 ? 144  THR A N     1 
ATOM   2107  C  CA    . THR D 4  144  ? 57.483  10.944  68.610  1.00 160.62 ? 144  THR A CA    1 
ATOM   2108  C  C     . THR D 4  144  ? 58.945  11.245  68.304  1.00 165.89 ? 144  THR A C     1 
ATOM   2109  O  O     . THR D 4  144  ? 59.458  12.290  68.719  1.00 160.55 ? 144  THR A O     1 
ATOM   2110  C  CB    . THR D 4  144  ? 57.374  10.216  69.953  1.00 148.36 ? 144  THR A CB    1 
ATOM   2111  O  OG1   . THR D 4  144  ? 57.836  8.867   69.812  1.00 142.91 ? 144  THR A OG1   1 
ATOM   2112  C  CG2   . THR D 4  144  ? 55.930  10.205  70.444  1.00 149.44 ? 144  THR A CG2   1 
ATOM   2113  N  N     . LYS D 4  145  ? 59.628  10.344  67.596  1.00 179.20 ? 145  LYS A N     1 
ATOM   2114  C  CA    . LYS D 4  145  ? 61.049  10.517  67.311  1.00 185.81 ? 145  LYS A CA    1 
ATOM   2115  C  C     . LYS D 4  145  ? 61.302  11.840  66.596  1.00 189.46 ? 145  LYS A C     1 
ATOM   2116  O  O     . LYS D 4  145  ? 60.624  12.176  65.622  1.00 194.05 ? 145  LYS A O     1 
ATOM   2117  C  CB    . LYS D 4  145  ? 61.563  9.352   66.464  1.00 187.68 ? 145  LYS A CB    1 
ATOM   2118  C  CG    . LYS D 4  145  ? 62.158  8.196   67.257  1.00 188.92 ? 145  LYS A CG    1 
ATOM   2119  C  CD    . LYS D 4  145  ? 61.106  7.460   68.070  1.00 189.29 ? 145  LYS A CD    1 
ATOM   2120  C  CE    . LYS D 4  145  ? 61.726  6.311   68.847  1.00 190.81 ? 145  LYS A CE    1 
ATOM   2121  N  NZ    . LYS D 4  145  ? 60.708  5.542   69.612  1.00 189.30 ? 145  LYS A NZ    1 
ATOM   2122  N  N     . MET D 4  146  ? 62.289  12.593  67.090  1.00 185.99 ? 146  MET A N     1 
ATOM   2123  C  CA    . MET D 4  146  ? 62.582  13.920  66.572  1.00 192.56 ? 146  MET A CA    1 
ATOM   2124  C  C     . MET D 4  146  ? 64.047  14.125  66.211  1.00 207.12 ? 146  MET A C     1 
ATOM   2125  O  O     . MET D 4  146  ? 64.399  15.201  65.715  1.00 196.14 ? 146  MET A O     1 
ATOM   2126  C  CB    . MET D 4  146  ? 62.170  14.995  67.589  1.00 199.26 ? 146  MET A CB    1 
ATOM   2127  C  CG    . MET D 4  146  ? 63.137  15.145  68.755  1.00 208.54 ? 146  MET A CG    1 
ATOM   2128  S  SD    . MET D 4  146  ? 63.435  13.603  69.643  1.00 210.27 ? 146  MET A SD    1 
ATOM   2129  C  CE    . MET D 4  146  ? 61.900  13.424  70.546  1.00 201.27 ? 146  MET A CE    1 
ATOM   2130  N  N     . VAL D 4  147  ? 64.909  13.143  66.456  1.00 224.23 ? 147  VAL A N     1 
ATOM   2131  C  CA    . VAL D 4  147  ? 66.328  13.257  66.153  1.00 225.82 ? 147  VAL A CA    1 
ATOM   2132  C  C     . VAL D 4  147  ? 66.773  11.998  65.427  1.00 216.78 ? 147  VAL A C     1 
ATOM   2133  O  O     . VAL D 4  147  ? 66.176  10.926  65.576  1.00 214.39 ? 147  VAL A O     1 
ATOM   2134  C  CB    . VAL D 4  147  ? 67.181  13.483  67.422  1.00 230.68 ? 147  VAL A CB    1 
ATOM   2135  C  CG1   . VAL D 4  147  ? 66.867  14.835  68.043  1.00 232.42 ? 147  VAL A CG1   1 
ATOM   2136  C  CG2   . VAL D 4  147  ? 66.951  12.361  68.423  1.00 229.28 ? 147  VAL A CG2   1 
ATOM   2137  N  N     . CYS D 4  148  ? 67.829  12.134  64.630  1.00 197.55 ? 148  CYS A N     1 
ATOM   2138  C  CA    . CYS D 4  148  ? 68.388  10.998  63.916  1.00 182.11 ? 148  CYS A CA    1 
ATOM   2139  C  C     . CYS D 4  148  ? 69.503  10.301  64.695  1.00 196.33 ? 148  CYS A C     1 
ATOM   2140  O  O     . CYS D 4  148  ? 70.104  9.357   64.169  1.00 174.97 ? 148  CYS A O     1 
ATOM   2141  C  CB    . CYS D 4  148  ? 68.880  11.438  62.534  1.00 169.14 ? 148  CYS A CB    1 
ATOM   2142  S  SG    . CYS D 4  148  ? 68.670  10.191  61.241  1.00 156.30 ? 148  CYS A SG    1 
ATOM   2143  N  N     . GLU D 4  149  ? 69.792  10.752  65.922  1.00 229.47 ? 149  GLU A N     1 
ATOM   2144  C  CA    . GLU D 4  149  ? 70.378  9.891   66.947  1.00 234.74 ? 149  GLU A CA    1 
ATOM   2145  C  C     . GLU D 4  149  ? 71.723  9.282   66.571  1.00 234.83 ? 149  GLU A C     1 
ATOM   2146  O  O     . GLU D 4  149  ? 71.776  8.119   66.166  1.00 246.33 ? 149  GLU A O     1 
ATOM   2147  C  CB    . GLU D 4  149  ? 69.407  8.778   67.330  1.00 233.03 ? 149  GLU A CB    1 
ATOM   2148  C  CG    . GLU D 4  149  ? 69.753  8.151   68.674  1.00 228.79 ? 149  GLU A CG    1 
ATOM   2149  C  CD    . GLU D 4  149  ? 70.428  9.133   69.630  1.00 223.14 ? 149  GLU A CD    1 
ATOM   2150  O  OE1   . GLU D 4  149  ? 69.778  10.124  70.027  1.00 221.04 ? 149  GLU A OE1   1 
ATOM   2151  O  OE2   . GLU D 4  149  ? 71.610  8.921   69.975  1.00 220.70 ? 149  GLU A OE2   1 
ATOM   2152  N  N     . THR D 4  150  ? 72.797  10.062  66.690  1.00 197.95 ? 150  THR A N     1 
ATOM   2153  C  CA    . THR D 4  150  ? 74.121  9.752   66.152  1.00 172.62 ? 150  THR A CA    1 
ATOM   2154  C  C     . THR D 4  150  ? 74.506  8.279   66.200  1.00 176.82 ? 150  THR A C     1 
ATOM   2155  O  O     . THR D 4  150  ? 74.860  7.715   65.162  1.00 161.22 ? 150  THR A O     1 
ATOM   2156  C  CB    . THR D 4  150  ? 75.193  10.555  66.895  1.00 157.67 ? 150  THR A CB    1 
ATOM   2157  O  OG1   . THR D 4  150  ? 74.886  11.950  66.848  1.00 153.65 ? 150  THR A OG1   1 
ATOM   2158  C  CG2   . THR D 4  150  ? 76.598  10.293  66.320  1.00 148.67 ? 150  THR A CG2   1 
ATOM   2159  N  N     . ASP D 4  151  ? 74.398  7.631   67.359  1.00 205.74 ? 151  ASP A N     1 
ATOM   2160  C  CA    . ASP D 4  151  ? 74.756  6.217   67.410  1.00 228.73 ? 151  ASP A CA    1 
ATOM   2161  C  C     . ASP D 4  151  ? 74.311  5.593   68.724  1.00 232.46 ? 151  ASP A C     1 
ATOM   2162  O  O     . ASP D 4  151  ? 73.910  6.283   69.666  1.00 237.98 ? 151  ASP A O     1 
ATOM   2163  C  CB    . ASP D 4  151  ? 76.257  6.022   67.217  1.00 241.23 ? 151  ASP A CB    1 
ATOM   2164  C  CG    . ASP D 4  151  ? 76.565  4.880   66.287  1.00 247.44 ? 151  ASP A CG    1 
ATOM   2165  O  OD1   . ASP D 4  151  ? 77.169  5.138   65.230  1.00 248.49 ? 151  ASP A OD1   1 
ATOM   2166  O  OD2   . ASP D 4  151  ? 76.186  3.733   66.605  1.00 249.31 ? 151  ASP A OD2   1 
ATOM   2167  N  N     . VAL D 4  152  ? 74.408  4.265   68.765  1.00 221.49 ? 152  VAL A N     1 
ATOM   2168  C  CA    . VAL D 4  152  ? 74.113  3.413   69.917  1.00 201.51 ? 152  VAL A CA    1 
ATOM   2169  C  C     . VAL D 4  152  ? 74.973  2.157   69.807  1.00 204.09 ? 152  VAL A C     1 
ATOM   2170  O  O     . VAL D 4  152  ? 75.507  1.877   68.724  1.00 209.05 ? 152  VAL A O     1 
ATOM   2171  C  CB    . VAL D 4  152  ? 72.621  3.049   69.986  1.00 180.98 ? 152  VAL A CB    1 
ATOM   2172  C  CG1   . VAL D 4  152  ? 71.820  4.163   70.641  1.00 170.28 ? 152  VAL A CG1   1 
ATOM   2173  C  CG2   . VAL D 4  152  ? 72.087  2.737   68.593  1.00 178.10 ? 152  VAL A CG2   1 
ATOM   2174  N  N     . PRO D 4  153  ? 75.148  1.366   70.884  1.00 199.16 ? 153  PRO A N     1 
ATOM   2175  C  CA    . PRO D 4  153  ? 75.886  0.104   70.741  1.00 186.48 ? 153  PRO A CA    1 
ATOM   2176  C  C     . PRO D 4  153  ? 75.009  -1.044  70.244  1.00 173.37 ? 153  PRO A C     1 
ATOM   2177  O  O     . PRO D 4  153  ? 74.917  -2.071  70.919  1.00 158.39 ? 153  PRO A O     1 
ATOM   2178  C  CB    . PRO D 4  153  ? 76.380  -0.167  72.161  1.00 180.80 ? 153  PRO A CB    1 
ATOM   2179  C  CG    . PRO D 4  153  ? 75.325  0.426   73.022  1.00 182.05 ? 153  PRO A CG    1 
ATOM   2180  C  CD    . PRO D 4  153  ? 74.837  1.657   72.295  1.00 191.10 ? 153  PRO A CD    1 
ATOM   2181  N  N     . LEU D 4  161  ? 77.772  3.622   68.784  1.00 214.81 ? 161  LEU A N     1 
ATOM   2182  C  CA    . LEU D 4  161  ? 79.220  3.502   68.668  1.00 212.75 ? 161  LEU A CA    1 
ATOM   2183  C  C     . LEU D 4  161  ? 79.593  2.602   67.492  1.00 226.85 ? 161  LEU A C     1 
ATOM   2184  O  O     . LEU D 4  161  ? 80.746  2.190   67.357  1.00 221.83 ? 161  LEU A O     1 
ATOM   2185  C  CB    . LEU D 4  161  ? 79.826  2.948   69.965  1.00 198.57 ? 161  LEU A CB    1 
ATOM   2186  C  CG    . LEU D 4  161  ? 79.508  3.630   71.303  1.00 187.07 ? 161  LEU A CG    1 
ATOM   2187  C  CD1   . LEU D 4  161  ? 78.172  3.172   71.881  1.00 177.27 ? 161  LEU A CD1   1 
ATOM   2188  C  CD2   . LEU D 4  161  ? 80.632  3.393   72.303  1.00 183.64 ? 161  LEU A CD2   1 
ATOM   2189  N  N     . VAL D 4  162  ? 78.613  2.306   66.638  1.00 234.26 ? 162  VAL A N     1 
ATOM   2190  C  CA    . VAL D 4  162  ? 78.772  1.329   65.569  1.00 240.15 ? 162  VAL A CA    1 
ATOM   2191  C  C     . VAL D 4  162  ? 78.483  1.933   64.192  1.00 257.46 ? 162  VAL A C     1 
ATOM   2192  O  O     . VAL D 4  162  ? 78.119  1.212   63.267  1.00 266.43 ? 162  VAL A O     1 
ATOM   2193  C  CB    . VAL D 4  162  ? 77.895  0.087   65.826  1.00 222.86 ? 162  VAL A CB    1 
ATOM   2194  C  CG1   . VAL D 4  162  ? 78.316  -0.606  67.114  1.00 216.18 ? 162  VAL A CG1   1 
ATOM   2195  C  CG2   . VAL D 4  162  ? 76.422  0.475   65.883  1.00 214.36 ? 162  VAL A CG2   1 
ATOM   2196  N  N     . SER D 4  163  ? 78.649  3.250   64.044  1.00 262.92 ? 163  SER A N     1 
ATOM   2197  C  CA    . SER D 4  163  ? 78.445  3.953   62.772  1.00 257.64 ? 163  SER A CA    1 
ATOM   2198  C  C     . SER D 4  163  ? 77.018  3.752   62.252  1.00 242.43 ? 163  SER A C     1 
ATOM   2199  O  O     . SER D 4  163  ? 76.789  3.258   61.146  1.00 242.34 ? 163  SER A O     1 
ATOM   2200  C  CB    . SER D 4  163  ? 79.484  3.524   61.729  1.00 262.91 ? 163  SER A CB    1 
ATOM   2201  O  OG    . SER D 4  163  ? 79.212  4.108   60.466  1.00 261.05 ? 163  SER A OG    1 
ATOM   2202  N  N     . ARG D 4  164  ? 76.055  4.147   63.082  1.00 231.73 ? 164  ARG A N     1 
ATOM   2203  C  CA    . ARG D 4  164  ? 74.653  4.065   62.697  1.00 215.99 ? 164  ARG A CA    1 
ATOM   2204  C  C     . ARG D 4  164  ? 74.361  5.045   61.565  1.00 203.76 ? 164  ARG A C     1 
ATOM   2205  O  O     . ARG D 4  164  ? 74.833  6.185   61.571  1.00 207.00 ? 164  ARG A O     1 
ATOM   2206  C  CB    . ARG D 4  164  ? 73.756  4.353   63.902  1.00 206.57 ? 164  ARG A CB    1 
ATOM   2207  C  CG    . ARG D 4  164  ? 72.418  3.618   63.900  1.00 197.89 ? 164  ARG A CG    1 
ATOM   2208  C  CD    . ARG D 4  164  ? 71.386  4.321   63.030  1.00 195.80 ? 164  ARG A CD    1 
ATOM   2209  N  NE    . ARG D 4  164  ? 70.020  3.975   63.416  1.00 190.16 ? 164  ARG A NE    1 
ATOM   2210  C  CZ    . ARG D 4  164  ? 69.383  2.874   63.031  1.00 177.76 ? 164  ARG A CZ    1 
ATOM   2211  N  NH1   . ARG D 4  164  ? 68.142  2.655   63.442  1.00 170.98 ? 164  ARG A NH1   1 
ATOM   2212  N  NH2   . ARG D 4  164  ? 69.975  1.997   62.232  1.00 174.43 ? 164  ARG A NH2   1 
ATOM   2213  N  N     . GLY D 4  165  ? 73.577  4.592   60.590  1.00 184.33 ? 165  GLY A N     1 
ATOM   2214  C  CA    . GLY D 4  165  ? 73.287  5.391   59.415  1.00 175.63 ? 165  GLY A CA    1 
ATOM   2215  C  C     . GLY D 4  165  ? 72.283  6.500   59.654  1.00 178.41 ? 165  GLY A C     1 
ATOM   2216  O  O     . GLY D 4  165  ? 71.152  6.434   59.165  1.00 164.08 ? 165  GLY A O     1 
ATOM   2217  N  N     . GLY D 4  166  ? 72.678  7.517   60.401  1.00 182.81 ? 166  GLY A N     1 
ATOM   2218  C  CA    . GLY D 4  166  ? 71.797  8.638   60.694  1.00 190.65 ? 166  GLY A CA    1 
ATOM   2219  C  C     . GLY D 4  166  ? 72.467  9.969   60.434  1.00 197.40 ? 166  GLY A C     1 
ATOM   2220  O  O     . GLY D 4  166  ? 73.658  10.140  60.697  1.00 179.07 ? 166  GLY A O     1 
ATOM   2221  N  N     . CYS D 4  167  ? 71.684  10.918  59.905  1.00 221.48 ? 167  CYS A N     1 
ATOM   2222  C  CA    . CYS D 4  167  ? 72.194  12.275  59.707  1.00 227.98 ? 167  CYS A CA    1 
ATOM   2223  C  C     . CYS D 4  167  ? 72.522  12.932  61.042  1.00 231.21 ? 167  CYS A C     1 
ATOM   2224  O  O     . CYS D 4  167  ? 73.535  13.628  61.167  1.00 235.87 ? 167  CYS A O     1 
ATOM   2225  C  CB    . CYS D 4  167  ? 71.187  13.115  58.916  1.00 222.12 ? 167  CYS A CB    1 
ATOM   2226  S  SG    . CYS D 4  167  ? 70.014  14.047  59.927  1.00 213.58 ? 167  CYS A SG    1 
ATOM   2227  N  N     . GLY D 4  168  ? 71.677  12.733  62.041  1.00 218.82 ? 168  GLY A N     1 
ATOM   2228  C  CA    . GLY D 4  168  ? 72.048  12.913  63.426  1.00 211.44 ? 168  GLY A CA    1 
ATOM   2229  C  C     . GLY D 4  168  ? 71.328  13.958  64.289  1.00 212.79 ? 168  GLY A C     1 
ATOM   2230  O  O     . GLY D 4  168  ? 71.779  14.192  65.419  1.00 206.56 ? 168  GLY A O     1 
ATOM   2231  N  N     . ASN D 4  169  ? 70.274  14.617  63.781  1.00 216.13 ? 169  ASN A N     1 
ATOM   2232  C  CA    . ASN D 4  169  ? 69.338  15.392  64.604  1.00 217.12 ? 169  ASN A CA    1 
ATOM   2233  C  C     . ASN D 4  169  ? 68.206  16.016  63.789  1.00 199.14 ? 169  ASN A C     1 
ATOM   2234  O  O     . ASN D 4  169  ? 68.106  15.795  62.578  1.00 189.91 ? 169  ASN A O     1 
ATOM   2235  C  CB    . ASN D 4  169  ? 70.070  16.477  65.408  1.00 228.05 ? 169  ASN A CB    1 
ATOM   2236  C  CG    . ASN D 4  169  ? 70.569  17.618  64.552  1.00 231.45 ? 169  ASN A CG    1 
ATOM   2237  O  OD1   . ASN D 4  169  ? 70.867  17.443  63.372  1.00 236.36 ? 169  ASN A OD1   1 
ATOM   2238  N  ND2   . ASN D 4  169  ? 70.721  18.788  65.165  1.00 225.94 ? 169  ASN A ND2   1 
ATOM   2239  N  N     . THR D 4  170  ? 67.347  16.790  64.461  1.00 197.07 ? 170  THR A N     1 
ATOM   2240  C  CA    . THR D 4  170  ? 66.419  17.749  63.839  1.00 189.44 ? 170  THR A CA    1 
ATOM   2241  C  C     . THR D 4  170  ? 65.400  17.089  62.897  1.00 208.08 ? 170  THR A C     1 
ATOM   2242  O  O     . THR D 4  170  ? 65.462  17.218  61.673  1.00 209.16 ? 170  THR A O     1 
ATOM   2243  C  CB    . THR D 4  170  ? 67.172  18.866  63.101  1.00 169.82 ? 170  THR A CB    1 
ATOM   2244  O  OG1   . THR D 4  170  ? 68.110  18.313  62.170  1.00 159.95 ? 170  THR A OG1   1 
ATOM   2245  C  CG2   . THR D 4  170  ? 67.898  19.766  64.093  1.00 167.76 ? 170  THR A CG2   1 
ATOM   2246  N  N     . GLN D 4  171  ? 64.445  16.367  63.509  1.00 218.10 ? 171  GLN A N     1 
ATOM   2247  C  CA    . GLN D 4  171  ? 63.252  15.954  62.772  1.00 217.27 ? 171  GLN A CA    1 
ATOM   2248  C  C     . GLN D 4  171  ? 62.062  16.836  63.147  1.00 208.31 ? 171  GLN A C     1 
ATOM   2249  O  O     . GLN D 4  171  ? 61.926  17.227  64.313  1.00 213.78 ? 171  GLN A O     1 
ATOM   2250  C  CB    . GLN D 4  171  ? 62.901  14.488  63.047  1.00 219.68 ? 171  GLN A CB    1 
ATOM   2251  C  CG    . GLN D 4  171  ? 63.621  13.509  62.144  1.00 223.23 ? 171  GLN A CG    1 
ATOM   2252  C  CD    . GLN D 4  171  ? 62.701  12.926  61.095  1.00 224.41 ? 171  GLN A CD    1 
ATOM   2253  O  OE1   . GLN D 4  171  ? 62.139  13.653  60.277  1.00 226.16 ? 171  GLN A OE1   1 
ATOM   2254  N  NE2   . GLN D 4  171  ? 62.531  11.608  61.118  1.00 224.82 ? 171  GLN A NE2   1 
ATOM   2255  N  N     . PRO D 4  172  ? 61.184  17.159  62.197  1.00 187.31 ? 172  PRO A N     1 
ATOM   2256  C  CA    . PRO D 4  172  ? 60.150  18.169  62.440  1.00 176.86 ? 172  PRO A CA    1 
ATOM   2257  C  C     . PRO D 4  172  ? 58.847  17.608  62.999  1.00 169.56 ? 172  PRO A C     1 
ATOM   2258  O  O     . PRO D 4  172  ? 58.563  16.412  62.919  1.00 167.45 ? 172  PRO A O     1 
ATOM   2259  C  CB    . PRO D 4  172  ? 59.924  18.752  61.037  1.00 163.99 ? 172  PRO A CB    1 
ATOM   2260  C  CG    . PRO D 4  172  ? 60.120  17.576  60.139  1.00 159.70 ? 172  PRO A CG    1 
ATOM   2261  C  CD    . PRO D 4  172  ? 61.190  16.714  60.789  1.00 173.03 ? 172  PRO A CD    1 
ATOM   2262  N  N     . THR D 4  173  ? 58.045  18.518  63.563  1.00 168.14 ? 173  THR A N     1 
ATOM   2263  C  CA    . THR D 4  173  ? 56.692  18.212  64.039  1.00 159.29 ? 173  THR A CA    1 
ATOM   2264  C  C     . THR D 4  173  ? 55.711  18.706  62.980  1.00 172.76 ? 173  THR A C     1 
ATOM   2265  O  O     . THR D 4  173  ? 55.194  19.821  63.034  1.00 160.12 ? 173  THR A O     1 
ATOM   2266  C  CB    . THR D 4  173  ? 56.436  18.856  65.400  1.00 153.93 ? 173  THR A CB    1 
ATOM   2267  O  OG1   . THR D 4  173  ? 57.546  18.606  66.272  1.00 163.20 ? 173  THR A OG1   1 
ATOM   2268  C  CG2   . THR D 4  173  ? 55.157  18.308  66.022  1.00 138.07 ? 173  THR A CG2   1 
ATOM   2269  N  N     . ILE D 4  174  ? 55.459  17.844  62.000  1.00 176.50 ? 174  ILE A N     1 
ATOM   2270  C  CA    . ILE D 4  174  ? 54.777  18.242  60.777  1.00 176.41 ? 174  ILE A CA    1 
ATOM   2271  C  C     . ILE D 4  174  ? 53.267  18.132  60.961  1.00 170.57 ? 174  ILE A C     1 
ATOM   2272  O  O     . ILE D 4  174  ? 52.763  17.371  61.793  1.00 171.32 ? 174  ILE A O     1 
ATOM   2273  C  CB    . ILE D 4  174  ? 55.265  17.393  59.582  1.00 169.70 ? 174  ILE A CB    1 
ATOM   2274  C  CG1   . ILE D 4  174  ? 55.422  18.261  58.333  1.00 176.81 ? 174  ILE A CG1   1 
ATOM   2275  C  CG2   . ILE D 4  174  ? 54.301  16.247  59.301  1.00 162.59 ? 174  ILE A CG2   1 
ATOM   2276  C  CD1   . ILE D 4  174  ? 56.104  17.549  57.179  1.00 183.18 ? 174  ILE A CD1   1 
ATOM   2277  N  N     . ARG D 4  175  ? 52.538  18.917  60.172  1.00 172.86 ? 175  ARG A N     1 
ATOM   2278  C  CA    . ARG D 4  175  ? 51.083  18.856  60.113  1.00 167.04 ? 175  ARG A CA    1 
ATOM   2279  C  C     . ARG D 4  175  ? 50.646  19.560  58.838  1.00 171.58 ? 175  ARG A C     1 
ATOM   2280  O  O     . ARG D 4  175  ? 51.323  20.475  58.361  1.00 181.16 ? 175  ARG A O     1 
ATOM   2281  C  CB    . ARG D 4  175  ? 50.431  19.501  61.341  1.00 162.83 ? 175  ARG A CB    1 
ATOM   2282  C  CG    . ARG D 4  175  ? 50.833  20.948  61.582  1.00 169.41 ? 175  ARG A CG    1 
ATOM   2283  C  CD    . ARG D 4  175  ? 49.632  21.880  61.491  1.00 172.82 ? 175  ARG A CD    1 
ATOM   2284  N  NE    . ARG D 4  175  ? 50.028  23.285  61.532  1.00 176.76 ? 175  ARG A NE    1 
ATOM   2285  C  CZ    . ARG D 4  175  ? 50.384  23.990  60.464  1.00 171.79 ? 175  ARG A CZ    1 
ATOM   2286  N  NH1   . ARG D 4  175  ? 50.735  25.263  60.591  1.00 167.49 ? 175  ARG A NH1   1 
ATOM   2287  N  NH2   . ARG D 4  175  ? 50.384  23.423  59.265  1.00 166.41 ? 175  ARG A NH2   1 
ATOM   2288  N  N     . LYS D 4  176  ? 49.513  19.131  58.294  1.00 164.81 ? 176  LYS A N     1 
ATOM   2289  C  CA    . LYS D 4  176  ? 49.077  19.604  56.988  1.00 161.62 ? 176  LYS A CA    1 
ATOM   2290  C  C     . LYS D 4  176  ? 48.200  20.846  57.110  1.00 162.59 ? 176  LYS A C     1 
ATOM   2291  O  O     . LYS D 4  176  ? 47.396  20.973  58.038  1.00 160.89 ? 176  LYS A O     1 
ATOM   2292  C  CB    . LYS D 4  176  ? 48.325  18.502  56.235  1.00 163.68 ? 176  LYS A CB    1 
ATOM   2293  C  CG    . LYS D 4  176  ? 46.936  18.188  56.769  1.00 164.29 ? 176  LYS A CG    1 
ATOM   2294  C  CD    . LYS D 4  176  ? 46.150  17.333  55.785  1.00 158.65 ? 176  LYS A CD    1 
ATOM   2295  C  CE    . LYS D 4  176  ? 45.990  18.038  54.444  1.00 151.90 ? 176  LYS A CE    1 
ATOM   2296  N  NZ    . LYS D 4  176  ? 45.281  19.343  54.571  1.00 145.92 ? 176  LYS A NZ    1 
ATOM   2297  N  N     . ASP D 4  177  ? 48.383  21.772  56.169  1.00 164.72 ? 177  ASP A N     1 
ATOM   2298  C  CA    . ASP D 4  177  ? 47.538  22.947  56.020  1.00 158.21 ? 177  ASP A CA    1 
ATOM   2299  C  C     . ASP D 4  177  ? 47.364  23.228  54.536  1.00 157.16 ? 177  ASP A C     1 
ATOM   2300  O  O     . ASP D 4  177  ? 48.337  23.208  53.777  1.00 144.83 ? 177  ASP A O     1 
ATOM   2301  C  CB    . ASP D 4  177  ? 48.133  24.176  56.725  1.00 154.07 ? 177  ASP A CB    1 
ATOM   2302  C  CG    . ASP D 4  177  ? 47.090  25.239  57.029  1.00 139.67 ? 177  ASP A CG    1 
ATOM   2303  O  OD1   . ASP D 4  177  ? 45.904  25.019  56.702  1.00 134.21 ? 177  ASP A OD1   1 
ATOM   2304  O  OD2   . ASP D 4  177  ? 47.452  26.293  57.595  1.00 125.00 ? 177  ASP A OD2   1 
ATOM   2305  N  N     . GLY D 4  178  ? 46.128  23.496  54.127  1.00 162.99 ? 178  GLY A N     1 
ATOM   2306  C  CA    . GLY D 4  178  ? 45.861  23.646  52.707  1.00 164.62 ? 178  GLY A CA    1 
ATOM   2307  C  C     . GLY D 4  178  ? 46.069  22.323  52.001  1.00 163.58 ? 178  GLY A C     1 
ATOM   2308  O  O     . GLY D 4  178  ? 45.514  21.289  52.388  1.00 171.97 ? 178  GLY A O     1 
ATOM   2309  N  N     . LEU D 4  179  ? 46.892  22.346  50.954  1.00 142.73 ? 179  LEU A N     1 
ATOM   2310  C  CA    . LEU D 4  179  ? 47.263  21.138  50.230  1.00 117.00 ? 179  LEU A CA    1 
ATOM   2311  C  C     . LEU D 4  179  ? 48.711  20.741  50.471  1.00 120.43 ? 179  LEU A C     1 
ATOM   2312  O  O     . LEU D 4  179  ? 49.233  19.868  49.764  1.00 108.36 ? 179  LEU A O     1 
ATOM   2313  C  CB    . LEU D 4  179  ? 47.005  21.322  48.736  1.00 115.36 ? 179  LEU A CB    1 
ATOM   2314  C  CG    . LEU D 4  179  ? 45.545  21.601  48.378  1.00 113.06 ? 179  LEU A CG    1 
ATOM   2315  C  CD1   . LEU D 4  179  ? 45.338  21.435  46.889  1.00 107.58 ? 179  LEU A CD1   1 
ATOM   2316  C  CD2   . LEU D 4  179  ? 44.599  20.700  49.164  1.00 93.24  ? 179  LEU A CD2   1 
ATOM   2317  N  N     . LYS D 4  180  ? 49.371  21.355  51.452  1.00 131.54 ? 180  LYS A N     1 
ATOM   2318  C  CA    . LYS D 4  180  ? 50.743  20.992  51.781  1.00 132.26 ? 180  LYS A CA    1 
ATOM   2319  C  C     . LYS D 4  180  ? 50.867  20.689  53.268  1.00 144.01 ? 180  LYS A C     1 
ATOM   2320  O  O     . LYS D 4  180  ? 49.873  20.652  53.992  1.00 142.83 ? 180  LYS A O     1 
ATOM   2321  C  CB    . LYS D 4  180  ? 51.725  22.097  51.384  1.00 124.39 ? 180  LYS A CB    1 
ATOM   2322  C  CG    . LYS D 4  180  ? 51.270  22.964  50.219  1.00 125.69 ? 180  LYS A CG    1 
ATOM   2323  C  CD    . LYS D 4  180  ? 50.511  24.190  50.708  1.00 124.82 ? 180  LYS A CD    1 
ATOM   2324  C  CE    . LYS D 4  180  ? 49.924  24.962  49.541  1.00 124.22 ? 180  LYS A CE    1 
ATOM   2325  N  NZ    . LYS D 4  180  ? 49.077  26.091  50.004  1.00 125.01 ? 180  LYS A NZ    1 
ATOM   2326  N  N     . LEU D 4  181  ? 52.101  20.472  53.719  1.00 155.78 ? 181  LEU A N     1 
ATOM   2327  C  CA    . LEU D 4  181  ? 52.396  20.093  55.091  1.00 167.02 ? 181  LEU A CA    1 
ATOM   2328  C  C     . LEU D 4  181  ? 53.667  20.795  55.551  1.00 177.87 ? 181  LEU A C     1 
ATOM   2329  O  O     . LEU D 4  181  ? 54.611  20.950  54.775  1.00 187.38 ? 181  LEU A O     1 
ATOM   2330  C  CB    . LEU D 4  181  ? 52.492  18.564  55.195  1.00 162.27 ? 181  LEU A CB    1 
ATOM   2331  C  CG    . LEU D 4  181  ? 53.194  17.852  54.026  1.00 167.23 ? 181  LEU A CG    1 
ATOM   2332  C  CD1   . LEU D 4  181  ? 54.713  18.038  54.009  1.00 173.69 ? 181  LEU A CD1   1 
ATOM   2333  C  CD2   . LEU D 4  181  ? 52.845  16.390  53.966  1.00 167.10 ? 181  LEU A CD2   1 
ATOM   2334  N  N     . VAL D 4  182  ? 53.667  21.246  56.809  1.00 183.01 ? 182  VAL A N     1 
ATOM   2335  C  CA    . VAL D 4  182  ? 54.767  22.030  57.362  1.00 173.93 ? 182  VAL A CA    1 
ATOM   2336  C  C     . VAL D 4  182  ? 54.932  21.689  58.837  1.00 173.47 ? 182  VAL A C     1 
ATOM   2337  O  O     . VAL D 4  182  ? 53.994  21.252  59.505  1.00 182.67 ? 182  VAL A O     1 
ATOM   2338  C  CB    . VAL D 4  182  ? 54.563  23.561  57.199  1.00 161.80 ? 182  VAL A CB    1 
ATOM   2339  C  CG1   . VAL D 4  182  ? 54.776  23.990  55.758  1.00 155.04 ? 182  VAL A CG1   1 
ATOM   2340  C  CG2   . VAL D 4  182  ? 53.191  23.972  57.690  1.00 155.98 ? 182  VAL A CG2   1 
ATOM   2341  N  N     . GLY D 4  183  ? 56.148  21.906  59.350  1.00 169.79 ? 183  GLY A N     1 
ATOM   2342  C  CA    . GLY D 4  183  ? 56.448  21.663  60.747  1.00 160.63 ? 183  GLY A CA    1 
ATOM   2343  C  C     . GLY D 4  183  ? 57.583  22.549  61.213  1.00 165.65 ? 183  GLY A C     1 
ATOM   2344  O  O     . GLY D 4  183  ? 58.209  23.266  60.427  1.00 162.55 ? 183  GLY A O     1 
ATOM   2345  N  N     . SER D 4  184  ? 57.844  22.492  62.516  1.00 158.06 ? 184  SER A N     1 
ATOM   2346  C  CA    . SER D 4  184  ? 58.919  23.250  63.139  1.00 170.81 ? 184  SER A CA    1 
ATOM   2347  C  C     . SER D 4  184  ? 60.008  22.299  63.618  1.00 186.19 ? 184  SER A C     1 
ATOM   2348  O  O     . SER D 4  184  ? 59.719  21.259  64.218  1.00 178.14 ? 184  SER A O     1 
ATOM   2349  C  CB    . SER D 4  184  ? 58.399  24.080  64.315  1.00 174.03 ? 184  SER A CB    1 
ATOM   2350  O  OG    . SER D 4  184  ? 57.913  23.244  65.352  1.00 172.93 ? 184  SER A OG    1 
ATOM   2351  N  N     . TRP D 4  185  ? 61.262  22.660  63.347  1.00 214.10 ? 185  TRP A N     1 
ATOM   2352  C  CA    . TRP D 4  185  ? 62.377  21.806  63.740  1.00 224.85 ? 185  TRP A CA    1 
ATOM   2353  C  C     . TRP D 4  185  ? 62.781  22.027  65.192  1.00 217.57 ? 185  TRP A C     1 
ATOM   2354  O  O     . TRP D 4  185  ? 63.192  21.074  65.865  1.00 223.31 ? 185  TRP A O     1 
ATOM   2355  C  CB    . TRP D 4  185  ? 63.569  22.040  62.810  1.00 236.08 ? 185  TRP A CB    1 
ATOM   2356  C  CG    . TRP D 4  185  ? 63.537  21.179  61.579  1.00 235.89 ? 185  TRP A CG    1 
ATOM   2357  C  CD1   . TRP D 4  185  ? 64.436  20.213  61.235  1.00 237.14 ? 185  TRP A CD1   1 
ATOM   2358  C  CD2   . TRP D 4  185  ? 62.553  21.201  60.535  1.00 231.98 ? 185  TRP A CD2   1 
ATOM   2359  N  NE1   . TRP D 4  185  ? 64.077  19.634  60.042  1.00 235.35 ? 185  TRP A NE1   1 
ATOM   2360  C  CE2   . TRP D 4  185  ? 62.925  20.222  59.591  1.00 233.08 ? 185  TRP A CE2   1 
ATOM   2361  C  CE3   . TRP D 4  185  ? 61.397  21.954  60.304  1.00 228.30 ? 185  TRP A CE3   1 
ATOM   2362  C  CZ2   . TRP D 4  185  ? 62.183  19.977  58.438  1.00 231.10 ? 185  TRP A CZ2   1 
ATOM   2363  C  CZ3   . TRP D 4  185  ? 60.662  21.708  59.159  1.00 228.20 ? 185  TRP A CZ3   1 
ATOM   2364  C  CH2   . TRP D 4  185  ? 61.057  20.728  58.241  1.00 229.24 ? 185  TRP A CH2   1 
ATOM   2365  N  N     . LYS D 4  186  ? 62.668  23.259  65.683  1.00 177.33 ? 186  LYS A N     1 
ATOM   2366  C  CA    . LYS D 4  186  ? 62.978  23.597  67.072  1.00 155.15 ? 186  LYS A CA    1 
ATOM   2367  C  C     . LYS D 4  186  ? 64.402  23.176  67.440  1.00 154.81 ? 186  LYS A C     1 
ATOM   2368  O  O     . LYS D 4  186  ? 65.377  23.683  66.885  1.00 148.98 ? 186  LYS A O     1 
ATOM   2369  C  CB    . LYS D 4  186  ? 61.959  22.948  68.021  1.00 126.55 ? 186  LYS A CB    1 
ATOM   2370  C  CG    . LYS D 4  186  ? 61.777  23.664  69.360  1.00 121.26 ? 186  LYS A CG    1 
ATOM   2371  C  CD    . LYS D 4  186  ? 62.876  23.316  70.359  1.00 123.68 ? 186  LYS A CD    1 
ATOM   2372  C  CE    . LYS D 4  186  ? 62.696  24.062  71.674  1.00 120.06 ? 186  LYS A CE    1 
ATOM   2373  N  NZ    . LYS D 4  186  ? 63.754  23.709  72.662  1.00 122.19 ? 186  LYS A NZ    1 
ATOM   2374  N  N     . LEU D 4  199  ? 57.259  28.001  59.864  1.00 172.25 ? 199  LEU A N     1 
ATOM   2375  C  CA    . LEU D 4  199  ? 58.662  27.666  59.647  1.00 179.89 ? 199  LEU A CA    1 
ATOM   2376  C  C     . LEU D 4  199  ? 58.915  27.270  58.193  1.00 207.89 ? 199  LEU A C     1 
ATOM   2377  O  O     . LEU D 4  199  ? 58.226  27.738  57.287  1.00 204.69 ? 199  LEU A O     1 
ATOM   2378  C  CB    . LEU D 4  199  ? 59.103  26.544  60.591  1.00 160.24 ? 199  LEU A CB    1 
ATOM   2379  C  CG    . LEU D 4  199  ? 59.503  26.943  62.016  1.00 140.40 ? 199  LEU A CG    1 
ATOM   2380  C  CD1   . LEU D 4  199  ? 60.571  28.030  61.997  1.00 127.20 ? 199  LEU A CD1   1 
ATOM   2381  C  CD2   . LEU D 4  199  ? 58.295  27.388  62.832  1.00 135.42 ? 199  LEU A CD2   1 
ATOM   2382  N  N     . ARG D 4  200  ? 59.903  26.406  57.976  1.00 246.67 ? 200  ARG A N     1 
ATOM   2383  C  CA    . ARG D 4  200  ? 60.295  26.049  56.620  1.00 243.09 ? 200  ARG A CA    1 
ATOM   2384  C  C     . ARG D 4  200  ? 59.239  25.156  55.974  1.00 232.04 ? 200  ARG A C     1 
ATOM   2385  O  O     . ARG D 4  200  ? 58.704  24.237  56.601  1.00 234.82 ? 200  ARG A O     1 
ATOM   2386  C  CB    . ARG D 4  200  ? 61.672  25.375  56.634  1.00 244.53 ? 200  ARG A CB    1 
ATOM   2387  C  CG    . ARG D 4  200  ? 61.700  23.859  56.503  1.00 238.36 ? 200  ARG A CG    1 
ATOM   2388  C  CD    . ARG D 4  200  ? 63.134  23.374  56.321  1.00 236.30 ? 200  ARG A CD    1 
ATOM   2389  N  NE    . ARG D 4  200  ? 63.226  22.158  55.518  1.00 229.22 ? 200  ARG A NE    1 
ATOM   2390  C  CZ    . ARG D 4  200  ? 63.528  22.138  54.224  1.00 222.33 ? 200  ARG A CZ    1 
ATOM   2391  N  NH1   . ARG D 4  200  ? 63.772  23.271  53.580  1.00 217.79 ? 200  ARG A NH1   1 
ATOM   2392  N  NH2   . ARG D 4  200  ? 63.591  20.983  53.573  1.00 221.45 ? 200  ARG A NH2   1 
ATOM   2393  N  N     . VAL D 4  201  ? 58.913  25.461  54.718  1.00 204.85 ? 201  VAL A N     1 
ATOM   2394  C  CA    . VAL D 4  201  ? 57.848  24.780  53.991  1.00 183.56 ? 201  VAL A CA    1 
ATOM   2395  C  C     . VAL D 4  201  ? 58.455  23.649  53.175  1.00 189.00 ? 201  VAL A C     1 
ATOM   2396  O  O     . VAL D 4  201  ? 59.545  23.790  52.607  1.00 191.16 ? 201  VAL A O     1 
ATOM   2397  C  CB    . VAL D 4  201  ? 57.076  25.772  53.100  1.00 163.29 ? 201  VAL A CB    1 
ATOM   2398  C  CG1   . VAL D 4  201  ? 55.913  25.079  52.398  1.00 153.46 ? 201  VAL A CG1   1 
ATOM   2399  C  CG2   . VAL D 4  201  ? 56.578  26.951  53.931  1.00 155.20 ? 201  VAL A CG2   1 
ATOM   2400  N  N     . LEU D 4  202  ? 57.751  22.522  53.120  1.00 186.47 ? 202  LEU A N     1 
ATOM   2401  C  CA    . LEU D 4  202  ? 58.296  21.320  52.499  1.00 182.87 ? 202  LEU A CA    1 
ATOM   2402  C  C     . LEU D 4  202  ? 58.337  21.472  50.984  1.00 179.15 ? 202  LEU A C     1 
ATOM   2403  O  O     . LEU D 4  202  ? 57.296  21.604  50.334  1.00 175.14 ? 202  LEU A O     1 
ATOM   2404  C  CB    . LEU D 4  202  ? 57.471  20.100  52.896  1.00 175.15 ? 202  LEU A CB    1 
ATOM   2405  C  CG    . LEU D 4  202  ? 57.919  19.427  54.197  1.00 177.29 ? 202  LEU A CG    1 
ATOM   2406  C  CD1   . LEU D 4  202  ? 59.390  19.057  54.115  1.00 184.15 ? 202  LEU A CD1   1 
ATOM   2407  C  CD2   . LEU D 4  202  ? 57.648  20.305  55.413  1.00 174.43 ? 202  LEU A CD2   1 
ATOM   2408  N  N     . SER D 4  203  ? 59.546  21.450  50.427  1.00 186.00 ? 203  SER A N     1 
ATOM   2409  C  CA    . SER D 4  203  ? 59.717  21.526  48.984  1.00 186.92 ? 203  SER A CA    1 
ATOM   2410  C  C     . SER D 4  203  ? 59.304  20.211  48.341  1.00 177.69 ? 203  SER A C     1 
ATOM   2411  O  O     . SER D 4  203  ? 59.738  19.137  48.766  1.00 185.74 ? 203  SER A O     1 
ATOM   2412  C  CB    . SER D 4  203  ? 61.169  21.853  48.641  1.00 194.49 ? 203  SER A CB    1 
ATOM   2413  O  OG    . SER D 4  203  ? 61.456  21.566  47.283  1.00 194.04 ? 203  SER A OG    1 
ATOM   2414  N  N     . THR D 4  204  ? 58.457  20.298  47.314  1.00 156.12 ? 204  THR A N     1 
ATOM   2415  C  CA    . THR D 4  204  ? 57.986  19.093  46.640  1.00 147.40 ? 204  THR A CA    1 
ATOM   2416  C  C     . THR D 4  204  ? 59.137  18.353  45.969  1.00 147.91 ? 204  THR A C     1 
ATOM   2417  O  O     . THR D 4  204  ? 59.241  17.125  46.066  1.00 136.73 ? 204  THR A O     1 
ATOM   2418  C  CB    . THR D 4  204  ? 56.910  19.455  45.618  1.00 150.46 ? 204  THR A CB    1 
ATOM   2419  O  OG1   . THR D 4  204  ? 56.002  20.399  46.199  1.00 143.31 ? 204  THR A OG1   1 
ATOM   2420  C  CG2   . THR D 4  204  ? 56.142  18.213  45.203  1.00 151.14 ? 204  THR A CG2   1 
ATOM   2421  N  N     . GLU D 4  205  ? 60.012  19.090  45.278  1.00 163.50 ? 205  GLU A N     1 
ATOM   2422  C  CA    . GLU D 4  205  ? 61.180  18.471  44.658  1.00 173.53 ? 205  GLU A CA    1 
ATOM   2423  C  C     . GLU D 4  205  ? 62.082  17.825  45.701  1.00 169.03 ? 205  GLU A C     1 
ATOM   2424  O  O     . GLU D 4  205  ? 62.704  16.788  45.440  1.00 159.64 ? 205  GLU A O     1 
ATOM   2425  C  CB    . GLU D 4  205  ? 61.960  19.510  43.852  1.00 184.66 ? 205  GLU A CB    1 
ATOM   2426  C  CG    . GLU D 4  205  ? 61.651  19.523  42.363  1.00 186.36 ? 205  GLU A CG    1 
ATOM   2427  C  CD    . GLU D 4  205  ? 62.553  18.590  41.574  1.00 188.50 ? 205  GLU A CD    1 
ATOM   2428  O  OE1   . GLU D 4  205  ? 63.188  17.706  42.190  1.00 189.86 ? 205  GLU A OE1   1 
ATOM   2429  O  OE2   . GLU D 4  205  ? 62.633  18.744  40.338  1.00 189.19 ? 205  GLU A OE2   1 
ATOM   2430  N  N     . GLU D 4  206  ? 62.170  18.428  46.888  1.00 174.73 ? 206  GLU A N     1 
ATOM   2431  C  CA    . GLU D 4  206  ? 62.996  17.860  47.948  1.00 173.07 ? 206  GLU A CA    1 
ATOM   2432  C  C     . GLU D 4  206  ? 62.482  16.490  48.369  1.00 162.12 ? 206  GLU A C     1 
ATOM   2433  O  O     . GLU D 4  206  ? 63.269  15.556  48.555  1.00 167.53 ? 206  GLU A O     1 
ATOM   2434  C  CB    . GLU D 4  206  ? 63.035  18.812  49.142  1.00 176.26 ? 206  GLU A CB    1 
ATOM   2435  C  CG    . GLU D 4  206  ? 64.228  18.615  50.058  1.00 186.12 ? 206  GLU A CG    1 
ATOM   2436  C  CD    . GLU D 4  206  ? 64.727  19.920  50.645  1.00 194.90 ? 206  GLU A CD    1 
ATOM   2437  O  OE1   . GLU D 4  206  ? 63.903  20.671  51.209  1.00 199.28 ? 206  GLU A OE1   1 
ATOM   2438  O  OE2   . GLU D 4  206  ? 65.941  20.195  50.544  1.00 199.95 ? 206  GLU A OE2   1 
ATOM   2439  N  N     . ILE D 4  207  ? 61.162  16.349  48.512  1.00 135.32 ? 207  ILE A N     1 
ATOM   2440  C  CA    . ILE D 4  207  ? 60.584  15.068  48.910  1.00 121.11 ? 207  ILE A CA    1 
ATOM   2441  C  C     . ILE D 4  207  ? 60.883  14.000  47.865  1.00 127.25 ? 207  ILE A C     1 
ATOM   2442  O  O     . ILE D 4  207  ? 61.177  12.846  48.202  1.00 118.17 ? 207  ILE A O     1 
ATOM   2443  C  CB    . ILE D 4  207  ? 59.070  15.217  49.151  1.00 108.63 ? 207  ILE A CB    1 
ATOM   2444  C  CG1   . ILE D 4  207  ? 58.790  16.407  50.074  1.00 99.92  ? 207  ILE A CG1   1 
ATOM   2445  C  CG2   . ILE D 4  207  ? 58.490  13.938  49.734  1.00 110.26 ? 207  ILE A CG2   1 
ATOM   2446  C  CD1   . ILE D 4  207  ? 57.317  16.672  50.312  1.00 97.44  ? 207  ILE A CD1   1 
ATOM   2447  N  N     . LEU D 4  208  ? 60.822  14.368  46.583  1.00 143.02 ? 208  LEU A N     1 
ATOM   2448  C  CA    . LEU D 4  208  ? 61.162  13.426  45.520  1.00 153.64 ? 208  LEU A CA    1 
ATOM   2449  C  C     . LEU D 4  208  ? 62.631  13.028  45.595  1.00 162.37 ? 208  LEU A C     1 
ATOM   2450  O  O     . LEU D 4  208  ? 62.969  11.840  45.521  1.00 148.66 ? 208  LEU A O     1 
ATOM   2451  C  CB    . LEU D 4  208  ? 60.821  14.036  44.157  1.00 151.16 ? 208  LEU A CB    1 
ATOM   2452  C  CG    . LEU D 4  208  ? 61.052  13.247  42.859  1.00 147.42 ? 208  LEU A CG    1 
ATOM   2453  C  CD1   . LEU D 4  208  ? 62.471  13.435  42.323  1.00 136.97 ? 208  LEU A CD1   1 
ATOM   2454  C  CD2   . LEU D 4  208  ? 60.738  11.765  43.047  1.00 142.73 ? 208  LEU A CD2   1 
ATOM   2455  N  N     . ASN D 4  209  ? 63.521  14.012  45.735  1.00 167.97 ? 209  ASN A N     1 
ATOM   2456  C  CA    . ASN D 4  209  ? 64.945  13.708  45.847  1.00 178.54 ? 209  ASN A CA    1 
ATOM   2457  C  C     . ASN D 4  209  ? 65.237  12.924  47.122  1.00 179.82 ? 209  ASN A C     1 
ATOM   2458  O  O     . ASN D 4  209  ? 66.080  12.019  47.124  1.00 190.45 ? 209  ASN A O     1 
ATOM   2459  C  CB    . ASN D 4  209  ? 65.759  15.002  45.802  1.00 179.33 ? 209  ASN A CB    1 
ATOM   2460  C  CG    . ASN D 4  209  ? 67.205  14.773  45.393  1.00 183.34 ? 209  ASN A CG    1 
ATOM   2461  O  OD1   . ASN D 4  209  ? 67.812  13.761  45.744  1.00 183.82 ? 209  ASN A OD1   1 
ATOM   2462  N  ND2   . ASN D 4  209  ? 67.764  15.720  44.648  1.00 178.96 ? 209  ASN A ND2   1 
ATOM   2463  N  N     . ILE D 4  210  ? 64.549  13.258  48.216  1.00 176.77 ? 210  ILE A N     1 
ATOM   2464  C  CA    . ILE D 4  210  ? 64.694  12.493  49.453  1.00 169.89 ? 210  ILE A CA    1 
ATOM   2465  C  C     . ILE D 4  210  ? 64.238  11.055  49.244  1.00 167.10 ? 210  ILE A C     1 
ATOM   2466  O  O     . ILE D 4  210  ? 64.954  10.102  49.576  1.00 165.20 ? 210  ILE A O     1 
ATOM   2467  C  CB    . ILE D 4  210  ? 63.917  13.166  50.600  1.00 162.84 ? 210  ILE A CB    1 
ATOM   2468  C  CG1   . ILE D 4  210  ? 64.649  14.417  51.090  1.00 165.59 ? 210  ILE A CG1   1 
ATOM   2469  C  CG2   . ILE D 4  210  ? 63.692  12.187  51.745  1.00 162.00 ? 210  ILE A CG2   1 
ATOM   2470  C  CD1   . ILE D 4  210  ? 63.873  15.211  52.118  1.00 167.08 ? 210  ILE A CD1   1 
ATOM   2471  N  N     . PHE D 4  211  ? 63.042  10.879  48.675  1.00 158.35 ? 211  PHE A N     1 
ATOM   2472  C  CA    . PHE D 4  211  ? 62.442  9.550   48.597  1.00 153.69 ? 211  PHE A CA    1 
ATOM   2473  C  C     . PHE D 4  211  ? 63.204  8.631   47.650  1.00 163.76 ? 211  PHE A C     1 
ATOM   2474  O  O     . PHE D 4  211  ? 63.261  7.419   47.884  1.00 157.73 ? 211  PHE A O     1 
ATOM   2475  C  CB    . PHE D 4  211  ? 60.979  9.658   48.170  1.00 154.13 ? 211  PHE A CB    1 
ATOM   2476  C  CG    . PHE D 4  211  ? 60.047  10.051  49.284  1.00 155.20 ? 211  PHE A CG    1 
ATOM   2477  C  CD1   . PHE D 4  211  ? 60.537  10.601  50.457  1.00 148.58 ? 211  PHE A CD1   1 
ATOM   2478  C  CD2   . PHE D 4  211  ? 58.680  9.872   49.156  1.00 160.15 ? 211  PHE A CD2   1 
ATOM   2479  C  CE1   . PHE D 4  211  ? 59.684  10.963  51.480  1.00 152.19 ? 211  PHE A CE1   1 
ATOM   2480  C  CE2   . PHE D 4  211  ? 57.820  10.232  50.178  1.00 157.00 ? 211  PHE A CE2   1 
ATOM   2481  C  CZ    . PHE D 4  211  ? 58.324  10.778  51.341  1.00 154.39 ? 211  PHE A CZ    1 
ATOM   2482  N  N     . LYS D 4  212  ? 63.786  9.179   46.581  1.00 179.07 ? 212  LYS A N     1 
ATOM   2483  C  CA    . LYS D 4  212  ? 64.592  8.360   45.681  1.00 189.11 ? 212  LYS A CA    1 
ATOM   2484  C  C     . LYS D 4  212  ? 65.769  7.739   46.423  1.00 189.87 ? 212  LYS A C     1 
ATOM   2485  O  O     . LYS D 4  212  ? 66.021  6.534   46.314  1.00 190.37 ? 212  LYS A O     1 
ATOM   2486  C  CB    . LYS D 4  212  ? 65.080  9.199   44.496  1.00 190.67 ? 212  LYS A CB    1 
ATOM   2487  C  CG    . LYS D 4  212  ? 66.406  8.735   43.895  1.00 184.20 ? 212  LYS A CG    1 
ATOM   2488  C  CD    . LYS D 4  212  ? 66.281  7.397   43.172  1.00 170.84 ? 212  LYS A CD    1 
ATOM   2489  C  CE    . LYS D 4  212  ? 67.617  6.668   43.138  1.00 165.37 ? 212  LYS A CE    1 
ATOM   2490  N  NZ    . LYS D 4  212  ? 68.737  7.557   42.723  1.00 160.83 ? 212  LYS A NZ    1 
ATOM   2491  N  N     . HIS D 4  213  ? 66.497  8.546   47.192  1.00 185.47 ? 213  HIS A N     1 
ATOM   2492  C  CA    . HIS D 4  213  ? 67.658  8.045   47.913  1.00 186.69 ? 213  HIS A CA    1 
ATOM   2493  C  C     . HIS D 4  213  ? 67.291  7.322   49.201  1.00 183.83 ? 213  HIS A C     1 
ATOM   2494  O  O     . HIS D 4  213  ? 68.194  6.905   49.935  1.00 195.29 ? 213  HIS A O     1 
ATOM   2495  C  CB    . HIS D 4  213  ? 68.633  9.187   48.203  1.00 190.04 ? 213  HIS A CB    1 
ATOM   2496  C  CG    . HIS D 4  213  ? 69.614  9.426   47.097  1.00 191.57 ? 213  HIS A CG    1 
ATOM   2497  N  ND1   . HIS D 4  213  ? 70.105  8.407   46.310  1.00 190.01 ? 213  HIS A ND1   1 
ATOM   2498  C  CD2   . HIS D 4  213  ? 70.188  10.564  46.641  1.00 191.66 ? 213  HIS A CD2   1 
ATOM   2499  C  CE1   . HIS D 4  213  ? 70.943  8.906   45.419  1.00 191.15 ? 213  HIS A CE1   1 
ATOM   2500  N  NE2   . HIS D 4  213  ? 71.011  10.213  45.598  1.00 193.27 ? 213  HIS A NE2   1 
ATOM   2501  N  N     . ILE D 4  214  ? 66.002  7.168   49.500  1.00 167.75 ? 214  ILE A N     1 
ATOM   2502  C  CA    . ILE D 4  214  ? 65.589  6.192   50.501  1.00 150.78 ? 214  ILE A CA    1 
ATOM   2503  C  C     . ILE D 4  214  ? 65.856  4.802   49.940  1.00 154.76 ? 214  ILE A C     1 
ATOM   2504  O  O     . ILE D 4  214  ? 65.360  4.446   48.865  1.00 145.47 ? 214  ILE A O     1 
ATOM   2505  C  CB    . ILE D 4  214  ? 64.114  6.376   50.882  1.00 132.58 ? 214  ILE A CB    1 
ATOM   2506  C  CG1   . ILE D 4  214  ? 63.867  7.782   51.431  1.00 136.35 ? 214  ILE A CG1   1 
ATOM   2507  C  CG2   . ILE D 4  214  ? 63.698  5.341   51.906  1.00 115.50 ? 214  ILE A CG2   1 
ATOM   2508  C  CD1   . ILE D 4  214  ? 62.447  8.006   51.913  1.00 133.82 ? 214  ILE A CD1   1 
ATOM   2509  N  N     . SER D 4  215  ? 66.648  4.014   50.664  1.00 166.58 ? 215  SER A N     1 
ATOM   2510  C  CA    . SER D 4  215  ? 67.176  2.770   50.125  1.00 173.91 ? 215  SER A CA    1 
ATOM   2511  C  C     . SER D 4  215  ? 66.064  1.736   49.938  1.00 170.49 ? 215  SER A C     1 
ATOM   2512  O  O     . SER D 4  215  ? 64.923  1.911   50.376  1.00 173.46 ? 215  SER A O     1 
ATOM   2513  C  CB    . SER D 4  215  ? 68.276  2.222   51.033  1.00 178.03 ? 215  SER A CB    1 
ATOM   2514  O  OG    . SER D 4  215  ? 69.375  3.116   51.094  1.00 178.73 ? 215  SER A OG    1 
ATOM   2515  N  N     . VAL D 4  216  ? 66.424  0.637   49.269  1.00 163.07 ? 216  VAL A N     1 
ATOM   2516  C  CA    . VAL D 4  216  ? 65.439  -0.377  48.904  1.00 153.48 ? 216  VAL A CA    1 
ATOM   2517  C  C     . VAL D 4  216  ? 64.962  -1.139  50.134  1.00 153.72 ? 216  VAL A C     1 
ATOM   2518  O  O     . VAL D 4  216  ? 63.790  -1.527  50.222  1.00 146.27 ? 216  VAL A O     1 
ATOM   2519  C  CB    . VAL D 4  216  ? 66.020  -1.323  47.835  1.00 141.88 ? 216  VAL A CB    1 
ATOM   2520  C  CG1   . VAL D 4  216  ? 66.182  -0.593  46.509  1.00 142.66 ? 216  VAL A CG1   1 
ATOM   2521  C  CG2   . VAL D 4  216  ? 67.356  -1.893  48.291  1.00 131.25 ? 216  VAL A CG2   1 
ATOM   2522  N  N     . LYS D 4  217  ? 65.853  -1.370  51.102  1.00 157.70 ? 217  LYS A N     1 
ATOM   2523  C  CA    . LYS D 4  217  ? 65.447  -2.071  52.316  1.00 154.21 ? 217  LYS A CA    1 
ATOM   2524  C  C     . LYS D 4  217  ? 64.492  -1.231  53.152  1.00 149.09 ? 217  LYS A C     1 
ATOM   2525  O  O     . LYS D 4  217  ? 63.665  -1.781  53.888  1.00 145.22 ? 217  LYS A O     1 
ATOM   2526  C  CB    . LYS D 4  217  ? 66.675  -2.468  53.137  1.00 156.17 ? 217  LYS A CB    1 
ATOM   2527  C  CG    . LYS D 4  217  ? 66.512  -3.792  53.870  1.00 161.87 ? 217  LYS A CG    1 
ATOM   2528  C  CD    . LYS D 4  217  ? 66.191  -4.919  52.897  1.00 160.61 ? 217  LYS A CD    1 
ATOM   2529  C  CE    . LYS D 4  217  ? 65.871  -6.216  53.624  1.00 158.89 ? 217  LYS A CE    1 
ATOM   2530  N  NZ    . LYS D 4  217  ? 66.980  -6.637  54.523  1.00 156.17 ? 217  LYS A NZ    1 
ATOM   2531  N  N     . ASP D 4  218  ? 64.590  0.097   53.055  1.00 152.07 ? 218  ASP A N     1 
ATOM   2532  C  CA    . ASP D 4  218  ? 63.617  0.957   53.719  1.00 152.49 ? 218  ASP A CA    1 
ATOM   2533  C  C     . ASP D 4  218  ? 62.263  0.891   53.021  1.00 159.35 ? 218  ASP A C     1 
ATOM   2534  O  O     . ASP D 4  218  ? 61.216  0.941   53.677  1.00 124.28 ? 218  ASP A O     1 
ATOM   2535  C  CB    . ASP D 4  218  ? 64.128  2.396   53.760  1.00 154.55 ? 218  ASP A CB    1 
ATOM   2536  C  CG    . ASP D 4  218  ? 65.609  2.486   54.082  1.00 156.98 ? 218  ASP A CG    1 
ATOM   2537  O  OD1   . ASP D 4  218  ? 66.071  1.772   54.998  1.00 156.65 ? 218  ASP A OD1   1 
ATOM   2538  O  OD2   . ASP D 4  218  ? 66.312  3.277   53.417  1.00 156.29 ? 218  ASP A OD2   1 
ATOM   2539  N  N     . PHE D 4  219  ? 62.268  0.790   51.688  1.00 192.50 ? 219  PHE A N     1 
ATOM   2540  C  CA    . PHE D 4  219  ? 61.026  0.631   50.935  1.00 195.59 ? 219  PHE A CA    1 
ATOM   2541  C  C     . PHE D 4  219  ? 60.289  -0.633  51.358  1.00 194.73 ? 219  PHE A C     1 
ATOM   2542  O  O     . PHE D 4  219  ? 59.158  -0.576  51.856  1.00 197.95 ? 219  PHE A O     1 
ATOM   2543  C  CB    . PHE D 4  219  ? 61.317  0.580   49.432  1.00 200.75 ? 219  PHE A CB    1 
ATOM   2544  C  CG    . PHE D 4  219  ? 61.644  1.908   48.816  1.00 211.94 ? 219  PHE A CG    1 
ATOM   2545  C  CD1   . PHE D 4  219  ? 61.856  2.009   47.451  1.00 218.26 ? 219  PHE A CD1   1 
ATOM   2546  C  CD2   . PHE D 4  219  ? 61.743  3.052   49.590  1.00 220.18 ? 219  PHE A CD2   1 
ATOM   2547  C  CE1   . PHE D 4  219  ? 62.158  3.222   46.868  1.00 225.98 ? 219  PHE A CE1   1 
ATOM   2548  C  CE2   . PHE D 4  219  ? 62.048  4.269   49.010  1.00 227.87 ? 219  PHE A CE2   1 
ATOM   2549  C  CZ    . PHE D 4  219  ? 62.255  4.354   47.648  1.00 229.81 ? 219  PHE A CZ    1 
ATOM   2550  N  N     . THR D 4  220  ? 60.926  -1.790  51.158  1.00 183.31 ? 220  THR A N     1 
ATOM   2551  C  CA    . THR D 4  220  ? 60.254  -3.070  51.358  1.00 167.77 ? 220  THR A CA    1 
ATOM   2552  C  C     . THR D 4  220  ? 59.845  -3.278  52.811  1.00 163.22 ? 220  THR A C     1 
ATOM   2553  O  O     . THR D 4  220  ? 58.834  -3.937  53.080  1.00 169.38 ? 220  THR A O     1 
ATOM   2554  C  CB    . THR D 4  220  ? 61.161  -4.212  50.889  1.00 173.47 ? 220  THR A CB    1 
ATOM   2555  O  OG1   . THR D 4  220  ? 61.795  -3.845  49.657  1.00 174.31 ? 220  THR A OG1   1 
ATOM   2556  C  CG2   . THR D 4  220  ? 60.353  -5.483  50.669  1.00 177.28 ? 220  THR A CG2   1 
ATOM   2557  N  N     . SER D 4  221  ? 60.610  -2.729  53.759  1.00 156.09 ? 221  SER A N     1 
ATOM   2558  C  CA    . SER D 4  221  ? 60.226  -2.837  55.163  1.00 149.13 ? 221  SER A CA    1 
ATOM   2559  C  C     . SER D 4  221  ? 58.929  -2.086  55.437  1.00 142.72 ? 221  SER A C     1 
ATOM   2560  O  O     . SER D 4  221  ? 58.115  -2.524  56.257  1.00 132.63 ? 221  SER A O     1 
ATOM   2561  C  CB    . SER D 4  221  ? 61.350  -2.318  56.062  1.00 151.86 ? 221  SER A CB    1 
ATOM   2562  O  OG    . SER D 4  221  ? 61.902  -1.116  55.555  1.00 160.88 ? 221  SER A OG    1 
ATOM   2563  N  N     . LEU D 4  222  ? 58.717  -0.957  54.758  1.00 146.22 ? 222  LEU A N     1 
ATOM   2564  C  CA    . LEU D 4  222  ? 57.459  -0.233  54.896  1.00 144.18 ? 222  LEU A CA    1 
ATOM   2565  C  C     . LEU D 4  222  ? 56.306  -0.953  54.212  1.00 159.14 ? 222  LEU A C     1 
ATOM   2566  O  O     . LEU D 4  222  ? 55.146  -0.719  54.568  1.00 151.16 ? 222  LEU A O     1 
ATOM   2567  C  CB    . LEU D 4  222  ? 57.602  1.183   54.335  1.00 129.92 ? 222  LEU A CB    1 
ATOM   2568  C  CG    . LEU D 4  222  ? 58.452  2.138   55.175  1.00 111.95 ? 222  LEU A CG    1 
ATOM   2569  C  CD1   . LEU D 4  222  ? 58.997  3.273   54.323  1.00 110.61 ? 222  LEU A CD1   1 
ATOM   2570  C  CD2   . LEU D 4  222  ? 57.649  2.681   56.349  1.00 102.81 ? 222  LEU A CD2   1 
ATOM   2571  N  N     . GLY D 4  223  ? 56.594  -1.816  53.241  1.00 174.01 ? 223  GLY A N     1 
ATOM   2572  C  CA    . GLY D 4  223  ? 55.561  -2.606  52.602  1.00 170.89 ? 223  GLY A CA    1 
ATOM   2573  C  C     . GLY D 4  223  ? 55.376  -2.315  51.129  1.00 158.34 ? 223  GLY A C     1 
ATOM   2574  O  O     . GLY D 4  223  ? 54.383  -2.735  50.526  1.00 144.91 ? 223  GLY A O     1 
ATOM   2575  N  N     . PHE D 4  224  ? 56.325  -1.598  50.536  1.00 162.97 ? 224  PHE A N     1 
ATOM   2576  C  CA    . PHE D 4  224  ? 56.248  -1.203  49.140  1.00 156.44 ? 224  PHE A CA    1 
ATOM   2577  C  C     . PHE D 4  224  ? 57.063  -2.176  48.289  1.00 156.38 ? 224  PHE A C     1 
ATOM   2578  O  O     . PHE D 4  224  ? 57.623  -3.156  48.785  1.00 168.92 ? 224  PHE A O     1 
ATOM   2579  C  CB    . PHE D 4  224  ? 56.718  0.243   48.962  1.00 156.20 ? 224  PHE A CB    1 
ATOM   2580  C  CG    . PHE D 4  224  ? 55.816  1.271   49.611  1.00 161.95 ? 224  PHE A CG    1 
ATOM   2581  C  CD1   . PHE D 4  224  ? 54.786  0.893   50.458  1.00 162.82 ? 224  PHE A CD1   1 
ATOM   2582  C  CD2   . PHE D 4  224  ? 56.003  2.619   49.366  1.00 163.62 ? 224  PHE A CD2   1 
ATOM   2583  C  CE1   . PHE D 4  224  ? 53.969  1.835   51.050  1.00 164.75 ? 224  PHE A CE1   1 
ATOM   2584  C  CE2   . PHE D 4  224  ? 55.187  3.568   49.955  1.00 159.24 ? 224  PHE A CE2   1 
ATOM   2585  C  CZ    . PHE D 4  224  ? 54.169  3.174   50.798  1.00 162.00 ? 224  PHE A CZ    1 
ATOM   2586  N  N     . ASN D 4  225  ? 57.128  -1.905  46.988  1.00 145.04 ? 225  ASN A N     1 
ATOM   2587  C  CA    . ASN D 4  225  ? 57.747  -2.823  46.041  1.00 139.25 ? 225  ASN A CA    1 
ATOM   2588  C  C     . ASN D 4  225  ? 58.885  -2.149  45.287  1.00 151.22 ? 225  ASN A C     1 
ATOM   2589  O  O     . ASN D 4  225  ? 58.822  -0.955  44.979  1.00 142.64 ? 225  ASN A O     1 
ATOM   2590  C  CB    . ASN D 4  225  ? 56.718  -3.370  45.046  1.00 116.13 ? 225  ASN A CB    1 
ATOM   2591  C  CG    . ASN D 4  225  ? 56.021  -4.617  45.557  1.00 107.80 ? 225  ASN A CG    1 
ATOM   2592  O  OD1   . ASN D 4  225  ? 55.583  -4.671  46.707  1.00 114.34 ? 225  ASN A OD1   1 
ATOM   2593  N  ND2   . ASN D 4  225  ? 55.928  -5.633  44.706  1.00 96.72  ? 225  ASN A ND2   1 
ATOM   2594  N  N     . GLU D 4  226  ? 59.925  -2.932  44.993  1.00 172.60 ? 226  GLU A N     1 
ATOM   2595  C  CA    . GLU D 4  226  ? 61.040  -2.433  44.196  1.00 176.34 ? 226  GLU A CA    1 
ATOM   2596  C  C     . GLU D 4  226  ? 60.602  -2.052  42.788  1.00 171.56 ? 226  GLU A C     1 
ATOM   2597  O  O     . GLU D 4  226  ? 61.155  -1.117  42.198  1.00 179.90 ? 226  GLU A O     1 
ATOM   2598  C  CB    . GLU D 4  226  ? 62.145  -3.493  44.144  1.00 183.30 ? 226  GLU A CB    1 
ATOM   2599  C  CG    . GLU D 4  226  ? 63.358  -3.121  43.303  1.00 185.13 ? 226  GLU A CG    1 
ATOM   2600  C  CD    . GLU D 4  226  ? 64.346  -4.266  43.170  1.00 178.13 ? 226  GLU A CD    1 
ATOM   2601  O  OE1   . GLU D 4  226  ? 64.046  -5.365  43.676  1.00 171.31 ? 226  GLU A OE1   1 
ATOM   2602  O  OE2   . GLU D 4  226  ? 65.421  -4.065  42.567  1.00 174.47 ? 226  GLU A OE2   1 
ATOM   2603  N  N     . VAL D 4  227  ? 59.605  -2.743  42.239  1.00 162.46 ? 227  VAL A N     1 
ATOM   2604  C  CA    . VAL D 4  227  ? 59.196  -2.553  40.854  1.00 158.17 ? 227  VAL A CA    1 
ATOM   2605  C  C     . VAL D 4  227  ? 57.813  -1.921  40.741  1.00 155.84 ? 227  VAL A C     1 
ATOM   2606  O  O     . VAL D 4  227  ? 57.594  -1.069  39.874  1.00 158.52 ? 227  VAL A O     1 
ATOM   2607  C  CB    . VAL D 4  227  ? 59.256  -3.883  40.076  1.00 142.15 ? 227  VAL A CB    1 
ATOM   2608  C  CG1   . VAL D 4  227  ? 60.695  -4.252  39.758  1.00 134.21 ? 227  VAL A CG1   1 
ATOM   2609  C  CG2   . VAL D 4  227  ? 58.587  -4.995  40.872  1.00 137.56 ? 227  VAL A CG2   1 
ATOM   2610  N  N     . PHE D 4  228  ? 56.866  -2.318  41.598  1.00 150.70 ? 228  PHE A N     1 
ATOM   2611  C  CA    . PHE D 4  228  ? 55.496  -1.822  41.450  1.00 138.72 ? 228  PHE A CA    1 
ATOM   2612  C  C     . PHE D 4  228  ? 55.326  -0.424  42.035  1.00 145.78 ? 228  PHE A C     1 
ATOM   2613  O  O     . PHE D 4  228  ? 55.069  0.540   41.307  1.00 146.98 ? 228  PHE A O     1 
ATOM   2614  C  CB    . PHE D 4  228  ? 54.497  -2.785  42.105  1.00 126.16 ? 228  PHE A CB    1 
ATOM   2615  C  CG    . PHE D 4  228  ? 54.291  -4.068  41.354  1.00 126.72 ? 228  PHE A CG    1 
ATOM   2616  C  CD1   . PHE D 4  228  ? 53.470  -5.058  41.868  1.00 123.10 ? 228  PHE A CD1   1 
ATOM   2617  C  CD2   . PHE D 4  228  ? 54.909  -4.284  40.137  1.00 133.55 ? 228  PHE A CD2   1 
ATOM   2618  C  CE1   . PHE D 4  228  ? 53.269  -6.240  41.179  1.00 126.38 ? 228  PHE A CE1   1 
ATOM   2619  C  CE2   . PHE D 4  228  ? 54.717  -5.462  39.447  1.00 137.09 ? 228  PHE A CE2   1 
ATOM   2620  C  CZ    . PHE D 4  228  ? 53.896  -6.441  39.966  1.00 131.83 ? 228  PHE A CZ    1 
ATOM   2621  N  N     . SER D 4  229  ? 55.470  -0.296  43.351  1.00 146.89 ? 229  SER A N     1 
ATOM   2622  C  CA    . SER D 4  229  ? 55.146  0.947   44.041  1.00 148.78 ? 229  SER A CA    1 
ATOM   2623  C  C     . SER D 4  229  ? 56.328  1.385   44.891  1.00 147.97 ? 229  SER A C     1 
ATOM   2624  O  O     . SER D 4  229  ? 56.766  0.647   45.779  1.00 152.03 ? 229  SER A O     1 
ATOM   2625  C  CB    . SER D 4  229  ? 53.898  0.779   44.912  1.00 150.90 ? 229  SER A CB    1 
ATOM   2626  O  OG    . SER D 4  229  ? 54.125  -0.147  45.961  1.00 165.46 ? 229  SER A OG    1 
ATOM   2627  N  N     . ARG D 4  230  ? 56.827  2.589   44.631  1.00 143.43 ? 230  ARG A N     1 
ATOM   2628  C  CA    . ARG D 4  230  ? 57.861  3.197   45.447  1.00 149.09 ? 230  ARG A CA    1 
ATOM   2629  C  C     . ARG D 4  230  ? 57.382  4.550   45.963  1.00 162.37 ? 230  ARG A C     1 
ATOM   2630  O  O     . ARG D 4  230  ? 56.596  5.228   45.292  1.00 174.55 ? 230  ARG A O     1 
ATOM   2631  C  CB    . ARG D 4  230  ? 59.164  3.373   44.654  1.00 147.38 ? 230  ARG A CB    1 
ATOM   2632  C  CG    . ARG D 4  230  ? 59.667  2.088   44.011  1.00 149.91 ? 230  ARG A CG    1 
ATOM   2633  C  CD    . ARG D 4  230  ? 60.546  2.368   42.805  1.00 153.66 ? 230  ARG A CD    1 
ATOM   2634  N  NE    . ARG D 4  230  ? 61.865  2.864   43.187  1.00 153.62 ? 230  ARG A NE    1 
ATOM   2635  C  CZ    . ARG D 4  230  ? 62.971  2.127   43.178  1.00 151.22 ? 230  ARG A CZ    1 
ATOM   2636  N  NH1   . ARG D 4  230  ? 64.130  2.660   43.539  1.00 149.22 ? 230  ARG A NH1   1 
ATOM   2637  N  NH2   . ARG D 4  230  ? 62.917  0.857   42.804  1.00 148.19 ? 230  ARG A NH2   1 
ATOM   2638  N  N     . PRO D 4  231  ? 57.819  4.961   47.157  1.00 167.11 ? 231  PRO A N     1 
ATOM   2639  C  CA    . PRO D 4  231  ? 57.367  6.258   47.690  1.00 166.64 ? 231  PRO A CA    1 
ATOM   2640  C  C     . PRO D 4  231  ? 57.746  7.431   46.808  1.00 165.30 ? 231  PRO A C     1 
ATOM   2641  O  O     . PRO D 4  231  ? 57.033  8.442   46.794  1.00 162.76 ? 231  PRO A O     1 
ATOM   2642  C  CB    . PRO D 4  231  ? 58.057  6.341   49.061  1.00 173.63 ? 231  PRO A CB    1 
ATOM   2643  C  CG    . PRO D 4  231  ? 58.496  4.952   49.377  1.00 174.75 ? 231  PRO A CG    1 
ATOM   2644  C  CD    . PRO D 4  231  ? 58.747  4.274   48.070  1.00 172.84 ? 231  PRO A CD    1 
ATOM   2645  N  N     . GLU D 4  232  ? 58.852  7.324   46.069  1.00 165.23 ? 232  GLU A N     1 
ATOM   2646  C  CA    . GLU D 4  232  ? 59.238  8.366   45.125  1.00 163.88 ? 232  GLU A CA    1 
ATOM   2647  C  C     . GLU D 4  232  ? 58.180  8.592   44.051  1.00 143.84 ? 232  GLU A C     1 
ATOM   2648  O  O     . GLU D 4  232  ? 58.142  9.672   43.449  1.00 139.62 ? 232  GLU A O     1 
ATOM   2649  C  CB    . GLU D 4  232  ? 60.575  8.002   44.479  1.00 170.38 ? 232  GLU A CB    1 
ATOM   2650  C  CG    . GLU D 4  232  ? 60.583  6.629   43.828  1.00 171.34 ? 232  GLU A CG    1 
ATOM   2651  C  CD    . GLU D 4  232  ? 61.981  6.121   43.546  1.00 177.22 ? 232  GLU A CD    1 
ATOM   2652  O  OE1   . GLU D 4  232  ? 62.359  5.072   44.109  1.00 177.96 ? 232  GLU A OE1   1 
ATOM   2653  O  OE2   . GLU D 4  232  ? 62.704  6.770   42.762  1.00 182.53 ? 232  GLU A OE2   1 
ATOM   2654  N  N     . TRP D 4  233  ? 57.326  7.603   43.799  1.00 128.34 ? 233  TRP A N     1 
ATOM   2655  C  CA    . TRP D 4  233  ? 56.255  7.724   42.823  1.00 114.67 ? 233  TRP A CA    1 
ATOM   2656  C  C     . TRP D 4  233  ? 54.900  7.979   43.469  1.00 120.31 ? 233  TRP A C     1 
ATOM   2657  O  O     . TRP D 4  233  ? 53.897  8.072   42.754  1.00 121.79 ? 233  TRP A O     1 
ATOM   2658  C  CB    . TRP D 4  233  ? 56.194  6.468   41.951  1.00 107.80 ? 233  TRP A CB    1 
ATOM   2659  C  CG    . TRP D 4  233  ? 57.435  6.286   41.144  1.00 119.37 ? 233  TRP A CG    1 
ATOM   2660  C  CD1   . TRP D 4  233  ? 58.294  7.265   40.737  1.00 129.43 ? 233  TRP A CD1   1 
ATOM   2661  C  CD2   . TRP D 4  233  ? 57.972  5.052   40.654  1.00 132.73 ? 233  TRP A CD2   1 
ATOM   2662  N  NE1   . TRP D 4  233  ? 59.331  6.719   40.022  1.00 136.78 ? 233  TRP A NE1   1 
ATOM   2663  C  CE2   . TRP D 4  233  ? 59.157  5.362   39.955  1.00 142.73 ? 233  TRP A CE2   1 
ATOM   2664  C  CE3   . TRP D 4  233  ? 57.566  3.716   40.735  1.00 135.48 ? 233  TRP A CE3   1 
ATOM   2665  C  CZ2   . TRP D 4  233  ? 59.940  4.385   39.342  1.00 148.42 ? 233  TRP A CZ2   1 
ATOM   2666  C  CZ3   . TRP D 4  233  ? 58.344  2.748   40.124  1.00 144.94 ? 233  TRP A CZ3   1 
ATOM   2667  C  CH2   . TRP D 4  233  ? 59.517  3.087   39.438  1.00 150.80 ? 233  TRP A CH2   1 
ATOM   2668  N  N     . MET D 4  234  ? 54.843  8.076   44.800  1.00 121.25 ? 234  MET A N     1 
ATOM   2669  C  CA    . MET D 4  234  ? 53.638  8.578   45.453  1.00 122.74 ? 234  MET A CA    1 
ATOM   2670  C  C     . MET D 4  234  ? 53.312  9.979   44.959  1.00 142.38 ? 234  MET A C     1 
ATOM   2671  O  O     . MET D 4  234  ? 52.169  10.273  44.590  1.00 143.37 ? 234  MET A O     1 
ATOM   2672  C  CB    . MET D 4  234  ? 53.819  8.582   46.971  1.00 131.85 ? 234  MET A CB    1 
ATOM   2673  C  CG    . MET D 4  234  ? 53.160  7.430   47.700  1.00 138.27 ? 234  MET A CG    1 
ATOM   2674  S  SD    . MET D 4  234  ? 52.672  7.909   49.370  1.00 150.16 ? 234  MET A SD    1 
ATOM   2675  C  CE    . MET D 4  234  ? 52.945  6.378   50.251  1.00 135.21 ? 234  MET A CE    1 
ATOM   2676  N  N     . ILE D 4  235  ? 54.311  10.858  44.949  1.00 157.99 ? 235  ILE A N     1 
ATOM   2677  C  CA    . ILE D 4  235  ? 54.180  12.173  44.338  1.00 164.80 ? 235  ILE A CA    1 
ATOM   2678  C  C     . ILE D 4  235  ? 54.179  11.987  42.827  1.00 150.38 ? 235  ILE A C     1 
ATOM   2679  O  O     . ILE D 4  235  ? 54.558  10.926  42.320  1.00 150.68 ? 235  ILE A O     1 
ATOM   2680  C  CB    . ILE D 4  235  ? 55.303  13.125  44.793  1.00 171.22 ? 235  ILE A CB    1 
ATOM   2681  C  CG1   . ILE D 4  235  ? 56.684  12.501  44.557  1.00 174.04 ? 235  ILE A CG1   1 
ATOM   2682  C  CG2   . ILE D 4  235  ? 55.127  13.490  46.262  1.00 171.82 ? 235  ILE A CG2   1 
ATOM   2683  C  CD1   . ILE D 4  235  ? 57.331  12.880  43.233  1.00 174.42 ? 235  ILE A CD1   1 
ATOM   2684  N  N     . LEU D 4  236  ? 53.768  13.018  42.099  1.00 128.90 ? 236  LEU A N     1 
ATOM   2685  C  CA    . LEU D 4  236  ? 53.628  12.948  40.650  1.00 128.28 ? 236  LEU A CA    1 
ATOM   2686  C  C     . LEU D 4  236  ? 54.254  14.180  40.017  1.00 145.07 ? 236  LEU A C     1 
ATOM   2687  O  O     . LEU D 4  236  ? 53.855  15.310  40.319  1.00 131.06 ? 236  LEU A O     1 
ATOM   2688  C  CB    . LEU D 4  236  ? 52.156  12.809  40.238  1.00 128.35 ? 236  LEU A CB    1 
ATOM   2689  C  CG    . LEU D 4  236  ? 51.131  13.788  40.815  1.00 133.76 ? 236  LEU A CG    1 
ATOM   2690  C  CD1   . LEU D 4  236  ? 49.967  13.956  39.862  1.00 148.06 ? 236  LEU A CD1   1 
ATOM   2691  C  CD2   . LEU D 4  236  ? 50.621  13.278  42.153  1.00 113.45 ? 236  LEU A CD2   1 
ATOM   2692  N  N     . THR D 4  237  ? 55.244  13.958  39.154  1.00 165.12 ? 237  THR A N     1 
ATOM   2693  C  CA    . THR D 4  237  ? 55.819  15.014  38.337  1.00 182.25 ? 237  THR A CA    1 
ATOM   2694  C  C     . THR D 4  237  ? 55.501  14.851  36.859  1.00 183.57 ? 237  THR A C     1 
ATOM   2695  O  O     . THR D 4  237  ? 55.682  15.804  36.093  1.00 190.02 ? 237  THR A O     1 
ATOM   2696  C  CB    . THR D 4  237  ? 57.343  15.070  38.527  1.00 192.07 ? 237  THR A CB    1 
ATOM   2697  O  OG1   . THR D 4  237  ? 57.869  16.219  37.852  1.00 213.79 ? 237  THR A OG1   1 
ATOM   2698  C  CG2   . THR D 4  237  ? 57.995  13.812  37.975  1.00 182.33 ? 237  THR A CG2   1 
ATOM   2699  N  N     . CYS D 4  238  ? 55.036  13.676  36.441  1.00 179.56 ? 238  CYS A N     1 
ATOM   2700  C  CA    . CYS D 4  238  ? 54.602  13.434  35.071  1.00 185.40 ? 238  CYS A CA    1 
ATOM   2701  C  C     . CYS D 4  238  ? 53.214  12.815  35.120  1.00 172.68 ? 238  CYS A C     1 
ATOM   2702  O  O     . CYS D 4  238  ? 53.016  11.781  35.766  1.00 174.78 ? 238  CYS A O     1 
ATOM   2703  C  CB    . CYS D 4  238  ? 55.578  12.516  34.331  1.00 198.01 ? 238  CYS A CB    1 
ATOM   2704  S  SG    . CYS D 4  238  ? 55.138  12.188  32.610  1.00 209.44 ? 238  CYS A SG    1 
ATOM   2705  N  N     . LEU D 4  239  ? 52.258  13.446  34.441  1.00 145.15 ? 239  LEU A N     1 
ATOM   2706  C  CA    . LEU D 4  239  ? 50.883  12.987  34.501  1.00 128.33 ? 239  LEU A CA    1 
ATOM   2707  C  C     . LEU D 4  239  ? 50.453  12.379  33.171  1.00 149.71 ? 239  LEU A C     1 
ATOM   2708  O  O     . LEU D 4  239  ? 50.816  12.892  32.107  1.00 156.43 ? 239  LEU A O     1 
ATOM   2709  C  CB    . LEU D 4  239  ? 49.940  14.143  34.862  1.00 113.11 ? 239  LEU A CB    1 
ATOM   2710  C  CG    . LEU D 4  239  ? 48.465  13.819  35.117  1.00 104.24 ? 239  LEU A CG    1 
ATOM   2711  C  CD1   . LEU D 4  239  ? 47.952  14.624  36.300  1.00 113.46 ? 239  LEU A CD1   1 
ATOM   2712  C  CD2   . LEU D 4  239  ? 47.616  14.091  33.883  1.00 81.98  ? 239  LEU A CD2   1 
ATOM   2713  N  N     . PRO D 4  240  ? 49.710  11.271  33.198  1.00 164.81 ? 240  PRO A N     1 
ATOM   2714  C  CA    . PRO D 4  240  ? 49.154  10.722  31.955  1.00 162.11 ? 240  PRO A CA    1 
ATOM   2715  C  C     . PRO D 4  240  ? 47.776  11.284  31.629  1.00 151.54 ? 240  PRO A C     1 
ATOM   2716  O  O     . PRO D 4  240  ? 46.879  11.262  32.477  1.00 144.13 ? 240  PRO A O     1 
ATOM   2717  C  CB    . PRO D 4  240  ? 49.098  9.218   32.245  1.00 150.93 ? 240  PRO A CB    1 
ATOM   2718  C  CG    . PRO D 4  240  ? 48.869  9.140   33.720  1.00 145.99 ? 240  PRO A CG    1 
ATOM   2719  C  CD    . PRO D 4  240  ? 49.542  10.349  34.336  1.00 161.60 ? 240  PRO A CD    1 
ATOM   2720  N  N     . VAL D 4  241  ? 47.591  11.785  30.412  1.00 144.85 ? 241  VAL A N     1 
ATOM   2721  C  CA    . VAL D 4  241  ? 46.282  12.279  29.988  1.00 135.93 ? 241  VAL A CA    1 
ATOM   2722  C  C     . VAL D 4  241  ? 45.483  11.120  29.401  1.00 129.36 ? 241  VAL A C     1 
ATOM   2723  O  O     . VAL D 4  241  ? 45.946  10.465  28.455  1.00 109.31 ? 241  VAL A O     1 
ATOM   2724  C  CB    . VAL D 4  241  ? 46.409  13.437  28.985  1.00 136.53 ? 241  VAL A CB    1 
ATOM   2725  C  CG1   . VAL D 4  241  ? 46.650  14.751  29.715  1.00 142.61 ? 241  VAL A CG1   1 
ATOM   2726  C  CG2   . VAL D 4  241  ? 47.522  13.172  27.982  1.00 129.51 ? 241  VAL A CG2   1 
ATOM   2727  N  N     . PRO D 4  242  ? 44.282  10.842  29.916  1.00 133.87 ? 242  PRO A N     1 
ATOM   2728  C  CA    . PRO D 4  242  ? 43.519  9.701   29.416  1.00 140.51 ? 242  PRO A CA    1 
ATOM   2729  C  C     . PRO D 4  242  ? 43.010  9.962   28.009  1.00 165.11 ? 242  PRO A C     1 
ATOM   2730  O  O     . PRO D 4  242  ? 42.823  11.123  27.607  1.00 165.25 ? 242  PRO A O     1 
ATOM   2731  C  CB    . PRO D 4  242  ? 42.359  9.584   30.421  1.00 121.65 ? 242  PRO A CB    1 
ATOM   2732  C  CG    . PRO D 4  242  ? 42.186  10.970  30.938  1.00 120.74 ? 242  PRO A CG    1 
ATOM   2733  C  CD    . PRO D 4  242  ? 43.568  11.566  30.983  1.00 132.47 ? 242  PRO A CD    1 
ATOM   2734  N  N     . PRO D 4  243  ? 42.771  8.913   27.225  1.00 176.66 ? 243  PRO A N     1 
ATOM   2735  C  CA    . PRO D 4  243  ? 42.330  9.097   25.835  1.00 176.14 ? 243  PRO A CA    1 
ATOM   2736  C  C     . PRO D 4  243  ? 40.943  9.712   25.768  1.00 164.87 ? 243  PRO A C     1 
ATOM   2737  O  O     . PRO D 4  243  ? 40.259  9.832   26.796  1.00 168.09 ? 243  PRO A O     1 
ATOM   2738  C  CB    . PRO D 4  243  ? 42.339  7.665   25.277  1.00 177.66 ? 243  PRO A CB    1 
ATOM   2739  C  CG    . PRO D 4  243  ? 42.161  6.798   26.469  1.00 180.77 ? 243  PRO A CG    1 
ATOM   2740  C  CD    . PRO D 4  243  ? 42.893  7.489   27.581  1.00 182.29 ? 243  PRO A CD    1 
ATOM   2741  N  N     . PRO D 4  244  ? 40.496  10.116  24.578  1.00 128.33 ? 244  PRO A N     1 
ATOM   2742  C  CA    . PRO D 4  244  ? 39.185  10.783  24.445  1.00 115.55 ? 244  PRO A CA    1 
ATOM   2743  C  C     . PRO D 4  244  ? 38.024  9.984   25.023  1.00 117.90 ? 244  PRO A C     1 
ATOM   2744  O  O     . PRO D 4  244  ? 37.106  10.590  25.597  1.00 105.57 ? 244  PRO A O     1 
ATOM   2745  C  CB    . PRO D 4  244  ? 39.042  10.964  22.925  1.00 111.51 ? 244  PRO A CB    1 
ATOM   2746  C  CG    . PRO D 4  244  ? 40.446  11.104  22.448  1.00 115.10 ? 244  PRO A CG    1 
ATOM   2747  C  CD    . PRO D 4  244  ? 41.285  10.212  23.333  1.00 107.58 ? 244  PRO A CD    1 
ATOM   2748  N  N     . PRO D 4  245  ? 37.991  8.642   24.892  1.00 135.31 ? 245  PRO A N     1 
ATOM   2749  C  CA    . PRO D 4  245  ? 36.828  7.903   25.430  1.00 142.05 ? 245  PRO A CA    1 
ATOM   2750  C  C     . PRO D 4  245  ? 36.520  8.167   26.898  1.00 131.12 ? 245  PRO A C     1 
ATOM   2751  O  O     . PRO D 4  245  ? 35.361  8.024   27.308  1.00 128.78 ? 245  PRO A O     1 
ATOM   2752  C  CB    . PRO D 4  245  ? 37.209  6.437   25.194  1.00 134.48 ? 245  PRO A CB    1 
ATOM   2753  C  CG    . PRO D 4  245  ? 38.039  6.482   23.984  1.00 131.85 ? 245  PRO A CG    1 
ATOM   2754  C  CD    . PRO D 4  245  ? 38.847  7.740   24.092  1.00 138.32 ? 245  PRO A CD    1 
ATOM   2755  N  N     . VAL D 4  246  ? 37.510  8.553   27.705  1.00 117.49 ? 246  VAL A N     1 
ATOM   2756  C  CA    . VAL D 4  246  ? 37.226  8.901   29.092  1.00 109.83 ? 246  VAL A CA    1 
ATOM   2757  C  C     . VAL D 4  246  ? 36.468  10.220  29.197  1.00 125.90 ? 246  VAL A C     1 
ATOM   2758  O  O     . VAL D 4  246  ? 35.752  10.448  30.180  1.00 124.65 ? 246  VAL A O     1 
ATOM   2759  C  CB    . VAL D 4  246  ? 38.538  8.946   29.900  1.00 102.87 ? 246  VAL A CB    1 
ATOM   2760  C  CG1   . VAL D 4  246  ? 38.253  9.033   31.391  1.00 88.65  ? 246  VAL A CG1   1 
ATOM   2761  C  CG2   . VAL D 4  246  ? 39.390  7.723   29.588  1.00 104.56 ? 246  VAL A CG2   1 
ATOM   2762  N  N     . ARG D 4  247  ? 36.592  11.091  28.195  1.00 143.75 ? 247  ARG A N     1 
ATOM   2763  C  CA    . ARG D 4  247  ? 35.935  12.398  28.174  1.00 156.14 ? 247  ARG A CA    1 
ATOM   2764  C  C     . ARG D 4  247  ? 35.272  12.583  26.815  1.00 161.70 ? 247  ARG A C     1 
ATOM   2765  O  O     . ARG D 4  247  ? 35.836  13.219  25.914  1.00 165.98 ? 247  ARG A O     1 
ATOM   2766  C  CB    . ARG D 4  247  ? 36.936  13.516  28.466  1.00 151.81 ? 247  ARG A CB    1 
ATOM   2767  C  CG    . ARG D 4  247  ? 38.303  13.277  27.851  1.00 148.85 ? 247  ARG A CG    1 
ATOM   2768  C  CD    . ARG D 4  247  ? 39.361  14.182  28.444  1.00 146.68 ? 247  ARG A CD    1 
ATOM   2769  N  NE    . ARG D 4  247  ? 40.703  13.760  28.056  1.00 153.35 ? 247  ARG A NE    1 
ATOM   2770  C  CZ    . ARG D 4  247  ? 41.315  14.147  26.942  1.00 164.28 ? 247  ARG A CZ    1 
ATOM   2771  N  NH1   . ARG D 4  247  ? 40.707  14.973  26.101  1.00 156.65 ? 247  ARG A NH1   1 
ATOM   2772  N  NH2   . ARG D 4  247  ? 42.538  13.710  26.670  1.00 183.18 ? 247  ARG A NH2   1 
ATOM   2773  N  N     . PRO D 4  248  ? 34.067  12.045  26.633  1.00 152.70 ? 248  PRO A N     1 
ATOM   2774  C  CA    . PRO D 4  248  ? 33.429  12.081  25.312  1.00 140.32 ? 248  PRO A CA    1 
ATOM   2775  C  C     . PRO D 4  248  ? 32.972  13.485  24.940  1.00 139.52 ? 248  PRO A C     1 
ATOM   2776  O  O     . PRO D 4  248  ? 33.005  14.423  25.739  1.00 151.34 ? 248  PRO A O     1 
ATOM   2777  C  CB    . PRO D 4  248  ? 32.239  11.132  25.468  1.00 131.57 ? 248  PRO A CB    1 
ATOM   2778  C  CG    . PRO D 4  248  ? 31.908  11.200  26.919  1.00 134.69 ? 248  PRO A CG    1 
ATOM   2779  C  CD    . PRO D 4  248  ? 33.220  11.382  27.640  1.00 143.90 ? 248  PRO A CD    1 
ATOM   2780  N  N     . SER D 4  249  ? 32.536  13.613  23.690  1.00 117.65 ? 249  SER A N     1 
ATOM   2781  C  CA    . SER D 4  249  ? 32.055  14.887  23.163  1.00 106.91 ? 249  SER A CA    1 
ATOM   2782  C  C     . SER D 4  249  ? 30.548  14.855  22.906  1.00 90.52  ? 249  SER A C     1 
ATOM   2783  O  O     . SER D 4  249  ? 29.742  14.971  23.831  1.00 72.91  ? 249  SER A O     1 
ATOM   2784  C  CB    . SER D 4  249  ? 32.795  15.241  21.870  1.00 103.30 ? 249  SER A CB    1 
ATOM   2785  O  OG    . SER D 4  249  ? 34.187  15.011  21.996  1.00 96.25  ? 249  SER A OG    1 
ATOM   2786  N  N     . ARG D 4  257  ? 27.564  17.604  20.388  1.00 108.56 ? 257  ARG A N     1 
ATOM   2787  C  CA    . ARG D 4  257  ? 28.090  18.885  19.929  1.00 129.96 ? 257  ARG A CA    1 
ATOM   2788  C  C     . ARG D 4  257  ? 28.676  19.700  21.080  1.00 158.92 ? 257  ARG A C     1 
ATOM   2789  O  O     . ARG D 4  257  ? 28.575  20.927  21.091  1.00 156.64 ? 257  ARG A O     1 
ATOM   2790  C  CB    . ARG D 4  257  ? 26.994  19.691  19.225  1.00 112.50 ? 257  ARG A CB    1 
ATOM   2791  N  N     . GLY D 4  258  ? 29.294  19.015  22.041  1.00 184.94 ? 258  GLY A N     1 
ATOM   2792  C  CA    . GLY D 4  258  ? 29.854  19.675  23.205  1.00 190.65 ? 258  GLY A CA    1 
ATOM   2793  C  C     . GLY D 4  258  ? 31.151  19.058  23.686  1.00 193.62 ? 258  GLY A C     1 
ATOM   2794  O  O     . GLY D 4  258  ? 31.761  18.246  22.984  1.00 198.41 ? 258  GLY A O     1 
ATOM   2795  N  N     . GLU D 4  259  ? 31.581  19.439  24.889  1.00 172.51 ? 259  GLU A N     1 
ATOM   2796  C  CA    . GLU D 4  259  ? 32.820  18.950  25.474  1.00 145.08 ? 259  GLU A CA    1 
ATOM   2797  C  C     . GLU D 4  259  ? 32.561  18.427  26.881  1.00 139.47 ? 259  GLU A C     1 
ATOM   2798  O  O     . GLU D 4  259  ? 31.575  18.784  27.531  1.00 117.10 ? 259  GLU A O     1 
ATOM   2799  C  CB    . GLU D 4  259  ? 33.898  20.044  25.510  1.00 133.47 ? 259  GLU A CB    1 
ATOM   2800  C  CG    . GLU D 4  259  ? 34.836  20.035  24.310  1.00 131.75 ? 259  GLU A CG    1 
ATOM   2801  C  CD    . GLU D 4  259  ? 35.657  18.761  24.209  1.00 121.52 ? 259  GLU A CD    1 
ATOM   2802  O  OE1   . GLU D 4  259  ? 35.887  18.108  25.250  1.00 121.34 ? 259  GLU A OE1   1 
ATOM   2803  O  OE2   . GLU D 4  259  ? 36.071  18.409  23.084  1.00 117.47 ? 259  GLU A OE2   1 
ATOM   2804  N  N     . ASP D 4  260  ? 33.474  17.578  27.348  1.00 155.78 ? 260  ASP A N     1 
ATOM   2805  C  CA    . ASP D 4  260  ? 33.338  16.901  28.629  1.00 154.99 ? 260  ASP A CA    1 
ATOM   2806  C  C     . ASP D 4  260  ? 33.915  17.750  29.757  1.00 156.56 ? 260  ASP A C     1 
ATOM   2807  O  O     . ASP D 4  260  ? 34.792  18.592  29.543  1.00 165.49 ? 260  ASP A O     1 
ATOM   2808  C  CB    . ASP D 4  260  ? 34.038  15.539  28.584  1.00 142.96 ? 260  ASP A CB    1 
ATOM   2809  C  CG    . ASP D 4  260  ? 33.847  14.734  29.857  1.00 140.80 ? 260  ASP A CG    1 
ATOM   2810  O  OD1   . ASP D 4  260  ? 32.966  13.848  29.878  1.00 139.78 ? 260  ASP A OD1   1 
ATOM   2811  O  OD2   . ASP D 4  260  ? 34.576  14.987  30.837  1.00 142.19 ? 260  ASP A OD2   1 
ATOM   2812  N  N     . ASP D 4  261  ? 33.407  17.516  30.973  1.00 139.21 ? 261  ASP A N     1 
ATOM   2813  C  CA    . ASP D 4  261  ? 33.894  18.243  32.142  1.00 122.73 ? 261  ASP A CA    1 
ATOM   2814  C  C     . ASP D 4  261  ? 35.359  17.942  32.423  1.00 101.90 ? 261  ASP A C     1 
ATOM   2815  O  O     . ASP D 4  261  ? 36.099  18.823  32.875  1.00 106.50 ? 261  ASP A O     1 
ATOM   2816  C  CB    . ASP D 4  261  ? 33.044  17.898  33.365  1.00 116.49 ? 261  ASP A CB    1 
ATOM   2817  C  CG    . ASP D 4  261  ? 31.604  18.339  33.215  1.00 124.71 ? 261  ASP A CG    1 
ATOM   2818  O  OD1   . ASP D 4  261  ? 31.205  19.306  33.896  1.00 127.16 ? 261  ASP A OD1   1 
ATOM   2819  O  OD2   . ASP D 4  261  ? 30.873  17.720  32.414  1.00 126.88 ? 261  ASP A OD2   1 
ATOM   2820  N  N     . LEU D 4  262  ? 35.793  16.705  32.171  1.00 76.89  ? 262  LEU A N     1 
ATOM   2821  C  CA    . LEU D 4  262  ? 37.191  16.352  32.388  1.00 69.94  ? 262  LEU A CA    1 
ATOM   2822  C  C     . LEU D 4  262  ? 38.107  17.135  31.459  1.00 85.72  ? 262  LEU A C     1 
ATOM   2823  O  O     . LEU D 4  262  ? 39.185  17.577  31.871  1.00 75.70  ? 262  LEU A O     1 
ATOM   2824  C  CB    . LEU D 4  262  ? 37.388  14.850  32.192  1.00 69.59  ? 262  LEU A CB    1 
ATOM   2825  C  CG    . LEU D 4  262  ? 38.227  14.166  33.265  1.00 89.48  ? 262  LEU A CG    1 
ATOM   2826  C  CD1   . LEU D 4  262  ? 37.623  14.450  34.631  1.00 69.44  ? 262  LEU A CD1   1 
ATOM   2827  C  CD2   . LEU D 4  262  ? 38.310  12.669  32.994  1.00 93.19  ? 262  LEU A CD2   1 
ATOM   2828  N  N     . THR D 4  263  ? 37.691  17.317  30.204  1.00 138.02 ? 263  THR A N     1 
ATOM   2829  C  CA    . THR D 4  263  ? 38.482  18.100  29.260  1.00 152.93 ? 263  THR A CA    1 
ATOM   2830  C  C     . THR D 4  263  ? 38.724  19.511  29.781  1.00 161.50 ? 263  THR A C     1 
ATOM   2831  O  O     . THR D 4  263  ? 39.829  20.048  29.646  1.00 166.75 ? 263  THR A O     1 
ATOM   2832  C  CB    . THR D 4  263  ? 37.780  18.148  27.903  1.00 159.12 ? 263  THR A CB    1 
ATOM   2833  O  OG1   . THR D 4  263  ? 37.105  16.906  27.667  1.00 160.27 ? 263  THR A OG1   1 
ATOM   2834  C  CG2   . THR D 4  263  ? 38.782  18.390  26.790  1.00 165.21 ? 263  THR A CG2   1 
ATOM   2835  N  N     . PHE D 4  264  ? 37.700  20.126  30.378  1.00 161.07 ? 264  PHE A N     1 
ATOM   2836  C  CA    . PHE D 4  264  ? 37.856  21.465  30.939  1.00 152.43 ? 264  PHE A CA    1 
ATOM   2837  C  C     . PHE D 4  264  ? 38.895  21.478  32.053  1.00 142.26 ? 264  PHE A C     1 
ATOM   2838  O  O     . PHE D 4  264  ? 39.795  22.326  32.068  1.00 130.90 ? 264  PHE A O     1 
ATOM   2839  C  CB    . PHE D 4  264  ? 36.511  21.977  31.461  1.00 149.78 ? 264  PHE A CB    1 
ATOM   2840  C  CG    . PHE D 4  264  ? 35.547  22.393  30.381  1.00 148.06 ? 264  PHE A CG    1 
ATOM   2841  C  CD1   . PHE D 4  264  ? 34.300  22.897  30.711  1.00 146.92 ? 264  PHE A CD1   1 
ATOM   2842  C  CD2   . PHE D 4  264  ? 35.888  22.291  29.042  1.00 143.02 ? 264  PHE A CD2   1 
ATOM   2843  C  CE1   . PHE D 4  264  ? 33.408  23.284  29.728  1.00 143.55 ? 264  PHE A CE1   1 
ATOM   2844  C  CE2   . PHE D 4  264  ? 34.999  22.677  28.054  1.00 138.91 ? 264  PHE A CE2   1 
ATOM   2845  C  CZ    . PHE D 4  264  ? 33.758  23.174  28.398  1.00 138.52 ? 264  PHE A CZ    1 
ATOM   2846  N  N     . LYS D 4  265  ? 38.791  20.537  32.994  1.00 137.70 ? 265  LYS A N     1 
ATOM   2847  C  CA    . LYS D 4  265  ? 39.646  20.578  34.177  1.00 143.77 ? 265  LYS A CA    1 
ATOM   2848  C  C     . LYS D 4  265  ? 41.098  20.273  33.828  1.00 144.02 ? 265  LYS A C     1 
ATOM   2849  O  O     . LYS D 4  265  ? 42.011  20.971  34.284  1.00 148.99 ? 265  LYS A O     1 
ATOM   2850  C  CB    . LYS D 4  265  ? 39.126  19.609  35.237  1.00 137.89 ? 265  LYS A CB    1 
ATOM   2851  C  CG    . LYS D 4  265  ? 40.007  19.522  36.471  1.00 142.21 ? 265  LYS A CG    1 
ATOM   2852  C  CD    . LYS D 4  265  ? 40.246  20.891  37.099  1.00 153.44 ? 265  LYS A CD    1 
ATOM   2853  C  CE    . LYS D 4  265  ? 38.960  21.488  37.645  1.00 157.45 ? 265  LYS A CE    1 
ATOM   2854  N  NZ    . LYS D 4  265  ? 38.276  20.566  38.590  1.00 154.35 ? 265  LYS A NZ    1 
ATOM   2855  N  N     . LEU D 4  266  ? 41.340  19.235  33.025  1.00 131.51 ? 266  LEU A N     1 
ATOM   2856  C  CA    . LEU D 4  266  ? 42.714  18.962  32.623  1.00 132.03 ? 266  LEU A CA    1 
ATOM   2857  C  C     . LEU D 4  266  ? 43.233  20.007  31.642  1.00 135.10 ? 266  LEU A C     1 
ATOM   2858  O  O     . LEU D 4  266  ? 44.444  20.074  31.404  1.00 138.39 ? 266  LEU A O     1 
ATOM   2859  C  CB    . LEU D 4  266  ? 42.834  17.550  32.039  1.00 129.57 ? 266  LEU A CB    1 
ATOM   2860  C  CG    . LEU D 4  266  ? 42.078  17.155  30.771  1.00 132.00 ? 266  LEU A CG    1 
ATOM   2861  C  CD1   . LEU D 4  266  ? 42.918  17.418  29.542  1.00 146.13 ? 266  LEU A CD1   1 
ATOM   2862  C  CD2   . LEU D 4  266  ? 41.671  15.692  30.833  1.00 120.97 ? 266  LEU A CD2   1 
ATOM   2863  N  N     . ALA D 4  267  ? 42.347  20.819  31.062  1.00 129.33 ? 267  ALA A N     1 
ATOM   2864  C  CA    . ALA D 4  267  ? 42.807  22.024  30.383  1.00 137.99 ? 267  ALA A CA    1 
ATOM   2865  C  C     . ALA D 4  267  ? 43.199  23.094  31.393  1.00 147.48 ? 267  ALA A C     1 
ATOM   2866  O  O     . ALA D 4  267  ? 44.147  23.854  31.164  1.00 158.72 ? 267  ALA A O     1 
ATOM   2867  C  CB    . ALA D 4  267  ? 41.731  22.545  29.430  1.00 130.28 ? 267  ALA A CB    1 
ATOM   2868  N  N     . ASP D 4  268  ? 42.480  23.166  32.518  1.00 138.34 ? 268  ASP A N     1 
ATOM   2869  C  CA    . ASP D 4  268  ? 42.832  24.113  33.572  1.00 124.46 ? 268  ASP A CA    1 
ATOM   2870  C  C     . ASP D 4  268  ? 44.220  23.826  34.131  1.00 125.19 ? 268  ASP A C     1 
ATOM   2871  O  O     . ASP D 4  268  ? 44.980  24.754  34.433  1.00 116.29 ? 268  ASP A O     1 
ATOM   2872  C  CB    . ASP D 4  268  ? 41.789  24.068  34.690  1.00 114.14 ? 268  ASP A CB    1 
ATOM   2873  C  CG    . ASP D 4  268  ? 40.440  24.605  34.255  1.00 109.76 ? 268  ASP A CG    1 
ATOM   2874  O  OD1   . ASP D 4  268  ? 40.273  24.901  33.053  1.00 109.55 ? 268  ASP A OD1   1 
ATOM   2875  O  OD2   . ASP D 4  268  ? 39.538  24.715  35.113  1.00 105.81 ? 268  ASP A OD2   1 
ATOM   2876  N  N     . ILE D 4  269  ? 44.567  22.545  34.284  1.00 144.84 ? 269  ILE A N     1 
ATOM   2877  C  CA    . ILE D 4  269  ? 45.886  22.201  34.806  1.00 158.25 ? 269  ILE A CA    1 
ATOM   2878  C  C     . ILE D 4  269  ? 46.967  22.534  33.782  1.00 162.55 ? 269  ILE A C     1 
ATOM   2879  O  O     . ILE D 4  269  ? 48.069  22.963  34.145  1.00 162.82 ? 269  ILE A O     1 
ATOM   2880  C  CB    . ILE D 4  269  ? 45.932  20.719  35.243  1.00 152.11 ? 269  ILE A CB    1 
ATOM   2881  C  CG1   . ILE D 4  269  ? 46.047  19.765  34.051  1.00 146.31 ? 269  ILE A CG1   1 
ATOM   2882  C  CG2   . ILE D 4  269  ? 44.692  20.355  36.042  1.00 145.09 ? 269  ILE A CG2   1 
ATOM   2883  C  CD1   . ILE D 4  269  ? 47.455  19.247  33.798  1.00 147.34 ? 269  ILE A CD1   1 
ATOM   2884  N  N     . LEU D 4  270  ? 46.670  22.356  32.491  1.00 142.70 ? 270  LEU A N     1 
ATOM   2885  C  CA    . LEU D 4  270  ? 47.650  22.685  31.463  1.00 139.29 ? 270  LEU A CA    1 
ATOM   2886  C  C     . LEU D 4  270  ? 47.771  24.194  31.299  1.00 165.01 ? 270  LEU A C     1 
ATOM   2887  O  O     . LEU D 4  270  ? 48.869  24.711  31.064  1.00 159.20 ? 270  LEU A O     1 
ATOM   2888  C  CB    . LEU D 4  270  ? 47.269  22.008  30.144  1.00 118.56 ? 270  LEU A CB    1 
ATOM   2889  C  CG    . LEU D 4  270  ? 48.386  21.570  29.186  1.00 119.77 ? 270  LEU A CG    1 
ATOM   2890  C  CD1   . LEU D 4  270  ? 47.804  20.766  28.037  1.00 114.26 ? 270  LEU A CD1   1 
ATOM   2891  C  CD2   . LEU D 4  270  ? 49.190  22.747  28.649  1.00 129.87 ? 270  LEU A CD2   1 
ATOM   2892  N  N     . LYS D 4  271  ? 46.654  24.917  31.427  1.00 184.07 ? 271  LYS A N     1 
ATOM   2893  C  CA    . LYS D 4  271  ? 46.719  26.375  31.439  1.00 180.98 ? 271  LYS A CA    1 
ATOM   2894  C  C     . LYS D 4  271  ? 47.554  26.873  32.612  1.00 175.27 ? 271  LYS A C     1 
ATOM   2895  O  O     . LYS D 4  271  ? 48.328  27.826  32.474  1.00 173.07 ? 271  LYS A O     1 
ATOM   2896  C  CB    . LYS D 4  271  ? 45.310  26.965  31.489  1.00 172.80 ? 271  LYS A CB    1 
ATOM   2897  C  CG    . LYS D 4  271  ? 45.226  28.415  31.034  1.00 168.07 ? 271  LYS A CG    1 
ATOM   2898  C  CD    . LYS D 4  271  ? 45.724  28.568  29.606  1.00 164.28 ? 271  LYS A CD    1 
ATOM   2899  C  CE    . LYS D 4  271  ? 45.604  30.005  29.122  1.00 162.89 ? 271  LYS A CE    1 
ATOM   2900  N  NZ    . LYS D 4  271  ? 46.247  30.194  27.790  1.00 165.56 ? 271  LYS A NZ    1 
ATOM   2901  N  N     . ALA D 4  272  ? 47.408  26.237  33.777  1.00 170.00 ? 272  ALA A N     1 
ATOM   2902  C  CA    . ALA D 4  272  ? 48.276  26.560  34.904  1.00 174.50 ? 272  ALA A CA    1 
ATOM   2903  C  C     . ALA D 4  272  ? 49.705  26.099  34.647  1.00 176.05 ? 272  ALA A C     1 
ATOM   2904  O  O     . ALA D 4  272  ? 50.661  26.749  35.086  1.00 185.79 ? 272  ALA A O     1 
ATOM   2905  C  CB    . ALA D 4  272  ? 47.730  25.930  36.185  1.00 173.24 ? 272  ALA A CB    1 
ATOM   2906  N  N     . ASN D 4  273  ? 49.870  24.978  33.938  1.00 171.24 ? 273  ASN A N     1 
ATOM   2907  C  CA    . ASN D 4  273  ? 51.209  24.463  33.662  1.00 163.01 ? 273  ASN A CA    1 
ATOM   2908  C  C     . ASN D 4  273  ? 51.964  25.381  32.711  1.00 174.58 ? 273  ASN A C     1 
ATOM   2909  O  O     . ASN D 4  273  ? 53.118  25.743  32.969  1.00 178.21 ? 273  ASN A O     1 
ATOM   2910  C  CB    . ASN D 4  273  ? 51.125  23.045  33.092  1.00 147.60 ? 273  ASN A CB    1 
ATOM   2911  C  CG    . ASN D 4  273  ? 52.490  22.467  32.753  1.00 143.31 ? 273  ASN A CG    1 
ATOM   2912  O  OD1   . ASN D 4  273  ? 53.152  21.870  33.604  1.00 139.25 ? 273  ASN A OD1   1 
ATOM   2913  N  ND2   . ASN D 4  273  ? 52.916  22.639  31.505  1.00 138.76 ? 273  ASN A ND2   1 
ATOM   2914  N  N     . ILE D 4  274  ? 51.326  25.776  31.606  1.00 173.13 ? 274  ILE A N     1 
ATOM   2915  C  CA    . ILE D 4  274  ? 51.993  26.658  30.654  1.00 173.97 ? 274  ILE A CA    1 
ATOM   2916  C  C     . ILE D 4  274  ? 52.185  28.044  31.256  1.00 170.05 ? 274  ILE A C     1 
ATOM   2917  O  O     . ILE D 4  274  ? 53.120  28.765  30.884  1.00 176.99 ? 274  ILE A O     1 
ATOM   2918  C  CB    . ILE D 4  274  ? 51.214  26.714  29.325  1.00 169.06 ? 274  ILE A CB    1 
ATOM   2919  C  CG1   . ILE D 4  274  ? 52.046  27.420  28.251  1.00 170.05 ? 274  ILE A CG1   1 
ATOM   2920  C  CG2   . ILE D 4  274  ? 49.870  27.413  29.508  1.00 158.51 ? 274  ILE A CG2   1 
ATOM   2921  C  CD1   . ILE D 4  274  ? 53.434  26.834  28.070  1.00 168.45 ? 274  ILE A CD1   1 
ATOM   2922  N  N     . SER D 4  275  ? 51.321  28.440  32.195  1.00 160.56 ? 275  SER A N     1 
ATOM   2923  C  CA    . SER D 4  275  ? 51.533  29.692  32.915  1.00 163.80 ? 275  SER A CA    1 
ATOM   2924  C  C     . SER D 4  275  ? 52.832  29.644  33.707  1.00 191.25 ? 275  SER A C     1 
ATOM   2925  O  O     . SER D 4  275  ? 53.669  30.546  33.603  1.00 182.77 ? 275  SER A O     1 
ATOM   2926  C  CB    . SER D 4  275  ? 50.348  29.978  33.839  1.00 144.09 ? 275  SER A CB    1 
ATOM   2927  O  OG    . SER D 4  275  ? 50.599  31.105  34.661  1.00 135.00 ? 275  SER A OG    1 
ATOM   2928  N  N     . LEU D 4  276  ? 53.020  28.585  34.495  1.00 208.26 ? 276  LEU A N     1 
ATOM   2929  C  CA    . LEU D 4  276  ? 54.259  28.425  35.247  1.00 204.87 ? 276  LEU A CA    1 
ATOM   2930  C  C     . LEU D 4  276  ? 55.422  28.051  34.334  1.00 203.88 ? 276  LEU A C     1 
ATOM   2931  O  O     . LEU D 4  276  ? 56.575  28.379  34.637  1.00 204.59 ? 276  LEU A O     1 
ATOM   2932  C  CB    . LEU D 4  276  ? 54.050  27.379  36.346  1.00 197.24 ? 276  LEU A CB    1 
ATOM   2933  C  CG    . LEU D 4  276  ? 54.814  27.492  37.665  1.00 192.86 ? 276  LEU A CG    1 
ATOM   2934  C  CD1   . LEU D 4  276  ? 54.149  26.637  38.725  1.00 183.94 ? 276  LEU A CD1   1 
ATOM   2935  C  CD2   . LEU D 4  276  ? 56.245  27.054  37.484  1.00 195.35 ? 276  LEU A CD2   1 
ATOM   2936  N  N     . GLU D 4  277  ? 55.142  27.379  33.212  1.00 201.52 ? 277  GLU A N     1 
ATOM   2937  C  CA    . GLU D 4  277  ? 56.197  27.028  32.262  1.00 192.30 ? 277  GLU A CA    1 
ATOM   2938  C  C     . GLU D 4  277  ? 56.836  28.275  31.661  1.00 192.28 ? 277  GLU A C     1 
ATOM   2939  O  O     . GLU D 4  277  ? 58.060  28.442  31.701  1.00 188.15 ? 277  GLU A O     1 
ATOM   2940  C  CB    . GLU D 4  277  ? 55.627  26.136  31.158  1.00 182.84 ? 277  GLU A CB    1 
ATOM   2941  C  CG    . GLU D 4  277  ? 56.461  24.908  30.833  1.00 175.63 ? 277  GLU A CG    1 
ATOM   2942  C  CD    . GLU D 4  277  ? 55.943  24.162  29.616  1.00 163.82 ? 277  GLU A CD    1 
ATOM   2943  O  OE1   . GLU D 4  277  ? 56.083  24.681  28.488  1.00 157.21 ? 277  GLU A OE1   1 
ATOM   2944  O  OE2   . GLU D 4  277  ? 55.390  23.055  29.790  1.00 156.61 ? 277  GLU A OE2   1 
ATOM   2945  N  N     . THR D 4  278  ? 56.016  29.162  31.090  1.00 191.82 ? 278  THR A N     1 
ATOM   2946  C  CA    . THR D 4  278  ? 56.539  30.388  30.496  1.00 189.53 ? 278  THR A CA    1 
ATOM   2947  C  C     . THR D 4  278  ? 57.062  31.349  31.556  1.00 187.16 ? 278  THR A C     1 
ATOM   2948  O  O     . THR D 4  278  ? 58.013  32.097  31.302  1.00 178.76 ? 278  THR A O     1 
ATOM   2949  C  CB    . THR D 4  278  ? 55.456  31.074  29.659  1.00 185.62 ? 278  THR A CB    1 
ATOM   2950  O  OG1   . THR D 4  278  ? 54.329  31.383  30.489  1.00 184.97 ? 278  THR A OG1   1 
ATOM   2951  C  CG2   . THR D 4  278  ? 55.003  30.172  28.519  1.00 179.36 ? 278  THR A CG2   1 
ATOM   2952  N  N     . LEU D 4  279  ? 56.457  31.340  32.745  1.00 179.77 ? 279  LEU A N     1 
ATOM   2953  C  CA    . LEU D 4  279  ? 56.818  32.305  33.778  1.00 175.67 ? 279  LEU A CA    1 
ATOM   2954  C  C     . LEU D 4  279  ? 58.195  32.008  34.363  1.00 174.94 ? 279  LEU A C     1 
ATOM   2955  O  O     . LEU D 4  279  ? 58.963  32.932  34.652  1.00 169.51 ? 279  LEU A O     1 
ATOM   2956  C  CB    . LEU D 4  279  ? 55.747  32.304  34.868  1.00 161.50 ? 279  LEU A CB    1 
ATOM   2957  C  CG    . LEU D 4  279  ? 55.761  33.337  35.990  1.00 147.19 ? 279  LEU A CG    1 
ATOM   2958  C  CD1   . LEU D 4  279  ? 56.586  32.822  37.152  1.00 138.67 ? 279  LEU A CD1   1 
ATOM   2959  C  CD2   . LEU D 4  279  ? 56.277  34.672  35.476  1.00 138.48 ? 279  LEU A CD2   1 
ATOM   2960  N  N     . GLU D 4  280  ? 58.520  30.726  34.551  1.00 179.26 ? 280  GLU A N     1 
ATOM   2961  C  CA    . GLU D 4  280  ? 59.793  30.362  35.168  1.00 179.88 ? 280  GLU A CA    1 
ATOM   2962  C  C     . GLU D 4  280  ? 60.975  30.807  34.315  1.00 184.54 ? 280  GLU A C     1 
ATOM   2963  O  O     . GLU D 4  280  ? 61.906  31.454  34.810  1.00 179.77 ? 280  GLU A O     1 
ATOM   2964  C  CB    . GLU D 4  280  ? 59.850  28.852  35.405  1.00 182.99 ? 280  GLU A CB    1 
ATOM   2965  C  CG    . GLU D 4  280  ? 59.377  28.415  36.776  1.00 189.04 ? 280  GLU A CG    1 
ATOM   2966  C  CD    . GLU D 4  280  ? 59.669  26.951  37.046  1.00 194.52 ? 280  GLU A CD    1 
ATOM   2967  O  OE1   . GLU D 4  280  ? 60.248  26.289  36.160  1.00 196.69 ? 280  GLU A OE1   1 
ATOM   2968  O  OE2   . GLU D 4  280  ? 59.331  26.465  38.146  1.00 196.01 ? 280  GLU A OE2   1 
ATOM   2969  N  N     . HIS D 4  281  ? 60.957  30.470  33.025  1.00 192.14 ? 281  HIS A N     1 
ATOM   2970  C  CA    . HIS D 4  281  ? 62.146  30.663  32.205  1.00 203.90 ? 281  HIS A CA    1 
ATOM   2971  C  C     . HIS D 4  281  ? 62.327  32.112  31.771  1.00 213.97 ? 281  HIS A C     1 
ATOM   2972  O  O     . HIS D 4  281  ? 63.466  32.579  31.650  1.00 214.86 ? 281  HIS A O     1 
ATOM   2973  C  CB    . HIS D 4  281  ? 62.089  29.751  30.979  1.00 201.64 ? 281  HIS A CB    1 
ATOM   2974  C  CG    . HIS D 4  281  ? 63.437  29.388  30.440  1.00 208.76 ? 281  HIS A CG    1 
ATOM   2975  N  ND1   . HIS D 4  281  ? 63.773  29.527  29.110  1.00 211.63 ? 281  HIS A ND1   1 
ATOM   2976  C  CD2   . HIS D 4  281  ? 64.537  28.894  31.056  1.00 211.33 ? 281  HIS A CD2   1 
ATOM   2977  C  CE1   . HIS D 4  281  ? 65.020  29.131  28.930  1.00 214.38 ? 281  HIS A CE1   1 
ATOM   2978  N  NE2   . HIS D 4  281  ? 65.507  28.743  30.095  1.00 212.99 ? 281  HIS A NE2   1 
ATOM   2979  N  N     . ASN D 4  282  ? 61.237  32.838  31.534  1.00 218.29 ? 282  ASN A N     1 
ATOM   2980  C  CA    . ASN D 4  282  ? 61.313  34.211  31.054  1.00 215.26 ? 282  ASN A CA    1 
ATOM   2981  C  C     . ASN D 4  282  ? 60.413  35.099  31.899  1.00 199.07 ? 282  ASN A C     1 
ATOM   2982  O  O     . ASN D 4  282  ? 59.230  34.794  32.085  1.00 193.68 ? 282  ASN A O     1 
ATOM   2983  C  CB    . ASN D 4  282  ? 60.921  34.297  29.575  1.00 217.98 ? 282  ASN A CB    1 
ATOM   2984  C  CG    . ASN D 4  282  ? 61.756  33.382  28.699  1.00 214.57 ? 282  ASN A CG    1 
ATOM   2985  O  OD1   . ASN D 4  282  ? 61.520  32.176  28.641  1.00 208.79 ? 282  ASN A OD1   1 
ATOM   2986  N  ND2   . ASN D 4  282  ? 62.743  33.953  28.017  1.00 215.33 ? 282  ASN A ND2   1 
ATOM   2987  N  N     . GLY D 4  283  ? 60.974  36.195  32.403  1.00 183.35 ? 283  GLY A N     1 
ATOM   2988  C  CA    . GLY D 4  283  ? 60.227  37.100  33.255  1.00 170.88 ? 283  GLY A CA    1 
ATOM   2989  C  C     . GLY D 4  283  ? 60.013  36.587  34.660  1.00 175.40 ? 283  GLY A C     1 
ATOM   2990  O  O     . GLY D 4  283  ? 58.905  36.702  35.197  1.00 170.93 ? 283  GLY A O     1 
ATOM   2991  N  N     . ALA D 4  284  ? 61.045  36.022  35.271  1.00 181.02 ? 284  ALA A N     1 
ATOM   2992  C  CA    . ALA D 4  284  ? 60.952  35.430  36.601  1.00 180.63 ? 284  ALA A CA    1 
ATOM   2993  C  C     . ALA D 4  284  ? 60.695  36.500  37.655  1.00 196.80 ? 284  ALA A C     1 
ATOM   2994  O  O     . ALA D 4  284  ? 61.590  37.310  37.932  1.00 191.27 ? 284  ALA A O     1 
ATOM   2995  C  CB    . ALA D 4  284  ? 62.236  34.663  36.925  1.00 168.45 ? 284  ALA A CB    1 
ATOM   2996  N  N     . PRO D 4  285  ? 59.506  36.539  38.268  1.00 219.03 ? 285  PRO A N     1 
ATOM   2997  C  CA    . PRO D 4  285  ? 59.181  37.585  39.245  1.00 225.49 ? 285  PRO A CA    1 
ATOM   2998  C  C     . PRO D 4  285  ? 59.649  37.310  40.670  1.00 239.20 ? 285  PRO A C     1 
ATOM   2999  O  O     . PRO D 4  285  ? 60.435  36.396  40.944  1.00 244.32 ? 285  PRO A O     1 
ATOM   3000  C  CB    . PRO D 4  285  ? 57.652  37.658  39.164  1.00 215.61 ? 285  PRO A CB    1 
ATOM   3001  C  CG    . PRO D 4  285  ? 57.248  36.264  38.850  1.00 213.87 ? 285  PRO A CG    1 
ATOM   3002  C  CD    . PRO D 4  285  ? 58.385  35.607  38.087  1.00 216.70 ? 285  PRO A CD    1 
ATOM   3003  N  N     . HIS D 4  286  ? 59.114  38.130  41.579  1.00 245.00 ? 286  HIS A N     1 
ATOM   3004  C  CA    . HIS D 4  286  ? 59.446  38.264  42.994  1.00 241.52 ? 286  HIS A CA    1 
ATOM   3005  C  C     . HIS D 4  286  ? 59.301  37.008  43.851  1.00 228.19 ? 286  HIS A C     1 
ATOM   3006  O  O     . HIS D 4  286  ? 59.460  37.093  45.073  1.00 233.04 ? 286  HIS A O     1 
ATOM   3007  C  CB    . HIS D 4  286  ? 58.574  39.374  43.587  1.00 241.37 ? 286  HIS A CB    1 
ATOM   3008  C  CG    . HIS D 4  286  ? 57.160  39.346  43.089  1.00 233.90 ? 286  HIS A CG    1 
ATOM   3009  N  ND1   . HIS D 4  286  ? 56.418  38.186  43.010  1.00 228.67 ? 286  HIS A ND1   1 
ATOM   3010  C  CD2   . HIS D 4  286  ? 56.360  40.335  42.625  1.00 232.33 ? 286  HIS A CD2   1 
ATOM   3011  C  CE1   . HIS D 4  286  ? 55.220  38.464  42.529  1.00 226.76 ? 286  HIS A CE1   1 
ATOM   3012  N  NE2   . HIS D 4  286  ? 55.159  39.761  42.289  1.00 228.89 ? 286  HIS A NE2   1 
ATOM   3013  N  N     . HIS D 4  287  ? 58.959  35.865  43.251  1.00 206.02 ? 287  HIS A N     1 
ATOM   3014  C  CA    . HIS D 4  287  ? 58.773  34.589  43.946  1.00 187.25 ? 287  HIS A CA    1 
ATOM   3015  C  C     . HIS D 4  287  ? 57.483  34.564  44.763  1.00 171.47 ? 287  HIS A C     1 
ATOM   3016  O  O     . HIS D 4  287  ? 57.334  33.763  45.695  1.00 154.16 ? 287  HIS A O     1 
ATOM   3017  C  CB    . HIS D 4  287  ? 59.997  34.234  44.817  1.00 185.15 ? 287  HIS A CB    1 
ATOM   3018  C  CG    . HIS D 4  287  ? 59.888  32.922  45.534  1.00 177.28 ? 287  HIS A CG    1 
ATOM   3019  N  ND1   . HIS D 4  287  ? 59.268  32.803  46.759  1.00 172.28 ? 287  HIS A ND1   1 
ATOM   3020  C  CD2   . HIS D 4  287  ? 60.312  31.679  45.203  1.00 172.81 ? 287  HIS A CD2   1 
ATOM   3021  C  CE1   . HIS D 4  287  ? 59.318  31.545  47.155  1.00 168.43 ? 287  HIS A CE1   1 
ATOM   3022  N  NE2   . HIS D 4  287  ? 59.946  30.841  46.229  1.00 171.42 ? 287  HIS A NE2   1 
ATOM   3023  N  N     . ALA D 4  288  ? 56.529  35.431  44.420  1.00 166.99 ? 288  ALA A N     1 
ATOM   3024  C  CA    . ALA D 4  288  ? 55.139  35.257  44.821  1.00 158.64 ? 288  ALA A CA    1 
ATOM   3025  C  C     . ALA D 4  288  ? 54.347  34.498  43.769  1.00 151.06 ? 288  ALA A C     1 
ATOM   3026  O  O     . ALA D 4  288  ? 53.129  34.693  43.634  1.00 151.89 ? 288  ALA A O     1 
ATOM   3027  C  CB    . ALA D 4  288  ? 54.488  36.608  45.118  1.00 152.10 ? 288  ALA A CB    1 
ATOM   3028  N  N     . ILE D 4  289  ? 55.039  33.649  43.000  1.00 136.54 ? 289  ILE A N     1 
ATOM   3029  C  CA    . ILE D 4  289  ? 54.405  32.747  42.044  1.00 121.29 ? 289  ILE A CA    1 
ATOM   3030  C  C     . ILE D 4  289  ? 53.735  31.579  42.741  1.00 124.40 ? 289  ILE A C     1 
ATOM   3031  O  O     . ILE D 4  289  ? 53.142  30.723  42.073  1.00 98.70  ? 289  ILE A O     1 
ATOM   3032  C  CB    . ILE D 4  289  ? 55.445  32.231  41.026  1.00 116.69 ? 289  ILE A CB    1 
ATOM   3033  C  CG1   . ILE D 4  289  ? 56.240  31.058  41.606  1.00 109.45 ? 289  ILE A CG1   1 
ATOM   3034  C  CG2   . ILE D 4  289  ? 56.397  33.347  40.640  1.00 105.89 ? 289  ILE A CG2   1 
ATOM   3035  C  CD1   . ILE D 4  289  ? 57.362  30.559  40.706  1.00 104.61 ? 289  ILE A CD1   1 
ATOM   3036  N  N     . GLU D 4  290  ? 53.810  31.529  44.073  1.00 160.78 ? 290  GLU A N     1 
ATOM   3037  C  CA    . GLU D 4  290  ? 53.218  30.441  44.838  1.00 181.14 ? 290  GLU A CA    1 
ATOM   3038  C  C     . GLU D 4  290  ? 51.724  30.307  44.592  1.00 191.19 ? 290  GLU A C     1 
ATOM   3039  O  O     . GLU D 4  290  ? 51.164  29.228  44.820  1.00 205.00 ? 290  GLU A O     1 
ATOM   3040  C  CB    . GLU D 4  290  ? 53.498  30.651  46.326  1.00 184.59 ? 290  GLU A CB    1 
ATOM   3041  C  CG    . GLU D 4  290  ? 53.096  32.023  46.834  1.00 179.71 ? 290  GLU A CG    1 
ATOM   3042  C  CD    . GLU D 4  290  ? 54.030  32.542  47.902  1.00 173.09 ? 290  GLU A CD    1 
ATOM   3043  O  OE1   . GLU D 4  290  ? 55.256  32.537  47.670  1.00 169.89 ? 290  GLU A OE1   1 
ATOM   3044  O  OE2   . GLU D 4  290  ? 53.538  32.958  48.972  1.00 168.88 ? 290  GLU A OE2   1 
ATOM   3045  N  N     . GLU D 4  291  ? 51.066  31.373  44.135  1.00 186.51 ? 291  GLU A N     1 
ATOM   3046  C  CA    . GLU D 4  291  ? 49.678  31.254  43.706  1.00 176.47 ? 291  GLU A CA    1 
ATOM   3047  C  C     . GLU D 4  291  ? 49.557  30.281  42.540  1.00 188.53 ? 291  GLU A C     1 
ATOM   3048  O  O     . GLU D 4  291  ? 48.684  29.406  42.535  1.00 180.95 ? 291  GLU A O     1 
ATOM   3049  C  CB    . GLU D 4  291  ? 49.124  32.626  43.325  1.00 159.79 ? 291  GLU A CB    1 
ATOM   3050  C  CG    . GLU D 4  291  ? 48.688  33.475  44.506  1.00 150.82 ? 291  GLU A CG    1 
ATOM   3051  C  CD    . GLU D 4  291  ? 47.914  34.704  44.074  1.00 146.47 ? 291  GLU A CD    1 
ATOM   3052  O  OE1   . GLU D 4  291  ? 48.026  35.089  42.891  1.00 144.69 ? 291  GLU A OE1   1 
ATOM   3053  O  OE2   . GLU D 4  291  ? 47.190  35.282  44.911  1.00 147.74 ? 291  GLU A OE2   1 
ATOM   3054  N  N     . ALA D 4  292  ? 50.437  30.414  41.544  1.00 194.72 ? 292  ALA A N     1 
ATOM   3055  C  CA    . ALA D 4  292  ? 50.400  29.520  40.390  1.00 194.46 ? 292  ALA A CA    1 
ATOM   3056  C  C     . ALA D 4  292  ? 50.817  28.105  40.769  1.00 192.62 ? 292  ALA A C     1 
ATOM   3057  O  O     . ALA D 4  292  ? 50.272  27.129  40.240  1.00 202.81 ? 292  ALA A O     1 
ATOM   3058  C  CB    . ALA D 4  292  ? 51.297  30.063  39.277  1.00 199.13 ? 292  ALA A CB    1 
ATOM   3059  N  N     . GLU D 4  293  ? 51.788  27.973  41.675  1.00 158.89 ? 293  GLU A N     1 
ATOM   3060  C  CA    . GLU D 4  293  ? 52.192  26.649  42.138  1.00 138.39 ? 293  GLU A CA    1 
ATOM   3061  C  C     . GLU D 4  293  ? 51.046  25.954  42.862  1.00 146.73 ? 293  GLU A C     1 
ATOM   3062  O  O     . GLU D 4  293  ? 50.763  24.776  42.616  1.00 140.83 ? 293  GLU A O     1 
ATOM   3063  C  CB    . GLU D 4  293  ? 53.416  26.762  43.048  1.00 139.11 ? 293  GLU A CB    1 
ATOM   3064  C  CG    . GLU D 4  293  ? 54.605  27.455  42.406  1.00 154.64 ? 293  GLU A CG    1 
ATOM   3065  C  CD    . GLU D 4  293  ? 55.728  27.715  43.391  1.00 168.80 ? 293  GLU A CD    1 
ATOM   3066  O  OE1   . GLU D 4  293  ? 55.818  28.843  43.919  1.00 167.67 ? 293  GLU A OE1   1 
ATOM   3067  O  OE2   . GLU D 4  293  ? 56.522  26.785  43.639  1.00 174.68 ? 293  GLU A OE2   1 
ATOM   3068  N  N     . SER D 4  294  ? 50.373  26.673  43.764  1.00 175.13 ? 294  SER A N     1 
ATOM   3069  C  CA    . SER D 4  294  ? 49.222  26.102  44.453  1.00 169.48 ? 294  SER A CA    1 
ATOM   3070  C  C     . SER D 4  294  ? 48.043  25.914  43.510  1.00 159.60 ? 294  SER A C     1 
ATOM   3071  O  O     . SER D 4  294  ? 47.282  24.953  43.661  1.00 164.92 ? 294  SER A O     1 
ATOM   3072  C  CB    . SER D 4  294  ? 48.815  26.987  45.631  1.00 179.28 ? 294  SER A CB    1 
ATOM   3073  O  OG    . SER D 4  294  ? 48.165  28.164  45.182  1.00 184.23 ? 294  SER A OG    1 
ATOM   3074  N  N     . LEU D 4  295  ? 47.874  26.816  42.537  1.00 151.82 ? 295  LEU A N     1 
ATOM   3075  C  CA    . LEU D 4  295  ? 46.761  26.695  41.601  1.00 146.02 ? 295  LEU A CA    1 
ATOM   3076  C  C     . LEU D 4  295  ? 46.875  25.422  40.771  1.00 138.73 ? 295  LEU A C     1 
ATOM   3077  O  O     . LEU D 4  295  ? 45.890  24.693  40.602  1.00 148.71 ? 295  LEU A O     1 
ATOM   3078  C  CB    . LEU D 4  295  ? 46.699  27.922  40.691  1.00 140.93 ? 295  LEU A CB    1 
ATOM   3079  C  CG    . LEU D 4  295  ? 45.807  27.796  39.456  1.00 134.25 ? 295  LEU A CG    1 
ATOM   3080  C  CD1   . LEU D 4  295  ? 44.372  28.153  39.802  1.00 132.09 ? 295  LEU A CD1   1 
ATOM   3081  C  CD2   . LEU D 4  295  ? 46.322  28.665  38.319  1.00 133.18 ? 295  LEU A CD2   1 
ATOM   3082  N  N     . LEU D 4  296  ? 48.068  25.138  40.246  1.00 128.99 ? 296  LEU A N     1 
ATOM   3083  C  CA    . LEU D 4  296  ? 48.272  23.897  39.507  1.00 118.68 ? 296  LEU A CA    1 
ATOM   3084  C  C     . LEU D 4  296  ? 48.108  22.688  40.418  1.00 134.53 ? 296  LEU A C     1 
ATOM   3085  O  O     . LEU D 4  296  ? 47.421  21.722  40.065  1.00 134.82 ? 296  LEU A O     1 
ATOM   3086  C  CB    . LEU D 4  296  ? 49.653  23.895  38.846  1.00 107.70 ? 296  LEU A CB    1 
ATOM   3087  C  CG    . LEU D 4  296  ? 50.052  22.602  38.131  1.00 112.42 ? 296  LEU A CG    1 
ATOM   3088  C  CD1   . LEU D 4  296  ? 50.639  22.906  36.773  1.00 114.74 ? 296  LEU A CD1   1 
ATOM   3089  C  CD2   . LEU D 4  296  ? 51.048  21.809  38.955  1.00 116.72 ? 296  LEU A CD2   1 
ATOM   3090  N  N     . GLN D 4  297  ? 48.737  22.723  41.595  1.00 148.21 ? 297  GLN A N     1 
ATOM   3091  C  CA    . GLN D 4  297  ? 48.571  21.646  42.567  1.00 152.03 ? 297  GLN A CA    1 
ATOM   3092  C  C     . GLN D 4  297  ? 47.108  21.455  42.942  1.00 149.83 ? 297  GLN A C     1 
ATOM   3093  O  O     . GLN D 4  297  ? 46.623  20.319  43.015  1.00 145.54 ? 297  GLN A O     1 
ATOM   3094  C  CB    . GLN D 4  297  ? 49.412  21.934  43.811  1.00 159.55 ? 297  GLN A CB    1 
ATOM   3095  C  CG    . GLN D 4  297  ? 48.839  21.375  45.107  1.00 152.78 ? 297  GLN A CG    1 
ATOM   3096  C  CD    . GLN D 4  297  ? 49.203  19.923  45.339  1.00 148.26 ? 297  GLN A CD    1 
ATOM   3097  O  OE1   . GLN D 4  297  ? 49.580  19.205  44.412  1.00 140.10 ? 297  GLN A OE1   1 
ATOM   3098  N  NE2   . GLN D 4  297  ? 49.096  19.482  46.587  1.00 148.29 ? 297  GLN A NE2   1 
ATOM   3099  N  N     . PHE D 4  298  ? 46.387  22.554  43.180  1.00 157.39 ? 298  PHE A N     1 
ATOM   3100  C  CA    . PHE D 4  298  ? 44.964  22.451  43.490  1.00 155.14 ? 298  PHE A CA    1 
ATOM   3101  C  C     . PHE D 4  298  ? 44.179  21.910  42.305  1.00 157.77 ? 298  PHE A C     1 
ATOM   3102  O  O     . PHE D 4  298  ? 43.261  21.100  42.479  1.00 149.95 ? 298  PHE A O     1 
ATOM   3103  C  CB    . PHE D 4  298  ? 44.419  23.814  43.923  1.00 155.31 ? 298  PHE A CB    1 
ATOM   3104  C  CG    . PHE D 4  298  ? 42.934  23.960  43.741  1.00 158.11 ? 298  PHE A CG    1 
ATOM   3105  C  CD1   . PHE D 4  298  ? 42.056  23.450  44.682  1.00 156.07 ? 298  PHE A CD1   1 
ATOM   3106  C  CD2   . PHE D 4  298  ? 42.417  24.618  42.636  1.00 164.45 ? 298  PHE A CD2   1 
ATOM   3107  C  CE1   . PHE D 4  298  ? 40.690  23.581  44.517  1.00 157.85 ? 298  PHE A CE1   1 
ATOM   3108  C  CE2   . PHE D 4  298  ? 41.052  24.752  42.467  1.00 166.68 ? 298  PHE A CE2   1 
ATOM   3109  C  CZ    . PHE D 4  298  ? 40.188  24.234  43.410  1.00 163.90 ? 298  PHE A CZ    1 
ATOM   3110  N  N     . HIS D 4  299  ? 44.522  22.348  41.091  1.00 156.67 ? 299  HIS A N     1 
ATOM   3111  C  CA    . HIS D 4  299  ? 43.825  21.870  39.900  1.00 153.64 ? 299  HIS A CA    1 
ATOM   3112  C  C     . HIS D 4  299  ? 43.983  20.364  39.734  1.00 138.04 ? 299  HIS A C     1 
ATOM   3113  O  O     . HIS D 4  299  ? 42.996  19.643  39.552  1.00 137.64 ? 299  HIS A O     1 
ATOM   3114  C  CB    . HIS D 4  299  ? 44.338  22.610  38.665  1.00 156.87 ? 299  HIS A CB    1 
ATOM   3115  C  CG    . HIS D 4  299  ? 43.663  23.922  38.422  1.00 162.27 ? 299  HIS A CG    1 
ATOM   3116  N  ND1   . HIS D 4  299  ? 42.675  24.415  39.247  1.00 163.08 ? 299  HIS A ND1   1 
ATOM   3117  C  CD2   . HIS D 4  299  ? 43.833  24.845  37.446  1.00 166.87 ? 299  HIS A CD2   1 
ATOM   3118  C  CE1   . HIS D 4  299  ? 42.264  25.584  38.789  1.00 164.79 ? 299  HIS A CE1   1 
ATOM   3119  N  NE2   . HIS D 4  299  ? 42.952  25.869  37.698  1.00 166.49 ? 299  HIS A NE2   1 
ATOM   3120  N  N     . VAL D 4  300  ? 45.224  19.869  39.793  1.00 116.34 ? 300  VAL A N     1 
ATOM   3121  C  CA    . VAL D 4  300  ? 45.462  18.431  39.681  1.00 99.39  ? 300  VAL A CA    1 
ATOM   3122  C  C     . VAL D 4  300  ? 44.785  17.687  40.826  1.00 101.64 ? 300  VAL A C     1 
ATOM   3123  O  O     . VAL D 4  300  ? 44.252  16.585  40.644  1.00 89.86  ? 300  VAL A O     1 
ATOM   3124  C  CB    . VAL D 4  300  ? 46.975  18.139  39.635  1.00 91.02  ? 300  VAL A CB    1 
ATOM   3125  C  CG1   . VAL D 4  300  ? 47.229  16.646  39.463  1.00 81.75  ? 300  VAL A CG1   1 
ATOM   3126  C  CG2   . VAL D 4  300  ? 47.645  18.931  38.520  1.00 91.01  ? 300  VAL A CG2   1 
ATOM   3127  N  N     . ALA D 4  301  ? 44.792  18.277  42.024  1.00 128.67 ? 301  ALA A N     1 
ATOM   3128  C  CA    . ALA D 4  301  ? 44.144  17.651  43.172  1.00 137.01 ? 301  ALA A CA    1 
ATOM   3129  C  C     . ALA D 4  301  ? 42.635  17.562  42.971  1.00 135.98 ? 301  ALA A C     1 
ATOM   3130  O  O     . ALA D 4  301  ? 42.048  16.476  43.057  1.00 137.24 ? 301  ALA A O     1 
ATOM   3131  C  CB    . ALA D 4  301  ? 44.477  18.430  44.446  1.00 141.85 ? 301  ALA A CB    1 
ATOM   3132  N  N     . THR D 4  302  ? 41.987  18.701  42.695  1.00 121.10 ? 302  THR A N     1 
ATOM   3133  C  CA    . THR D 4  302  ? 40.547  18.708  42.459  1.00 115.58 ? 302  THR A CA    1 
ATOM   3134  C  C     . THR D 4  302  ? 40.175  17.974  41.176  1.00 125.91 ? 302  THR A C     1 
ATOM   3135  O  O     . THR D 4  302  ? 39.003  17.631  40.990  1.00 132.34 ? 302  THR A O     1 
ATOM   3136  C  CB    . THR D 4  302  ? 40.014  20.148  42.422  1.00 96.89  ? 302  THR A CB    1 
ATOM   3137  O  OG1   . THR D 4  302  ? 38.584  20.136  42.513  1.00 109.93 ? 302  THR A OG1   1 
ATOM   3138  C  CG2   . THR D 4  302  ? 40.412  20.847  41.131  1.00 94.82  ? 302  THR A CG2   1 
ATOM   3139  N  N     . TYR D 4  303  ? 41.148  17.721  40.295  1.00 133.25 ? 303  TYR A N     1 
ATOM   3140  C  CA    . TYR D 4  303  ? 40.922  16.858  39.140  1.00 116.33 ? 303  TYR A CA    1 
ATOM   3141  C  C     . TYR D 4  303  ? 40.893  15.390  39.543  1.00 112.50 ? 303  TYR A C     1 
ATOM   3142  O  O     . TYR D 4  303  ? 40.225  14.583  38.886  1.00 105.74 ? 303  TYR A O     1 
ATOM   3143  C  CB    . TYR D 4  303  ? 42.002  17.115  38.083  1.00 111.74 ? 303  TYR A CB    1 
ATOM   3144  C  CG    . TYR D 4  303  ? 42.287  15.961  37.148  1.00 100.01 ? 303  TYR A CG    1 
ATOM   3145  C  CD1   . TYR D 4  303  ? 41.384  15.604  36.156  1.00 98.04  ? 303  TYR A CD1   1 
ATOM   3146  C  CD2   . TYR D 4  303  ? 43.474  15.247  37.241  1.00 88.15  ? 303  TYR A CD2   1 
ATOM   3147  C  CE1   . TYR D 4  303  ? 41.647  14.554  35.296  1.00 104.07 ? 303  TYR A CE1   1 
ATOM   3148  C  CE2   . TYR D 4  303  ? 43.746  14.197  36.384  1.00 91.87  ? 303  TYR A CE2   1 
ATOM   3149  C  CZ    . TYR D 4  303  ? 42.830  13.855  35.414  1.00 104.62 ? 303  TYR A CZ    1 
ATOM   3150  O  OH    . TYR D 4  303  ? 43.098  12.810  34.561  1.00 107.58 ? 303  TYR A OH    1 
ATOM   3151  N  N     . MET D 4  304  ? 41.592  15.037  40.622  1.00 116.89 ? 304  MET A N     1 
ATOM   3152  C  CA    . MET D 4  304  ? 41.531  13.703  41.209  1.00 111.45 ? 304  MET A CA    1 
ATOM   3153  C  C     . MET D 4  304  ? 40.355  13.570  42.171  1.00 106.16 ? 304  MET A C     1 
ATOM   3154  O  O     . MET D 4  304  ? 39.604  12.593  42.111  1.00 108.72 ? 304  MET A O     1 
ATOM   3155  C  CB    . MET D 4  304  ? 42.842  13.387  41.939  1.00 105.34 ? 304  MET A CB    1 
ATOM   3156  C  CG    . MET D 4  304  ? 44.084  13.364  41.059  1.00 107.84 ? 304  MET A CG    1 
ATOM   3157  S  SD    . MET D 4  304  ? 44.131  11.964  39.926  1.00 115.53 ? 304  MET A SD    1 
ATOM   3158  C  CE    . MET D 4  304  ? 45.867  11.947  39.483  1.00 101.34 ? 304  MET A CE    1 
ATOM   3159  N  N     . ASP D 4  305  ? 40.181  14.552  43.056  1.00 99.26  ? 305  ASP A N     1 
ATOM   3160  C  CA    . ASP D 4  305  ? 39.137  14.508  44.075  1.00 109.14 ? 305  ASP A CA    1 
ATOM   3161  C  C     . ASP D 4  305  ? 38.650  15.929  44.312  1.00 112.59 ? 305  ASP A C     1 
ATOM   3162  O  O     . ASP D 4  305  ? 39.424  16.779  44.761  1.00 127.23 ? 305  ASP A O     1 
ATOM   3163  C  CB    . ASP D 4  305  ? 39.671  13.889  45.373  1.00 132.98 ? 305  ASP A CB    1 
ATOM   3164  C  CG    . ASP D 4  305  ? 38.639  13.864  46.493  1.00 148.36 ? 305  ASP A CG    1 
ATOM   3165  O  OD1   . ASP D 4  305  ? 37.469  14.232  46.256  1.00 154.75 ? 305  ASP A OD1   1 
ATOM   3166  O  OD2   . ASP D 4  305  ? 39.003  13.470  47.622  1.00 146.70 ? 305  ASP A OD2   1 
ATOM   3167  N  N     . ASN D 4  306  ? 37.375  16.189  44.015  1.00 98.87  ? 306  ASN A N     1 
ATOM   3168  C  CA    . ASN D 4  306  ? 36.759  17.480  44.297  1.00 117.09 ? 306  ASN A CA    1 
ATOM   3169  C  C     . ASN D 4  306  ? 35.894  17.442  45.555  1.00 126.87 ? 306  ASN A C     1 
ATOM   3170  O  O     . ASN D 4  306  ? 35.030  18.307  45.737  1.00 131.25 ? 306  ASN A O     1 
ATOM   3171  C  CB    . ASN D 4  306  ? 35.934  17.955  43.098  1.00 121.08 ? 306  ASN A CB    1 
ATOM   3172  C  CG    . ASN D 4  306  ? 35.647  19.451  43.136  1.00 123.99 ? 306  ASN A CG    1 
ATOM   3173  O  OD1   . ASN D 4  306  ? 36.350  20.247  42.513  1.00 130.95 ? 306  ASN A OD1   1 
ATOM   3174  N  ND2   . ASN D 4  306  ? 34.608  19.837  43.871  1.00 114.64 ? 306  ASN A ND2   1 
ATOM   3175  N  N     . ASP D 4  307  ? 36.107  16.457  46.423  1.00 132.28 ? 307  ASP A N     1 
ATOM   3176  C  CA    . ASP D 4  307  ? 35.425  16.381  47.713  1.00 139.75 ? 307  ASP A CA    1 
ATOM   3177  C  C     . ASP D 4  307  ? 36.501  16.334  48.795  1.00 141.71 ? 307  ASP A C     1 
ATOM   3178  O  O     . ASP D 4  307  ? 36.933  15.261  49.224  1.00 157.66 ? 307  ASP A O     1 
ATOM   3179  C  CB    . ASP D 4  307  ? 34.485  15.178  47.774  1.00 140.05 ? 307  ASP A CB    1 
ATOM   3180  C  CG    . ASP D 4  307  ? 33.022  15.583  47.699  1.00 142.99 ? 307  ASP A CG    1 
ATOM   3181  O  OD1   . ASP D 4  307  ? 32.687  16.679  48.195  1.00 143.36 ? 307  ASP A OD1   1 
ATOM   3182  O  OD2   . ASP D 4  307  ? 32.212  14.815  47.137  1.00 146.32 ? 307  ASP A OD2   1 
ATOM   3183  N  N     . ILE D 4  308  ? 36.929  17.521  49.222  1.00 120.64 ? 308  ILE A N     1 
ATOM   3184  C  CA    . ILE D 4  308  ? 37.994  17.715  50.198  1.00 98.21  ? 308  ILE A CA    1 
ATOM   3185  C  C     . ILE D 4  308  ? 37.447  18.646  51.271  1.00 110.91 ? 308  ILE A C     1 
ATOM   3186  O  O     . ILE D 4  308  ? 36.245  18.941  51.306  1.00 116.38 ? 308  ILE A O     1 
ATOM   3187  C  CB    . ILE D 4  308  ? 39.269  18.298  49.554  1.00 87.23  ? 308  ILE A CB    1 
ATOM   3188  C  CG1   . ILE D 4  308  ? 39.419  17.826  48.110  1.00 73.38  ? 308  ILE A CG1   1 
ATOM   3189  C  CG2   . ILE D 4  308  ? 40.514  17.862  50.320  1.00 94.29  ? 308  ILE A CG2   1 
ATOM   3190  C  CD1   . ILE D 4  308  ? 40.702  18.276  47.436  1.00 74.85  ? 308  ILE A CD1   1 
ATOM   3191  N  N     . ALA D 4  309  ? 38.330  19.100  52.162  1.00 113.80 ? 309  ALA A N     1 
ATOM   3192  C  CA    . ALA D 4  309  ? 37.971  20.076  53.182  1.00 103.51 ? 309  ALA A CA    1 
ATOM   3193  C  C     . ALA D 4  309  ? 38.529  21.434  52.763  1.00 120.31 ? 309  ALA A C     1 
ATOM   3194  O  O     . ALA D 4  309  ? 39.001  22.228  53.581  1.00 106.17 ? 309  ALA A O     1 
ATOM   3195  C  CB    . ALA D 4  309  ? 38.478  19.665  54.567  1.00 79.38  ? 309  ALA A CB    1 
ATOM   3196  N  N     . GLY D 4  310  ? 38.453  21.702  51.455  1.00 132.05 ? 310  GLY A N     1 
ATOM   3197  C  CA    . GLY D 4  310  ? 38.928  22.933  50.860  1.00 136.99 ? 310  GLY A CA    1 
ATOM   3198  C  C     . GLY D 4  310  ? 37.841  23.668  50.098  1.00 145.60 ? 310  GLY A C     1 
ATOM   3199  O  O     . GLY D 4  310  ? 36.822  24.045  50.686  1.00 136.19 ? 310  GLY A O     1 
ATOM   3200  N  N     . GLN D 4  311  ? 38.047  23.899  48.803  1.00 153.45 ? 311  GLN A N     1 
ATOM   3201  C  CA    . GLN D 4  311  ? 37.103  24.640  47.979  1.00 171.98 ? 311  GLN A CA    1 
ATOM   3202  C  C     . GLN D 4  311  ? 36.668  23.818  46.773  1.00 177.84 ? 311  GLN A C     1 
ATOM   3203  O  O     . GLN D 4  311  ? 37.444  23.014  46.245  1.00 189.27 ? 311  GLN A O     1 
ATOM   3204  C  CB    . GLN D 4  311  ? 37.711  25.971  47.500  1.00 190.59 ? 311  GLN A CB    1 
ATOM   3205  C  CG    . GLN D 4  311  ? 38.792  25.825  46.437  1.00 204.48 ? 311  GLN A CG    1 
ATOM   3206  C  CD    . GLN D 4  311  ? 39.937  26.804  46.619  1.00 211.42 ? 311  GLN A CD    1 
ATOM   3207  O  OE1   . GLN D 4  311  ? 39.813  27.986  46.297  1.00 205.42 ? 311  GLN A OE1   1 
ATOM   3208  N  NE2   . GLN D 4  311  ? 41.054  26.320  47.151  1.00 219.93 ? 311  GLN A NE2   1 
ATOM   3209  N  N     . PRO D 4  312  ? 35.409  23.974  46.340  1.00 175.75 ? 312  PRO A N     1 
ATOM   3210  C  CA    . PRO D 4  312  ? 34.965  23.383  45.067  1.00 159.38 ? 312  PRO A CA    1 
ATOM   3211  C  C     . PRO D 4  312  ? 35.358  24.252  43.879  1.00 163.69 ? 312  PRO A C     1 
ATOM   3212  O  O     . PRO D 4  312  ? 36.120  25.210  44.042  1.00 187.61 ? 312  PRO A O     1 
ATOM   3213  C  CB    . PRO D 4  312  ? 33.439  23.304  45.219  1.00 146.20 ? 312  PRO A CB    1 
ATOM   3214  C  CG    . PRO D 4  312  ? 33.148  23.660  46.664  1.00 151.73 ? 312  PRO A CG    1 
ATOM   3215  C  CD    . PRO D 4  312  ? 34.282  24.520  47.109  1.00 168.95 ? 312  PRO A CD    1 
ATOM   3216  N  N     . GLN D 4  313  ? 34.857  23.931  42.683  1.00 137.24 ? 313  GLN A N     1 
ATOM   3217  C  CA    . GLN D 4  313  ? 35.166  24.689  41.472  1.00 124.16 ? 313  GLN A CA    1 
ATOM   3218  C  C     . GLN D 4  313  ? 33.894  24.793  40.629  1.00 124.21 ? 313  GLN A C     1 
ATOM   3219  O  O     . GLN D 4  313  ? 32.816  24.369  41.049  1.00 128.44 ? 313  GLN A O     1 
ATOM   3220  C  CB    . GLN D 4  313  ? 36.333  24.031  40.716  1.00 125.21 ? 313  GLN A CB    1 
ATOM   3221  C  CG    . GLN D 4  313  ? 36.963  24.868  39.606  1.00 140.39 ? 313  GLN A CG    1 
ATOM   3222  C  CD    . GLN D 4  313  ? 37.625  26.128  40.128  1.00 156.04 ? 313  GLN A CD    1 
ATOM   3223  O  OE1   . GLN D 4  313  ? 38.333  26.096  41.137  1.00 166.71 ? 313  GLN A OE1   1 
ATOM   3224  N  NE2   . GLN D 4  313  ? 37.397  27.245  39.446  1.00 153.83 ? 313  GLN A NE2   1 
ATOM   3225  N  N     . ALA D 4  314  ? 34.008  25.384  39.440  1.00 135.09 ? 314  ALA A N     1 
ATOM   3226  C  CA    . ALA D 4  314  ? 32.864  25.556  38.546  1.00 140.81 ? 314  ALA A CA    1 
ATOM   3227  C  C     . ALA D 4  314  ? 33.257  25.288  37.093  1.00 135.51 ? 314  ALA A C     1 
ATOM   3228  O  O     . ALA D 4  314  ? 32.430  25.376  36.184  1.00 127.22 ? 314  ALA A O     1 
ATOM   3229  C  CB    . ALA D 4  314  ? 32.282  26.956  38.686  1.00 144.67 ? 314  ALA A CB    1 
ATOM   3230  N  N     . GLY D 4  319  ? 30.687  26.879  35.433  1.00 83.22  ? 319  GLY A N     1 
ATOM   3231  C  CA    . GLY D 4  319  ? 29.373  27.300  35.885  1.00 100.20 ? 319  GLY A CA    1 
ATOM   3232  C  C     . GLY D 4  319  ? 28.789  26.435  36.987  1.00 125.70 ? 319  GLY A C     1 
ATOM   3233  O  O     . GLY D 4  319  ? 27.961  26.897  37.773  1.00 99.42  ? 319  GLY A O     1 
ATOM   3234  N  N     . ARG D 4  320  ? 29.226  25.181  37.051  1.00 160.12 ? 320  ARG A N     1 
ATOM   3235  C  CA    . ARG D 4  320  ? 28.711  24.207  38.000  1.00 169.66 ? 320  ARG A CA    1 
ATOM   3236  C  C     . ARG D 4  320  ? 29.862  23.365  38.534  1.00 181.01 ? 320  ARG A C     1 
ATOM   3237  O  O     . ARG D 4  320  ? 30.880  23.202  37.851  1.00 190.72 ? 320  ARG A O     1 
ATOM   3238  C  CB    . ARG D 4  320  ? 27.657  23.297  37.349  1.00 162.19 ? 320  ARG A CB    1 
ATOM   3239  N  N     . PRO D 4  321  ? 29.729  22.820  39.747  1.00 162.15 ? 321  PRO A N     1 
ATOM   3240  C  CA    . PRO D 4  321  ? 30.832  22.047  40.337  1.00 137.34 ? 321  PRO A CA    1 
ATOM   3241  C  C     . PRO D 4  321  ? 31.249  20.869  39.468  1.00 134.49 ? 321  PRO A C     1 
ATOM   3242  O  O     . PRO D 4  321  ? 30.414  20.172  38.886  1.00 142.51 ? 321  PRO A O     1 
ATOM   3243  C  CB    . PRO D 4  321  ? 30.254  21.575  41.677  1.00 132.04 ? 321  PRO A CB    1 
ATOM   3244  C  CG    . PRO D 4  321  ? 29.215  22.585  42.009  1.00 141.64 ? 321  PRO A CG    1 
ATOM   3245  C  CD    . PRO D 4  321  ? 28.614  22.995  40.694  1.00 152.15 ? 321  PRO A CD    1 
ATOM   3246  N  N     . VAL D 4  322  ? 32.562  20.650  39.393  1.00 112.34 ? 322  VAL A N     1 
ATOM   3247  C  CA    . VAL D 4  322  ? 33.107  19.560  38.593  1.00 114.03 ? 322  VAL A CA    1 
ATOM   3248  C  C     . VAL D 4  322  ? 32.925  18.236  39.331  1.00 130.56 ? 322  VAL A C     1 
ATOM   3249  O  O     . VAL D 4  322  ? 32.759  18.188  40.553  1.00 138.06 ? 322  VAL A O     1 
ATOM   3250  C  CB    . VAL D 4  322  ? 34.591  19.819  38.265  1.00 85.81  ? 322  VAL A CB    1 
ATOM   3251  C  CG1   . VAL D 4  322  ? 35.042  18.999  37.056  1.00 78.13  ? 322  VAL A CG1   1 
ATOM   3252  C  CG2   . VAL D 4  322  ? 34.837  21.302  38.043  1.00 80.60  ? 322  VAL A CG2   1 
ATOM   3253  N  N     . LYS D 4  323  ? 32.951  17.146  38.569  1.00 124.22 ? 323  LYS A N     1 
ATOM   3254  C  CA    . LYS D 4  323  ? 32.964  15.795  39.116  1.00 116.79 ? 323  LYS A CA    1 
ATOM   3255  C  C     . LYS D 4  323  ? 34.345  15.200  38.874  1.00 123.42 ? 323  LYS A C     1 
ATOM   3256  O  O     . LYS D 4  323  ? 34.774  15.065  37.724  1.00 113.95 ? 323  LYS A O     1 
ATOM   3257  C  CB    . LYS D 4  323  ? 31.877  14.927  38.481  1.00 115.83 ? 323  LYS A CB    1 
ATOM   3258  C  CG    . LYS D 4  323  ? 30.460  15.338  38.853  1.00 114.42 ? 323  LYS A CG    1 
ATOM   3259  C  CD    . LYS D 4  323  ? 29.427  14.449  38.181  1.00 109.37 ? 323  LYS A CD    1 
ATOM   3260  C  CE    . LYS D 4  323  ? 28.016  14.879  38.541  1.00 111.15 ? 323  LYS A CE    1 
ATOM   3261  N  NZ    . LYS D 4  323  ? 27.006  14.124  37.754  1.00 104.26 ? 323  LYS A NZ    1 
ATOM   3262  N  N     . SER D 4  324  ? 35.039  14.858  39.956  1.00 145.67 ? 324  SER A N     1 
ATOM   3263  C  CA    . SER D 4  324  ? 36.385  14.325  39.844  1.00 146.54 ? 324  SER A CA    1 
ATOM   3264  C  C     . SER D 4  324  ? 36.355  12.873  39.371  1.00 141.24 ? 324  SER A C     1 
ATOM   3265  O  O     . SER D 4  324  ? 35.299  12.242  39.265  1.00 152.93 ? 324  SER A O     1 
ATOM   3266  C  CB    . SER D 4  324  ? 37.112  14.424  41.183  1.00 155.03 ? 324  SER A CB    1 
ATOM   3267  O  OG    . SER D 4  324  ? 37.508  15.756  41.454  1.00 160.31 ? 324  SER A OG    1 
ATOM   3268  N  N     . ILE D 4  325  ? 37.548  12.345  39.078  1.00 114.19 ? 325  ILE A N     1 
ATOM   3269  C  CA    . ILE D 4  325  ? 37.672  10.926  38.755  1.00 97.86  ? 325  ILE A CA    1 
ATOM   3270  C  C     . ILE D 4  325  ? 37.117  10.084  39.893  1.00 96.50  ? 325  ILE A C     1 
ATOM   3271  O  O     . ILE D 4  325  ? 36.460  9.060   39.669  1.00 102.20 ? 325  ILE A O     1 
ATOM   3272  C  CB    . ILE D 4  325  ? 39.141  10.565  38.463  1.00 98.90  ? 325  ILE A CB    1 
ATOM   3273  C  CG1   . ILE D 4  325  ? 39.831  11.669  37.666  1.00 91.92  ? 325  ILE A CG1   1 
ATOM   3274  C  CG2   . ILE D 4  325  ? 39.220  9.256   37.695  1.00 96.43  ? 325  ILE A CG2   1 
ATOM   3275  C  CD1   . ILE D 4  325  ? 39.323  11.813  36.270  1.00 77.00  ? 325  ILE A CD1   1 
ATOM   3276  N  N     . ARG D 4  326  ? 37.372  10.507  41.133  1.00 108.05 ? 326  ARG A N     1 
ATOM   3277  C  CA    . ARG D 4  326  ? 36.831  9.808   42.293  1.00 115.47 ? 326  ARG A CA    1 
ATOM   3278  C  C     . ARG D 4  326  ? 35.308  9.790   42.271  1.00 117.02 ? 326  ARG A C     1 
ATOM   3279  O  O     . ARG D 4  326  ? 34.686  8.756   42.544  1.00 124.78 ? 326  ARG A O     1 
ATOM   3280  C  CB    . ARG D 4  326  ? 37.337  10.467  43.574  1.00 109.64 ? 326  ARG A CB    1 
ATOM   3281  C  CG    . ARG D 4  326  ? 36.553  10.085  44.808  1.00 103.48 ? 326  ARG A CG    1 
ATOM   3282  C  CD    . ARG D 4  326  ? 36.725  11.096  45.924  1.00 104.68 ? 326  ARG A CD    1 
ATOM   3283  N  NE    . ARG D 4  326  ? 37.096  10.447  47.177  1.00 118.51 ? 326  ARG A NE    1 
ATOM   3284  C  CZ    . ARG D 4  326  ? 36.244  10.169  48.155  1.00 126.54 ? 326  ARG A CZ    1 
ATOM   3285  N  NH1   . ARG D 4  326  ? 34.963  10.485  48.028  1.00 123.88 ? 326  ARG A NH1   1 
ATOM   3286  N  NH2   . ARG D 4  326  ? 36.672  9.571   49.259  1.00 130.11 ? 326  ARG A NH2   1 
ATOM   3287  N  N     . ALA D 4  327  ? 34.689  10.926  41.946  1.00 96.27  ? 327  ALA A N     1 
ATOM   3288  C  CA    . ALA D 4  327  ? 33.232  11.000  41.955  1.00 97.05  ? 327  ALA A CA    1 
ATOM   3289  C  C     . ALA D 4  327  ? 32.613  10.098  40.894  1.00 104.85 ? 327  ALA A C     1 
ATOM   3290  O  O     . ALA D 4  327  ? 31.472  9.649   41.052  1.00 101.37 ? 327  ALA A O     1 
ATOM   3291  C  CB    . ALA D 4  327  ? 32.782  12.447  41.756  1.00 96.00  ? 327  ALA A CB    1 
ATOM   3292  N  N     . ARG D 4  328  ? 33.348  9.819   39.814  1.00 108.70 ? 328  ARG A N     1 
ATOM   3293  C  CA    . ARG D 4  328  ? 32.807  8.984   38.747  1.00 112.82 ? 328  ARG A CA    1 
ATOM   3294  C  C     . ARG D 4  328  ? 32.520  7.570   39.236  1.00 114.60 ? 328  ARG A C     1 
ATOM   3295  O  O     . ARG D 4  328  ? 31.507  6.969   38.859  1.00 134.50 ? 328  ARG A O     1 
ATOM   3296  C  CB    . ARG D 4  328  ? 33.778  8.942   37.567  1.00 116.70 ? 328  ARG A CB    1 
ATOM   3297  C  CG    . ARG D 4  328  ? 33.626  10.081  36.575  1.00 109.55 ? 328  ARG A CG    1 
ATOM   3298  C  CD    . ARG D 4  328  ? 34.373  9.765   35.290  1.00 112.54 ? 328  ARG A CD    1 
ATOM   3299  N  NE    . ARG D 4  328  ? 34.315  10.861  34.329  1.00 114.08 ? 328  ARG A NE    1 
ATOM   3300  C  CZ    . ARG D 4  328  ? 34.763  10.778  33.081  1.00 111.61 ? 328  ARG A CZ    1 
ATOM   3301  N  NH1   . ARG D 4  328  ? 35.296  9.646   32.643  1.00 102.05 ? 328  ARG A NH1   1 
ATOM   3302  N  NH2   . ARG D 4  328  ? 34.675  11.824  32.271  1.00 113.67 ? 328  ARG A NH2   1 
ATOM   3303  N  N     . LEU D 4  329  ? 33.396  7.023   40.078  1.00 85.12  ? 329  LEU A N     1 
ATOM   3304  C  CA    . LEU D 4  329  ? 33.322  5.627   40.489  1.00 83.85  ? 329  LEU A CA    1 
ATOM   3305  C  C     . LEU D 4  329  ? 32.897  5.459   41.945  1.00 80.09  ? 329  LEU A C     1 
ATOM   3306  O  O     . LEU D 4  329  ? 33.138  4.404   42.539  1.00 73.53  ? 329  LEU A O     1 
ATOM   3307  C  CB    . LEU D 4  329  ? 34.666  4.943   40.226  1.00 76.64  ? 329  LEU A CB    1 
ATOM   3308  C  CG    . LEU D 4  329  ? 35.949  5.721   40.545  1.00 77.86  ? 329  LEU A CG    1 
ATOM   3309  C  CD1   . LEU D 4  329  ? 36.212  5.834   42.046  1.00 102.82 ? 329  LEU A CD1   1 
ATOM   3310  C  CD2   . LEU D 4  329  ? 37.141  5.100   39.828  1.00 67.30  ? 329  LEU A CD2   1 
ATOM   3311  N  N     . LYS D 4  330  ? 32.252  6.465   42.524  1.00 84.74  ? 330  LYS A N     1 
ATOM   3312  C  CA    . LYS D 4  330  ? 31.825  6.429   43.914  1.00 89.88  ? 330  LYS A CA    1 
ATOM   3313  C  C     . LYS D 4  330  ? 30.302  6.422   43.993  1.00 89.07  ? 330  LYS A C     1 
ATOM   3314  O  O     . LYS D 4  330  ? 29.618  7.028   43.162  1.00 99.28  ? 330  LYS A O     1 
ATOM   3315  C  CB    . LYS D 4  330  ? 32.393  7.628   44.686  1.00 101.39 ? 330  LYS A CB    1 
ATOM   3316  C  CG    . LYS D 4  330  ? 31.996  7.702   46.154  1.00 105.81 ? 330  LYS A CG    1 
ATOM   3317  C  CD    . LYS D 4  330  ? 30.908  8.742   46.378  1.00 107.80 ? 330  LYS A CD    1 
ATOM   3318  C  CE    . LYS D 4  330  ? 30.526  8.836   47.845  1.00 120.78 ? 330  LYS A CE    1 
ATOM   3319  N  NZ    . LYS D 4  330  ? 29.515  9.902   48.087  1.00 128.68 ? 330  LYS A NZ    1 
ATOM   3320  N  N     . GLY D 4  331  ? 29.776  5.723   44.998  1.00 71.69  ? 331  GLY A N     1 
ATOM   3321  C  CA    . GLY D 4  331  ? 28.348  5.693   45.233  1.00 73.53  ? 331  GLY A CA    1 
ATOM   3322  C  C     . GLY D 4  331  ? 27.640  4.636   44.409  1.00 85.31  ? 331  GLY A C     1 
ATOM   3323  O  O     . GLY D 4  331  ? 28.225  3.944   43.573  1.00 97.05  ? 331  GLY A O     1 
ATOM   3324  N  N     . LYS D 4  332  ? 26.334  4.511   44.665  1.00 87.55  ? 332  LYS A N     1 
ATOM   3325  C  CA    . LYS D 4  332  ? 25.519  3.547   43.933  1.00 79.30  ? 332  LYS A CA    1 
ATOM   3326  C  C     . LYS D 4  332  ? 25.342  3.938   42.473  1.00 97.55  ? 332  LYS A C     1 
ATOM   3327  O  O     . LYS D 4  332  ? 25.091  3.065   41.636  1.00 106.18 ? 332  LYS A O     1 
ATOM   3328  C  CB    . LYS D 4  332  ? 24.153  3.395   44.606  1.00 61.25  ? 332  LYS A CB    1 
ATOM   3329  C  CG    . LYS D 4  332  ? 23.312  4.661   44.573  1.00 84.40  ? 332  LYS A CG    1 
ATOM   3330  C  CD    . LYS D 4  332  ? 22.826  5.042   45.959  1.00 114.42 ? 332  LYS A CD    1 
ATOM   3331  C  CE    . LYS D 4  332  ? 23.970  5.555   46.819  1.00 115.96 ? 332  LYS A CE    1 
ATOM   3332  N  NZ    . LYS D 4  332  ? 23.483  6.305   48.011  1.00 113.59 ? 332  LYS A NZ    1 
ATOM   3333  N  N     . GLU D 4  333  ? 25.469  5.222   42.149  1.00 106.08 ? 333  GLU A N     1 
ATOM   3334  C  CA    . GLU D 4  333  ? 25.449  5.676   40.767  1.00 102.60 ? 333  GLU A CA    1 
ATOM   3335  C  C     . GLU D 4  333  ? 26.833  5.666   40.134  1.00 97.36  ? 333  GLU A C     1 
ATOM   3336  O  O     . GLU D 4  333  ? 26.956  5.966   38.942  1.00 103.39 ? 333  GLU A O     1 
ATOM   3337  C  CB    . GLU D 4  333  ? 24.853  7.086   40.681  1.00 124.36 ? 333  GLU A CB    1 
ATOM   3338  C  CG    . GLU D 4  333  ? 23.562  7.273   41.467  1.00 128.79 ? 333  GLU A CG    1 
ATOM   3339  C  CD    . GLU D 4  333  ? 22.354  6.677   40.767  1.00 125.53 ? 333  GLU A CD    1 
ATOM   3340  O  OE1   . GLU D 4  333  ? 22.430  6.426   39.545  1.00 123.23 ? 333  GLU A OE1   1 
ATOM   3341  O  OE2   . GLU D 4  333  ? 21.326  6.460   41.444  1.00 125.59 ? 333  GLU A OE2   1 
ATOM   3342  N  N     . GLY D 4  334  ? 27.868  5.328   40.896  1.00 92.54  ? 334  GLY A N     1 
ATOM   3343  C  CA    . GLY D 4  334  ? 29.217  5.286   40.375  1.00 85.82  ? 334  GLY A CA    1 
ATOM   3344  C  C     . GLY D 4  334  ? 29.446  4.096   39.463  1.00 89.85  ? 334  GLY A C     1 
ATOM   3345  O  O     . GLY D 4  334  ? 28.585  3.239   39.260  1.00 93.74  ? 334  GLY A O     1 
ATOM   3346  N  N     . ARG D 4  335  ? 30.660  4.045   38.907  1.00 86.27  ? 335  ARG A N     1 
ATOM   3347  C  CA    . ARG D 4  335  ? 30.981  3.023   37.912  1.00 97.22  ? 335  ARG A CA    1 
ATOM   3348  C  C     . ARG D 4  335  ? 30.929  1.622   38.506  1.00 96.17  ? 335  ARG A C     1 
ATOM   3349  O  O     . ARG D 4  335  ? 30.420  0.690   37.873  1.00 109.30 ? 335  ARG A O     1 
ATOM   3350  C  CB    . ARG D 4  335  ? 32.363  3.283   37.311  1.00 89.76  ? 335  ARG A CB    1 
ATOM   3351  C  CG    . ARG D 4  335  ? 32.563  4.674   36.732  1.00 103.82 ? 335  ARG A CG    1 
ATOM   3352  C  CD    . ARG D 4  335  ? 32.202  4.721   35.255  1.00 105.92 ? 335  ARG A CD    1 
ATOM   3353  N  NE    . ARG D 4  335  ? 30.849  5.219   35.023  1.00 119.13 ? 335  ARG A NE    1 
ATOM   3354  C  CZ    . ARG D 4  335  ? 30.540  6.507   34.897  1.00 120.97 ? 335  ARG A CZ    1 
ATOM   3355  N  NH1   . ARG D 4  335  ? 31.493  7.426   34.977  1.00 116.65 ? 335  ARG A NH1   1 
ATOM   3356  N  NH2   . ARG D 4  335  ? 29.283  6.876   34.686  1.00 112.90 ? 335  ARG A NH2   1 
ATOM   3357  N  N     . ILE D 4  336  ? 31.454  1.446   39.714  1.00 90.32  ? 336  ILE A N     1 
ATOM   3358  C  CA    . ILE D 4  336  ? 31.622  0.101   40.255  1.00 81.02  ? 336  ILE A CA    1 
ATOM   3359  C  C     . ILE D 4  336  ? 30.305  -0.426  40.807  1.00 79.05  ? 336  ILE A C     1 
ATOM   3360  O  O     . ILE D 4  336  ? 29.806  -1.474  40.381  1.00 72.77  ? 336  ILE A O     1 
ATOM   3361  C  CB    . ILE D 4  336  ? 32.726  0.089   41.324  1.00 65.65  ? 336  ILE A CB    1 
ATOM   3362  C  CG1   . ILE D 4  336  ? 33.880  0.994   40.895  1.00 83.68  ? 336  ILE A CG1   1 
ATOM   3363  C  CG2   . ILE D 4  336  ? 33.229  -1.323  41.537  1.00 64.60  ? 336  ILE A CG2   1 
ATOM   3364  C  CD1   . ILE D 4  336  ? 34.506  0.592   39.580  1.00 80.39  ? 336  ILE A CD1   1 
ATOM   3365  N  N     . ARG D 4  337  ? 29.721  0.296   41.761  1.00 77.18  ? 337  ARG A N     1 
ATOM   3366  C  CA    . ARG D 4  337  ? 28.480  -0.155  42.376  1.00 93.47  ? 337  ARG A CA    1 
ATOM   3367  C  C     . ARG D 4  337  ? 27.293  -0.085  41.418  1.00 81.27  ? 337  ARG A C     1 
ATOM   3368  O  O     . ARG D 4  337  ? 26.292  -0.775  41.642  1.00 64.07  ? 337  ARG A O     1 
ATOM   3369  C  CB    . ARG D 4  337  ? 28.211  0.671   43.640  1.00 65.63  ? 337  ARG A CB    1 
ATOM   3370  C  CG    . ARG D 4  337  ? 27.162  0.093   44.576  1.00 58.91  ? 337  ARG A CG    1 
ATOM   3371  C  CD    . ARG D 4  337  ? 27.025  0.923   45.843  1.00 58.93  ? 337  ARG A CD    1 
ATOM   3372  N  NE    . ARG D 4  337  ? 25.748  0.683   46.510  1.00 58.19  ? 337  ARG A NE    1 
ATOM   3373  C  CZ    . ARG D 4  337  ? 25.324  1.349   47.581  1.00 76.14  ? 337  ARG A CZ    1 
ATOM   3374  N  NH1   . ARG D 4  337  ? 26.079  2.300   48.121  1.00 86.79  ? 337  ARG A NH1   1 
ATOM   3375  N  NH2   . ARG D 4  337  ? 24.142  1.065   48.114  1.00 64.14  ? 337  ARG A NH2   1 
ATOM   3376  N  N     . GLY D 4  338  ? 27.389  0.697   40.341  1.00 61.13  ? 338  GLY A N     1 
ATOM   3377  C  CA    . GLY D 4  338  ? 26.229  0.946   39.505  1.00 92.22  ? 338  GLY A CA    1 
ATOM   3378  C  C     . GLY D 4  338  ? 26.374  0.653   38.022  1.00 100.68 ? 338  GLY A C     1 
ATOM   3379  O  O     . GLY D 4  338  ? 25.375  0.645   37.296  1.00 112.30 ? 338  GLY A O     1 
ATOM   3380  N  N     . ASN D 4  339  ? 27.601  0.423   37.551  1.00 117.96 ? 339  ASN A N     1 
ATOM   3381  C  CA    . ASN D 4  339  ? 27.834  0.087   36.150  1.00 105.58 ? 339  ASN A CA    1 
ATOM   3382  C  C     . ASN D 4  339  ? 28.660  -1.173  35.938  1.00 105.14 ? 339  ASN A C     1 
ATOM   3383  O  O     . ASN D 4  339  ? 28.820  -1.590  34.786  1.00 106.79 ? 339  ASN A O     1 
ATOM   3384  C  CB    . ASN D 4  339  ? 28.529  1.248   35.419  1.00 85.73  ? 339  ASN A CB    1 
ATOM   3385  C  CG    . ASN D 4  339  ? 27.635  2.459   35.264  1.00 103.65 ? 339  ASN A CG    1 
ATOM   3386  O  OD1   . ASN D 4  339  ? 28.112  3.575   35.066  1.00 111.20 ? 339  ASN A OD1   1 
ATOM   3387  N  ND2   . ASN D 4  339  ? 26.327  2.242   35.344  1.00 117.30 ? 339  ASN A ND2   1 
ATOM   3388  N  N     . LEU D 4  340  ? 29.190  -1.786  36.993  1.00 85.09  ? 340  LEU A N     1 
ATOM   3389  C  CA    . LEU D 4  340  ? 29.989  -2.998  36.869  1.00 62.42  ? 340  LEU A CA    1 
ATOM   3390  C  C     . LEU D 4  340  ? 29.444  -4.160  37.680  1.00 73.60  ? 340  LEU A C     1 
ATOM   3391  O  O     . LEU D 4  340  ? 29.459  -5.298  37.203  1.00 77.50  ? 340  LEU A O     1 
ATOM   3392  C  CB    . LEU D 4  340  ? 31.438  -2.713  37.286  1.00 61.94  ? 340  LEU A CB    1 
ATOM   3393  C  CG    . LEU D 4  340  ? 32.366  -2.298  36.142  1.00 77.13  ? 340  LEU A CG    1 
ATOM   3394  C  CD1   . LEU D 4  340  ? 33.604  -1.602  36.681  1.00 91.27  ? 340  LEU A CD1   1 
ATOM   3395  C  CD2   . LEU D 4  340  ? 32.747  -3.507  35.296  1.00 74.50  ? 340  LEU A CD2   1 
ATOM   3396  N  N     . MET D 4  341  ? 28.963  -3.908  38.893  1.00 78.63  ? 341  MET A N     1 
ATOM   3397  C  CA    . MET D 4  341  ? 28.319  -4.934  39.700  1.00 88.65  ? 341  MET A CA    1 
ATOM   3398  C  C     . MET D 4  341  ? 26.819  -5.002  39.456  1.00 101.36 ? 341  MET A C     1 
ATOM   3399  O  O     . MET D 4  341  ? 26.128  -5.786  40.116  1.00 104.57 ? 341  MET A O     1 
ATOM   3400  C  CB    . MET D 4  341  ? 28.597  -4.685  41.183  1.00 78.00  ? 341  MET A CB    1 
ATOM   3401  C  CG    . MET D 4  341  ? 30.077  -4.671  41.509  1.00 80.68  ? 341  MET A CG    1 
ATOM   3402  S  SD    . MET D 4  341  ? 30.567  -6.194  42.325  1.00 98.18  ? 341  MET A SD    1 
ATOM   3403  C  CE    . MET D 4  341  ? 29.566  -6.093  43.801  1.00 103.95 ? 341  MET A CE    1 
ATOM   3404  N  N     . GLY D 4  342  ? 26.313  -4.192  38.534  1.00 101.80 ? 342  GLY A N     1 
ATOM   3405  C  CA    . GLY D 4  342  ? 24.916  -4.154  38.158  1.00 97.34  ? 342  GLY A CA    1 
ATOM   3406  C  C     . GLY D 4  342  ? 24.763  -3.159  37.029  1.00 105.36 ? 342  GLY A C     1 
ATOM   3407  O  O     . GLY D 4  342  ? 25.382  -2.092  37.070  1.00 102.69 ? 342  GLY A O     1 
ATOM   3408  N  N     . LYS D 4  343  ? 23.967  -3.481  36.013  1.00 110.26 ? 343  LYS A N     1 
ATOM   3409  C  CA    . LYS D 4  343  ? 23.919  -2.630  34.831  1.00 108.54 ? 343  LYS A CA    1 
ATOM   3410  C  C     . LYS D 4  343  ? 22.621  -2.861  34.074  1.00 91.49  ? 343  LYS A C     1 
ATOM   3411  O  O     . LYS D 4  343  ? 21.875  -3.806  34.344  1.00 68.33  ? 343  LYS A O     1 
ATOM   3412  C  CB    . LYS D 4  343  ? 25.122  -2.886  33.918  1.00 98.49  ? 343  LYS A CB    1 
ATOM   3413  C  CG    . LYS D 4  343  ? 25.600  -4.326  33.910  1.00 82.56  ? 343  LYS A CG    1 
ATOM   3414  C  CD    . LYS D 4  343  ? 26.754  -4.492  32.948  1.00 80.13  ? 343  LYS A CD    1 
ATOM   3415  C  CE    . LYS D 4  343  ? 27.656  -5.642  33.348  1.00 88.66  ? 343  LYS A CE    1 
ATOM   3416  N  NZ    . LYS D 4  343  ? 28.807  -5.771  32.414  1.00 97.93  ? 343  LYS A NZ    1 
ATOM   3417  N  N     . ARG D 4  344  ? 22.360  -1.962  33.124  1.00 90.19  ? 344  ARG A N     1 
ATOM   3418  C  CA    . ARG D 4  344  ? 21.291  -2.165  32.159  1.00 86.15  ? 344  ARG A CA    1 
ATOM   3419  C  C     . ARG D 4  344  ? 21.566  -3.422  31.346  1.00 90.70  ? 344  ARG A C     1 
ATOM   3420  O  O     . ARG D 4  344  ? 22.718  -3.807  31.131  1.00 108.46 ? 344  ARG A O     1 
ATOM   3421  C  CB    . ARG D 4  344  ? 21.173  -0.958  31.225  1.00 80.58  ? 344  ARG A CB    1 
ATOM   3422  C  CG    . ARG D 4  344  ? 21.183  0.391   31.920  1.00 87.91  ? 344  ARG A CG    1 
ATOM   3423  C  CD    . ARG D 4  344  ? 19.835  0.711   32.536  1.00 90.02  ? 344  ARG A CD    1 
ATOM   3424  N  NE    . ARG D 4  344  ? 19.890  1.919   33.352  1.00 98.85  ? 344  ARG A NE    1 
ATOM   3425  C  CZ    . ARG D 4  344  ? 18.877  2.369   34.085  1.00 113.25 ? 344  ARG A CZ    1 
ATOM   3426  N  NH1   . ARG D 4  344  ? 17.724  1.713   34.097  1.00 103.58 ? 344  ARG A NH1   1 
ATOM   3427  N  NH2   . ARG D 4  344  ? 19.018  3.472   34.807  1.00 132.35 ? 344  ARG A NH2   1 
ATOM   3428  N  N     . VAL D 4  345  ? 20.498  -4.069  30.892  1.00 73.30  ? 345  VAL A N     1 
ATOM   3429  C  CA    . VAL D 4  345  ? 20.620  -5.301  30.126  1.00 75.35  ? 345  VAL A CA    1 
ATOM   3430  C  C     . VAL D 4  345  ? 19.633  -5.278  28.970  1.00 74.24  ? 345  VAL A C     1 
ATOM   3431  O  O     . VAL D 4  345  ? 18.536  -4.720  29.071  1.00 62.84  ? 345  VAL A O     1 
ATOM   3432  C  CB    . VAL D 4  345  ? 20.385  -6.549  31.002  1.00 76.71  ? 345  VAL A CB    1 
ATOM   3433  C  CG1   . VAL D 4  345  ? 21.578  -6.792  31.905  1.00 80.80  ? 345  VAL A CG1   1 
ATOM   3434  C  CG2   . VAL D 4  345  ? 19.110  -6.389  31.817  1.00 61.00  ? 345  VAL A CG2   1 
ATOM   3435  N  N     . ASP D 4  346  ? 20.037  -5.894  27.863  1.00 56.47  ? 346  ASP A N     1 
ATOM   3436  C  CA    . ASP D 4  346  ? 19.112  -6.145  26.775  1.00 56.38  ? 346  ASP A CA    1 
ATOM   3437  C  C     . ASP D 4  346  ? 18.235  -7.348  27.111  1.00 56.25  ? 346  ASP A C     1 
ATOM   3438  O  O     . ASP D 4  346  ? 18.445  -8.044  28.108  1.00 56.32  ? 346  ASP A O     1 
ATOM   3439  C  CB    . ASP D 4  346  ? 19.866  -6.379  25.464  1.00 69.72  ? 346  ASP A CB    1 
ATOM   3440  C  CG    . ASP D 4  346  ? 20.754  -5.208  25.076  1.00 66.46  ? 346  ASP A CG    1 
ATOM   3441  O  OD1   . ASP D 4  346  ? 20.398  -4.053  25.392  1.00 59.90  ? 346  ASP A OD1   1 
ATOM   3442  O  OD2   . ASP D 4  346  ? 21.807  -5.443  24.445  1.00 61.54  ? 346  ASP A OD2   1 
ATOM   3443  N  N     . PHE D 4  347  ? 17.240  -7.587  26.257  1.00 80.23  ? 347  PHE A N     1 
ATOM   3444  C  CA    . PHE D 4  347  ? 16.331  -8.725  26.396  1.00 71.06  ? 347  PHE A CA    1 
ATOM   3445  C  C     . PHE D 4  347  ? 15.642  -8.705  27.761  1.00 64.31  ? 347  PHE A C     1 
ATOM   3446  O  O     . PHE D 4  347  ? 15.621  -9.696  28.494  1.00 87.12  ? 347  PHE A O     1 
ATOM   3447  C  CB    . PHE D 4  347  ? 17.069  -10.044 26.150  1.00 61.52  ? 347  PHE A CB    1 
ATOM   3448  C  CG    . PHE D 4  347  ? 17.855  -10.061 24.865  1.00 75.52  ? 347  PHE A CG    1 
ATOM   3449  C  CD1   . PHE D 4  347  ? 19.209  -9.768  24.856  1.00 99.67  ? 347  PHE A CD1   1 
ATOM   3450  C  CD2   . PHE D 4  347  ? 17.233  -10.344 23.661  1.00 78.13  ? 347  PHE A CD2   1 
ATOM   3451  C  CE1   . PHE D 4  347  ? 19.931  -9.773  23.672  1.00 87.62  ? 347  PHE A CE1   1 
ATOM   3452  C  CE2   . PHE D 4  347  ? 17.950  -10.350 22.475  1.00 82.31  ? 347  PHE A CE2   1 
ATOM   3453  C  CZ    . PHE D 4  347  ? 19.300  -10.064 22.482  1.00 81.86  ? 347  PHE A CZ    1 
ATOM   3454  N  N     . SER D 4  348  ? 15.075  -7.549  28.094  1.00 55.01  ? 348  SER A N     1 
ATOM   3455  C  CA    . SER D 4  348  ? 14.395  -7.336  29.361  1.00 55.76  ? 348  SER A CA    1 
ATOM   3456  C  C     . SER D 4  348  ? 13.045  -6.686  29.098  1.00 65.05  ? 348  SER A C     1 
ATOM   3457  O  O     . SER D 4  348  ? 12.797  -6.138  28.021  1.00 72.83  ? 348  SER A O     1 
ATOM   3458  C  CB    . SER D 4  348  ? 15.237  -6.469  30.308  1.00 63.59  ? 348  SER A CB    1 
ATOM   3459  O  OG    . SER D 4  348  ? 15.658  -5.276  29.671  1.00 65.79  ? 348  SER A OG    1 
ATOM   3460  N  N     . ALA D 4  349  ? 12.164  -6.762  30.093  1.00 68.50  ? 349  ALA A N     1 
ATOM   3461  C  CA    . ALA D 4  349  ? 10.816  -6.233  29.949  1.00 82.06  ? 349  ALA A CA    1 
ATOM   3462  C  C     . ALA D 4  349  ? 10.270  -5.851  31.316  1.00 73.13  ? 349  ALA A C     1 
ATOM   3463  O  O     . ALA D 4  349  ? 10.802  -6.252  32.353  1.00 91.16  ? 349  ALA A O     1 
ATOM   3464  C  CB    . ALA D 4  349  ? 9.888   -7.243  29.263  1.00 90.87  ? 349  ALA A CB    1 
ATOM   3465  N  N     . ARG D 4  350  ? 9.190   -5.071  31.301  1.00 52.06  ? 350  ARG A N     1 
ATOM   3466  C  CA    . ARG D 4  350  ? 8.529   -4.626  32.521  1.00 56.83  ? 350  ARG A CA    1 
ATOM   3467  C  C     . ARG D 4  350  ? 7.084   -4.271  32.195  1.00 51.38  ? 350  ARG A C     1 
ATOM   3468  O  O     . ARG D 4  350  ? 6.817   -3.642  31.168  1.00 51.33  ? 350  ARG A O     1 
ATOM   3469  C  CB    . ARG D 4  350  ? 9.253   -3.423  33.138  1.00 69.88  ? 350  ARG A CB    1 
ATOM   3470  C  CG    . ARG D 4  350  ? 8.546   -2.841  34.345  1.00 69.04  ? 350  ARG A CG    1 
ATOM   3471  C  CD    . ARG D 4  350  ? 9.139   -1.507  34.739  1.00 84.19  ? 350  ARG A CD    1 
ATOM   3472  N  NE    . ARG D 4  350  ? 8.673   -1.084  36.055  1.00 96.15  ? 350  ARG A NE    1 
ATOM   3473  C  CZ    . ARG D 4  350  ? 9.206   -1.495  37.201  1.00 78.59  ? 350  ARG A CZ    1 
ATOM   3474  N  NH1   . ARG D 4  350  ? 10.225  -2.345  37.192  1.00 71.87  ? 350  ARG A NH1   1 
ATOM   3475  N  NH2   . ARG D 4  350  ? 8.721   -1.056  38.355  1.00 78.27  ? 350  ARG A NH2   1 
ATOM   3476  N  N     . THR D 4  351  ? 6.160   -4.666  33.072  1.00 51.26  ? 351  THR A N     1 
ATOM   3477  C  CA    . THR D 4  351  ? 4.738   -4.481  32.806  1.00 57.29  ? 351  THR A CA    1 
ATOM   3478  C  C     . THR D 4  351  ? 3.940   -4.713  34.087  1.00 62.50  ? 351  THR A C     1 
ATOM   3479  O  O     . THR D 4  351  ? 4.317   -5.538  34.923  1.00 95.52  ? 351  THR A O     1 
ATOM   3480  C  CB    . THR D 4  351  ? 4.275   -5.428  31.683  1.00 82.99  ? 351  THR A CB    1 
ATOM   3481  O  OG1   . THR D 4  351  ? 4.675   -4.894  30.414  1.00 128.43 ? 351  THR A OG1   1 
ATOM   3482  C  CG2   . THR D 4  351  ? 2.768   -5.636  31.689  1.00 70.67  ? 351  THR A CG2   1 
ATOM   3483  N  N     . VAL D 4  352  ? 2.845   -3.955  34.232  1.00 50.72  ? 352  VAL A N     1 
ATOM   3484  C  CA    . VAL D 4  352  ? 1.903   -4.157  35.330  1.00 50.67  ? 352  VAL A CA    1 
ATOM   3485  C  C     . VAL D 4  352  ? 1.466   -5.617  35.380  1.00 70.38  ? 352  VAL A C     1 
ATOM   3486  O  O     . VAL D 4  352  ? 1.217   -6.244  34.345  1.00 99.13  ? 352  VAL A O     1 
ATOM   3487  C  CB    . VAL D 4  352  ? 0.695   -3.215  35.160  1.00 53.20  ? 352  VAL A CB    1 
ATOM   3488  C  CG1   . VAL D 4  352  ? -0.489  -3.668  36.008  1.00 50.56  ? 352  VAL A CG1   1 
ATOM   3489  C  CG2   . VAL D 4  352  ? 1.086   -1.786  35.500  1.00 95.09  ? 352  VAL A CG2   1 
ATOM   3490  N  N     . ILE D 4  353  ? 1.365   -6.164  36.591  1.00 51.62  ? 353  ILE A N     1 
ATOM   3491  C  CA    . ILE D 4  353  ? 1.068   -7.580  36.778  1.00 52.10  ? 353  ILE A CA    1 
ATOM   3492  C  C     . ILE D 4  353  ? -0.341  -7.754  37.329  1.00 52.22  ? 353  ILE A C     1 
ATOM   3493  O  O     . ILE D 4  353  ? -0.894  -6.870  37.995  1.00 52.38  ? 353  ILE A O     1 
ATOM   3494  C  CB    . ILE D 4  353  ? 2.094   -8.260  37.707  1.00 75.49  ? 353  ILE A CB    1 
ATOM   3495  C  CG1   . ILE D 4  353  ? 1.879   -7.819  39.156  1.00 79.67  ? 353  ILE A CG1   1 
ATOM   3496  C  CG2   . ILE D 4  353  ? 3.500   -7.926  37.256  1.00 90.52  ? 353  ILE A CG2   1 
ATOM   3497  C  CD1   . ILE D 4  353  ? 2.861   -8.421  40.133  1.00 52.32  ? 353  ILE A CD1   1 
ATOM   3498  N  N     . SER D 4  354  ? -0.922  -8.916  37.030  1.00 54.58  ? 354  SER A N     1 
ATOM   3499  C  CA    . SER D 4  354  ? -2.179  -9.372  37.607  1.00 54.88  ? 354  SER A CA    1 
ATOM   3500  C  C     . SER D 4  354  ? -2.168  -10.895 37.592  1.00 56.25  ? 354  SER A C     1 
ATOM   3501  O  O     . SER D 4  354  ? -1.376  -11.516 36.880  1.00 76.19  ? 354  SER A O     1 
ATOM   3502  C  CB    . SER D 4  354  ? -3.394  -8.804  36.859  1.00 64.40  ? 354  SER A CB    1 
ATOM   3503  O  OG    . SER D 4  354  ? -3.154  -8.697  35.464  1.00 88.76  ? 354  SER A OG    1 
ATOM   3504  N  N     . GLY D 4  355  ? -3.044  -11.495 38.388  1.00 55.79  ? 355  GLY A N     1 
ATOM   3505  C  CA    . GLY D 4  355  ? -2.998  -12.927 38.660  1.00 56.49  ? 355  GLY A CA    1 
ATOM   3506  C  C     . GLY D 4  355  ? -4.135  -13.675 37.987  1.00 57.60  ? 355  GLY A C     1 
ATOM   3507  O  O     . GLY D 4  355  ? -5.257  -13.172 37.903  1.00 87.07  ? 355  GLY A O     1 
ATOM   3508  N  N     . ASP D 4  356  ? -3.834  -14.888 37.530  1.00 61.30  ? 356  ASP A N     1 
ATOM   3509  C  CA    . ASP D 4  356  ? -4.782  -15.722 36.801  1.00 75.80  ? 356  ASP A CA    1 
ATOM   3510  C  C     . ASP D 4  356  ? -5.048  -17.016 37.554  1.00 67.14  ? 356  ASP A C     1 
ATOM   3511  O  O     . ASP D 4  356  ? -4.126  -17.835 37.714  1.00 88.41  ? 356  ASP A O     1 
ATOM   3512  C  CB    . ASP D 4  356  ? -4.258  -16.027 35.399  1.00 78.81  ? 356  ASP A CB    1 
ATOM   3513  C  CG    . ASP D 4  356  ? -5.332  -15.921 34.347  1.00 70.37  ? 356  ASP A CG    1 
ATOM   3514  O  OD1   . ASP D 4  356  ? -5.199  -15.062 33.454  1.00 79.64  ? 356  ASP A OD1   1 
ATOM   3515  O  OD2   . ASP D 4  356  ? -6.304  -16.706 34.407  1.00 71.71  ? 356  ASP A OD2   1 
ATOM   3516  N  N     . PRO D 4  357  ? -6.278  -17.257 38.015  1.00 57.56  ? 357  PRO A N     1 
ATOM   3517  C  CA    . PRO D 4  357  ? -6.580  -18.539 38.671  1.00 66.50  ? 357  PRO A CA    1 
ATOM   3518  C  C     . PRO D 4  357  ? -6.569  -19.728 37.724  1.00 59.31  ? 357  PRO A C     1 
ATOM   3519  O  O     . PRO D 4  357  ? -6.399  -20.864 38.184  1.00 60.05  ? 357  PRO A O     1 
ATOM   3520  C  CB    . PRO D 4  357  ? -7.980  -18.309 39.249  1.00 59.62  ? 357  PRO A CB    1 
ATOM   3521  C  CG    . PRO D 4  357  ? -8.579  -17.291 38.336  1.00 58.26  ? 357  PRO A CG    1 
ATOM   3522  C  CD    . PRO D 4  357  ? -7.448  -16.366 37.980  1.00 57.34  ? 357  PRO A CD    1 
ATOM   3523  N  N     . ASN D 4  358  ? -6.755  -19.505 36.425  1.00 65.67  ? 358  ASN A N     1 
ATOM   3524  C  CA    . ASN D 4  358  ? -6.722  -20.564 35.418  1.00 70.84  ? 358  ASN A CA    1 
ATOM   3525  C  C     . ASN D 4  358  ? -5.362  -20.657 34.747  1.00 59.86  ? 358  ASN A C     1 
ATOM   3526  O  O     . ASN D 4  358  ? -5.254  -20.957 33.554  1.00 60.89  ? 358  ASN A O     1 
ATOM   3527  C  CB    . ASN D 4  358  ? -7.825  -20.348 34.388  1.00 60.39  ? 358  ASN A CB    1 
ATOM   3528  C  CG    . ASN D 4  358  ? -9.208  -20.452 34.993  1.00 69.35  ? 358  ASN A CG    1 
ATOM   3529  O  OD1   . ASN D 4  358  ? -10.020 -19.533 34.879  1.00 111.76 ? 358  ASN A OD1   1 
ATOM   3530  N  ND2   . ASN D 4  358  ? -9.490  -21.583 35.633  1.00 61.76  ? 358  ASN A ND2   1 
ATOM   3531  N  N     . LEU D 4  359  ? -4.306  -20.391 35.509  1.00 59.34  ? 359  LEU A N     1 
ATOM   3532  C  CA    . LEU D 4  359  ? -2.939  -20.444 35.025  1.00 59.97  ? 359  LEU A CA    1 
ATOM   3533  C  C     . LEU D 4  359  ? -2.110  -21.296 35.979  1.00 86.71  ? 359  LEU A C     1 
ATOM   3534  O  O     . LEU D 4  359  ? -2.360  -21.322 37.187  1.00 90.67  ? 359  LEU A O     1 
ATOM   3535  C  CB    . LEU D 4  359  ? -2.380  -19.023 34.904  1.00 58.07  ? 359  LEU A CB    1 
ATOM   3536  C  CG    . LEU D 4  359  ? -1.350  -18.702 33.828  1.00 57.81  ? 359  LEU A CG    1 
ATOM   3537  C  CD1   . LEU D 4  359  ? -1.269  -17.204 33.620  1.00 56.87  ? 359  LEU A CD1   1 
ATOM   3538  C  CD2   . LEU D 4  359  ? -0.013  -19.225 34.258  1.00 70.83  ? 359  LEU A CD2   1 
ATOM   3539  N  N     . GLU D 4  360  ? -1.132  -22.012 35.425  1.00 110.27 ? 360  GLU A N     1 
ATOM   3540  C  CA    . GLU D 4  360  ? -0.291  -22.884 36.234  1.00 110.13 ? 360  GLU A CA    1 
ATOM   3541  C  C     . GLU D 4  360  ? 0.708   -22.060 37.051  1.00 85.29  ? 360  GLU A C     1 
ATOM   3542  O  O     . GLU D 4  360  ? 0.928   -20.873 36.802  1.00 82.07  ? 360  GLU A O     1 
ATOM   3543  C  CB    . GLU D 4  360  ? 0.441   -23.897 35.353  1.00 113.95 ? 360  GLU A CB    1 
ATOM   3544  C  CG    . GLU D 4  360  ? -0.463  -24.935 34.704  1.00 92.41  ? 360  GLU A CG    1 
ATOM   3545  C  CD    . GLU D 4  360  ? -1.142  -25.828 35.725  1.00 106.53 ? 360  GLU A CD    1 
ATOM   3546  O  OE1   . GLU D 4  360  ? -0.539  -26.086 36.791  1.00 121.46 ? 360  GLU A OE1   1 
ATOM   3547  O  OE2   . GLU D 4  360  ? -2.280  -26.268 35.464  1.00 112.73 ? 360  GLU A OE2   1 
ATOM   3548  N  N     . LEU D 4  361  ? 1.329   -22.718 38.035  1.00 70.08  ? 361  LEU A N     1 
ATOM   3549  C  CA    . LEU D 4  361  ? 2.192   -22.011 38.980  1.00 62.55  ? 361  LEU A CA    1 
ATOM   3550  C  C     . LEU D 4  361  ? 3.478   -21.528 38.322  1.00 61.46  ? 361  LEU A C     1 
ATOM   3551  O  O     . LEU D 4  361  ? 3.853   -20.357 38.455  1.00 83.29  ? 361  LEU A O     1 
ATOM   3552  C  CB    . LEU D 4  361  ? 2.510   -22.909 40.178  1.00 81.42  ? 361  LEU A CB    1 
ATOM   3553  C  CG    . LEU D 4  361  ? 3.250   -22.276 41.361  1.00 71.32  ? 361  LEU A CG    1 
ATOM   3554  C  CD1   . LEU D 4  361  ? 2.297   -21.924 42.489  1.00 66.64  ? 361  LEU A CD1   1 
ATOM   3555  C  CD2   . LEU D 4  361  ? 4.320   -23.221 41.870  1.00 60.27  ? 361  LEU A CD2   1 
ATOM   3556  N  N     . ASP D 4  362  ? 4.168   -22.417 37.607  1.00 64.79  ? 362  ASP A N     1 
ATOM   3557  C  CA    . ASP D 4  362  ? 5.479   -22.102 37.056  1.00 67.94  ? 362  ASP A CA    1 
ATOM   3558  C  C     . ASP D 4  362  ? 5.416   -21.255 35.791  1.00 75.44  ? 362  ASP A C     1 
ATOM   3559  O  O     . ASP D 4  362  ? 6.467   -20.823 35.309  1.00 68.08  ? 362  ASP A O     1 
ATOM   3560  C  CB    . ASP D 4  362  ? 6.252   -23.394 36.767  1.00 65.57  ? 362  ASP A CB    1 
ATOM   3561  C  CG    . ASP D 4  362  ? 5.375   -24.478 36.169  1.00 87.15  ? 362  ASP A CG    1 
ATOM   3562  O  OD1   . ASP D 4  362  ? 5.875   -25.244 35.319  1.00 92.71  ? 362  ASP A OD1   1 
ATOM   3563  O  OD2   . ASP D 4  362  ? 4.183   -24.558 36.539  1.00 92.87  ? 362  ASP A OD2   1 
ATOM   3564  N  N     . GLN D 4  363  ? 4.230   -21.002 35.245  1.00 71.99  ? 363  GLN A N     1 
ATOM   3565  C  CA    . GLN D 4  363  ? 4.152   -20.234 34.012  1.00 89.76  ? 363  GLN A CA    1 
ATOM   3566  C  C     . GLN D 4  363  ? 4.170   -18.733 34.302  1.00 99.35  ? 363  GLN A C     1 
ATOM   3567  O  O     . GLN D 4  363  ? 4.028   -18.284 35.444  1.00 98.77  ? 363  GLN A O     1 
ATOM   3568  C  CB    . GLN D 4  363  ? 2.897   -20.593 33.223  1.00 86.09  ? 363  GLN A CB    1 
ATOM   3569  C  CG    . GLN D 4  363  ? 2.642   -22.070 33.051  1.00 94.03  ? 363  GLN A CG    1 
ATOM   3570  C  CD    . GLN D 4  363  ? 1.428   -22.337 32.183  1.00 98.11  ? 363  GLN A CD    1 
ATOM   3571  O  OE1   . GLN D 4  363  ? 0.297   -22.038 32.571  1.00 95.32  ? 363  GLN A OE1   1 
ATOM   3572  N  NE2   . GLN D 4  363  ? 1.655   -22.892 30.997  1.00 111.86 ? 363  GLN A NE2   1 
ATOM   3573  N  N     . VAL D 4  364  ? 4.352   -17.953 33.238  1.00 86.40  ? 364  VAL A N     1 
ATOM   3574  C  CA    . VAL D 4  364  ? 4.309   -16.497 33.294  1.00 56.63  ? 364  VAL A CA    1 
ATOM   3575  C  C     . VAL D 4  364  ? 3.477   -16.001 32.117  1.00 64.58  ? 364  VAL A C     1 
ATOM   3576  O  O     . VAL D 4  364  ? 3.676   -16.442 30.978  1.00 62.64  ? 364  VAL A O     1 
ATOM   3577  C  CB    . VAL D 4  364  ? 5.722   -15.875 33.269  1.00 56.32  ? 364  VAL A CB    1 
ATOM   3578  C  CG1   . VAL D 4  364  ? 6.545   -16.431 32.112  1.00 56.85  ? 364  VAL A CG1   1 
ATOM   3579  C  CG2   . VAL D 4  364  ? 5.649   -14.356 33.198  1.00 55.51  ? 364  VAL A CG2   1 
ATOM   3580  N  N     . GLY D 4  365  ? 2.541   -15.097 32.390  1.00 85.33  ? 365  GLY A N     1 
ATOM   3581  C  CA    . GLY D 4  365  ? 1.741   -14.513 31.330  1.00 79.86  ? 365  GLY A CA    1 
ATOM   3582  C  C     . GLY D 4  365  ? 2.459   -13.380 30.628  1.00 65.08  ? 365  GLY A C     1 
ATOM   3583  O  O     . GLY D 4  365  ? 2.588   -12.281 31.174  1.00 86.81  ? 365  GLY A O     1 
ATOM   3584  N  N     . VAL D 4  366  ? 2.929   -13.634 29.417  1.00 55.21  ? 366  VAL A N     1 
ATOM   3585  C  CA    . VAL D 4  366  ? 3.737   -12.682 28.662  1.00 57.73  ? 366  VAL A CA    1 
ATOM   3586  C  C     . VAL D 4  366  ? 2.870   -12.107 27.547  1.00 70.86  ? 366  VAL A C     1 
ATOM   3587  O  O     . VAL D 4  366  ? 2.330   -12.870 26.734  1.00 55.42  ? 366  VAL A O     1 
ATOM   3588  C  CB    . VAL D 4  366  ? 5.002   -13.345 28.093  1.00 58.03  ? 366  VAL A CB    1 
ATOM   3589  C  CG1   . VAL D 4  366  ? 5.968   -12.293 27.574  1.00 55.04  ? 366  VAL A CG1   1 
ATOM   3590  C  CG2   . VAL D 4  366  ? 5.661   -14.228 29.148  1.00 55.64  ? 366  VAL A CG2   1 
ATOM   3591  N  N     . PRO D 4  367  ? 2.696   -10.789 27.473  1.00 91.10  ? 367  PRO A N     1 
ATOM   3592  C  CA    . PRO D 4  367  ? 1.900   -10.205 26.388  1.00 97.01  ? 367  PRO A CA    1 
ATOM   3593  C  C     . PRO D 4  367  ? 2.545   -10.441 25.031  1.00 96.32  ? 367  PRO A C     1 
ATOM   3594  O  O     . PRO D 4  367  ? 3.747   -10.688 24.913  1.00 97.86  ? 367  PRO A O     1 
ATOM   3595  C  CB    . PRO D 4  367  ? 1.866   -8.712  26.731  1.00 99.61  ? 367  PRO A CB    1 
ATOM   3596  C  CG    . PRO D 4  367  ? 2.167   -8.650  28.196  1.00 88.59  ? 367  PRO A CG    1 
ATOM   3597  C  CD    . PRO D 4  367  ? 3.109   -9.781  28.462  1.00 84.33  ? 367  PRO A CD    1 
ATOM   3598  N  N     . LYS D 4  368  ? 1.712   -10.356 23.990  1.00 98.32  ? 368  LYS A N     1 
ATOM   3599  C  CA    . LYS D 4  368  ? 2.195   -10.614 22.637  1.00 86.44  ? 368  LYS A CA    1 
ATOM   3600  C  C     . LYS D 4  368  ? 3.240   -9.587  22.217  1.00 87.07  ? 368  LYS A C     1 
ATOM   3601  O  O     . LYS D 4  368  ? 4.270   -9.946  21.635  1.00 112.41 ? 368  LYS A O     1 
ATOM   3602  C  CB    . LYS D 4  368  ? 1.027   -10.629 21.650  1.00 91.56  ? 368  LYS A CB    1 
ATOM   3603  C  CG    . LYS D 4  368  ? -0.035  -11.675 21.957  1.00 96.75  ? 368  LYS A CG    1 
ATOM   3604  C  CD    . LYS D 4  368  ? -1.040  -11.807 20.815  1.00 117.63 ? 368  LYS A CD    1 
ATOM   3605  C  CE    . LYS D 4  368  ? -1.975  -10.606 20.738  1.00 114.68 ? 368  LYS A CE    1 
ATOM   3606  N  NZ    . LYS D 4  368  ? -3.134  -10.853 19.831  1.00 94.30  ? 368  LYS A NZ    1 
ATOM   3607  N  N     . SER D 4  369  ? 2.996   -8.304  22.505  1.00 57.01  ? 369  SER A N     1 
ATOM   3608  C  CA    . SER D 4  369  ? 3.959   -7.273  22.129  1.00 58.47  ? 369  SER A CA    1 
ATOM   3609  C  C     . SER D 4  369  ? 5.292   -7.470  22.838  1.00 77.27  ? 369  SER A C     1 
ATOM   3610  O  O     . SER D 4  369  ? 6.345   -7.145  22.279  1.00 64.26  ? 369  SER A O     1 
ATOM   3611  C  CB    . SER D 4  369  ? 3.402   -5.878  22.423  1.00 53.74  ? 369  SER A CB    1 
ATOM   3612  O  OG    . SER D 4  369  ? 2.966   -5.756  23.764  1.00 53.28  ? 369  SER A OG    1 
ATOM   3613  N  N     . ILE D 4  370  ? 5.267   -7.994  24.066  1.00 94.57  ? 370  ILE A N     1 
ATOM   3614  C  CA    . ILE D 4  370  ? 6.507   -8.380  24.730  1.00 85.07  ? 370  ILE A CA    1 
ATOM   3615  C  C     . ILE D 4  370  ? 7.117   -9.589  24.034  1.00 82.20  ? 370  ILE A C     1 
ATOM   3616  O  O     . ILE D 4  370  ? 8.325   -9.631  23.773  1.00 75.02  ? 370  ILE A O     1 
ATOM   3617  C  CB    . ILE D 4  370  ? 6.257   -8.652  26.226  1.00 91.31  ? 370  ILE A CB    1 
ATOM   3618  C  CG1   . ILE D 4  370  ? 5.642   -7.427  26.905  1.00 89.41  ? 370  ILE A CG1   1 
ATOM   3619  C  CG2   . ILE D 4  370  ? 7.555   -9.028  26.925  1.00 105.78 ? 370  ILE A CG2   1 
ATOM   3620  C  CD1   . ILE D 4  370  ? 6.586   -6.253  27.030  1.00 89.08  ? 370  ILE A CD1   1 
ATOM   3621  N  N     . ALA D 4  371  ? 6.289   -10.588 23.714  1.00 88.41  ? 371  ALA A N     1 
ATOM   3622  C  CA    . ALA D 4  371  ? 6.773   -11.743 22.967  1.00 94.25  ? 371  ALA A CA    1 
ATOM   3623  C  C     . ALA D 4  371  ? 7.217   -11.358 21.563  1.00 91.65  ? 371  ALA A C     1 
ATOM   3624  O  O     . ALA D 4  371  ? 8.119   -11.993 21.004  1.00 87.82  ? 371  ALA A O     1 
ATOM   3625  C  CB    . ALA D 4  371  ? 5.692   -12.823 22.907  1.00 101.30 ? 371  ALA A CB    1 
ATOM   3626  N  N     . LYS D 4  372  ? 6.596   -10.329 20.977  1.00 81.47  ? 372  LYS A N     1 
ATOM   3627  C  CA    . LYS D 4  372  ? 7.038   -9.845  19.673  1.00 89.72  ? 372  LYS A CA    1 
ATOM   3628  C  C     . LYS D 4  372  ? 8.396   -9.158  19.760  1.00 72.17  ? 372  LYS A C     1 
ATOM   3629  O  O     . LYS D 4  372  ? 9.188   -9.235  18.814  1.00 86.22  ? 372  LYS A O     1 
ATOM   3630  C  CB    . LYS D 4  372  ? 6.004   -8.883  19.081  1.00 110.08 ? 372  LYS A CB    1 
ATOM   3631  C  CG    . LYS D 4  372  ? 4.752   -9.540  18.514  1.00 102.90 ? 372  LYS A CG    1 
ATOM   3632  C  CD    . LYS D 4  372  ? 3.742   -8.489  18.078  1.00 91.64  ? 372  LYS A CD    1 
ATOM   3633  C  CE    . LYS D 4  372  ? 2.444   -9.128  17.629  1.00 72.11  ? 372  LYS A CE    1 
ATOM   3634  N  NZ    . LYS D 4  372  ? 1.321   -8.156  17.693  1.00 65.90  ? 372  LYS A NZ    1 
ATOM   3635  N  N     . THR D 4  373  ? 8.682   -8.486  20.875  1.00 55.73  ? 373  THR A N     1 
ATOM   3636  C  CA    . THR D 4  373  ? 9.908   -7.707  21.014  1.00 65.91  ? 373  THR A CA    1 
ATOM   3637  C  C     . THR D 4  373  ? 11.094  -8.552  21.466  1.00 73.38  ? 373  THR A C     1 
ATOM   3638  O  O     . THR D 4  373  ? 12.213  -8.356  20.978  1.00 86.10  ? 373  THR A O     1 
ATOM   3639  C  CB    . THR D 4  373  ? 9.692   -6.555  22.003  1.00 67.09  ? 373  THR A CB    1 
ATOM   3640  O  OG1   . THR D 4  373  ? 8.352   -6.057  21.889  1.00 61.73  ? 373  THR A OG1   1 
ATOM   3641  C  CG2   . THR D 4  373  ? 10.675  -5.418  21.725  1.00 69.78  ? 373  THR A CG2   1 
ATOM   3642  N  N     . LEU D 4  374  ? 10.871  -9.491  22.382  1.00 75.33  ? 374  LEU A N     1 
ATOM   3643  C  CA    . LEU D 4  374  ? 11.946  -10.335 22.881  1.00 64.87  ? 374  LEU A CA    1 
ATOM   3644  C  C     . LEU D 4  374  ? 12.238  -11.475 21.911  1.00 70.39  ? 374  LEU A C     1 
ATOM   3645  O  O     . LEU D 4  374  ? 11.340  -12.008 21.252  1.00 70.53  ? 374  LEU A O     1 
ATOM   3646  C  CB    . LEU D 4  374  ? 11.588  -10.898 24.256  1.00 62.59  ? 374  LEU A CB    1 
ATOM   3647  C  CG    . LEU D 4  374  ? 11.420  -9.837  25.347  1.00 79.27  ? 374  LEU A CG    1 
ATOM   3648  C  CD1   . LEU D 4  374  ? 10.974  -10.462 26.662  1.00 83.15  ? 374  LEU A CD1   1 
ATOM   3649  C  CD2   . LEU D 4  374  ? 12.704  -9.028  25.544  1.00 74.85  ? 374  LEU A CD2   1 
ATOM   3650  N  N     . THR D 4  375  ? 13.509  -11.859 21.839  1.00 68.10  ? 375  THR A N     1 
ATOM   3651  C  CA    . THR D 4  375  ? 13.949  -12.868 20.892  1.00 75.70  ? 375  THR A CA    1 
ATOM   3652  C  C     . THR D 4  375  ? 15.013  -13.751 21.532  1.00 78.37  ? 375  THR A C     1 
ATOM   3653  O  O     . THR D 4  375  ? 15.734  -13.322 22.438  1.00 90.99  ? 375  THR A O     1 
ATOM   3654  C  CB    . THR D 4  375  ? 14.497  -12.230 19.609  1.00 79.97  ? 375  THR A CB    1 
ATOM   3655  O  OG1   . THR D 4  375  ? 14.902  -13.259 18.702  1.00 106.08 ? 375  THR A OG1   1 
ATOM   3656  C  CG2   . THR D 4  375  ? 15.682  -11.335 19.924  1.00 76.21  ? 375  THR A CG2   1 
ATOM   3657  N  N     . TYR D 4  376  ? 15.093  -14.995 21.061  1.00 63.90  ? 376  TYR A N     1 
ATOM   3658  C  CA    . TYR D 4  376  ? 16.099  -15.945 21.526  1.00 63.67  ? 376  TYR A CA    1 
ATOM   3659  C  C     . TYR D 4  376  ? 16.861  -16.502 20.332  1.00 65.70  ? 376  TYR A C     1 
ATOM   3660  O  O     . TYR D 4  376  ? 16.236  -17.068 19.412  1.00 67.40  ? 376  TYR A O     1 
ATOM   3661  C  CB    . TYR D 4  376  ? 15.472  -17.088 22.327  1.00 79.46  ? 376  TYR A CB    1 
ATOM   3662  C  CG    . TYR D 4  376  ? 16.422  -18.253 22.513  1.00 83.02  ? 376  TYR A CG    1 
ATOM   3663  C  CD1   . TYR D 4  376  ? 17.639  -18.084 23.164  1.00 82.42  ? 376  TYR A CD1   1 
ATOM   3664  C  CD2   . TYR D 4  376  ? 16.108  -19.517 22.033  1.00 80.74  ? 376  TYR A CD2   1 
ATOM   3665  C  CE1   . TYR D 4  376  ? 18.515  -19.139 23.330  1.00 85.83  ? 376  TYR A CE1   1 
ATOM   3666  C  CE2   . TYR D 4  376  ? 16.978  -20.579 22.198  1.00 97.43  ? 376  TYR A CE2   1 
ATOM   3667  C  CZ    . TYR D 4  376  ? 18.180  -20.384 22.845  1.00 98.77  ? 376  TYR A CZ    1 
ATOM   3668  O  OH    . TYR D 4  376  ? 19.048  -21.440 23.011  1.00 89.12  ? 376  TYR A OH    1 
ATOM   3669  N  N     . PRO D 4  377  ? 18.190  -16.391 20.304  1.00 79.93  ? 377  PRO A N     1 
ATOM   3670  C  CA    . PRO D 4  377  ? 18.963  -17.050 19.240  1.00 87.27  ? 377  PRO A CA    1 
ATOM   3671  C  C     . PRO D 4  377  ? 18.869  -18.568 19.289  1.00 85.69  ? 377  PRO A C     1 
ATOM   3672  O  O     . PRO D 4  377  ? 19.361  -19.188 20.235  1.00 87.23  ? 377  PRO A O     1 
ATOM   3673  C  CB    . PRO D 4  377  ? 20.397  -16.583 19.505  1.00 88.40  ? 377  PRO A CB    1 
ATOM   3674  C  CG    . PRO D 4  377  ? 20.245  -15.312 20.265  1.00 104.14 ? 377  PRO A CG    1 
ATOM   3675  C  CD    . PRO D 4  377  ? 19.031  -15.504 21.123  1.00 101.92 ? 377  PRO A CD    1 
ATOM   3676  N  N     . GLU D 4  378  ? 18.251  -19.167 18.270  1.00 88.07  ? 378  GLU A N     1 
ATOM   3677  C  CA    . GLU D 4  378  ? 18.151  -20.618 18.144  1.00 78.23  ? 378  GLU A CA    1 
ATOM   3678  C  C     . GLU D 4  378  ? 18.854  -21.039 16.858  1.00 83.28  ? 378  GLU A C     1 
ATOM   3679  O  O     . GLU D 4  378  ? 18.402  -20.703 15.757  1.00 81.45  ? 378  GLU A O     1 
ATOM   3680  C  CB    . GLU D 4  378  ? 16.691  -21.077 18.141  1.00 65.29  ? 378  GLU A CB    1 
ATOM   3681  C  CG    . GLU D 4  378  ? 16.497  -22.513 17.673  1.00 72.26  ? 378  GLU A CG    1 
ATOM   3682  C  CD    . GLU D 4  378  ? 15.144  -23.075 18.063  1.00 92.51  ? 378  GLU A CD    1 
ATOM   3683  O  OE1   . GLU D 4  378  ? 14.551  -22.573 19.041  1.00 100.46 ? 378  GLU A OE1   1 
ATOM   3684  O  OE2   . GLU D 4  378  ? 14.674  -24.018 17.389  1.00 104.22 ? 378  GLU A OE2   1 
ATOM   3685  N  N     . VAL D 4  379  ? 19.962  -21.769 16.997  1.00 89.77  ? 379  VAL A N     1 
ATOM   3686  C  CA    . VAL D 4  379  ? 20.697  -22.231 15.828  1.00 97.42  ? 379  VAL A CA    1 
ATOM   3687  C  C     . VAL D 4  379  ? 19.898  -23.321 15.130  1.00 114.80 ? 379  VAL A C     1 
ATOM   3688  O  O     . VAL D 4  379  ? 19.294  -24.189 15.775  1.00 102.05 ? 379  VAL A O     1 
ATOM   3689  C  CB    . VAL D 4  379  ? 22.097  -22.727 16.231  1.00 89.71  ? 379  VAL A CB    1 
ATOM   3690  C  CG1   . VAL D 4  379  ? 22.893  -23.155 15.003  1.00 92.73  ? 379  VAL A CG1   1 
ATOM   3691  C  CG2   . VAL D 4  379  ? 22.837  -21.639 16.992  1.00 93.07  ? 379  VAL A CG2   1 
ATOM   3692  N  N     . VAL D 4  380  ? 19.882  -23.272 13.795  1.00 138.46 ? 380  VAL A N     1 
ATOM   3693  C  CA    . VAL D 4  380  ? 19.089  -24.218 13.021  1.00 138.67 ? 380  VAL A CA    1 
ATOM   3694  C  C     . VAL D 4  380  ? 19.623  -25.637 13.198  1.00 140.65 ? 380  VAL A C     1 
ATOM   3695  O  O     . VAL D 4  380  ? 20.789  -25.861 13.546  1.00 149.03 ? 380  VAL A O     1 
ATOM   3696  C  CB    . VAL D 4  380  ? 19.076  -23.828 11.536  1.00 128.58 ? 380  VAL A CB    1 
ATOM   3697  C  CG1   . VAL D 4  380  ? 18.636  -22.385 11.367  1.00 133.61 ? 380  VAL A CG1   1 
ATOM   3698  C  CG2   . VAL D 4  380  ? 20.454  -24.038 10.942  1.00 122.87 ? 380  VAL A CG2   1 
ATOM   3699  N  N     . THR D 4  381  ? 18.750  -26.605 12.941  1.00 123.70 ? 381  THR A N     1 
ATOM   3700  C  CA    . THR D 4  381  ? 19.087  -28.017 13.031  1.00 106.18 ? 381  THR A CA    1 
ATOM   3701  C  C     . THR D 4  381  ? 18.052  -28.794 12.230  1.00 106.26 ? 381  THR A C     1 
ATOM   3702  O  O     . THR D 4  381  ? 16.955  -28.281 11.977  1.00 107.46 ? 381  THR A O     1 
ATOM   3703  C  CB    . THR D 4  381  ? 19.124  -28.489 14.497  1.00 115.80 ? 381  THR A CB    1 
ATOM   3704  O  OG1   . THR D 4  381  ? 20.009  -29.608 14.623  1.00 142.35 ? 381  THR A OG1   1 
ATOM   3705  C  CG2   . THR D 4  381  ? 17.751  -28.907 14.961  1.00 108.41 ? 381  THR A CG2   1 
ATOM   3706  N  N     . PRO D 4  382  ? 18.377  -30.015 11.794  1.00 95.97  ? 382  PRO A N     1 
ATOM   3707  C  CA    . PRO D 4  382  ? 17.411  -30.773 10.981  1.00 102.92 ? 382  PRO A CA    1 
ATOM   3708  C  C     . PRO D 4  382  ? 16.050  -30.964 11.630  1.00 98.26  ? 382  PRO A C     1 
ATOM   3709  O  O     . PRO D 4  382  ? 15.044  -31.036 10.911  1.00 95.60  ? 382  PRO A O     1 
ATOM   3710  C  CB    . PRO D 4  382  ? 18.125  -32.114 10.758  1.00 127.72 ? 382  PRO A CB    1 
ATOM   3711  C  CG    . PRO D 4  382  ? 19.567  -31.776 10.824  1.00 120.28 ? 382  PRO A CG    1 
ATOM   3712  C  CD    . PRO D 4  382  ? 19.696  -30.677 11.835  1.00 98.89  ? 382  PRO A CD    1 
ATOM   3713  N  N     . TYR D 4  383  ? 15.969  -31.042 12.957  1.00 105.21 ? 383  TYR A N     1 
ATOM   3714  C  CA    . TYR D 4  383  ? 14.681  -31.293 13.590  1.00 126.12 ? 383  TYR A CA    1 
ATOM   3715  C  C     . TYR D 4  383  ? 13.928  -30.022 13.983  1.00 137.74 ? 383  TYR A C     1 
ATOM   3716  O  O     . TYR D 4  383  ? 12.755  -30.118 14.361  1.00 150.21 ? 383  TYR A O     1 
ATOM   3717  C  CB    . TYR D 4  383  ? 14.839  -32.208 14.818  1.00 131.72 ? 383  TYR A CB    1 
ATOM   3718  C  CG    . TYR D 4  383  ? 16.121  -32.057 15.613  1.00 141.47 ? 383  TYR A CG    1 
ATOM   3719  C  CD1   . TYR D 4  383  ? 16.146  -31.326 16.793  1.00 149.73 ? 383  TYR A CD1   1 
ATOM   3720  C  CD2   . TYR D 4  383  ? 17.299  -32.671 15.198  1.00 133.97 ? 383  TYR A CD2   1 
ATOM   3721  C  CE1   . TYR D 4  383  ? 17.311  -31.193 17.527  1.00 150.59 ? 383  TYR A CE1   1 
ATOM   3722  C  CE2   . TYR D 4  383  ? 18.467  -32.540 15.923  1.00 134.45 ? 383  TYR A CE2   1 
ATOM   3723  C  CZ    . TYR D 4  383  ? 18.469  -31.801 17.086  1.00 145.40 ? 383  TYR A CZ    1 
ATOM   3724  O  OH    . TYR D 4  383  ? 19.631  -31.672 17.810  1.00 149.45 ? 383  TYR A OH    1 
ATOM   3725  N  N     . ASN D 4  384  ? 14.549  -28.842 13.897  1.00 128.99 ? 384  ASN A N     1 
ATOM   3726  C  CA    . ASN D 4  384  ? 13.833  -27.595 14.144  1.00 125.01 ? 384  ASN A CA    1 
ATOM   3727  C  C     . ASN D 4  384  ? 13.579  -26.771 12.887  1.00 120.48 ? 384  ASN A C     1 
ATOM   3728  O  O     . ASN D 4  384  ? 12.776  -25.832 12.938  1.00 112.13 ? 384  ASN A O     1 
ATOM   3729  C  CB    . ASN D 4  384  ? 14.583  -26.724 15.173  1.00 111.67 ? 384  ASN A CB    1 
ATOM   3730  C  CG    . ASN D 4  384  ? 15.937  -26.212 14.673  1.00 114.37 ? 384  ASN A CG    1 
ATOM   3731  O  OD1   . ASN D 4  384  ? 16.177  -26.064 13.473  1.00 95.46  ? 384  ASN A OD1   1 
ATOM   3732  N  ND2   . ASN D 4  384  ? 16.827  -25.922 15.615  1.00 135.64 ? 384  ASN A ND2   1 
ATOM   3733  N  N     . ILE D 4  385  ? 14.231  -27.095 11.767  1.00 113.49 ? 385  ILE A N     1 
ATOM   3734  C  CA    . ILE D 4  385  ? 14.246  -26.183 10.626  1.00 97.03  ? 385  ILE A CA    1 
ATOM   3735  C  C     . ILE D 4  385  ? 12.861  -26.043 10.003  1.00 94.69  ? 385  ILE A C     1 
ATOM   3736  O  O     . ILE D 4  385  ? 12.508  -24.966 9.504   1.00 87.77  ? 385  ILE A O     1 
ATOM   3737  C  CB    . ILE D 4  385  ? 15.294  -26.642 9.593   1.00 75.24  ? 385  ILE A CB    1 
ATOM   3738  C  CG1   . ILE D 4  385  ? 15.425  -25.609 8.471   1.00 73.33  ? 385  ILE A CG1   1 
ATOM   3739  C  CG2   . ILE D 4  385  ? 14.951  -28.021 9.041   1.00 74.85  ? 385  ILE A CG2   1 
ATOM   3740  C  CD1   . ILE D 4  385  ? 16.414  -25.992 7.399   1.00 74.60  ? 385  ILE A CD1   1 
ATOM   3741  N  N     . ASP D 4  386  ? 12.052  -27.107 10.023  1.00 118.69 ? 386  ASP A N     1 
ATOM   3742  C  CA    . ASP D 4  386  ? 10.703  -27.013 9.473   1.00 127.79 ? 386  ASP A CA    1 
ATOM   3743  C  C     . ASP D 4  386  ? 9.858   -26.014 10.252  1.00 112.61 ? 386  ASP A C     1 
ATOM   3744  O  O     . ASP D 4  386  ? 8.944   -25.399 9.691   1.00 109.66 ? 386  ASP A O     1 
ATOM   3745  C  CB    . ASP D 4  386  ? 10.035  -28.390 9.465   1.00 142.74 ? 386  ASP A CB    1 
ATOM   3746  C  CG    . ASP D 4  386  ? 10.608  -29.312 8.400   1.00 140.63 ? 386  ASP A CG    1 
ATOM   3747  O  OD1   . ASP D 4  386  ? 11.127  -28.800 7.387   1.00 141.61 ? 386  ASP A OD1   1 
ATOM   3748  O  OD2   . ASP D 4  386  ? 10.528  -30.548 8.569   1.00 146.63 ? 386  ASP A OD2   1 
ATOM   3749  N  N     . ARG D 4  387  ? 10.148  -25.840 11.541  1.00 89.17  ? 387  ARG A N     1 
ATOM   3750  C  CA    . ARG D 4  387  ? 9.491   -24.806 12.330  1.00 84.22  ? 387  ARG A CA    1 
ATOM   3751  C  C     . ARG D 4  387  ? 10.083  -23.427 12.054  1.00 97.81  ? 387  ARG A C     1 
ATOM   3752  O  O     . ARG D 4  387  ? 9.354   -22.430 12.039  1.00 101.96 ? 387  ARG A O     1 
ATOM   3753  C  CB    . ARG D 4  387  ? 9.599   -25.146 13.815  1.00 96.36  ? 387  ARG A CB    1 
ATOM   3754  C  CG    . ARG D 4  387  ? 8.821   -24.228 14.737  1.00 111.35 ? 387  ARG A CG    1 
ATOM   3755  C  CD    . ARG D 4  387  ? 8.877   -24.749 16.161  1.00 123.60 ? 387  ARG A CD    1 
ATOM   3756  N  NE    . ARG D 4  387  ? 10.251  -25.031 16.569  1.00 127.06 ? 387  ARG A NE    1 
ATOM   3757  C  CZ    . ARG D 4  387  ? 10.958  -24.276 17.402  1.00 109.96 ? 387  ARG A CZ    1 
ATOM   3758  N  NH1   . ARG D 4  387  ? 10.424  -23.182 17.930  1.00 92.91  ? 387  ARG A NH1   1 
ATOM   3759  N  NH2   . ARG D 4  387  ? 12.203  -24.617 17.708  1.00 110.12 ? 387  ARG A NH2   1 
ATOM   3760  N  N     . LEU D 4  388  ? 11.395  -23.357 11.811  1.00 90.20  ? 388  LEU A N     1 
ATOM   3761  C  CA    . LEU D 4  388  ? 12.072  -22.066 11.704  1.00 95.68  ? 388  LEU A CA    1 
ATOM   3762  C  C     . LEU D 4  388  ? 11.742  -21.351 10.398  1.00 95.10  ? 388  LEU A C     1 
ATOM   3763  O  O     . LEU D 4  388  ? 11.553  -20.128 10.388  1.00 76.22  ? 388  LEU A O     1 
ATOM   3764  C  CB    . LEU D 4  388  ? 13.581  -22.258 11.841  1.00 91.09  ? 388  LEU A CB    1 
ATOM   3765  C  CG    . LEU D 4  388  ? 14.067  -22.477 13.273  1.00 83.08  ? 388  LEU A CG    1 
ATOM   3766  C  CD1   . LEU D 4  388  ? 15.585  -22.518 13.337  1.00 91.01  ? 388  LEU A CD1   1 
ATOM   3767  C  CD2   . LEU D 4  388  ? 13.518  -21.387 14.182  1.00 76.43  ? 388  LEU A CD2   1 
ATOM   3768  N  N     . THR D 4  389  ? 11.694  -22.086 9.282   1.00 87.78  ? 389  THR A N     1 
ATOM   3769  C  CA    . THR D 4  389  ? 11.351  -21.462 8.006   1.00 82.24  ? 389  THR A CA    1 
ATOM   3770  C  C     . THR D 4  389  ? 9.978   -20.805 8.069   1.00 72.99  ? 389  THR A C     1 
ATOM   3771  O  O     . THR D 4  389  ? 9.791   -19.691 7.566   1.00 79.07  ? 389  THR A O     1 
ATOM   3772  C  CB    . THR D 4  389  ? 11.394  -22.494 6.879   1.00 97.00  ? 389  THR A CB    1 
ATOM   3773  O  OG1   . THR D 4  389  ? 10.754  -23.700 7.310   1.00 125.00 ? 389  THR A OG1   1 
ATOM   3774  C  CG2   . THR D 4  389  ? 12.831  -22.795 6.470   1.00 89.27  ? 389  THR A CG2   1 
ATOM   3775  N  N     . GLN D 4  390  ? 9.006   -21.481 8.686   1.00 71.18  ? 390  GLN A N     1 
ATOM   3776  C  CA    . GLN D 4  390  ? 7.686   -20.886 8.860   1.00 83.11  ? 390  GLN A CA    1 
ATOM   3777  C  C     . GLN D 4  390  ? 7.747   -19.672 9.778   1.00 81.84  ? 390  GLN A C     1 
ATOM   3778  O  O     . GLN D 4  390  ? 7.055   -18.673 9.546   1.00 88.98  ? 390  GLN A O     1 
ATOM   3779  C  CB    . GLN D 4  390  ? 6.709   -21.930 9.408   1.00 107.58 ? 390  GLN A CB    1 
ATOM   3780  C  CG    . GLN D 4  390  ? 5.422   -21.354 9.989   1.00 123.38 ? 390  GLN A CG    1 
ATOM   3781  C  CD    . GLN D 4  390  ? 4.261   -21.401 9.010   1.00 138.12 ? 390  GLN A CD    1 
ATOM   3782  O  OE1   . GLN D 4  390  ? 4.262   -22.187 8.061   1.00 154.07 ? 390  GLN A OE1   1 
ATOM   3783  N  NE2   . GLN D 4  390  ? 3.260   -20.556 9.239   1.00 127.75 ? 390  GLN A NE2   1 
ATOM   3784  N  N     . LEU D 4  391  ? 8.579   -19.734 10.821  1.00 81.33  ? 391  LEU A N     1 
ATOM   3785  C  CA    . LEU D 4  391  ? 8.719   -18.601 11.732  1.00 100.21 ? 391  LEU A CA    1 
ATOM   3786  C  C     . LEU D 4  391  ? 9.260   -17.376 11.003  1.00 99.62  ? 391  LEU A C     1 
ATOM   3787  O  O     . LEU D 4  391  ? 8.736   -16.267 11.157  1.00 100.39 ? 391  LEU A O     1 
ATOM   3788  C  CB    . LEU D 4  391  ? 9.626   -18.981 12.902  1.00 109.48 ? 391  LEU A CB    1 
ATOM   3789  C  CG    . LEU D 4  391  ? 9.061   -19.970 13.923  1.00 91.18  ? 391  LEU A CG    1 
ATOM   3790  C  CD1   . LEU D 4  391  ? 9.973   -20.059 15.131  1.00 95.80  ? 391  LEU A CD1   1 
ATOM   3791  C  CD2   . LEU D 4  391  ? 7.656   -19.567 14.343  1.00 80.25  ? 391  LEU A CD2   1 
ATOM   3792  N  N     . VAL D 4  392  ? 10.316  -17.560 10.207  1.00 88.95  ? 392  VAL A N     1 
ATOM   3793  C  CA    . VAL D 4  392  ? 10.823  -16.465 9.383   1.00 77.45  ? 392  VAL A CA    1 
ATOM   3794  C  C     . VAL D 4  392  ? 9.755   -16.015 8.395   1.00 93.01  ? 392  VAL A C     1 
ATOM   3795  O  O     . VAL D 4  392  ? 9.579   -14.815 8.148   1.00 92.28  ? 392  VAL A O     1 
ATOM   3796  C  CB    . VAL D 4  392  ? 12.119  -16.892 8.667   1.00 71.97  ? 392  VAL A CB    1 
ATOM   3797  C  CG1   . VAL D 4  392  ? 12.456  -15.932 7.538   1.00 71.16  ? 392  VAL A CG1   1 
ATOM   3798  C  CG2   . VAL D 4  392  ? 13.274  -16.982 9.653   1.00 83.60  ? 392  VAL A CG2   1 
ATOM   3799  N  N     . ARG D 4  393  ? 9.013   -16.971 7.830   1.00 105.18 ? 393  ARG A N     1 
ATOM   3800  C  CA    . ARG D 4  393  ? 7.952   -16.636 6.884   1.00 110.53 ? 393  ARG A CA    1 
ATOM   3801  C  C     . ARG D 4  393  ? 6.856   -15.816 7.553   1.00 105.58 ? 393  ARG A C     1 
ATOM   3802  O  O     . ARG D 4  393  ? 6.267   -14.927 6.927   1.00 127.15 ? 393  ARG A O     1 
ATOM   3803  C  CB    . ARG D 4  393  ? 7.377   -17.915 6.273   1.00 124.52 ? 393  ARG A CB    1 
ATOM   3804  C  CG    . ARG D 4  393  ? 6.147   -17.711 5.399   1.00 127.82 ? 393  ARG A CG    1 
ATOM   3805  C  CD    . ARG D 4  393  ? 6.032   -18.821 4.365   1.00 122.66 ? 393  ARG A CD    1 
ATOM   3806  N  NE    . ARG D 4  393  ? 7.266   -18.965 3.598   1.00 123.37 ? 393  ARG A NE    1 
ATOM   3807  C  CZ    . ARG D 4  393  ? 8.036   -20.049 3.619   1.00 102.41 ? 393  ARG A CZ    1 
ATOM   3808  N  NH1   . ARG D 4  393  ? 7.696   -21.091 4.364   1.00 86.69  ? 393  ARG A NH1   1 
ATOM   3809  N  NH2   . ARG D 4  393  ? 9.146   -20.092 2.893   1.00 101.80 ? 393  ARG A NH2   1 
ATOM   3810  N  N     . ASN D 4  394  ? 6.567   -16.098 8.826   1.00 74.04  ? 394  ASN A N     1 
ATOM   3811  C  CA    . ASN D 4  394  ? 5.605   -15.284 9.561   1.00 66.59  ? 394  ASN A CA    1 
ATOM   3812  C  C     . ASN D 4  394  ? 6.075   -13.840 9.661   1.00 86.96  ? 394  ASN A C     1 
ATOM   3813  O  O     . ASN D 4  394  ? 5.314   -12.904 9.390   1.00 103.08 ? 394  ASN A O     1 
ATOM   3814  C  CB    . ASN D 4  394  ? 5.372   -15.865 10.955  1.00 69.56  ? 394  ASN A CB    1 
ATOM   3815  C  CG    . ASN D 4  394  ? 4.318   -16.945 10.965  1.00 85.86  ? 394  ASN A CG    1 
ATOM   3816  O  OD1   . ASN D 4  394  ? 4.630   -18.135 11.003  1.00 104.20 ? 394  ASN A OD1   1 
ATOM   3817  N  ND2   . ASN D 4  394  ? 3.055   -16.535 10.923  1.00 89.99  ? 394  ASN A ND2   1 
ATOM   3818  N  N     . GLY D 4  395  ? 7.329   -13.639 10.050  1.00 90.25  ? 395  GLY A N     1 
ATOM   3819  C  CA    . GLY D 4  395  ? 7.866   -12.312 10.206  1.00 94.89  ? 395  GLY A CA    1 
ATOM   3820  C  C     . GLY D 4  395  ? 7.533   -11.717 11.557  1.00 92.70  ? 395  GLY A C     1 
ATOM   3821  O  O     . GLY D 4  395  ? 6.710   -12.243 12.316  1.00 79.55  ? 395  GLY A O     1 
ATOM   3822  N  N     . PRO D 4  396  ? 8.168   -10.589 11.880  1.00 76.04  ? 396  PRO A N     1 
ATOM   3823  C  CA    . PRO D 4  396  ? 7.991   -9.990  13.210  1.00 64.23  ? 396  PRO A CA    1 
ATOM   3824  C  C     . PRO D 4  396  ? 6.663   -9.280  13.409  1.00 58.95  ? 396  PRO A C     1 
ATOM   3825  O  O     . PRO D 4  396  ? 6.372   -8.867  14.540  1.00 75.95  ? 396  PRO A O     1 
ATOM   3826  C  CB    . PRO D 4  396  ? 9.154   -8.996  13.294  1.00 77.81  ? 396  PRO A CB    1 
ATOM   3827  C  CG    . PRO D 4  396  ? 9.394   -8.611  11.871  1.00 61.11  ? 396  PRO A CG    1 
ATOM   3828  C  CD    . PRO D 4  396  ? 9.121   -9.832  11.049  1.00 60.77  ? 396  PRO A CD    1 
ATOM   3829  N  N     . ASN D 4  397  ? 5.852   -9.117  12.364  1.00 71.58  ? 397  ASN A N     1 
ATOM   3830  C  CA    . ASN D 4  397  ? 4.591   -8.401  12.523  1.00 103.44 ? 397  ASN A CA    1 
ATOM   3831  C  C     . ASN D 4  397  ? 3.649   -9.153  13.454  1.00 92.73  ? 397  ASN A C     1 
ATOM   3832  O  O     . ASN D 4  397  ? 3.082   -8.571  14.387  1.00 86.82  ? 397  ASN A O     1 
ATOM   3833  C  CB    . ASN D 4  397  ? 3.939   -8.175  11.159  1.00 138.03 ? 397  ASN A CB    1 
ATOM   3834  C  CG    . ASN D 4  397  ? 4.038   -6.735  10.701  1.00 154.67 ? 397  ASN A CG    1 
ATOM   3835  O  OD1   . ASN D 4  397  ? 4.816   -5.951  11.243  1.00 161.26 ? 397  ASN A OD1   1 
ATOM   3836  N  ND2   . ASN D 4  397  ? 3.254   -6.382  9.688   1.00 154.22 ? 397  ASN A ND2   1 
ATOM   3837  N  N     . GLU D 4  398  ? 3.479   -10.453 13.225  1.00 88.21  ? 398  GLU A N     1 
ATOM   3838  C  CA    . GLU D 4  398  ? 2.615   -11.281 14.050  1.00 99.23  ? 398  GLU A CA    1 
ATOM   3839  C  C     . GLU D 4  398  ? 3.389   -12.509 14.506  1.00 90.71  ? 398  GLU A C     1 
ATOM   3840  O  O     . GLU D 4  398  ? 4.241   -13.032 13.783  1.00 89.11  ? 398  GLU A O     1 
ATOM   3841  C  CB    . GLU D 4  398  ? 1.339   -11.693 13.296  1.00 126.74 ? 398  GLU A CB    1 
ATOM   3842  C  CG    . GLU D 4  398  ? 0.236   -12.256 14.190  1.00 142.60 ? 398  GLU A CG    1 
ATOM   3843  C  CD    . GLU D 4  398  ? -0.142  -11.322 15.331  1.00 123.17 ? 398  GLU A CD    1 
ATOM   3844  O  OE1   . GLU D 4  398  ? -0.339  -11.814 16.463  1.00 98.92  ? 398  GLU A OE1   1 
ATOM   3845  O  OE2   . GLU D 4  398  ? -0.248  -10.098 15.098  1.00 116.85 ? 398  GLU A OE2   1 
ATOM   3846  N  N     . HIS D 4  399  ? 3.081   -12.962 15.721  1.00 76.55  ? 399  HIS A N     1 
ATOM   3847  C  CA    . HIS D 4  399  ? 3.690   -13.990 16.551  1.00 85.76  ? 399  HIS A CA    1 
ATOM   3848  C  C     . HIS D 4  399  ? 2.906   -15.294 16.438  1.00 90.96  ? 399  HIS A C     1 
ATOM   3849  O  O     . HIS D 4  399  ? 1.671   -15.268 16.388  1.00 104.67 ? 399  HIS A O     1 
ATOM   3850  C  CB    . HIS D 4  399  ? 3.717   -13.523 18.009  1.00 93.78  ? 399  HIS A CB    1 
ATOM   3851  C  CG    . HIS D 4  399  ? 4.188   -14.560 18.979  1.00 98.11  ? 399  HIS A CG    1 
ATOM   3852  N  ND1   . HIS D 4  399  ? 3.324   -15.387 19.666  1.00 95.75  ? 399  HIS A ND1   1 
ATOM   3853  C  CD2   . HIS D 4  399  ? 5.433   -14.887 19.397  1.00 96.93  ? 399  HIS A CD2   1 
ATOM   3854  C  CE1   . HIS D 4  399  ? 4.019   -16.189 20.452  1.00 100.98 ? 399  HIS A CE1   1 
ATOM   3855  N  NE2   . HIS D 4  399  ? 5.301   -15.906 20.309  1.00 100.64 ? 399  HIS A NE2   1 
ATOM   3856  N  N     . PRO D 4  400  ? 3.563   -16.469 16.393  1.00 88.01  ? 400  PRO A N     1 
ATOM   3857  C  CA    . PRO D 4  400  ? 5.007   -16.705 16.517  1.00 74.71  ? 400  PRO A CA    1 
ATOM   3858  C  C     . PRO D 4  400  ? 5.800   -16.343 15.269  1.00 64.23  ? 400  PRO A C     1 
ATOM   3859  O  O     . PRO D 4  400  ? 5.660   -16.995 14.235  1.00 83.21  ? 400  PRO A O     1 
ATOM   3860  C  CB    . PRO D 4  400  ? 5.102   -18.219 16.778  1.00 64.42  ? 400  PRO A CB    1 
ATOM   3861  C  CG    . PRO D 4  400  ? 3.678   -18.712 16.897  1.00 73.42  ? 400  PRO A CG    1 
ATOM   3862  C  CD    . PRO D 4  400  ? 2.840   -17.728 16.163  1.00 83.31  ? 400  PRO A CD    1 
ATOM   3863  N  N     . GLY D 4  401  ? 6.635   -15.315 15.373  1.00 60.96  ? 401  GLY A N     1 
ATOM   3864  C  CA    . GLY D 4  401  ? 7.452   -14.909 14.250  1.00 61.35  ? 401  GLY A CA    1 
ATOM   3865  C  C     . GLY D 4  401  ? 8.935   -14.940 14.547  1.00 61.41  ? 401  GLY A C     1 
ATOM   3866  O  O     . GLY D 4  401  ? 9.404   -15.739 15.363  1.00 61.54  ? 401  GLY A O     1 
ATOM   3867  N  N     . ALA D 4  402  ? 9.681   -14.073 13.870  1.00 70.23  ? 402  ALA A N     1 
ATOM   3868  C  CA    . ALA D 4  402  ? 11.109  -13.909 14.094  1.00 66.07  ? 402  ALA A CA    1 
ATOM   3869  C  C     . ALA D 4  402  ? 11.512  -12.547 13.552  1.00 78.24  ? 402  ALA A C     1 
ATOM   3870  O  O     . ALA D 4  402  ? 10.867  -12.012 12.647  1.00 88.85  ? 402  ALA A O     1 
ATOM   3871  C  CB    . ALA D 4  402  ? 11.925  -15.022 13.426  1.00 67.16  ? 402  ALA A CB    1 
ATOM   3872  N  N     . LYS D 4  403  ? 12.584  -11.993 14.112  1.00 80.45  ? 403  LYS A N     1 
ATOM   3873  C  CA    . LYS D 4  403  ? 13.016  -10.648 13.760  1.00 87.41  ? 403  LYS A CA    1 
ATOM   3874  C  C     . LYS D 4  403  ? 14.324  -10.599 12.989  1.00 73.91  ? 403  LYS A C     1 
ATOM   3875  O  O     . LYS D 4  403  ? 14.522  -9.673  12.201  1.00 74.56  ? 403  LYS A O     1 
ATOM   3876  C  CB    . LYS D 4  403  ? 13.148  -9.784  15.022  1.00 90.92  ? 403  LYS A CB    1 
ATOM   3877  C  CG    . LYS D 4  403  ? 11.865  -9.672  15.834  1.00 89.02  ? 403  LYS A CG    1 
ATOM   3878  C  CD    . LYS D 4  403  ? 11.679  -8.271  16.391  1.00 94.42  ? 403  LYS A CD    1 
ATOM   3879  C  CE    . LYS D 4  403  ? 12.953  -7.769  17.053  1.00 109.29 ? 403  LYS A CE    1 
ATOM   3880  N  NZ    . LYS D 4  403  ? 12.876  -6.318  17.370  1.00 113.38 ? 403  LYS A NZ    1 
ATOM   3881  N  N     . TYR D 4  404  ? 15.220  -11.564 13.187  1.00 62.07  ? 404  TYR A N     1 
ATOM   3882  C  CA    . TYR D 4  404  ? 16.524  -11.514 12.542  1.00 64.48  ? 404  TYR A CA    1 
ATOM   3883  C  C     . TYR D 4  404  ? 16.982  -12.922 12.190  1.00 68.98  ? 404  TYR A C     1 
ATOM   3884  O  O     . TYR D 4  404  ? 16.554  -13.909 12.793  1.00 74.09  ? 404  TYR A O     1 
ATOM   3885  C  CB    . TYR D 4  404  ? 17.573  -10.832 13.431  1.00 83.58  ? 404  TYR A CB    1 
ATOM   3886  C  CG    . TYR D 4  404  ? 17.407  -9.334  13.566  1.00 92.98  ? 404  TYR A CG    1 
ATOM   3887  C  CD1   . TYR D 4  404  ? 16.585  -8.790  14.545  1.00 100.39 ? 404  TYR A CD1   1 
ATOM   3888  C  CD2   . TYR D 4  404  ? 18.073  -8.465  12.713  1.00 85.97  ? 404  TYR A CD2   1 
ATOM   3889  C  CE1   . TYR D 4  404  ? 16.433  -7.421  14.670  1.00 105.41 ? 404  TYR A CE1   1 
ATOM   3890  C  CE2   . TYR D 4  404  ? 17.928  -7.096  12.831  1.00 86.31  ? 404  TYR A CE2   1 
ATOM   3891  C  CZ    . TYR D 4  404  ? 17.107  -6.579  13.811  1.00 106.62 ? 404  TYR A CZ    1 
ATOM   3892  O  OH    . TYR D 4  404  ? 16.959  -5.216  13.932  1.00 120.35 ? 404  TYR A OH    1 
ATOM   3893  N  N     . VAL D 4  405  ? 17.862  -12.994 11.193  1.00 80.04  ? 405  VAL A N     1 
ATOM   3894  C  CA    . VAL D 4  405  ? 18.558  -14.217 10.810  1.00 91.51  ? 405  VAL A CA    1 
ATOM   3895  C  C     . VAL D 4  405  ? 20.038  -13.882 10.689  1.00 93.91  ? 405  VAL A C     1 
ATOM   3896  O  O     . VAL D 4  405  ? 20.400  -12.872 10.074  1.00 104.87 ? 405  VAL A O     1 
ATOM   3897  C  CB    . VAL D 4  405  ? 18.023  -14.803 9.487   1.00 87.84  ? 405  VAL A CB    1 
ATOM   3898  C  CG1   . VAL D 4  405  ? 18.816  -16.041 9.080   1.00 67.69  ? 405  VAL A CG1   1 
ATOM   3899  C  CG2   . VAL D 4  405  ? 16.540  -15.138 9.607   1.00 88.95  ? 405  VAL A CG2   1 
ATOM   3900  N  N     . ILE D 4  406  ? 20.888  -14.712 11.285  1.00 87.65  ? 406  ILE A N     1 
ATOM   3901  C  CA    . ILE D 4  406  ? 22.330  -14.493 11.295  1.00 86.76  ? 406  ILE A CA    1 
ATOM   3902  C  C     . ILE D 4  406  ? 22.968  -15.565 10.424  1.00 98.23  ? 406  ILE A C     1 
ATOM   3903  O  O     . ILE D 4  406  ? 22.979  -16.749 10.785  1.00 87.27  ? 406  ILE A O     1 
ATOM   3904  C  CB    . ILE D 4  406  ? 22.905  -14.519 12.717  1.00 89.24  ? 406  ILE A CB    1 
ATOM   3905  C  CG1   . ILE D 4  406  ? 22.065  -13.642 13.649  1.00 82.81  ? 406  ILE A CG1   1 
ATOM   3906  C  CG2   . ILE D 4  406  ? 24.360  -14.064 12.709  1.00 97.56  ? 406  ILE A CG2   1 
ATOM   3907  C  CD1   . ILE D 4  406  ? 22.638  -13.495 15.046  1.00 79.65  ? 406  ILE A CD1   1 
ATOM   3908  N  N     . ARG D 4  407  ? 23.498  -15.154 9.275   1.00 110.25 ? 407  ARG A N     1 
ATOM   3909  C  CA    . ARG D 4  407  ? 24.247  -16.072 8.436   1.00 122.95 ? 407  ARG A CA    1 
ATOM   3910  C  C     . ARG D 4  407  ? 25.578  -16.423 9.100   1.00 130.27 ? 407  ARG A C     1 
ATOM   3911  O  O     . ARG D 4  407  ? 26.000  -15.807 10.084  1.00 123.32 ? 407  ARG A O     1 
ATOM   3912  C  CB    . ARG D 4  407  ? 24.488  -15.468 7.051   1.00 122.31 ? 407  ARG A CB    1 
ATOM   3913  C  CG    . ARG D 4  407  ? 23.275  -14.785 6.436   1.00 124.10 ? 407  ARG A CG    1 
ATOM   3914  C  CD    . ARG D 4  407  ? 23.478  -14.519 4.945   1.00 120.23 ? 407  ARG A CD    1 
ATOM   3915  N  NE    . ARG D 4  407  ? 24.808  -13.993 4.648   1.00 125.74 ? 407  ARG A NE    1 
ATOM   3916  C  CZ    . ARG D 4  407  ? 25.105  -12.700 4.562   1.00 121.27 ? 407  ARG A CZ    1 
ATOM   3917  N  NH1   . ARG D 4  407  ? 24.164  -11.784 4.743   1.00 100.91 ? 407  ARG A NH1   1 
ATOM   3918  N  NH2   . ARG D 4  407  ? 26.346  -12.320 4.288   1.00 128.36 ? 407  ARG A NH2   1 
ATOM   3919  N  N     . ASP D 4  408  ? 26.246  -17.437 8.543   1.00 149.89 ? 408  ASP A N     1 
ATOM   3920  C  CA    . ASP D 4  408  ? 27.554  -17.829 9.055   1.00 150.68 ? 408  ASP A CA    1 
ATOM   3921  C  C     . ASP D 4  408  ? 28.600  -16.751 8.804   1.00 135.35 ? 408  ASP A C     1 
ATOM   3922  O  O     . ASP D 4  408  ? 29.602  -16.681 9.525   1.00 137.17 ? 408  ASP A O     1 
ATOM   3923  C  CB    . ASP D 4  408  ? 27.994  -19.151 8.422   1.00 168.39 ? 408  ASP A CB    1 
ATOM   3924  C  CG    . ASP D 4  408  ? 27.709  -19.210 6.930   1.00 183.17 ? 408  ASP A CG    1 
ATOM   3925  O  OD1   . ASP D 4  408  ? 26.604  -18.802 6.515   1.00 190.07 ? 408  ASP A OD1   1 
ATOM   3926  O  OD2   . ASP D 4  408  ? 28.591  -19.668 6.172   1.00 187.07 ? 408  ASP A OD2   1 
ATOM   3927  N  N     . SER D 4  409  ? 28.388  -15.910 7.790   1.00 127.29 ? 409  SER A N     1 
ATOM   3928  C  CA    . SER D 4  409  ? 29.341  -14.845 7.494   1.00 132.26 ? 409  SER A CA    1 
ATOM   3929  C  C     . SER D 4  409  ? 29.425  -13.853 8.646   1.00 140.49 ? 409  SER A C     1 
ATOM   3930  O  O     . SER D 4  409  ? 30.520  -13.454 9.058   1.00 148.72 ? 409  SER A O     1 
ATOM   3931  C  CB    . SER D 4  409  ? 28.947  -14.135 6.197   1.00 144.45 ? 409  SER A CB    1 
ATOM   3932  O  OG    . SER D 4  409  ? 27.647  -13.578 6.294   1.00 146.88 ? 409  SER A OG    1 
ATOM   3933  N  N     . GLY D 4  410  ? 28.276  -13.445 9.178   1.00 151.96 ? 410  GLY A N     1 
ATOM   3934  C  CA    . GLY D 4  410  ? 28.250  -12.551 10.319  1.00 164.08 ? 410  GLY A CA    1 
ATOM   3935  C  C     . GLY D 4  410  ? 27.243  -11.426 10.198  1.00 173.06 ? 410  GLY A C     1 
ATOM   3936  O  O     . GLY D 4  410  ? 26.769  -10.902 11.209  1.00 186.65 ? 410  GLY A O     1 
ATOM   3937  N  N     . ASP D 4  411  ? 26.913  -11.044 8.967   1.00 161.30 ? 411  ASP A N     1 
ATOM   3938  C  CA    . ASP D 4  411  ? 26.006  -9.927  8.745   1.00 141.47 ? 411  ASP A CA    1 
ATOM   3939  C  C     . ASP D 4  411  ? 24.576  -10.298 9.121   1.00 110.94 ? 411  ASP A C     1 
ATOM   3940  O  O     . ASP D 4  411  ? 24.150  -11.448 8.986   1.00 94.80  ? 411  ASP A O     1 
ATOM   3941  C  CB    . ASP D 4  411  ? 26.067  -9.479  7.286   1.00 157.80 ? 411  ASP A CB    1 
ATOM   3942  C  CG    . ASP D 4  411  ? 27.467  -9.087  6.858   1.00 166.88 ? 411  ASP A CG    1 
ATOM   3943  O  OD1   . ASP D 4  411  ? 28.210  -8.533  7.695   1.00 165.22 ? 411  ASP A OD1   1 
ATOM   3944  O  OD2   . ASP D 4  411  ? 27.827  -9.341  5.690   1.00 168.39 ? 411  ASP A OD2   1 
ATOM   3945  N  N     . ARG D 4  412  ? 23.830  -9.300  9.587   1.00 99.73  ? 412  ARG A N     1 
ATOM   3946  C  CA    . ARG D 4  412  ? 22.488  -9.517  10.110  1.00 101.83 ? 412  ARG A CA    1 
ATOM   3947  C  C     . ARG D 4  412  ? 21.444  -9.285  9.025   1.00 93.01  ? 412  ARG A C     1 
ATOM   3948  O  O     . ARG D 4  412  ? 21.541  -8.332  8.246   1.00 110.07 ? 412  ARG A O     1 
ATOM   3949  C  CB    . ARG D 4  412  ? 22.223  -8.588  11.295  1.00 106.16 ? 412  ARG A CB    1 
ATOM   3950  C  CG    . ARG D 4  412  ? 21.558  -9.263  12.480  1.00 102.41 ? 412  ARG A CG    1 
ATOM   3951  C  CD    . ARG D 4  412  ? 22.075  -8.689  13.785  1.00 98.31  ? 412  ARG A CD    1 
ATOM   3952  N  NE    . ARG D 4  412  ? 21.598  -9.432  14.947  1.00 110.46 ? 412  ARG A NE    1 
ATOM   3953  C  CZ    . ARG D 4  412  ? 22.025  -9.223  16.188  1.00 139.42 ? 412  ARG A CZ    1 
ATOM   3954  N  NH1   . ARG D 4  412  ? 22.946  -8.298  16.429  1.00 145.23 ? 412  ARG A NH1   1 
ATOM   3955  N  NH2   . ARG D 4  412  ? 21.536  -9.940  17.190  1.00 152.03 ? 412  ARG A NH2   1 
ATOM   3956  N  N     . ILE D 4  413  ? 20.450  -10.166 8.975   1.00 66.24  ? 413  ILE A N     1 
ATOM   3957  C  CA    . ILE D 4  413  ? 19.340  -10.050 8.035   1.00 84.16  ? 413  ILE A CA    1 
ATOM   3958  C  C     . ILE D 4  413  ? 18.128  -9.539  8.803   1.00 81.94  ? 413  ILE A C     1 
ATOM   3959  O  O     . ILE D 4  413  ? 17.717  -10.140 9.803   1.00 102.73 ? 413  ILE A O     1 
ATOM   3960  C  CB    . ILE D 4  413  ? 19.037  -11.388 7.339   1.00 70.88  ? 413  ILE A CB    1 
ATOM   3961  C  CG1   . ILE D 4  413  ? 19.937  -11.585 6.113   1.00 68.11  ? 413  ILE A CG1   1 
ATOM   3962  C  CG2   . ILE D 4  413  ? 17.578  -11.457 6.915   1.00 66.55  ? 413  ILE A CG2   1 
ATOM   3963  C  CD1   . ILE D 4  413  ? 21.405  -11.758 6.424   1.00 68.68  ? 413  ILE A CD1   1 
ATOM   3964  N  N     . ASP D 4  414  ? 17.560  -8.426  8.345   1.00 64.22  ? 414  ASP A N     1 
ATOM   3965  C  CA    . ASP D 4  414  ? 16.454  -7.771  9.032   1.00 70.15  ? 414  ASP A CA    1 
ATOM   3966  C  C     . ASP D 4  414  ? 15.153  -8.131  8.324   1.00 82.48  ? 414  ASP A C     1 
ATOM   3967  O  O     . ASP D 4  414  ? 14.971  -7.799  7.149   1.00 98.73  ? 414  ASP A O     1 
ATOM   3968  C  CB    . ASP D 4  414  ? 16.655  -6.256  9.061   1.00 74.34  ? 414  ASP A CB    1 
ATOM   3969  C  CG    . ASP D 4  414  ? 15.772  -5.566  10.084  1.00 68.04  ? 414  ASP A CG    1 
ATOM   3970  O  OD1   . ASP D 4  414  ? 14.561  -5.865  10.145  1.00 61.24  ? 414  ASP A OD1   1 
ATOM   3971  O  OD2   . ASP D 4  414  ? 16.298  -4.718  10.833  1.00 68.02  ? 414  ASP A OD2   1 
ATOM   3972  N  N     . LEU D 4  415  ? 14.247  -8.792  9.045   1.00 87.33  ? 415  LEU A N     1 
ATOM   3973  C  CA    . LEU D 4  415  ? 12.998  -9.246  8.447   1.00 68.93  ? 415  LEU A CA    1 
ATOM   3974  C  C     . LEU D 4  415  ? 11.929  -8.163  8.386   1.00 63.27  ? 415  LEU A C     1 
ATOM   3975  O  O     . LEU D 4  415  ? 10.964  -8.315  7.630   1.00 69.25  ? 415  LEU A O     1 
ATOM   3976  C  CB    . LEU D 4  415  ? 12.452  -10.452 9.212   1.00 62.80  ? 415  LEU A CB    1 
ATOM   3977  C  CG    . LEU D 4  415  ? 13.362  -11.676 9.297   1.00 63.54  ? 415  LEU A CG    1 
ATOM   3978  C  CD1   . LEU D 4  415  ? 12.530  -12.914 9.593   1.00 73.53  ? 415  LEU A CD1   1 
ATOM   3979  C  CD2   . LEU D 4  415  ? 14.169  -11.856 8.019   1.00 64.62  ? 415  LEU A CD2   1 
ATOM   3980  N  N     . ARG D 4  416  ? 12.067  -7.083  9.161   1.00 77.58  ? 416  ARG A N     1 
ATOM   3981  C  CA    . ARG D 4  416  ? 11.064  -6.022  9.119   1.00 91.05  ? 416  ARG A CA    1 
ATOM   3982  C  C     . ARG D 4  416  ? 11.030  -5.351  7.752   1.00 100.00 ? 416  ARG A C     1 
ATOM   3983  O  O     . ARG D 4  416  ? 9.954   -5.006  7.247   1.00 106.46 ? 416  ARG A O     1 
ATOM   3984  C  CB    . ARG D 4  416  ? 11.326  -4.995  10.221  1.00 96.89  ? 416  ARG A CB    1 
ATOM   3985  C  CG    . ARG D 4  416  ? 11.003  -5.499  11.618  1.00 110.42 ? 416  ARG A CG    1 
ATOM   3986  C  CD    . ARG D 4  416  ? 11.327  -4.472  12.695  1.00 114.73 ? 416  ARG A CD    1 
ATOM   3987  N  NE    . ARG D 4  416  ? 12.582  -3.770  12.444  1.00 120.36 ? 416  ARG A NE    1 
ATOM   3988  C  CZ    . ARG D 4  416  ? 13.788  -4.314  12.575  1.00 123.05 ? 416  ARG A CZ    1 
ATOM   3989  N  NH1   . ARG D 4  416  ? 13.918  -5.580  12.954  1.00 119.96 ? 416  ARG A NH1   1 
ATOM   3990  N  NH2   . ARG D 4  416  ? 14.869  -3.588  12.323  1.00 132.85 ? 416  ARG A NH2   1 
ATOM   3991  N  N     . TYR D 4  417  ? 12.193  -5.154  7.138   1.00 79.59  ? 417  TYR A N     1 
ATOM   3992  C  CA    . TYR D 4  417  ? 12.253  -4.648  5.770   1.00 96.93  ? 417  TYR A CA    1 
ATOM   3993  C  C     . TYR D 4  417  ? 13.476  -5.248  5.093   1.00 97.75  ? 417  TYR A C     1 
ATOM   3994  O  O     . TYR D 4  417  ? 14.612  -4.939  5.461   1.00 111.03 ? 417  TYR A O     1 
ATOM   3995  C  CB    . TYR D 4  417  ? 12.283  -3.120  5.736   1.00 120.45 ? 417  TYR A CB    1 
ATOM   3996  C  CG    . TYR D 4  417  ? 13.007  -2.464  6.893   1.00 117.44 ? 417  TYR A CG    1 
ATOM   3997  C  CD1   . TYR D 4  417  ? 14.392  -2.362  6.910   1.00 119.68 ? 417  TYR A CD1   1 
ATOM   3998  C  CD2   . TYR D 4  417  ? 12.301  -1.937  7.968   1.00 91.10  ? 417  TYR A CD2   1 
ATOM   3999  C  CE1   . TYR D 4  417  ? 15.052  -1.761  7.962   1.00 122.79 ? 417  TYR A CE1   1 
ATOM   4000  C  CE2   . TYR D 4  417  ? 12.952  -1.334  9.025   1.00 90.67  ? 417  TYR A CE2   1 
ATOM   4001  C  CZ    . TYR D 4  417  ? 14.327  -1.249  9.017   1.00 123.33 ? 417  TYR A CZ    1 
ATOM   4002  O  OH    . TYR D 4  417  ? 14.982  -0.648  10.069  1.00 136.38 ? 417  TYR A OH    1 
ATOM   4003  N  N     . SER D 4  418  ? 13.233  -6.121  4.120   1.00 87.76  ? 418  SER A N     1 
ATOM   4004  C  CA    . SER D 4  418  ? 14.281  -6.716  3.307   1.00 82.51  ? 418  SER A CA    1 
ATOM   4005  C  C     . SER D 4  418  ? 13.618  -7.334  2.090   1.00 93.07  ? 418  SER A C     1 
ATOM   4006  O  O     . SER D 4  418  ? 12.454  -7.742  2.142   1.00 98.80  ? 418  SER A O     1 
ATOM   4007  C  CB    . SER D 4  418  ? 15.086  -7.773  4.075   1.00 66.98  ? 418  SER A CB    1 
ATOM   4008  O  OG    . SER D 4  418  ? 16.084  -8.365  3.259   1.00 66.92  ? 418  SER A OG    1 
ATOM   4009  N  N     . LYS D 4  419  ? 14.369  -7.393  0.993   1.00 95.83  ? 419  LYS A N     1 
ATOM   4010  C  CA    . LYS D 4  419  ? 13.817  -7.926  -0.244  1.00 91.88  ? 419  LYS A CA    1 
ATOM   4011  C  C     . LYS D 4  419  ? 13.700  -9.444  -0.210  1.00 95.12  ? 419  LYS A C     1 
ATOM   4012  O  O     . LYS D 4  419  ? 12.839  -10.008 -0.897  1.00 109.01 ? 419  LYS A O     1 
ATOM   4013  C  CB    . LYS D 4  419  ? 14.675  -7.485  -1.429  1.00 75.28  ? 419  LYS A CB    1 
ATOM   4014  C  CG    . LYS D 4  419  ? 16.152  -7.795  -1.276  1.00 71.03  ? 419  LYS A CG    1 
ATOM   4015  C  CD    . LYS D 4  419  ? 16.881  -7.545  -2.578  1.00 72.26  ? 419  LYS A CD    1 
ATOM   4016  C  CE    . LYS D 4  419  ? 16.650  -6.129  -3.072  1.00 78.16  ? 419  LYS A CE    1 
ATOM   4017  N  NZ    . LYS D 4  419  ? 17.298  -5.896  -4.391  1.00 108.30 ? 419  LYS A NZ    1 
ATOM   4018  N  N     . ARG D 4  420  ? 14.537  -10.119 0.579   1.00 76.62  ? 420  ARG A N     1 
ATOM   4019  C  CA    . ARG D 4  420  ? 14.581  -11.574 0.604   1.00 71.97  ? 420  ARG A CA    1 
ATOM   4020  C  C     . ARG D 4  420  ? 13.901  -12.170 1.833   1.00 78.18  ? 420  ARG A C     1 
ATOM   4021  O  O     . ARG D 4  420  ? 14.181  -13.320 2.187   1.00 89.45  ? 420  ARG A O     1 
ATOM   4022  C  CB    . ARG D 4  420  ? 16.027  -12.062 0.515   1.00 71.52  ? 420  ARG A CB    1 
ATOM   4023  C  CG    . ARG D 4  420  ? 16.761  -11.592 -0.725  1.00 72.51  ? 420  ARG A CG    1 
ATOM   4024  C  CD    . ARG D 4  420  ? 17.789  -12.618 -1.161  1.00 77.10  ? 420  ARG A CD    1 
ATOM   4025  N  NE    . ARG D 4  420  ? 17.190  -13.935 -1.366  1.00 87.81  ? 420  ARG A NE    1 
ATOM   4026  C  CZ    . ARG D 4  420  ? 17.883  -15.033 -1.649  1.00 98.16  ? 420  ARG A CZ    1 
ATOM   4027  N  NH1   . ARG D 4  420  ? 19.204  -14.975 -1.754  1.00 86.22  ? 420  ARG A NH1   1 
ATOM   4028  N  NH2   . ARG D 4  420  ? 17.257  -16.189 -1.823  1.00 114.69 ? 420  ARG A NH2   1 
ATOM   4029  N  N     . ALA D 4  421  ? 13.011  -11.420 2.486   1.00 77.79  ? 421  ALA A N     1 
ATOM   4030  C  CA    . ALA D 4  421  ? 12.264  -11.976 3.608   1.00 87.20  ? 421  ALA A CA    1 
ATOM   4031  C  C     . ALA D 4  421  ? 11.315  -13.089 3.179   1.00 106.50 ? 421  ALA A C     1 
ATOM   4032  O  O     . ALA D 4  421  ? 10.978  -13.950 4.000   1.00 97.98  ? 421  ALA A O     1 
ATOM   4033  C  CB    . ALA D 4  421  ? 11.482  -10.870 4.318   1.00 69.01  ? 421  ALA A CB    1 
ATOM   4034  N  N     . GLY D 4  422  ? 10.884  -13.098 1.918   1.00 114.68 ? 422  GLY A N     1 
ATOM   4035  C  CA    . GLY D 4  422  ? 9.968   -14.113 1.434   1.00 122.98 ? 422  GLY A CA    1 
ATOM   4036  C  C     . GLY D 4  422  ? 10.611  -15.441 1.084   1.00 130.02 ? 422  GLY A C     1 
ATOM   4037  O  O     . GLY D 4  422  ? 10.052  -16.503 1.381   1.00 146.04 ? 422  GLY A O     1 
ATOM   4038  N  N     . ASP D 4  423  ? 11.782  -15.403 0.451   1.00 106.50 ? 423  ASP A N     1 
ATOM   4039  C  CA    . ASP D 4  423  ? 12.506  -16.607 0.061   1.00 109.94 ? 423  ASP A CA    1 
ATOM   4040  C  C     . ASP D 4  423  ? 13.824  -16.663 0.821   1.00 110.61 ? 423  ASP A C     1 
ATOM   4041  O  O     . ASP D 4  423  ? 14.646  -15.746 0.720   1.00 110.16 ? 423  ASP A O     1 
ATOM   4042  C  CB    . ASP D 4  423  ? 12.745  -16.648 -1.453  1.00 107.48 ? 423  ASP A CB    1 
ATOM   4043  C  CG    . ASP D 4  423  ? 13.535  -15.454 -1.958  1.00 127.60 ? 423  ASP A CG    1 
ATOM   4044  O  OD1   . ASP D 4  423  ? 13.408  -14.362 -1.367  1.00 145.93 ? 423  ASP A OD1   1 
ATOM   4045  O  OD2   . ASP D 4  423  ? 14.282  -15.608 -2.948  1.00 134.03 ? 423  ASP A OD2   1 
ATOM   4046  N  N     . ILE D 4  424  ? 14.019  -17.738 1.580   1.00 93.49  ? 424  ILE A N     1 
ATOM   4047  C  CA    . ILE D 4  424  ? 15.231  -17.955 2.360   1.00 80.62  ? 424  ILE A CA    1 
ATOM   4048  C  C     . ILE D 4  424  ? 15.585  -19.436 2.343   1.00 100.01 ? 424  ILE A C     1 
ATOM   4049  O  O     . ILE D 4  424  ? 14.703  -20.301 2.372   1.00 115.14 ? 424  ILE A O     1 
ATOM   4050  C  CB    . ILE D 4  424  ? 15.083  -17.405 3.799   1.00 71.99  ? 424  ILE A CB    1 
ATOM   4051  C  CG1   . ILE D 4  424  ? 13.674  -17.649 4.365   1.00 93.97  ? 424  ILE A CG1   1 
ATOM   4052  C  CG2   . ILE D 4  424  ? 15.436  -15.917 3.853   1.00 69.79  ? 424  ILE A CG2   1 
ATOM   4053  C  CD1   . ILE D 4  424  ? 13.237  -19.088 4.530   1.00 88.09  ? 424  ILE A CD1   1 
ATOM   4054  N  N     . GLN D 4  425  ? 16.878  -19.725 2.239   1.00 104.78 ? 425  GLN A N     1 
ATOM   4055  C  CA    . GLN D 4  425  ? 17.384  -21.094 2.242   1.00 120.55 ? 425  GLN A CA    1 
ATOM   4056  C  C     . GLN D 4  425  ? 18.239  -21.234 3.495   1.00 133.58 ? 425  GLN A C     1 
ATOM   4057  O  O     . GLN D 4  425  ? 19.402  -20.820 3.515   1.00 154.00 ? 425  GLN A O     1 
ATOM   4058  C  CB    . GLN D 4  425  ? 18.176  -21.397 0.972   1.00 136.95 ? 425  GLN A CB    1 
ATOM   4059  C  CG    . GLN D 4  425  ? 17.858  -22.761 0.355   1.00 149.54 ? 425  GLN A CG    1 
ATOM   4060  C  CD    . GLN D 4  425  ? 18.676  -23.905 0.935   1.00 161.47 ? 425  GLN A CD    1 
ATOM   4061  O  OE1   . GLN D 4  425  ? 19.901  -23.839 1.022   1.00 169.80 ? 425  GLN A OE1   1 
ATOM   4062  N  NE2   . GLN D 4  425  ? 17.987  -24.963 1.348   1.00 161.95 ? 425  GLN A NE2   1 
ATOM   4063  N  N     . LEU D 4  426  ? 17.653  -21.807 4.542   1.00 131.92 ? 426  LEU A N     1 
ATOM   4064  C  CA    . LEU D 4  426  ? 18.305  -21.912 5.845   1.00 114.57 ? 426  LEU A CA    1 
ATOM   4065  C  C     . LEU D 4  426  ? 19.371  -22.997 5.779   1.00 115.04 ? 426  LEU A C     1 
ATOM   4066  O  O     . LEU D 4  426  ? 19.064  -24.190 5.791   1.00 118.93 ? 426  LEU A O     1 
ATOM   4067  C  CB    . LEU D 4  426  ? 17.276  -22.206 6.933   1.00 108.34 ? 426  LEU A CB    1 
ATOM   4068  C  CG    . LEU D 4  426  ? 16.353  -21.051 7.339   1.00 99.71  ? 426  LEU A CG    1 
ATOM   4069  C  CD1   . LEU D 4  426  ? 15.458  -21.448 8.508   1.00 80.00  ? 426  LEU A CD1   1 
ATOM   4070  C  CD2   . LEU D 4  426  ? 17.154  -19.798 7.684   1.00 89.82  ? 426  LEU A CD2   1 
ATOM   4071  N  N     . GLN D 4  427  ? 20.633  -22.583 5.694   1.00 130.15 ? 427  GLN A N     1 
ATOM   4072  C  CA    . GLN D 4  427  ? 21.741  -23.520 5.786   1.00 146.64 ? 427  GLN A CA    1 
ATOM   4073  C  C     . GLN D 4  427  ? 21.965  -23.929 7.235   1.00 129.37 ? 427  GLN A C     1 
ATOM   4074  O  O     . GLN D 4  427  ? 21.693  -23.169 8.169   1.00 130.26 ? 427  GLN A O     1 
ATOM   4075  C  CB    . GLN D 4  427  ? 23.023  -22.908 5.218   1.00 155.39 ? 427  GLN A CB    1 
ATOM   4076  C  CG    . GLN D 4  427  ? 23.373  -23.395 3.825   1.00 164.87 ? 427  GLN A CG    1 
ATOM   4077  C  CD    . GLN D 4  427  ? 22.165  -23.453 2.919   1.00 179.03 ? 427  GLN A CD    1 
ATOM   4078  O  OE1   . GLN D 4  427  ? 21.490  -22.447 2.703   1.00 191.05 ? 427  GLN A OE1   1 
ATOM   4079  N  NE2   . GLN D 4  427  ? 21.872  -24.639 2.395   1.00 178.84 ? 427  GLN A NE2   1 
ATOM   4080  N  N     . TYR D 4  428  ? 22.467  -25.146 7.417   1.00 91.06  ? 428  TYR A N     1 
ATOM   4081  C  CA    . TYR D 4  428  ? 22.780  -25.624 8.754   1.00 91.11  ? 428  TYR A CA    1 
ATOM   4082  C  C     . TYR D 4  428  ? 23.900  -24.790 9.361   1.00 109.69 ? 428  TYR A C     1 
ATOM   4083  O  O     . TYR D 4  428  ? 24.841  -24.386 8.673   1.00 113.88 ? 428  TYR A O     1 
ATOM   4084  C  CB    . TYR D 4  428  ? 23.173  -27.097 8.713   1.00 113.74 ? 428  TYR A CB    1 
ATOM   4085  C  CG    . TYR D 4  428  ? 21.999  -28.017 8.486   1.00 116.43 ? 428  TYR A CG    1 
ATOM   4086  C  CD1   . TYR D 4  428  ? 22.151  -29.217 7.806   1.00 127.43 ? 428  TYR A CD1   1 
ATOM   4087  C  CD2   . TYR D 4  428  ? 20.732  -27.678 8.943   1.00 112.65 ? 428  TYR A CD2   1 
ATOM   4088  C  CE1   . TYR D 4  428  ? 21.077  -30.059 7.595   1.00 140.15 ? 428  TYR A CE1   1 
ATOM   4089  C  CE2   . TYR D 4  428  ? 19.651  -28.513 8.736   1.00 124.23 ? 428  TYR A CE2   1 
ATOM   4090  C  CZ    . TYR D 4  428  ? 19.830  -29.703 8.060   1.00 139.98 ? 428  TYR A CZ    1 
ATOM   4091  O  OH    . TYR D 4  428  ? 18.759  -30.543 7.849   1.00 144.54 ? 428  TYR A OH    1 
ATOM   4092  N  N     . GLY D 4  429  ? 23.788  -24.524 10.661  1.00 116.54 ? 429  GLY A N     1 
ATOM   4093  C  CA    . GLY D 4  429  ? 24.722  -23.666 11.351  1.00 116.17 ? 429  GLY A CA    1 
ATOM   4094  C  C     . GLY D 4  429  ? 24.312  -22.213 11.432  1.00 104.85 ? 429  GLY A C     1 
ATOM   4095  O  O     . GLY D 4  429  ? 24.954  -21.446 12.162  1.00 105.90 ? 429  GLY A O     1 
ATOM   4096  N  N     . TRP D 4  430  ? 23.270  -21.807 10.712  1.00 101.55 ? 430  TRP A N     1 
ATOM   4097  C  CA    . TRP D 4  430  ? 22.789  -20.437 10.794  1.00 101.77 ? 430  TRP A CA    1 
ATOM   4098  C  C     . TRP D 4  430  ? 21.994  -20.223 12.076  1.00 89.44  ? 430  TRP A C     1 
ATOM   4099  O  O     . TRP D 4  430  ? 21.455  -21.159 12.674  1.00 104.24 ? 430  TRP A O     1 
ATOM   4100  C  CB    . TRP D 4  430  ? 21.915  -20.085 9.591   1.00 113.13 ? 430  TRP A CB    1 
ATOM   4101  C  CG    . TRP D 4  430  ? 22.685  -19.700 8.374   1.00 121.55 ? 430  TRP A CG    1 
ATOM   4102  C  CD1   . TRP D 4  430  ? 24.037  -19.762 8.205   1.00 127.31 ? 430  TRP A CD1   1 
ATOM   4103  C  CD2   . TRP D 4  430  ? 22.151  -19.170 7.156   1.00 107.30 ? 430  TRP A CD2   1 
ATOM   4104  N  NE1   . TRP D 4  430  ? 24.377  -19.316 6.951   1.00 123.53 ? 430  TRP A NE1   1 
ATOM   4105  C  CE2   . TRP D 4  430  ? 23.238  -18.945 6.288   1.00 109.16 ? 430  TRP A CE2   1 
ATOM   4106  C  CE3   . TRP D 4  430  ? 20.860  -18.869 6.713   1.00 83.75  ? 430  TRP A CE3   1 
ATOM   4107  C  CZ2   . TRP D 4  430  ? 23.074  -18.433 5.004   1.00 101.39 ? 430  TRP A CZ2   1 
ATOM   4108  C  CZ3   . TRP D 4  430  ? 20.699  -18.361 5.439   1.00 87.34  ? 430  TRP A CZ3   1 
ATOM   4109  C  CH2   . TRP D 4  430  ? 21.800  -18.148 4.599   1.00 100.05 ? 430  TRP A CH2   1 
ATOM   4110  N  N     . LYS D 4  431  ? 21.918  -18.964 12.490  1.00 69.62  ? 431  LYS A N     1 
ATOM   4111  C  CA    . LYS D 4  431  ? 21.185  -18.572 13.682  1.00 81.21  ? 431  LYS A CA    1 
ATOM   4112  C  C     . LYS D 4  431  ? 19.920  -17.827 13.281  1.00 67.65  ? 431  LYS A C     1 
ATOM   4113  O  O     . LYS D 4  431  ? 19.938  -17.001 12.362  1.00 67.68  ? 431  LYS A O     1 
ATOM   4114  C  CB    . LYS D 4  431  ? 22.050  -17.698 14.599  1.00 107.07 ? 431  LYS A CB    1 
ATOM   4115  C  CG    . LYS D 4  431  ? 23.448  -18.254 14.859  1.00 116.05 ? 431  LYS A CG    1 
ATOM   4116  C  CD    . LYS D 4  431  ? 24.224  -17.391 15.849  1.00 99.95  ? 431  LYS A CD    1 
ATOM   4117  C  CE    . LYS D 4  431  ? 25.701  -17.760 15.872  1.00 90.53  ? 431  LYS A CE    1 
ATOM   4118  N  NZ    . LYS D 4  431  ? 26.369  -17.455 14.575  1.00 94.30  ? 431  LYS A NZ    1 
ATOM   4119  N  N     . VAL D 4  432  ? 18.825  -18.126 13.971  1.00 74.99  ? 432  VAL A N     1 
ATOM   4120  C  CA    . VAL D 4  432  ? 17.537  -17.481 13.745  1.00 65.42  ? 432  VAL A CA    1 
ATOM   4121  C  C     . VAL D 4  432  ? 17.078  -16.884 15.065  1.00 75.44  ? 432  VAL A C     1 
ATOM   4122  O  O     . VAL D 4  432  ? 16.827  -17.616 16.031  1.00 74.35  ? 432  VAL A O     1 
ATOM   4123  C  CB    . VAL D 4  432  ? 16.489  -18.463 13.204  1.00 65.92  ? 432  VAL A CB    1 
ATOM   4124  C  CG1   . VAL D 4  432  ? 15.103  -17.836 13.253  1.00 65.09  ? 432  VAL A CG1   1 
ATOM   4125  C  CG2   . VAL D 4  432  ? 16.843  -18.882 11.792  1.00 75.65  ? 432  VAL A CG2   1 
ATOM   4126  N  N     . GLU D 4  433  ? 16.962  -15.558 15.106  1.00 75.65  ? 433  GLU A N     1 
ATOM   4127  C  CA    . GLU D 4  433  ? 16.472  -14.871 16.297  1.00 80.88  ? 433  GLU A CA    1 
ATOM   4128  C  C     . GLU D 4  433  ? 14.948  -14.931 16.274  1.00 74.98  ? 433  GLU A C     1 
ATOM   4129  O  O     . GLU D 4  433  ? 14.255  -14.011 15.832  1.00 71.62  ? 433  GLU A O     1 
ATOM   4130  C  CB    . GLU D 4  433  ? 16.996  -13.443 16.355  1.00 92.97  ? 433  GLU A CB    1 
ATOM   4131  C  CG    . GLU D 4  433  ? 18.509  -13.356 16.449  1.00 85.92  ? 433  GLU A CG    1 
ATOM   4132  C  CD    . GLU D 4  433  ? 18.976  -12.156 17.245  1.00 101.67 ? 433  GLU A CD    1 
ATOM   4133  O  OE1   . GLU D 4  433  ? 18.405  -11.905 18.327  1.00 109.35 ? 433  GLU A OE1   1 
ATOM   4134  O  OE2   . GLU D 4  433  ? 19.908  -11.463 16.788  1.00 113.24 ? 433  GLU A OE2   1 
ATOM   4135  N  N     . ARG D 4  434  ? 14.423  -16.052 16.759  1.00 70.63  ? 434  ARG A N     1 
ATOM   4136  C  CA    . ARG D 4  434  ? 12.990  -16.290 16.790  1.00 68.69  ? 434  ARG A CA    1 
ATOM   4137  C  C     . ARG D 4  434  ? 12.330  -15.510 17.924  1.00 84.88  ? 434  ARG A C     1 
ATOM   4138  O  O     . ARG D 4  434  ? 12.976  -15.085 18.886  1.00 86.70  ? 434  ARG A O     1 
ATOM   4139  C  CB    . ARG D 4  434  ? 12.706  -17.783 16.955  1.00 62.63  ? 434  ARG A CB    1 
ATOM   4140  C  CG    . ARG D 4  434  ? 13.743  -18.494 17.806  1.00 62.94  ? 434  ARG A CG    1 
ATOM   4141  C  CD    . ARG D 4  434  ? 13.216  -19.803 18.365  1.00 79.92  ? 434  ARG A CD    1 
ATOM   4142  N  NE    . ARG D 4  434  ? 12.230  -19.590 19.420  1.00 86.06  ? 434  ARG A NE    1 
ATOM   4143  C  CZ    . ARG D 4  434  ? 11.973  -20.463 20.390  1.00 108.82 ? 434  ARG A CZ    1 
ATOM   4144  N  NH1   . ARG D 4  434  ? 12.635  -21.610 20.446  1.00 106.72 ? 434  ARG A NH1   1 
ATOM   4145  N  NH2   . ARG D 4  434  ? 11.056  -20.186 21.307  1.00 114.72 ? 434  ARG A NH2   1 
ATOM   4146  N  N     . HIS D 4  435  ? 11.019  -15.321 17.792  1.00 94.59  ? 435  HIS A N     1 
ATOM   4147  C  CA    . HIS D 4  435  ? 10.230  -14.705 18.849  1.00 78.38  ? 435  HIS A CA    1 
ATOM   4148  C  C     . HIS D 4  435  ? 10.277  -15.566 20.106  1.00 79.51  ? 435  HIS A C     1 
ATOM   4149  O  O     . HIS D 4  435  ? 10.454  -16.785 20.044  1.00 98.41  ? 435  HIS A O     1 
ATOM   4150  C  CB    . HIS D 4  435  ? 8.774   -14.541 18.399  1.00 73.20  ? 435  HIS A CB    1 
ATOM   4151  C  CG    . HIS D 4  435  ? 8.491   -13.255 17.682  1.00 89.21  ? 435  HIS A CG    1 
ATOM   4152  N  ND1   . HIS D 4  435  ? 7.210   -12.821 17.412  1.00 85.81  ? 435  HIS A ND1   1 
ATOM   4153  C  CD2   . HIS D 4  435  ? 9.320   -12.312 17.175  1.00 90.37  ? 435  HIS A CD2   1 
ATOM   4154  C  CE1   . HIS D 4  435  ? 7.263   -11.664 16.776  1.00 79.07  ? 435  HIS A CE1   1 
ATOM   4155  N  NE2   . HIS D 4  435  ? 8.532   -11.333 16.620  1.00 80.05  ? 435  HIS A NE2   1 
ATOM   4156  N  N     . ILE D 4  436  ? 10.112  -14.924 21.261  1.00 61.51  ? 436  ILE A N     1 
ATOM   4157  C  CA    . ILE D 4  436  ? 9.820   -15.688 22.469  1.00 89.17  ? 436  ILE A CA    1 
ATOM   4158  C  C     . ILE D 4  436  ? 8.515   -16.444 22.277  1.00 79.43  ? 436  ILE A C     1 
ATOM   4159  O  O     . ILE D 4  436  ? 7.514   -15.893 21.797  1.00 82.33  ? 436  ILE A O     1 
ATOM   4160  C  CB    . ILE D 4  436  ? 9.784   -14.770 23.705  1.00 82.38  ? 436  ILE A CB    1 
ATOM   4161  C  CG1   . ILE D 4  436  ? 11.144  -14.742 24.420  1.00 57.81  ? 436  ILE A CG1   1 
ATOM   4162  C  CG2   . ILE D 4  436  ? 8.668   -15.172 24.662  1.00 73.31  ? 436  ILE A CG2   1 
ATOM   4163  C  CD1   . ILE D 4  436  ? 12.320  -14.391 23.527  1.00 58.16  ? 436  ILE A CD1   1 
ATOM   4164  N  N     . MET D 4  437  ? 8.524   -17.723 22.650  1.00 71.84  ? 437  MET A N     1 
ATOM   4165  C  CA    . MET D 4  437  ? 7.416   -18.630 22.385  1.00 77.67  ? 437  MET A CA    1 
ATOM   4166  C  C     . MET D 4  437  ? 7.004   -19.331 23.672  1.00 71.40  ? 437  MET A C     1 
ATOM   4167  O  O     . MET D 4  437  ? 7.656   -19.208 24.712  1.00 74.05  ? 437  MET A O     1 
ATOM   4168  C  CB    . MET D 4  437  ? 7.800   -19.659 21.319  1.00 80.88  ? 437  MET A CB    1 
ATOM   4169  C  CG    . MET D 4  437  ? 6.692   -20.012 20.346  1.00 69.59  ? 437  MET A CG    1 
ATOM   4170  S  SD    . MET D 4  437  ? 7.368   -21.004 19.007  1.00 106.79 ? 437  MET A SD    1 
ATOM   4171  C  CE    . MET D 4  437  ? 8.873   -20.094 18.655  1.00 96.08  ? 437  MET A CE    1 
ATOM   4172  N  N     . ASP D 4  438  ? 5.913   -20.089 23.582  1.00 73.04  ? 438  ASP A N     1 
ATOM   4173  C  CA    . ASP D 4  438  ? 5.349   -20.755 24.750  1.00 63.47  ? 438  ASP A CA    1 
ATOM   4174  C  C     . ASP D 4  438  ? 6.339   -21.745 25.355  1.00 80.93  ? 438  ASP A C     1 
ATOM   4175  O  O     . ASP D 4  438  ? 7.138   -22.369 24.651  1.00 78.24  ? 438  ASP A O     1 
ATOM   4176  C  CB    . ASP D 4  438  ? 4.056   -21.482 24.376  1.00 64.09  ? 438  ASP A CB    1 
ATOM   4177  C  CG    . ASP D 4  438  ? 2.818   -20.703 24.768  1.00 75.27  ? 438  ASP A CG    1 
ATOM   4178  O  OD1   . ASP D 4  438  ? 2.969   -19.544 25.202  1.00 75.80  ? 438  ASP A OD1   1 
ATOM   4179  O  OD2   . ASP D 4  438  ? 1.697   -21.238 24.633  1.00 75.45  ? 438  ASP A OD2   1 
ATOM   4180  N  N     . ASN D 4  439  ? 6.273   -21.879 26.683  1.00 87.06  ? 439  ASN A N     1 
ATOM   4181  C  CA    . ASN D 4  439  ? 7.054   -22.865 27.434  1.00 66.29  ? 439  ASN A CA    1 
ATOM   4182  C  C     . ASN D 4  439  ? 8.555   -22.696 27.192  1.00 84.20  ? 439  ASN A C     1 
ATOM   4183  O  O     . ASN D 4  439  ? 9.278   -23.655 26.911  1.00 93.02  ? 439  ASN A O     1 
ATOM   4184  C  CB    . ASN D 4  439  ? 6.597   -24.289 27.107  1.00 72.30  ? 439  ASN A CB    1 
ATOM   4185  C  CG    . ASN D 4  439  ? 5.187   -24.574 27.596  1.00 80.44  ? 439  ASN A CG    1 
ATOM   4186  O  OD1   . ASN D 4  439  ? 4.651   -23.852 28.439  1.00 65.78  ? 439  ASN A OD1   1 
ATOM   4187  N  ND2   . ASN D 4  439  ? 4.576   -25.628 27.063  1.00 92.91  ? 439  ASN A ND2   1 
ATOM   4188  N  N     . ASP D 4  440  ? 9.019   -21.451 27.302  1.00 81.36  ? 440  ASP A N     1 
ATOM   4189  C  CA    . ASP D 4  440  ? 10.432  -21.115 27.296  1.00 70.46  ? 440  ASP A CA    1 
ATOM   4190  C  C     . ASP D 4  440  ? 10.856  -20.621 28.677  1.00 76.66  ? 440  ASP A C     1 
ATOM   4191  O  O     . ASP D 4  440  ? 10.033  -20.097 29.434  1.00 83.33  ? 440  ASP A O     1 
ATOM   4192  C  CB    . ASP D 4  440  ? 10.750  -20.037 26.252  1.00 67.76  ? 440  ASP A CB    1 
ATOM   4193  C  CG    . ASP D 4  440  ? 10.440  -20.484 24.834  1.00 85.68  ? 440  ASP A CG    1 
ATOM   4194  O  OD1   . ASP D 4  440  ? 9.956   -21.621 24.653  1.00 103.91 ? 440  ASP A OD1   1 
ATOM   4195  O  OD2   . ASP D 4  440  ? 10.683  -19.692 23.898  1.00 77.28  ? 440  ASP A OD2   1 
ATOM   4196  N  N     . PRO D 4  441  ? 12.127  -20.788 29.048  1.00 77.80  ? 441  PRO A N     1 
ATOM   4197  C  CA    . PRO D 4  441  ? 12.583  -20.306 30.360  1.00 80.39  ? 441  PRO A CA    1 
ATOM   4198  C  C     . PRO D 4  441  ? 12.860  -18.808 30.344  1.00 82.99  ? 441  PRO A C     1 
ATOM   4199  O  O     . PRO D 4  441  ? 13.570  -18.303 29.472  1.00 96.61  ? 441  PRO A O     1 
ATOM   4200  C  CB    . PRO D 4  441  ? 13.868  -21.107 30.601  1.00 90.28  ? 441  PRO A CB    1 
ATOM   4201  C  CG    . PRO D 4  441  ? 14.379  -21.393 29.232  1.00 87.69  ? 441  PRO A CG    1 
ATOM   4202  C  CD    . PRO D 4  441  ? 13.163  -21.577 28.358  1.00 86.79  ? 441  PRO A CD    1 
ATOM   4203  N  N     . VAL D 4  442  ? 12.294  -18.101 31.320  1.00 58.26  ? 442  VAL A N     1 
ATOM   4204  C  CA    . VAL D 4  442  ? 12.521  -16.673 31.494  1.00 60.27  ? 442  VAL A CA    1 
ATOM   4205  C  C     . VAL D 4  442  ? 12.658  -16.390 32.982  1.00 68.30  ? 442  VAL A C     1 
ATOM   4206  O  O     . VAL D 4  442  ? 12.085  -17.090 33.823  1.00 62.20  ? 442  VAL A O     1 
ATOM   4207  C  CB    . VAL D 4  442  ? 11.392  -15.811 30.880  1.00 61.01  ? 442  VAL A CB    1 
ATOM   4208  C  CG1   . VAL D 4  442  ? 11.495  -15.786 29.361  1.00 57.17  ? 442  VAL A CG1   1 
ATOM   4209  C  CG2   . VAL D 4  442  ? 10.026  -16.318 31.322  1.00 56.82  ? 442  VAL A CG2   1 
ATOM   4210  N  N     . LEU D 4  443  ? 13.425  -15.355 33.307  1.00 83.36  ? 443  LEU A N     1 
ATOM   4211  C  CA    . LEU D 4  443  ? 13.635  -14.957 34.694  1.00 81.06  ? 443  LEU A CA    1 
ATOM   4212  C  C     . LEU D 4  443  ? 12.594  -13.915 35.072  1.00 71.10  ? 443  LEU A C     1 
ATOM   4213  O  O     . LEU D 4  443  ? 12.603  -12.799 34.546  1.00 76.59  ? 443  LEU A O     1 
ATOM   4214  C  CB    . LEU D 4  443  ? 15.038  -14.403 34.905  1.00 62.33  ? 443  LEU A CB    1 
ATOM   4215  C  CG    . LEU D 4  443  ? 15.883  -15.232 35.860  1.00 67.19  ? 443  LEU A CG    1 
ATOM   4216  C  CD1   . LEU D 4  443  ? 17.239  -14.592 35.980  1.00 82.70  ? 443  LEU A CD1   1 
ATOM   4217  C  CD2   . LEU D 4  443  ? 15.214  -15.338 37.222  1.00 70.80  ? 443  LEU A CD2   1 
ATOM   4218  N  N     . PHE D 4  444  ? 11.706  -14.275 35.990  1.00 55.49  ? 444  PHE A N     1 
ATOM   4219  C  CA    . PHE D 4  444  ? 10.673  -13.379 36.480  1.00 54.82  ? 444  PHE A CA    1 
ATOM   4220  C  C     . PHE D 4  444  ? 11.093  -12.818 37.831  1.00 78.14  ? 444  PHE A C     1 
ATOM   4221  O  O     . PHE D 4  444  ? 11.498  -13.572 38.722  1.00 93.98  ? 444  PHE A O     1 
ATOM   4222  C  CB    . PHE D 4  444  ? 9.336   -14.110 36.579  1.00 54.94  ? 444  PHE A CB    1 
ATOM   4223  C  CG    . PHE D 4  444  ? 8.156   -13.199 36.576  1.00 54.34  ? 444  PHE A CG    1 
ATOM   4224  C  CD1   . PHE D 4  444  ? 8.082   -12.163 35.665  1.00 53.92  ? 444  PHE A CD1   1 
ATOM   4225  C  CD2   . PHE D 4  444  ? 7.101   -13.397 37.448  1.00 54.27  ? 444  PHE A CD2   1 
ATOM   4226  C  CE1   . PHE D 4  444  ? 6.999   -11.316 35.648  1.00 53.43  ? 444  PHE A CE1   1 
ATOM   4227  C  CE2   . PHE D 4  444  ? 6.007   -12.558 37.427  1.00 53.78  ? 444  PHE A CE2   1 
ATOM   4228  C  CZ    . PHE D 4  444  ? 5.959   -11.514 36.525  1.00 56.42  ? 444  PHE A CZ    1 
ATOM   4229  N  N     . ASN D 4  445  ? 10.992  -11.498 37.978  1.00 88.89  ? 445  ASN A N     1 
ATOM   4230  C  CA    . ASN D 4  445  ? 11.565  -10.817 39.127  1.00 77.10  ? 445  ASN A CA    1 
ATOM   4231  C  C     . ASN D 4  445  ? 10.682  -9.642  39.521  1.00 74.19  ? 445  ASN A C     1 
ATOM   4232  O  O     . ASN D 4  445  ? 9.994   -9.053  38.683  1.00 84.19  ? 445  ASN A O     1 
ATOM   4233  C  CB    . ASN D 4  445  ? 12.992  -10.334 38.816  1.00 70.50  ? 445  ASN A CB    1 
ATOM   4234  C  CG    . ASN D 4  445  ? 13.564  -9.435  39.899  1.00 77.72  ? 445  ASN A CG    1 
ATOM   4235  O  OD1   . ASN D 4  445  ? 13.139  -9.481  41.053  1.00 88.08  ? 445  ASN A OD1   1 
ATOM   4236  N  ND2   . ASN D 4  445  ? 14.526  -8.600  39.524  1.00 60.26  ? 445  ASN A ND2   1 
ATOM   4237  N  N     . ARG D 4  446  ? 10.712  -9.309  40.811  1.00 76.73  ? 446  ARG A N     1 
ATOM   4238  C  CA    . ARG D 4  446  ? 10.093  -8.094  41.329  1.00 76.62  ? 446  ARG A CA    1 
ATOM   4239  C  C     . ARG D 4  446  ? 11.067  -7.430  42.290  1.00 63.87  ? 446  ARG A C     1 
ATOM   4240  O  O     . ARG D 4  446  ? 11.525  -8.066  43.243  1.00 77.07  ? 446  ARG A O     1 
ATOM   4241  C  CB    . ARG D 4  446  ? 8.770   -8.392  42.041  1.00 75.34  ? 446  ARG A CB    1 
ATOM   4242  C  CG    . ARG D 4  446  ? 8.128   -7.170  42.684  1.00 65.51  ? 446  ARG A CG    1 
ATOM   4243  C  CD    . ARG D 4  446  ? 7.333   -7.552  43.919  1.00 65.93  ? 446  ARG A CD    1 
ATOM   4244  N  NE    . ARG D 4  446  ? 6.365   -6.529  44.301  1.00 86.46  ? 446  ARG A NE    1 
ATOM   4245  C  CZ    . ARG D 4  446  ? 6.633   -5.518  45.121  1.00 60.51  ? 446  ARG A CZ    1 
ATOM   4246  N  NH1   . ARG D 4  446  ? 7.846   -5.390  45.643  1.00 51.72  ? 446  ARG A NH1   1 
ATOM   4247  N  NH2   . ARG D 4  446  ? 5.691   -4.633  45.418  1.00 61.84  ? 446  ARG A NH2   1 
ATOM   4248  N  N     . GLN D 4  447  ? 11.392  -6.164  42.035  1.00 52.69  ? 447  GLN A N     1 
ATOM   4249  C  CA    . GLN D 4  447  ? 12.139  -5.389  43.009  1.00 52.72  ? 447  GLN A CA    1 
ATOM   4250  C  C     . GLN D 4  447  ? 11.229  -5.014  44.179  1.00 58.82  ? 447  GLN A C     1 
ATOM   4251  O  O     . GLN D 4  447  ? 10.024  -4.814  43.999  1.00 77.14  ? 447  GLN A O     1 
ATOM   4252  C  CB    . GLN D 4  447  ? 12.723  -4.128  42.374  1.00 85.86  ? 447  GLN A CB    1 
ATOM   4253  C  CG    . GLN D 4  447  ? 13.954  -4.372  41.525  1.00 97.66  ? 447  GLN A CG    1 
ATOM   4254  C  CD    . GLN D 4  447  ? 13.622  -4.614  40.070  1.00 82.03  ? 447  GLN A CD    1 
ATOM   4255  O  OE1   . GLN D 4  447  ? 12.507  -4.342  39.623  1.00 77.18  ? 447  GLN A OE1   1 
ATOM   4256  N  NE2   . GLN D 4  447  ? 14.590  -5.130  39.319  1.00 64.18  ? 447  GLN A NE2   1 
ATOM   4257  N  N     . PRO D 4  448  ? 11.781  -4.921  45.401  1.00 52.33  ? 448  PRO A N     1 
ATOM   4258  C  CA    . PRO D 4  448  ? 13.196  -5.111  45.727  1.00 52.75  ? 448  PRO A CA    1 
ATOM   4259  C  C     . PRO D 4  448  ? 13.595  -6.581  45.855  1.00 77.80  ? 448  PRO A C     1 
ATOM   4260  O  O     . PRO D 4  448  ? 12.840  -7.396  46.394  1.00 59.90  ? 448  PRO A O     1 
ATOM   4261  C  CB    . PRO D 4  448  ? 13.333  -4.390  47.065  1.00 52.80  ? 448  PRO A CB    1 
ATOM   4262  C  CG    . PRO D 4  448  ? 11.999  -4.571  47.713  1.00 52.58  ? 448  PRO A CG    1 
ATOM   4263  C  CD    . PRO D 4  448  ? 10.972  -4.665  46.606  1.00 52.19  ? 448  PRO A CD    1 
ATOM   4264  N  N     . SER D 4  449  ? 14.785  -6.907  45.353  1.00 103.62 ? 449  SER A N     1 
ATOM   4265  C  CA    . SER D 4  449  ? 15.273  -8.282  45.314  1.00 93.90  ? 449  SER A CA    1 
ATOM   4266  C  C     . SER D 4  449  ? 16.044  -8.567  46.598  1.00 105.15 ? 449  SER A C     1 
ATOM   4267  O  O     . SER D 4  449  ? 17.228  -8.236  46.714  1.00 125.56 ? 449  SER A O     1 
ATOM   4268  C  CB    . SER D 4  449  ? 16.140  -8.504  44.081  1.00 89.22  ? 449  SER A CB    1 
ATOM   4269  O  OG    . SER D 4  449  ? 15.498  -8.039  42.906  1.00 104.85 ? 449  SER A OG    1 
ATOM   4270  N  N     . LEU D 4  450  ? 15.364  -9.175  47.573  1.00 75.44  ? 450  LEU A N     1 
ATOM   4271  C  CA    . LEU D 4  450  ? 15.990  -9.626  48.809  1.00 65.98  ? 450  LEU A CA    1 
ATOM   4272  C  C     . LEU D 4  450  ? 16.034  -11.147 48.894  1.00 81.33  ? 450  LEU A C     1 
ATOM   4273  O  O     . LEU D 4  450  ? 16.266  -11.705 49.970  1.00 58.15  ? 450  LEU A O     1 
ATOM   4274  C  CB    . LEU D 4  450  ? 15.252  -9.060  50.024  1.00 70.17  ? 450  LEU A CB    1 
ATOM   4275  C  CG    . LEU D 4  450  ? 14.912  -7.567  50.066  1.00 72.77  ? 450  LEU A CG    1 
ATOM   4276  C  CD1   . LEU D 4  450  ? 13.509  -7.324  49.526  1.00 70.22  ? 450  LEU A CD1   1 
ATOM   4277  C  CD2   . LEU D 4  450  ? 15.047  -7.004  51.478  1.00 103.18 ? 450  LEU A CD2   1 
ATOM   4278  N  N     . HIS D 4  451  ? 15.821  -11.827 47.772  1.00 118.99 ? 451  HIS A N     1 
ATOM   4279  C  CA    . HIS D 4  451  ? 15.538  -13.252 47.760  1.00 102.29 ? 451  HIS A CA    1 
ATOM   4280  C  C     . HIS D 4  451  ? 16.084  -13.884 46.493  1.00 108.29 ? 451  HIS A C     1 
ATOM   4281  O  O     . HIS D 4  451  ? 16.111  -13.262 45.429  1.00 98.25  ? 451  HIS A O     1 
ATOM   4282  C  CB    . HIS D 4  451  ? 14.032  -13.522 47.807  1.00 98.07  ? 451  HIS A CB    1 
ATOM   4283  C  CG    . HIS D 4  451  ? 13.461  -13.606 49.183  1.00 91.33  ? 451  HIS A CG    1 
ATOM   4284  N  ND1   . HIS D 4  451  ? 12.128  -13.372 49.440  1.00 86.23  ? 451  HIS A ND1   1 
ATOM   4285  C  CD2   . HIS D 4  451  ? 14.026  -13.916 50.372  1.00 96.42  ? 451  HIS A CD2   1 
ATOM   4286  C  CE1   . HIS D 4  451  ? 11.897  -13.529 50.730  1.00 99.57  ? 451  HIS A CE1   1 
ATOM   4287  N  NE2   . HIS D 4  451  ? 13.033  -13.857 51.319  1.00 109.52 ? 451  HIS A NE2   1 
ATOM   4288  N  N     . LYS D 4  452  ? 16.474  -15.153 46.608  1.00 94.36  ? 452  LYS A N     1 
ATOM   4289  C  CA    . LYS D 4  452  ? 16.455  -15.997 45.425  1.00 66.24  ? 452  LYS A CA    1 
ATOM   4290  C  C     . LYS D 4  452  ? 15.021  -16.240 44.964  1.00 79.22  ? 452  LYS A C     1 
ATOM   4291  O  O     . LYS D 4  452  ? 14.769  -16.370 43.759  1.00 84.95  ? 452  LYS A O     1 
ATOM   4292  C  CB    . LYS D 4  452  ? 17.186  -17.316 45.698  1.00 62.45  ? 452  LYS A CB    1 
ATOM   4293  C  CG    . LYS D 4  452  ? 17.062  -17.846 47.114  1.00 74.85  ? 452  LYS A CG    1 
ATOM   4294  C  CD    . LYS D 4  452  ? 17.170  -19.369 47.165  1.00 77.35  ? 452  LYS A CD    1 
ATOM   4295  C  CE    . LYS D 4  452  ? 18.393  -19.888 46.429  1.00 87.31  ? 452  LYS A CE    1 
ATOM   4296  N  NZ    . LYS D 4  452  ? 18.427  -21.379 46.437  1.00 94.52  ? 452  LYS A NZ    1 
ATOM   4297  N  N     . MET D 4  453  ? 14.069  -16.273 45.903  1.00 80.90  ? 453  MET A N     1 
ATOM   4298  C  CA    . MET D 4  453  ? 12.650  -16.427 45.592  1.00 83.12  ? 453  MET A CA    1 
ATOM   4299  C  C     . MET D 4  453  ? 12.104  -15.194 44.883  1.00 58.55  ? 453  MET A C     1 
ATOM   4300  O  O     . MET D 4  453  ? 10.926  -15.162 44.499  1.00 59.97  ? 453  MET A O     1 
ATOM   4301  C  CB    . MET D 4  453  ? 11.832  -16.691 46.861  1.00 99.36  ? 453  MET A CB    1 
ATOM   4302  C  CG    . MET D 4  453  ? 12.083  -18.038 47.505  1.00 92.29  ? 453  MET A CG    1 
ATOM   4303  S  SD    . MET D 4  453  ? 13.825  -18.288 47.865  1.00 101.44 ? 453  MET A SD    1 
ATOM   4304  C  CE    . MET D 4  453  ? 13.716  -19.291 49.340  1.00 119.92 ? 453  MET A CE    1 
ATOM   4305  N  N     . SER D 4  454  ? 12.931  -14.168 44.723  1.00 58.08  ? 454  SER A N     1 
ATOM   4306  C  CA    . SER D 4  454  ? 12.514  -12.973 43.999  1.00 81.99  ? 454  SER A CA    1 
ATOM   4307  C  C     . SER D 4  454  ? 12.946  -12.982 42.536  1.00 87.33  ? 454  SER A C     1 
ATOM   4308  O  O     . SER D 4  454  ? 12.552  -12.083 41.788  1.00 57.29  ? 454  SER A O     1 
ATOM   4309  C  CB    . SER D 4  454  ? 13.052  -11.710 44.683  1.00 84.38  ? 454  SER A CB    1 
ATOM   4310  O  OG    . SER D 4  454  ? 12.335  -11.443 45.875  1.00 90.21  ? 454  SER A OG    1 
ATOM   4311  N  N     . MET D 4  455  ? 13.749  -13.962 42.113  1.00 81.64  ? 455  MET A N     1 
ATOM   4312  C  CA    . MET D 4  455  ? 14.112  -14.133 40.700  1.00 87.45  ? 455  MET A CA    1 
ATOM   4313  C  C     . MET D 4  455  ? 14.022  -15.627 40.401  1.00 91.99  ? 455  MET A C     1 
ATOM   4314  O  O     . MET D 4  455  ? 14.981  -16.376 40.606  1.00 112.71 ? 455  MET A O     1 
ATOM   4315  C  CB    . MET D 4  455  ? 15.497  -13.584 40.386  1.00 81.12  ? 455  MET A CB    1 
ATOM   4316  C  CG    . MET D 4  455  ? 15.665  -12.107 40.655  1.00 89.89  ? 455  MET A CG    1 
ATOM   4317  S  SD    . MET D 4  455  ? 17.242  -11.498 40.035  1.00 95.21  ? 455  MET A SD    1 
ATOM   4318  C  CE    . MET D 4  455  ? 16.766  -10.900 38.422  1.00 86.81  ? 455  MET A CE    1 
ATOM   4319  N  N     . MET D 4  456  ? 12.861  -16.055 39.921  1.00 70.84  ? 456  MET A N     1 
ATOM   4320  C  CA    . MET D 4  456  ? 12.619  -17.455 39.627  1.00 84.98  ? 456  MET A CA    1 
ATOM   4321  C  C     . MET D 4  456  ? 12.343  -17.633 38.141  1.00 100.87 ? 456  MET A C     1 
ATOM   4322  O  O     . MET D 4  456  ? 11.737  -16.773 37.494  1.00 73.94  ? 456  MET A O     1 
ATOM   4323  C  CB    . MET D 4  456  ? 11.446  -18.001 40.444  1.00 73.48  ? 456  MET A CB    1 
ATOM   4324  C  CG    . MET D 4  456  ? 11.723  -18.095 41.930  1.00 70.01  ? 456  MET A CG    1 
ATOM   4325  S  SD    . MET D 4  456  ? 10.371  -18.881 42.833  1.00 73.22  ? 456  MET A SD    1 
ATOM   4326  C  CE    . MET D 4  456  ? 9.089   -17.644 42.720  1.00 61.41  ? 456  MET A CE    1 
ATOM   4327  N  N     . ALA D 4  457  ? 12.803  -18.760 37.607  1.00 86.59  ? 457  ALA A N     1 
ATOM   4328  C  CA    . ALA D 4  457  ? 12.515  -19.108 36.227  1.00 58.26  ? 457  ALA A CA    1 
ATOM   4329  C  C     . ALA D 4  457  ? 11.034  -19.412 36.058  1.00 74.13  ? 457  ALA A C     1 
ATOM   4330  O  O     . ALA D 4  457  ? 10.373  -19.912 36.970  1.00 61.28  ? 457  ALA A O     1 
ATOM   4331  C  CB    . ALA D 4  457  ? 13.343  -20.315 35.797  1.00 59.23  ? 457  ALA A CB    1 
ATOM   4332  N  N     . HIS D 4  458  ? 10.513  -19.111 34.871  1.00 99.90  ? 458  HIS A N     1 
ATOM   4333  C  CA    . HIS D 4  458  ? 9.107   -19.340 34.579  1.00 84.38  ? 458  HIS A CA    1 
ATOM   4334  C  C     . HIS D 4  458  ? 8.957   -19.898 33.171  1.00 89.14  ? 458  HIS A C     1 
ATOM   4335  O  O     . HIS D 4  458  ? 9.827   -19.724 32.314  1.00 86.85  ? 458  HIS A O     1 
ATOM   4336  C  CB    . HIS D 4  458  ? 8.281   -18.055 34.720  1.00 67.77  ? 458  HIS A CB    1 
ATOM   4337  C  CG    . HIS D 4  458  ? 7.905   -17.722 36.131  1.00 73.35  ? 458  HIS A CG    1 
ATOM   4338  N  ND1   . HIS D 4  458  ? 6.599   -17.714 36.572  1.00 67.55  ? 458  HIS A ND1   1 
ATOM   4339  C  CD2   . HIS D 4  458  ? 8.664   -17.368 37.196  1.00 63.84  ? 458  HIS A CD2   1 
ATOM   4340  C  CE1   . HIS D 4  458  ? 6.569   -17.375 37.848  1.00 69.96  ? 458  HIS A CE1   1 
ATOM   4341  N  NE2   . HIS D 4  458  ? 7.809   -17.157 38.251  1.00 63.16  ? 458  HIS A NE2   1 
ATOM   4342  N  N     . ARG D 4  459  ? 7.834   -20.577 32.947  1.00 84.93  ? 459  ARG A N     1 
ATOM   4343  C  CA    . ARG D 4  459  ? 7.467   -21.084 31.631  1.00 73.98  ? 459  ARG A CA    1 
ATOM   4344  C  C     . ARG D 4  459  ? 6.666   -20.028 30.882  1.00 76.41  ? 459  ARG A C     1 
ATOM   4345  O  O     . ARG D 4  459  ? 5.651   -19.539 31.387  1.00 77.02  ? 459  ARG A O     1 
ATOM   4346  C  CB    . ARG D 4  459  ? 6.644   -22.367 31.759  1.00 69.83  ? 459  ARG A CB    1 
ATOM   4347  C  CG    . ARG D 4  459  ? 7.456   -23.648 31.703  1.00 67.24  ? 459  ARG A CG    1 
ATOM   4348  C  CD    . ARG D 4  459  ? 6.646   -24.824 32.233  1.00 69.88  ? 459  ARG A CD    1 
ATOM   4349  N  NE    . ARG D 4  459  ? 5.336   -24.929 31.596  1.00 67.92  ? 459  ARG A NE    1 
ATOM   4350  C  CZ    . ARG D 4  459  ? 4.249   -25.413 32.192  1.00 75.04  ? 459  ARG A CZ    1 
ATOM   4351  N  NH1   . ARG D 4  459  ? 4.306   -25.836 33.447  1.00 80.65  ? 459  ARG A NH1   1 
ATOM   4352  N  NH2   . ARG D 4  459  ? 3.100   -25.471 31.531  1.00 78.75  ? 459  ARG A NH2   1 
ATOM   4353  N  N     . VAL D 4  460  ? 7.121   -19.678 29.681  1.00 76.69  ? 460  VAL A N     1 
ATOM   4354  C  CA    . VAL D 4  460  ? 6.457   -18.626 28.925  1.00 68.93  ? 460  VAL A CA    1 
ATOM   4355  C  C     . VAL D 4  460  ? 5.078   -19.102 28.490  1.00 69.41  ? 460  VAL A C     1 
ATOM   4356  O  O     . VAL D 4  460  ? 4.916   -20.221 27.984  1.00 75.31  ? 460  VAL A O     1 
ATOM   4357  C  CB    . VAL D 4  460  ? 7.303   -18.201 27.718  1.00 71.20  ? 460  VAL A CB    1 
ATOM   4358  C  CG1   . VAL D 4  460  ? 6.550   -17.179 26.893  1.00 94.07  ? 460  VAL A CG1   1 
ATOM   4359  C  CG2   . VAL D 4  460  ? 8.624   -17.628 28.176  1.00 70.45  ? 460  VAL A CG2   1 
ATOM   4360  N  N     . LYS D 4  461  ? 4.072   -18.253 28.702  1.00 62.60  ? 461  LYS A N     1 
ATOM   4361  C  CA    . LYS D 4  461  ? 2.704   -18.508 28.251  1.00 60.45  ? 461  LYS A CA    1 
ATOM   4362  C  C     . LYS D 4  461  ? 2.196   -17.207 27.635  1.00 61.00  ? 461  LYS A C     1 
ATOM   4363  O  O     . LYS D 4  461  ? 1.779   -16.296 28.359  1.00 89.47  ? 461  LYS A O     1 
ATOM   4364  C  CB    . LYS D 4  461  ? 1.813   -18.973 29.397  1.00 59.96  ? 461  LYS A CB    1 
ATOM   4365  C  CG    . LYS D 4  461  ? 0.337   -19.105 29.041  1.00 60.24  ? 461  LYS A CG    1 
ATOM   4366  C  CD    . LYS D 4  461  ? 0.090   -20.193 28.005  1.00 78.97  ? 461  LYS A CD    1 
ATOM   4367  C  CE    . LYS D 4  461  ? -1.402  -20.423 27.799  1.00 82.69  ? 461  LYS A CE    1 
ATOM   4368  N  NZ    . LYS D 4  461  ? -1.681  -21.477 26.784  1.00 80.04  ? 461  LYS A NZ    1 
ATOM   4369  N  N     . VAL D 4  462  ? 2.242   -17.118 26.304  1.00 70.22  ? 462  VAL A N     1 
ATOM   4370  C  CA    . VAL D 4  462  ? 1.880   -15.881 25.619  1.00 66.33  ? 462  VAL A CA    1 
ATOM   4371  C  C     . VAL D 4  462  ? 0.381   -15.653 25.750  1.00 60.01  ? 462  VAL A C     1 
ATOM   4372  O  O     . VAL D 4  462  ? -0.427  -16.552 25.483  1.00 62.95  ? 462  VAL A O     1 
ATOM   4373  C  CB    . VAL D 4  462  ? 2.317   -15.929 24.147  1.00 59.59  ? 462  VAL A CB    1 
ATOM   4374  C  CG1   . VAL D 4  462  ? 2.122   -14.569 23.495  1.00 59.91  ? 462  VAL A CG1   1 
ATOM   4375  C  CG2   . VAL D 4  462  ? 3.770   -16.380 24.027  1.00 59.87  ? 462  VAL A CG2   1 
ATOM   4376  N  N     . ILE D 4  463  ? 0.000   -14.446 26.158  1.00 60.01  ? 463  ILE A N     1 
ATOM   4377  C  CA    . ILE D 4  463  ? -1.399  -14.147 26.460  1.00 61.59  ? 463  ILE A CA    1 
ATOM   4378  C  C     . ILE D 4  463  ? -1.793  -12.858 25.749  1.00 70.44  ? 463  ILE A C     1 
ATOM   4379  O  O     . ILE D 4  463  ? -0.936  -12.031 25.400  1.00 71.91  ? 463  ILE A O     1 
ATOM   4380  C  CB    . ILE D 4  463  ? -1.649  -14.076 27.988  1.00 70.33  ? 463  ILE A CB    1 
ATOM   4381  C  CG1   . ILE D 4  463  ? -0.471  -13.429 28.727  1.00 68.55  ? 463  ILE A CG1   1 
ATOM   4382  C  CG2   . ILE D 4  463  ? -1.944  -15.467 28.533  1.00 70.30  ? 463  ILE A CG2   1 
ATOM   4383  C  CD1   . ILE D 4  463  ? -0.369  -11.931 28.585  1.00 62.72  ? 463  ILE A CD1   1 
ATOM   4384  N  N     . PRO D 4  464  ? -3.097  -12.667 25.500  1.00 61.73  ? 464  PRO A N     1 
ATOM   4385  C  CA    . PRO D 4  464  ? -3.528  -11.607 24.579  1.00 82.02  ? 464  PRO A CA    1 
ATOM   4386  C  C     . PRO D 4  464  ? -3.736  -10.240 25.212  1.00 98.62  ? 464  PRO A C     1 
ATOM   4387  O  O     . PRO D 4  464  ? -4.416  -9.396  24.624  1.00 138.79 ? 464  PRO A O     1 
ATOM   4388  C  CB    . PRO D 4  464  ? -4.851  -12.155 24.035  1.00 107.87 ? 464  PRO A CB    1 
ATOM   4389  C  CG    . PRO D 4  464  ? -5.396  -12.934 25.176  1.00 90.65  ? 464  PRO A CG    1 
ATOM   4390  C  CD    . PRO D 4  464  ? -4.207  -13.581 25.831  1.00 68.13  ? 464  PRO A CD    1 
ATOM   4391  N  N     . TYR D 4  465  ? -3.204  -10.002 26.405  1.00 68.07  ? 465  TYR A N     1 
ATOM   4392  C  CA    . TYR D 4  465  ? -3.357  -8.707  27.049  1.00 63.66  ? 465  TYR A CA    1 
ATOM   4393  C  C     . TYR D 4  465  ? -2.009  -8.233  27.572  1.00 83.01  ? 465  TYR A C     1 
ATOM   4394  O  O     . TYR D 4  465  ? -1.102  -9.029  27.828  1.00 103.16 ? 465  TYR A O     1 
ATOM   4395  C  CB    . TYR D 4  465  ? -4.382  -8.751  28.190  1.00 76.22  ? 465  TYR A CB    1 
ATOM   4396  C  CG    . TYR D 4  465  ? -5.820  -8.834  27.726  1.00 55.40  ? 465  TYR A CG    1 
ATOM   4397  C  CD1   . TYR D 4  465  ? -6.322  -9.995  27.152  1.00 55.35  ? 465  TYR A CD1   1 
ATOM   4398  C  CD2   . TYR D 4  465  ? -6.672  -7.746  27.852  1.00 63.46  ? 465  TYR A CD2   1 
ATOM   4399  C  CE1   . TYR D 4  465  ? -7.636  -10.073 26.729  1.00 55.81  ? 465  TYR A CE1   1 
ATOM   4400  C  CE2   . TYR D 4  465  ? -7.990  -7.816  27.430  1.00 66.93  ? 465  TYR A CE2   1 
ATOM   4401  C  CZ    . TYR D 4  465  ? -8.466  -8.981  26.869  1.00 66.09  ? 465  TYR A CZ    1 
ATOM   4402  O  OH    . TYR D 4  465  ? -9.775  -9.051  26.448  1.00 68.11  ? 465  TYR A OH    1 
ATOM   4403  N  N     . SER D 4  466  ? -1.886  -6.918  27.726  1.00 74.75  ? 466  SER A N     1 
ATOM   4404  C  CA    . SER D 4  466  ? -0.618  -6.308  28.126  1.00 72.83  ? 466  SER A CA    1 
ATOM   4405  C  C     . SER D 4  466  ? -0.477  -6.212  29.644  1.00 86.03  ? 466  SER A C     1 
ATOM   4406  O  O     . SER D 4  466  ? -0.190  -5.151  30.190  1.00 88.94  ? 466  SER A O     1 
ATOM   4407  C  CB    . SER D 4  466  ? -0.473  -4.937  27.473  1.00 74.37  ? 466  SER A CB    1 
ATOM   4408  O  OG    . SER D 4  466  ? -1.637  -4.153  27.664  1.00 100.76 ? 466  SER A OG    1 
ATOM   4409  N  N     . THR D 4  467  ? -0.679  -7.332  30.338  1.00 114.86 ? 467  THR A N     1 
ATOM   4410  C  CA    . THR D 4  467  ? -0.364  -7.450  31.757  1.00 84.86  ? 467  THR A CA    1 
ATOM   4411  C  C     . THR D 4  467  ? 0.380   -8.755  31.988  1.00 86.15  ? 467  THR A C     1 
ATOM   4412  O  O     . THR D 4  467  ? 0.058   -9.777  31.377  1.00 104.11 ? 467  THR A O     1 
ATOM   4413  C  CB    . THR D 4  467  ? -1.616  -7.408  32.659  1.00 63.03  ? 467  THR A CB    1 
ATOM   4414  O  OG1   . THR D 4  467  ? -2.602  -8.330  32.175  1.00 83.15  ? 467  THR A OG1   1 
ATOM   4415  C  CG2   . THR D 4  467  ? -2.203  -6.008  32.701  1.00 77.48  ? 467  THR A CG2   1 
ATOM   4416  N  N     . PHE D 4  468  ? 1.376   -8.712  32.868  1.00 84.40  ? 468  PHE A N     1 
ATOM   4417  C  CA    . PHE D 4  468  ? 2.115   -9.911  33.255  1.00 74.89  ? 468  PHE A CA    1 
ATOM   4418  C  C     . PHE D 4  468  ? 1.220   -10.787 34.118  1.00 65.91  ? 468  PHE A C     1 
ATOM   4419  O  O     . PHE D 4  468  ? 1.046   -10.539 35.314  1.00 88.07  ? 468  PHE A O     1 
ATOM   4420  C  CB    . PHE D 4  468  ? 3.394   -9.541  33.996  1.00 64.18  ? 468  PHE A CB    1 
ATOM   4421  C  CG    . PHE D 4  468  ? 4.577   -9.329  33.098  1.00 59.46  ? 468  PHE A CG    1 
ATOM   4422  C  CD1   . PHE D 4  468  ? 5.479   -8.308  33.343  1.00 81.74  ? 468  PHE A CD1   1 
ATOM   4423  C  CD2   . PHE D 4  468  ? 4.801   -10.169 32.022  1.00 55.40  ? 468  PHE A CD2   1 
ATOM   4424  C  CE1   . PHE D 4  468  ? 6.575   -8.118  32.519  1.00 79.33  ? 468  PHE A CE1   1 
ATOM   4425  C  CE2   . PHE D 4  468  ? 5.894   -9.985  31.199  1.00 74.22  ? 468  PHE A CE2   1 
ATOM   4426  C  CZ    . PHE D 4  468  ? 6.782   -8.959  31.447  1.00 68.36  ? 468  PHE A CZ    1 
ATOM   4427  N  N     . ARG D 4  469  ? 0.642   -11.819 33.513  1.00 53.74  ? 469  ARG A N     1 
ATOM   4428  C  CA    . ARG D 4  469  ? -0.145  -12.777 34.271  1.00 54.19  ? 469  ARG A CA    1 
ATOM   4429  C  C     . ARG D 4  469  ? 0.785   -13.710 35.036  1.00 72.04  ? 469  ARG A C     1 
ATOM   4430  O  O     . ARG D 4  469  ? 1.792   -14.183 34.501  1.00 76.85  ? 469  ARG A O     1 
ATOM   4431  C  CB    . ARG D 4  469  ? -1.060  -13.585 33.346  1.00 60.07  ? 469  ARG A CB    1 
ATOM   4432  C  CG    . ARG D 4  469  ? -1.680  -12.805 32.191  1.00 54.62  ? 469  ARG A CG    1 
ATOM   4433  C  CD    . ARG D 4  469  ? -2.585  -11.681 32.672  1.00 54.11  ? 469  ARG A CD    1 
ATOM   4434  N  NE    . ARG D 4  469  ? -3.766  -12.179 33.370  1.00 54.47  ? 469  ARG A NE    1 
ATOM   4435  C  CZ    . ARG D 4  469  ? -4.817  -11.429 33.685  1.00 54.26  ? 469  ARG A CZ    1 
ATOM   4436  N  NH1   . ARG D 4  469  ? -4.839  -10.145 33.350  1.00 53.69  ? 469  ARG A NH1   1 
ATOM   4437  N  NH2   . ARG D 4  469  ? -5.847  -11.962 34.328  1.00 54.68  ? 469  ARG A NH2   1 
ATOM   4438  N  N     . LEU D 4  470  ? 0.452   -13.963 36.298  1.00 54.57  ? 470  LEU A N     1 
ATOM   4439  C  CA    . LEU D 4  470  ? 1.202   -14.906 37.111  1.00 54.97  ? 470  LEU A CA    1 
ATOM   4440  C  C     . LEU D 4  470  ? 0.215   -15.685 37.965  1.00 64.45  ? 470  LEU A C     1 
ATOM   4441  O  O     . LEU D 4  470  ? -0.938  -15.279 38.134  1.00 55.33  ? 470  LEU A O     1 
ATOM   4442  C  CB    . LEU D 4  470  ? 2.253   -14.200 37.982  1.00 54.51  ? 470  LEU A CB    1 
ATOM   4443  C  CG    . LEU D 4  470  ? 1.796   -12.989 38.799  1.00 53.99  ? 470  LEU A CG    1 
ATOM   4444  C  CD1   . LEU D 4  470  ? 1.367   -13.393 40.200  1.00 54.10  ? 470  LEU A CD1   1 
ATOM   4445  C  CD2   . LEU D 4  470  ? 2.893   -11.941 38.867  1.00 53.36  ? 470  LEU A CD2   1 
ATOM   4446  N  N     . ASN D 4  471  ? 0.667   -16.821 38.493  1.00 60.27  ? 471  ASN A N     1 
ATOM   4447  C  CA    . ASN D 4  471  ? -0.226  -17.628 39.312  1.00 69.25  ? 471  ASN A CA    1 
ATOM   4448  C  C     . ASN D 4  471  ? -0.497  -16.929 40.634  1.00 81.21  ? 471  ASN A C     1 
ATOM   4449  O  O     . ASN D 4  471  ? 0.377   -16.276 41.208  1.00 84.54  ? 471  ASN A O     1 
ATOM   4450  C  CB    . ASN D 4  471  ? 0.338   -19.022 39.573  1.00 58.60  ? 471  ASN A CB    1 
ATOM   4451  C  CG    . ASN D 4  471  ? -0.698  -19.948 40.205  1.00 59.43  ? 471  ASN A CG    1 
ATOM   4452  O  OD1   . ASN D 4  471  ? -1.887  -19.626 40.239  1.00 59.30  ? 471  ASN A OD1   1 
ATOM   4453  N  ND2   . ASN D 4  471  ? -0.255  -21.088 40.715  1.00 60.06  ? 471  ASN A ND2   1 
ATOM   4454  N  N     . LEU D 4  472  ? -1.728  -17.082 41.117  1.00 65.75  ? 472  LEU A N     1 
ATOM   4455  C  CA    . LEU D 4  472  ? -2.162  -16.362 42.305  1.00 56.15  ? 472  LEU A CA    1 
ATOM   4456  C  C     . LEU D 4  472  ? -1.375  -16.779 43.542  1.00 63.91  ? 472  LEU A C     1 
ATOM   4457  O  O     . LEU D 4  472  ? -1.250  -15.996 44.491  1.00 78.31  ? 472  LEU A O     1 
ATOM   4458  C  CB    . LEU D 4  472  ? -3.663  -16.575 42.482  1.00 56.56  ? 472  LEU A CB    1 
ATOM   4459  C  CG    . LEU D 4  472  ? -4.447  -15.748 43.487  1.00 56.29  ? 472  LEU A CG    1 
ATOM   4460  C  CD1   . LEU D 4  472  ? -4.412  -16.404 44.844  1.00 56.78  ? 472  LEU A CD1   1 
ATOM   4461  C  CD2   . LEU D 4  472  ? -3.928  -14.320 43.550  1.00 55.39  ? 472  LEU A CD2   1 
ATOM   4462  N  N     . SER D 4  473  ? -0.821  -17.991 43.546  1.00 87.86  ? 473  SER A N     1 
ATOM   4463  C  CA    . SER D 4  473  ? -0.081  -18.508 44.691  1.00 93.67  ? 473  SER A CA    1 
ATOM   4464  C  C     . SER D 4  473  ? 1.434   -18.383 44.525  1.00 78.47  ? 473  SER A C     1 
ATOM   4465  O  O     . SER D 4  473  ? 2.183   -19.130 45.163  1.00 77.67  ? 473  SER A O     1 
ATOM   4466  C  CB    . SER D 4  473  ? -0.472  -19.964 44.956  1.00 86.12  ? 473  SER A CB    1 
ATOM   4467  O  OG    . SER D 4  473  ? -1.821  -20.069 45.384  1.00 73.35  ? 473  SER A OG    1 
ATOM   4468  N  N     . VAL D 4  474  ? 1.901   -17.468 43.680  1.00 56.43  ? 474  VAL A N     1 
ATOM   4469  C  CA    . VAL D 4  474  ? 3.315   -17.113 43.627  1.00 56.16  ? 474  VAL A CA    1 
ATOM   4470  C  C     . VAL D 4  474  ? 3.529   -15.679 44.126  1.00 69.97  ? 474  VAL A C     1 
ATOM   4471  O  O     . VAL D 4  474  ? 4.560   -15.058 43.853  1.00 55.04  ? 474  VAL A O     1 
ATOM   4472  C  CB    . VAL D 4  474  ? 3.897   -17.342 42.218  1.00 56.21  ? 474  VAL A CB    1 
ATOM   4473  C  CG1   . VAL D 4  474  ? 3.508   -16.221 41.252  1.00 64.37  ? 474  VAL A CG1   1 
ATOM   4474  C  CG2   . VAL D 4  474  ? 5.415   -17.543 42.268  1.00 56.35  ? 474  VAL A CG2   1 
ATOM   4475  N  N     . THR D 4  475  ? 2.563   -15.158 44.887  1.00 67.11  ? 475  THR A N     1 
ATOM   4476  C  CA    . THR D 4  475  ? 2.661   -13.799 45.412  1.00 77.62  ? 475  THR A CA    1 
ATOM   4477  C  C     . THR D 4  475  ? 3.674   -13.712 46.549  1.00 88.64  ? 475  THR A C     1 
ATOM   4478  O  O     . THR D 4  475  ? 4.529   -12.819 46.564  1.00 101.20 ? 475  THR A O     1 
ATOM   4479  C  CB    . THR D 4  475  ? 1.285   -13.326 45.889  1.00 75.89  ? 475  THR A CB    1 
ATOM   4480  O  OG1   . THR D 4  475  ? 0.741   -14.278 46.813  1.00 76.25  ? 475  THR A OG1   1 
ATOM   4481  C  CG2   . THR D 4  475  ? 0.335   -13.169 44.715  1.00 58.99  ? 475  THR A CG2   1 
ATOM   4482  N  N     . SER D 4  476  ? 3.592   -14.636 47.507  1.00 59.67  ? 476  SER A N     1 
ATOM   4483  C  CA    . SER D 4  476  ? 4.353   -14.501 48.748  1.00 58.75  ? 476  SER A CA    1 
ATOM   4484  C  C     . SER D 4  476  ? 5.863   -14.438 48.538  1.00 60.66  ? 476  SER A C     1 
ATOM   4485  O  O     . SER D 4  476  ? 6.500   -13.540 49.116  1.00 83.94  ? 476  SER A O     1 
ATOM   4486  C  CB    . SER D 4  476  ? 3.963   -15.635 49.702  1.00 76.07  ? 476  SER A CB    1 
ATOM   4487  O  OG    . SER D 4  476  ? 2.559   -15.664 49.895  1.00 80.90  ? 476  SER A OG    1 
ATOM   4488  N  N     . PRO D 4  477  ? 6.501   -15.321 47.758  1.00 55.67  ? 477  PRO A N     1 
ATOM   4489  C  CA    . PRO D 4  477  ? 7.959   -15.191 47.581  1.00 55.70  ? 477  PRO A CA    1 
ATOM   4490  C  C     . PRO D 4  477  ? 8.377   -13.896 46.906  1.00 55.02  ? 477  PRO A C     1 
ATOM   4491  O  O     . PRO D 4  477  ? 9.448   -13.363 47.219  1.00 68.06  ? 477  PRO A O     1 
ATOM   4492  C  CB    . PRO D 4  477  ? 8.323   -16.420 46.736  1.00 56.27  ? 477  PRO A CB    1 
ATOM   4493  C  CG    . PRO D 4  477  ? 7.069   -16.788 46.051  1.00 65.39  ? 477  PRO A CG    1 
ATOM   4494  C  CD    . PRO D 4  477  ? 5.984   -16.500 47.041  1.00 56.17  ? 477  PRO A CD    1 
ATOM   4495  N  N     . TYR D 4  478  ? 7.566   -13.372 45.986  1.00 81.75  ? 478  TYR A N     1 
ATOM   4496  C  CA    . TYR D 4  478  ? 7.853   -12.077 45.380  1.00 78.05  ? 478  TYR A CA    1 
ATOM   4497  C  C     . TYR D 4  478  ? 7.348   -10.912 46.222  1.00 75.58  ? 478  TYR A C     1 
ATOM   4498  O  O     . TYR D 4  478  ? 7.828   -9.786  46.043  1.00 60.33  ? 478  TYR A O     1 
ATOM   4499  C  CB    . TYR D 4  478  ? 7.228   -11.990 43.982  1.00 56.18  ? 478  TYR A CB    1 
ATOM   4500  C  CG    . TYR D 4  478  ? 7.844   -12.913 42.957  1.00 54.14  ? 478  TYR A CG    1 
ATOM   4501  C  CD1   . TYR D 4  478  ? 7.113   -13.954 42.403  1.00 54.53  ? 478  TYR A CD1   1 
ATOM   4502  C  CD2   . TYR D 4  478  ? 9.157   -12.739 42.537  1.00 59.57  ? 478  TYR A CD2   1 
ATOM   4503  C  CE1   . TYR D 4  478  ? 7.670   -14.801 41.462  1.00 54.97  ? 478  TYR A CE1   1 
ATOM   4504  C  CE2   . TYR D 4  478  ? 9.723   -13.583 41.596  1.00 68.72  ? 478  TYR A CE2   1 
ATOM   4505  C  CZ    . TYR D 4  478  ? 8.976   -14.612 41.064  1.00 62.08  ? 478  TYR A CZ    1 
ATOM   4506  O  OH    . TYR D 4  478  ? 9.537   -15.451 40.130  1.00 61.30  ? 478  TYR A OH    1 
ATOM   4507  N  N     . ASN D 4  479  ? 6.413   -11.165 47.142  1.00 85.22  ? 479  ASN A N     1 
ATOM   4508  C  CA    . ASN D 4  479  ? 5.680   -10.111 47.848  1.00 98.27  ? 479  ASN A CA    1 
ATOM   4509  C  C     . ASN D 4  479  ? 5.007   -9.174  46.846  1.00 104.49 ? 479  ASN A C     1 
ATOM   4510  O  O     . ASN D 4  479  ? 5.137   -7.950  46.910  1.00 103.44 ? 479  ASN A O     1 
ATOM   4511  C  CB    . ASN D 4  479  ? 6.585   -9.338  48.814  1.00 93.25  ? 479  ASN A CB    1 
ATOM   4512  C  CG    . ASN D 4  479  ? 5.799   -8.468  49.777  1.00 84.93  ? 479  ASN A CG    1 
ATOM   4513  O  OD1   . ASN D 4  479  ? 4.570   -8.534  49.832  1.00 77.20  ? 479  ASN A OD1   1 
ATOM   4514  N  ND2   . ASN D 4  479  ? 6.506   -7.636  50.534  1.00 95.82  ? 479  ASN A ND2   1 
ATOM   4515  N  N     . ALA D 4  480  ? 4.287   -9.770  45.901  1.00 103.52 ? 480  ALA A N     1 
ATOM   4516  C  CA    . ALA D 4  480  ? 3.566   -9.037  44.874  1.00 112.28 ? 480  ALA A CA    1 
ATOM   4517  C  C     . ALA D 4  480  ? 2.105   -8.871  45.265  1.00 104.21 ? 480  ALA A C     1 
ATOM   4518  O  O     . ALA D 4  480  ? 1.469   -9.808  45.758  1.00 109.10 ? 480  ALA A O     1 
ATOM   4519  C  CB    . ALA D 4  480  ? 3.656   -9.753  43.528  1.00 124.36 ? 480  ALA A CB    1 
ATOM   4520  N  N     . ASP D 4  481  ? 1.581   -7.671  45.039  1.00 88.94  ? 481  ASP A N     1 
ATOM   4521  C  CA    . ASP D 4  481  ? 0.168   -7.378  45.218  1.00 74.32  ? 481  ASP A CA    1 
ATOM   4522  C  C     . ASP D 4  481  ? -0.328  -6.716  43.943  1.00 82.70  ? 481  ASP A C     1 
ATOM   4523  O  O     . ASP D 4  481  ? 0.392   -5.926  43.328  1.00 106.72 ? 481  ASP A O     1 
ATOM   4524  C  CB    . ASP D 4  481  ? -0.080  -6.465  46.434  1.00 79.91  ? 481  ASP A CB    1 
ATOM   4525  C  CG    . ASP D 4  481  ? -0.122  -7.229  47.753  1.00 116.57 ? 481  ASP A CG    1 
ATOM   4526  O  OD1   . ASP D 4  481  ? 0.812   -8.016  48.023  1.00 133.88 ? 481  ASP A OD1   1 
ATOM   4527  O  OD2   . ASP D 4  481  ? -1.086  -7.038  48.524  1.00 121.30 ? 481  ASP A OD2   1 
ATOM   4528  N  N     . PHE D 4  482  ? -1.544  -7.054  43.530  1.00 72.00  ? 482  PHE A N     1 
ATOM   4529  C  CA    . PHE D 4  482  ? -2.115  -6.479  42.312  1.00 57.65  ? 482  PHE A CA    1 
ATOM   4530  C  C     . PHE D 4  482  ? -2.832  -5.167  42.611  1.00 62.16  ? 482  PHE A C     1 
ATOM   4531  O  O     . PHE D 4  482  ? -3.993  -4.952  42.272  1.00 51.33  ? 482  PHE A O     1 
ATOM   4532  C  CB    . PHE D 4  482  ? -3.038  -7.494  41.655  1.00 56.44  ? 482  PHE A CB    1 
ATOM   4533  C  CG    . PHE D 4  482  ? -2.413  -8.852  41.502  1.00 60.83  ? 482  PHE A CG    1 
ATOM   4534  C  CD1   . PHE D 4  482  ? -3.115  -9.999  41.833  1.00 54.82  ? 482  PHE A CD1   1 
ATOM   4535  C  CD2   . PHE D 4  482  ? -1.119  -8.980  41.022  1.00 54.73  ? 482  PHE A CD2   1 
ATOM   4536  C  CE1   . PHE D 4  482  ? -2.535  -11.247 41.698  1.00 53.50  ? 482  PHE A CE1   1 
ATOM   4537  C  CE2   . PHE D 4  482  ? -0.536  -10.226 40.878  1.00 52.78  ? 482  PHE A CE2   1 
ATOM   4538  C  CZ    . PHE D 4  482  ? -1.246  -11.360 41.219  1.00 53.36  ? 482  PHE A CZ    1 
ATOM   4539  N  N     . ASP D 4  483  ? -2.108  -4.275  43.283  1.00 94.73  ? 483  ASP A N     1 
ATOM   4540  C  CA    . ASP D 4  483  ? -2.572  -2.928  43.574  1.00 80.87  ? 483  ASP A CA    1 
ATOM   4541  C  C     . ASP D 4  483  ? -1.837  -1.889  42.741  1.00 61.12  ? 483  ASP A C     1 
ATOM   4542  O  O     . ASP D 4  483  ? -1.923  -0.693  43.033  1.00 82.10  ? 483  ASP A O     1 
ATOM   4543  C  CB    . ASP D 4  483  ? -2.436  -2.635  45.077  1.00 103.25 ? 483  ASP A CB    1 
ATOM   4544  C  CG    . ASP D 4  483  ? -0.988  -2.476  45.529  1.00 90.54  ? 483  ASP A CG    1 
ATOM   4545  O  OD1   . ASP D 4  483  ? -0.517  -1.329  45.642  1.00 91.40  ? 483  ASP A OD1   1 
ATOM   4546  O  OD2   . ASP D 4  483  ? -0.322  -3.499  45.790  1.00 82.45  ? 483  ASP A OD2   1 
ATOM   4547  N  N     . GLY D 4  484  ? -1.131  -2.321  41.699  1.00 50.26  ? 484  GLY A N     1 
ATOM   4548  C  CA    . GLY D 4  484  ? -0.377  -1.412  40.860  1.00 53.17  ? 484  GLY A CA    1 
ATOM   4549  C  C     . GLY D 4  484  ? 1.067   -1.831  40.683  1.00 50.49  ? 484  GLY A C     1 
ATOM   4550  O  O     . GLY D 4  484  ? 1.819   -1.185  39.947  1.00 49.86  ? 484  GLY A O     1 
ATOM   4551  N  N     . ASP D 4  485  ? 1.467   -2.910  41.355  1.00 75.35  ? 485  ASP A N     1 
ATOM   4552  C  CA    . ASP D 4  485  ? 2.855   -3.352  41.306  1.00 81.82  ? 485  ASP A CA    1 
ATOM   4553  C  C     . ASP D 4  485  ? 3.245   -3.767  39.895  1.00 63.08  ? 485  ASP A C     1 
ATOM   4554  O  O     . ASP D 4  485  ? 2.434   -4.312  39.140  1.00 53.80  ? 485  ASP A O     1 
ATOM   4555  C  CB    . ASP D 4  485  ? 3.083   -4.518  42.273  1.00 84.41  ? 485  ASP A CB    1 
ATOM   4556  C  CG    . ASP D 4  485  ? 2.649   -4.196  43.688  1.00 86.41  ? 485  ASP A CG    1 
ATOM   4557  O  OD1   . ASP D 4  485  ? 1.824   -3.277  43.861  1.00 94.25  ? 485  ASP A OD1   1 
ATOM   4558  O  OD2   . ASP D 4  485  ? 3.131   -4.862  44.628  1.00 90.95  ? 485  ASP A OD2   1 
ATOM   4559  N  N     . GLU D 4  486  ? 4.499   -3.499  39.543  1.00 52.64  ? 486  GLU A N     1 
ATOM   4560  C  CA    . GLU D 4  486  ? 5.093   -3.922  38.286  1.00 53.20  ? 486  GLU A CA    1 
ATOM   4561  C  C     . GLU D 4  486  ? 6.207   -4.924  38.561  1.00 63.08  ? 486  GLU A C     1 
ATOM   4562  O  O     . GLU D 4  486  ? 6.788   -4.957  39.649  1.00 91.34  ? 486  GLU A O     1 
ATOM   4563  C  CB    . GLU D 4  486  ? 5.646   -2.723  37.504  1.00 58.07  ? 486  GLU A CB    1 
ATOM   4564  C  CG    . GLU D 4  486  ? 4.620   -1.634  37.211  1.00 77.86  ? 486  GLU A CG    1 
ATOM   4565  C  CD    . GLU D 4  486  ? 5.243   -0.380  36.615  1.00 94.02  ? 486  GLU A CD    1 
ATOM   4566  O  OE1   . GLU D 4  486  ? 4.666   0.715   36.789  1.00 90.86  ? 486  GLU A OE1   1 
ATOM   4567  O  OE2   . GLU D 4  486  ? 6.305   -0.489  35.965  1.00 106.11 ? 486  GLU A OE2   1 
ATOM   4568  N  N     . MET D 4  487  ? 6.505   -5.745  37.556  1.00 56.40  ? 487  MET A N     1 
ATOM   4569  C  CA    . MET D 4  487  ? 7.551   -6.753  37.652  1.00 56.64  ? 487  MET A CA    1 
ATOM   4570  C  C     . MET D 4  487  ? 8.442   -6.696  36.418  1.00 72.91  ? 487  MET A C     1 
ATOM   4571  O  O     . MET D 4  487  ? 8.119   -6.052  35.418  1.00 88.04  ? 487  MET A O     1 
ATOM   4572  C  CB    . MET D 4  487  ? 6.969   -8.161  37.807  1.00 55.20  ? 487  MET A CB    1 
ATOM   4573  C  CG    . MET D 4  487  ? 6.482   -8.485  39.199  1.00 55.24  ? 487  MET A CG    1 
ATOM   4574  S  SD    . MET D 4  487  ? 6.946   -10.171 39.614  1.00 57.45  ? 487  MET A SD    1 
ATOM   4575  C  CE    . MET D 4  487  ? 5.695   -10.604 40.808  1.00 72.79  ? 487  MET A CE    1 
ATOM   4576  N  N     . ASN D 4  488  ? 9.577   -7.387  36.501  1.00 70.84  ? 488  ASN A N     1 
ATOM   4577  C  CA    . ASN D 4  488  ? 10.555  -7.460  35.423  1.00 73.67  ? 488  ASN A CA    1 
ATOM   4578  C  C     . ASN D 4  488  ? 10.660  -8.886  34.893  1.00 88.07  ? 488  ASN A C     1 
ATOM   4579  O  O     . ASN D 4  488  ? 10.168  -9.843  35.500  1.00 80.01  ? 488  ASN A O     1 
ATOM   4580  C  CB    . ASN D 4  488  ? 11.927  -6.966  35.898  1.00 79.89  ? 488  ASN A CB    1 
ATOM   4581  C  CG    . ASN D 4  488  ? 11.914  -5.505  36.309  1.00 99.89  ? 488  ASN A CG    1 
ATOM   4582  O  OD1   . ASN D 4  488  ? 10.861  -4.868  36.360  1.00 97.79  ? 488  ASN A OD1   1 
ATOM   4583  N  ND2   . ASN D 4  488  ? 13.090  -4.969  36.611  1.00 126.01 ? 488  ASN A ND2   1 
ATOM   4584  N  N     . LEU D 4  489  ? 11.319  -9.016  33.742  1.00 97.73  ? 489  LEU A N     1 
ATOM   4585  C  CA    . LEU D 4  489  ? 11.492  -10.307 33.091  1.00 91.59  ? 489  LEU A CA    1 
ATOM   4586  C  C     . LEU D 4  489  ? 12.758  -10.275 32.246  1.00 75.08  ? 489  LEU A C     1 
ATOM   4587  O  O     . LEU D 4  489  ? 13.043  -9.276  31.579  1.00 60.88  ? 489  LEU A O     1 
ATOM   4588  C  CB    . LEU D 4  489  ? 10.274  -10.658 32.228  1.00 88.25  ? 489  LEU A CB    1 
ATOM   4589  C  CG    . LEU D 4  489  ? 10.207  -12.045 31.585  1.00 76.79  ? 489  LEU A CG    1 
ATOM   4590  C  CD1   . LEU D 4  489  ? 8.760   -12.503 31.528  1.00 60.17  ? 489  LEU A CD1   1 
ATOM   4591  C  CD2   . LEU D 4  489  ? 10.820  -12.056 30.186  1.00 76.91  ? 489  LEU A CD2   1 
ATOM   4592  N  N     . HIS D 4  490  ? 13.512  -11.375 32.276  1.00 69.17  ? 490  HIS A N     1 
ATOM   4593  C  CA    . HIS D 4  490  ? 14.760  -11.497 31.536  1.00 64.12  ? 490  HIS A CA    1 
ATOM   4594  C  C     . HIS D 4  490  ? 14.708  -12.749 30.676  1.00 82.59  ? 490  HIS A C     1 
ATOM   4595  O  O     . HIS D 4  490  ? 13.984  -13.700 30.981  1.00 88.62  ? 490  HIS A O     1 
ATOM   4596  C  CB    . HIS D 4  490  ? 15.969  -11.560 32.477  1.00 66.76  ? 490  HIS A CB    1 
ATOM   4597  C  CG    . HIS D 4  490  ? 16.172  -10.317 33.287  1.00 65.52  ? 490  HIS A CG    1 
ATOM   4598  N  ND1   . HIS D 4  490  ? 17.234  -9.462  33.084  1.00 62.44  ? 490  HIS A ND1   1 
ATOM   4599  C  CD2   . HIS D 4  490  ? 15.448  -9.785  34.301  1.00 59.15  ? 490  HIS A CD2   1 
ATOM   4600  C  CE1   . HIS D 4  490  ? 17.159  -8.460  33.942  1.00 71.20  ? 490  HIS A CE1   1 
ATOM   4601  N  NE2   . HIS D 4  490  ? 16.084  -8.631  34.690  1.00 62.87  ? 490  HIS A NE2   1 
ATOM   4602  N  N     . VAL D 4  491  ? 15.487  -12.751 29.594  1.00 88.09  ? 491  VAL A N     1 
ATOM   4603  C  CA    . VAL D 4  491  ? 15.457  -13.824 28.612  1.00 84.22  ? 491  VAL A CA    1 
ATOM   4604  C  C     . VAL D 4  491  ? 16.868  -14.340 28.363  1.00 75.18  ? 491  VAL A C     1 
ATOM   4605  O  O     . VAL D 4  491  ? 17.746  -13.569 27.964  1.00 73.21  ? 491  VAL A O     1 
ATOM   4606  C  CB    . VAL D 4  491  ? 14.814  -13.375 27.289  1.00 60.45  ? 491  VAL A CB    1 
ATOM   4607  C  CG1   . VAL D 4  491  ? 15.137  -14.359 26.178  1.00 58.44  ? 491  VAL A CG1   1 
ATOM   4608  C  CG2   . VAL D 4  491  ? 13.310  -13.219 27.463  1.00 57.05  ? 491  VAL A CG2   1 
ATOM   4609  N  N     . PRO D 4  492  ? 17.133  -15.628 28.563  1.00 80.29  ? 492  PRO A N     1 
ATOM   4610  C  CA    . PRO D 4  492  ? 18.476  -16.157 28.312  1.00 85.96  ? 492  PRO A CA    1 
ATOM   4611  C  C     . PRO D 4  492  ? 18.800  -16.180 26.826  1.00 90.65  ? 492  PRO A C     1 
ATOM   4612  O  O     . PRO D 4  492  ? 17.920  -16.133 25.963  1.00 86.30  ? 492  PRO A O     1 
ATOM   4613  C  CB    . PRO D 4  492  ? 18.411  -17.574 28.891  1.00 94.72  ? 492  PRO A CB    1 
ATOM   4614  C  CG    . PRO D 4  492  ? 16.968  -17.937 28.824  1.00 105.96 ? 492  PRO A CG    1 
ATOM   4615  C  CD    . PRO D 4  492  ? 16.208  -16.662 29.056  1.00 86.90  ? 492  PRO A CD    1 
ATOM   4616  N  N     . GLN D 4  493  ? 20.101  -16.254 26.536  1.00 87.70  ? 493  GLN A N     1 
ATOM   4617  C  CA    . GLN D 4  493  ? 20.603  -16.187 25.168  1.00 83.05  ? 493  GLN A CA    1 
ATOM   4618  C  C     . GLN D 4  493  ? 21.490  -17.371 24.797  1.00 81.21  ? 493  GLN A C     1 
ATOM   4619  O  O     . GLN D 4  493  ? 22.102  -17.355 23.722  1.00 78.04  ? 493  GLN A O     1 
ATOM   4620  C  CB    . GLN D 4  493  ? 21.377  -14.882 24.954  1.00 77.10  ? 493  GLN A CB    1 
ATOM   4621  C  CG    . GLN D 4  493  ? 20.555  -13.629 25.193  1.00 86.88  ? 493  GLN A CG    1 
ATOM   4622  C  CD    . GLN D 4  493  ? 19.417  -13.482 24.207  1.00 82.40  ? 493  GLN A CD    1 
ATOM   4623  O  OE1   . GLN D 4  493  ? 19.626  -13.114 23.051  1.00 74.53  ? 493  GLN A OE1   1 
ATOM   4624  N  NE2   . GLN D 4  493  ? 18.202  -13.777 24.658  1.00 70.80  ? 493  GLN A NE2   1 
ATOM   4625  N  N     . SER D 4  494  ? 21.592  -18.387 25.653  1.00 89.59  ? 494  SER A N     1 
ATOM   4626  C  CA    . SER D 4  494  ? 22.386  -19.567 25.338  1.00 107.41 ? 494  SER A CA    1 
ATOM   4627  C  C     . SER D 4  494  ? 21.747  -20.791 25.980  1.00 105.11 ? 494  SER A C     1 
ATOM   4628  O  O     . SER D 4  494  ? 20.916  -20.681 26.885  1.00 76.80  ? 494  SER A O     1 
ATOM   4629  C  CB    . SER D 4  494  ? 23.844  -19.412 25.795  1.00 120.30 ? 494  SER A CB    1 
ATOM   4630  O  OG    . SER D 4  494  ? 23.928  -19.034 27.157  1.00 135.29 ? 494  SER A OG    1 
ATOM   4631  N  N     . GLU D 4  495  ? 22.156  -21.969 25.499  1.00 113.44 ? 495  GLU A N     1 
ATOM   4632  C  CA    . GLU D 4  495  ? 21.546  -23.210 25.966  1.00 109.81 ? 495  GLU A CA    1 
ATOM   4633  C  C     . GLU D 4  495  ? 21.896  -23.491 27.423  1.00 103.08 ? 495  GLU A C     1 
ATOM   4634  O  O     . GLU D 4  495  ? 21.026  -23.890 28.206  1.00 116.47 ? 495  GLU A O     1 
ATOM   4635  C  CB    . GLU D 4  495  ? 21.972  -24.376 25.072  1.00 101.40 ? 495  GLU A CB    1 
ATOM   4636  C  CG    . GLU D 4  495  ? 21.028  -24.644 23.908  1.00 103.32 ? 495  GLU A CG    1 
ATOM   4637  C  CD    . GLU D 4  495  ? 19.636  -25.041 24.363  1.00 119.18 ? 495  GLU A CD    1 
ATOM   4638  O  OE1   . GLU D 4  495  ? 18.664  -24.738 23.640  1.00 118.80 ? 495  GLU A OE1   1 
ATOM   4639  O  OE2   . GLU D 4  495  ? 19.513  -25.652 25.446  1.00 126.81 ? 495  GLU A OE2   1 
ATOM   4640  N  N     . GLU D 4  496  ? 23.163  -23.297 27.805  1.00 82.88  ? 496  GLU A N     1 
ATOM   4641  C  CA    . GLU D 4  496  ? 23.540  -23.463 29.206  1.00 82.83  ? 496  GLU A CA    1 
ATOM   4642  C  C     . GLU D 4  496  ? 22.757  -22.508 30.092  1.00 85.29  ? 496  GLU A C     1 
ATOM   4643  O  O     . GLU D 4  496  ? 22.353  -22.863 31.206  1.00 85.10  ? 496  GLU A O     1 
ATOM   4644  C  CB    . GLU D 4  496  ? 25.041  -23.230 29.389  1.00 89.30  ? 496  GLU A CB    1 
ATOM   4645  C  CG    . GLU D 4  496  ? 25.916  -23.747 28.265  1.00 101.99 ? 496  GLU A CG    1 
ATOM   4646  C  CD    . GLU D 4  496  ? 26.567  -22.624 27.480  1.00 112.27 ? 496  GLU A CD    1 
ATOM   4647  O  OE1   . GLU D 4  496  ? 25.842  -21.708 27.034  1.00 113.60 ? 496  GLU A OE1   1 
ATOM   4648  O  OE2   . GLU D 4  496  ? 27.806  -22.651 27.319  1.00 116.32 ? 496  GLU A OE2   1 
ATOM   4649  N  N     . THR D 4  497  ? 22.531  -21.287 29.606  1.00 88.87  ? 497  THR A N     1 
ATOM   4650  C  CA    . THR D 4  497  ? 21.797  -20.289 30.373  1.00 80.08  ? 497  THR A CA    1 
ATOM   4651  C  C     . THR D 4  497  ? 20.344  -20.706 30.570  1.00 78.88  ? 497  THR A C     1 
ATOM   4652  O  O     . THR D 4  497  ? 19.800  -20.600 31.675  1.00 70.35  ? 497  THR A O     1 
ATOM   4653  C  CB    . THR D 4  497  ? 21.889  -18.940 29.663  1.00 80.06  ? 497  THR A CB    1 
ATOM   4654  O  OG1   . THR D 4  497  ? 23.245  -18.704 29.267  1.00 77.31  ? 497  THR A OG1   1 
ATOM   4655  C  CG2   . THR D 4  497  ? 21.476  -17.836 30.582  1.00 88.08  ? 497  THR A CG2   1 
ATOM   4656  N  N     . ARG D 4  498  ? 19.695  -21.175 29.501  1.00 92.82  ? 498  ARG A N     1 
ATOM   4657  C  CA    . ARG D 4  498  ? 18.350  -21.729 29.624  1.00 99.20  ? 498  ARG A CA    1 
ATOM   4658  C  C     . ARG D 4  498  ? 18.303  -22.835 30.670  1.00 91.56  ? 498  ARG A C     1 
ATOM   4659  O  O     . ARG D 4  498  ? 17.352  -22.921 31.455  1.00 83.63  ? 498  ARG A O     1 
ATOM   4660  C  CB    . ARG D 4  498  ? 17.884  -22.265 28.269  1.00 105.62 ? 498  ARG A CB    1 
ATOM   4661  C  CG    . ARG D 4  498  ? 17.836  -21.228 27.162  1.00 110.60 ? 498  ARG A CG    1 
ATOM   4662  C  CD    . ARG D 4  498  ? 17.452  -21.863 25.834  1.00 110.81 ? 498  ARG A CD    1 
ATOM   4663  N  NE    . ARG D 4  498  ? 16.144  -21.431 25.351  1.00 108.99 ? 498  ARG A NE    1 
ATOM   4664  C  CZ    . ARG D 4  498  ? 15.016  -22.105 25.542  1.00 99.26  ? 498  ARG A CZ    1 
ATOM   4665  N  NH1   . ARG D 4  498  ? 15.033  -23.256 26.203  1.00 112.93 ? 498  ARG A NH1   1 
ATOM   4666  N  NH2   . ARG D 4  498  ? 13.870  -21.634 25.062  1.00 74.79  ? 498  ARG A NH2   1 
ATOM   4667  N  N     . ALA D 4  499  ? 19.329  -23.688 30.694  1.00 90.64  ? 499  ALA A N     1 
ATOM   4668  C  CA    . ALA D 4  499  ? 19.335  -24.822 31.612  1.00 97.71  ? 499  ALA A CA    1 
ATOM   4669  C  C     . ALA D 4  499  ? 19.370  -24.364 33.065  1.00 107.75 ? 499  ALA A C     1 
ATOM   4670  O  O     . ALA D 4  499  ? 18.644  -24.903 33.908  1.00 115.49 ? 499  ALA A O     1 
ATOM   4671  C  CB    . ALA D 4  499  ? 20.524  -25.734 31.309  1.00 97.93  ? 499  ALA A CB    1 
ATOM   4672  N  N     . GLU D 4  500  ? 20.208  -23.370 33.375  1.00 88.53  ? 500  GLU A N     1 
ATOM   4673  C  CA    . GLU D 4  500  ? 20.340  -22.909 34.754  1.00 66.72  ? 500  GLU A CA    1 
ATOM   4674  C  C     . GLU D 4  500  ? 19.017  -22.402 35.309  1.00 64.55  ? 500  GLU A C     1 
ATOM   4675  O  O     . GLU D 4  500  ? 18.754  -22.536 36.509  1.00 92.87  ? 500  GLU A O     1 
ATOM   4676  C  CB    . GLU D 4  500  ? 21.404  -21.818 34.844  1.00 62.91  ? 500  GLU A CB    1 
ATOM   4677  C  CG    . GLU D 4  500  ? 22.803  -22.304 34.527  1.00 63.88  ? 500  GLU A CG    1 
ATOM   4678  C  CD    . GLU D 4  500  ? 23.838  -21.207 34.658  1.00 78.12  ? 500  GLU A CD    1 
ATOM   4679  O  OE1   . GLU D 4  500  ? 23.449  -20.029 34.795  1.00 79.32  ? 500  GLU A OE1   1 
ATOM   4680  O  OE2   . GLU D 4  500  ? 25.042  -21.524 34.625  1.00 80.58  ? 500  GLU A OE2   1 
ATOM   4681  N  N     . LEU D 4  501  ? 18.173  -21.817 34.462  1.00 61.71  ? 501  LEU A N     1 
ATOM   4682  C  CA    . LEU D 4  501  ? 16.853  -21.400 34.921  1.00 63.12  ? 501  LEU A CA    1 
ATOM   4683  C  C     . LEU D 4  501  ? 15.963  -22.608 35.192  1.00 80.88  ? 501  LEU A C     1 
ATOM   4684  O  O     . LEU D 4  501  ? 15.348  -22.712 36.260  1.00 90.04  ? 501  LEU A O     1 
ATOM   4685  C  CB    . LEU D 4  501  ? 16.215  -20.465 33.894  1.00 62.49  ? 501  LEU A CB    1 
ATOM   4686  C  CG    . LEU D 4  501  ? 16.826  -19.074 33.713  1.00 59.66  ? 501  LEU A CG    1 
ATOM   4687  C  CD1   . LEU D 4  501  ? 15.751  -18.060 33.364  1.00 58.79  ? 501  LEU A CD1   1 
ATOM   4688  C  CD2   . LEU D 4  501  ? 17.567  -18.638 34.962  1.00 71.71  ? 501  LEU A CD2   1 
ATOM   4689  N  N     . SER D 4  502  ? 15.902  -23.545 34.244  1.00 84.93  ? 502  SER A N     1 
ATOM   4690  C  CA    . SER D 4  502  ? 15.001  -24.686 34.382  1.00 82.07  ? 502  SER A CA    1 
ATOM   4691  C  C     . SER D 4  502  ? 15.494  -25.687 35.419  1.00 73.61  ? 502  SER A C     1 
ATOM   4692  O  O     . SER D 4  502  ? 14.681  -26.384 36.036  1.00 64.88  ? 502  SER A O     1 
ATOM   4693  C  CB    . SER D 4  502  ? 14.832  -25.380 33.033  1.00 78.25  ? 502  SER A CB    1 
ATOM   4694  O  OG    . SER D 4  502  ? 16.084  -25.526 32.386  1.00 86.39  ? 502  SER A OG    1 
ATOM   4695  N  N     . GLN D 4  503  ? 16.808  -25.776 35.621  1.00 77.44  ? 503  GLN A N     1 
ATOM   4696  C  CA    . GLN D 4  503  ? 17.379  -26.803 36.482  1.00 94.75  ? 503  GLN A CA    1 
ATOM   4697  C  C     . GLN D 4  503  ? 17.820  -26.289 37.845  1.00 81.87  ? 503  GLN A C     1 
ATOM   4698  O  O     . GLN D 4  503  ? 18.051  -27.104 38.746  1.00 69.18  ? 503  GLN A O     1 
ATOM   4699  C  CB    . GLN D 4  503  ? 18.577  -27.469 35.792  1.00 95.91  ? 503  GLN A CB    1 
ATOM   4700  C  CG    . GLN D 4  503  ? 18.243  -28.068 34.439  1.00 82.39  ? 503  GLN A CG    1 
ATOM   4701  C  CD    . GLN D 4  503  ? 17.211  -29.174 34.535  1.00 82.48  ? 503  GLN A CD    1 
ATOM   4702  O  OE1   . GLN D 4  503  ? 17.533  -30.313 34.876  1.00 83.65  ? 503  GLN A OE1   1 
ATOM   4703  N  NE2   . GLN D 4  503  ? 15.959  -28.843 34.233  1.00 71.82  ? 503  GLN A NE2   1 
ATOM   4704  N  N     . LEU D 4  504  ? 17.963  -24.976 38.018  1.00 75.87  ? 504  LEU A N     1 
ATOM   4705  C  CA    . LEU D 4  504  ? 18.307  -24.405 39.317  1.00 72.62  ? 504  LEU A CA    1 
ATOM   4706  C  C     . LEU D 4  504  ? 17.326  -23.345 39.796  1.00 68.72  ? 504  LEU A C     1 
ATOM   4707  O  O     . LEU D 4  504  ? 16.963  -23.336 40.977  1.00 76.32  ? 504  LEU A O     1 
ATOM   4708  C  CB    . LEU D 4  504  ? 19.721  -23.801 39.278  1.00 63.19  ? 504  LEU A CB    1 
ATOM   4709  C  CG    . LEU D 4  504  ? 20.846  -24.672 38.711  1.00 64.26  ? 504  LEU A CG    1 
ATOM   4710  C  CD1   . LEU D 4  504  ? 22.168  -23.920 38.715  1.00 64.29  ? 504  LEU A CD1   1 
ATOM   4711  C  CD2   . LEU D 4  504  ? 20.969  -25.974 39.486  1.00 65.21  ? 504  LEU A CD2   1 
ATOM   4712  N  N     . CYS D 4  505  ? 16.871  -22.459 38.907  1.00 69.23  ? 505  CYS A N     1 
ATOM   4713  C  CA    . CYS D 4  505  ? 16.092  -21.288 39.286  1.00 60.33  ? 505  CYS A CA    1 
ATOM   4714  C  C     . CYS D 4  505  ? 14.597  -21.454 39.042  1.00 61.29  ? 505  CYS A C     1 
ATOM   4715  O  O     . CYS D 4  505  ? 13.846  -20.485 39.193  1.00 59.24  ? 505  CYS A O     1 
ATOM   4716  C  CB    . CYS D 4  505  ? 16.598  -20.059 38.531  1.00 59.75  ? 505  CYS A CB    1 
ATOM   4717  S  SG    . CYS D 4  505  ? 18.398  -19.905 38.485  1.00 84.93  ? 505  CYS A SG    1 
ATOM   4718  N  N     . ALA D 4  506  ? 14.148  -22.651 38.679  1.00 81.94  ? 506  ALA A N     1 
ATOM   4719  C  CA    . ALA D 4  506  ? 12.744  -22.862 38.364  1.00 71.59  ? 506  ALA A CA    1 
ATOM   4720  C  C     . ALA D 4  506  ? 11.872  -22.653 39.597  1.00 69.03  ? 506  ALA A C     1 
ATOM   4721  O  O     . ALA D 4  506  ? 12.294  -22.892 40.730  1.00 77.14  ? 506  ALA A O     1 
ATOM   4722  C  CB    . ALA D 4  506  ? 12.532  -24.269 37.804  1.00 70.28  ? 506  ALA A CB    1 
ATOM   4723  N  N     . VAL D 4  507  ? 10.641  -22.186 39.357  1.00 59.74  ? 507  VAL A N     1 
ATOM   4724  C  CA    . VAL D 4  507  ? 9.668   -22.033 40.446  1.00 59.49  ? 507  VAL A CA    1 
ATOM   4725  C  C     . VAL D 4  507  ? 9.434   -23.332 41.209  1.00 60.37  ? 507  VAL A C     1 
ATOM   4726  O  O     . VAL D 4  507  ? 9.427   -23.297 42.451  1.00 70.15  ? 507  VAL A O     1 
ATOM   4727  C  CB    . VAL D 4  507  ? 8.359   -21.432 39.906  1.00 58.95  ? 507  VAL A CB    1 
ATOM   4728  C  CG1   . VAL D 4  507  ? 7.262   -21.514 40.954  1.00 58.92  ? 507  VAL A CG1   1 
ATOM   4729  C  CG2   . VAL D 4  507  ? 8.577   -19.997 39.499  1.00 58.03  ? 507  VAL A CG2   1 
ATOM   4730  N  N     . PRO D 4  508  ? 9.233   -24.488 40.563  1.00 61.19  ? 508  PRO A N     1 
ATOM   4731  C  CA    . PRO D 4  508  ? 8.997   -25.707 41.357  1.00 70.97  ? 508  PRO A CA    1 
ATOM   4732  C  C     . PRO D 4  508  ? 10.147  -26.060 42.283  1.00 62.50  ? 508  PRO A C     1 
ATOM   4733  O  O     . PRO D 4  508  ? 9.926   -26.706 43.315  1.00 89.04  ? 508  PRO A O     1 
ATOM   4734  C  CB    . PRO D 4  508  ? 8.779   -26.790 40.288  1.00 92.77  ? 508  PRO A CB    1 
ATOM   4735  C  CG    . PRO D 4  508  ? 8.350   -26.051 39.083  1.00 83.57  ? 508  PRO A CG    1 
ATOM   4736  C  CD    . PRO D 4  508  ? 9.113   -24.765 39.118  1.00 68.30  ? 508  PRO A CD    1 
ATOM   4737  N  N     . LEU D 4  509  ? 11.370  -25.646 41.954  1.00 62.34  ? 509  LEU A N     1 
ATOM   4738  C  CA    . LEU D 4  509  ? 12.517  -26.006 42.780  1.00 74.28  ? 509  LEU A CA    1 
ATOM   4739  C  C     . LEU D 4  509  ? 12.542  -25.211 44.078  1.00 64.15  ? 509  LEU A C     1 
ATOM   4740  O  O     . LEU D 4  509  ? 12.883  -25.750 45.138  1.00 62.81  ? 509  LEU A O     1 
ATOM   4741  C  CB    . LEU D 4  509  ? 13.810  -25.789 41.996  1.00 69.76  ? 509  LEU A CB    1 
ATOM   4742  C  CG    . LEU D 4  509  ? 14.318  -26.915 41.095  1.00 63.85  ? 509  LEU A CG    1 
ATOM   4743  C  CD1   . LEU D 4  509  ? 13.222  -27.552 40.254  1.00 73.27  ? 509  LEU A CD1   1 
ATOM   4744  C  CD2   . LEU D 4  509  ? 15.387  -26.344 40.201  1.00 66.52  ? 509  LEU A CD2   1 
ATOM   4745  N  N     . GLN D 4  510  ? 12.179  -23.935 44.018  1.00 61.27  ? 510  GLN A N     1 
ATOM   4746  C  CA    . GLN D 4  510  ? 12.198  -23.065 45.181  1.00 60.74  ? 510  GLN A CA    1 
ATOM   4747  C  C     . GLN D 4  510  ? 10.941  -23.183 46.036  1.00 63.30  ? 510  GLN A C     1 
ATOM   4748  O  O     . GLN D 4  510  ? 10.771  -22.377 46.956  1.00 86.42  ? 510  GLN A O     1 
ATOM   4749  C  CB    . GLN D 4  510  ? 12.384  -21.611 44.740  1.00 59.77  ? 510  GLN A CB    1 
ATOM   4750  C  CG    . GLN D 4  510  ? 13.465  -21.412 43.695  1.00 59.79  ? 510  GLN A CG    1 
ATOM   4751  C  CD    . GLN D 4  510  ? 14.864  -21.529 44.263  1.00 75.50  ? 510  GLN A CD    1 
ATOM   4752  O  OE1   . GLN D 4  510  ? 15.052  -21.602 45.479  1.00 86.83  ? 510  GLN A OE1   1 
ATOM   4753  N  NE2   . GLN D 4  510  ? 15.858  -21.543 43.384  1.00 60.45  ? 510  GLN A NE2   1 
ATOM   4754  N  N     . ILE D 4  511  ? 10.061  -24.151 45.750  1.00 61.99  ? 511  ILE A N     1 
ATOM   4755  C  CA    . ILE D 4  511  ? 8.832   -24.296 46.532  1.00 65.04  ? 511  ILE A CA    1 
ATOM   4756  C  C     . ILE D 4  511  ? 9.159   -24.551 47.997  1.00 80.20  ? 511  ILE A C     1 
ATOM   4757  O  O     . ILE D 4  511  ? 8.558   -23.951 48.896  1.00 86.86  ? 511  ILE A O     1 
ATOM   4758  C  CB    . ILE D 4  511  ? 7.939   -25.408 45.947  1.00 64.68  ? 511  ILE A CB    1 
ATOM   4759  C  CG1   . ILE D 4  511  ? 7.472   -25.039 44.537  1.00 62.34  ? 511  ILE A CG1   1 
ATOM   4760  C  CG2   . ILE D 4  511  ? 6.733   -25.658 46.844  1.00 69.86  ? 511  ILE A CG2   1 
ATOM   4761  C  CD1   . ILE D 4  511  ? 6.489   -26.028 43.938  1.00 63.04  ? 511  ILE A CD1   1 
ATOM   4762  N  N     . VAL D 4  512  ? 10.107  -25.442 48.263  1.00 93.17  ? 512  VAL A N     1 
ATOM   4763  C  CA    . VAL D 4  512  ? 10.667  -25.590 49.600  1.00 88.62  ? 512  VAL A CA    1 
ATOM   4764  C  C     . VAL D 4  512  ? 11.798  -24.583 49.749  1.00 98.18  ? 512  VAL A C     1 
ATOM   4765  O  O     . VAL D 4  512  ? 12.619  -24.403 48.839  1.00 112.44 ? 512  VAL A O     1 
ATOM   4766  C  CB    . VAL D 4  512  ? 11.139  -27.036 49.854  1.00 87.69  ? 512  VAL A CB    1 
ATOM   4767  C  CG1   . VAL D 4  512  ? 12.332  -27.403 48.972  1.00 95.43  ? 512  VAL A CG1   1 
ATOM   4768  C  CG2   . VAL D 4  512  ? 11.479  -27.225 51.323  1.00 86.54  ? 512  VAL A CG2   1 
ATOM   4769  N  N     . SER D 4  513  ? 11.827  -23.895 50.883  1.00 92.75  ? 513  SER A N     1 
ATOM   4770  C  CA    . SER D 4  513  ? 12.760  -22.793 51.036  1.00 96.18  ? 513  SER A CA    1 
ATOM   4771  C  C     . SER D 4  513  ? 13.845  -23.153 52.032  1.00 88.54  ? 513  SER A C     1 
ATOM   4772  O  O     . SER D 4  513  ? 13.533  -23.589 53.148  1.00 92.34  ? 513  SER A O     1 
ATOM   4773  C  CB    . SER D 4  513  ? 12.031  -21.525 51.497  1.00 119.18 ? 513  SER A CB    1 
ATOM   4774  O  OG    . SER D 4  513  ? 11.486  -21.682 52.796  1.00 133.90 ? 513  SER A OG    1 
ATOM   4775  N  N     . PRO D 4  514  ? 15.122  -22.997 51.669  1.00 86.02  ? 514  PRO A N     1 
ATOM   4776  C  CA    . PRO D 4  514  ? 16.182  -23.148 52.679  1.00 90.15  ? 514  PRO A CA    1 
ATOM   4777  C  C     . PRO D 4  514  ? 16.042  -22.151 53.812  1.00 88.94  ? 514  PRO A C     1 
ATOM   4778  O  O     . PRO D 4  514  ? 16.336  -22.476 54.968  1.00 75.89  ? 514  PRO A O     1 
ATOM   4779  C  CB    . PRO D 4  514  ? 17.471  -22.929 51.875  1.00 83.05  ? 514  PRO A CB    1 
ATOM   4780  C  CG    . PRO D 4  514  ? 17.084  -23.171 50.449  1.00 85.44  ? 514  PRO A CG    1 
ATOM   4781  C  CD    . PRO D 4  514  ? 15.660  -22.732 50.326  1.00 81.91  ? 514  PRO A CD    1 
ATOM   4782  N  N     . GLN D 4  515  ? 15.598  -20.936 53.509  1.00 108.44 ? 515  GLN A N     1 
ATOM   4783  C  CA    . GLN D 4  515  ? 15.214  -19.998 54.551  1.00 103.25 ? 515  GLN A CA    1 
ATOM   4784  C  C     . GLN D 4  515  ? 13.959  -20.507 55.247  1.00 90.07  ? 515  GLN A C     1 
ATOM   4785  O  O     . GLN D 4  515  ? 12.945  -20.778 54.594  1.00 92.94  ? 515  GLN A O     1 
ATOM   4786  C  CB    . GLN D 4  515  ? 14.985  -18.615 53.950  1.00 94.97  ? 515  GLN A CB    1 
ATOM   4787  C  CG    . GLN D 4  515  ? 14.064  -17.726 54.758  1.00 97.23  ? 515  GLN A CG    1 
ATOM   4788  C  CD    . GLN D 4  515  ? 13.741  -16.447 54.024  1.00 76.78  ? 515  GLN A CD    1 
ATOM   4789  O  OE1   . GLN D 4  515  ? 12.794  -15.739 54.366  1.00 70.19  ? 515  GLN A OE1   1 
ATOM   4790  N  NE2   . GLN D 4  515  ? 14.541  -16.136 53.009  1.00 69.57  ? 515  GLN A NE2   1 
ATOM   4791  N  N     . SER D 4  516  ? 14.036  -20.655 56.571  1.00 61.71  ? 516  SER A N     1 
ATOM   4792  C  CA    . SER D 4  516  ? 12.950  -21.119 57.432  1.00 82.65  ? 516  SER A CA    1 
ATOM   4793  C  C     . SER D 4  516  ? 12.596  -22.589 57.222  1.00 93.66  ? 516  SER A C     1 
ATOM   4794  O  O     . SER D 4  516  ? 11.610  -23.062 57.807  1.00 107.19 ? 516  SER A O     1 
ATOM   4795  C  CB    . SER D 4  516  ? 11.686  -20.263 57.267  1.00 92.71  ? 516  SER A CB    1 
ATOM   4796  O  OG    . SER D 4  516  ? 11.960  -18.889 57.489  1.00 93.48  ? 516  SER A OG    1 
ATOM   4797  N  N     . ASN D 4  517  ? 13.375  -23.322 56.421  1.00 97.42  ? 517  ASN A N     1 
ATOM   4798  C  CA    . ASN D 4  517  ? 13.213  -24.765 56.181  1.00 71.94  ? 517  ASN A CA    1 
ATOM   4799  C  C     . ASN D 4  517  ? 11.744  -25.166 56.033  1.00 75.18  ? 517  ASN A C     1 
ATOM   4800  O  O     . ASN D 4  517  ? 11.256  -26.106 56.666  1.00 71.67  ? 517  ASN A O     1 
ATOM   4801  C  CB    . ASN D 4  517  ? 13.904  -25.593 57.274  1.00 65.18  ? 517  ASN A CB    1 
ATOM   4802  C  CG    . ASN D 4  517  ? 13.407  -25.270 58.675  1.00 69.35  ? 517  ASN A CG    1 
ATOM   4803  O  OD1   . ASN D 4  517  ? 14.114  -24.644 59.464  1.00 90.47  ? 517  ASN A OD1   1 
ATOM   4804  N  ND2   . ASN D 4  517  ? 12.194  -25.705 58.993  1.00 65.51  ? 517  ASN A ND2   1 
ATOM   4805  N  N     . LYS D 4  518  ? 11.039  -24.449 55.167  1.00 87.03  ? 518  LYS A N     1 
ATOM   4806  C  CA    . LYS D 4  518  ? 9.602   -24.621 55.004  1.00 87.78  ? 518  LYS A CA    1 
ATOM   4807  C  C     . LYS D 4  518  ? 9.215   -24.089 53.629  1.00 79.02  ? 518  LYS A C     1 
ATOM   4808  O  O     . LYS D 4  518  ? 10.014  -23.412 52.968  1.00 62.48  ? 518  LYS A O     1 
ATOM   4809  C  CB    . LYS D 4  518  ? 8.827   -23.901 56.124  1.00 68.47  ? 518  LYS A CB    1 
ATOM   4810  C  CG    . LYS D 4  518  ? 8.899   -22.384 56.063  1.00 95.13  ? 518  LYS A CG    1 
ATOM   4811  C  CD    . LYS D 4  518  ? 7.711   -21.739 56.757  1.00 105.91 ? 518  LYS A CD    1 
ATOM   4812  C  CE    . LYS D 4  518  ? 7.655   -20.245 56.467  1.00 93.48  ? 518  LYS A CE    1 
ATOM   4813  N  NZ    . LYS D 4  518  ? 7.610   -19.940 55.011  1.00 60.49  ? 518  LYS A NZ    1 
ATOM   4814  N  N     . PRO D 4  519  ? 8.008   -24.397 53.154  1.00 62.43  ? 519  PRO A N     1 
ATOM   4815  C  CA    . PRO D 4  519  ? 7.565   -23.826 51.880  1.00 68.00  ? 519  PRO A CA    1 
ATOM   4816  C  C     . PRO D 4  519  ? 7.375   -22.324 51.984  1.00 64.05  ? 519  PRO A C     1 
ATOM   4817  O  O     . PRO D 4  519  ? 7.102   -21.780 53.057  1.00 63.08  ? 519  PRO A O     1 
ATOM   4818  C  CB    . PRO D 4  519  ? 6.233   -24.538 51.613  1.00 81.22  ? 519  PRO A CB    1 
ATOM   4819  C  CG    . PRO D 4  519  ? 5.765   -24.967 52.956  1.00 73.36  ? 519  PRO A CG    1 
ATOM   4820  C  CD    . PRO D 4  519  ? 7.017   -25.346 53.688  1.00 75.82  ? 519  PRO A CD    1 
ATOM   4821  N  N     . CYS D 4  520  ? 7.531   -21.651 50.843  1.00 86.47  ? 520  CYS A N     1 
ATOM   4822  C  CA    . CYS D 4  520  ? 7.311   -20.216 50.750  1.00 87.83  ? 520  CYS A CA    1 
ATOM   4823  C  C     . CYS D 4  520  ? 6.052   -19.847 49.982  1.00 73.46  ? 520  CYS A C     1 
ATOM   4824  O  O     . CYS D 4  520  ? 5.681   -18.668 49.966  1.00 75.10  ? 520  CYS A O     1 
ATOM   4825  C  CB    . CYS D 4  520  ? 8.523   -19.529 50.101  1.00 80.24  ? 520  CYS A CB    1 
ATOM   4826  S  SG    . CYS D 4  520  ? 9.107   -20.303 48.583  1.00 79.14  ? 520  CYS A SG    1 
ATOM   4827  N  N     . MET D 4  521  ? 5.390   -20.810 49.350  1.00 59.10  ? 521  MET A N     1 
ATOM   4828  C  CA    . MET D 4  521  ? 4.178   -20.555 48.589  1.00 65.60  ? 521  MET A CA    1 
ATOM   4829  C  C     . MET D 4  521  ? 3.045   -21.399 49.149  1.00 59.51  ? 521  MET A C     1 
ATOM   4830  O  O     . MET D 4  521  ? 3.246   -22.565 49.504  1.00 60.37  ? 521  MET A O     1 
ATOM   4831  C  CB    . MET D 4  521  ? 4.389   -20.863 47.103  1.00 75.19  ? 521  MET A CB    1 
ATOM   4832  C  CG    . MET D 4  521  ? 5.794   -20.548 46.612  1.00 70.77  ? 521  MET A CG    1 
ATOM   4833  S  SD    . MET D 4  521  ? 6.016   -20.780 44.843  1.00 82.56  ? 521  MET A SD    1 
ATOM   4834  C  CE    . MET D 4  521  ? 7.803   -20.780 44.728  1.00 58.62  ? 521  MET A CE    1 
ATOM   4835  N  N     . GLY D 4  522  ? 1.857   -20.804 49.238  1.00 74.06  ? 522  GLY A N     1 
ATOM   4836  C  CA    . GLY D 4  522  ? 0.691   -21.496 49.745  1.00 64.35  ? 522  GLY A CA    1 
ATOM   4837  C  C     . GLY D 4  522  ? -0.569  -21.035 49.042  1.00 76.94  ? 522  GLY A C     1 
ATOM   4838  O  O     . GLY D 4  522  ? -0.539  -20.159 48.174  1.00 79.43  ? 522  GLY A O     1 
ATOM   4839  N  N     . ILE D 4  523  ? -1.680  -21.649 49.436  1.00 60.27  ? 523  ILE A N     1 
ATOM   4840  C  CA    . ILE D 4  523  ? -2.995  -21.304 48.905  1.00 61.26  ? 523  ILE A CA    1 
ATOM   4841  C  C     . ILE D 4  523  ? -3.498  -20.071 49.651  1.00 59.57  ? 523  ILE A C     1 
ATOM   4842  O  O     . ILE D 4  523  ? -3.543  -20.060 50.886  1.00 60.68  ? 523  ILE A O     1 
ATOM   4843  C  CB    . ILE D 4  523  ? -3.965  -22.487 49.042  1.00 61.29  ? 523  ILE A CB    1 
ATOM   4844  C  CG1   . ILE D 4  523  ? -4.014  -23.307 47.751  1.00 64.30  ? 523  ILE A CG1   1 
ATOM   4845  C  CG2   . ILE D 4  523  ? -5.346  -22.026 49.398  1.00 61.36  ? 523  ILE A CG2   1 
ATOM   4846  C  CD1   . ILE D 4  523  ? -2.696  -23.921 47.354  1.00 69.43  ? 523  ILE A CD1   1 
ATOM   4847  N  N     . VAL D 4  524  ? -3.838  -19.010 48.913  1.00 77.54  ? 524  VAL A N     1 
ATOM   4848  C  CA    . VAL D 4  524  ? -4.088  -17.713 49.531  1.00 58.30  ? 524  VAL A CA    1 
ATOM   4849  C  C     . VAL D 4  524  ? -5.419  -17.126 49.061  1.00 75.60  ? 524  VAL A C     1 
ATOM   4850  O  O     . VAL D 4  524  ? -5.715  -17.083 47.861  1.00 111.47 ? 524  VAL A O     1 
ATOM   4851  C  CB    . VAL D 4  524  ? -2.925  -16.716 49.294  1.00 60.58  ? 524  VAL A CB    1 
ATOM   4852  C  CG1   . VAL D 4  524  ? -1.585  -17.365 49.595  1.00 80.34  ? 524  VAL A CG1   1 
ATOM   4853  C  CG2   . VAL D 4  524  ? -2.916  -16.155 47.884  1.00 56.86  ? 524  VAL A CG2   1 
ATOM   4854  N  N     . GLN D 4  525  ? -6.251  -16.758 50.031  1.00 71.05  ? 525  GLN A N     1 
ATOM   4855  C  CA    . GLN D 4  525  ? -7.209  -15.657 49.989  1.00 84.66  ? 525  GLN A CA    1 
ATOM   4856  C  C     . GLN D 4  525  ? -8.454  -15.881 49.132  1.00 95.88  ? 525  GLN A C     1 
ATOM   4857  O  O     . GLN D 4  525  ? -9.474  -15.223 49.360  1.00 141.98 ? 525  GLN A O     1 
ATOM   4858  C  CB    . GLN D 4  525  ? -6.449  -14.399 49.530  1.00 76.09  ? 525  GLN A CB    1 
ATOM   4859  C  CG    . GLN D 4  525  ? -7.292  -13.200 49.115  1.00 64.73  ? 525  GLN A CG    1 
ATOM   4860  C  CD    . GLN D 4  525  ? -6.452  -12.043 48.599  1.00 81.59  ? 525  GLN A CD    1 
ATOM   4861  O  OE1   . GLN D 4  525  ? -6.721  -10.882 48.905  1.00 77.98  ? 525  GLN A OE1   1 
ATOM   4862  N  NE2   . GLN D 4  525  ? -5.439  -12.356 47.794  1.00 86.11  ? 525  GLN A NE2   1 
ATOM   4863  N  N     . ASP D 4  526  ? -8.454  -16.830 48.208  1.00 92.52  ? 526  ASP A N     1 
ATOM   4864  C  CA    . ASP D 4  526  ? -9.755  -17.255 47.699  1.00 85.90  ? 526  ASP A CA    1 
ATOM   4865  C  C     . ASP D 4  526  ? -9.872  -18.755 47.804  1.00 68.57  ? 526  ASP A C     1 
ATOM   4866  O  O     . ASP D 4  526  ? -10.864 -19.290 48.318  1.00 74.06  ? 526  ASP A O     1 
ATOM   4867  C  CB    . ASP D 4  526  ? -9.994  -16.806 46.261  1.00 90.00  ? 526  ASP A CB    1 
ATOM   4868  C  CG    . ASP D 4  526  ? -10.860 -15.568 46.179  1.00 67.02  ? 526  ASP A CG    1 
ATOM   4869  O  OD1   . ASP D 4  526  ? -10.496 -14.607 45.475  1.00 59.43  ? 526  ASP A OD1   1 
ATOM   4870  O  OD2   . ASP D 4  526  ? -11.928 -15.575 46.812  1.00 61.05  ? 526  ASP A OD2   1 
ATOM   4871  N  N     . THR D 4  527  ? -8.846  -19.434 47.305  1.00 69.13  ? 527  THR A N     1 
ATOM   4872  C  CA    . THR D 4  527  ? -8.766  -20.869 47.490  1.00 94.25  ? 527  THR A CA    1 
ATOM   4873  C  C     . THR D 4  527  ? -8.713  -21.194 48.973  1.00 97.02  ? 527  THR A C     1 
ATOM   4874  O  O     . THR D 4  527  ? -9.305  -22.178 49.425  1.00 102.02 ? 527  THR A O     1 
ATOM   4875  C  CB    . THR D 4  527  ? -7.546  -21.421 46.760  1.00 90.59  ? 527  THR A CB    1 
ATOM   4876  O  OG1   . THR D 4  527  ? -7.325  -20.671 45.558  1.00 63.82  ? 527  THR A OG1   1 
ATOM   4877  C  CG2   . THR D 4  527  ? -7.761  -22.881 46.411  1.00 98.80  ? 527  THR A CG2   1 
ATOM   4878  N  N     . LEU D 4  528  ? -8.050  -20.341 49.755  1.00 85.58  ? 528  LEU A N     1 
ATOM   4879  C  CA    . LEU D 4  528  ? -7.965  -20.559 51.193  1.00 78.40  ? 528  LEU A CA    1 
ATOM   4880  C  C     . LEU D 4  528  ? -9.304  -20.283 51.865  1.00 76.76  ? 528  LEU A C     1 
ATOM   4881  O  O     . LEU D 4  528  ? -9.793  -21.098 52.656  1.00 89.49  ? 528  LEU A O     1 
ATOM   4882  C  CB    . LEU D 4  528  ? -6.863  -19.679 51.785  1.00 65.23  ? 528  LEU A CB    1 
ATOM   4883  C  CG    . LEU D 4  528  ? -6.698  -19.725 53.303  1.00 63.24  ? 528  LEU A CG    1 
ATOM   4884  C  CD1   . LEU D 4  528  ? -6.567  -21.165 53.783  1.00 66.13  ? 528  LEU A CD1   1 
ATOM   4885  C  CD2   . LEU D 4  528  ? -5.495  -18.899 53.731  1.00 75.71  ? 528  LEU A CD2   1 
ATOM   4886  N  N     . CYS D 4  529  ? -9.913  -19.137 51.559  1.00 61.23  ? 529  CYS A N     1 
ATOM   4887  C  CA    . CYS D 4  529  ? -11.239 -18.845 52.088  1.00 61.67  ? 529  CYS A CA    1 
ATOM   4888  C  C     . CYS D 4  529  ? -12.255 -19.878 51.616  1.00 67.02  ? 529  CYS A C     1 
ATOM   4889  O  O     . CYS D 4  529  ? -13.146 -20.280 52.374  1.00 63.58  ? 529  CYS A O     1 
ATOM   4890  C  CB    . CYS D 4  529  ? -11.660 -17.436 51.670  1.00 60.82  ? 529  CYS A CB    1 
ATOM   4891  S  SG    . CYS D 4  529  ? -13.299 -16.951 52.232  1.00 64.43  ? 529  CYS A SG    1 
ATOM   4892  N  N     . GLY D 4  530  ? -12.125 -20.328 50.366  1.00 86.37  ? 530  GLY A N     1 
ATOM   4893  C  CA    . GLY D 4  530  ? -13.082 -21.268 49.813  1.00 73.69  ? 530  GLY A CA    1 
ATOM   4894  C  C     . GLY D 4  530  ? -12.861 -22.703 50.236  1.00 79.01  ? 530  GLY A C     1 
ATOM   4895  O  O     . GLY D 4  530  ? -13.826 -23.463 50.361  1.00 93.46  ? 530  GLY A O     1 
ATOM   4896  N  N     . ILE D 4  531  ? -11.604 -23.100 50.460  1.00 72.11  ? 531  ILE A N     1 
ATOM   4897  C  CA    . ILE D 4  531  ? -11.343 -24.487 50.835  1.00 65.67  ? 531  ILE A CA    1 
ATOM   4898  C  C     . ILE D 4  531  ? -11.845 -24.759 52.244  1.00 80.03  ? 531  ILE A C     1 
ATOM   4899  O  O     . ILE D 4  531  ? -12.192 -25.897 52.575  1.00 92.90  ? 531  ILE A O     1 
ATOM   4900  C  CB    . ILE D 4  531  ? -9.848  -24.829 50.683  1.00 65.30  ? 531  ILE A CB    1 
ATOM   4901  C  CG1   . ILE D 4  531  ? -9.668  -26.319 50.398  1.00 66.43  ? 531  ILE A CG1   1 
ATOM   4902  C  CG2   . ILE D 4  531  ? -9.055  -24.417 51.919  1.00 64.91  ? 531  ILE A CG2   1 
ATOM   4903  C  CD1   . ILE D 4  531  ? -8.272  -26.688 49.955  1.00 66.13  ? 531  ILE A CD1   1 
ATOM   4904  N  N     . ARG D 4  532  ? -11.908 -23.730 53.090  1.00 67.68  ? 532  ARG A N     1 
ATOM   4905  C  CA    . ARG D 4  532  ? -12.545 -23.889 54.391  1.00 78.31  ? 532  ARG A CA    1 
ATOM   4906  C  C     . ARG D 4  532  ? -14.057 -23.996 54.235  1.00 84.53  ? 532  ARG A C     1 
ATOM   4907  O  O     . ARG D 4  532  ? -14.692 -24.878 54.824  1.00 90.42  ? 532  ARG A O     1 
ATOM   4908  C  CB    . ARG D 4  532  ? -12.165 -22.726 55.311  1.00 83.22  ? 532  ARG A CB    1 
ATOM   4909  C  CG    . ARG D 4  532  ? -12.968 -22.672 56.599  1.00 80.84  ? 532  ARG A CG    1 
ATOM   4910  C  CD    . ARG D 4  532  ? -13.959 -21.526 56.566  1.00 71.17  ? 532  ARG A CD    1 
ATOM   4911  N  NE    . ARG D 4  532  ? -14.952 -21.628 57.629  1.00 75.49  ? 532  ARG A NE    1 
ATOM   4912  C  CZ    . ARG D 4  532  ? -16.015 -20.837 57.723  1.00 79.03  ? 532  ARG A CZ    1 
ATOM   4913  N  NH1   . ARG D 4  532  ? -16.214 -19.890 56.815  1.00 80.89  ? 532  ARG A NH1   1 
ATOM   4914  N  NH2   . ARG D 4  532  ? -16.881 -20.997 58.714  1.00 69.79  ? 532  ARG A NH2   1 
ATOM   4915  N  N     . LYS D 4  533  ? -14.648 -23.107 53.432  1.00 66.72  ? 533  LYS A N     1 
ATOM   4916  C  CA    . LYS D 4  533  ? -16.075 -23.200 53.141  1.00 67.49  ? 533  LYS A CA    1 
ATOM   4917  C  C     . LYS D 4  533  ? -16.418 -24.536 52.497  1.00 68.63  ? 533  LYS A C     1 
ATOM   4918  O  O     . LYS D 4  533  ? -17.469 -25.122 52.782  1.00 69.81  ? 533  LYS A O     1 
ATOM   4919  C  CB    . LYS D 4  533  ? -16.499 -22.050 52.228  1.00 66.59  ? 533  LYS A CB    1 
ATOM   4920  C  CG    . LYS D 4  533  ? -16.373 -20.672 52.841  1.00 65.62  ? 533  LYS A CG    1 
ATOM   4921  C  CD    . LYS D 4  533  ? -17.638 -19.869 52.600  1.00 65.68  ? 533  LYS A CD    1 
ATOM   4922  C  CE    . LYS D 4  533  ? -18.864 -20.605 53.123  1.00 67.09  ? 533  LYS A CE    1 
ATOM   4923  N  NZ    . LYS D 4  533  ? -20.114 -19.839 52.866  1.00 71.89  ? 533  LYS A NZ    1 
ATOM   4924  N  N     . LEU D 4  534  ? -15.537 -25.033 51.624  1.00 86.57  ? 534  LEU A N     1 
ATOM   4925  C  CA    . LEU D 4  534  ? -15.809 -26.276 50.908  1.00 91.16  ? 534  LEU A CA    1 
ATOM   4926  C  C     . LEU D 4  534  ? -15.788 -27.473 51.847  1.00 83.10  ? 534  LEU A C     1 
ATOM   4927  O  O     . LEU D 4  534  ? -16.647 -28.356 51.755  1.00 77.56  ? 534  LEU A O     1 
ATOM   4928  C  CB    . LEU D 4  534  ? -14.787 -26.469 49.785  1.00 86.20  ? 534  LEU A CB    1 
ATOM   4929  C  CG    . LEU D 4  534  ? -14.782 -27.831 49.080  1.00 70.17  ? 534  LEU A CG    1 
ATOM   4930  C  CD1   . LEU D 4  534  ? -15.980 -27.970 48.148  1.00 70.60  ? 534  LEU A CD1   1 
ATOM   4931  C  CD2   . LEU D 4  534  ? -13.478 -28.062 48.327  1.00 69.37  ? 534  LEU A CD2   1 
ATOM   4932  N  N     . THR D 4  535  ? -14.826 -27.512 52.765  1.00 79.98  ? 535  THR A N     1 
ATOM   4933  C  CA    . THR D 4  535  ? -14.577 -28.703 53.565  1.00 86.40  ? 535  THR A CA    1 
ATOM   4934  C  C     . THR D 4  535  ? -15.530 -28.848 54.746  1.00 93.33  ? 535  THR A C     1 
ATOM   4935  O  O     . THR D 4  535  ? -15.427 -29.832 55.482  1.00 109.33 ? 535  THR A O     1 
ATOM   4936  C  CB    . THR D 4  535  ? -13.133 -28.692 54.068  1.00 92.89  ? 535  THR A CB    1 
ATOM   4937  O  OG1   . THR D 4  535  ? -12.294 -28.087 53.079  1.00 99.78  ? 535  THR A OG1   1 
ATOM   4938  C  CG2   . THR D 4  535  ? -12.647 -30.110 54.293  1.00 99.96  ? 535  THR A CG2   1 
ATOM   4939  N  N     . LEU D 4  536  ? -16.452 -27.909 54.946  1.00 72.25  ? 536  LEU A N     1 
ATOM   4940  C  CA    . LEU D 4  536  ? -17.388 -28.020 56.057  1.00 73.23  ? 536  LEU A CA    1 
ATOM   4941  C  C     . LEU D 4  536  ? -18.238 -29.278 55.923  1.00 80.05  ? 536  LEU A C     1 
ATOM   4942  O  O     . LEU D 4  536  ? -18.656 -29.653 54.825  1.00 78.35  ? 536  LEU A O     1 
ATOM   4943  C  CB    . LEU D 4  536  ? -18.290 -26.788 56.120  1.00 79.94  ? 536  LEU A CB    1 
ATOM   4944  C  CG    . LEU D 4  536  ? -17.594 -25.450 56.360  1.00 71.14  ? 536  LEU A CG    1 
ATOM   4945  C  CD1   . LEU D 4  536  ? -18.601 -24.412 56.827  1.00 71.02  ? 536  LEU A CD1   1 
ATOM   4946  C  CD2   . LEU D 4  536  ? -16.469 -25.607 57.368  1.00 70.93  ? 536  LEU A CD2   1 
ATOM   4947  N  N     . ARG D 4  537  ? -18.491 -29.937 57.059  1.00 105.84 ? 537  ARG A N     1 
ATOM   4948  C  CA    . ARG D 4  537  ? -19.345 -31.122 57.049  1.00 106.52 ? 537  ARG A CA    1 
ATOM   4949  C  C     . ARG D 4  537  ? -20.761 -30.782 56.609  1.00 95.21  ? 537  ARG A C     1 
ATOM   4950  O  O     . ARG D 4  537  ? -21.474 -31.645 56.083  1.00 93.25  ? 537  ARG A O     1 
ATOM   4951  C  CB    . ARG D 4  537  ? -19.357 -31.774 58.433  1.00 104.18 ? 537  ARG A CB    1 
ATOM   4952  C  CG    . ARG D 4  537  ? -17.982 -32.214 58.916  1.00 100.43 ? 537  ARG A CG    1 
ATOM   4953  C  CD    . ARG D 4  537  ? -17.839 -32.023 60.415  1.00 113.62 ? 537  ARG A CD    1 
ATOM   4954  N  NE    . ARG D 4  537  ? -18.304 -33.160 61.205  1.00 112.93 ? 537  ARG A NE    1 
ATOM   4955  C  CZ    . ARG D 4  537  ? -17.512 -34.129 61.658  1.00 88.88  ? 537  ARG A CZ    1 
ATOM   4956  N  NH1   . ARG D 4  537  ? -16.210 -34.099 61.404  1.00 82.37  ? 537  ARG A NH1   1 
ATOM   4957  N  NH2   . ARG D 4  537  ? -18.019 -35.121 62.374  1.00 85.02  ? 537  ARG A NH2   1 
ATOM   4958  N  N     . ASP D 4  538  ? -21.186 -29.534 56.817  1.00 86.73  ? 538  ASP A N     1 
ATOM   4959  C  CA    . ASP D 4  538  ? -22.479 -29.083 56.321  1.00 91.26  ? 538  ASP A CA    1 
ATOM   4960  C  C     . ASP D 4  538  ? -22.478 -28.875 54.812  1.00 97.72  ? 538  ASP A C     1 
ATOM   4961  O  O     . ASP D 4  538  ? -23.552 -28.855 54.199  1.00 83.97  ? 538  ASP A O     1 
ATOM   4962  C  CB    . ASP D 4  538  ? -22.880 -27.784 57.020  1.00 89.52  ? 538  ASP A CB    1 
ATOM   4963  C  CG    . ASP D 4  538  ? -23.996 -27.981 58.022  1.00 89.09  ? 538  ASP A CG    1 
ATOM   4964  O  OD1   . ASP D 4  538  ? -24.522 -29.109 58.117  1.00 98.62  ? 538  ASP A OD1   1 
ATOM   4965  O  OD2   . ASP D 4  538  ? -24.350 -27.003 58.713  1.00 78.96  ? 538  ASP A OD2   1 
ATOM   4966  N  N     . THR D 4  539  ? -21.305 -28.722 54.204  1.00 85.78  ? 539  THR A N     1 
ATOM   4967  C  CA    . THR D 4  539  ? -21.211 -28.486 52.770  1.00 75.33  ? 539  THR A CA    1 
ATOM   4968  C  C     . THR D 4  539  ? -21.408 -29.798 52.021  1.00 76.59  ? 539  THR A C     1 
ATOM   4969  O  O     . THR D 4  539  ? -20.627 -30.743 52.188  1.00 77.02  ? 539  THR A O     1 
ATOM   4970  C  CB    . THR D 4  539  ? -19.863 -27.861 52.416  1.00 73.72  ? 539  THR A CB    1 
ATOM   4971  O  OG1   . THR D 4  539  ? -19.825 -26.508 52.887  1.00 72.55  ? 539  THR A OG1   1 
ATOM   4972  C  CG2   . THR D 4  539  ? -19.652 -27.870 50.911  1.00 73.26  ? 539  THR A CG2   1 
ATOM   4973  N  N     . PHE D 4  540  ? -22.450 -29.853 51.196  1.00 94.96  ? 540  PHE A N     1 
ATOM   4974  C  CA    . PHE D 4  540  ? -22.741 -31.010 50.365  1.00 113.03 ? 540  PHE A CA    1 
ATOM   4975  C  C     . PHE D 4  540  ? -22.934 -30.559 48.924  1.00 117.28 ? 540  PHE A C     1 
ATOM   4976  O  O     . PHE D 4  540  ? -23.455 -29.471 48.661  1.00 112.34 ? 540  PHE A O     1 
ATOM   4977  C  CB    . PHE D 4  540  ? -23.976 -31.761 50.872  1.00 115.14 ? 540  PHE A CB    1 
ATOM   4978  C  CG    . PHE D 4  540  ? -23.701 -32.629 52.064  1.00 110.16 ? 540  PHE A CG    1 
ATOM   4979  C  CD1   . PHE D 4  540  ? -24.212 -32.304 53.309  1.00 104.49 ? 540  PHE A CD1   1 
ATOM   4980  C  CD2   . PHE D 4  540  ? -22.927 -33.770 51.938  1.00 89.67  ? 540  PHE A CD2   1 
ATOM   4981  C  CE1   . PHE D 4  540  ? -23.953 -33.102 54.409  1.00 94.59  ? 540  PHE A CE1   1 
ATOM   4982  C  CE2   . PHE D 4  540  ? -22.668 -34.572 53.032  1.00 88.43  ? 540  PHE A CE2   1 
ATOM   4983  C  CZ    . PHE D 4  540  ? -23.183 -34.238 54.269  1.00 95.24  ? 540  PHE A CZ    1 
ATOM   4984  N  N     . ILE D 4  541  ? -22.500 -31.405 47.993  1.00 101.12 ? 541  ILE A N     1 
ATOM   4985  C  CA    . ILE D 4  541  ? -22.437 -31.070 46.575  1.00 92.09  ? 541  ILE A CA    1 
ATOM   4986  C  C     . ILE D 4  541  ? -23.286 -32.065 45.795  1.00 103.79 ? 541  ILE A C     1 
ATOM   4987  O  O     . ILE D 4  541  ? -23.109 -33.281 45.932  1.00 85.29  ? 541  ILE A O     1 
ATOM   4988  C  CB    . ILE D 4  541  ? -20.984 -31.074 46.067  1.00 80.12  ? 541  ILE A CB    1 
ATOM   4989  C  CG1   . ILE D 4  541  ? -20.094 -30.253 46.997  1.00 78.76  ? 541  ILE A CG1   1 
ATOM   4990  C  CG2   . ILE D 4  541  ? -20.907 -30.513 44.671  1.00 85.84  ? 541  ILE A CG2   1 
ATOM   4991  C  CD1   . ILE D 4  541  ? -18.678 -30.110 46.501  1.00 86.64  ? 541  ILE A CD1   1 
ATOM   4992  N  N     . GLU D 4  542  ? -24.199 -31.549 44.973  1.00 109.98 ? 542  GLU A N     1 
ATOM   4993  C  CA    . GLU D 4  542  ? -25.030 -32.402 44.139  1.00 110.25 ? 542  GLU A CA    1 
ATOM   4994  C  C     . GLU D 4  542  ? -24.239 -32.897 42.928  1.00 93.81  ? 542  GLU A C     1 
ATOM   4995  O  O     . GLU D 4  542  ? -23.106 -32.478 42.675  1.00 86.43  ? 542  GLU A O     1 
ATOM   4996  C  CB    . GLU D 4  542  ? -26.293 -31.663 43.695  1.00 120.49 ? 542  GLU A CB    1 
ATOM   4997  C  CG    . GLU D 4  542  ? -27.209 -31.259 44.842  1.00 136.24 ? 542  GLU A CG    1 
ATOM   4998  C  CD    . GLU D 4  542  ? -28.498 -30.614 44.366  1.00 144.65 ? 542  GLU A CD    1 
ATOM   4999  O  OE1   . GLU D 4  542  ? -29.089 -31.119 43.388  1.00 149.35 ? 542  GLU A OE1   1 
ATOM   5000  O  OE2   . GLU D 4  542  ? -28.916 -29.601 44.965  1.00 146.57 ? 542  GLU A OE2   1 
ATOM   5001  N  N     . LEU D 4  543  ? -24.868 -33.793 42.161  1.00 86.75  ? 543  LEU A N     1 
ATOM   5002  C  CA    . LEU D 4  543  ? -24.149 -34.532 41.125  1.00 85.21  ? 543  LEU A CA    1 
ATOM   5003  C  C     . LEU D 4  543  ? -23.650 -33.613 40.015  1.00 92.30  ? 543  LEU A C     1 
ATOM   5004  O  O     . LEU D 4  543  ? -22.487 -33.703 39.603  1.00 87.41  ? 543  LEU A O     1 
ATOM   5005  C  CB    . LEU D 4  543  ? -25.044 -35.628 40.547  1.00 87.22  ? 543  LEU A CB    1 
ATOM   5006  C  CG    . LEU D 4  543  ? -24.523 -36.291 39.270  1.00 87.59  ? 543  LEU A CG    1 
ATOM   5007  C  CD1   . LEU D 4  543  ? -23.197 -36.991 39.527  1.00 87.36  ? 543  LEU A CD1   1 
ATOM   5008  C  CD2   . LEU D 4  543  ? -25.543 -37.267 38.711  1.00 89.65  ? 543  LEU A CD2   1 
ATOM   5009  N  N     . ASP D 4  544  ? -24.518 -32.731 39.511  1.00 102.22 ? 544  ASP A N     1 
ATOM   5010  C  CA    . ASP D 4  544  ? -24.142 -31.853 38.404  1.00 88.74  ? 544  ASP A CA    1 
ATOM   5011  C  C     . ASP D 4  544  ? -22.885 -31.062 38.735  1.00 84.60  ? 544  ASP A C     1 
ATOM   5012  O  O     . ASP D 4  544  ? -21.959 -30.972 37.920  1.00 77.33  ? 544  ASP A O     1 
ATOM   5013  C  CB    . ASP D 4  544  ? -25.297 -30.906 38.072  1.00 93.81  ? 544  ASP A CB    1 
ATOM   5014  C  CG    . ASP D 4  544  ? -25.914 -30.277 39.311  1.00 102.13 ? 544  ASP A CG    1 
ATOM   5015  O  OD1   . ASP D 4  544  ? -25.197 -29.554 40.039  1.00 95.83  ? 544  ASP A OD1   1 
ATOM   5016  O  OD2   . ASP D 4  544  ? -27.116 -30.513 39.562  1.00 101.99 ? 544  ASP A OD2   1 
ATOM   5017  N  N     . GLN D 4  545  ? -22.837 -30.481 39.935  1.00 89.73  ? 545  GLN A N     1 
ATOM   5018  C  CA    . GLN D 4  545  ? -21.669 -29.714 40.349  1.00 84.33  ? 545  GLN A CA    1 
ATOM   5019  C  C     . GLN D 4  545  ? -20.430 -30.595 40.427  1.00 85.10  ? 545  GLN A C     1 
ATOM   5020  O  O     . GLN D 4  545  ? -19.327 -30.157 40.081  1.00 92.74  ? 545  GLN A O     1 
ATOM   5021  C  CB    . GLN D 4  545  ? -21.934 -29.055 41.702  1.00 100.33 ? 545  GLN A CB    1 
ATOM   5022  C  CG    . GLN D 4  545  ? -21.796 -27.546 41.735  1.00 102.94 ? 545  GLN A CG    1 
ATOM   5023  C  CD    . GLN D 4  545  ? -22.155 -26.977 43.096  1.00 92.18  ? 545  GLN A CD    1 
ATOM   5024  O  OE1   . GLN D 4  545  ? -23.106 -27.427 43.738  1.00 91.68  ? 545  GLN A OE1   1 
ATOM   5025  N  NE2   . GLN D 4  545  ? -21.390 -25.987 43.545  1.00 82.15  ? 545  GLN A NE2   1 
ATOM   5026  N  N     . VAL D 4  546  ? -20.593 -31.844 40.880  1.00 76.87  ? 546  VAL A N     1 
ATOM   5027  C  CA    . VAL D 4  546  ? -19.448 -32.737 41.058  1.00 77.04  ? 546  VAL A CA    1 
ATOM   5028  C  C     . VAL D 4  546  ? -18.772 -33.018 39.724  1.00 76.90  ? 546  VAL A C     1 
ATOM   5029  O  O     . VAL D 4  546  ? -17.542 -32.968 39.614  1.00 76.06  ? 546  VAL A O     1 
ATOM   5030  C  CB    . VAL D 4  546  ? -19.883 -34.041 41.752  1.00 78.78  ? 546  VAL A CB    1 
ATOM   5031  C  CG1   . VAL D 4  546  ? -18.784 -35.089 41.648  1.00 79.21  ? 546  VAL A CG1   1 
ATOM   5032  C  CG2   . VAL D 4  546  ? -20.219 -33.780 43.210  1.00 78.76  ? 546  VAL A CG2   1 
ATOM   5033  N  N     . LEU D 4  547  ? -19.564 -33.307 38.689  1.00 83.40  ? 547  LEU A N     1 
ATOM   5034  C  CA    . LEU D 4  547  ? -18.993 -33.695 37.403  1.00 78.93  ? 547  LEU A CA    1 
ATOM   5035  C  C     . LEU D 4  547  ? -18.165 -32.566 36.797  1.00 76.15  ? 547  LEU A C     1 
ATOM   5036  O  O     . LEU D 4  547  ? -17.075 -32.805 36.264  1.00 75.77  ? 547  LEU A O     1 
ATOM   5037  C  CB    . LEU D 4  547  ? -20.110 -34.138 36.456  1.00 88.28  ? 547  LEU A CB    1 
ATOM   5038  C  CG    . LEU D 4  547  ? -21.062 -35.194 37.036  1.00 87.07  ? 547  LEU A CG    1 
ATOM   5039  C  CD1   . LEU D 4  547  ? -22.294 -35.379 36.160  1.00 83.08  ? 547  LEU A CD1   1 
ATOM   5040  C  CD2   . LEU D 4  547  ? -20.355 -36.526 37.249  1.00 82.09  ? 547  LEU A CD2   1 
ATOM   5041  N  N     . ASN D 4  548  ? -18.659 -31.327 36.869  1.00 91.79  ? 548  ASN A N     1 
ATOM   5042  C  CA    . ASN D 4  548  ? -17.846 -30.185 36.456  1.00 94.71  ? 548  ASN A CA    1 
ATOM   5043  C  C     . ASN D 4  548  ? -16.647 -30.011 37.378  1.00 97.08  ? 548  ASN A C     1 
ATOM   5044  O  O     . ASN D 4  548  ? -15.517 -29.813 36.916  1.00 105.46 ? 548  ASN A O     1 
ATOM   5045  C  CB    . ASN D 4  548  ? -18.691 -28.910 36.435  1.00 102.73 ? 548  ASN A CB    1 
ATOM   5046  C  CG    . ASN D 4  548  ? -19.699 -28.892 35.303  1.00 96.69  ? 548  ASN A CG    1 
ATOM   5047  O  OD1   . ASN D 4  548  ? -19.337 -28.997 34.131  1.00 107.19 ? 548  ASN A OD1   1 
ATOM   5048  N  ND2   . ASN D 4  548  ? -20.975 -28.759 35.651  1.00 86.51  ? 548  ASN A ND2   1 
ATOM   5049  N  N     . MET D 4  549  ? -16.881 -30.080 38.690  1.00 78.40  ? 549  MET A N     1 
ATOM   5050  C  CA    . MET D 4  549  ? -15.793 -29.979 39.656  1.00 80.47  ? 549  MET A CA    1 
ATOM   5051  C  C     . MET D 4  549  ? -14.767 -31.082 39.438  1.00 72.45  ? 549  MET A C     1 
ATOM   5052  O  O     . MET D 4  549  ? -13.558 -30.857 39.574  1.00 71.57  ? 549  MET A O     1 
ATOM   5053  C  CB    . MET D 4  549  ? -16.363 -30.045 41.071  1.00 72.29  ? 549  MET A CB    1 
ATOM   5054  C  CG    . MET D 4  549  ? -15.827 -29.000 42.022  1.00 85.10  ? 549  MET A CG    1 
ATOM   5055  S  SD    . MET D 4  549  ? -16.898 -28.845 43.463  1.00 106.63 ? 549  MET A SD    1 
ATOM   5056  C  CE    . MET D 4  549  ? -18.465 -28.476 42.685  1.00 76.22  ? 549  MET A CE    1 
ATOM   5057  N  N     . LEU D 4  550  ? -15.236 -32.281 39.086  1.00 73.96  ? 550  LEU A N     1 
ATOM   5058  C  CA    . LEU D 4  550  ? -14.334 -33.403 38.857  1.00 74.67  ? 550  LEU A CA    1 
ATOM   5059  C  C     . LEU D 4  550  ? -13.525 -33.210 37.581  1.00 74.09  ? 550  LEU A C     1 
ATOM   5060  O  O     . LEU D 4  550  ? -12.314 -33.464 37.562  1.00 73.75  ? 550  LEU A O     1 
ATOM   5061  C  CB    . LEU D 4  550  ? -15.140 -34.699 38.793  1.00 76.54  ? 550  LEU A CB    1 
ATOM   5062  C  CG    . LEU D 4  550  ? -14.590 -35.950 39.463  1.00 77.62  ? 550  LEU A CG    1 
ATOM   5063  C  CD1   . LEU D 4  550  ? -13.962 -35.610 40.797  1.00 76.86  ? 550  LEU A CD1   1 
ATOM   5064  C  CD2   . LEU D 4  550  ? -15.739 -36.916 39.656  1.00 79.40  ? 550  LEU A CD2   1 
ATOM   5065  N  N     . TYR D 4  551  ? -14.179 -32.762 36.506  1.00 76.13  ? 551  TYR A N     1 
ATOM   5066  C  CA    . TYR D 4  551  ? -13.481 -32.568 35.241  1.00 75.68  ? 551  TYR A CA    1 
ATOM   5067  C  C     . TYR D 4  551  ? -12.423 -31.479 35.346  1.00 74.07  ? 551  TYR A C     1 
ATOM   5068  O  O     . TYR D 4  551  ? -11.395 -31.549 34.664  1.00 77.08  ? 551  TYR A O     1 
ATOM   5069  C  CB    . TYR D 4  551  ? -14.482 -32.224 34.133  1.00 93.98  ? 551  TYR A CB    1 
ATOM   5070  C  CG    . TYR D 4  551  ? -13.884 -32.226 32.740  1.00 103.89 ? 551  TYR A CG    1 
ATOM   5071  C  CD1   . TYR D 4  551  ? -12.739 -32.961 32.454  1.00 122.95 ? 551  TYR A CD1   1 
ATOM   5072  C  CD2   . TYR D 4  551  ? -14.446 -31.471 31.717  1.00 85.88  ? 551  TYR A CD2   1 
ATOM   5073  C  CE1   . TYR D 4  551  ? -12.180 -32.957 31.192  1.00 113.99 ? 551  TYR A CE1   1 
ATOM   5074  C  CE2   . TYR D 4  551  ? -13.891 -31.463 30.447  1.00 83.62  ? 551  TYR A CE2   1 
ATOM   5075  C  CZ    . TYR D 4  551  ? -12.758 -32.209 30.193  1.00 84.95  ? 551  TYR A CZ    1 
ATOM   5076  O  OH    . TYR D 4  551  ? -12.196 -32.207 28.939  1.00 75.71  ? 551  TYR A OH    1 
ATOM   5077  N  N     . TRP D 4  552  ? -12.646 -30.479 36.202  1.00 70.92  ? 552  TRP A N     1 
ATOM   5078  C  CA    . TRP D 4  552  ? -11.742 -29.335 36.249  1.00 69.36  ? 552  TRP A CA    1 
ATOM   5079  C  C     . TRP D 4  552  ? -10.336 -29.734 36.679  1.00 69.09  ? 552  TRP A C     1 
ATOM   5080  O  O     . TRP D 4  552  ? -9.367  -29.046 36.337  1.00 68.05  ? 552  TRP A O     1 
ATOM   5081  C  CB    . TRP D 4  552  ? -12.306 -28.262 37.175  1.00 79.28  ? 552  TRP A CB    1 
ATOM   5082  C  CG    . TRP D 4  552  ? -12.817 -27.069 36.430  1.00 79.79  ? 552  TRP A CG    1 
ATOM   5083  C  CD1   . TRP D 4  552  ? -14.119 -26.687 36.278  1.00 68.01  ? 552  TRP A CD1   1 
ATOM   5084  C  CD2   . TRP D 4  552  ? -12.030 -26.109 35.718  1.00 79.72  ? 552  TRP A CD2   1 
ATOM   5085  N  NE1   . TRP D 4  552  ? -14.188 -25.542 35.522  1.00 67.08  ? 552  TRP A NE1   1 
ATOM   5086  C  CE2   . TRP D 4  552  ? -12.920 -25.167 35.166  1.00 66.17  ? 552  TRP A CE2   1 
ATOM   5087  C  CE3   . TRP D 4  552  ? -10.658 -25.954 35.496  1.00 81.70  ? 552  TRP A CE3   1 
ATOM   5088  C  CZ2   . TRP D 4  552  ? -12.483 -24.086 34.407  1.00 73.09  ? 552  TRP A CZ2   1 
ATOM   5089  C  CZ3   . TRP D 4  552  ? -10.225 -24.880 34.744  1.00 64.79  ? 552  TRP A CZ3   1 
ATOM   5090  C  CH2   . TRP D 4  552  ? -11.135 -23.959 34.208  1.00 74.54  ? 552  TRP A CH2   1 
ATOM   5091  N  N     . VAL D 4  553  ? -10.199 -30.835 37.410  1.00 72.39  ? 553  VAL A N     1 
ATOM   5092  C  CA    . VAL D 4  553  ? -8.881  -31.352 37.767  1.00 72.34  ? 553  VAL A CA    1 
ATOM   5093  C  C     . VAL D 4  553  ? -8.213  -31.873 36.501  1.00 90.32  ? 553  VAL A C     1 
ATOM   5094  O  O     . VAL D 4  553  ? -8.740  -32.795 35.859  1.00 98.98  ? 553  VAL A O     1 
ATOM   5095  C  CB    . VAL D 4  553  ? -8.976  -32.452 38.832  1.00 88.90  ? 553  VAL A CB    1 
ATOM   5096  C  CG1   . VAL D 4  553  ? -7.624  -32.661 39.495  1.00 96.91  ? 553  VAL A CG1   1 
ATOM   5097  C  CG2   . VAL D 4  553  ? -10.043 -32.104 39.852  1.00 88.59  ? 553  VAL A CG2   1 
ATOM   5098  N  N     . PRO D 4  554  ? -7.060  -31.326 36.110  1.00 97.97  ? 554  PRO A N     1 
ATOM   5099  C  CA    . PRO D 4  554  ? -6.453  -31.741 34.835  1.00 94.87  ? 554  PRO A CA    1 
ATOM   5100  C  C     . PRO D 4  554  ? -6.009  -33.191 34.818  1.00 106.46 ? 554  PRO A C     1 
ATOM   5101  O  O     . PRO D 4  554  ? -6.047  -33.824 33.756  1.00 111.46 ? 554  PRO A O     1 
ATOM   5102  C  CB    . PRO D 4  554  ? -5.262  -30.785 34.686  1.00 81.99  ? 554  PRO A CB    1 
ATOM   5103  C  CG    . PRO D 4  554  ? -4.944  -30.359 36.086  1.00 89.93  ? 554  PRO A CG    1 
ATOM   5104  C  CD    . PRO D 4  554  ? -6.256  -30.309 36.809  1.00 86.38  ? 554  PRO A CD    1 
ATOM   5105  N  N     . ASP D 4  555  ? -5.595  -33.742 35.957  1.00 131.44 ? 555  ASP A N     1 
ATOM   5106  C  CA    . ASP D 4  555  ? -5.093  -35.107 36.027  1.00 148.08 ? 555  ASP A CA    1 
ATOM   5107  C  C     . ASP D 4  555  ? -6.141  -36.092 36.528  1.00 140.01 ? 555  ASP A C     1 
ATOM   5108  O  O     . ASP D 4  555  ? -5.788  -37.121 37.115  1.00 156.76 ? 555  ASP A O     1 
ATOM   5109  C  CB    . ASP D 4  555  ? -3.849  -35.170 36.912  1.00 154.76 ? 555  ASP A CB    1 
ATOM   5110  C  CG    . ASP D 4  555  ? -2.683  -34.407 36.329  1.00 153.94 ? 555  ASP A CG    1 
ATOM   5111  O  OD1   . ASP D 4  555  ? -2.191  -33.476 36.997  1.00 149.40 ? 555  ASP A OD1   1 
ATOM   5112  O  OD2   . ASP D 4  555  ? -2.262  -34.734 35.199  1.00 158.91 ? 555  ASP A OD2   1 
ATOM   5113  N  N     . TRP D 4  556  ? -7.423  -35.804 36.316  1.00 77.92  ? 556  TRP A N     1 
ATOM   5114  C  CA    . TRP D 4  556  ? -8.457  -36.730 36.756  1.00 81.28  ? 556  TRP A CA    1 
ATOM   5115  C  C     . TRP D 4  556  ? -8.404  -38.001 35.914  1.00 99.05  ? 556  TRP A C     1 
ATOM   5116  O  O     . TRP D 4  556  ? -8.300  -37.942 34.685  1.00 99.41  ? 556  TRP A O     1 
ATOM   5117  C  CB    . TRP D 4  556  ? -9.843  -36.095 36.664  1.00 88.31  ? 556  TRP A CB    1 
ATOM   5118  C  CG    . TRP D 4  556  ? -10.908 -37.008 37.196  1.00 89.04  ? 556  TRP A CG    1 
ATOM   5119  C  CD1   . TRP D 4  556  ? -10.821 -37.801 38.302  1.00 104.12 ? 556  TRP A CD1   1 
ATOM   5120  C  CD2   . TRP D 4  556  ? -12.198 -37.262 36.622  1.00 95.51  ? 556  TRP A CD2   1 
ATOM   5121  N  NE1   . TRP D 4  556  ? -11.981 -38.515 38.467  1.00 110.97 ? 556  TRP A NE1   1 
ATOM   5122  C  CE2   . TRP D 4  556  ? -12.843 -38.204 37.449  1.00 92.69  ? 556  TRP A CE2   1 
ATOM   5123  C  CE3   . TRP D 4  556  ? -12.874 -36.777 35.498  1.00 105.67 ? 556  TRP A CE3   1 
ATOM   5124  C  CZ2   . TRP D 4  556  ? -14.129 -38.672 37.188  1.00 96.44  ? 556  TRP A CZ2   1 
ATOM   5125  C  CZ3   . TRP D 4  556  ? -14.152 -37.244 35.240  1.00 98.20  ? 556  TRP A CZ3   1 
ATOM   5126  C  CH2   . TRP D 4  556  ? -14.766 -38.181 36.083  1.00 99.69  ? 556  TRP A CH2   1 
ATOM   5127  N  N     . ASP D 4  557  ? -8.478  -39.149 36.584  1.00 127.00 ? 557  ASP A N     1 
ATOM   5128  C  CA    . ASP D 4  557  ? -8.373  -40.453 35.945  1.00 130.63 ? 557  ASP A CA    1 
ATOM   5129  C  C     . ASP D 4  557  ? -9.721  -41.008 35.499  1.00 133.52 ? 557  ASP A C     1 
ATOM   5130  O  O     . ASP D 4  557  ? -9.804  -42.188 35.143  1.00 144.90 ? 557  ASP A O     1 
ATOM   5131  C  CB    . ASP D 4  557  ? -7.690  -41.447 36.892  1.00 129.17 ? 557  ASP A CB    1 
ATOM   5132  C  CG    . ASP D 4  557  ? -8.319  -41.463 38.276  1.00 129.95 ? 557  ASP A CG    1 
ATOM   5133  O  OD1   . ASP D 4  557  ? -9.246  -40.663 38.524  1.00 133.10 ? 557  ASP A OD1   1 
ATOM   5134  O  OD2   . ASP D 4  557  ? -7.885  -42.277 39.119  1.00 130.32 ? 557  ASP A OD2   1 
ATOM   5135  N  N     . GLY D 4  558  ? -10.771 -40.191 35.510  1.00 124.46 ? 558  GLY A N     1 
ATOM   5136  C  CA    . GLY D 4  558  ? -12.084 -40.659 35.120  1.00 120.71 ? 558  GLY A CA    1 
ATOM   5137  C  C     . GLY D 4  558  ? -12.786 -41.513 36.150  1.00 117.23 ? 558  GLY A C     1 
ATOM   5138  O  O     . GLY D 4  558  ? -13.840 -42.083 35.846  1.00 110.74 ? 558  GLY A O     1 
ATOM   5139  N  N     . VAL D 4  559  ? -12.238 -41.619 37.358  1.00 116.39 ? 559  VAL A N     1 
ATOM   5140  C  CA    . VAL D 4  559  ? -12.812 -42.450 38.410  1.00 114.22 ? 559  VAL A CA    1 
ATOM   5141  C  C     . VAL D 4  559  ? -13.795 -41.584 39.190  1.00 106.06 ? 559  VAL A C     1 
ATOM   5142  O  O     . VAL D 4  559  ? -13.397 -40.741 39.996  1.00 101.07 ? 559  VAL A O     1 
ATOM   5143  C  CB    . VAL D 4  559  ? -11.731 -43.035 39.321  1.00 123.17 ? 559  VAL A CB    1 
ATOM   5144  C  CG1   . VAL D 4  559  ? -12.361 -43.811 40.471  1.00 133.54 ? 559  VAL A CG1   1 
ATOM   5145  C  CG2   . VAL D 4  559  ? -10.789 -43.924 38.524  1.00 128.78 ? 559  VAL A CG2   1 
ATOM   5146  N  N     . ILE D 4  560  ? -15.086 -41.789 38.947  1.00 105.01 ? 560  ILE A N     1 
ATOM   5147  C  CA    . ILE D 4  560  ? -16.128 -41.130 39.729  1.00 103.00 ? 560  ILE A CA    1 
ATOM   5148  C  C     . ILE D 4  560  ? -16.103 -41.723 41.133  1.00 95.93  ? 560  ILE A C     1 
ATOM   5149  O  O     . ILE D 4  560  ? -16.270 -42.941 41.292  1.00 111.59 ? 560  ILE A O     1 
ATOM   5150  C  CB    . ILE D 4  560  ? -17.513 -41.294 39.085  1.00 109.46 ? 560  ILE A CB    1 
ATOM   5151  C  CG1   . ILE D 4  560  ? -17.579 -40.543 37.755  1.00 112.63 ? 560  ILE A CG1   1 
ATOM   5152  C  CG2   . ILE D 4  560  ? -18.600 -40.807 40.034  1.00 98.66  ? 560  ILE A CG2   1 
ATOM   5153  C  CD1   . ILE D 4  560  ? -18.946 -40.580 37.099  1.00 121.93 ? 560  ILE A CD1   1 
ATOM   5154  N  N     . PRO D 4  561  ? -15.894 -40.915 42.169  1.00 84.36  ? 561  PRO A N     1 
ATOM   5155  C  CA    . PRO D 4  561  ? -15.840 -41.465 43.526  1.00 85.07  ? 561  PRO A CA    1 
ATOM   5156  C  C     . PRO D 4  561  ? -17.214 -41.899 44.001  1.00 86.53  ? 561  PRO A C     1 
ATOM   5157  O  O     . PRO D 4  561  ? -18.228 -41.267 43.695  1.00 86.38  ? 561  PRO A O     1 
ATOM   5158  C  CB    . PRO D 4  561  ? -15.310 -40.295 44.359  1.00 83.30  ? 561  PRO A CB    1 
ATOM   5159  C  CG    . PRO D 4  561  ? -15.768 -39.087 43.616  1.00 82.05  ? 561  PRO A CG    1 
ATOM   5160  C  CD    . PRO D 4  561  ? -15.728 -39.453 42.156  1.00 82.43  ? 561  PRO A CD    1 
ATOM   5161  N  N     . THR D 4  562  ? -17.239 -42.992 44.750  1.00 88.02  ? 562  THR A N     1 
ATOM   5162  C  CA    . THR D 4  562  ? -18.483 -43.444 45.348  1.00 89.51  ? 562  THR A CA    1 
ATOM   5163  C  C     . THR D 4  562  ? -18.980 -42.377 46.319  1.00 90.08  ? 562  THR A C     1 
ATOM   5164  O  O     . THR D 4  562  ? -18.229 -41.965 47.214  1.00 87.55  ? 562  THR A O     1 
ATOM   5165  C  CB    . THR D 4  562  ? -18.282 -44.774 46.068  1.00 91.23  ? 562  THR A CB    1 
ATOM   5166  O  OG1   . THR D 4  562  ? -17.489 -45.640 45.246  1.00 91.82  ? 562  THR A OG1   1 
ATOM   5167  C  CG2   . THR D 4  562  ? -19.621 -45.439 46.346  1.00 93.14  ? 562  THR A CG2   1 
ATOM   5168  N  N     . PRO D 4  563  ? -20.215 -41.901 46.174  1.00 103.51 ? 563  PRO A N     1 
ATOM   5169  C  CA    . PRO D 4  563  ? -20.654 -40.743 46.960  1.00 96.00  ? 563  PRO A CA    1 
ATOM   5170  C  C     . PRO D 4  563  ? -20.685 -41.055 48.446  1.00 106.14 ? 563  PRO A C     1 
ATOM   5171  O  O     . PRO D 4  563  ? -21.011 -42.171 48.858  1.00 107.12 ? 563  PRO A O     1 
ATOM   5172  C  CB    . PRO D 4  563  ? -22.059 -40.459 46.418  1.00 93.65  ? 563  PRO A CB    1 
ATOM   5173  C  CG    . PRO D 4  563  ? -22.514 -41.772 45.871  1.00 109.39 ? 563  PRO A CG    1 
ATOM   5174  C  CD    . PRO D 4  563  ? -21.287 -42.425 45.312  1.00 112.75 ? 563  PRO A CD    1 
ATOM   5175  N  N     . ALA D 4  564  ? -20.338 -40.046 49.250  1.00 86.86  ? 564  ALA A N     1 
ATOM   5176  C  CA    . ALA D 4  564  ? -20.402 -40.195 50.698  1.00 87.33  ? 564  ALA A CA    1 
ATOM   5177  C  C     . ALA D 4  564  ? -21.823 -40.464 51.168  1.00 88.84  ? 564  ALA A C     1 
ATOM   5178  O  O     . ALA D 4  564  ? -22.022 -41.174 52.159  1.00 90.10  ? 564  ALA A O     1 
ATOM   5179  C  CB    . ALA D 4  564  ? -19.848 -38.946 51.382  1.00 85.50  ? 564  ALA A CB    1 
ATOM   5180  N  N     . ILE D 4  565  ? -22.817 -39.922 50.471  1.00 88.81  ? 565  ILE A N     1 
ATOM   5181  C  CA    . ILE D 4  565  ? -24.217 -40.107 50.822  1.00 90.25  ? 565  ILE A CA    1 
ATOM   5182  C  C     . ILE D 4  565  ? -24.919 -40.771 49.645  1.00 97.85  ? 565  ILE A C     1 
ATOM   5183  O  O     . ILE D 4  565  ? -24.652 -40.450 48.482  1.00 93.05  ? 565  ILE A O     1 
ATOM   5184  C  CB    . ILE D 4  565  ? -24.889 -38.775 51.210  1.00 89.21  ? 565  ILE A CB    1 
ATOM   5185  C  CG1   . ILE D 4  565  ? -24.452 -38.368 52.618  1.00 88.63  ? 565  ILE A CG1   1 
ATOM   5186  C  CG2   . ILE D 4  565  ? -26.395 -38.900 51.177  1.00 90.67  ? 565  ILE A CG2   1 
ATOM   5187  C  CD1   . ILE D 4  565  ? -25.287 -37.262 53.228  1.00 91.93  ? 565  ILE A CD1   1 
ATOM   5188  N  N     . ILE D 4  566  ? -25.808 -41.710 49.965  1.00 103.71 ? 566  ILE A N     1 
ATOM   5189  C  CA    . ILE D 4  566  ? -26.511 -42.589 49.034  1.00 95.22  ? 566  ILE A CA    1 
ATOM   5190  C  C     . ILE D 4  566  ? -28.000 -42.428 49.339  1.00 96.42  ? 566  ILE A C     1 
ATOM   5191  O  O     . ILE D 4  566  ? -28.416 -41.368 49.814  1.00 98.76  ? 566  ILE A O     1 
ATOM   5192  C  CB    . ILE D 4  566  ? -26.018 -44.045 49.105  1.00 96.77  ? 566  ILE A CB    1 
ATOM   5193  C  CG1   . ILE D 4  566  ? -24.491 -44.067 49.216  1.00 95.47  ? 566  ILE A CG1   1 
ATOM   5194  C  CG2   . ILE D 4  566  ? -26.382 -44.786 47.824  1.00 97.97  ? 566  ILE A CG2   1 
ATOM   5195  C  CD1   . ILE D 4  566  ? -23.849 -45.417 48.948  1.00 96.77  ? 566  ILE A CD1   1 
ATOM   5196  N  N     . LYS D 4  567  ? -28.813 -43.457 49.055  1.00 119.83 ? 567  LYS A N     1 
ATOM   5197  C  CA    . LYS D 4  567  ? -30.178 -43.507 48.524  1.00 140.45 ? 567  LYS A CA    1 
ATOM   5198  C  C     . LYS D 4  567  ? -31.082 -42.283 48.710  1.00 151.63 ? 567  LYS A C     1 
ATOM   5199  O  O     . LYS D 4  567  ? -31.680 -41.864 47.710  1.00 168.53 ? 567  LYS A O     1 
ATOM   5200  C  CB    . LYS D 4  567  ? -30.898 -44.731 49.116  1.00 145.79 ? 567  LYS A CB    1 
ATOM   5201  C  CG    . LYS D 4  567  ? -32.399 -44.523 49.331  1.00 141.62 ? 567  LYS A CG    1 
ATOM   5202  C  CD    . LYS D 4  567  ? -33.171 -45.802 49.580  1.00 141.05 ? 567  LYS A CD    1 
ATOM   5203  C  CE    . LYS D 4  567  ? -34.613 -45.467 49.935  1.00 140.82 ? 567  LYS A CE    1 
ATOM   5204  N  NZ    . LYS D 4  567  ? -35.545 -46.585 49.640  1.00 144.41 ? 567  LYS A NZ    1 
ATOM   5205  N  N     . PRO D 4  568  ? -31.261 -41.688 49.907  1.00 123.73 ? 568  PRO A N     1 
ATOM   5206  C  CA    . PRO D 4  568  ? -32.115 -40.482 49.964  1.00 106.26 ? 568  PRO A CA    1 
ATOM   5207  C  C     . PRO D 4  568  ? -31.766 -39.445 48.909  1.00 96.12  ? 568  PRO A C     1 
ATOM   5208  O  O     . PRO D 4  568  ? -32.671 -38.848 48.317  1.00 96.20  ? 568  PRO A O     1 
ATOM   5209  C  CB    . PRO D 4  568  ? -31.898 -39.957 51.395  1.00 97.36  ? 568  PRO A CB    1 
ATOM   5210  C  CG    . PRO D 4  568  ? -30.736 -40.742 51.944  1.00 97.31  ? 568  PRO A CG    1 
ATOM   5211  C  CD    . PRO D 4  568  ? -30.818 -42.069 51.262  1.00 107.15 ? 568  PRO A CD    1 
ATOM   5212  N  N     . LYS D 4  569  ? -30.481 -39.244 48.633  1.00 94.52  ? 569  LYS A N     1 
ATOM   5213  C  CA    . LYS D 4  569  ? -30.002 -38.481 47.489  1.00 92.92  ? 569  LYS A CA    1 
ATOM   5214  C  C     . LYS D 4  569  ? -28.505 -38.719 47.369  1.00 94.47  ? 569  LYS A C     1 
ATOM   5215  O  O     . LYS D 4  569  ? -27.800 -38.691 48.384  1.00 131.98 ? 569  LYS A O     1 
ATOM   5216  C  CB    . LYS D 4  569  ? -30.300 -36.987 47.643  1.00 92.76  ? 569  LYS A CB    1 
ATOM   5217  C  CG    . LYS D 4  569  ? -30.189 -36.188 46.352  1.00 90.14  ? 569  LYS A CG    1 
ATOM   5218  C  CD    . LYS D 4  569  ? -30.785 -34.793 46.508  1.00 99.95  ? 569  LYS A CD    1 
ATOM   5219  C  CE    . LYS D 4  569  ? -30.699 -33.993 45.210  1.00 116.60 ? 569  LYS A CE    1 
ATOM   5220  N  NZ    . LYS D 4  569  ? -31.439 -34.632 44.083  1.00 124.15 ? 569  LYS A NZ    1 
ATOM   5221  N  N     . PRO D 4  570  ? -27.975 -38.955 46.172  1.00 91.45  ? 570  PRO A N     1 
ATOM   5222  C  CA    . PRO D 4  570  ? -26.520 -39.106 46.048  1.00 90.31  ? 570  PRO A CA    1 
ATOM   5223  C  C     . PRO D 4  570  ? -25.815 -37.776 46.245  1.00 88.05  ? 570  PRO A C     1 
ATOM   5224  O  O     . PRO D 4  570  ? -25.842 -36.911 45.364  1.00 86.93  ? 570  PRO A O     1 
ATOM   5225  C  CB    . PRO D 4  570  ? -26.337 -39.644 44.624  1.00 90.71  ? 570  PRO A CB    1 
ATOM   5226  C  CG    . PRO D 4  570  ? -27.553 -39.202 43.895  1.00 105.51 ? 570  PRO A CG    1 
ATOM   5227  C  CD    . PRO D 4  570  ? -28.671 -39.190 44.896  1.00 112.61 ? 570  PRO A CD    1 
ATOM   5228  N  N     . LEU D 4  571  ? -25.180 -37.611 47.403  1.00 92.66  ? 571  LEU A N     1 
ATOM   5229  C  CA    . LEU D 4  571  ? -24.520 -36.370 47.780  1.00 89.36  ? 571  LEU A CA    1 
ATOM   5230  C  C     . LEU D 4  571  ? -23.042 -36.614 48.046  1.00 88.49  ? 571  LEU A C     1 
ATOM   5231  O  O     . LEU D 4  571  ? -22.627 -37.723 48.394  1.00 103.64 ? 571  LEU A O     1 
ATOM   5232  C  CB    . LEU D 4  571  ? -25.166 -35.749 49.027  1.00 89.34  ? 571  LEU A CB    1 
ATOM   5233  C  CG    . LEU D 4  571  ? -26.174 -34.615 48.829  1.00 96.06  ? 571  LEU A CG    1 
ATOM   5234  C  CD1   . LEU D 4  571  ? -27.130 -34.908 47.683  1.00 94.57  ? 571  LEU A CD1   1 
ATOM   5235  C  CD2   . LEU D 4  571  ? -26.942 -34.358 50.119  1.00 98.80  ? 571  LEU A CD2   1 
ATOM   5236  N  N     . TRP D 4  572  ? -22.254 -35.558 47.877  1.00 87.47  ? 572  TRP A N     1 
ATOM   5237  C  CA    . TRP D 4  572  ? -20.829 -35.568 48.167  1.00 100.66 ? 572  TRP A CA    1 
ATOM   5238  C  C     . TRP D 4  572  ? -20.514 -34.444 49.140  1.00 125.13 ? 572  TRP A C     1 
ATOM   5239  O  O     . TRP D 4  572  ? -21.024 -33.328 48.996  1.00 145.31 ? 572  TRP A O     1 
ATOM   5240  C  CB    . TRP D 4  572  ? -19.993 -35.382 46.895  1.00 104.82 ? 572  TRP A CB    1 
ATOM   5241  C  CG    . TRP D 4  572  ? -19.992 -36.554 45.965  1.00 109.33 ? 572  TRP A CG    1 
ATOM   5242  C  CD1   . TRP D 4  572  ? -18.974 -37.440 45.769  1.00 119.05 ? 572  TRP A CD1   1 
ATOM   5243  C  CD2   . TRP D 4  572  ? -21.046 -36.951 45.079  1.00 101.59 ? 572  TRP A CD2   1 
ATOM   5244  N  NE1   . TRP D 4  572  ? -19.333 -38.374 44.828  1.00 116.35 ? 572  TRP A NE1   1 
ATOM   5245  C  CE2   . TRP D 4  572  ? -20.600 -38.096 44.387  1.00 102.98 ? 572  TRP A CE2   1 
ATOM   5246  C  CE3   . TRP D 4  572  ? -22.325 -36.456 44.807  1.00 90.74  ? 572  TRP A CE3   1 
ATOM   5247  C  CZ2   . TRP D 4  572  ? -21.385 -38.751 43.444  1.00 92.57  ? 572  TRP A CZ2   1 
ATOM   5248  C  CZ3   . TRP D 4  572  ? -23.104 -37.110 43.870  1.00 89.59  ? 572  TRP A CZ3   1 
ATOM   5249  C  CH2   . TRP D 4  572  ? -22.631 -38.245 43.201  1.00 90.57  ? 572  TRP A CH2   1 
ATOM   5250  N  N     . SER D 4  573  ? -19.680 -34.736 50.130  1.00 104.48 ? 573  SER A N     1 
ATOM   5251  C  CA    . SER D 4  573  ? -19.141 -33.667 50.951  1.00 82.94  ? 573  SER A CA    1 
ATOM   5252  C  C     . SER D 4  573  ? -18.105 -32.878 50.159  1.00 81.52  ? 573  SER A C     1 
ATOM   5253  O  O     . SER D 4  573  ? -17.573 -33.341 49.146  1.00 94.50  ? 573  SER A O     1 
ATOM   5254  C  CB    . SER D 4  573  ? -18.495 -34.226 52.213  1.00 91.28  ? 573  SER A CB    1 
ATOM   5255  O  OG    . SER D 4  573  ? -17.254 -34.844 51.909  1.00 90.83  ? 573  SER A OG    1 
ATOM   5256  N  N     . GLY D 4  574  ? -17.815 -31.668 50.631  1.00 75.76  ? 574  GLY A N     1 
ATOM   5257  C  CA    . GLY D 4  574  ? -16.699 -30.937 50.060  1.00 75.45  ? 574  GLY A CA    1 
ATOM   5258  C  C     . GLY D 4  574  ? -15.394 -31.687 50.232  1.00 83.11  ? 574  GLY A C     1 
ATOM   5259  O  O     . GLY D 4  574  ? -14.529 -31.663 49.353  1.00 79.71  ? 574  GLY A O     1 
ATOM   5260  N  N     . LYS D 4  575  ? -15.247 -32.381 51.362  1.00 88.51  ? 575  LYS A N     1 
ATOM   5261  C  CA    . LYS D 4  575  ? -14.080 -33.228 51.581  1.00 97.71  ? 575  LYS A CA    1 
ATOM   5262  C  C     . LYS D 4  575  ? -13.949 -34.288 50.494  1.00 92.10  ? 575  LYS A C     1 
ATOM   5263  O  O     . LYS D 4  575  ? -12.834 -34.658 50.107  1.00 82.54  ? 575  LYS A O     1 
ATOM   5264  C  CB    . LYS D 4  575  ? -14.169 -33.887 52.959  1.00 107.24 ? 575  LYS A CB    1 
ATOM   5265  C  CG    . LYS D 4  575  ? -14.779 -33.011 54.050  1.00 100.13 ? 575  LYS A CG    1 
ATOM   5266  C  CD    . LYS D 4  575  ? -14.206 -33.376 55.416  1.00 81.96  ? 575  LYS A CD    1 
ATOM   5267  C  CE    . LYS D 4  575  ? -15.149 -33.026 56.555  1.00 82.45  ? 575  LYS A CE    1 
ATOM   5268  N  NZ    . LYS D 4  575  ? -15.251 -31.566 56.806  1.00 91.17  ? 575  LYS A NZ    1 
ATOM   5269  N  N     . GLN D 4  576  ? -15.080 -34.793 50.000  1.00 88.39  ? 576  GLN A N     1 
ATOM   5270  C  CA    . GLN D 4  576  ? -15.064 -35.874 49.019  1.00 93.49  ? 576  GLN A CA    1 
ATOM   5271  C  C     . GLN D 4  576  ? -14.320 -35.469 47.753  1.00 92.85  ? 576  GLN A C     1 
ATOM   5272  O  O     . GLN D 4  576  ? -13.284 -36.049 47.410  1.00 100.16 ? 576  GLN A O     1 
ATOM   5273  C  CB    . GLN D 4  576  ? -16.499 -36.289 48.690  1.00 79.65  ? 576  GLN A CB    1 
ATOM   5274  C  CG    . GLN D 4  576  ? -17.075 -37.338 49.615  1.00 81.37  ? 576  GLN A CG    1 
ATOM   5275  C  CD    . GLN D 4  576  ? -16.742 -38.750 49.172  1.00 82.78  ? 576  GLN A CD    1 
ATOM   5276  O  OE1   . GLN D 4  576  ? -17.620 -39.493 48.733  1.00 84.19  ? 576  GLN A OE1   1 
ATOM   5277  N  NE2   . GLN D 4  576  ? -15.469 -39.122 49.264  1.00 86.03  ? 576  GLN A NE2   1 
ATOM   5278  N  N     . ILE D 4  577  ? -14.840 -34.468 47.043  1.00 88.29  ? 577  ILE A N     1 
ATOM   5279  C  CA    . ILE D 4  577  ? -14.290 -34.137 45.733  1.00 89.74  ? 577  ILE A CA    1 
ATOM   5280  C  C     . ILE D 4  577  ? -12.949 -33.429 45.867  1.00 79.60  ? 577  ILE A C     1 
ATOM   5281  O  O     . ILE D 4  577  ? -12.111 -33.495 44.959  1.00 73.71  ? 577  ILE A O     1 
ATOM   5282  C  CB    . ILE D 4  577  ? -15.310 -33.305 44.932  1.00 75.22  ? 577  ILE A CB    1 
ATOM   5283  C  CG1   . ILE D 4  577  ? -15.719 -32.046 45.701  1.00 82.41  ? 577  ILE A CG1   1 
ATOM   5284  C  CG2   . ILE D 4  577  ? -16.540 -34.149 44.604  1.00 76.84  ? 577  ILE A CG2   1 
ATOM   5285  C  CD1   . ILE D 4  577  ? -14.869 -30.824 45.407  1.00 95.62  ? 577  ILE A CD1   1 
ATOM   5286  N  N     . LEU D 4  578  ? -12.722 -32.741 46.987  1.00 73.42  ? 578  LEU A N     1 
ATOM   5287  C  CA    . LEU D 4  578  ? -11.465 -32.023 47.165  1.00 72.08  ? 578  LEU A CA    1 
ATOM   5288  C  C     . LEU D 4  578  ? -10.288 -32.989 47.239  1.00 72.54  ? 578  LEU A C     1 
ATOM   5289  O  O     . LEU D 4  578  ? -9.202  -32.696 46.725  1.00 71.72  ? 578  LEU A O     1 
ATOM   5290  C  CB    . LEU D 4  578  ? -11.539 -31.157 48.421  1.00 71.41  ? 578  LEU A CB    1 
ATOM   5291  C  CG    . LEU D 4  578  ? -10.234 -30.572 48.962  1.00 70.32  ? 578  LEU A CG    1 
ATOM   5292  C  CD1   . LEU D 4  578  ? -9.534  -29.687 47.935  1.00 69.03  ? 578  LEU A CD1   1 
ATOM   5293  C  CD2   . LEU D 4  578  ? -10.509 -29.806 50.243  1.00 69.92  ? 578  LEU A CD2   1 
ATOM   5294  N  N     . SER D 4  579  ? -10.497 -34.158 47.849  1.00 95.82  ? 579  SER A N     1 
ATOM   5295  C  CA    . SER D 4  579  ? -9.449  -35.164 47.964  1.00 97.28  ? 579  SER A CA    1 
ATOM   5296  C  C     . SER D 4  579  ? -8.996  -35.704 46.612  1.00 96.77  ? 579  SER A C     1 
ATOM   5297  O  O     . SER D 4  579  ? -7.931  -36.327 46.543  1.00 95.57  ? 579  SER A O     1 
ATOM   5298  C  CB    . SER D 4  579  ? -9.933  -36.315 48.853  1.00 98.36  ? 579  SER A CB    1 
ATOM   5299  O  OG    . SER D 4  579  ? -11.317 -36.570 48.664  1.00 130.64 ? 579  SER A OG    1 
ATOM   5300  N  N     . VAL D 4  580  ? -9.765  -35.477 45.542  1.00 84.59  ? 580  VAL A N     1 
ATOM   5301  C  CA    . VAL D 4  580  ? -9.366  -35.936 44.213  1.00 87.38  ? 580  VAL A CA    1 
ATOM   5302  C  C     . VAL D 4  580  ? -8.128  -35.191 43.728  1.00 73.69  ? 580  VAL A C     1 
ATOM   5303  O  O     . VAL D 4  580  ? -7.351  -35.717 42.920  1.00 73.94  ? 580  VAL A O     1 
ATOM   5304  C  CB    . VAL D 4  580  ? -10.539 -35.783 43.224  1.00 87.32  ? 580  VAL A CB    1 
ATOM   5305  C  CG1   . VAL D 4  580  ? -10.181 -36.355 41.853  1.00 85.65  ? 580  VAL A CG1   1 
ATOM   5306  C  CG2   . VAL D 4  580  ? -11.787 -36.458 43.772  1.00 90.89  ? 580  VAL A CG2   1 
ATOM   5307  N  N     . ALA D 4  581  ? -7.920  -33.961 44.200  1.00 72.31  ? 581  ALA A N     1 
ATOM   5308  C  CA    . ALA D 4  581  ? -6.717  -33.226 43.831  1.00 71.08  ? 581  ALA A CA    1 
ATOM   5309  C  C     . ALA D 4  581  ? -5.474  -33.754 44.531  1.00 71.25  ? 581  ALA A C     1 
ATOM   5310  O  O     . ALA D 4  581  ? -4.362  -33.522 44.045  1.00 70.63  ? 581  ALA A O     1 
ATOM   5311  C  CB    . ALA D 4  581  ? -6.891  -31.741 44.142  1.00 69.65  ? 581  ALA A CB    1 
ATOM   5312  N  N     . ILE D 4  582  ? -5.636  -34.455 45.648  1.00 77.93  ? 582  ILE A N     1 
ATOM   5313  C  CA    . ILE D 4  582  ? -4.496  -34.912 46.446  1.00 72.31  ? 582  ILE A CA    1 
ATOM   5314  C  C     . ILE D 4  582  ? -4.000  -36.245 45.891  1.00 73.55  ? 582  ILE A C     1 
ATOM   5315  O  O     . ILE D 4  582  ? -4.792  -37.195 45.780  1.00 94.22  ? 582  ILE A O     1 
ATOM   5316  C  CB    . ILE D 4  582  ? -4.884  -35.040 47.917  1.00 79.09  ? 582  ILE A CB    1 
ATOM   5317  C  CG1   . ILE D 4  582  ? -5.936  -33.993 48.284  1.00 97.42  ? 582  ILE A CG1   1 
ATOM   5318  C  CG2   . ILE D 4  582  ? -3.654  -34.892 48.804  1.00 82.88  ? 582  ILE A CG2   1 
ATOM   5319  C  CD1   . ILE D 4  582  ? -6.299  -33.981 49.753  1.00 94.75  ? 582  ILE A CD1   1 
ATOM   5320  N  N     . PRO D 4  583  ? -2.717  -36.362 45.556  1.00 73.29  ? 583  PRO A N     1 
ATOM   5321  C  CA    . PRO D 4  583  ? -2.209  -37.617 44.992  1.00 85.19  ? 583  PRO A CA    1 
ATOM   5322  C  C     . PRO D 4  583  ? -2.225  -38.737 46.018  1.00 75.86  ? 583  PRO A C     1 
ATOM   5323  O  O     . PRO D 4  583  ? -2.229  -38.515 47.229  1.00 75.72  ? 583  PRO A O     1 
ATOM   5324  C  CB    . PRO D 4  583  ? -0.771  -37.272 44.581  1.00 73.76  ? 583  PRO A CB    1 
ATOM   5325  C  CG    . PRO D 4  583  ? -0.719  -35.775 44.550  1.00 72.11  ? 583  PRO A CG    1 
ATOM   5326  C  CD    . PRO D 4  583  ? -1.685  -35.315 45.592  1.00 71.90  ? 583  PRO A CD    1 
ATOM   5327  N  N     . ASN D 4  584  ? -2.226  -39.963 45.508  1.00 84.32  ? 584  ASN A N     1 
ATOM   5328  C  CA    . ASN D 4  584  ? -2.171  -41.126 46.376  1.00 91.75  ? 584  ASN A CA    1 
ATOM   5329  C  C     . ASN D 4  584  ? -0.837  -41.173 47.110  1.00 97.48  ? 584  ASN A C     1 
ATOM   5330  O  O     . ASN D 4  584  ? 0.179   -40.662 46.632  1.00 84.66  ? 584  ASN A O     1 
ATOM   5331  C  CB    . ASN D 4  584  ? -2.370  -42.399 45.561  1.00 91.16  ? 584  ASN A CB    1 
ATOM   5332  C  CG    . ASN D 4  584  ? -3.357  -42.207 44.439  1.00 88.74  ? 584  ASN A CG    1 
ATOM   5333  O  OD1   . ASN D 4  584  ? -2.974  -42.062 43.279  1.00 99.04  ? 584  ASN A OD1   1 
ATOM   5334  N  ND2   . ASN D 4  584  ? -4.641  -42.204 44.776  1.00 98.57  ? 584  ASN A ND2   1 
ATOM   5335  N  N     . GLY D 4  585  ? -0.850  -41.783 48.291  1.00 85.08  ? 585  GLY A N     1 
ATOM   5336  C  CA    . GLY D 4  585  ? 0.345   -41.896 49.096  1.00 80.02  ? 585  GLY A CA    1 
ATOM   5337  C  C     . GLY D 4  585  ? 0.647   -40.712 49.986  1.00 84.87  ? 585  GLY A C     1 
ATOM   5338  O  O     . GLY D 4  585  ? 1.754   -40.639 50.532  1.00 105.50 ? 585  GLY A O     1 
ATOM   5339  N  N     . ILE D 4  586  ? -0.293  -39.785 50.153  1.00 85.05  ? 586  ILE A N     1 
ATOM   5340  C  CA    . ILE D 4  586  ? -0.112  -38.624 51.021  1.00 87.01  ? 586  ILE A CA    1 
ATOM   5341  C  C     . ILE D 4  586  ? -0.786  -38.904 52.357  1.00 103.64 ? 586  ILE A C     1 
ATOM   5342  O  O     . ILE D 4  586  ? -1.943  -39.341 52.403  1.00 121.04 ? 586  ILE A O     1 
ATOM   5343  C  CB    . ILE D 4  586  ? -0.657  -37.339 50.366  1.00 80.96  ? 586  ILE A CB    1 
ATOM   5344  C  CG1   . ILE D 4  586  ? 0.450   -36.609 49.594  1.00 73.75  ? 586  ILE A CG1   1 
ATOM   5345  C  CG2   . ILE D 4  586  ? -1.263  -36.398 51.403  1.00 78.64  ? 586  ILE A CG2   1 
ATOM   5346  C  CD1   . ILE D 4  586  ? 1.177   -37.447 48.567  1.00 92.96  ? 586  ILE A CD1   1 
ATOM   5347  N  N     . HIS D 4  587  ? -0.055  -38.662 53.443  1.00 85.47  ? 587  HIS A N     1 
ATOM   5348  C  CA    . HIS D 4  587  ? -0.499  -38.992 54.791  1.00 92.99  ? 587  HIS A CA    1 
ATOM   5349  C  C     . HIS D 4  587  ? -0.360  -37.734 55.631  1.00 86.14  ? 587  HIS A C     1 
ATOM   5350  O  O     . HIS D 4  587  ? 0.723   -37.144 55.676  1.00 101.92 ? 587  HIS A O     1 
ATOM   5351  C  CB    . HIS D 4  587  ? 0.354   -40.118 55.387  1.00 132.26 ? 587  HIS A CB    1 
ATOM   5352  C  CG    . HIS D 4  587  ? -0.426  -41.152 56.140  1.00 153.66 ? 587  HIS A CG    1 
ATOM   5353  N  ND1   . HIS D 4  587  ? -1.150  -42.142 55.511  1.00 150.35 ? 587  HIS A ND1   1 
ATOM   5354  C  CD2   . HIS D 4  587  ? -0.606  -41.342 57.468  1.00 155.53 ? 587  HIS A CD2   1 
ATOM   5355  C  CE1   . HIS D 4  587  ? -1.725  -42.908 56.420  1.00 156.44 ? 587  HIS A CE1   1 
ATOM   5356  N  NE2   . HIS D 4  587  ? -1.417  -42.440 57.616  1.00 159.25 ? 587  HIS A NE2   1 
ATOM   5357  N  N     . LEU D 4  588  ? -1.438  -37.311 56.290  1.00 75.89  ? 588  LEU A N     1 
ATOM   5358  C  CA    . LEU D 4  588  ? -1.385  -36.101 57.104  1.00 81.29  ? 588  LEU A CA    1 
ATOM   5359  C  C     . LEU D 4  588  ? -2.023  -36.347 58.461  1.00 88.02  ? 588  LEU A C     1 
ATOM   5360  O  O     . LEU D 4  588  ? -3.132  -36.884 58.545  1.00 77.10  ? 588  LEU A O     1 
ATOM   5361  C  CB    . LEU D 4  588  ? -2.064  -34.921 56.404  1.00 88.66  ? 588  LEU A CB    1 
ATOM   5362  C  CG    . LEU D 4  588  ? -1.345  -33.593 56.648  1.00 95.15  ? 588  LEU A CG    1 
ATOM   5363  C  CD1   . LEU D 4  588  ? 0.058   -33.633 56.062  1.00 98.71  ? 588  LEU A CD1   1 
ATOM   5364  C  CD2   . LEU D 4  588  ? -2.133  -32.431 56.068  1.00 104.12 ? 588  LEU A CD2   1 
ATOM   5365  N  N     . GLN D 4  589  ? -1.313  -35.941 59.514  1.00 92.51  ? 589  GLN A N     1 
ATOM   5366  C  CA    . GLN D 4  589  ? -1.734  -36.117 60.899  1.00 94.41  ? 589  GLN A CA    1 
ATOM   5367  C  C     . GLN D 4  589  ? -1.603  -34.774 61.603  1.00 85.66  ? 589  GLN A C     1 
ATOM   5368  O  O     . GLN D 4  589  ? -0.528  -34.165 61.573  1.00 82.38  ? 589  GLN A O     1 
ATOM   5369  C  CB    . GLN D 4  589  ? -0.872  -37.179 61.591  1.00 105.22 ? 589  GLN A CB    1 
ATOM   5370  C  CG    . GLN D 4  589  ? -1.571  -38.008 62.655  1.00 118.68 ? 589  GLN A CG    1 
ATOM   5371  C  CD    . GLN D 4  589  ? -0.643  -39.034 63.287  1.00 131.63 ? 589  GLN A CD    1 
ATOM   5372  O  OE1   . GLN D 4  589  ? 0.408   -38.687 63.829  1.00 128.79 ? 589  GLN A OE1   1 
ATOM   5373  N  NE2   . GLN D 4  589  ? -1.025  -40.305 63.213  1.00 129.54 ? 589  GLN A NE2   1 
ATOM   5374  N  N     . ARG D 4  590  ? -2.689  -34.306 62.223  1.00 100.19 ? 590  ARG A N     1 
ATOM   5375  C  CA    . ARG D 4  590  ? -2.638  -33.059 62.979  1.00 112.93 ? 590  ARG A CA    1 
ATOM   5376  C  C     . ARG D 4  590  ? -3.800  -33.002 63.964  1.00 132.46 ? 590  ARG A C     1 
ATOM   5377  O  O     . ARG D 4  590  ? -4.956  -33.208 63.579  1.00 144.25 ? 590  ARG A O     1 
ATOM   5378  C  CB    . ARG D 4  590  ? -2.667  -31.843 62.045  1.00 97.22  ? 590  ARG A CB    1 
ATOM   5379  C  CG    . ARG D 4  590  ? -1.563  -30.829 62.326  1.00 104.52 ? 590  ARG A CG    1 
ATOM   5380  C  CD    . ARG D 4  590  ? -1.923  -29.425 61.858  1.00 116.78 ? 590  ARG A CD    1 
ATOM   5381  N  NE    . ARG D 4  590  ? -3.104  -28.901 62.539  1.00 118.87 ? 590  ARG A NE    1 
ATOM   5382  C  CZ    . ARG D 4  590  ? -4.305  -28.789 61.981  1.00 115.53 ? 590  ARG A CZ    1 
ATOM   5383  N  NH1   . ARG D 4  590  ? -5.320  -28.304 62.683  1.00 114.83 ? 590  ARG A NH1   1 
ATOM   5384  N  NH2   . ARG D 4  590  ? -4.491  -29.153 60.719  1.00 102.71 ? 590  ARG A NH2   1 
ATOM   5385  N  N     . PHE D 4  591  ? -3.475  -32.732 65.230  1.00 114.97 ? 591  PHE A N     1 
ATOM   5386  C  CA    . PHE D 4  591  ? -4.426  -32.498 66.308  1.00 84.61  ? 591  PHE A CA    1 
ATOM   5387  C  C     . PHE D 4  591  ? -4.216  -31.088 66.843  1.00 95.50  ? 591  PHE A C     1 
ATOM   5388  O  O     . PHE D 4  591  ? -3.077  -30.620 66.929  1.00 73.65  ? 591  PHE A O     1 
ATOM   5389  C  CB    . PHE D 4  591  ? -4.232  -33.527 67.423  1.00 77.00  ? 591  PHE A CB    1 
ATOM   5390  C  CG    . PHE D 4  591  ? -4.475  -34.966 67.002  1.00 78.33  ? 591  PHE A CG    1 
ATOM   5391  C  CD1   . PHE D 4  591  ? -3.492  -35.688 66.329  1.00 78.45  ? 591  PHE A CD1   1 
ATOM   5392  C  CD2   . PHE D 4  591  ? -5.648  -35.621 67.361  1.00 79.58  ? 591  PHE A CD2   1 
ATOM   5393  C  CE1   . PHE D 4  591  ? -3.689  -37.010 65.945  1.00 79.74  ? 591  PHE A CE1   1 
ATOM   5394  C  CE2   . PHE D 4  591  ? -5.855  -36.947 67.020  1.00 80.90  ? 591  PHE A CE2   1 
ATOM   5395  C  CZ    . PHE D 4  591  ? -4.863  -37.655 66.292  1.00 80.99  ? 591  PHE A CZ    1 
ATOM   5396  N  N     . ASP D 4  592  ? -5.312  -30.380 67.159  1.00 125.84 ? 592  ASP A N     1 
ATOM   5397  C  CA    . ASP D 4  592  ? -5.185  -29.004 67.668  1.00 139.13 ? 592  ASP A CA    1 
ATOM   5398  C  C     . ASP D 4  592  ? -6.172  -28.736 68.803  1.00 133.44 ? 592  ASP A C     1 
ATOM   5399  O  O     . ASP D 4  592  ? -7.282  -28.237 68.586  1.00 158.31 ? 592  ASP A O     1 
ATOM   5400  C  CB    . ASP D 4  592  ? -5.352  -27.986 66.541  1.00 155.26 ? 592  ASP A CB    1 
ATOM   5401  C  CG    . ASP D 4  592  ? -6.556  -28.269 65.661  1.00 151.44 ? 592  ASP A CG    1 
ATOM   5402  O  OD1   . ASP D 4  592  ? -6.947  -27.380 64.871  1.00 124.76 ? 592  ASP A OD1   1 
ATOM   5403  O  OD2   . ASP D 4  592  ? -7.126  -29.373 65.774  1.00 157.68 ? 592  ASP A OD2   1 
ATOM   5404  N  N     . GLU D 4  593  ? -5.756  -29.098 70.018  1.00 136.53 ? 593  GLU A N     1 
ATOM   5405  C  CA    . GLU D 4  593  ? -6.237  -28.511 71.264  1.00 158.51 ? 593  GLU A CA    1 
ATOM   5406  C  C     . GLU D 4  593  ? -7.696  -28.854 71.563  1.00 157.46 ? 593  GLU A C     1 
ATOM   5407  O  O     . GLU D 4  593  ? -8.182  -28.628 72.678  1.00 172.94 ? 593  GLU A O     1 
ATOM   5408  C  CB    . GLU D 4  593  ? -5.984  -27.001 71.200  1.00 166.25 ? 593  GLU A CB    1 
ATOM   5409  C  CG    . GLU D 4  593  ? -6.774  -26.127 72.148  1.00 171.64 ? 593  GLU A CG    1 
ATOM   5410  C  CD    . GLU D 4  593  ? -5.977  -24.944 72.663  1.00 174.89 ? 593  GLU A CD    1 
ATOM   5411  O  OE1   . GLU D 4  593  ? -4.918  -25.174 73.276  1.00 180.90 ? 593  GLU A OE1   1 
ATOM   5412  O  OE2   . GLU D 4  593  ? -6.415  -23.787 72.470  1.00 177.09 ? 593  GLU A OE2   1 
ATOM   5413  N  N     . GLY D 4  594  ? -8.399  -29.442 70.612  1.00 112.09 ? 594  GLY A N     1 
ATOM   5414  C  CA    . GLY D 4  594  ? -9.760  -29.857 70.879  1.00 105.33 ? 594  GLY A CA    1 
ATOM   5415  C  C     . GLY D 4  594  ? -10.038 -31.119 70.110  1.00 122.50 ? 594  GLY A C     1 
ATOM   5416  O  O     . GLY D 4  594  ? -11.135 -31.309 69.573  1.00 140.94 ? 594  GLY A O     1 
ATOM   5417  N  N     . THR D 4  595  ? -9.035  -31.985 70.005  1.00 104.17 ? 595  THR A N     1 
ATOM   5418  C  CA    . THR D 4  595  ? -9.014  -32.927 68.898  1.00 88.04  ? 595  THR A CA    1 
ATOM   5419  C  C     . THR D 4  595  ? -8.839  -34.318 69.487  1.00 80.55  ? 595  THR A C     1 
ATOM   5420  O  O     . THR D 4  595  ? -7.820  -34.594 70.134  1.00 80.76  ? 595  THR A O     1 
ATOM   5421  C  CB    . THR D 4  595  ? -7.880  -32.617 67.926  1.00 94.36  ? 595  THR A CB    1 
ATOM   5422  O  OG1   . THR D 4  595  ? -7.947  -31.241 67.545  1.00 90.54  ? 595  THR A OG1   1 
ATOM   5423  C  CG2   . THR D 4  595  ? -8.177  -33.372 66.641  1.00 77.86  ? 595  THR A CG2   1 
ATOM   5424  N  N     . THR D 4  596  ? -9.843  -35.169 69.303  1.00 83.07  ? 596  THR A N     1 
ATOM   5425  C  CA    . THR D 4  596  ? -9.744  -36.609 69.474  1.00 84.67  ? 596  THR A CA    1 
ATOM   5426  C  C     . THR D 4  596  ? -9.470  -37.220 68.099  1.00 84.50  ? 596  THR A C     1 
ATOM   5427  O  O     . THR D 4  596  ? -9.173  -36.511 67.134  1.00 95.55  ? 596  THR A O     1 
ATOM   5428  C  CB    . THR D 4  596  ? -11.035 -37.161 70.094  1.00 86.23  ? 596  THR A CB    1 
ATOM   5429  O  OG1   . THR D 4  596  ? -11.576 -36.202 71.009  1.00 111.50 ? 596  THR A OG1   1 
ATOM   5430  C  CG2   . THR D 4  596  ? -10.787 -38.477 70.840  1.00 88.00  ? 596  THR A CG2   1 
ATOM   5431  N  N     . LEU D 4  597  ? -9.556  -38.546 67.993  1.00 106.40 ? 597  LEU A N     1 
ATOM   5432  C  CA    . LEU D 4  597  ? -9.769  -39.133 66.676  1.00 118.90 ? 597  LEU A CA    1 
ATOM   5433  C  C     . LEU D 4  597  ? -11.192 -38.916 66.188  1.00 116.70 ? 597  LEU A C     1 
ATOM   5434  O  O     . LEU D 4  597  ? -11.493 -39.221 65.029  1.00 127.33 ? 597  LEU A O     1 
ATOM   5435  C  CB    . LEU D 4  597  ? -9.450  -40.631 66.689  1.00 132.45 ? 597  LEU A CB    1 
ATOM   5436  C  CG    . LEU D 4  597  ? -7.985  -40.986 66.933  1.00 132.45 ? 597  LEU A CG    1 
ATOM   5437  C  CD1   . LEU D 4  597  ? -7.844  -42.446 67.324  1.00 125.51 ? 597  LEU A CD1   1 
ATOM   5438  C  CD2   . LEU D 4  597  ? -7.167  -40.671 65.694  1.00 118.78 ? 597  LEU A CD2   1 
ATOM   5439  N  N     . LEU D 4  598  ? -12.064 -38.392 67.050  1.00 98.93  ? 598  LEU A N     1 
ATOM   5440  C  CA    . LEU D 4  598  ? -13.475 -38.165 66.762  1.00 103.94 ? 598  LEU A CA    1 
ATOM   5441  C  C     . LEU D 4  598  ? -13.786 -36.715 66.402  1.00 108.27 ? 598  LEU A C     1 
ATOM   5442  O  O     . LEU D 4  598  ? -14.694 -36.471 65.602  1.00 83.89  ? 598  LEU A O     1 
ATOM   5443  C  CB    . LEU D 4  598  ? -14.313 -38.606 67.971  1.00 104.16 ? 598  LEU A CB    1 
ATOM   5444  C  CG    . LEU D 4  598  ? -15.800 -38.948 67.827  1.00 97.48  ? 598  LEU A CG    1 
ATOM   5445  C  CD1   . LEU D 4  598  ? -16.652 -37.700 67.726  1.00 118.67 ? 598  LEU A CD1   1 
ATOM   5446  C  CD2   . LEU D 4  598  ? -16.029 -39.843 66.624  1.00 89.11  ? 598  LEU A CD2   1 
ATOM   5447  N  N     . SER D 4  599  ? -13.057 -35.753 66.985  1.00 110.71 ? 599  SER A N     1 
ATOM   5448  C  CA    . SER D 4  599  ? -13.088 -34.339 66.613  1.00 104.38 ? 599  SER A CA    1 
ATOM   5449  C  C     . SER D 4  599  ? -14.506 -33.785 66.542  1.00 107.59 ? 599  SER A C     1 
ATOM   5450  O  O     . SER D 4  599  ? -15.028 -33.564 65.442  1.00 96.84  ? 599  SER A O     1 
ATOM   5451  C  CB    . SER D 4  599  ? -12.389 -34.125 65.272  1.00 91.42  ? 599  SER A CB    1 
ATOM   5452  O  OG    . SER D 4  599  ? -13.174 -34.634 64.211  1.00 107.79 ? 599  SER A OG    1 
ATOM   5453  N  N     . PRO D 4  600  ? -15.162 -33.561 67.683  1.00 130.16 ? 600  PRO A N     1 
ATOM   5454  C  CA    . PRO D 4  600  ? -16.544 -33.056 67.649  1.00 137.11 ? 600  PRO A CA    1 
ATOM   5455  C  C     . PRO D 4  600  ? -16.698 -31.714 66.952  1.00 125.56 ? 600  PRO A C     1 
ATOM   5456  O  O     . PRO D 4  600  ? -17.797 -31.408 66.473  1.00 139.00 ? 600  PRO A O     1 
ATOM   5457  C  CB    . PRO D 4  600  ? -16.920 -32.965 69.135  1.00 148.45 ? 600  PRO A CB    1 
ATOM   5458  C  CG    . PRO D 4  600  ? -15.977 -33.905 69.825  1.00 149.30 ? 600  PRO A CG    1 
ATOM   5459  C  CD    . PRO D 4  600  ? -14.698 -33.822 69.054  1.00 140.87 ? 600  PRO A CD    1 
ATOM   5460  N  N     . LYS D 4  601  ? -15.642 -30.906 66.871  1.00 85.66  ? 601  LYS A N     1 
ATOM   5461  C  CA    . LYS D 4  601  ? -15.690 -29.631 66.171  1.00 81.34  ? 601  LYS A CA    1 
ATOM   5462  C  C     . LYS D 4  601  ? -15.013 -29.686 64.806  1.00 84.47  ? 601  LYS A C     1 
ATOM   5463  O  O     . LYS D 4  601  ? -14.796 -28.635 64.192  1.00 75.32  ? 601  LYS A O     1 
ATOM   5464  C  CB    . LYS D 4  601  ? -15.053 -28.535 67.027  1.00 87.33  ? 601  LYS A CB    1 
ATOM   5465  C  CG    . LYS D 4  601  ? -15.689 -28.382 68.396  1.00 92.87  ? 601  LYS A CG    1 
ATOM   5466  C  CD    . LYS D 4  601  ? -14.794 -27.590 69.335  1.00 106.13 ? 601  LYS A CD    1 
ATOM   5467  C  CE    . LYS D 4  601  ? -15.298 -27.672 70.768  1.00 117.23 ? 601  LYS A CE    1 
ATOM   5468  N  NZ    . LYS D 4  601  ? -14.299 -27.159 71.748  1.00 101.20 ? 601  LYS A NZ    1 
ATOM   5469  N  N     . ASP D 4  602  ? -14.677 -30.886 64.325  1.00 89.64  ? 602  ASP A N     1 
ATOM   5470  C  CA    . ASP D 4  602  ? -13.987 -31.087 63.048  1.00 93.95  ? 602  ASP A CA    1 
ATOM   5471  C  C     . ASP D 4  602  ? -12.660 -30.330 63.002  1.00 84.36  ? 602  ASP A C     1 
ATOM   5472  O  O     . ASP D 4  602  ? -12.206 -29.909 61.936  1.00 82.82  ? 602  ASP A O     1 
ATOM   5473  C  CB    . ASP D 4  602  ? -14.875 -30.693 61.859  1.00 98.31  ? 602  ASP A CB    1 
ATOM   5474  C  CG    . ASP D 4  602  ? -14.495 -31.421 60.569  1.00 89.98  ? 602  ASP A CG    1 
ATOM   5475  O  OD1   . ASP D 4  602  ? -14.365 -32.663 60.595  1.00 97.01  ? 602  ASP A OD1   1 
ATOM   5476  O  OD2   . ASP D 4  602  ? -14.337 -30.757 59.524  1.00 76.99  ? 602  ASP A OD2   1 
ATOM   5477  N  N     . ASN D 4  603  ? -12.031 -30.141 64.157  1.00 76.25  ? 603  ASN A N     1 
ATOM   5478  C  CA    . ASN D 4  603  ? -10.691 -29.582 64.179  1.00 82.70  ? 603  ASN A CA    1 
ATOM   5479  C  C     . ASN D 4  603  ? -9.667  -30.658 63.822  1.00 85.94  ? 603  ASN A C     1 
ATOM   5480  O  O     . ASN D 4  603  ? -9.984  -31.846 63.706  1.00 75.77  ? 603  ASN A O     1 
ATOM   5481  C  CB    . ASN D 4  603  ? -10.389 -28.962 65.544  1.00 74.05  ? 603  ASN A CB    1 
ATOM   5482  C  CG    . ASN D 4  603  ? -11.019 -29.731 66.685  1.00 81.00  ? 603  ASN A CG    1 
ATOM   5483  O  OD1   . ASN D 4  603  ? -11.160 -30.953 66.627  1.00 101.71 ? 603  ASN A OD1   1 
ATOM   5484  N  ND2   . ASN D 4  603  ? -11.410 -29.014 67.731  1.00 94.41  ? 603  ASN A ND2   1 
ATOM   5485  N  N     . GLY D 4  604  ? -8.426  -30.224 63.625  1.00 104.38 ? 604  GLY A N     1 
ATOM   5486  C  CA    . GLY D 4  604  ? -7.364  -31.137 63.254  1.00 104.61 ? 604  GLY A CA    1 
ATOM   5487  C  C     . GLY D 4  604  ? -7.467  -31.590 61.815  1.00 101.21 ? 604  GLY A C     1 
ATOM   5488  O  O     . GLY D 4  604  ? -8.425  -31.251 61.118  1.00 108.02 ? 604  GLY A O     1 
ATOM   5489  N  N     . MET D 4  605  ? -6.482  -32.356 61.357  1.00 105.68 ? 605  MET A N     1 
ATOM   5490  C  CA    . MET D 4  605  ? -6.460  -32.809 59.974  1.00 113.09 ? 605  MET A CA    1 
ATOM   5491  C  C     . MET D 4  605  ? -5.945  -34.237 59.911  1.00 103.99 ? 605  MET A C     1 
ATOM   5492  O  O     . MET D 4  605  ? -4.861  -34.531 60.422  1.00 110.99 ? 605  MET A O     1 
ATOM   5493  C  CB    . MET D 4  605  ? -5.584  -31.897 59.106  1.00 115.00 ? 605  MET A CB    1 
ATOM   5494  C  CG    . MET D 4  605  ? -5.608  -32.253 57.630  1.00 108.18 ? 605  MET A CG    1 
ATOM   5495  S  SD    . MET D 4  605  ? -7.285  -32.355 56.972  1.00 104.72 ? 605  MET A SD    1 
ATOM   5496  C  CE    . MET D 4  605  ? -7.893  -30.713 57.346  1.00 96.15  ? 605  MET A CE    1 
ATOM   5497  N  N     . LEU D 4  606  ? -6.721  -35.116 59.284  1.00 76.07  ? 606  LEU A N     1 
ATOM   5498  C  CA    . LEU D 4  606  ? -6.315  -36.497 59.051  1.00 77.33  ? 606  LEU A CA    1 
ATOM   5499  C  C     . LEU D 4  606  ? -6.537  -36.823 57.583  1.00 89.49  ? 606  LEU A C     1 
ATOM   5500  O  O     . LEU D 4  606  ? -7.680  -36.823 57.113  1.00 77.60  ? 606  LEU A O     1 
ATOM   5501  C  CB    . LEU D 4  606  ? -7.093  -37.464 59.947  1.00 79.00  ? 606  LEU A CB    1 
ATOM   5502  C  CG    . LEU D 4  606  ? -6.724  -38.941 59.789  1.00 80.48  ? 606  LEU A CG    1 
ATOM   5503  C  CD1   . LEU D 4  606  ? -5.222  -39.131 59.947  1.00 80.19  ? 606  LEU A CD1   1 
ATOM   5504  C  CD2   . LEU D 4  606  ? -7.497  -39.826 60.766  1.00 82.16  ? 606  LEU A CD2   1 
ATOM   5505  N  N     . ILE D 4  607  ? -5.450  -37.093 56.863  1.00 100.25 ? 607  ILE A N     1 
ATOM   5506  C  CA    . ILE D 4  607  ? -5.490  -37.395 55.437  1.00 100.06 ? 607  ILE A CA    1 
ATOM   5507  C  C     . ILE D 4  607  ? -4.758  -38.710 55.214  1.00 97.31  ? 607  ILE A C     1 
ATOM   5508  O  O     . ILE D 4  607  ? -3.623  -38.876 55.678  1.00 104.68 ? 607  ILE A O     1 
ATOM   5509  C  CB    . ILE D 4  607  ? -4.849  -36.272 54.600  1.00 97.81  ? 607  ILE A CB    1 
ATOM   5510  C  CG1   . ILE D 4  607  ? -5.746  -35.035 54.587  1.00 81.34  ? 607  ILE A CG1   1 
ATOM   5511  C  CG2   . ILE D 4  607  ? -4.574  -36.743 53.181  1.00 90.78  ? 607  ILE A CG2   1 
ATOM   5512  C  CD1   . ILE D 4  607  ? -5.187  -33.889 53.775  1.00 79.76  ? 607  ILE A CD1   1 
ATOM   5513  N  N     . ILE D 4  608  ? -5.400  -39.640 54.510  1.00 90.01  ? 608  ILE A N     1 
ATOM   5514  C  CA    . ILE D 4  608  ? -4.849  -40.968 54.257  1.00 97.52  ? 608  ILE A CA    1 
ATOM   5515  C  C     . ILE D 4  608  ? -4.884  -41.222 52.755  1.00 111.92 ? 608  ILE A C     1 
ATOM   5516  O  O     . ILE D 4  608  ? -5.965  -41.420 52.184  1.00 136.53 ? 608  ILE A O     1 
ATOM   5517  C  CB    . ILE D 4  608  ? -5.624  -42.069 54.993  1.00 99.81  ? 608  ILE A CB    1 
ATOM   5518  C  CG1   . ILE D 4  608  ? -5.842  -41.721 56.467  1.00 94.53  ? 608  ILE A CG1   1 
ATOM   5519  C  CG2   . ILE D 4  608  ? -4.896  -43.402 54.880  1.00 112.33 ? 608  ILE A CG2   1 
ATOM   5520  C  CD1   . ILE D 4  608  ? -4.588  -41.511 57.257  1.00 96.52  ? 608  ILE A CD1   1 
ATOM   5521  N  N     . ASP D 4  609  ? -3.710  -41.225 52.117  1.00 103.18 ? 609  ASP A N     1 
ATOM   5522  C  CA    . ASP D 4  609  ? -3.526  -41.755 50.765  1.00 99.57  ? 609  ASP A CA    1 
ATOM   5523  C  C     . ASP D 4  609  ? -4.472  -41.078 49.767  1.00 130.70 ? 609  ASP A C     1 
ATOM   5524  O  O     . ASP D 4  609  ? -5.380  -41.692 49.201  1.00 155.45 ? 609  ASP A O     1 
ATOM   5525  C  CB    . ASP D 4  609  ? -3.705  -43.278 50.765  1.00 95.55  ? 609  ASP A CB    1 
ATOM   5526  C  CG    . ASP D 4  609  ? -3.384  -43.913 49.425  1.00 96.97  ? 609  ASP A CG    1 
ATOM   5527  O  OD1   . ASP D 4  609  ? -2.286  -43.659 48.888  1.00 99.06  ? 609  ASP A OD1   1 
ATOM   5528  O  OD2   . ASP D 4  609  ? -4.232  -44.672 48.907  1.00 99.37  ? 609  ASP A OD2   1 
ATOM   5529  N  N     . GLY D 4  610  ? -4.243  -39.782 49.580  1.00 137.30 ? 610  GLY A N     1 
ATOM   5530  C  CA    . GLY D 4  610  ? -5.023  -39.032 48.616  1.00 146.33 ? 610  GLY A CA    1 
ATOM   5531  C  C     . GLY D 4  610  ? -6.485  -38.873 48.963  1.00 143.10 ? 610  GLY A C     1 
ATOM   5532  O  O     . GLY D 4  610  ? -7.293  -38.562 48.083  1.00 160.92 ? 610  GLY A O     1 
ATOM   5533  N  N     . GLN D 4  611  ? -6.849  -39.096 50.222  1.00 109.16 ? 611  GLN A N     1 
ATOM   5534  C  CA    . GLN D 4  611  ? -8.202  -38.879 50.707  1.00 99.41  ? 611  GLN A CA    1 
ATOM   5535  C  C     . GLN D 4  611  ? -8.121  -38.312 52.113  1.00 103.54 ? 611  GLN A C     1 
ATOM   5536  O  O     . GLN D 4  611  ? -7.249  -38.701 52.894  1.00 122.52 ? 611  GLN A O     1 
ATOM   5537  C  CB    . GLN D 4  611  ? -9.026  -40.175 50.701  1.00 85.73  ? 611  GLN A CB    1 
ATOM   5538  C  CG    . GLN D 4  611  ? -9.721  -40.463 49.379  1.00 108.63 ? 611  GLN A CG    1 
ATOM   5539  C  CD    . GLN D 4  611  ? -11.157 -39.972 49.361  1.00 121.69 ? 611  GLN A CD    1 
ATOM   5540  O  OE1   . GLN D 4  611  ? -11.765 -39.758 50.412  1.00 130.33 ? 611  GLN A OE1   1 
ATOM   5541  N  NE2   . GLN D 4  611  ? -11.705 -39.782 48.163  1.00 85.29  ? 611  GLN A NE2   1 
ATOM   5542  N  N     . ILE D 4  612  ? -9.017  -37.380 52.430  1.00 88.95  ? 612  ILE A N     1 
ATOM   5543  C  CA    . ILE D 4  612  ? -9.037  -36.759 53.750  1.00 77.20  ? 612  ILE A CA    1 
ATOM   5544  C  C     . ILE D 4  612  ? -10.136 -37.421 54.570  1.00 78.64  ? 612  ILE A C     1 
ATOM   5545  O  O     . ILE D 4  612  ? -11.205 -37.768 54.046  1.00 79.43  ? 612  ILE A O     1 
ATOM   5546  C  CB    . ILE D 4  612  ? -9.217  -35.227 53.666  1.00 75.58  ? 612  ILE A CB    1 
ATOM   5547  C  CG1   . ILE D 4  612  ? -10.686 -34.812 53.605  1.00 75.78  ? 612  ILE A CG1   1 
ATOM   5548  C  CG2   . ILE D 4  612  ? -8.508  -34.677 52.439  1.00 74.41  ? 612  ILE A CG2   1 
ATOM   5549  C  CD1   . ILE D 4  612  ? -10.877 -33.308 53.713  1.00 74.30  ? 612  ILE A CD1   1 
ATOM   5550  N  N     . ILE D 4  613  ? -9.858  -37.634 55.851  1.00 101.88 ? 613  ILE A N     1 
ATOM   5551  C  CA    . ILE D 4  613  ? -10.722 -38.414 56.733  1.00 105.10 ? 613  ILE A CA    1 
ATOM   5552  C  C     . ILE D 4  613  ? -11.654 -37.521 57.541  1.00 102.57 ? 613  ILE A C     1 
ATOM   5553  O  O     . ILE D 4  613  ? -12.864 -37.746 57.584  1.00 110.79 ? 613  ILE A O     1 
ATOM   5554  C  CB    . ILE D 4  613  ? -9.852  -39.305 57.647  1.00 89.78  ? 613  ILE A CB    1 
ATOM   5555  C  CG1   . ILE D 4  613  ? -8.852  -40.099 56.808  1.00 86.11  ? 613  ILE A CG1   1 
ATOM   5556  C  CG2   . ILE D 4  613  ? -10.697 -40.245 58.469  1.00 87.66  ? 613  ILE A CG2   1 
ATOM   5557  C  CD1   . ILE D 4  613  ? -9.503  -41.119 55.896  1.00 87.39  ? 613  ILE A CD1   1 
ATOM   5558  N  N     . PHE D 4  614  ? -11.101 -36.504 58.199  1.00 79.10  ? 614  PHE A N     1 
ATOM   5559  C  CA    . PHE D 4  614  ? -11.898 -35.524 58.920  1.00 78.66  ? 614  PHE A CA    1 
ATOM   5560  C  C     . PHE D 4  614  ? -11.089 -34.244 59.071  1.00 76.93  ? 614  PHE A C     1 
ATOM   5561  O  O     . PHE D 4  614  ? -9.857  -34.253 59.017  1.00 76.35  ? 614  PHE A O     1 
ATOM   5562  C  CB    . PHE D 4  614  ? -12.353 -36.053 60.291  1.00 79.95  ? 614  PHE A CB    1 
ATOM   5563  C  CG    . PHE D 4  614  ? -11.242 -36.156 61.309  1.00 115.27 ? 614  PHE A CG    1 
ATOM   5564  C  CD1   . PHE D 4  614  ? -10.935 -35.089 62.141  1.00 110.66 ? 614  PHE A CD1   1 
ATOM   5565  C  CD2   . PHE D 4  614  ? -10.521 -37.331 61.449  1.00 113.54 ? 614  PHE A CD2   1 
ATOM   5566  C  CE1   . PHE D 4  614  ? -9.921  -35.188 63.076  1.00 95.55  ? 614  PHE A CE1   1 
ATOM   5567  C  CE2   . PHE D 4  614  ? -9.509  -37.435 62.389  1.00 108.06 ? 614  PHE A CE2   1 
ATOM   5568  C  CZ    . PHE D 4  614  ? -9.209  -36.363 63.200  1.00 101.78 ? 614  PHE A CZ    1 
ATOM   5569  N  N     . GLY D 4  615  ? -11.803 -33.146 59.258  1.00 76.20  ? 615  GLY A N     1 
ATOM   5570  C  CA    . GLY D 4  615  ? -11.162 -31.884 59.591  1.00 74.73  ? 615  GLY A CA    1 
ATOM   5571  C  C     . GLY D 4  615  ? -11.356 -30.839 58.513  1.00 73.42  ? 615  GLY A C     1 
ATOM   5572  O  O     . GLY D 4  615  ? -11.239 -31.125 57.317  1.00 76.01  ? 615  GLY A O     1 
ATOM   5573  N  N     . VAL D 4  616  ? -11.670 -29.617 58.941  1.00 72.55  ? 616  VAL A N     1 
ATOM   5574  C  CA    . VAL D 4  616  ? -11.757 -28.491 58.022  1.00 71.24  ? 616  VAL A CA    1 
ATOM   5575  C  C     . VAL D 4  616  ? -10.359 -28.104 57.565  1.00 77.28  ? 616  VAL A C     1 
ATOM   5576  O  O     . VAL D 4  616  ? -9.427  -28.017 58.375  1.00 82.28  ? 616  VAL A O     1 
ATOM   5577  C  CB    . VAL D 4  616  ? -12.460 -27.297 58.688  1.00 71.75  ? 616  VAL A CB    1 
ATOM   5578  C  CG1   . VAL D 4  616  ? -12.733 -26.200 57.671  1.00 77.78  ? 616  VAL A CG1   1 
ATOM   5579  C  CG2   . VAL D 4  616  ? -13.750 -27.731 59.371  1.00 71.99  ? 616  VAL A CG2   1 
ATOM   5580  N  N     . VAL D 4  617  ? -10.202 -27.872 56.264  1.00 69.43  ? 617  VAL A N     1 
ATOM   5581  C  CA    . VAL D 4  617  ? -8.942  -27.370 55.728  1.00 77.33  ? 617  VAL A CA    1 
ATOM   5582  C  C     . VAL D 4  617  ? -8.860  -25.868 55.960  1.00 79.47  ? 617  VAL A C     1 
ATOM   5583  O  O     . VAL D 4  617  ? -9.836  -25.135 55.759  1.00 73.29  ? 617  VAL A O     1 
ATOM   5584  C  CB    . VAL D 4  617  ? -8.814  -27.710 54.234  1.00 68.16  ? 617  VAL A CB    1 
ATOM   5585  C  CG1   . VAL D 4  617  ? -7.392  -27.476 53.753  1.00 67.30  ? 617  VAL A CG1   1 
ATOM   5586  C  CG2   . VAL D 4  617  ? -9.225  -29.146 53.989  1.00 69.56  ? 617  VAL A CG2   1 
ATOM   5587  N  N     . GLU D 4  618  ? -7.692  -25.406 56.388  1.00 92.54  ? 618  GLU A N     1 
ATOM   5588  C  CA    . GLU D 4  618  ? -7.451  -23.990 56.632  1.00 78.52  ? 618  GLU A CA    1 
ATOM   5589  C  C     . GLU D 4  618  ? -5.970  -23.718 56.371  1.00 74.36  ? 618  GLU A C     1 
ATOM   5590  O  O     . GLU D 4  618  ? -5.288  -24.513 55.717  1.00 64.69  ? 618  GLU A O     1 
ATOM   5591  C  CB    . GLU D 4  618  ? -7.925  -23.600 58.045  1.00 76.55  ? 618  GLU A CB    1 
ATOM   5592  C  CG    . GLU D 4  618  ? -7.571  -24.597 59.126  1.00 78.85  ? 618  GLU A CG    1 
ATOM   5593  C  CD    . GLU D 4  618  ? -6.082  -24.729 59.289  1.00 87.44  ? 618  GLU A CD    1 
ATOM   5594  O  OE1   . GLU D 4  618  ? -5.410  -23.677 59.331  1.00 69.99  ? 618  GLU A OE1   1 
ATOM   5595  O  OE2   . GLU D 4  618  ? -5.586  -25.872 59.360  1.00 118.25 ? 618  GLU A OE2   1 
ATOM   5596  N  N     . LYS D 4  619  ? -5.470  -22.590 56.881  1.00 67.01  ? 619  LYS A N     1 
ATOM   5597  C  CA    . LYS D 4  619  ? -4.120  -22.157 56.532  1.00 66.23  ? 619  LYS A CA    1 
ATOM   5598  C  C     . LYS D 4  619  ? -3.051  -23.106 57.073  1.00 82.58  ? 619  LYS A C     1 
ATOM   5599  O  O     . LYS D 4  619  ? -2.033  -23.329 56.410  1.00 92.18  ? 619  LYS A O     1 
ATOM   5600  C  CB    . LYS D 4  619  ? -3.877  -20.729 57.028  1.00 65.33  ? 619  LYS A CB    1 
ATOM   5601  C  CG    . LYS D 4  619  ? -2.566  -20.134 56.532  1.00 71.68  ? 619  LYS A CG    1 
ATOM   5602  C  CD    . LYS D 4  619  ? -2.349  -18.710 57.015  1.00 80.17  ? 619  LYS A CD    1 
ATOM   5603  C  CE    . LYS D 4  619  ? -1.135  -18.095 56.329  1.00 93.64  ? 619  LYS A CE    1 
ATOM   5604  N  NZ    . LYS D 4  619  ? -0.632  -16.883 57.032  1.00 92.53  ? 619  LYS A NZ    1 
ATOM   5605  N  N     . LYS D 4  620  ? -3.254  -23.675 58.268  1.00 74.65  ? 620  LYS A N     1 
ATOM   5606  C  CA    . LYS D 4  620  ? -2.249  -24.587 58.817  1.00 89.91  ? 620  LYS A CA    1 
ATOM   5607  C  C     . LYS D 4  620  ? -2.035  -25.796 57.915  1.00 95.91  ? 620  LYS A C     1 
ATOM   5608  O  O     . LYS D 4  620  ? -0.919  -26.325 57.839  1.00 98.73  ? 620  LYS A O     1 
ATOM   5609  C  CB    . LYS D 4  620  ? -2.645  -25.072 60.216  1.00 108.86 ? 620  LYS A CB    1 
ATOM   5610  C  CG    . LYS D 4  620  ? -2.992  -23.998 61.237  1.00 91.92  ? 620  LYS A CG    1 
ATOM   5611  C  CD    . LYS D 4  620  ? -3.665  -24.646 62.441  1.00 68.59  ? 620  LYS A CD    1 
ATOM   5612  C  CE    . LYS D 4  620  ? -4.539  -23.662 63.194  1.00 79.82  ? 620  LYS A CE    1 
ATOM   5613  N  NZ    . LYS D 4  620  ? -5.765  -24.347 63.693  1.00 85.70  ? 620  LYS A NZ    1 
ATOM   5614  N  N     . THR D 4  621  ? -3.087  -26.250 57.233  1.00 90.82  ? 621  THR A N     1 
ATOM   5615  C  CA    . THR D 4  621  ? -2.980  -27.435 56.390  1.00 81.07  ? 621  THR A CA    1 
ATOM   5616  C  C     . THR D 4  621  ? -2.358  -27.112 55.037  1.00 81.32  ? 621  THR A C     1 
ATOM   5617  O  O     . THR D 4  621  ? -1.491  -27.851 54.556  1.00 74.40  ? 621  THR A O     1 
ATOM   5618  C  CB    . THR D 4  621  ? -4.361  -28.063 56.190  1.00 67.52  ? 621  THR A CB    1 
ATOM   5619  O  OG1   . THR D 4  621  ? -5.073  -28.073 57.434  1.00 80.78  ? 621  THR A OG1   1 
ATOM   5620  C  CG2   . THR D 4  621  ? -4.233  -29.487 55.675  1.00 68.61  ? 621  THR A CG2   1 
ATOM   5621  N  N     . VAL D 4  622  ? -2.775  -26.008 54.418  1.00 82.40  ? 622  VAL A N     1 
ATOM   5622  C  CA    . VAL D 4  622  ? -2.478  -25.732 53.021  1.00 82.79  ? 622  VAL A CA    1 
ATOM   5623  C  C     . VAL D 4  622  ? -1.694  -24.433 52.843  1.00 90.49  ? 622  VAL A C     1 
ATOM   5624  O  O     . VAL D 4  622  ? -1.481  -23.987 51.714  1.00 95.75  ? 622  VAL A O     1 
ATOM   5625  C  CB    . VAL D 4  622  ? -3.777  -25.724 52.186  1.00 85.31  ? 622  VAL A CB    1 
ATOM   5626  C  CG1   . VAL D 4  622  ? -4.545  -24.416 52.372  1.00 88.72  ? 622  VAL A CG1   1 
ATOM   5627  C  CG2   . VAL D 4  622  ? -3.499  -26.024 50.718  1.00 83.56  ? 622  VAL A CG2   1 
ATOM   5628  N  N     . GLY D 4  623  ? -1.247  -23.817 53.939  1.00 62.74  ? 623  GLY A N     1 
ATOM   5629  C  CA    . GLY D 4  623  ? -0.408  -22.641 53.861  1.00 65.97  ? 623  GLY A CA    1 
ATOM   5630  C  C     . GLY D 4  623  ? 1.072   -22.985 53.866  1.00 81.77  ? 623  GLY A C     1 
ATOM   5631  O  O     . GLY D 4  623  ? 1.477   -24.146 53.850  1.00 107.72 ? 623  GLY A O     1 
ATOM   5632  N  N     . SER D 4  624  ? 1.893   -21.934 53.883  1.00 90.84  ? 624  SER A N     1 
ATOM   5633  C  CA    . SER D 4  624  ? 3.346   -22.085 53.948  1.00 79.64  ? 624  SER A CA    1 
ATOM   5634  C  C     . SER D 4  624  ? 3.727   -22.387 55.394  1.00 92.94  ? 624  SER A C     1 
ATOM   5635  O  O     . SER D 4  624  ? 4.125   -21.514 56.168  1.00 129.46 ? 624  SER A O     1 
ATOM   5636  C  CB    . SER D 4  624  ? 4.045   -20.835 53.429  1.00 96.70  ? 624  SER A CB    1 
ATOM   5637  O  OG    . SER D 4  624  ? 3.837   -19.728 54.292  1.00 111.19 ? 624  SER A OG    1 
ATOM   5638  N  N     . SER D 4  625  ? 3.601   -23.660 55.759  1.00 68.02  ? 625  SER A N     1 
ATOM   5639  C  CA    . SER D 4  625  ? 3.848   -24.114 57.118  1.00 86.41  ? 625  SER A CA    1 
ATOM   5640  C  C     . SER D 4  625  ? 4.780   -25.319 57.101  1.00 101.53 ? 625  SER A C     1 
ATOM   5641  O  O     . SER D 4  625  ? 4.985   -25.957 56.066  1.00 121.39 ? 625  SER A O     1 
ATOM   5642  C  CB    . SER D 4  625  ? 2.536   -24.463 57.835  1.00 86.83  ? 625  SER A CB    1 
ATOM   5643  O  OG    . SER D 4  625  ? 1.632   -25.111 56.957  1.00 68.09  ? 625  SER A OG    1 
ATOM   5644  N  N     . ASN D 4  626  ? 5.346   -25.619 58.271  1.00 92.43  ? 626  ASN A N     1 
ATOM   5645  C  CA    . ASN D 4  626  ? 6.277   -26.738 58.389  1.00 87.28  ? 626  ASN A CA    1 
ATOM   5646  C  C     . ASN D 4  626  ? 5.591   -28.058 58.055  1.00 82.84  ? 626  ASN A C     1 
ATOM   5647  O  O     . ASN D 4  626  ? 6.009   -28.780 57.143  1.00 94.08  ? 626  ASN A O     1 
ATOM   5648  C  CB    . ASN D 4  626  ? 6.870   -26.780 59.800  1.00 103.67 ? 626  ASN A CB    1 
ATOM   5649  C  CG    . ASN D 4  626  ? 8.026   -25.813 59.980  1.00 118.14 ? 626  ASN A CG    1 
ATOM   5650  O  OD1   . ASN D 4  626  ? 9.182   -26.151 59.722  1.00 119.22 ? 626  ASN A OD1   1 
ATOM   5651  N  ND2   . ASN D 4  626  ? 7.717   -24.599 60.422  1.00 129.21 ? 626  ASN A ND2   1 
ATOM   5652  N  N     . GLY D 4  627  ? 4.534   -28.390 58.788  1.00 74.92  ? 627  GLY A N     1 
ATOM   5653  C  CA    . GLY D 4  627  ? 3.841   -29.646 58.574  1.00 84.73  ? 627  GLY A CA    1 
ATOM   5654  C  C     . GLY D 4  627  ? 2.688   -29.532 57.600  1.00 89.27  ? 627  GLY A C     1 
ATOM   5655  O  O     . GLY D 4  627  ? 1.740   -30.321 57.662  1.00 76.63  ? 627  GLY A O     1 
ATOM   5656  N  N     . GLY D 4  628  ? 2.758   -28.549 56.695  1.00 132.75 ? 628  GLY A N     1 
ATOM   5657  C  CA    . GLY D 4  628  ? 1.700   -28.335 55.731  1.00 125.64 ? 628  GLY A CA    1 
ATOM   5658  C  C     . GLY D 4  628  ? 1.726   -29.324 54.579  1.00 104.88 ? 628  GLY A C     1 
ATOM   5659  O  O     . GLY D 4  628  ? 2.695   -30.050 54.358  1.00 99.87  ? 628  GLY A O     1 
ATOM   5660  N  N     . LEU D 4  629  ? 0.618   -29.337 53.832  1.00 93.10  ? 629  LEU A N     1 
ATOM   5661  C  CA    . LEU D 4  629  ? 0.482   -30.262 52.710  1.00 85.94  ? 629  LEU A CA    1 
ATOM   5662  C  C     . LEU D 4  629  ? 1.576   -30.055 51.674  1.00 85.89  ? 629  LEU A C     1 
ATOM   5663  O  O     . LEU D 4  629  ? 2.058   -31.020 51.069  1.00 67.99  ? 629  LEU A O     1 
ATOM   5664  C  CB    . LEU D 4  629  ? -0.891  -30.099 52.059  1.00 73.39  ? 629  LEU A CB    1 
ATOM   5665  C  CG    . LEU D 4  629  ? -1.811  -31.318 52.065  1.00 71.01  ? 629  LEU A CG    1 
ATOM   5666  C  CD1   . LEU D 4  629  ? -3.089  -31.002 51.318  1.00 68.99  ? 629  LEU A CD1   1 
ATOM   5667  C  CD2   . LEU D 4  629  ? -1.122  -32.526 51.448  1.00 77.48  ? 629  LEU A CD2   1 
ATOM   5668  N  N     . ILE D 4  630  ? 1.974   -28.803 51.448  1.00 91.50  ? 630  ILE A N     1 
ATOM   5669  C  CA    . ILE D 4  630  ? 2.970   -28.516 50.421  1.00 87.89  ? 630  ILE A CA    1 
ATOM   5670  C  C     . ILE D 4  630  ? 4.313   -29.123 50.802  1.00 83.53  ? 630  ILE A C     1 
ATOM   5671  O  O     . ILE D 4  630  ? 5.027   -29.671 49.953  1.00 86.09  ? 630  ILE A O     1 
ATOM   5672  C  CB    . ILE D 4  630  ? 3.074   -26.998 50.185  1.00 87.62  ? 630  ILE A CB    1 
ATOM   5673  C  CG1   . ILE D 4  630  ? 1.694   -26.400 49.899  1.00 83.49  ? 630  ILE A CG1   1 
ATOM   5674  C  CG2   . ILE D 4  630  ? 4.035   -26.694 49.046  1.00 84.60  ? 630  ILE A CG2   1 
ATOM   5675  C  CD1   . ILE D 4  630  ? 1.024   -25.812 51.119  1.00 106.13 ? 630  ILE A CD1   1 
ATOM   5676  N  N     . HIS D 4  631  ? 4.671   -29.049 52.085  1.00 99.13  ? 631  HIS A N     1 
ATOM   5677  C  CA    . HIS D 4  631  ? 5.930   -29.633 52.540  1.00 97.50  ? 631  HIS A CA    1 
ATOM   5678  C  C     . HIS D 4  631  ? 5.954   -31.143 52.323  1.00 92.09  ? 631  HIS A C     1 
ATOM   5679  O  O     . HIS D 4  631  ? 7.003   -31.715 52.004  1.00 83.64  ? 631  HIS A O     1 
ATOM   5680  C  CB    . HIS D 4  631  ? 6.157   -29.296 54.014  1.00 82.59  ? 631  HIS A CB    1 
ATOM   5681  C  CG    . HIS D 4  631  ? 7.600   -29.141 54.385  1.00 91.34  ? 631  HIS A CG    1 
ATOM   5682  N  ND1   . HIS D 4  631  ? 8.015   -28.907 55.679  1.00 90.97  ? 631  HIS A ND1   1 
ATOM   5683  C  CD2   . HIS D 4  631  ? 8.725   -29.186 53.632  1.00 93.21  ? 631  HIS A CD2   1 
ATOM   5684  C  CE1   . HIS D 4  631  ? 9.332   -28.813 55.707  1.00 94.82  ? 631  HIS A CE1   1 
ATOM   5685  N  NE2   . HIS D 4  631  ? 9.788   -28.980 54.478  1.00 87.16  ? 631  HIS A NE2   1 
ATOM   5686  N  N     . VAL D 4  632  ? 4.806   -31.804 52.488  1.00 80.77  ? 632  VAL A N     1 
ATOM   5687  C  CA    . VAL D 4  632  ? 4.752   -33.258 52.344  1.00 79.80  ? 632  VAL A CA    1 
ATOM   5688  C  C     . VAL D 4  632  ? 4.883   -33.657 50.878  1.00 84.37  ? 632  VAL A C     1 
ATOM   5689  O  O     . VAL D 4  632  ? 5.688   -34.526 50.521  1.00 70.67  ? 632  VAL A O     1 
ATOM   5690  C  CB    . VAL D 4  632  ? 3.453   -33.808 52.962  1.00 77.49  ? 632  VAL A CB    1 
ATOM   5691  C  CG1   . VAL D 4  632  ? 3.372   -35.325 52.798  1.00 95.37  ? 632  VAL A CG1   1 
ATOM   5692  C  CG2   . VAL D 4  632  ? 3.344   -33.410 54.426  1.00 70.54  ? 632  VAL A CG2   1 
ATOM   5693  N  N     . VAL D 4  633  ? 4.093   -33.028 50.005  1.00 84.82  ? 633  VAL A N     1 
ATOM   5694  C  CA    . VAL D 4  633  ? 4.069   -33.437 48.605  1.00 85.93  ? 633  VAL A CA    1 
ATOM   5695  C  C     . VAL D 4  633  ? 5.389   -33.102 47.922  1.00 73.50  ? 633  VAL A C     1 
ATOM   5696  O  O     . VAL D 4  633  ? 5.896   -33.881 47.106  1.00 83.47  ? 633  VAL A O     1 
ATOM   5697  C  CB    . VAL D 4  633  ? 2.868   -32.793 47.890  1.00 82.29  ? 633  VAL A CB    1 
ATOM   5698  C  CG1   . VAL D 4  633  ? 2.801   -33.248 46.436  1.00 95.17  ? 633  VAL A CG1   1 
ATOM   5699  C  CG2   . VAL D 4  633  ? 1.579   -33.134 48.624  1.00 73.97  ? 633  VAL A CG2   1 
ATOM   5700  N  N     . THR D 4  634  ? 5.974   -31.946 48.244  1.00 67.82  ? 634  THR A N     1 
ATOM   5701  C  CA    . THR D 4  634  ? 7.268   -31.594 47.666  1.00 67.41  ? 634  THR A CA    1 
ATOM   5702  C  C     . THR D 4  634  ? 8.353   -32.577 48.089  1.00 86.81  ? 634  THR A C     1 
ATOM   5703  O  O     . THR D 4  634  ? 9.273   -32.862 47.314  1.00 72.49  ? 634  THR A O     1 
ATOM   5704  C  CB    . THR D 4  634  ? 7.658   -30.173 48.075  1.00 73.62  ? 634  THR A CB    1 
ATOM   5705  O  OG1   . THR D 4  634  ? 6.529   -29.305 47.923  1.00 77.68  ? 634  THR A OG1   1 
ATOM   5706  C  CG2   . THR D 4  634  ? 8.810   -29.656 47.214  1.00 65.68  ? 634  THR A CG2   1 
ATOM   5707  N  N     . ARG D 4  635  ? 8.254   -33.114 49.305  1.00 104.21 ? 635  ARG A N     1 
ATOM   5708  C  CA    . ARG D 4  635  ? 9.284   -34.008 49.819  1.00 104.36 ? 635  ARG A CA    1 
ATOM   5709  C  C     . ARG D 4  635  ? 9.188   -35.400 49.208  1.00 91.27  ? 635  ARG A C     1 
ATOM   5710  O  O     . ARG D 4  635  ? 10.209  -35.979 48.819  1.00 102.34 ? 635  ARG A O     1 
ATOM   5711  C  CB    . ARG D 4  635  ? 9.186   -34.092 51.342  1.00 118.13 ? 635  ARG A CB    1 
ATOM   5712  C  CG    . ARG D 4  635  ? 9.973   -33.025 52.072  1.00 132.18 ? 635  ARG A CG    1 
ATOM   5713  C  CD    . ARG D 4  635  ? 11.455  -33.243 51.867  1.00 132.26 ? 635  ARG A CD    1 
ATOM   5714  N  NE    . ARG D 4  635  ? 12.069  -32.194 51.062  1.00 119.27 ? 635  ARG A NE    1 
ATOM   5715  C  CZ    . ARG D 4  635  ? 13.220  -32.339 50.415  1.00 108.88 ? 635  ARG A CZ    1 
ATOM   5716  N  NH1   . ARG D 4  635  ? 13.865  -33.496 50.471  1.00 118.83 ? 635  ARG A NH1   1 
ATOM   5717  N  NH2   . ARG D 4  635  ? 13.720  -31.333 49.708  1.00 89.11  ? 635  ARG A NH2   1 
ATOM   5718  N  N     . GLU D 4  636  ? 7.979   -35.954 49.116  1.00 71.87  ? 636  GLU A N     1 
ATOM   5719  C  CA    . GLU D 4  636  ? 7.806   -37.343 48.695  1.00 75.23  ? 636  GLU A CA    1 
ATOM   5720  C  C     . GLU D 4  636  ? 7.602   -37.461 47.185  1.00 96.57  ? 636  GLU A C     1 
ATOM   5721  O  O     . GLU D 4  636  ? 8.374   -38.138 46.499  1.00 81.07  ? 636  GLU A O     1 
ATOM   5722  C  CB    . GLU D 4  636  ? 6.628   -37.972 49.448  1.00 87.55  ? 636  GLU A CB    1 
ATOM   5723  C  CG    . GLU D 4  636  ? 6.872   -39.405 49.889  1.00 96.01  ? 636  GLU A CG    1 
ATOM   5724  C  CD    . GLU D 4  636  ? 7.593   -39.483 51.219  1.00 104.97 ? 636  GLU A CD    1 
ATOM   5725  O  OE1   . GLU D 4  636  ? 7.100   -38.879 52.195  1.00 108.30 ? 636  GLU A OE1   1 
ATOM   5726  O  OE2   . GLU D 4  636  ? 8.651   -40.145 51.289  1.00 123.16 ? 636  GLU A OE2   1 
ATOM   5727  N  N     . LYS D 4  637  ? 6.564   -36.808 46.659  1.00 123.63 ? 637  LYS A N     1 
ATOM   5728  C  CA    . LYS D 4  637  ? 6.272   -36.907 45.231  1.00 115.87 ? 637  LYS A CA    1 
ATOM   5729  C  C     . LYS D 4  637  ? 7.305   -36.156 44.401  1.00 106.22 ? 637  LYS A C     1 
ATOM   5730  O  O     . LYS D 4  637  ? 7.906   -36.722 43.481  1.00 120.61 ? 637  LYS A O     1 
ATOM   5731  C  CB    . LYS D 4  637  ? 4.864   -36.385 44.943  1.00 102.70 ? 637  LYS A CB    1 
ATOM   5732  C  CG    . LYS D 4  637  ? 3.772   -37.252 45.530  1.00 115.87 ? 637  LYS A CG    1 
ATOM   5733  C  CD    . LYS D 4  637  ? 3.952   -38.695 45.090  1.00 133.70 ? 637  LYS A CD    1 
ATOM   5734  C  CE    . LYS D 4  637  ? 2.905   -39.597 45.711  1.00 128.78 ? 637  LYS A CE    1 
ATOM   5735  N  NZ    . LYS D 4  637  ? 3.052   -41.014 45.272  1.00 118.52 ? 637  LYS A NZ    1 
ATOM   5736  N  N     . GLY D 4  638  ? 7.525   -34.882 44.710  1.00 76.15  ? 638  GLY A N     1 
ATOM   5737  C  CA    . GLY D 4  638  ? 8.485   -34.083 43.990  1.00 78.30  ? 638  GLY A CA    1 
ATOM   5738  C  C     . GLY D 4  638  ? 7.954   -32.705 43.658  1.00 91.88  ? 638  GLY A C     1 
ATOM   5739  O  O     . GLY D 4  638  ? 6.777   -32.396 43.872  1.00 107.26 ? 638  GLY A O     1 
ATOM   5740  N  N     . PRO D 4  639  ? 8.823   -31.846 43.118  1.00 73.19  ? 639  PRO A N     1 
ATOM   5741  C  CA    . PRO D 4  639  ? 8.379   -30.478 42.804  1.00 67.29  ? 639  PRO A CA    1 
ATOM   5742  C  C     . PRO D 4  639  ? 7.330   -30.422 41.709  1.00 86.51  ? 639  PRO A C     1 
ATOM   5743  O  O     . PRO D 4  639  ? 6.415   -29.594 41.787  1.00 98.55  ? 639  PRO A O     1 
ATOM   5744  C  CB    . PRO D 4  639  ? 9.681   -29.782 42.383  1.00 65.54  ? 639  PRO A CB    1 
ATOM   5745  C  CG    . PRO D 4  639  ? 10.549  -30.888 41.880  1.00 66.60  ? 639  PRO A CG    1 
ATOM   5746  C  CD    . PRO D 4  639  ? 10.227  -32.078 42.742  1.00 67.67  ? 639  PRO A CD    1 
ATOM   5747  N  N     . GLN D 4  640  ? 7.431   -31.282 40.693  1.00 70.17  ? 640  GLN A N     1 
ATOM   5748  C  CA    . GLN D 4  640  ? 6.498   -31.214 39.573  1.00 74.35  ? 640  GLN A CA    1 
ATOM   5749  C  C     . GLN D 4  640  ? 5.072   -31.490 40.030  1.00 79.55  ? 640  GLN A C     1 
ATOM   5750  O  O     . GLN D 4  640  ? 4.146   -30.737 39.704  1.00 78.63  ? 640  GLN A O     1 
ATOM   5751  C  CB    . GLN D 4  640  ? 6.916   -32.200 38.483  1.00 107.34 ? 640  GLN A CB    1 
ATOM   5752  C  CG    . GLN D 4  640  ? 8.411   -32.255 38.254  1.00 124.41 ? 640  GLN A CG    1 
ATOM   5753  C  CD    . GLN D 4  640  ? 9.004   -30.889 37.982  1.00 124.06 ? 640  GLN A CD    1 
ATOM   5754  O  OE1   . GLN D 4  640  ? 9.977   -30.487 38.618  1.00 123.06 ? 640  GLN A OE1   1 
ATOM   5755  N  NE2   . GLN D 4  640  ? 8.424   -30.170 37.026  1.00 120.76 ? 640  GLN A NE2   1 
ATOM   5756  N  N     . VAL D 4  641  ? 4.876   -32.570 40.789  1.00 75.26  ? 641  VAL A N     1 
ATOM   5757  C  CA    . VAL D 4  641  ? 3.541   -32.890 41.281  1.00 72.56  ? 641  VAL A CA    1 
ATOM   5758  C  C     . VAL D 4  641  ? 3.077   -31.836 42.273  1.00 70.60  ? 641  VAL A C     1 
ATOM   5759  O  O     . VAL D 4  641  ? 1.887   -31.511 42.343  1.00 87.79  ? 641  VAL A O     1 
ATOM   5760  C  CB    . VAL D 4  641  ? 3.518   -34.298 41.902  1.00 85.46  ? 641  VAL A CB    1 
ATOM   5761  C  CG1   . VAL D 4  641  ? 2.083   -34.786 42.053  1.00 102.36 ? 641  VAL A CG1   1 
ATOM   5762  C  CG2   . VAL D 4  641  ? 4.333   -35.259 41.055  1.00 107.12 ? 641  VAL A CG2   1 
ATOM   5763  N  N     . CYS D 4  642  ? 4.005   -31.287 43.057  1.00 66.88  ? 642  CYS A N     1 
ATOM   5764  C  CA    . CYS D 4  642  ? 3.639   -30.216 43.974  1.00 65.95  ? 642  CYS A CA    1 
ATOM   5765  C  C     . CYS D 4  642  ? 3.304   -28.940 43.213  1.00 81.92  ? 642  CYS A C     1 
ATOM   5766  O  O     . CYS D 4  642  ? 2.360   -28.226 43.571  1.00 94.27  ? 642  CYS A O     1 
ATOM   5767  C  CB    . CYS D 4  642  ? 4.769   -29.974 44.972  1.00 77.51  ? 642  CYS A CB    1 
ATOM   5768  S  SG    . CYS D 4  642  ? 4.248   -29.130 46.479  1.00 107.97 ? 642  CYS A SG    1 
ATOM   5769  N  N     . ALA D 4  643  ? 4.060   -28.639 42.155  1.00 82.67  ? 643  ALA A N     1 
ATOM   5770  C  CA    . ALA D 4  643  ? 3.737   -27.476 41.338  1.00 76.29  ? 643  ALA A CA    1 
ATOM   5771  C  C     . ALA D 4  643  ? 2.394   -27.659 40.644  1.00 98.66  ? 643  ALA A C     1 
ATOM   5772  O  O     . ALA D 4  643  ? 1.594   -26.719 40.563  1.00 109.54 ? 643  ALA A O     1 
ATOM   5773  C  CB    . ALA D 4  643  ? 4.849   -27.219 40.320  1.00 67.88  ? 643  ALA A CB    1 
ATOM   5774  N  N     . LYS D 4  644  ? 2.123   -28.867 40.144  1.00 78.94  ? 644  LYS A N     1 
ATOM   5775  C  CA    . LYS D 4  644  ? 0.802   -29.152 39.598  1.00 84.07  ? 644  LYS A CA    1 
ATOM   5776  C  C     . LYS D 4  644  ? -0.258  -29.159 40.691  1.00 80.74  ? 644  LYS A C     1 
ATOM   5777  O  O     . LYS D 4  644  ? -1.417  -28.813 40.432  1.00 90.45  ? 644  LYS A O     1 
ATOM   5778  C  CB    . LYS D 4  644  ? 0.815   -30.491 38.860  1.00 97.30  ? 644  LYS A CB    1 
ATOM   5779  C  CG    . LYS D 4  644  ? -0.496  -30.831 38.161  1.00 107.55 ? 644  LYS A CG    1 
ATOM   5780  C  CD    . LYS D 4  644  ? -0.339  -30.824 36.649  1.00 119.16 ? 644  LYS A CD    1 
ATOM   5781  C  CE    . LYS D 4  644  ? 0.678   -31.863 36.201  1.00 134.24 ? 644  LYS A CE    1 
ATOM   5782  N  NZ    . LYS D 4  644  ? 0.250   -33.252 36.539  1.00 130.30 ? 644  LYS A NZ    1 
ATOM   5783  N  N     . LEU D 4  645  ? 0.124   -29.537 41.915  1.00 80.10  ? 645  LEU A N     1 
ATOM   5784  C  CA    . LEU D 4  645  ? -0.837  -29.613 43.012  1.00 86.56  ? 645  LEU A CA    1 
ATOM   5785  C  C     . LEU D 4  645  ? -1.505  -28.268 43.264  1.00 73.88  ? 645  LEU A C     1 
ATOM   5786  O  O     . LEU D 4  645  ? -2.711  -28.206 43.533  1.00 65.07  ? 645  LEU A O     1 
ATOM   5787  C  CB    . LEU D 4  645  ? -0.140  -30.107 44.281  1.00 66.33  ? 645  LEU A CB    1 
ATOM   5788  C  CG    . LEU D 4  645  ? -0.879  -29.876 45.598  1.00 66.34  ? 645  LEU A CG    1 
ATOM   5789  C  CD1   . LEU D 4  645  ? -2.128  -30.742 45.666  1.00 67.42  ? 645  LEU A CD1   1 
ATOM   5790  C  CD2   . LEU D 4  645  ? 0.037   -30.152 46.777  1.00 66.55  ? 645  LEU A CD2   1 
ATOM   5791  N  N     . PHE D 4  646  ? -0.735  -27.181 43.188  1.00 63.77  ? 646  PHE A N     1 
ATOM   5792  C  CA    . PHE D 4  646  ? -1.290  -25.848 43.392  1.00 62.76  ? 646  PHE A CA    1 
ATOM   5793  C  C     . PHE D 4  646  ? -2.474  -25.599 42.466  1.00 62.74  ? 646  PHE A C     1 
ATOM   5794  O  O     . PHE D 4  646  ? -3.581  -25.283 42.918  1.00 62.75  ? 646  PHE A O     1 
ATOM   5795  C  CB    . PHE D 4  646  ? -0.200  -24.796 43.175  1.00 61.72  ? 646  PHE A CB    1 
ATOM   5796  C  CG    . PHE D 4  646  ? 0.671   -24.570 44.375  1.00 74.36  ? 646  PHE A CG    1 
ATOM   5797  C  CD1   . PHE D 4  646  ? 1.955   -25.085 44.424  1.00 86.03  ? 646  PHE A CD1   1 
ATOM   5798  C  CD2   . PHE D 4  646  ? 0.209   -23.833 45.451  1.00 79.75  ? 646  PHE A CD2   1 
ATOM   5799  C  CE1   . PHE D 4  646  ? 2.759   -24.875 45.534  1.00 83.84  ? 646  PHE A CE1   1 
ATOM   5800  C  CE2   . PHE D 4  646  ? 1.006   -23.619 46.560  1.00 77.98  ? 646  PHE A CE2   1 
ATOM   5801  C  CZ    . PHE D 4  646  ? 2.282   -24.141 46.601  1.00 82.28  ? 646  PHE A CZ    1 
ATOM   5802  N  N     . GLY D 4  647  ? -2.257  -25.763 41.160  1.00 73.93  ? 647  GLY A N     1 
ATOM   5803  C  CA    . GLY D 4  647  ? -3.311  -25.470 40.202  1.00 83.57  ? 647  GLY A CA    1 
ATOM   5804  C  C     . GLY D 4  647  ? -4.544  -26.329 40.398  1.00 73.14  ? 647  GLY A C     1 
ATOM   5805  O  O     . GLY D 4  647  ? -5.672  -25.833 40.342  1.00 80.45  ? 647  GLY A O     1 
ATOM   5806  N  N     . ASN D 4  648  ? -4.348  -27.625 40.646  1.00 67.25  ? 648  ASN A N     1 
ATOM   5807  C  CA    . ASN D 4  648  ? -5.490  -28.522 40.806  1.00 74.89  ? 648  ASN A CA    1 
ATOM   5808  C  C     . ASN D 4  648  ? -6.386  -28.084 41.961  1.00 77.71  ? 648  ASN A C     1 
ATOM   5809  O  O     . ASN D 4  648  ? -7.615  -28.070 41.827  1.00 68.67  ? 648  ASN A O     1 
ATOM   5810  C  CB    . ASN D 4  648  ? -5.003  -29.958 41.000  1.00 85.14  ? 648  ASN A CB    1 
ATOM   5811  C  CG    . ASN D 4  648  ? -4.159  -30.453 39.835  1.00 88.36  ? 648  ASN A CG    1 
ATOM   5812  O  OD1   . ASN D 4  648  ? -3.626  -29.661 39.055  1.00 96.18  ? 648  ASN A OD1   1 
ATOM   5813  N  ND2   . ASN D 4  648  ? -4.037  -31.768 39.711  1.00 94.66  ? 648  ASN A ND2   1 
ATOM   5814  N  N     . ILE D 4  649  ? -5.793  -27.706 43.097  1.00 83.81  ? 649  ILE A N     1 
ATOM   5815  C  CA    . ILE D 4  649  ? -6.593  -27.196 44.210  1.00 80.64  ? 649  ILE A CA    1 
ATOM   5816  C  C     . ILE D 4  649  ? -7.257  -25.879 43.831  1.00 89.32  ? 649  ILE A C     1 
ATOM   5817  O  O     . ILE D 4  649  ? -8.434  -25.651 44.135  1.00 84.79  ? 649  ILE A O     1 
ATOM   5818  C  CB    . ILE D 4  649  ? -5.731  -27.047 45.476  1.00 73.02  ? 649  ILE A CB    1 
ATOM   5819  C  CG1   . ILE D 4  649  ? -5.009  -28.357 45.797  1.00 77.46  ? 649  ILE A CG1   1 
ATOM   5820  C  CG2   . ILE D 4  649  ? -6.585  -26.603 46.655  1.00 75.78  ? 649  ILE A CG2   1 
ATOM   5821  C  CD1   . ILE D 4  649  ? -4.343  -28.364 47.160  1.00 70.64  ? 649  ILE A CD1   1 
ATOM   5822  N  N     . GLN D 4  650  ? -6.515  -24.994 43.164  1.00 94.03  ? 650  GLN A N     1 
ATOM   5823  C  CA    . GLN D 4  650  ? -7.070  -23.701 42.770  1.00 96.65  ? 650  GLN A CA    1 
ATOM   5824  C  C     . GLN D 4  650  ? -8.263  -23.873 41.838  1.00 78.19  ? 650  GLN A C     1 
ATOM   5825  O  O     . GLN D 4  650  ? -9.342  -23.320 42.082  1.00 62.89  ? 650  GLN A O     1 
ATOM   5826  C  CB    . GLN D 4  650  ? -5.987  -22.855 42.104  1.00 83.88  ? 650  GLN A CB    1 
ATOM   5827  C  CG    . GLN D 4  650  ? -4.860  -22.453 43.025  1.00 60.84  ? 650  GLN A CG    1 
ATOM   5828  C  CD    . GLN D 4  650  ? -4.013  -21.344 42.445  1.00 59.79  ? 650  GLN A CD    1 
ATOM   5829  O  OE1   . GLN D 4  650  ? -2.784  -21.389 42.510  1.00 59.56  ? 650  GLN A OE1   1 
ATOM   5830  N  NE2   . GLN D 4  650  ? -4.666  -20.340 41.864  1.00 59.21  ? 650  GLN A NE2   1 
ATOM   5831  N  N     . LYS D 4  651  ? -8.092  -24.655 40.770  1.00 73.96  ? 651  LYS A N     1 
ATOM   5832  C  CA    . LYS D 4  651  ? -9.149  -24.794 39.772  1.00 78.38  ? 651  LYS A CA    1 
ATOM   5833  C  C     . LYS D 4  651  ? -10.426 -25.381 40.360  1.00 70.09  ? 651  LYS A C     1 
ATOM   5834  O  O     . LYS D 4  651  ? -11.525 -25.044 39.908  1.00 70.04  ? 651  LYS A O     1 
ATOM   5835  C  CB    . LYS D 4  651  ? -8.652  -25.653 38.610  1.00 64.57  ? 651  LYS A CB    1 
ATOM   5836  C  CG    . LYS D 4  651  ? -7.476  -25.040 37.877  1.00 63.67  ? 651  LYS A CG    1 
ATOM   5837  C  CD    . LYS D 4  651  ? -6.543  -26.100 37.341  1.00 64.30  ? 651  LYS A CD    1 
ATOM   5838  C  CE    . LYS D 4  651  ? -5.339  -25.467 36.674  1.00 63.45  ? 651  LYS A CE    1 
ATOM   5839  N  NZ    . LYS D 4  651  ? -4.348  -26.497 36.272  1.00 67.24  ? 651  LYS A NZ    1 
ATOM   5840  N  N     . VAL D 4  652  ? -10.309 -26.253 41.361  1.00 65.71  ? 652  VAL A N     1 
ATOM   5841  C  CA    . VAL D 4  652  ? -11.501 -26.837 41.970  1.00 66.75  ? 652  VAL A CA    1 
ATOM   5842  C  C     . VAL D 4  652  ? -12.159 -25.842 42.916  1.00 67.08  ? 652  VAL A C     1 
ATOM   5843  O  O     . VAL D 4  652  ? -13.371 -25.605 42.853  1.00 66.57  ? 652  VAL A O     1 
ATOM   5844  C  CB    . VAL D 4  652  ? -11.157 -28.145 42.701  1.00 67.82  ? 652  VAL A CB    1 
ATOM   5845  C  CG1   . VAL D 4  652  ? -12.402 -28.717 43.365  1.00 68.96  ? 652  VAL A CG1   1 
ATOM   5846  C  CG2   . VAL D 4  652  ? -10.566 -29.150 41.742  1.00 68.47  ? 652  VAL A CG2   1 
ATOM   5847  N  N     . VAL D 4  653  ? -11.370 -25.259 43.820  1.00 73.40  ? 653  VAL A N     1 
ATOM   5848  C  CA    . VAL D 4  653  ? -11.948 -24.450 44.888  1.00 73.12  ? 653  VAL A CA    1 
ATOM   5849  C  C     . VAL D 4  653  ? -12.410 -23.099 44.355  1.00 87.74  ? 653  VAL A C     1 
ATOM   5850  O  O     . VAL D 4  653  ? -13.444 -22.574 44.783  1.00 96.50  ? 653  VAL A O     1 
ATOM   5851  C  CB    . VAL D 4  653  ? -10.941 -24.302 46.041  1.00 71.05  ? 653  VAL A CB    1 
ATOM   5852  C  CG1   . VAL D 4  653  ? -11.546 -23.505 47.176  1.00 85.03  ? 653  VAL A CG1   1 
ATOM   5853  C  CG2   . VAL D 4  653  ? -10.506 -25.673 46.533  1.00 78.39  ? 653  VAL A CG2   1 
ATOM   5854  N  N     . ASN D 4  654  ? -11.657 -22.510 43.421  1.00 83.41  ? 654  ASN A N     1 
ATOM   5855  C  CA    . ASN D 4  654  ? -12.144 -21.306 42.753  1.00 72.83  ? 654  ASN A CA    1 
ATOM   5856  C  C     . ASN D 4  654  ? -13.464 -21.575 42.040  1.00 70.89  ? 654  ASN A C     1 
ATOM   5857  O  O     . ASN D 4  654  ? -14.352 -20.715 42.014  1.00 87.92  ? 654  ASN A O     1 
ATOM   5858  C  CB    . ASN D 4  654  ? -11.098 -20.779 41.771  1.00 62.22  ? 654  ASN A CB    1 
ATOM   5859  C  CG    . ASN D 4  654  ? -9.865  -20.235 42.463  1.00 60.76  ? 654  ASN A CG    1 
ATOM   5860  O  OD1   . ASN D 4  654  ? -8.739  -20.626 42.154  1.00 60.62  ? 654  ASN A OD1   1 
ATOM   5861  N  ND2   . ASN D 4  654  ? -10.071 -19.306 43.390  1.00 60.23  ? 654  ASN A ND2   1 
ATOM   5862  N  N     . PHE D 4  655  ? -13.612 -22.772 41.466  1.00 65.50  ? 655  PHE A N     1 
ATOM   5863  C  CA    . PHE D 4  655  ? -14.859 -23.138 40.802  1.00 65.17  ? 655  PHE A CA    1 
ATOM   5864  C  C     . PHE D 4  655  ? -16.012 -23.224 41.794  1.00 71.49  ? 655  PHE A C     1 
ATOM   5865  O  O     . PHE D 4  655  ? -17.054 -22.586 41.603  1.00 65.93  ? 655  PHE A O     1 
ATOM   5866  C  CB    . PHE D 4  655  ? -14.682 -24.463 40.060  1.00 66.19  ? 655  PHE A CB    1 
ATOM   5867  C  CG    . PHE D 4  655  ? -15.847 -24.834 39.189  1.00 78.96  ? 655  PHE A CG    1 
ATOM   5868  C  CD1   . PHE D 4  655  ? -15.912 -24.401 37.877  1.00 76.37  ? 655  PHE A CD1   1 
ATOM   5869  C  CD2   . PHE D 4  655  ? -16.866 -25.639 39.674  1.00 68.41  ? 655  PHE A CD2   1 
ATOM   5870  C  CE1   . PHE D 4  655  ? -16.980 -24.748 37.070  1.00 86.45  ? 655  PHE A CE1   1 
ATOM   5871  C  CE2   . PHE D 4  655  ? -17.936 -25.990 38.871  1.00 69.38  ? 655  PHE A CE2   1 
ATOM   5872  C  CZ    . PHE D 4  655  ? -17.992 -25.544 37.568  1.00 76.71  ? 655  PHE A CZ    1 
ATOM   5873  N  N     . TRP D 4  656  ? -15.846 -24.013 42.861  1.00 86.18  ? 656  TRP A N     1 
ATOM   5874  C  CA    . TRP D 4  656  ? -16.917 -24.148 43.844  1.00 87.56  ? 656  TRP A CA    1 
ATOM   5875  C  C     . TRP D 4  656  ? -17.258 -22.804 44.473  1.00 98.21  ? 656  TRP A C     1 
ATOM   5876  O  O     . TRP D 4  656  ? -18.435 -22.484 44.668  1.00 108.72 ? 656  TRP A O     1 
ATOM   5877  C  CB    . TRP D 4  656  ? -16.534 -25.156 44.927  1.00 74.16  ? 656  TRP A CB    1 
ATOM   5878  C  CG    . TRP D 4  656  ? -17.611 -25.307 45.961  1.00 83.62  ? 656  TRP A CG    1 
ATOM   5879  C  CD1   . TRP D 4  656  ? -18.648 -26.194 45.935  1.00 85.76  ? 656  TRP A CD1   1 
ATOM   5880  C  CD2   . TRP D 4  656  ? -17.779 -24.531 47.155  1.00 87.78  ? 656  TRP A CD2   1 
ATOM   5881  N  NE1   . TRP D 4  656  ? -19.442 -26.028 47.043  1.00 78.54  ? 656  TRP A NE1   1 
ATOM   5882  C  CE2   . TRP D 4  656  ? -18.931 -25.014 47.808  1.00 80.03  ? 656  TRP A CE2   1 
ATOM   5883  C  CE3   . TRP D 4  656  ? -17.063 -23.480 47.739  1.00 78.63  ? 656  TRP A CE3   1 
ATOM   5884  C  CZ2   . TRP D 4  656  ? -19.383 -24.485 49.013  1.00 75.68  ? 656  TRP A CZ2   1 
ATOM   5885  C  CZ3   . TRP D 4  656  ? -17.516 -22.955 48.936  1.00 83.42  ? 656  TRP A CZ3   1 
ATOM   5886  C  CH2   . TRP D 4  656  ? -18.665 -23.459 49.561  1.00 81.71  ? 656  TRP A CH2   1 
ATOM   5887  N  N     . LEU D 4  657  ? -16.239 -22.001 44.794  1.00 93.90  ? 657  LEU A N     1 
ATOM   5888  C  CA    . LEU D 4  657  ? -16.492 -20.674 45.347  1.00 91.39  ? 657  LEU A CA    1 
ATOM   5889  C  C     . LEU D 4  657  ? -17.172 -19.766 44.330  1.00 84.36  ? 657  LEU A C     1 
ATOM   5890  O  O     . LEU D 4  657  ? -17.984 -18.914 44.707  1.00 84.25  ? 657  LEU A O     1 
ATOM   5891  C  CB    . LEU D 4  657  ? -15.183 -20.044 45.832  1.00 87.19  ? 657  LEU A CB    1 
ATOM   5892  C  CG    . LEU D 4  657  ? -15.277 -18.652 46.467  1.00 65.46  ? 657  LEU A CG    1 
ATOM   5893  C  CD1   . LEU D 4  657  ? -16.325 -18.646 47.569  1.00 63.51  ? 657  LEU A CD1   1 
ATOM   5894  C  CD2   . LEU D 4  657  ? -13.930 -18.177 47.003  1.00 61.89  ? 657  LEU A CD2   1 
ATOM   5895  N  N     . LEU D 4  658  ? -16.857 -19.934 43.044  1.00 68.03  ? 658  LEU A N     1 
ATOM   5896  C  CA    . LEU D 4  658  ? -17.514 -19.148 42.006  1.00 72.87  ? 658  LEU A CA    1 
ATOM   5897  C  C     . LEU D 4  658  ? -19.019 -19.384 41.996  1.00 72.13  ? 658  LEU A C     1 
ATOM   5898  O  O     . LEU D 4  658  ? -19.803 -18.435 41.880  1.00 98.91  ? 658  LEU A O     1 
ATOM   5899  C  CB    . LEU D 4  658  ? -16.906 -19.480 40.642  1.00 82.53  ? 658  LEU A CB    1 
ATOM   5900  C  CG    . LEU D 4  658  ? -17.626 -19.089 39.349  1.00 82.40  ? 658  LEU A CG    1 
ATOM   5901  C  CD1   . LEU D 4  658  ? -18.027 -17.616 39.296  1.00 66.91  ? 658  LEU A CD1   1 
ATOM   5902  C  CD2   . LEU D 4  658  ? -16.739 -19.437 38.165  1.00 84.36  ? 658  LEU A CD2   1 
ATOM   5903  N  N     . HIS D 4  659  ? -19.442 -20.638 42.115  1.00 66.07  ? 659  HIS A N     1 
ATOM   5904  C  CA    . HIS D 4  659  ? -20.864 -20.951 42.075  1.00 81.65  ? 659  HIS A CA    1 
ATOM   5905  C  C     . HIS D 4  659  ? -21.521 -20.881 43.446  1.00 81.83  ? 659  HIS A C     1 
ATOM   5906  O  O     . HIS D 4  659  ? -22.736 -20.665 43.533  1.00 82.87  ? 659  HIS A O     1 
ATOM   5907  C  CB    . HIS D 4  659  ? -21.067 -22.332 41.450  1.00 106.58 ? 659  HIS A CB    1 
ATOM   5908  C  CG    . HIS D 4  659  ? -20.549 -22.434 40.049  1.00 92.51  ? 659  HIS A CG    1 
ATOM   5909  N  ND1   . HIS D 4  659  ? -21.307 -22.095 38.949  1.00 81.31  ? 659  HIS A ND1   1 
ATOM   5910  C  CD2   . HIS D 4  659  ? -19.337 -22.801 39.571  1.00 94.07  ? 659  HIS A CD2   1 
ATOM   5911  C  CE1   . HIS D 4  659  ? -20.591 -22.268 37.853  1.00 97.54  ? 659  HIS A CE1   1 
ATOM   5912  N  NE2   . HIS D 4  659  ? -19.391 -22.695 38.203  1.00 91.45  ? 659  HIS A NE2   1 
ATOM   5913  N  N     . ASN D 4  660  ? -20.751 -21.059 44.520  1.00 79.63  ? 660  ASN A N     1 
ATOM   5914  C  CA    . ASN D 4  660  ? -21.281 -20.810 45.855  1.00 86.33  ? 660  ASN A CA    1 
ATOM   5915  C  C     . ASN D 4  660  ? -21.348 -19.315 46.146  1.00 67.72  ? 660  ASN A C     1 
ATOM   5916  O  O     . ASN D 4  660  ? -22.354 -18.818 46.663  1.00 66.79  ? 660  ASN A O     1 
ATOM   5917  C  CB    . ASN D 4  660  ? -20.427 -21.521 46.905  1.00 85.59  ? 660  ASN A CB    1 
ATOM   5918  C  CG    . ASN D 4  660  ? -21.057 -21.499 48.281  1.00 89.71  ? 660  ASN A CG    1 
ATOM   5919  O  OD1   . ASN D 4  660  ? -21.754 -22.435 48.671  1.00 98.32  ? 660  ASN A OD1   1 
ATOM   5920  N  ND2   . ASN D 4  660  ? -20.816 -20.426 49.026  1.00 96.43  ? 660  ASN A ND2   1 
ATOM   5921  N  N     . GLY D 4  661  ? -20.289 -18.590 45.821  1.00 82.04  ? 661  GLY A N     1 
ATOM   5922  C  CA    . GLY D 4  661  ? -20.266 -17.150 46.026  1.00 87.11  ? 661  GLY A CA    1 
ATOM   5923  C  C     . GLY D 4  661  ? -19.867 -16.777 47.438  1.00 80.86  ? 661  GLY A C     1 
ATOM   5924  O  O     . GLY D 4  661  ? -20.111 -17.502 48.401  1.00 94.68  ? 661  GLY A O     1 
ATOM   5925  N  N     . PHE D 4  662  ? -19.226 -15.617 47.558  1.00 86.54  ? 662  PHE A N     1 
ATOM   5926  C  CA    . PHE D 4  662  ? -18.819 -15.102 48.857  1.00 87.42  ? 662  PHE A CA    1 
ATOM   5927  C  C     . PHE D 4  662  ? -18.701 -13.590 48.780  1.00 106.63 ? 662  PHE A C     1 
ATOM   5928  O  O     . PHE D 4  662  ? -18.251 -13.047 47.769  1.00 107.75 ? 662  PHE A O     1 
ATOM   5929  C  CB    . PHE D 4  662  ? -17.484 -15.690 49.321  1.00 72.89  ? 662  PHE A CB    1 
ATOM   5930  C  CG    . PHE D 4  662  ? -17.089 -15.264 50.707  1.00 76.44  ? 662  PHE A CG    1 
ATOM   5931  C  CD1   . PHE D 4  662  ? -17.997 -15.336 51.750  1.00 74.29  ? 662  PHE A CD1   1 
ATOM   5932  C  CD2   . PHE D 4  662  ? -15.820 -14.771 50.964  1.00 69.80  ? 662  PHE A CD2   1 
ATOM   5933  C  CE1   . PHE D 4  662  ? -17.643 -14.944 53.025  1.00 65.33  ? 662  PHE A CE1   1 
ATOM   5934  C  CE2   . PHE D 4  662  ? -15.462 -14.370 52.240  1.00 63.64  ? 662  PHE A CE2   1 
ATOM   5935  C  CZ    . PHE D 4  662  ? -16.375 -14.460 53.271  1.00 64.42  ? 662  PHE A CZ    1 
ATOM   5936  N  N     . SER D 4  663  ? -19.094 -12.922 49.860  1.00 109.21 ? 663  SER A N     1 
ATOM   5937  C  CA    . SER D 4  663  ? -19.049 -11.472 49.931  1.00 107.66 ? 663  SER A CA    1 
ATOM   5938  C  C     . SER D 4  663  ? -18.713 -11.068 51.359  1.00 110.25 ? 663  SER A C     1 
ATOM   5939  O  O     . SER D 4  663  ? -18.547 -11.912 52.243  1.00 136.24 ? 663  SER A O     1 
ATOM   5940  C  CB    . SER D 4  663  ? -20.375 -10.856 49.480  1.00 110.42 ? 663  SER A CB    1 
ATOM   5941  O  OG    . SER D 4  663  ? -20.367 -9.450  49.652  1.00 117.71 ? 663  SER A OG    1 
ATOM   5942  N  N     . THR D 4  664  ? -18.604 -9.759  51.576  1.00 94.11  ? 664  THR A N     1 
ATOM   5943  C  CA    . THR D 4  664  ? -18.480 -9.197  52.916  1.00 98.18  ? 664  THR A CA    1 
ATOM   5944  C  C     . THR D 4  664  ? -19.201 -7.861  52.947  1.00 100.77 ? 664  THR A C     1 
ATOM   5945  O  O     . THR D 4  664  ? -18.813 -6.928  52.237  1.00 125.09 ? 664  THR A O     1 
ATOM   5946  C  CB    . THR D 4  664  ? -17.016 -9.029  53.328  1.00 98.33  ? 664  THR A CB    1 
ATOM   5947  O  OG1   . THR D 4  664  ? -16.463 -10.315 53.627  1.00 122.88 ? 664  THR A OG1   1 
ATOM   5948  C  CG2   . THR D 4  664  ? -16.905 -8.140  54.557  1.00 83.73  ? 664  THR A CG2   1 
ATOM   5949  N  N     . GLY D 4  665  ? -20.245 -7.772  53.770  1.00 69.21  ? 665  GLY A N     1 
ATOM   5950  C  CA    . GLY D 4  665  ? -21.019 -6.560  53.909  1.00 71.56  ? 665  GLY A CA    1 
ATOM   5951  C  C     . GLY D 4  665  ? -20.602 -5.743  55.119  1.00 78.26  ? 665  GLY A C     1 
ATOM   5952  O  O     . GLY D 4  665  ? -19.593 -6.007  55.776  1.00 70.00  ? 665  GLY A O     1 
ATOM   5953  N  N     . ILE D 4  666  ? -21.402 -4.716  55.403  1.00 77.08  ? 666  ILE A N     1 
ATOM   5954  C  CA    . ILE D 4  666  ? -21.193 -3.902  56.593  1.00 72.35  ? 666  ILE A CA    1 
ATOM   5955  C  C     . ILE D 4  666  ? -22.054 -4.372  57.760  1.00 82.58  ? 666  ILE A C     1 
ATOM   5956  O  O     . ILE D 4  666  ? -21.758 -4.022  58.913  1.00 108.41 ? 666  ILE A O     1 
ATOM   5957  C  CB    . ILE D 4  666  ? -21.453 -2.409  56.310  1.00 72.08  ? 666  ILE A CB    1 
ATOM   5958  C  CG1   . ILE D 4  666  ? -20.613 -1.548  57.256  1.00 85.39  ? 666  ILE A CG1   1 
ATOM   5959  C  CG2   . ILE D 4  666  ? -22.934 -2.093  56.461  1.00 92.52  ? 666  ILE A CG2   1 
ATOM   5960  C  CD1   . ILE D 4  666  ? -20.867 -0.072  57.137  1.00 92.73  ? 666  ILE A CD1   1 
ATOM   5961  N  N     . GLY D 4  667  ? -23.098 -5.157  57.502  1.00 79.02  ? 667  GLY A N     1 
ATOM   5962  C  CA    . GLY D 4  667  ? -23.783 -5.832  58.586  1.00 102.32 ? 667  GLY A CA    1 
ATOM   5963  C  C     . GLY D 4  667  ? -22.928 -6.849  59.309  1.00 91.57  ? 667  GLY A C     1 
ATOM   5964  O  O     . GLY D 4  667  ? -23.306 -7.286  60.402  1.00 99.20  ? 667  GLY A O     1 
ATOM   5965  N  N     . ASP D 4  668  ? -21.790 -7.231  58.723  1.00 69.43  ? 668  ASP A N     1 
ATOM   5966  C  CA    . ASP D 4  668  ? -20.847 -8.148  59.347  1.00 84.16  ? 668  ASP A CA    1 
ATOM   5967  C  C     . ASP D 4  668  ? -20.014 -7.496  60.443  1.00 89.43  ? 668  ASP A C     1 
ATOM   5968  O  O     . ASP D 4  668  ? -19.341 -8.213  61.193  1.00 96.58  ? 668  ASP A O     1 
ATOM   5969  C  CB    . ASP D 4  668  ? -19.917 -8.749  58.287  1.00 87.14  ? 668  ASP A CB    1 
ATOM   5970  C  CG    . ASP D 4  668  ? -20.655 -9.616  57.279  1.00 96.71  ? 668  ASP A CG    1 
ATOM   5971  O  OD1   . ASP D 4  668  ? -21.769 -10.087 57.592  1.00 105.31 ? 668  ASP A OD1   1 
ATOM   5972  O  OD2   . ASP D 4  668  ? -20.116 -9.833  56.173  1.00 107.10 ? 668  ASP A OD2   1 
ATOM   5973  N  N     . THR D 4  669  ? -20.029 -6.169  60.553  1.00 69.20  ? 669  THR A N     1 
ATOM   5974  C  CA    . THR D 4  669  ? -19.327 -5.487  61.633  1.00 66.35  ? 669  THR A CA    1 
ATOM   5975  C  C     . THR D 4  669  ? -20.216 -5.200  62.834  1.00 78.51  ? 669  THR A C     1 
ATOM   5976  O  O     . THR D 4  669  ? -19.695 -4.875  63.907  1.00 98.20  ? 669  THR A O     1 
ATOM   5977  C  CB    . THR D 4  669  ? -18.735 -4.165  61.137  1.00 70.61  ? 669  THR A CB    1 
ATOM   5978  O  OG1   . THR D 4  669  ? -19.790 -3.322  60.658  1.00 79.18  ? 669  THR A OG1   1 
ATOM   5979  C  CG2   . THR D 4  669  ? -17.732 -4.411  60.019  1.00 75.03  ? 669  THR A CG2   1 
ATOM   5980  N  N     . ILE D 4  670  ? -21.532 -5.305  62.681  1.00 70.62  ? 670  ILE A N     1 
ATOM   5981  C  CA    . ILE D 4  670  ? -22.459 -4.967  63.754  1.00 78.48  ? 670  ILE A CA    1 
ATOM   5982  C  C     . ILE D 4  670  ? -22.588 -6.139  64.716  1.00 87.28  ? 670  ILE A C     1 
ATOM   5983  O  O     . ILE D 4  670  ? -22.725 -7.296  64.303  1.00 108.19 ? 670  ILE A O     1 
ATOM   5984  C  CB    . ILE D 4  670  ? -23.829 -4.569  63.177  1.00 69.94  ? 670  ILE A CB    1 
ATOM   5985  C  CG1   . ILE D 4  670  ? -23.652 -3.510  62.089  1.00 64.11  ? 670  ILE A CG1   1 
ATOM   5986  C  CG2   . ILE D 4  670  ? -24.753 -4.076  64.285  1.00 68.77  ? 670  ILE A CG2   1 
ATOM   5987  C  CD1   . ILE D 4  670  ? -24.943 -2.908  61.603  1.00 64.58  ? 670  ILE A CD1   1 
ATOM   5988  N  N     . ALA D 4  671  ? -22.545 -5.838  66.008  1.00 80.33  ? 671  ALA A N     1 
ATOM   5989  C  CA    . ALA D 4  671  ? -22.792 -6.808  67.061  1.00 67.20  ? 671  ALA A CA    1 
ATOM   5990  C  C     . ALA D 4  671  ? -24.157 -6.545  67.683  1.00 68.37  ? 671  ALA A C     1 
ATOM   5991  O  O     . ALA D 4  671  ? -24.810 -5.537  67.401  1.00 68.28  ? 671  ALA A O     1 
ATOM   5992  C  CB    . ALA D 4  671  ? -21.688 -6.750  68.120  1.00 78.55  ? 671  ALA A CB    1 
ATOM   5993  N  N     . ASP D 4  672  ? -24.586 -7.471  68.538  1.00 69.53  ? 672  ASP A N     1 
ATOM   5994  C  CA    . ASP D 4  672  ? -25.890 -7.349  69.178  1.00 80.88  ? 672  ASP A CA    1 
ATOM   5995  C  C     . ASP D 4  672  ? -25.995 -6.044  69.955  1.00 107.80 ? 672  ASP A C     1 
ATOM   5996  O  O     . ASP D 4  672  ? -25.010 -5.543  70.505  1.00 122.10 ? 672  ASP A O     1 
ATOM   5997  C  CB    . ASP D 4  672  ? -26.134 -8.530  70.120  1.00 88.80  ? 672  ASP A CB    1 
ATOM   5998  C  CG    . ASP D 4  672  ? -26.759 -9.721  69.422  1.00 116.51 ? 672  ASP A CG    1 
ATOM   5999  O  OD1   . ASP D 4  672  ? -26.010 -10.558 68.876  1.00 128.90 ? 672  ASP A OD1   1 
ATOM   6000  O  OD2   . ASP D 4  672  ? -28.004 -9.827  69.438  1.00 124.89 ? 672  ASP A OD2   1 
ATOM   6001  N  N     . GLY D 4  673  ? -27.199 -5.479  69.973  1.00 128.74 ? 673  GLY A N     1 
ATOM   6002  C  CA    . GLY D 4  673  ? -27.509 -4.365  70.837  1.00 131.66 ? 673  GLY A CA    1 
ATOM   6003  C  C     . GLY D 4  673  ? -27.167 -4.667  72.283  1.00 116.13 ? 673  GLY A C     1 
ATOM   6004  O  O     . GLY D 4  673  ? -26.483 -3.888  72.957  1.00 121.94 ? 673  GLY A O     1 
ATOM   6005  N  N     . PRO D 4  674  ? -27.660 -5.800  72.797  1.00 74.11  ? 674  PRO A N     1 
ATOM   6006  C  CA    . PRO D 4  674  ? -27.194 -6.247  74.119  1.00 74.47  ? 674  PRO A CA    1 
ATOM   6007  C  C     . PRO D 4  674  ? -25.686 -6.397  74.211  1.00 86.51  ? 674  PRO A C     1 
ATOM   6008  O  O     . PRO D 4  674  ? -25.112 -6.127  75.272  1.00 117.60 ? 674  PRO A O     1 
ATOM   6009  C  CB    . PRO D 4  674  ? -27.919 -7.585  74.298  1.00 75.71  ? 674  PRO A CB    1 
ATOM   6010  C  CG    . PRO D 4  674  ? -29.189 -7.396  73.565  1.00 76.18  ? 674  PRO A CG    1 
ATOM   6011  C  CD    . PRO D 4  674  ? -28.850 -6.552  72.360  1.00 76.99  ? 674  PRO A CD    1 
ATOM   6012  N  N     . THR D 4  675  ? -25.018 -6.824  73.134  1.00 72.40  ? 675  THR A N     1 
ATOM   6013  C  CA    . THR D 4  675  ? -23.559 -6.874  73.168  1.00 71.41  ? 675  THR A CA    1 
ATOM   6014  C  C     . THR D 4  675  ? -22.964 -5.474  73.236  1.00 70.53  ? 675  THR A C     1 
ATOM   6015  O  O     . THR D 4  675  ? -22.009 -5.235  73.983  1.00 70.32  ? 675  THR A O     1 
ATOM   6016  C  CB    . THR D 4  675  ? -23.017 -7.630  71.955  1.00 70.56  ? 675  THR A CB    1 
ATOM   6017  O  OG1   . THR D 4  675  ? -23.536 -8.964  71.955  1.00 95.87  ? 675  THR A OG1   1 
ATOM   6018  C  CG2   . THR D 4  675  ? -21.491 -7.686  71.989  1.00 69.60  ? 675  THR A CG2   1 
ATOM   6019  N  N     . MET D 4  676  ? -23.523 -4.532  72.473  1.00 81.87  ? 676  MET A N     1 
ATOM   6020  C  CA    . MET D 4  676  ? -23.039 -3.154  72.521  1.00 103.69 ? 676  MET A CA    1 
ATOM   6021  C  C     . MET D 4  676  ? -23.185 -2.561  73.917  1.00 120.26 ? 676  MET A C     1 
ATOM   6022  O  O     . MET D 4  676  ? -22.278 -1.875  74.406  1.00 123.24 ? 676  MET A O     1 
ATOM   6023  C  CB    . MET D 4  676  ? -23.783 -2.298  71.496  1.00 98.54  ? 676  MET A CB    1 
ATOM   6024  C  CG    . MET D 4  676  ? -23.229 -2.401  70.087  1.00 105.20 ? 676  MET A CG    1 
ATOM   6025  S  SD    . MET D 4  676  ? -21.429 -2.299  70.055  1.00 119.87 ? 676  MET A SD    1 
ATOM   6026  C  CE    . MET D 4  676  ? -21.125 -2.271  68.291  1.00 126.04 ? 676  MET A CE    1 
ATOM   6027  N  N     . ARG D 4  677  ? -24.322 -2.807  74.573  1.00 114.72 ? 677  ARG A N     1 
ATOM   6028  C  CA    . ARG D 4  677  ? -24.518 -2.291  75.924  1.00 93.06  ? 677  ARG A CA    1 
ATOM   6029  C  C     . ARG D 4  677  ? -23.465 -2.844  76.877  1.00 94.28  ? 677  ARG A C     1 
ATOM   6030  O  O     . ARG D 4  677  ? -22.975 -2.127  77.756  1.00 117.89 ? 677  ARG A O     1 
ATOM   6031  C  CB    . ARG D 4  677  ? -25.926 -2.625  76.416  1.00 81.51  ? 677  ARG A CB    1 
ATOM   6032  C  CG    . ARG D 4  677  ? -26.294 -1.953  77.727  1.00 93.82  ? 677  ARG A CG    1 
ATOM   6033  C  CD    . ARG D 4  677  ? -27.638 -2.431  78.260  1.00 122.43 ? 677  ARG A CD    1 
ATOM   6034  N  NE    . ARG D 4  677  ? -28.769 -1.805  77.576  1.00 131.23 ? 677  ARG A NE    1 
ATOM   6035  C  CZ    . ARG D 4  677  ? -29.596 -2.442  76.753  1.00 137.59 ? 677  ARG A CZ    1 
ATOM   6036  N  NH1   . ARG D 4  677  ? -29.428 -3.735  76.505  1.00 140.21 ? 677  ARG A NH1   1 
ATOM   6037  N  NH2   . ARG D 4  677  ? -30.595 -1.788  76.178  1.00 145.99 ? 677  ARG A NH2   1 
ATOM   6038  N  N     . GLU D 4  678  ? -23.100 -4.119  76.713  1.00 92.67  ? 678  GLU A N     1 
ATOM   6039  C  CA    . GLU D 4  678  ? -21.995 -4.675  77.487  1.00 77.97  ? 678  GLU A CA    1 
ATOM   6040  C  C     . GLU D 4  678  ? -20.665 -4.047  77.096  1.00 82.42  ? 678  GLU A C     1 
ATOM   6041  O  O     . GLU D 4  678  ? -19.769 -3.924  77.940  1.00 110.45 ? 678  GLU A O     1 
ATOM   6042  C  CB    . GLU D 4  678  ? -21.920 -6.191  77.306  1.00 78.31  ? 678  GLU A CB    1 
ATOM   6043  C  CG    . GLU D 4  678  ? -22.989 -6.972  78.041  1.00 102.43 ? 678  GLU A CG    1 
ATOM   6044  C  CD    . GLU D 4  678  ? -22.515 -8.358  78.433  1.00 126.20 ? 678  GLU A CD    1 
ATOM   6045  O  OE1   . GLU D 4  678  ? -21.326 -8.499  78.793  1.00 131.07 ? 678  GLU A OE1   1 
ATOM   6046  O  OE2   . GLU D 4  678  ? -23.326 -9.306  78.378  1.00 132.05 ? 678  GLU A OE2   1 
ATOM   6047  N  N     . ILE D 4  679  ? -20.512 -3.656  75.829  1.00 70.16  ? 679  ILE A N     1 
ATOM   6048  C  CA    . ILE D 4  679  ? -19.245 -3.096  75.370  1.00 85.55  ? 679  ILE A CA    1 
ATOM   6049  C  C     . ILE D 4  679  ? -18.995 -1.740  76.018  1.00 90.79  ? 679  ILE A C     1 
ATOM   6050  O  O     . ILE D 4  679  ? -17.919 -1.487  76.572  1.00 95.38  ? 679  ILE A O     1 
ATOM   6051  C  CB    . ILE D 4  679  ? -19.224 -2.999  73.833  1.00 87.08  ? 679  ILE A CB    1 
ATOM   6052  C  CG1   . ILE D 4  679  ? -19.162 -4.391  73.208  1.00 67.80  ? 679  ILE A CG1   1 
ATOM   6053  C  CG2   . ILE D 4  679  ? -18.038 -2.168  73.369  1.00 95.90  ? 679  ILE A CG2   1 
ATOM   6054  C  CD1   . ILE D 4  679  ? -17.878 -5.116  73.480  1.00 74.67  ? 679  ILE A CD1   1 
ATOM   6055  N  N     . THR D 4  680  ? -19.985 -0.846  75.957  1.00 109.77 ? 680  THR A N     1 
ATOM   6056  C  CA    . THR D 4  680  ? -19.817 0.473   76.557  1.00 116.30 ? 680  THR A CA    1 
ATOM   6057  C  C     . THR D 4  680  ? -19.761 0.392   78.079  1.00 125.01 ? 680  THR A C     1 
ATOM   6058  O  O     . THR D 4  680  ? -19.139 1.247   78.720  1.00 127.77 ? 680  THR A O     1 
ATOM   6059  C  CB    . THR D 4  680  ? -20.942 1.408   76.102  1.00 108.40 ? 680  THR A CB    1 
ATOM   6060  O  OG1   . THR D 4  680  ? -20.814 2.674   76.762  1.00 115.96 ? 680  THR A OG1   1 
ATOM   6061  C  CG2   . THR D 4  680  ? -22.305 0.807   76.421  1.00 97.27  ? 680  THR A CG2   1 
ATOM   6062  N  N     . GLU D 4  681  ? -20.394 -0.624  78.672  1.00 125.92 ? 681  GLU A N     1 
ATOM   6063  C  CA    . GLU D 4  681  ? -20.209 -0.872  80.098  1.00 115.47 ? 681  GLU A CA    1 
ATOM   6064  C  C     . GLU D 4  681  ? -18.762 -1.235  80.400  1.00 113.63 ? 681  GLU A C     1 
ATOM   6065  O  O     . GLU D 4  681  ? -18.175 -0.730  81.364  1.00 107.91 ? 681  GLU A O     1 
ATOM   6066  C  CB    . GLU D 4  681  ? -21.142 -1.988  80.570  1.00 122.61 ? 681  GLU A CB    1 
ATOM   6067  C  CG    . GLU D 4  681  ? -20.654 -2.699  81.827  1.00 143.50 ? 681  GLU A CG    1 
ATOM   6068  C  CD    . GLU D 4  681  ? -21.349 -4.025  82.065  1.00 160.22 ? 681  GLU A CD    1 
ATOM   6069  O  OE1   . GLU D 4  681  ? -22.437 -4.240  81.492  1.00 165.08 ? 681  GLU A OE1   1 
ATOM   6070  O  OE2   . GLU D 4  681  ? -20.805 -4.852  82.828  1.00 161.48 ? 681  GLU A OE2   1 
ATOM   6071  N  N     . THR D 4  682  ? -18.173 -2.109  79.580  1.00 125.77 ? 682  THR A N     1 
ATOM   6072  C  CA    . THR D 4  682  ? -16.782 -2.506  79.778  1.00 121.66 ? 682  THR A CA    1 
ATOM   6073  C  C     . THR D 4  682  ? -15.843 -1.311  79.665  1.00 117.71 ? 682  THR A C     1 
ATOM   6074  O  O     . THR D 4  682  ? -14.850 -1.223  80.397  1.00 125.66 ? 682  THR A O     1 
ATOM   6075  C  CB    . THR D 4  682  ? -16.398 -3.586  78.765  1.00 133.85 ? 682  THR A CB    1 
ATOM   6076  O  OG1   . THR D 4  682  ? -17.352 -4.655  78.815  1.00 148.54 ? 682  THR A OG1   1 
ATOM   6077  C  CG2   . THR D 4  682  ? -15.012 -4.142  79.065  1.00 128.89 ? 682  THR A CG2   1 
ATOM   6078  N  N     . ILE D 4  683  ? -16.138 -0.379  78.755  1.00 115.93 ? 683  ILE A N     1 
ATOM   6079  C  CA    . ILE D 4  683  ? -15.311 0.818   78.621  1.00 120.57 ? 683  ILE A CA    1 
ATOM   6080  C  C     . ILE D 4  683  ? -15.439 1.696   79.861  1.00 121.32 ? 683  ILE A C     1 
ATOM   6081  O  O     . ILE D 4  683  ? -14.436 2.098   80.463  1.00 121.26 ? 683  ILE A O     1 
ATOM   6082  C  CB    . ILE D 4  683  ? -15.681 1.592   77.343  1.00 114.30 ? 683  ILE A CB    1 
ATOM   6083  C  CG1   . ILE D 4  683  ? -15.452 0.725   76.103  1.00 112.24 ? 683  ILE A CG1   1 
ATOM   6084  C  CG2   . ILE D 4  683  ? -14.872 2.877   77.246  1.00 98.69  ? 683  ILE A CG2   1 
ATOM   6085  C  CD1   . ILE D 4  683  ? -13.993 0.418   75.835  1.00 101.01 ? 683  ILE A CD1   1 
ATOM   6086  N  N     . ALA D 4  684  ? -16.675 1.999   80.266  1.00 127.34 ? 684  ALA A N     1 
ATOM   6087  C  CA    . ALA D 4  684  ? -16.883 2.851   81.433  1.00 124.45 ? 684  ALA A CA    1 
ATOM   6088  C  C     . ALA D 4  684  ? -16.407 2.179   82.716  1.00 116.10 ? 684  ALA A C     1 
ATOM   6089  O  O     . ALA D 4  684  ? -15.992 2.867   83.656  1.00 91.35  ? 684  ALA A O     1 
ATOM   6090  C  CB    . ALA D 4  684  ? -18.359 3.238   81.547  1.00 113.78 ? 684  ALA A CB    1 
ATOM   6091  N  N     . GLU D 4  685  ? -16.457 0.846   82.776  1.00 102.05 ? 685  GLU A N     1 
ATOM   6092  C  CA    . GLU D 4  685  ? -15.917 0.139   83.933  1.00 103.75 ? 685  GLU A CA    1 
ATOM   6093  C  C     . GLU D 4  685  ? -14.419 0.380   84.068  1.00 97.18  ? 685  GLU A C     1 
ATOM   6094  O  O     . GLU D 4  685  ? -13.913 0.598   85.175  1.00 101.10 ? 685  GLU A O     1 
ATOM   6095  C  CB    . GLU D 4  685  ? -16.219 -1.356  83.820  1.00 117.95 ? 685  GLU A CB    1 
ATOM   6096  C  CG    . GLU D 4  685  ? -15.227 -2.263  84.526  1.00 124.42 ? 685  GLU A CG    1 
ATOM   6097  C  CD    . GLU D 4  685  ? -15.543 -3.734  84.322  1.00 133.06 ? 685  GLU A CD    1 
ATOM   6098  O  OE1   . GLU D 4  685  ? -16.727 -4.113  84.446  1.00 134.73 ? 685  GLU A OE1   1 
ATOM   6099  O  OE2   . GLU D 4  685  ? -14.608 -4.509  84.032  1.00 140.56 ? 685  GLU A OE2   1 
ATOM   6100  N  N     . ALA D 4  686  ? -13.691 0.352   82.949  1.00 96.12  ? 686  ALA A N     1 
ATOM   6101  C  CA    . ALA D 4  686  ? -12.273 0.684   82.991  1.00 83.34  ? 686  ALA A CA    1 
ATOM   6102  C  C     . ALA D 4  686  ? -12.054 2.178   83.183  1.00 77.78  ? 686  ALA A C     1 
ATOM   6103  O  O     . ALA D 4  686  ? -10.998 2.587   83.677  1.00 93.63  ? 686  ALA A O     1 
ATOM   6104  C  CB    . ALA D 4  686  ? -11.579 0.208   81.716  1.00 80.43  ? 686  ALA A CB    1 
ATOM   6105  N  N     . LYS D 4  687  ? -13.032 3.003   82.799  1.00 90.56  ? 687  LYS A N     1 
ATOM   6106  C  CA    . LYS D 4  687  ? -12.902 4.444   82.993  1.00 111.73 ? 687  LYS A CA    1 
ATOM   6107  C  C     . LYS D 4  687  ? -12.873 4.800   84.474  1.00 113.27 ? 687  LYS A C     1 
ATOM   6108  O  O     . LYS D 4  687  ? -12.086 5.654   84.900  1.00 113.73 ? 687  LYS A O     1 
ATOM   6109  C  CB    . LYS D 4  687  ? -14.041 5.181   82.287  1.00 112.99 ? 687  LYS A CB    1 
ATOM   6110  C  CG    . LYS D 4  687  ? -13.863 5.301   80.780  1.00 104.90 ? 687  LYS A CG    1 
ATOM   6111  C  CD    . LYS D 4  687  ? -14.392 6.628   80.250  1.00 101.54 ? 687  LYS A CD    1 
ATOM   6112  C  CE    . LYS D 4  687  ? -15.802 6.483   79.696  1.00 93.71  ? 687  LYS A CE    1 
ATOM   6113  N  NZ    . LYS D 4  687  ? -16.199 7.640   78.844  1.00 75.21  ? 687  LYS A NZ    1 
ATOM   6114  N  N     . LYS D 4  688  ? -13.731 4.161   85.273  1.00 113.88 ? 688  LYS A N     1 
ATOM   6115  C  CA    . LYS D 4  688  ? -13.724 4.410   86.711  1.00 102.33 ? 688  LYS A CA    1 
ATOM   6116  C  C     . LYS D 4  688  ? -12.442 3.897   87.354  1.00 83.93  ? 688  LYS A C     1 
ATOM   6117  O  O     . LYS D 4  688  ? -11.939 4.499   88.309  1.00 99.63  ? 688  LYS A O     1 
ATOM   6118  C  CB    . LYS D 4  688  ? -14.946 3.765   87.363  1.00 112.61 ? 688  LYS A CB    1 
ATOM   6119  C  CG    . LYS D 4  688  ? -15.948 4.766   87.913  1.00 120.56 ? 688  LYS A CG    1 
ATOM   6120  C  CD    . LYS D 4  688  ? -16.437 5.711   86.821  1.00 115.71 ? 688  LYS A CD    1 
ATOM   6121  C  CE    . LYS D 4  688  ? -17.209 4.963   85.743  1.00 107.47 ? 688  LYS A CE    1 
ATOM   6122  N  NZ    . LYS D 4  688  ? -17.699 5.867   84.666  1.00 117.77 ? 688  LYS A NZ    1 
ATOM   6123  N  N     . LYS D 4  689  ? -11.906 2.783   86.849  1.00 75.88  ? 689  LYS A N     1 
ATOM   6124  C  CA    . LYS D 4  689  ? -10.612 2.295   87.320  1.00 87.42  ? 689  LYS A CA    1 
ATOM   6125  C  C     . LYS D 4  689  ? -9.519  3.335   87.105  1.00 80.69  ? 689  LYS A C     1 
ATOM   6126  O  O     . LYS D 4  689  ? -8.678  3.556   87.983  1.00 99.13  ? 689  LYS A O     1 
ATOM   6127  C  CB    . LYS D 4  689  ? -10.248 0.995   86.600  1.00 83.58  ? 689  LYS A CB    1 
ATOM   6128  C  CG    . LYS D 4  689  ? -10.618 -0.284  87.336  1.00 82.14  ? 689  LYS A CG    1 
ATOM   6129  C  CD    . LYS D 4  689  ? -9.980  -1.483  86.648  1.00 92.85  ? 689  LYS A CD    1 
ATOM   6130  C  CE    . LYS D 4  689  ? -10.317 -2.787  87.353  1.00 111.65 ? 689  LYS A CE    1 
ATOM   6131  N  NZ    . LYS D 4  689  ? -9.585  -3.943  86.757  1.00 107.27 ? 689  LYS A NZ    1 
ATOM   6132  N  N     . VAL D 4  690  ? -9.516  3.978   85.936  1.00 72.21  ? 690  VAL A N     1 
ATOM   6133  C  CA    . VAL D 4  690  ? -8.532  5.019   85.651  1.00 71.66  ? 690  VAL A CA    1 
ATOM   6134  C  C     . VAL D 4  690  ? -8.718  6.198   86.598  1.00 72.58  ? 690  VAL A C     1 
ATOM   6135  O  O     . VAL D 4  690  ? -7.749  6.739   87.143  1.00 72.86  ? 690  VAL A O     1 
ATOM   6136  C  CB    . VAL D 4  690  ? -8.631  5.452   84.178  1.00 70.37  ? 690  VAL A CB    1 
ATOM   6137  C  CG1   . VAL D 4  690  ? -7.771  6.678   83.912  1.00 69.95  ? 690  VAL A CG1   1 
ATOM   6138  C  CG2   . VAL D 4  690  ? -8.221  4.305   83.273  1.00 69.50  ? 690  VAL A CG2   1 
ATOM   6139  N  N     . LEU D 4  691  ? -9.971  6.612   86.806  1.00 73.12  ? 691  LEU A N     1 
ATOM   6140  C  CA    . LEU D 4  691  ? -10.243 7.733   87.701  1.00 74.09  ? 691  LEU A CA    1 
ATOM   6141  C  C     . LEU D 4  691  ? -9.794  7.425   89.122  1.00 81.22  ? 691  LEU A C     1 
ATOM   6142  O  O     . LEU D 4  691  ? -9.190  8.272   89.788  1.00 96.27  ? 691  LEU A O     1 
ATOM   6143  C  CB    . LEU D 4  691  ? -11.733 8.081   87.669  1.00 74.54  ? 691  LEU A CB    1 
ATOM   6144  C  CG    . LEU D 4  691  ? -12.227 9.146   88.652  1.00 75.72  ? 691  LEU A CG    1 
ATOM   6145  C  CD1   . LEU D 4  691  ? -13.134 10.137  87.944  1.00 77.75  ? 691  LEU A CD1   1 
ATOM   6146  C  CD2   . LEU D 4  691  ? -12.962 8.514   89.826  1.00 77.08  ? 691  LEU A CD2   1 
ATOM   6147  N  N     . ASP D 4  692  ? -10.071 6.209   89.597  1.00 75.81  ? 692  ASP A N     1 
ATOM   6148  C  CA    . ASP D 4  692  ? -9.742  5.852   90.973  1.00 77.07  ? 692  ASP A CA    1 
ATOM   6149  C  C     . ASP D 4  692  ? -8.235  5.800   91.189  1.00 76.88  ? 692  ASP A C     1 
ATOM   6150  O  O     . ASP D 4  692  ? -7.721  6.366   92.160  1.00 92.55  ? 692  ASP A O     1 
ATOM   6151  C  CB    . ASP D 4  692  ? -10.389 4.515   91.326  1.00 77.62  ? 692  ASP A CB    1 
ATOM   6152  C  CG    . ASP D 4  692  ? -11.895 4.614   91.440  1.00 83.05  ? 692  ASP A CG    1 
ATOM   6153  O  OD1   . ASP D 4  692  ? -12.404 5.746   91.591  1.00 86.96  ? 692  ASP A OD1   1 
ATOM   6154  O  OD2   . ASP D 4  692  ? -12.570 3.566   91.371  1.00 82.51  ? 692  ASP A OD2   1 
ATOM   6155  N  N     . VAL D 4  693  ? -7.509  5.125   90.295  1.00 75.80  ? 693  VAL A N     1 
ATOM   6156  C  CA    . VAL D 4  693  ? -6.054  5.073   90.411  1.00 75.61  ? 693  VAL A CA    1 
ATOM   6157  C  C     . VAL D 4  693  ? -5.456  6.467   90.279  1.00 75.41  ? 693  VAL A C     1 
ATOM   6158  O  O     . VAL D 4  693  ? -4.449  6.784   90.925  1.00 81.67  ? 693  VAL A O     1 
ATOM   6159  C  CB    . VAL D 4  693  ? -5.473  4.094   89.372  1.00 75.21  ? 693  VAL A CB    1 
ATOM   6160  C  CG1   . VAL D 4  693  ? -3.984  4.346   89.150  1.00 74.01  ? 693  VAL A CG1   1 
ATOM   6161  C  CG2   . VAL D 4  693  ? -5.715  2.655   89.815  1.00 78.13  ? 693  VAL A CG2   1 
ATOM   6162  N  N     . THR D 4  694  ? -6.069  7.329   89.463  1.00 88.99  ? 694  THR A N     1 
ATOM   6163  C  CA    . THR D 4  694  ? -5.638  8.722   89.412  1.00 81.73  ? 694  THR A CA    1 
ATOM   6164  C  C     . THR D 4  694  ? -5.798  9.393   90.771  1.00 90.77  ? 694  THR A C     1 
ATOM   6165  O  O     . THR D 4  694  ? -4.895  10.098  91.234  1.00 104.38 ? 694  THR A O     1 
ATOM   6166  C  CB    . THR D 4  694  ? -6.424  9.485   88.346  1.00 73.95  ? 694  THR A CB    1 
ATOM   6167  O  OG1   . THR D 4  694  ? -6.235  8.859   87.071  1.00 72.64  ? 694  THR A OG1   1 
ATOM   6168  C  CG2   . THR D 4  694  ? -5.953  10.930  88.270  1.00 73.99  ? 694  THR A CG2   1 
ATOM   6169  N  N     . LYS D 4  695  ? -6.941  9.175   91.428  1.00 97.62  ? 695  LYS A N     1 
ATOM   6170  C  CA    . LYS D 4  695  ? -7.143  9.721   92.767  1.00 93.96  ? 695  LYS A CA    1 
ATOM   6171  C  C     . LYS D 4  695  ? -6.085  9.207   93.735  1.00 85.32  ? 695  LYS A C     1 
ATOM   6172  O  O     . LYS D 4  695  ? -5.610  9.952   94.600  1.00 85.17  ? 695  LYS A O     1 
ATOM   6173  C  CB    . LYS D 4  695  ? -8.545  9.369   93.270  1.00 103.66 ? 695  LYS A CB    1 
ATOM   6174  C  CG    . LYS D 4  695  ? -9.672  9.890   92.391  1.00 100.26 ? 695  LYS A CG    1 
ATOM   6175  C  CD    . LYS D 4  695  ? -10.290 11.159  92.953  1.00 105.22 ? 695  LYS A CD    1 
ATOM   6176  C  CE    . LYS D 4  695  ? -11.446 10.829  93.882  1.00 114.54 ? 695  LYS A CE    1 
ATOM   6177  N  NZ    . LYS D 4  695  ? -12.511 10.062  93.177  1.00 113.72 ? 695  LYS A NZ    1 
ATOM   6178  N  N     . GLU D 4  696  ? -5.704  7.934   93.600  1.00 80.14  ? 696  GLU A N     1 
ATOM   6179  C  CA    . GLU D 4  696  ? -4.666  7.372   94.457  1.00 91.52  ? 696  GLU A CA    1 
ATOM   6180  C  C     . GLU D 4  696  ? -3.353  8.128   94.298  1.00 102.41 ? 696  GLU A C     1 
ATOM   6181  O  O     . GLU D 4  696  ? -2.668  8.415   95.287  1.00 119.74 ? 696  GLU A O     1 
ATOM   6182  C  CB    . GLU D 4  696  ? -4.472  5.888   94.141  1.00 112.22 ? 696  GLU A CB    1 
ATOM   6183  C  CG    . GLU D 4  696  ? -5.426  4.959   94.875  1.00 132.73 ? 696  GLU A CG    1 
ATOM   6184  C  CD    . GLU D 4  696  ? -5.077  3.493   94.685  1.00 131.84 ? 696  GLU A CD    1 
ATOM   6185  O  OE1   . GLU D 4  696  ? -5.945  2.728   94.210  1.00 131.61 ? 696  GLU A OE1   1 
ATOM   6186  O  OE2   . GLU D 4  696  ? -3.937  3.104   95.017  1.00 131.86 ? 696  GLU A OE2   1 
ATOM   6187  N  N     . ALA D 4  697  ? -2.987  8.464   93.059  1.00 78.06  ? 697  ALA A N     1 
ATOM   6188  C  CA    . ALA D 4  697  ? -1.757  9.214   92.837  1.00 77.82  ? 697  ALA A CA    1 
ATOM   6189  C  C     . ALA D 4  697  ? -1.905  10.675  93.245  1.00 78.48  ? 697  ALA A C     1 
ATOM   6190  O  O     . ALA D 4  697  ? -0.910  11.317  93.596  1.00 78.92  ? 697  ALA A O     1 
ATOM   6191  C  CB    . ALA D 4  697  ? -1.336  9.111   91.372  1.00 76.27  ? 697  ALA A CB    1 
ATOM   6192  N  N     . GLN D 4  698  ? -3.130  11.211  93.207  1.00 102.54 ? 698  GLN A N     1 
ATOM   6193  C  CA    . GLN D 4  698  ? -3.347  12.610  93.568  1.00 104.79 ? 698  GLN A CA    1 
ATOM   6194  C  C     . GLN D 4  698  ? -3.127  12.859  95.054  1.00 109.06 ? 698  GLN A C     1 
ATOM   6195  O  O     . GLN D 4  698  ? -2.639  13.930  95.433  1.00 112.90 ? 698  GLN A O     1 
ATOM   6196  C  CB    . GLN D 4  698  ? -4.762  13.044  93.177  1.00 118.50 ? 698  GLN A CB    1 
ATOM   6197  C  CG    . GLN D 4  698  ? -4.984  13.206  91.682  1.00 119.81 ? 698  GLN A CG    1 
ATOM   6198  C  CD    . GLN D 4  698  ? -6.391  13.657  91.345  1.00 111.88 ? 698  GLN A CD    1 
ATOM   6199  O  OE1   . GLN D 4  698  ? -7.238  13.813  92.228  1.00 106.12 ? 698  GLN A OE1   1 
ATOM   6200  N  NE2   . GLN D 4  698  ? -6.648  13.869  90.059  1.00 93.87  ? 698  GLN A NE2   1 
ATOM   6201  N  N     . ALA D 4  699  ? -3.476  11.894  95.905  1.00 111.42 ? 699  ALA A N     1 
ATOM   6202  C  CA    . ALA D 4  699  ? -3.328  12.020  97.348  1.00 106.80 ? 699  ALA A CA    1 
ATOM   6203  C  C     . ALA D 4  699  ? -1.982  11.518  97.855  1.00 99.26  ? 699  ALA A C     1 
ATOM   6204  O  O     . ALA D 4  699  ? -1.803  11.394  99.071  1.00 108.81 ? 699  ALA A O     1 
ATOM   6205  C  CB    . ALA D 4  699  ? -4.460  11.270  98.056  1.00 97.54  ? 699  ALA A CB    1 
ATOM   6206  N  N     . ASN D 4  700  ? -1.039  11.230  96.955  1.00 84.41  ? 700  ASN A N     1 
ATOM   6207  C  CA    . ASN D 4  700  ? 0.287   10.718  97.316  1.00 87.39  ? 700  ASN A CA    1 
ATOM   6208  C  C     . ASN D 4  700  ? 0.168   9.466   98.183  1.00 91.27  ? 700  ASN A C     1 
ATOM   6209  O  O     . ASN D 4  700  ? 0.959   9.235   99.101  1.00 105.27 ? 700  ASN A O     1 
ATOM   6210  C  CB    . ASN D 4  700  ? 1.128   11.793  98.011  1.00 96.26  ? 700  ASN A CB    1 
ATOM   6211  C  CG    . ASN D 4  700  ? 2.628   11.543  97.882  1.00 95.45  ? 700  ASN A CG    1 
ATOM   6212  O  OD1   . ASN D 4  700  ? 3.071   10.409  97.695  1.00 101.61 ? 700  ASN A OD1   1 
ATOM   6213  N  ND2   . ASN D 4  700  ? 3.415   12.610  97.988  1.00 85.96  ? 700  ASN A ND2   1 
ATOM   6214  N  N     . LEU D 4  701  ? -0.847  8.657   97.895  1.00 98.24  ? 701  LEU A N     1 
ATOM   6215  C  CA    . LEU D 4  701  ? -1.045  7.382   98.565  1.00 111.07 ? 701  LEU A CA    1 
ATOM   6216  C  C     . LEU D 4  701  ? -0.594  6.204   97.714  1.00 119.31 ? 701  LEU A C     1 
ATOM   6217  O  O     . LEU D 4  701  ? -0.772  5.053   98.124  1.00 131.22 ? 701  LEU A O     1 
ATOM   6218  C  CB    . LEU D 4  701  ? -2.518  7.211   98.953  1.00 104.32 ? 701  LEU A CB    1 
ATOM   6219  C  CG    . LEU D 4  701  ? -3.120  8.364   99.757  1.00 104.42 ? 701  LEU A CG    1 
ATOM   6220  C  CD1   . LEU D 4  701  ? -4.556  8.057   100.153 1.00 106.21 ? 701  LEU A CD1   1 
ATOM   6221  C  CD2   . LEU D 4  701  ? -2.270  8.664   100.984 1.00 113.67 ? 701  LEU A CD2   1 
ATOM   6222  N  N     . LEU D 4  702  ? -0.008  6.469   96.549  1.00 105.23 ? 702  LEU A N     1 
ATOM   6223  C  CA    . LEU D 4  702  ? 0.443   5.416   95.649  1.00 111.25 ? 702  LEU A CA    1 
ATOM   6224  C  C     . LEU D 4  702  ? 1.819   4.924   96.076  1.00 116.71 ? 702  LEU A C     1 
ATOM   6225  O  O     . LEU D 4  702  ? 2.771   5.708   96.154  1.00 110.93 ? 702  LEU A O     1 
ATOM   6226  C  CB    . LEU D 4  702  ? 0.486   5.923   94.209  1.00 123.96 ? 702  LEU A CB    1 
ATOM   6227  C  CG    . LEU D 4  702  ? -0.691  5.572   93.295  1.00 127.21 ? 702  LEU A CG    1 
ATOM   6228  C  CD1   . LEU D 4  702  ? -0.280  5.661   91.831  1.00 110.90 ? 702  LEU A CD1   1 
ATOM   6229  C  CD2   . LEU D 4  702  ? -1.222  4.186   93.617  1.00 141.58 ? 702  LEU A CD2   1 
ATOM   6230  N  N     . THR D 4  703  ? 1.922   3.627   96.351  1.00 132.89 ? 703  THR A N     1 
ATOM   6231  C  CA    . THR D 4  703  ? 3.219   3.015   96.598  1.00 142.71 ? 703  THR A CA    1 
ATOM   6232  C  C     . THR D 4  703  ? 4.046   3.060   95.321  1.00 154.09 ? 703  THR A C     1 
ATOM   6233  O  O     . THR D 4  703  ? 3.606   2.580   94.270  1.00 130.39 ? 703  THR A O     1 
ATOM   6234  C  CB    . THR D 4  703  ? 3.047   1.576   97.077  1.00 131.71 ? 703  THR A CB    1 
ATOM   6235  O  OG1   . THR D 4  703  ? 2.279   1.560   98.286  1.00 133.22 ? 703  THR A OG1   1 
ATOM   6236  C  CG2   . THR D 4  703  ? 4.403   0.932   97.331  1.00 124.79 ? 703  THR A CG2   1 
ATOM   6237  N  N     . ALA D 4  704  ? 5.233   3.648   95.404  1.00 181.95 ? 704  ALA A N     1 
ATOM   6238  C  CA    . ALA D 4  704  ? 6.108   3.727   94.244  1.00 174.11 ? 704  ALA A CA    1 
ATOM   6239  C  C     . ALA D 4  704  ? 6.697   2.353   93.955  1.00 171.77 ? 704  ALA A C     1 
ATOM   6240  O  O     . ALA D 4  704  ? 7.387   1.776   94.803  1.00 180.45 ? 704  ALA A O     1 
ATOM   6241  C  CB    . ALA D 4  704  ? 7.215   4.750   94.483  1.00 178.50 ? 704  ALA A CB    1 
ATOM   6242  N  N     . LYS D 4  705  ? 6.410   1.820   92.770  1.00 167.89 ? 705  LYS A N     1 
ATOM   6243  C  CA    . LYS D 4  705  ? 7.020   0.564   92.358  1.00 165.71 ? 705  LYS A CA    1 
ATOM   6244  C  C     . LYS D 4  705  ? 8.532   0.727   92.280  1.00 172.66 ? 705  LYS A C     1 
ATOM   6245  O  O     . LYS D 4  705  ? 9.047   1.807   91.977  1.00 181.28 ? 705  LYS A O     1 
ATOM   6246  C  CB    . LYS D 4  705  ? 6.469   0.116   91.003  1.00 149.98 ? 705  LYS A CB    1 
ATOM   6247  C  CG    . LYS D 4  705  ? 4.952   0.135   90.900  1.00 131.72 ? 705  LYS A CG    1 
ATOM   6248  C  CD    . LYS D 4  705  ? 4.496   -0.203  89.488  1.00 118.32 ? 705  LYS A CD    1 
ATOM   6249  C  CE    . LYS D 4  705  ? 2.993   -0.042  89.331  1.00 116.66 ? 705  LYS A CE    1 
ATOM   6250  N  NZ    . LYS D 4  705  ? 2.223   -0.998  90.174  1.00 118.71 ? 705  LYS A NZ    1 
ATOM   6251  N  N     . HIS D 4  706  ? 9.249   -0.358  92.564  1.00 158.56 ? 706  HIS A N     1 
ATOM   6252  C  CA    . HIS D 4  706  ? 10.702  -0.285  92.617  1.00 142.01 ? 706  HIS A CA    1 
ATOM   6253  C  C     . HIS D 4  706  ? 11.278  -0.011  91.234  1.00 128.91 ? 706  HIS A C     1 
ATOM   6254  O  O     . HIS D 4  706  ? 10.868  -0.616  90.239  1.00 132.88 ? 706  HIS A O     1 
ATOM   6255  C  CB    . HIS D 4  706  ? 11.294  -1.577  93.179  1.00 136.48 ? 706  HIS A CB    1 
ATOM   6256  C  CG    . HIS D 4  706  ? 12.785  -1.543  93.314  1.00 141.06 ? 706  HIS A CG    1 
ATOM   6257  N  ND1   . HIS D 4  706  ? 13.456  -0.480  93.880  1.00 147.08 ? 706  HIS A ND1   1 
ATOM   6258  C  CD2   . HIS D 4  706  ? 13.736  -2.437  92.953  1.00 143.54 ? 706  HIS A CD2   1 
ATOM   6259  C  CE1   . HIS D 4  706  ? 14.755  -0.722  93.864  1.00 145.06 ? 706  HIS A CE1   1 
ATOM   6260  N  NE2   . HIS D 4  706  ? 14.951  -1.903  93.306  1.00 143.39 ? 706  HIS A NE2   1 
ATOM   6261  N  N     . GLY D 4  707  ? 12.227  0.921   91.177  1.00 119.95 ? 707  GLY A N     1 
ATOM   6262  C  CA    . GLY D 4  707  ? 12.945  1.222   89.959  1.00 104.22 ? 707  GLY A CA    1 
ATOM   6263  C  C     . GLY D 4  707  ? 12.265  2.182   89.011  1.00 117.15 ? 707  GLY A C     1 
ATOM   6264  O  O     . GLY D 4  707  ? 12.833  2.480   87.953  1.00 114.94 ? 707  GLY A O     1 
ATOM   6265  N  N     . MET D 4  708  ? 11.079  2.689   89.343  1.00 132.25 ? 708  MET A N     1 
ATOM   6266  C  CA    . MET D 4  708  ? 10.367  3.578   88.436  1.00 133.66 ? 708  MET A CA    1 
ATOM   6267  C  C     . MET D 4  708  ? 9.726   4.723   89.208  1.00 121.33 ? 708  MET A C     1 
ATOM   6268  O  O     . MET D 4  708  ? 9.482   4.636   90.414  1.00 114.90 ? 708  MET A O     1 
ATOM   6269  C  CB    . MET D 4  708  ? 9.299   2.828   87.631  1.00 142.28 ? 708  MET A CB    1 
ATOM   6270  C  CG    . MET D 4  708  ? 8.328   2.025   88.474  1.00 146.45 ? 708  MET A CG    1 
ATOM   6271  S  SD    . MET D 4  708  ? 6.983   1.349   87.483  1.00 144.15 ? 708  MET A SD    1 
ATOM   6272  C  CE    . MET D 4  708  ? 7.904   0.558   86.168  1.00 137.24 ? 708  MET A CE    1 
ATOM   6273  N  N     . THR D 4  709  ? 9.459   5.805   88.478  1.00 103.43 ? 709  THR A N     1 
ATOM   6274  C  CA    . THR D 4  709  ? 8.799   6.976   89.033  1.00 105.69 ? 709  THR A CA    1 
ATOM   6275  C  C     . THR D 4  709  ? 7.373   6.628   89.451  1.00 99.09  ? 709  THR A C     1 
ATOM   6276  O  O     . THR D 4  709  ? 6.759   5.683   88.944  1.00 117.50 ? 709  THR A O     1 
ATOM   6277  C  CB    . THR D 4  709  ? 8.768   8.110   88.002  1.00 96.90  ? 709  THR A CB    1 
ATOM   6278  O  OG1   . THR D 4  709  ? 10.073  8.284   87.433  1.00 102.56 ? 709  THR A OG1   1 
ATOM   6279  C  CG2   . THR D 4  709  ? 8.334   9.421   88.637  1.00 90.21  ? 709  THR A CG2   1 
ATOM   6280  N  N     . LEU D 4  710  ? 6.849   7.397   90.408  1.00 85.26  ? 710  LEU A N     1 
ATOM   6281  C  CA    . LEU D 4  710  ? 5.420   7.337   90.699  1.00 92.43  ? 710  LEU A CA    1 
ATOM   6282  C  C     . LEU D 4  710  ? 4.601   7.651   89.452  1.00 96.98  ? 710  LEU A C     1 
ATOM   6283  O  O     . LEU D 4  710  ? 3.575   7.011   89.194  1.00 109.17 ? 710  LEU A O     1 
ATOM   6284  C  CB    . LEU D 4  710  ? 5.067   8.304   91.829  1.00 97.10  ? 710  LEU A CB    1 
ATOM   6285  C  CG    . LEU D 4  710  ? 5.647   8.040   93.222  1.00 99.26  ? 710  LEU A CG    1 
ATOM   6286  C  CD1   . LEU D 4  710  ? 7.043   8.636   93.366  1.00 95.54  ? 710  LEU A CD1   1 
ATOM   6287  C  CD2   . LEU D 4  710  ? 4.714   8.583   94.295  1.00 106.59 ? 710  LEU A CD2   1 
ATOM   6288  N  N     . ARG D 4  711  ? 5.046   8.633   88.664  1.00 85.33  ? 711  ARG A N     1 
ATOM   6289  C  CA    . ARG D 4  711  ? 4.356   8.964   87.423  1.00 93.53  ? 711  ARG A CA    1 
ATOM   6290  C  C     . ARG D 4  711  ? 4.477   7.829   86.412  1.00 89.77  ? 711  ARG A C     1 
ATOM   6291  O  O     . ARG D 4  711  ? 3.494   7.458   85.759  1.00 81.86  ? 711  ARG A O     1 
ATOM   6292  C  CB    . ARG D 4  711  ? 4.913   10.267  86.846  1.00 103.28 ? 711  ARG A CB    1 
ATOM   6293  C  CG    . ARG D 4  711  ? 4.908   11.424  87.828  1.00 113.84 ? 711  ARG A CG    1 
ATOM   6294  C  CD    . ARG D 4  711  ? 5.071   12.761  87.119  1.00 120.74 ? 711  ARG A CD    1 
ATOM   6295  N  NE    . ARG D 4  711  ? 3.866   13.580  87.211  1.00 126.23 ? 711  ARG A NE    1 
ATOM   6296  C  CZ    . ARG D 4  711  ? 3.796   14.854  86.840  1.00 130.50 ? 711  ARG A CZ    1 
ATOM   6297  N  NH1   . ARG D 4  711  ? 4.866   15.465  86.349  1.00 137.52 ? 711  ARG A NH1   1 
ATOM   6298  N  NH2   . ARG D 4  711  ? 2.656   15.517  86.961  1.00 128.72 ? 711  ARG A NH2   1 
ATOM   6299  N  N     . GLU D 4  712  ? 5.685   7.275   86.258  1.00 84.91  ? 712  GLU A N     1 
ATOM   6300  C  CA    . GLU D 4  712  ? 5.859   6.103   85.406  1.00 81.31  ? 712  GLU A CA    1 
ATOM   6301  C  C     . GLU D 4  712  ? 4.969   4.958   85.866  1.00 78.46  ? 712  GLU A C     1 
ATOM   6302  O  O     . GLU D 4  712  ? 4.385   4.243   85.043  1.00 105.99 ? 712  GLU A O     1 
ATOM   6303  C  CB    . GLU D 4  712  ? 7.323   5.663   85.398  1.00 83.69  ? 712  GLU A CB    1 
ATOM   6304  C  CG    . GLU D 4  712  ? 8.271   6.627   84.713  1.00 85.12  ? 712  GLU A CG    1 
ATOM   6305  C  CD    . GLU D 4  712  ? 9.681   6.076   84.626  1.00 97.38  ? 712  GLU A CD    1 
ATOM   6306  O  OE1   . GLU D 4  712  ? 9.927   4.980   85.175  1.00 97.31  ? 712  GLU A OE1   1 
ATOM   6307  O  OE2   . GLU D 4  712  ? 10.541  6.733   84.001  1.00 99.37  ? 712  GLU A OE2   1 
ATOM   6308  N  N     . SER D 4  713  ? 4.859   4.769   87.182  1.00 94.36  ? 713  SER A N     1 
ATOM   6309  C  CA    . SER D 4  713  ? 3.955   3.757   87.714  1.00 114.78 ? 713  SER A CA    1 
ATOM   6310  C  C     . SER D 4  713  ? 2.505   4.099   87.397  1.00 125.70 ? 713  SER A C     1 
ATOM   6311  O  O     . SER D 4  713  ? 1.692   3.206   87.129  1.00 135.63 ? 713  SER A O     1 
ATOM   6312  C  CB    . SER D 4  713  ? 4.156   3.618   89.224  1.00 106.47 ? 713  SER A CB    1 
ATOM   6313  O  OG    . SER D 4  713  ? 5.513   3.360   89.537  1.00 116.25 ? 713  SER A OG    1 
ATOM   6314  N  N     . PHE D 4  714  ? 2.163   5.388   87.420  1.00 110.81 ? 714  PHE A N     1 
ATOM   6315  C  CA    . PHE D 4  714  ? 0.804   5.799   87.086  1.00 99.11  ? 714  PHE A CA    1 
ATOM   6316  C  C     . PHE D 4  714  ? 0.496   5.527   85.620  1.00 115.09 ? 714  PHE A C     1 
ATOM   6317  O  O     . PHE D 4  714  ? -0.530  4.919   85.294  1.00 123.79 ? 714  PHE A O     1 
ATOM   6318  C  CB    . PHE D 4  714  ? 0.605   7.279   87.402  1.00 93.65  ? 714  PHE A CB    1 
ATOM   6319  C  CG    . PHE D 4  714  ? -0.730  7.808   86.974  1.00 96.96  ? 714  PHE A CG    1 
ATOM   6320  C  CD1   . PHE D 4  714  ? -1.894  7.298   87.521  1.00 99.28  ? 714  PHE A CD1   1 
ATOM   6321  C  CD2   . PHE D 4  714  ? -0.826  8.792   86.006  1.00 97.55  ? 714  PHE A CD2   1 
ATOM   6322  C  CE1   . PHE D 4  714  ? -3.128  7.773   87.126  1.00 95.69  ? 714  PHE A CE1   1 
ATOM   6323  C  CE2   . PHE D 4  714  ? -2.060  9.271   85.606  1.00 90.25  ? 714  PHE A CE2   1 
ATOM   6324  C  CZ    . PHE D 4  714  ? -3.211  8.759   86.168  1.00 83.36  ? 714  PHE A CZ    1 
ATOM   6325  N  N     . GLU D 4  715  ? 1.374   5.979   84.720  1.00 115.58 ? 715  GLU A N     1 
ATOM   6326  C  CA    . GLU D 4  715  ? 1.168   5.733   83.296  1.00 108.63 ? 715  GLU A CA    1 
ATOM   6327  C  C     . GLU D 4  715  ? 1.096   4.241   82.996  1.00 100.17 ? 715  GLU A C     1 
ATOM   6328  O  O     . GLU D 4  715  ? 0.237   3.797   82.227  1.00 123.44 ? 715  GLU A O     1 
ATOM   6329  C  CB    . GLU D 4  715  ? 2.287   6.388   82.483  1.00 100.19 ? 715  GLU A CB    1 
ATOM   6330  C  CG    . GLU D 4  715  ? 2.142   7.892   82.299  1.00 107.31 ? 715  GLU A CG    1 
ATOM   6331  C  CD    . GLU D 4  715  ? 1.152   8.248   81.207  1.00 110.05 ? 715  GLU A CD    1 
ATOM   6332  O  OE1   . GLU D 4  715  ? 1.567   8.341   80.032  1.00 91.92  ? 715  GLU A OE1   1 
ATOM   6333  O  OE2   . GLU D 4  715  ? -0.041  8.438   81.524  1.00 108.27 ? 715  GLU A OE2   1 
ATOM   6334  N  N     . ASP D 4  716  ? 1.985   3.451   83.605  1.00 68.82  ? 716  ASP A N     1 
ATOM   6335  C  CA    . ASP D 4  716  ? 2.039   2.020   83.317  1.00 68.60  ? 716  ASP A CA    1 
ATOM   6336  C  C     . ASP D 4  716  ? 0.716   1.337   83.647  1.00 82.71  ? 716  ASP A C     1 
ATOM   6337  O  O     . ASP D 4  716  ? 0.265   0.453   82.909  1.00 86.56  ? 716  ASP A O     1 
ATOM   6338  C  CB    . ASP D 4  716  ? 3.197   1.380   84.089  1.00 89.10  ? 716  ASP A CB    1 
ATOM   6339  C  CG    . ASP D 4  716  ? 3.292   -0.128  83.883  1.00 113.36 ? 716  ASP A CG    1 
ATOM   6340  O  OD1   . ASP D 4  716  ? 2.431   -0.876  84.396  1.00 118.61 ? 716  ASP A OD1   1 
ATOM   6341  O  OD2   . ASP D 4  716  ? 4.239   -0.567  83.197  1.00 122.12 ? 716  ASP A OD2   1 
ATOM   6342  N  N     . ASN D 4  717  ? 0.078   1.735   84.749  1.00 93.02  ? 717  ASN A N     1 
ATOM   6343  C  CA    . ASN D 4  717  ? -1.206  1.144   85.110  1.00 88.21  ? 717  ASN A CA    1 
ATOM   6344  C  C     . ASN D 4  717  ? -2.280  1.497   84.091  1.00 83.23  ? 717  ASN A C     1 
ATOM   6345  O  O     . ASN D 4  717  ? -2.976  0.615   83.575  1.00 96.23  ? 717  ASN A O     1 
ATOM   6346  C  CB    . ASN D 4  717  ? -1.626  1.604   86.507  1.00 89.14  ? 717  ASN A CB    1 
ATOM   6347  C  CG    . ASN D 4  717  ? -0.878  0.885   87.606  1.00 105.42 ? 717  ASN A CG    1 
ATOM   6348  O  OD1   . ASN D 4  717  ? 0.287   0.522   87.446  1.00 118.53 ? 717  ASN A OD1   1 
ATOM   6349  N  ND2   . ASN D 4  717  ? -1.548  0.672   88.732  1.00 109.93 ? 717  ASN A ND2   1 
ATOM   6350  N  N     . VAL D 4  718  ? -2.421  2.790   83.779  1.00 68.94  ? 718  VAL A N     1 
ATOM   6351  C  CA    . VAL D 4  718  ? -3.518  3.244   82.926  1.00 79.38  ? 718  VAL A CA    1 
ATOM   6352  C  C     . VAL D 4  718  ? -3.367  2.714   81.502  1.00 80.18  ? 718  VAL A C     1 
ATOM   6353  O  O     . VAL D 4  718  ? -4.366  2.435   80.827  1.00 66.76  ? 718  VAL A O     1 
ATOM   6354  C  CB    . VAL D 4  718  ? -3.607  4.783   82.960  1.00 68.34  ? 718  VAL A CB    1 
ATOM   6355  C  CG1   . VAL D 4  718  ? -4.868  5.264   82.264  1.00 67.94  ? 718  VAL A CG1   1 
ATOM   6356  C  CG2   . VAL D 4  718  ? -3.575  5.285   84.397  1.00 69.58  ? 718  VAL A CG2   1 
ATOM   6357  N  N     . VAL D 4  719  ? -2.131  2.564   81.019  1.00 75.42  ? 719  VAL A N     1 
ATOM   6358  C  CA    . VAL D 4  719  ? -1.914  1.941   79.714  1.00 65.59  ? 719  VAL A CA    1 
ATOM   6359  C  C     . VAL D 4  719  ? -2.436  0.507   79.723  1.00 75.19  ? 719  VAL A C     1 
ATOM   6360  O  O     . VAL D 4  719  ? -3.209  0.101   78.848  1.00 65.24  ? 719  VAL A O     1 
ATOM   6361  C  CB    . VAL D 4  719  ? -0.423  1.997   79.334  1.00 65.18  ? 719  VAL A CB    1 
ATOM   6362  C  CG1   . VAL D 4  719  ? -0.137  1.090   78.141  1.00 84.87  ? 719  VAL A CG1   1 
ATOM   6363  C  CG2   . VAL D 4  719  ? 0.002   3.425   79.039  1.00 64.87  ? 719  VAL A CG2   1 
ATOM   6364  N  N     . ARG D 4  720  ? -2.021  -0.277  80.719  1.00 75.87  ? 720  ARG A N     1 
ATOM   6365  C  CA    . ARG D 4  720  ? -2.521  -1.641  80.852  1.00 68.87  ? 720  ARG A CA    1 
ATOM   6366  C  C     . ARG D 4  720  ? -4.019  -1.660  81.127  1.00 69.32  ? 720  ARG A C     1 
ATOM   6367  O  O     . ARG D 4  720  ? -4.733  -2.549  80.649  1.00 69.22  ? 720  ARG A O     1 
ATOM   6368  C  CB    . ARG D 4  720  ? -1.774  -2.362  81.970  1.00 93.25  ? 720  ARG A CB    1 
ATOM   6369  C  CG    . ARG D 4  720  ? -0.584  -3.187  81.530  1.00 87.18  ? 720  ARG A CG    1 
ATOM   6370  C  CD    . ARG D 4  720  ? -0.093  -4.047  82.683  1.00 73.71  ? 720  ARG A CD    1 
ATOM   6371  N  NE    . ARG D 4  720  ? -1.200  -4.566  83.485  1.00 89.57  ? 720  ARG A NE    1 
ATOM   6372  C  CZ    . ARG D 4  720  ? -1.507  -4.139  84.709  1.00 99.21  ? 720  ARG A CZ    1 
ATOM   6373  N  NH1   . ARG D 4  720  ? -0.790  -3.179  85.281  1.00 89.19  ? 720  ARG A NH1   1 
ATOM   6374  N  NH2   . ARG D 4  720  ? -2.534  -4.670  85.358  1.00 111.03 ? 720  ARG A NH2   1 
ATOM   6375  N  N     . PHE D 4  721  ? -4.508  -0.695  81.911  1.00 67.98  ? 721  PHE A N     1 
ATOM   6376  C  CA    . PHE D 4  721  ? -5.931  -0.635  82.240  1.00 68.52  ? 721  PHE A CA    1 
ATOM   6377  C  C     . PHE D 4  721  ? -6.793  -0.512  80.992  1.00 67.67  ? 721  PHE A C     1 
ATOM   6378  O  O     . PHE D 4  721  ? -7.847  -1.150  80.893  1.00 67.96  ? 721  PHE A O     1 
ATOM   6379  C  CB    . PHE D 4  721  ? -6.207  0.540   83.178  1.00 77.09  ? 721  PHE A CB    1 
ATOM   6380  C  CG    . PHE D 4  721  ? -6.093  0.203   84.638  1.00 71.01  ? 721  PHE A CG    1 
ATOM   6381  C  CD1   . PHE D 4  721  ? -6.878  0.859   85.570  1.00 71.41  ? 721  PHE A CD1   1 
ATOM   6382  C  CD2   . PHE D 4  721  ? -5.211  -0.766  85.078  1.00 70.82  ? 721  PHE A CD2   1 
ATOM   6383  C  CE1   . PHE D 4  721  ? -6.786  0.559   86.907  1.00 72.64  ? 721  PHE A CE1   1 
ATOM   6384  C  CE2   . PHE D 4  721  ? -5.112  -1.069  86.418  1.00 96.89  ? 721  PHE A CE2   1 
ATOM   6385  C  CZ    . PHE D 4  721  ? -5.903  -0.406  87.335  1.00 99.94  ? 721  PHE A CZ    1 
ATOM   6386  N  N     . LEU D 4  722  ? -6.369  0.319   80.036  1.00 66.70  ? 722  LEU A N     1 
ATOM   6387  C  CA    . LEU D 4  722  ? -7.156  0.560   78.830  1.00 65.92  ? 722  LEU A CA    1 
ATOM   6388  C  C     . LEU D 4  722  ? -6.966  -0.534  77.785  1.00 65.23  ? 722  LEU A C     1 
ATOM   6389  O  O     . LEU D 4  722  ? -7.916  -0.859  77.065  1.00 64.99  ? 722  LEU A O     1 
ATOM   6390  C  CB    . LEU D 4  722  ? -6.802  1.930   78.242  1.00 65.24  ? 722  LEU A CB    1 
ATOM   6391  C  CG    . LEU D 4  722  ? -7.084  3.147   79.135  1.00 65.90  ? 722  LEU A CG    1 
ATOM   6392  C  CD1   . LEU D 4  722  ? -6.606  4.445   78.500  1.00 65.25  ? 722  LEU A CD1   1 
ATOM   6393  C  CD2   . LEU D 4  722  ? -8.567  3.249   79.469  1.00 66.51  ? 722  LEU A CD2   1 
ATOM   6394  N  N     . ASN D 4  723  ? -5.766  -1.112  77.686  1.00 64.98  ? 723  ASN A N     1 
ATOM   6395  C  CA    . ASN D 4  723  ? -5.557  -2.218  76.756  1.00 64.46  ? 723  ASN A CA    1 
ATOM   6396  C  C     . ASN D 4  723  ? -6.438  -3.408  77.114  1.00 65.16  ? 723  ASN A C     1 
ATOM   6397  O  O     . ASN D 4  723  ? -6.975  -4.082  76.229  1.00 64.81  ? 723  ASN A O     1 
ATOM   6398  C  CB    . ASN D 4  723  ? -4.084  -2.626  76.741  1.00 72.89  ? 723  ASN A CB    1 
ATOM   6399  C  CG    . ASN D 4  723  ? -3.176  -1.525  76.227  1.00 78.12  ? 723  ASN A CG    1 
ATOM   6400  O  OD1   . ASN D 4  723  ? -3.619  -0.405  75.977  1.00 84.28  ? 723  ASN A OD1   1 
ATOM   6401  N  ND2   . ASN D 4  723  ? -1.892  -1.835  76.082  1.00 94.27  ? 723  ASN A ND2   1 
ATOM   6402  N  N     . GLU D 4  724  ? -6.599  -3.683  78.410  1.00 76.42  ? 724  GLU A N     1 
ATOM   6403  C  CA    . GLU D 4  724  ? -7.505  -4.747  78.827  1.00 82.47  ? 724  GLU A CA    1 
ATOM   6404  C  C     . GLU D 4  724  ? -8.943  -4.416  78.449  1.00 90.70  ? 724  GLU A C     1 
ATOM   6405  O  O     . GLU D 4  724  ? -9.714  -5.306  78.077  1.00 107.41 ? 724  GLU A O     1 
ATOM   6406  C  CB    . GLU D 4  724  ? -7.384  -4.985  80.332  1.00 97.70  ? 724  GLU A CB    1 
ATOM   6407  C  CG    . GLU D 4  724  ? -6.063  -5.605  80.761  1.00 110.29 ? 724  GLU A CG    1 
ATOM   6408  C  CD    . GLU D 4  724  ? -6.017  -5.899  82.249  1.00 127.11 ? 724  GLU A CD    1 
ATOM   6409  O  OE1   . GLU D 4  724  ? -7.069  -5.782  82.912  1.00 132.88 ? 724  GLU A OE1   1 
ATOM   6410  O  OE2   . GLU D 4  724  ? -4.928  -6.237  82.759  1.00 132.30 ? 724  GLU A OE2   1 
ATOM   6411  N  N     . ALA D 4  725  ? -9.320  -3.137  78.530  1.00 66.93  ? 725  ALA A N     1 
ATOM   6412  C  CA    . ALA D 4  725  ? -10.656 -2.732  78.101  1.00 69.64  ? 725  ALA A CA    1 
ATOM   6413  C  C     . ALA D 4  725  ? -10.831 -2.919  76.600  1.00 69.70  ? 725  ALA A C     1 
ATOM   6414  O  O     . ALA D 4  725  ? -11.868 -3.417  76.147  1.00 66.12  ? 725  ALA A O     1 
ATOM   6415  C  CB    . ALA D 4  725  ? -10.917 -1.279  78.492  1.00 70.44  ? 725  ALA A CB    1 
ATOM   6416  N  N     . ARG D 4  726  ? -9.826  -2.523  75.816  1.00 83.41  ? 726  ARG A N     1 
ATOM   6417  C  CA    . ARG D 4  726  ? -9.877  -2.729  74.371  1.00 79.42  ? 726  ARG A CA    1 
ATOM   6418  C  C     . ARG D 4  726  ? -9.909  -4.212  74.023  1.00 85.64  ? 726  ARG A C     1 
ATOM   6419  O  O     . ARG D 4  726  ? -10.684 -4.638  73.159  1.00 92.15  ? 726  ARG A O     1 
ATOM   6420  C  CB    . ARG D 4  726  ? -8.678  -2.050  73.709  1.00 67.16  ? 726  ARG A CB    1 
ATOM   6421  C  CG    . ARG D 4  726  ? -8.483  -2.410  72.250  1.00 66.23  ? 726  ARG A CG    1 
ATOM   6422  C  CD    . ARG D 4  726  ? -7.108  -1.979  71.769  1.00 72.72  ? 726  ARG A CD    1 
ATOM   6423  N  NE    . ARG D 4  726  ? -6.092  -2.999  72.021  1.00 91.00  ? 726  ARG A NE    1 
ATOM   6424  C  CZ    . ARG D 4  726  ? -4.785  -2.804  71.876  1.00 112.62 ? 726  ARG A CZ    1 
ATOM   6425  N  NH1   . ARG D 4  726  ? -4.329  -1.623  71.479  1.00 107.72 ? 726  ARG A NH1   1 
ATOM   6426  N  NH2   . ARG D 4  726  ? -3.934  -3.789  72.128  1.00 131.35 ? 726  ARG A NH2   1 
ATOM   6427  N  N     . ASP D 4  727  ? -9.069  -5.012  74.685  1.00 72.37  ? 727  ASP A N     1 
ATOM   6428  C  CA    . ASP D 4  727  ? -9.005  -6.437  74.379  1.00 66.73  ? 727  ASP A CA    1 
ATOM   6429  C  C     . ASP D 4  727  ? -10.251 -7.170  74.863  1.00 80.93  ? 727  ASP A C     1 
ATOM   6430  O  O     . ASP D 4  727  ? -10.751 -8.066  74.175  1.00 108.23 ? 727  ASP A O     1 
ATOM   6431  C  CB    . ASP D 4  727  ? -7.742  -7.050  74.988  1.00 81.89  ? 727  ASP A CB    1 
ATOM   6432  C  CG    . ASP D 4  727  ? -6.465  -6.486  74.382  1.00 92.50  ? 727  ASP A CG    1 
ATOM   6433  O  OD1   . ASP D 4  727  ? -6.537  -5.464  73.666  1.00 85.03  ? 727  ASP A OD1   1 
ATOM   6434  O  OD2   . ASP D 4  727  ? -5.385  -7.064  74.628  1.00 100.03 ? 727  ASP A OD2   1 
ATOM   6435  N  N     . LYS D 4  728  ? -10.771 -6.809  76.040  1.00 76.00  ? 728  LYS A N     1 
ATOM   6436  C  CA    . LYS D 4  728  ? -11.987 -7.461  76.519  1.00 100.11 ? 728  LYS A CA    1 
ATOM   6437  C  C     . LYS D 4  728  ? -13.186 -7.099  75.650  1.00 101.01 ? 728  LYS A C     1 
ATOM   6438  O  O     . LYS D 4  728  ? -14.056 -7.942  75.404  1.00 120.60 ? 728  LYS A O     1 
ATOM   6439  C  CB    . LYS D 4  728  ? -12.255 -7.100  77.981  1.00 101.65 ? 728  LYS A CB    1 
ATOM   6440  C  CG    . LYS D 4  728  ? -13.448 -7.837  78.578  1.00 110.90 ? 728  LYS A CG    1 
ATOM   6441  C  CD    . LYS D 4  728  ? -13.421 -7.829  80.099  1.00 120.29 ? 728  LYS A CD    1 
ATOM   6442  C  CE    . LYS D 4  728  ? -14.499 -8.741  80.672  1.00 119.71 ? 728  LYS A CE    1 
ATOM   6443  N  NZ    . LYS D 4  728  ? -14.328 -8.960  82.137  1.00 106.79 ? 728  LYS A NZ    1 
ATOM   6444  N  N     . ALA D 4  729  ? -13.248 -5.854  75.170  1.00 77.00  ? 729  ALA A N     1 
ATOM   6445  C  CA    . ALA D 4  729  ? -14.346 -5.461  74.291  1.00 85.10  ? 729  ALA A CA    1 
ATOM   6446  C  C     . ALA D 4  729  ? -14.272 -6.188  72.953  1.00 89.16  ? 729  ALA A C     1 
ATOM   6447  O  O     . ALA D 4  729  ? -15.306 -6.547  72.378  1.00 75.81  ? 729  ALA A O     1 
ATOM   6448  C  CB    . ALA D 4  729  ? -14.341 -3.947  74.081  1.00 65.83  ? 729  ALA A CB    1 
ATOM   6449  N  N     . GLY D 4  730  ? -13.060 -6.418  72.445  1.00 104.36 ? 730  GLY A N     1 
ATOM   6450  C  CA    . GLY D 4  730  ? -12.925 -7.143  71.191  1.00 95.91  ? 730  GLY A CA    1 
ATOM   6451  C  C     . GLY D 4  730  ? -13.354 -8.592  71.311  1.00 79.49  ? 730  GLY A C     1 
ATOM   6452  O  O     . GLY D 4  730  ? -14.095 -9.107  70.469  1.00 96.45  ? 730  GLY A O     1 
ATOM   6453  N  N     . ARG D 4  731  ? -12.892 -9.272  72.361  1.00 70.72  ? 731  ARG A N     1 
ATOM   6454  C  CA    . ARG D 4  731  ? -13.320 -10.647 72.579  1.00 82.70  ? 731  ARG A CA    1 
ATOM   6455  C  C     . ARG D 4  731  ? -14.797 -10.712 72.950  1.00 95.73  ? 731  ARG A C     1 
ATOM   6456  O  O     . ARG D 4  731  ? -15.457 -11.724 72.687  1.00 126.62 ? 731  ARG A O     1 
ATOM   6457  C  CB    . ARG D 4  731  ? -12.455 -11.299 73.659  1.00 80.63  ? 731  ARG A CB    1 
ATOM   6458  C  CG    . ARG D 4  731  ? -10.961 -11.117 73.428  1.00 86.99  ? 731  ARG A CG    1 
ATOM   6459  C  CD    . ARG D 4  731  ? -10.188 -12.418 73.527  1.00 118.53 ? 731  ARG A CD    1 
ATOM   6460  N  NE    . ARG D 4  731  ? -8.758  -12.204 73.315  1.00 131.47 ? 731  ARG A NE    1 
ATOM   6461  C  CZ    . ARG D 4  731  ? -7.910  -11.808 74.261  1.00 125.76 ? 731  ARG A CZ    1 
ATOM   6462  N  NH1   . ARG D 4  731  ? -8.345  -11.575 75.494  1.00 99.24  ? 731  ARG A NH1   1 
ATOM   6463  N  NH2   . ARG D 4  731  ? -6.627  -11.640 73.974  1.00 128.07 ? 731  ARG A NH2   1 
ATOM   6464  N  N     . LEU D 4  732  ? -15.332 -9.645  73.554  1.00 67.96  ? 732  LEU A N     1 
ATOM   6465  C  CA    . LEU D 4  732  ? -16.769 -9.580  73.799  1.00 68.82  ? 732  LEU A CA    1 
ATOM   6466  C  C     . LEU D 4  732  ? -17.550 -9.450  72.500  1.00 68.34  ? 732  LEU A C     1 
ATOM   6467  O  O     . LEU D 4  732  ? -18.725 -9.829  72.445  1.00 75.94  ? 732  LEU A O     1 
ATOM   6468  C  CB    . LEU D 4  732  ? -17.107 -8.412  74.728  1.00 69.13  ? 732  LEU A CB    1 
ATOM   6469  C  CG    . LEU D 4  732  ? -17.766 -8.750  76.067  1.00 70.56  ? 732  LEU A CG    1 
ATOM   6470  C  CD1   . LEU D 4  732  ? -18.105 -7.480  76.831  1.00 70.79  ? 732  LEU A CD1   1 
ATOM   6471  C  CD2   . LEU D 4  732  ? -19.011 -9.600  75.858  1.00 85.22  ? 732  LEU A CD2   1 
ATOM   6472  N  N     . ALA D 4  733  ? -16.923 -8.908  71.457  1.00 67.12  ? 733  ALA A N     1 
ATOM   6473  C  CA    . ALA D 4  733  ? -17.522 -8.850  70.129  1.00 66.61  ? 733  ALA A CA    1 
ATOM   6474  C  C     . ALA D 4  733  ? -17.269 -10.121 69.331  1.00 66.56  ? 733  ALA A C     1 
ATOM   6475  O  O     . ALA D 4  733  ? -18.188 -10.642 68.690  1.00 66.95  ? 733  ALA A O     1 
ATOM   6476  C  CB    . ALA D 4  733  ? -16.979 -7.644  69.359  1.00 65.38  ? 733  ALA A CB    1 
ATOM   6477  N  N     . GLU D 4  734  ? -16.035 -10.637 69.374  1.00 80.13  ? 734  GLU A N     1 
ATOM   6478  C  CA    . GLU D 4  734  ? -15.706 -11.859 68.647  1.00 80.62  ? 734  GLU A CA    1 
ATOM   6479  C  C     . GLU D 4  734  ? -16.578 -13.027 69.088  1.00 77.51  ? 734  GLU A C     1 
ATOM   6480  O  O     . GLU D 4  734  ? -16.865 -13.922 68.286  1.00 97.74  ? 734  GLU A O     1 
ATOM   6481  C  CB    . GLU D 4  734  ? -14.226 -12.190 68.840  1.00 99.18  ? 734  GLU A CB    1 
ATOM   6482  C  CG    . GLU D 4  734  ? -13.695 -13.287 67.928  1.00 111.38 ? 734  GLU A CG    1 
ATOM   6483  C  CD    . GLU D 4  734  ? -12.216 -13.550 68.145  1.00 108.50 ? 734  GLU A CD    1 
ATOM   6484  O  OE1   . GLU D 4  734  ? -11.721 -13.278 69.259  1.00 104.99 ? 734  GLU A OE1   1 
ATOM   6485  O  OE2   . GLU D 4  734  ? -11.549 -14.017 67.197  1.00 111.48 ? 734  GLU A OE2   1 
ATOM   6486  N  N     . VAL D 4  735  ? -17.008 -13.034 70.350  1.00 89.98  ? 735  VAL A N     1 
ATOM   6487  C  CA    . VAL D 4  735  ? -17.962 -14.039 70.807  1.00 94.46  ? 735  VAL A CA    1 
ATOM   6488  C  C     . VAL D 4  735  ? -19.310 -13.841 70.125  1.00 91.45  ? 735  VAL A C     1 
ATOM   6489  O  O     . VAL D 4  735  ? -19.989 -14.809 69.764  1.00 111.65 ? 735  VAL A O     1 
ATOM   6490  C  CB    . VAL D 4  735  ? -18.090 -13.989 72.341  1.00 98.76  ? 735  VAL A CB    1 
ATOM   6491  C  CG1   . VAL D 4  735  ? -19.449 -14.515 72.791  1.00 109.99 ? 735  VAL A CG1   1 
ATOM   6492  C  CG2   . VAL D 4  735  ? -16.966 -14.777 72.995  1.00 107.33 ? 735  VAL A CG2   1 
ATOM   6493  N  N     . ASN D 4  736  ? -19.711 -12.583 69.924  1.00 80.25  ? 736  ASN A N     1 
ATOM   6494  C  CA    . ASN D 4  736  ? -21.029 -12.291 69.372  1.00 92.89  ? 736  ASN A CA    1 
ATOM   6495  C  C     . ASN D 4  736  ? -21.105 -12.552 67.873  1.00 105.28 ? 736  ASN A C     1 
ATOM   6496  O  O     . ASN D 4  736  ? -22.204 -12.765 67.350  1.00 110.50 ? 736  ASN A O     1 
ATOM   6497  C  CB    . ASN D 4  736  ? -21.410 -10.839 69.670  1.00 88.08  ? 736  ASN A CB    1 
ATOM   6498  C  CG    . ASN D 4  736  ? -22.874 -10.550 69.390  1.00 103.11 ? 736  ASN A CG    1 
ATOM   6499  O  OD1   . ASN D 4  736  ? -23.703 -10.578 70.301  1.00 119.76 ? 736  ASN A OD1   1 
ATOM   6500  N  ND2   . ASN D 4  736  ? -23.198 -10.258 68.134  1.00 98.28  ? 736  ASN A ND2   1 
ATOM   6501  N  N     . LEU D 4  737  ? -19.974 -12.535 67.173  1.00 90.14  ? 737  LEU A N     1 
ATOM   6502  C  CA    . LEU D 4  737  ? -19.984 -12.762 65.734  1.00 68.29  ? 737  LEU A CA    1 
ATOM   6503  C  C     . LEU D 4  737  ? -20.397 -14.198 65.443  1.00 87.20  ? 737  LEU A C     1 
ATOM   6504  O  O     . LEU D 4  737  ? -19.710 -15.144 65.842  1.00 100.58 ? 737  LEU A O     1 
ATOM   6505  C  CB    . LEU D 4  737  ? -18.615 -12.459 65.133  1.00 66.22  ? 737  LEU A CB    1 
ATOM   6506  C  CG    . LEU D 4  737  ? -18.225 -10.980 65.184  1.00 67.97  ? 737  LEU A CG    1 
ATOM   6507  C  CD1   . LEU D 4  737  ? -17.000 -10.709 64.330  1.00 64.05  ? 737  LEU A CD1   1 
ATOM   6508  C  CD2   . LEU D 4  737  ? -19.391 -10.098 64.760  1.00 65.31  ? 737  LEU A CD2   1 
ATOM   6509  N  N     . LYS D 4  738  ? -21.523 -14.355 64.753  1.00 91.44  ? 738  LYS A N     1 
ATOM   6510  C  CA    . LYS D 4  738  ? -22.061 -15.670 64.448  1.00 78.06  ? 738  LYS A CA    1 
ATOM   6511  C  C     . LYS D 4  738  ? -21.188 -16.369 63.407  1.00 69.28  ? 738  LYS A C     1 
ATOM   6512  O  O     . LYS D 4  738  ? -20.226 -15.806 62.877  1.00 68.06  ? 738  LYS A O     1 
ATOM   6513  C  CB    . LYS D 4  738  ? -23.503 -15.536 63.968  1.00 70.61  ? 738  LYS A CB    1 
ATOM   6514  C  CG    . LYS D 4  738  ? -24.184 -14.293 64.512  1.00 70.60  ? 738  LYS A CG    1 
ATOM   6515  C  CD    . LYS D 4  738  ? -25.554 -14.090 63.910  1.00 71.22  ? 738  LYS A CD    1 
ATOM   6516  C  CE    . LYS D 4  738  ? -26.140 -12.764 64.350  1.00 83.68  ? 738  LYS A CE    1 
ATOM   6517  N  NZ    . LYS D 4  738  ? -27.468 -12.550 63.734  1.00 71.74  ? 738  LYS A NZ    1 
ATOM   6518  N  N     . ASP D 4  739  ? -21.533 -17.623 63.109  1.00 73.06  ? 739  ASP A N     1 
ATOM   6519  C  CA    . ASP D 4  739  ? -20.739 -18.398 62.161  1.00 91.51  ? 739  ASP A CA    1 
ATOM   6520  C  C     . ASP D 4  739  ? -20.833 -17.836 60.747  1.00 101.32 ? 739  ASP A C     1 
ATOM   6521  O  O     . ASP D 4  739  ? -19.883 -17.966 59.966  1.00 97.07  ? 739  ASP A O     1 
ATOM   6522  C  CB    . ASP D 4  739  ? -21.181 -19.858 62.177  1.00 102.19 ? 739  ASP A CB    1 
ATOM   6523  C  CG    . ASP D 4  739  ? -20.792 -20.564 63.454  1.00 104.79 ? 739  ASP A CG    1 
ATOM   6524  O  OD1   . ASP D 4  739  ? -21.636 -20.638 64.371  1.00 119.38 ? 739  ASP A OD1   1 
ATOM   6525  O  OD2   . ASP D 4  739  ? -19.636 -21.026 63.547  1.00 116.40 ? 739  ASP A OD2   1 
ATOM   6526  N  N     . LEU D 4  740  ? -21.958 -17.208 60.401  1.00 96.05  ? 740  LEU A N     1 
ATOM   6527  C  CA    . LEU D 4  740  ? -22.145 -16.644 59.069  1.00 73.26  ? 740  LEU A CA    1 
ATOM   6528  C  C     . LEU D 4  740  ? -21.389 -15.340 58.850  1.00 66.88  ? 740  LEU A C     1 
ATOM   6529  O  O     . LEU D 4  740  ? -21.283 -14.899 57.701  1.00 66.12  ? 740  LEU A O     1 
ATOM   6530  C  CB    . LEU D 4  740  ? -23.635 -16.403 58.781  1.00 77.49  ? 740  LEU A CB    1 
ATOM   6531  C  CG    . LEU D 4  740  ? -24.479 -15.623 59.793  1.00 77.57  ? 740  LEU A CG    1 
ATOM   6532  C  CD1   . LEU D 4  740  ? -25.628 -14.927 59.090  1.00 74.13  ? 740  LEU A CD1   1 
ATOM   6533  C  CD2   . LEU D 4  740  ? -25.030 -16.558 60.859  1.00 81.17  ? 740  LEU A CD2   1 
ATOM   6534  N  N     . ASN D 4  741  ? -20.880 -14.708 59.906  1.00 66.56  ? 741  ASN A N     1 
ATOM   6535  C  CA    . ASN D 4  741  ? -20.187 -13.434 59.757  1.00 69.36  ? 741  ASN A CA    1 
ATOM   6536  C  C     . ASN D 4  741  ? -18.976 -13.589 58.847  1.00 64.32  ? 741  ASN A C     1 
ATOM   6537  O  O     . ASN D 4  741  ? -18.019 -14.289 59.188  1.00 74.91  ? 741  ASN A O     1 
ATOM   6538  C  CB    . ASN D 4  741  ? -19.756 -12.903 61.122  1.00 76.57  ? 741  ASN A CB    1 
ATOM   6539  C  CG    . ASN D 4  741  ? -18.843 -11.695 61.014  1.00 64.08  ? 741  ASN A CG    1 
ATOM   6540  O  OD1   . ASN D 4  741  ? -17.637 -11.825 60.803  1.00 72.97  ? 741  ASN A OD1   1 
ATOM   6541  N  ND2   . ASN D 4  741  ? -19.416 -10.512 61.168  1.00 63.88  ? 741  ASN A ND2   1 
ATOM   6542  N  N     . ASN D 4  742  ? -19.014 -12.915 57.695  1.00 76.95  ? 742  ASN A N     1 
ATOM   6543  C  CA    . ASN D 4  742  ? -17.980 -13.114 56.687  1.00 84.48  ? 742  ASN A CA    1 
ATOM   6544  C  C     . ASN D 4  742  ? -16.628 -12.577 57.144  1.00 76.54  ? 742  ASN A C     1 
ATOM   6545  O  O     . ASN D 4  742  ? -15.587 -13.085 56.715  1.00 86.18  ? 742  ASN A O     1 
ATOM   6546  C  CB    . ASN D 4  742  ? -18.406 -12.463 55.371  1.00 96.36  ? 742  ASN A CB    1 
ATOM   6547  C  CG    . ASN D 4  742  ? -19.868 -12.725 55.037  1.00 92.19  ? 742  ASN A CG    1 
ATOM   6548  O  OD1   . ASN D 4  742  ? -20.738 -12.648 55.905  1.00 96.96  ? 742  ASN A OD1   1 
ATOM   6549  N  ND2   . ASN D 4  742  ? -20.141 -13.048 53.777  1.00 78.12  ? 742  ASN A ND2   1 
ATOM   6550  N  N     . VAL D 4  743  ? -16.619 -11.557 58.006  1.00 89.61  ? 743  VAL A N     1 
ATOM   6551  C  CA    . VAL D 4  743  ? -15.357 -11.080 58.568  1.00 97.82  ? 743  VAL A CA    1 
ATOM   6552  C  C     . VAL D 4  743  ? -14.731 -12.159 59.441  1.00 99.94  ? 743  VAL A C     1 
ATOM   6553  O  O     . VAL D 4  743  ? -13.518 -12.401 59.386  1.00 101.48 ? 743  VAL A O     1 
ATOM   6554  C  CB    . VAL D 4  743  ? -15.572 -9.770  59.350  1.00 86.01  ? 743  VAL A CB    1 
ATOM   6555  C  CG1   . VAL D 4  743  ? -14.255 -9.271  59.921  1.00 91.40  ? 743  VAL A CG1   1 
ATOM   6556  C  CG2   . VAL D 4  743  ? -16.214 -8.707  58.466  1.00 85.11  ? 743  VAL A CG2   1 
ATOM   6557  N  N     . LYS D 4  744  ? -15.549 -12.827 60.258  1.00 96.56  ? 744  LYS A N     1 
ATOM   6558  C  CA    . LYS D 4  744  ? -15.058 -13.938 61.067  1.00 81.64  ? 744  LYS A CA    1 
ATOM   6559  C  C     . LYS D 4  744  ? -14.594 -15.094 60.190  1.00 81.52  ? 744  LYS A C     1 
ATOM   6560  O  O     . LYS D 4  744  ? -13.599 -15.759 60.504  1.00 71.83  ? 744  LYS A O     1 
ATOM   6561  C  CB    . LYS D 4  744  ? -16.155 -14.395 62.031  1.00 73.43  ? 744  LYS A CB    1 
ATOM   6562  C  CG    . LYS D 4  744  ? -15.704 -15.350 63.124  1.00 83.60  ? 744  LYS A CG    1 
ATOM   6563  C  CD    . LYS D 4  744  ? -16.810 -15.547 64.152  1.00 97.30  ? 744  LYS A CD    1 
ATOM   6564  C  CE    . LYS D 4  744  ? -16.441 -16.607 65.177  1.00 102.59 ? 744  LYS A CE    1 
ATOM   6565  N  NZ    . LYS D 4  744  ? -15.171 -16.283 65.884  1.00 98.91  ? 744  LYS A NZ    1 
ATOM   6566  N  N     . GLN D 4  745  ? -15.298 -15.343 59.080  1.00 97.50  ? 745  GLN A N     1 
ATOM   6567  C  CA    . GLN D 4  745  ? -14.957 -16.470 58.216  1.00 77.58  ? 745  GLN A CA    1 
ATOM   6568  C  C     . GLN D 4  745  ? -13.585 -16.291 57.584  1.00 65.31  ? 745  GLN A C     1 
ATOM   6569  O  O     . GLN D 4  745  ? -12.819 -17.254 57.459  1.00 86.85  ? 745  GLN A O     1 
ATOM   6570  C  CB    . GLN D 4  745  ? -16.020 -16.647 57.133  1.00 66.59  ? 745  GLN A CB    1 
ATOM   6571  C  CG    . GLN D 4  745  ? -17.410 -16.930 57.668  1.00 71.29  ? 745  GLN A CG    1 
ATOM   6572  C  CD    . GLN D 4  745  ? -18.331 -17.491 56.606  1.00 92.27  ? 745  GLN A CD    1 
ATOM   6573  O  OE1   . GLN D 4  745  ? -17.885 -18.165 55.678  1.00 85.43  ? 745  GLN A OE1   1 
ATOM   6574  N  NE2   . GLN D 4  745  ? -19.625 -17.220 56.739  1.00 107.63 ? 745  GLN A NE2   1 
ATOM   6575  N  N     . MET D 4  746  ? -13.260 -15.068 57.173  1.00 61.60  ? 746  MET A N     1 
ATOM   6576  C  CA    . MET D 4  746  ? -11.933 -14.807 56.631  1.00 65.61  ? 746  MET A CA    1 
ATOM   6577  C  C     . MET D 4  746  ? -10.865 -15.001 57.698  1.00 75.12  ? 746  MET A C     1 
ATOM   6578  O  O     . MET D 4  746  ? -9.768  -15.494 57.410  1.00 74.66  ? 746  MET A O     1 
ATOM   6579  C  CB    . MET D 4  746  ? -11.881 -13.393 56.061  1.00 72.90  ? 746  MET A CB    1 
ATOM   6580  C  CG    . MET D 4  746  ? -12.674 -13.232 54.775  1.00 59.57  ? 746  MET A CG    1 
ATOM   6581  S  SD    . MET D 4  746  ? -12.129 -11.806 53.829  1.00 60.19  ? 746  MET A SD    1 
ATOM   6582  C  CE    . MET D 4  746  ? -13.490 -10.682 54.073  1.00 58.43  ? 746  MET A CE    1 
ATOM   6583  N  N     . VAL D 4  747  ? -11.174 -14.623 58.940  1.00 96.11  ? 747  VAL A N     1 
ATOM   6584  C  CA    . VAL D 4  747  ? -10.258 -14.872 60.048  1.00 90.31  ? 747  VAL A CA    1 
ATOM   6585  C  C     . VAL D 4  747  ? -10.165 -16.367 60.332  1.00 92.09  ? 747  VAL A C     1 
ATOM   6586  O  O     . VAL D 4  747  ? -9.072  -16.904 60.551  1.00 90.73  ? 747  VAL A O     1 
ATOM   6587  C  CB    . VAL D 4  747  ? -10.704 -14.080 61.293  1.00 87.64  ? 747  VAL A CB    1 
ATOM   6588  C  CG1   . VAL D 4  747  ? -10.058 -14.636 62.557  1.00 101.26 ? 747  VAL A CG1   1 
ATOM   6589  C  CG2   . VAL D 4  747  ? -10.387 -12.598 61.128  1.00 80.51  ? 747  VAL A CG2   1 
ATOM   6590  N  N     . MET D 4  748  ? -11.305 -17.066 60.307  1.00 72.88  ? 748  MET A N     1 
ATOM   6591  C  CA    . MET D 4  748  ? -11.321 -18.477 60.684  1.00 76.21  ? 748  MET A CA    1 
ATOM   6592  C  C     . MET D 4  748  ? -10.499 -19.318 59.716  1.00 77.84  ? 748  MET A C     1 
ATOM   6593  O  O     . MET D 4  748  ? -9.770  -20.227 60.133  1.00 90.90  ? 748  MET A O     1 
ATOM   6594  C  CB    . MET D 4  748  ? -12.764 -18.981 60.764  1.00 76.65  ? 748  MET A CB    1 
ATOM   6595  C  CG    . MET D 4  748  ? -13.473 -18.571 62.048  1.00 95.37  ? 748  MET A CG    1 
ATOM   6596  S  SD    . MET D 4  748  ? -14.631 -19.795 62.683  1.00 112.23 ? 748  MET A SD    1 
ATOM   6597  C  CE    . MET D 4  748  ? -15.956 -19.635 61.493  1.00 68.33  ? 748  MET A CE    1 
ATOM   6598  N  N     . ALA D 4  749  ? -10.602 -19.034 58.419  1.00 73.11  ? 749  ALA A N     1 
ATOM   6599  C  CA    . ALA D 4  749  ? -9.713  -19.659 57.449  1.00 72.27  ? 749  ALA A CA    1 
ATOM   6600  C  C     . ALA D 4  749  ? -8.331  -19.017 57.423  1.00 70.95  ? 749  ALA A C     1 
ATOM   6601  O  O     . ALA D 4  749  ? -7.416  -19.569 56.801  1.00 67.33  ? 749  ALA A O     1 
ATOM   6602  C  CB    . ALA D 4  749  ? -10.334 -19.606 56.051  1.00 68.16  ? 749  ALA A CB    1 
ATOM   6603  N  N     . GLY D 4  750  ? -8.157  -17.875 58.084  1.00 75.46  ? 750  GLY A N     1 
ATOM   6604  C  CA    . GLY D 4  750  ? -6.880  -17.194 58.066  1.00 86.66  ? 750  GLY A CA    1 
ATOM   6605  C  C     . GLY D 4  750  ? -6.537  -16.547 56.746  1.00 86.49  ? 750  GLY A C     1 
ATOM   6606  O  O     . GLY D 4  750  ? -5.364  -16.258 56.494  1.00 84.82  ? 750  GLY A O     1 
ATOM   6607  N  N     . SER D 4  751  ? -7.534  -16.315 55.890  1.00 94.27  ? 751  SER A N     1 
ATOM   6608  C  CA    . SER D 4  751  ? -7.286  -15.713 54.584  1.00 93.09  ? 751  SER A CA    1 
ATOM   6609  C  C     . SER D 4  751  ? -6.730  -14.302 54.723  1.00 112.01 ? 751  SER A C     1 
ATOM   6610  O  O     . SER D 4  751  ? -5.611  -14.013 54.285  1.00 137.11 ? 751  SER A O     1 
ATOM   6611  C  CB    . SER D 4  751  ? -8.575  -15.698 53.767  1.00 97.73  ? 751  SER A CB    1 
ATOM   6612  O  OG    . SER D 4  751  ? -9.550  -14.887 54.396  1.00 99.91  ? 751  SER A OG    1 
ATOM   6613  N  N     . LYS D 4  752  ? -7.513  -13.399 55.320  1.00 118.60 ? 752  LYS A N     1 
ATOM   6614  C  CA    . LYS D 4  752  ? -7.040  -12.040 55.579  1.00 105.87 ? 752  LYS A CA    1 
ATOM   6615  C  C     . LYS D 4  752  ? -7.851  -11.497 56.754  1.00 96.30  ? 752  LYS A C     1 
ATOM   6616  O  O     . LYS D 4  752  ? -9.024  -11.149 56.591  1.00 84.53  ? 752  LYS A O     1 
ATOM   6617  C  CB    . LYS D 4  752  ? -7.179  -11.158 54.350  1.00 69.97  ? 752  LYS A CB    1 
ATOM   6618  C  CG    . LYS D 4  752  ? -6.913  -9.685  54.610  1.00 58.46  ? 752  LYS A CG    1 
ATOM   6619  C  CD    . LYS D 4  752  ? -5.920  -9.133  53.601  1.00 72.20  ? 752  LYS A CD    1 
ATOM   6620  C  CE    . LYS D 4  752  ? -4.580  -9.846  53.701  1.00 84.76  ? 752  LYS A CE    1 
ATOM   6621  N  NZ    . LYS D 4  752  ? -3.634  -9.338  52.674  1.00 100.27 ? 752  LYS A NZ    1 
ATOM   6622  N  N     . GLY D 4  753  ? -7.225  -11.430 57.916  1.00 88.47  ? 753  GLY A N     1 
ATOM   6623  C  CA    . GLY D 4  753  ? -7.890  -10.895 59.085  1.00 109.51 ? 753  GLY A CA    1 
ATOM   6624  C  C     . GLY D 4  753  ? -7.219  -11.340 60.359  1.00 117.57 ? 753  GLY A C     1 
ATOM   6625  O  O     . GLY D 4  753  ? -6.463  -12.313 60.399  1.00 139.87 ? 753  GLY A O     1 
ATOM   6626  N  N     . SER D 4  754  ? -7.509  -10.600 61.424  1.00 103.26 ? 754  SER A N     1 
ATOM   6627  C  CA    . SER D 4  754  ? -6.996  -10.904 62.749  1.00 91.18  ? 754  SER A CA    1 
ATOM   6628  C  C     . SER D 4  754  ? -8.038  -10.478 63.772  1.00 84.35  ? 754  SER A C     1 
ATOM   6629  O  O     . SER D 4  754  ? -9.009  -9.788  63.451  1.00 70.08  ? 754  SER A O     1 
ATOM   6630  C  CB    . SER D 4  754  ? -5.653  -10.209 63.003  1.00 93.66  ? 754  SER A CB    1 
ATOM   6631  O  OG    . SER D 4  754  ? -4.694  -10.584 62.029  1.00 99.62  ? 754  SER A OG    1 
ATOM   6632  N  N     . PHE D 4  755  ? -7.823  -10.901 65.018  1.00 89.33  ? 755  PHE A N     1 
ATOM   6633  C  CA    . PHE D 4  755  ? -8.765  -10.570 66.081  1.00 102.97 ? 755  PHE A CA    1 
ATOM   6634  C  C     . PHE D 4  755  ? -8.797  -9.068  66.345  1.00 88.70  ? 755  PHE A C     1 
ATOM   6635  O  O     . PHE D 4  755  ? -9.864  -8.502  66.609  1.00 89.46  ? 755  PHE A O     1 
ATOM   6636  C  CB    . PHE D 4  755  ? -8.404  -11.331 67.357  1.00 115.52 ? 755  PHE A CB    1 
ATOM   6637  C  CG    . PHE D 4  755  ? -8.723  -10.582 68.619  1.00 117.11 ? 755  PHE A CG    1 
ATOM   6638  C  CD1   . PHE D 4  755  ? -10.028 -10.491 69.073  1.00 121.85 ? 755  PHE A CD1   1 
ATOM   6639  C  CD2   . PHE D 4  755  ? -7.721  -9.959  69.346  1.00 118.50 ? 755  PHE A CD2   1 
ATOM   6640  C  CE1   . PHE D 4  755  ? -10.328 -9.799  70.229  1.00 111.93 ? 755  PHE A CE1   1 
ATOM   6641  C  CE2   . PHE D 4  755  ? -8.017  -9.266  70.503  1.00 111.84 ? 755  PHE A CE2   1 
ATOM   6642  C  CZ    . PHE D 4  755  ? -9.321  -9.186  70.944  1.00 106.29 ? 755  PHE A CZ    1 
ATOM   6643  N  N     . ILE D 4  756  ? -7.638  -8.408  66.275  1.00 66.59  ? 756  ILE A N     1 
ATOM   6644  C  CA    . ILE D 4  756  ? -7.556  -6.986  66.606  1.00 59.88  ? 756  ILE A CA    1 
ATOM   6645  C  C     . ILE D 4  756  ? -8.428  -6.159  65.671  1.00 78.92  ? 756  ILE A C     1 
ATOM   6646  O  O     . ILE D 4  756  ? -9.075  -5.195  66.098  1.00 59.48  ? 756  ILE A O     1 
ATOM   6647  C  CB    . ILE D 4  756  ? -6.088  -6.518  66.577  1.00 64.38  ? 756  ILE A CB    1 
ATOM   6648  C  CG1   . ILE D 4  756  ? -5.999  -4.988  66.617  1.00 60.19  ? 756  ILE A CG1   1 
ATOM   6649  C  CG2   . ILE D 4  756  ? -5.367  -7.093  65.362  1.00 66.06  ? 756  ILE A CG2   1 
ATOM   6650  C  CD1   . ILE D 4  756  ? -4.585  -4.450  66.730  1.00 73.26  ? 756  ILE A CD1   1 
ATOM   6651  N  N     . ASN D 4  757  ? -8.462  -6.524  64.385  1.00 98.32  ? 757  ASN A N     1 
ATOM   6652  C  CA    . ASN D 4  757  ? -9.281  -5.794  63.420  1.00 70.12  ? 757  ASN A CA    1 
ATOM   6653  C  C     . ASN D 4  757  ? -10.753 -5.829  63.809  1.00 67.79  ? 757  ASN A C     1 
ATOM   6654  O  O     . ASN D 4  757  ? -11.471 -4.836  63.646  1.00 59.52  ? 757  ASN A O     1 
ATOM   6655  C  CB    . ASN D 4  757  ? -9.090  -6.375  62.020  1.00 69.25  ? 757  ASN A CB    1 
ATOM   6656  C  CG    . ASN D 4  757  ? -7.643  -6.720  61.720  1.00 75.47  ? 757  ASN A CG    1 
ATOM   6657  O  OD1   . ASN D 4  757  ? -7.308  -7.882  61.492  1.00 85.35  ? 757  ASN A OD1   1 
ATOM   6658  N  ND2   . ASN D 4  757  ? -6.782  -5.709  61.701  1.00 71.86  ? 757  ASN A ND2   1 
ATOM   6659  N  N     . ILE D 4  758  ? -11.220 -6.970  64.320  1.00 64.94  ? 758  ILE A N     1 
ATOM   6660  C  CA    . ILE D 4  758  ? -12.603 -7.072  64.776  1.00 68.35  ? 758  ILE A CA    1 
ATOM   6661  C  C     . ILE D 4  758  ? -12.853 -6.123  65.940  1.00 71.41  ? 758  ILE A C     1 
ATOM   6662  O  O     . ILE D 4  758  ? -13.883 -5.440  65.992  1.00 86.34  ? 758  ILE A O     1 
ATOM   6663  C  CB    . ILE D 4  758  ? -12.930 -8.528  65.152  1.00 76.62  ? 758  ILE A CB    1 
ATOM   6664  C  CG1   . ILE D 4  758  ? -12.573 -9.468  63.999  1.00 64.67  ? 758  ILE A CG1   1 
ATOM   6665  C  CG2   . ILE D 4  758  ? -14.393 -8.662  65.537  1.00 76.71  ? 758  ILE A CG2   1 
ATOM   6666  C  CD1   . ILE D 4  758  ? -12.937 -10.911 64.249  1.00 66.57  ? 758  ILE A CD1   1 
ATOM   6667  N  N     . ALA D 4  759  ? -11.915 -6.065  66.889  1.00 61.15  ? 759  ALA A N     1 
ATOM   6668  C  CA    . ALA D 4  759  ? -12.071 -5.197  68.052  1.00 61.56  ? 759  ALA A CA    1 
ATOM   6669  C  C     . ALA D 4  759  ? -12.208 -3.739  67.638  1.00 60.96  ? 759  ALA A C     1 
ATOM   6670  O  O     . ALA D 4  759  ? -13.135 -3.039  68.065  1.00 61.37  ? 759  ALA A O     1 
ATOM   6671  C  CB    . ALA D 4  759  ? -10.880 -5.375  68.995  1.00 61.71  ? 759  ALA A CB    1 
ATOM   6672  N  N     . GLN D 4  760  ? -11.290 -3.264  66.796  1.00 60.04  ? 760  GLN A N     1 
ATOM   6673  C  CA    . GLN D 4  760  ? -11.296 -1.859  66.414  1.00 59.50  ? 760  GLN A CA    1 
ATOM   6674  C  C     . GLN D 4  760  ? -12.477 -1.526  65.512  1.00 73.90  ? 760  GLN A C     1 
ATOM   6675  O  O     . GLN D 4  760  ? -13.017 -0.417  65.584  1.00 90.77  ? 760  GLN A O     1 
ATOM   6676  C  CB    . GLN D 4  760  ? -9.979  -1.503  65.724  1.00 58.63  ? 760  GLN A CB    1 
ATOM   6677  C  CG    . GLN D 4  760  ? -8.753  -1.910  66.519  1.00 58.77  ? 760  GLN A CG    1 
ATOM   6678  C  CD    . GLN D 4  760  ? -7.480  -1.247  66.032  1.00 58.11  ? 760  GLN A CD    1 
ATOM   6679  O  OE1   . GLN D 4  760  ? -6.915  -1.635  65.009  1.00 66.04  ? 760  GLN A OE1   1 
ATOM   6680  N  NE2   . GLN D 4  760  ? -7.004  -0.260  66.778  1.00 65.18  ? 760  GLN A NE2   1 
ATOM   6681  N  N     . MET D 4  761  ? -12.897 -2.468  64.667  1.00 60.52  ? 761  MET A N     1 
ATOM   6682  C  CA    . MET D 4  761  ? -13.974 -2.170  63.732  1.00 71.72  ? 761  MET A CA    1 
ATOM   6683  C  C     . MET D 4  761  ? -15.333 -2.157  64.418  1.00 74.14  ? 761  MET A C     1 
ATOM   6684  O  O     . MET D 4  761  ? -16.239 -1.440  63.977  1.00 85.72  ? 761  MET A O     1 
ATOM   6685  C  CB    . MET D 4  761  ? -13.969 -3.179  62.584  1.00 90.92  ? 761  MET A CB    1 
ATOM   6686  C  CG    . MET D 4  761  ? -13.195 -2.721  61.359  1.00 69.94  ? 761  MET A CG    1 
ATOM   6687  S  SD    . MET D 4  761  ? -13.650 -3.654  59.887  1.00 91.46  ? 761  MET A SD    1 
ATOM   6688  C  CE    . MET D 4  761  ? -12.387 -4.924  59.862  1.00 110.67 ? 761  MET A CE    1 
ATOM   6689  N  N     . SER D 4  762  ? -15.501 -2.922  65.485  1.00 60.97  ? 762  SER A N     1 
ATOM   6690  C  CA    . SER D 4  762  ? -16.826 -3.094  66.066  1.00 61.95  ? 762  SER A CA    1 
ATOM   6691  C  C     . SER D 4  762  ? -16.949 -2.594  67.495  1.00 62.65  ? 762  SER A C     1 
ATOM   6692  O  O     . SER D 4  762  ? -17.987 -2.027  67.848  1.00 63.22  ? 762  SER A O     1 
ATOM   6693  C  CB    . SER D 4  762  ? -17.231 -4.572  66.006  1.00 62.57  ? 762  SER A CB    1 
ATOM   6694  O  OG    . SER D 4  762  ? -16.107 -5.408  66.208  1.00 106.34 ? 762  SER A OG    1 
ATOM   6695  N  N     . ALA D 4  763  ? -15.929 -2.774  68.333  1.00 62.67  ? 763  ALA A N     1 
ATOM   6696  C  CA    . ALA D 4  763  ? -16.067 -2.474  69.756  1.00 63.49  ? 763  ALA A CA    1 
ATOM   6697  C  C     . ALA D 4  763  ? -15.374 -1.175  70.152  1.00 63.10  ? 763  ALA A C     1 
ATOM   6698  O  O     . ALA D 4  763  ? -16.018 -0.253  70.660  1.00 63.51  ? 763  ALA A O     1 
ATOM   6699  C  CB    . ALA D 4  763  ? -15.520 -3.642  70.585  1.00 64.04  ? 763  ALA A CB    1 
ATOM   6700  N  N     . CYS D 4  764  ? -14.069 -1.078  69.906  1.00 62.36  ? 764  CYS A N     1 
ATOM   6701  C  CA    . CYS D 4  764  ? -13.291 0.092   70.295  1.00 62.05  ? 764  CYS A CA    1 
ATOM   6702  C  C     . CYS D 4  764  ? -11.918 0.019   69.648  1.00 76.45  ? 764  CYS A C     1 
ATOM   6703  O  O     . CYS D 4  764  ? -11.213 -0.984  69.796  1.00 102.71 ? 764  CYS A O     1 
ATOM   6704  C  CB    . CYS D 4  764  ? -13.158 0.180   71.818  1.00 72.12  ? 764  CYS A CB    1 
ATOM   6705  S  SG    . CYS D 4  764  ? -11.704 1.079   72.391  1.00 87.44  ? 764  CYS A SG    1 
ATOM   6706  N  N     . VAL D 4  765  ? -11.526 1.079   68.940  1.00 75.48  ? 765  VAL A N     1 
ATOM   6707  C  CA    . VAL D 4  765  ? -10.265 1.046   68.205  1.00 84.12  ? 765  VAL A CA    1 
ATOM   6708  C  C     . VAL D 4  765  ? -9.080  1.000   69.165  1.00 77.65  ? 765  VAL A C     1 
ATOM   6709  O  O     . VAL D 4  765  ? -8.083  0.319   68.904  1.00 90.61  ? 765  VAL A O     1 
ATOM   6710  C  CB    . VAL D 4  765  ? -10.197 2.225   67.215  1.00 69.87  ? 765  VAL A CB    1 
ATOM   6711  C  CG1   . VAL D 4  765  ? -10.576 3.494   67.894  1.00 62.17  ? 765  VAL A CG1   1 
ATOM   6712  C  CG2   . VAL D 4  765  ? -8.810  2.355   66.607  1.00 72.27  ? 765  VAL A CG2   1 
ATOM   6713  N  N     . GLY D 4  766  ? -9.175  1.696   70.299  1.00 71.86  ? 766  GLY A N     1 
ATOM   6714  C  CA    . GLY D 4  766  ? -8.250  1.508   71.398  1.00 70.98  ? 766  GLY A CA    1 
ATOM   6715  C  C     . GLY D 4  766  ? -7.495  2.787   71.735  1.00 65.97  ? 766  GLY A C     1 
ATOM   6716  O  O     . GLY D 4  766  ? -8.043  3.889   71.642  1.00 66.57  ? 766  GLY A O     1 
ATOM   6717  N  N     . GLN D 4  767  ? -6.231  2.621   72.120  1.00 80.21  ? 767  GLN A N     1 
ATOM   6718  C  CA    . GLN D 4  767  ? -5.404  3.689   72.668  1.00 83.87  ? 767  GLN A CA    1 
ATOM   6719  C  C     . GLN D 4  767  ? -4.239  3.966   71.728  1.00 69.56  ? 767  GLN A C     1 
ATOM   6720  O  O     . GLN D 4  767  ? -3.496  3.047   71.365  1.00 64.59  ? 767  GLN A O     1 
ATOM   6721  C  CB    . GLN D 4  767  ? -4.891  3.306   74.064  1.00 71.57  ? 767  GLN A CB    1 
ATOM   6722  C  CG    . GLN D 4  767  ? -3.791  4.196   74.631  1.00 63.62  ? 767  GLN A CG    1 
ATOM   6723  C  CD    . GLN D 4  767  ? -4.234  5.630   74.849  1.00 77.00  ? 767  GLN A CD    1 
ATOM   6724  O  OE1   . GLN D 4  767  ? -5.043  5.919   75.732  1.00 66.06  ? 767  GLN A OE1   1 
ATOM   6725  N  NE2   . GLN D 4  767  ? -3.696  6.540   74.047  1.00 106.37 ? 767  GLN A NE2   1 
ATOM   6726  N  N     . GLN D 4  768  ? -4.081  5.230   71.338  1.00 62.94  ? 768  GLN A N     1 
ATOM   6727  C  CA    . GLN D 4  768  ? -2.991  5.624   70.458  1.00 59.55  ? 768  GLN A CA    1 
ATOM   6728  C  C     . GLN D 4  768  ? -1.689  5.770   71.235  1.00 59.92  ? 768  GLN A C     1 
ATOM   6729  O  O     . GLN D 4  768  ? -1.682  6.054   72.436  1.00 70.73  ? 768  GLN A O     1 
ATOM   6730  C  CB    . GLN D 4  768  ? -3.320  6.935   69.742  1.00 59.18  ? 768  GLN A CB    1 
ATOM   6731  C  CG    . GLN D 4  768  ? -3.887  6.748   68.343  1.00 58.41  ? 768  GLN A CG    1 
ATOM   6732  C  CD    . GLN D 4  768  ? -4.976  5.694   68.288  1.00 65.09  ? 768  GLN A CD    1 
ATOM   6733  O  OE1   . GLN D 4  768  ? -5.841  5.631   69.163  1.00 77.91  ? 768  GLN A OE1   1 
ATOM   6734  N  NE2   . GLN D 4  768  ? -4.937  4.856   67.258  1.00 58.81  ? 768  GLN A NE2   1 
ATOM   6735  N  N     . SER D 4  769  ? -0.577  5.573   70.532  1.00 59.45  ? 769  SER A N     1 
ATOM   6736  C  CA    . SER D 4  769  ? 0.741   5.615   71.147  1.00 76.13  ? 769  SER A CA    1 
ATOM   6737  C  C     . SER D 4  769  ? 1.686   6.394   70.250  1.00 79.58  ? 769  SER A C     1 
ATOM   6738  O  O     . SER D 4  769  ? 1.749   6.150   69.041  1.00 75.71  ? 769  SER A O     1 
ATOM   6739  C  CB    . SER D 4  769  ? 1.291   4.203   71.398  1.00 103.66 ? 769  SER A CB    1 
ATOM   6740  O  OG    . SER D 4  769  ? 2.136   3.772   70.344  1.00 129.79 ? 769  SER A OG    1 
ATOM   6741  N  N     . VAL D 4  770  ? 2.407   7.338   70.844  1.00 93.02  ? 770  VAL A N     1 
ATOM   6742  C  CA    . VAL D 4  770  ? 3.455   8.082   70.160  1.00 91.68  ? 770  VAL A CA    1 
ATOM   6743  C  C     . VAL D 4  770  ? 4.753   7.849   70.915  1.00 89.57  ? 770  VAL A C     1 
ATOM   6744  O  O     . VAL D 4  770  ? 4.837   8.129   72.118  1.00 78.20  ? 770  VAL A O     1 
ATOM   6745  C  CB    . VAL D 4  770  ? 3.136   9.581   70.070  1.00 83.10  ? 770  VAL A CB    1 
ATOM   6746  C  CG1   . VAL D 4  770  ? 4.263   10.308  69.359  1.00 68.04  ? 770  VAL A CG1   1 
ATOM   6747  C  CG2   . VAL D 4  770  ? 1.820   9.793   69.346  1.00 78.06  ? 770  VAL A CG2   1 
ATOM   6748  N  N     . GLU D 4  771  ? 5.756   7.323   70.211  1.00 96.00  ? 771  GLU A N     1 
ATOM   6749  C  CA    . GLU D 4  771  ? 7.088   7.098   70.770  1.00 80.02  ? 771  GLU A CA    1 
ATOM   6750  C  C     . GLU D 4  771  ? 7.044   6.163   71.974  1.00 85.53  ? 771  GLU A C     1 
ATOM   6751  O  O     . GLU D 4  771  ? 7.873   6.259   72.883  1.00 87.46  ? 771  GLU A O     1 
ATOM   6752  C  CB    . GLU D 4  771  ? 7.749   8.426   71.146  1.00 72.04  ? 771  GLU A CB    1 
ATOM   6753  C  CG    . GLU D 4  771  ? 9.136   8.618   70.582  1.00 76.76  ? 771  GLU A CG    1 
ATOM   6754  C  CD    . GLU D 4  771  ? 9.490   10.083  70.460  1.00 87.74  ? 771  GLU A CD    1 
ATOM   6755  O  OE1   . GLU D 4  771  ? 9.051   10.716  69.477  1.00 89.68  ? 771  GLU A OE1   1 
ATOM   6756  O  OE2   . GLU D 4  771  ? 10.197  10.600  71.348  1.00 98.33  ? 771  GLU A OE2   1 
ATOM   6757  N  N     . GLY D 4  772  ? 6.076   5.249   71.991  1.00 90.34  ? 772  GLY A N     1 
ATOM   6758  C  CA    . GLY D 4  772  ? 5.896   4.342   73.101  1.00 79.45  ? 772  GLY A CA    1 
ATOM   6759  C  C     . GLY D 4  772  ? 4.995   4.850   74.204  1.00 65.14  ? 772  GLY A C     1 
ATOM   6760  O  O     . GLY D 4  772  ? 4.612   4.062   75.079  1.00 80.05  ? 772  GLY A O     1 
ATOM   6761  N  N     . LYS D 4  773  ? 4.635   6.128   74.192  1.00 61.53  ? 773  LYS A N     1 
ATOM   6762  C  CA    . LYS D 4  773  ? 3.832   6.725   75.247  1.00 62.23  ? 773  LYS A CA    1 
ATOM   6763  C  C     . LYS D 4  773  ? 2.520   7.242   74.671  1.00 61.79  ? 773  LYS A C     1 
ATOM   6764  O  O     . LYS D 4  773  ? 2.326   7.297   73.455  1.00 71.35  ? 773  LYS A O     1 
ATOM   6765  C  CB    . LYS D 4  773  ? 4.590   7.866   75.939  1.00 62.89  ? 773  LYS A CB    1 
ATOM   6766  C  CG    . LYS D 4  773  ? 6.064   7.581   76.176  1.00 63.20  ? 773  LYS A CG    1 
ATOM   6767  C  CD    . LYS D 4  773  ? 6.691   8.626   77.080  1.00 64.08  ? 773  LYS A CD    1 
ATOM   6768  C  CE    . LYS D 4  773  ? 5.977   8.673   78.420  1.00 79.84  ? 773  LYS A CE    1 
ATOM   6769  N  NZ    . LYS D 4  773  ? 6.551   9.711   79.314  1.00 90.08  ? 773  LYS A NZ    1 
ATOM   6770  N  N     . ARG D 4  774  ? 1.619   7.634   75.569  1.00 62.43  ? 774  ARG A N     1 
ATOM   6771  C  CA    . ARG D 4  774  ? 0.365   8.255   75.170  1.00 62.20  ? 774  ARG A CA    1 
ATOM   6772  C  C     . ARG D 4  774  ? 0.633   9.627   74.549  1.00 61.92  ? 774  ARG A C     1 
ATOM   6773  O  O     . ARG D 4  774  ? 1.774   10.091  74.458  1.00 61.94  ? 774  ARG A O     1 
ATOM   6774  C  CB    . ARG D 4  774  ? -0.573  8.378   76.370  1.00 74.09  ? 774  ARG A CB    1 
ATOM   6775  C  CG    . ARG D 4  774  ? -0.790  7.082   77.127  1.00 67.43  ? 774  ARG A CG    1 
ATOM   6776  C  CD    . ARG D 4  774  ? -1.153  7.347   78.585  1.00 70.15  ? 774  ARG A CD    1 
ATOM   6777  N  NE    . ARG D 4  774  ? -2.563  7.677   78.782  1.00 69.38  ? 774  ARG A NE    1 
ATOM   6778  C  CZ    . ARG D 4  774  ? -3.073  8.105   79.935  1.00 65.94  ? 774  ARG A CZ    1 
ATOM   6779  N  NH1   . ARG D 4  774  ? -2.286  8.275   80.989  1.00 66.74  ? 774  ARG A NH1   1 
ATOM   6780  N  NH2   . ARG D 4  774  ? -4.368  8.376   80.033  1.00 66.19  ? 774  ARG A NH2   1 
ATOM   6781  N  N     . ILE D 4  775  ? -0.441  10.290  74.119  1.00 65.37  ? 775  ILE A N     1 
ATOM   6782  C  CA    . ILE D 4  775  ? -0.306  11.584  73.457  1.00 75.55  ? 775  ILE A CA    1 
ATOM   6783  C  C     . ILE D 4  775  ? 0.205   12.612  74.457  1.00 66.00  ? 775  ILE A C     1 
ATOM   6784  O  O     . ILE D 4  775  ? -0.362  12.782  75.544  1.00 66.81  ? 775  ILE A O     1 
ATOM   6785  C  CB    . ILE D 4  775  ? -1.642  12.019  72.836  1.00 88.32  ? 775  ILE A CB    1 
ATOM   6786  C  CG1   . ILE D 4  775  ? -2.268  10.868  72.046  1.00 84.51  ? 775  ILE A CG1   1 
ATOM   6787  C  CG2   . ILE D 4  775  ? -1.439  13.218  71.926  1.00 91.21  ? 775  ILE A CG2   1 
ATOM   6788  C  CD1   . ILE D 4  775  ? -1.432  10.390  70.885  1.00 91.79  ? 775  ILE A CD1   1 
ATOM   6789  N  N     . ALA D 4  776  ? 1.277   13.306  74.089  1.00 65.08  ? 776  ALA A N     1 
ATOM   6790  C  CA    . ALA D 4  776  ? 1.949   14.232  74.985  1.00 88.99  ? 776  ALA A CA    1 
ATOM   6791  C  C     . ALA D 4  776  ? 1.305   15.616  74.930  1.00 75.51  ? 776  ALA A C     1 
ATOM   6792  O  O     . ALA D 4  776  ? 0.520   15.934  74.035  1.00 71.93  ? 776  ALA A O     1 
ATOM   6793  C  CB    . ALA D 4  776  ? 3.436   14.322  74.639  1.00 109.39 ? 776  ALA A CB    1 
ATOM   6794  N  N     . PHE D 4  777  ? 1.652   16.447  75.916  1.00 76.70  ? 777  PHE A N     1 
ATOM   6795  C  CA    . PHE D 4  777  ? 1.157   17.822  75.988  1.00 77.46  ? 777  PHE A CA    1 
ATOM   6796  C  C     . PHE D 4  777  ? 1.986   18.685  75.041  1.00 72.98  ? 777  PHE A C     1 
ATOM   6797  O  O     . PHE D 4  777  ? 2.937   19.367  75.434  1.00 72.65  ? 777  PHE A O     1 
ATOM   6798  C  CB    . PHE D 4  777  ? 1.219   18.362  77.415  1.00 87.75  ? 777  PHE A CB    1 
ATOM   6799  C  CG    . PHE D 4  777  ? 0.717   17.406  78.466  1.00 83.74  ? 777  PHE A CG    1 
ATOM   6800  C  CD1   . PHE D 4  777  ? 1.580   16.526  79.094  1.00 85.68  ? 777  PHE A CD1   1 
ATOM   6801  C  CD2   . PHE D 4  777  ? -0.616  17.405  78.838  1.00 75.81  ? 777  PHE A CD2   1 
ATOM   6802  C  CE1   . PHE D 4  777  ? 1.114   15.656  80.064  1.00 96.45  ? 777  PHE A CE1   1 
ATOM   6803  C  CE2   . PHE D 4  777  ? -1.086  16.543  79.808  1.00 68.25  ? 777  PHE A CE2   1 
ATOM   6804  C  CZ    . PHE D 4  777  ? -0.221  15.668  80.419  1.00 87.67  ? 777  PHE A CZ    1 
ATOM   6805  N  N     . GLY D 4  778  ? 1.620   18.646  73.758  1.00 81.81  ? 778  GLY A N     1 
ATOM   6806  C  CA    . GLY D 4  778  ? 2.223   19.570  72.812  1.00 69.81  ? 778  GLY A CA    1 
ATOM   6807  C  C     . GLY D 4  778  ? 1.917   21.007  73.177  1.00 71.19  ? 778  GLY A C     1 
ATOM   6808  O  O     . GLY D 4  778  ? 2.807   21.862  73.205  1.00 70.57  ? 778  GLY A O     1 
ATOM   6809  N  N     . PHE D 4  779  ? 0.650   21.285  73.473  1.00 71.48  ? 779  PHE A N     1 
ATOM   6810  C  CA    . PHE D 4  779  ? 0.282   22.531  74.120  1.00 89.59  ? 779  PHE A CA    1 
ATOM   6811  C  C     . PHE D 4  779  ? 0.700   22.482  75.588  1.00 88.29  ? 779  PHE A C     1 
ATOM   6812  O  O     . PHE D 4  779  ? 0.993   21.417  76.139  1.00 94.46  ? 779  PHE A O     1 
ATOM   6813  C  CB    . PHE D 4  779  ? -1.223  22.788  73.986  1.00 96.66  ? 779  PHE A CB    1 
ATOM   6814  C  CG    . PHE D 4  779  ? -1.675  23.031  72.567  1.00 78.31  ? 779  PHE A CG    1 
ATOM   6815  C  CD1   . PHE D 4  779  ? -1.999  21.972  71.738  1.00 71.71  ? 779  PHE A CD1   1 
ATOM   6816  C  CD2   . PHE D 4  779  ? -1.755  24.316  72.058  1.00 79.35  ? 779  PHE A CD2   1 
ATOM   6817  C  CE1   . PHE D 4  779  ? -2.406  22.193  70.431  1.00 68.09  ? 779  PHE A CE1   1 
ATOM   6818  C  CE2   . PHE D 4  779  ? -2.161  24.539  70.749  1.00 73.78  ? 779  PHE A CE2   1 
ATOM   6819  C  CZ    . PHE D 4  779  ? -2.486  23.474  69.938  1.00 65.69  ? 779  PHE A CZ    1 
ATOM   6820  N  N     . VAL D 4  780  ? 0.735   23.651  76.220  1.00 76.66  ? 780  VAL A N     1 
ATOM   6821  C  CA    . VAL D 4  780  ? 1.285   23.752  77.568  1.00 70.13  ? 780  VAL A CA    1 
ATOM   6822  C  C     . VAL D 4  780  ? 0.378   22.969  78.516  1.00 78.50  ? 780  VAL A C     1 
ATOM   6823  O  O     . VAL D 4  780  ? -0.760  23.372  78.779  1.00 99.48  ? 780  VAL A O     1 
ATOM   6824  C  CB    . VAL D 4  780  ? 1.428   25.215  78.013  1.00 71.25  ? 780  VAL A CB    1 
ATOM   6825  C  CG1   . VAL D 4  780  ? 1.670   25.284  79.505  1.00 72.50  ? 780  VAL A CG1   1 
ATOM   6826  C  CG2   . VAL D 4  780  ? 2.570   25.879  77.265  1.00 78.81  ? 780  VAL A CG2   1 
ATOM   6827  N  N     . ASP D 4  781  ? 0.881   21.839  79.012  1.00 76.24  ? 781  ASP A N     1 
ATOM   6828  C  CA    . ASP D 4  781  ? 0.188   21.004  79.998  1.00 77.97  ? 781  ASP A CA    1 
ATOM   6829  C  C     . ASP D 4  781  ? -1.196  20.561  79.529  1.00 92.99  ? 781  ASP A C     1 
ATOM   6830  O  O     . ASP D 4  781  ? -2.092  20.328  80.345  1.00 91.54  ? 781  ASP A O     1 
ATOM   6831  C  CB    . ASP D 4  781  ? 0.092   21.713  81.350  1.00 72.82  ? 781  ASP A CB    1 
ATOM   6832  C  CG    . ASP D 4  781  ? 1.422   21.761  82.073  1.00 86.06  ? 781  ASP A CG    1 
ATOM   6833  O  OD1   . ASP D 4  781  ? 2.448   21.399  81.458  1.00 92.84  ? 781  ASP A OD1   1 
ATOM   6834  O  OD2   . ASP D 4  781  ? 1.441   22.146  83.260  1.00 100.89 ? 781  ASP A OD2   1 
ATOM   6835  N  N     . ARG D 4  782  ? -1.382  20.433  78.217  1.00 82.61  ? 782  ARG A N     1 
ATOM   6836  C  CA    . ARG D 4  782  ? -2.599  19.848  77.673  1.00 66.89  ? 782  ARG A CA    1 
ATOM   6837  C  C     . ARG D 4  782  ? -2.308  19.368  76.259  1.00 65.63  ? 782  ARG A C     1 
ATOM   6838  O  O     . ARG D 4  782  ? -1.430  19.906  75.578  1.00 65.31  ? 782  ARG A O     1 
ATOM   6839  C  CB    . ARG D 4  782  ? -3.771  20.834  77.689  1.00 67.34  ? 782  ARG A CB    1 
ATOM   6840  C  CG    . ARG D 4  782  ? -3.440  22.235  77.222  1.00 67.55  ? 782  ARG A CG    1 
ATOM   6841  C  CD    . ARG D 4  782  ? -4.676  23.100  77.351  1.00 68.11  ? 782  ARG A CD    1 
ATOM   6842  N  NE    . ARG D 4  782  ? -4.533  24.399  76.707  1.00 68.22  ? 782  ARG A NE    1 
ATOM   6843  C  CZ    . ARG D 4  782  ? -5.549  25.226  76.476  1.00 68.53  ? 782  ARG A CZ    1 
ATOM   6844  N  NH1   . ARG D 4  782  ? -6.780  24.884  76.840  1.00 68.77  ? 782  ARG A NH1   1 
ATOM   6845  N  NH2   . ARG D 4  782  ? -5.337  26.392  75.880  1.00 68.67  ? 782  ARG A NH2   1 
ATOM   6846  N  N     . THR D 4  783  ? -3.043  18.334  75.837  1.00 87.34  ? 783  THR A N     1 
ATOM   6847  C  CA    . THR D 4  783  ? -2.844  17.769  74.504  1.00 96.96  ? 783  THR A CA    1 
ATOM   6848  C  C     . THR D 4  783  ? -3.530  18.602  73.429  1.00 80.00  ? 783  THR A C     1 
ATOM   6849  O  O     . THR D 4  783  ? -3.022  18.707  72.306  1.00 65.47  ? 783  THR A O     1 
ATOM   6850  C  CB    . THR D 4  783  ? -3.364  16.331  74.447  1.00 80.39  ? 783  THR A CB    1 
ATOM   6851  O  OG1   . THR D 4  783  ? -4.694  16.282  74.979  1.00 72.20  ? 783  THR A OG1   1 
ATOM   6852  C  CG2   . THR D 4  783  ? -2.462  15.407  75.246  1.00 97.30  ? 783  THR A CG2   1 
ATOM   6853  N  N     . LEU D 4  784  ? -4.679  19.188  73.749  1.00 63.89  ? 784  LEU A N     1 
ATOM   6854  C  CA    . LEU D 4  784  ? -5.470  19.957  72.804  1.00 63.59  ? 784  LEU A CA    1 
ATOM   6855  C  C     . LEU D 4  784  ? -6.132  21.119  73.524  1.00 64.60  ? 784  LEU A C     1 
ATOM   6856  O  O     . LEU D 4  784  ? -6.489  21.002  74.703  1.00 81.95  ? 784  LEU A O     1 
ATOM   6857  C  CB    . LEU D 4  784  ? -6.546  19.093  72.130  1.00 62.96  ? 784  LEU A CB    1 
ATOM   6858  C  CG    . LEU D 4  784  ? -6.054  18.171  71.013  1.00 61.86  ? 784  LEU A CG    1 
ATOM   6859  C  CD1   . LEU D 4  784  ? -7.232  17.496  70.331  1.00 61.39  ? 784  LEU A CD1   1 
ATOM   6860  C  CD2   . LEU D 4  784  ? -5.199  18.932  70.003  1.00 61.37  ? 784  LEU A CD2   1 
ATOM   6861  N  N     . PRO D 4  785  ? -6.326  22.246  72.835  1.00 64.60  ? 785  PRO A N     1 
ATOM   6862  C  CA    . PRO D 4  785  ? -6.868  23.442  73.497  1.00 65.81  ? 785  PRO A CA    1 
ATOM   6863  C  C     . PRO D 4  785  ? -8.345  23.349  73.852  1.00 66.07  ? 785  PRO A C     1 
ATOM   6864  O  O     . PRO D 4  785  ? -8.946  24.358  74.229  1.00 71.18  ? 785  PRO A O     1 
ATOM   6865  C  CB    . PRO D 4  785  ? -6.626  24.551  72.465  1.00 71.86  ? 785  PRO A CB    1 
ATOM   6866  C  CG    . PRO D 4  785  ? -5.562  24.017  71.568  1.00 65.93  ? 785  PRO A CG    1 
ATOM   6867  C  CD    . PRO D 4  785  ? -5.813  22.551  71.490  1.00 63.77  ? 785  PRO A CD    1 
ATOM   6868  N  N     . HIS D 4  786  ? -8.949  22.168  73.728  1.00 65.59  ? 786  HIS A N     1 
ATOM   6869  C  CA    . HIS D 4  786  ? -10.305 21.929  74.206  1.00 66.11  ? 786  HIS A CA    1 
ATOM   6870  C  C     . HIS D 4  786  ? -10.324 21.208  75.545  1.00 77.21  ? 786  HIS A C     1 
ATOM   6871  O  O     . HIS D 4  786  ? -11.399 20.825  76.020  1.00 76.53  ? 786  HIS A O     1 
ATOM   6872  C  CB    . HIS D 4  786  ? -11.102 21.137  73.170  1.00 68.07  ? 786  HIS A CB    1 
ATOM   6873  C  CG    . HIS D 4  786  ? -10.728 21.454  71.758  1.00 80.93  ? 786  HIS A CG    1 
ATOM   6874  N  ND1   . HIS D 4  786  ? -9.591  20.954  71.160  1.00 81.75  ? 786  HIS A ND1   1 
ATOM   6875  C  CD2   . HIS D 4  786  ? -11.336 22.227  70.827  1.00 76.78  ? 786  HIS A CD2   1 
ATOM   6876  C  CE1   . HIS D 4  786  ? -9.516  21.404  69.920  1.00 85.32  ? 786  HIS A CE1   1 
ATOM   6877  N  NE2   . HIS D 4  786  ? -10.563 22.177  69.693  1.00 88.04  ? 786  HIS A NE2   1 
ATOM   6878  N  N     . PHE D 4  787  ? -9.160  21.018  76.159  1.00 86.01  ? 787  PHE A N     1 
ATOM   6879  C  CA    . PHE D 4  787  ? -9.031  20.403  77.469  1.00 76.43  ? 787  PHE A CA    1 
ATOM   6880  C  C     . PHE D 4  787  ? -8.441  21.414  78.440  1.00 70.46  ? 787  PHE A C     1 
ATOM   6881  O  O     . PHE D 4  787  ? -7.579  22.217  78.067  1.00 68.61  ? 787  PHE A O     1 
ATOM   6882  C  CB    . PHE D 4  787  ? -8.128  19.164  77.414  1.00 91.29  ? 787  PHE A CB    1 
ATOM   6883  C  CG    . PHE D 4  787  ? -8.616  18.092  76.483  1.00 81.77  ? 787  PHE A CG    1 
ATOM   6884  C  CD1   . PHE D 4  787  ? -7.738  17.449  75.625  1.00 65.08  ? 787  PHE A CD1   1 
ATOM   6885  C  CD2   . PHE D 4  787  ? -9.949  17.715  76.476  1.00 74.59  ? 787  PHE A CD2   1 
ATOM   6886  C  CE1   . PHE D 4  787  ? -8.183  16.460  74.769  1.00 64.26  ? 787  PHE A CE1   1 
ATOM   6887  C  CE2   . PHE D 4  787  ? -10.398 16.724  75.624  1.00 68.49  ? 787  PHE A CE2   1 
ATOM   6888  C  CZ    . PHE D 4  787  ? -9.515  16.096  74.771  1.00 64.45  ? 787  PHE A CZ    1 
ATOM   6889  N  N     . SER D 4  788  ? -8.907  21.375  79.683  1.00 69.79  ? 788  SER A N     1 
ATOM   6890  C  CA    . SER D 4  788  ? -8.243  22.134  80.726  1.00 70.84  ? 788  SER A CA    1 
ATOM   6891  C  C     . SER D 4  788  ? -6.857  21.547  80.978  1.00 70.59  ? 788  SER A C     1 
ATOM   6892  O  O     . SER D 4  788  ? -6.569  20.397  80.635  1.00 69.81  ? 788  SER A O     1 
ATOM   6893  C  CB    . SER D 4  788  ? -9.075  22.133  82.006  1.00 72.08  ? 788  SER A CB    1 
ATOM   6894  O  OG    . SER D 4  788  ? -10.448 22.334  81.716  1.00 72.20  ? 788  SER A OG    1 
ATOM   6895  N  N     . LYS D 4  789  ? -5.984  22.358  81.567  1.00 71.33  ? 789  LYS A N     1 
ATOM   6896  C  CA    . LYS D 4  789  ? -4.615  21.920  81.789  1.00 71.19  ? 789  LYS A CA    1 
ATOM   6897  C  C     . LYS D 4  789  ? -4.556  20.829  82.856  1.00 81.98  ? 789  LYS A C     1 
ATOM   6898  O  O     . LYS D 4  789  ? -5.438  20.702  83.711  1.00 72.44  ? 789  LYS A O     1 
ATOM   6899  C  CB    . LYS D 4  789  ? -3.729  23.099  82.188  1.00 72.01  ? 789  LYS A CB    1 
ATOM   6900  C  CG    . LYS D 4  789  ? -3.199  23.890  81.010  1.00 71.36  ? 789  LYS A CG    1 
ATOM   6901  C  CD    . LYS D 4  789  ? -2.344  25.056  81.470  1.00 72.32  ? 789  LYS A CD    1 
ATOM   6902  C  CE    . LYS D 4  789  ? -1.845  25.878  80.294  1.00 71.76  ? 789  LYS A CE    1 
ATOM   6903  N  NZ    . LYS D 4  789  ? -1.181  27.135  80.734  1.00 93.70  ? 789  LYS A NZ    1 
ATOM   6904  N  N     . ASP D 4  790  ? -3.493  20.027  82.787  1.00 92.01  ? 790  ASP A N     1 
ATOM   6905  C  CA    . ASP D 4  790  ? -3.272  18.917  83.714  1.00 81.17  ? 790  ASP A CA    1 
ATOM   6906  C  C     . ASP D 4  790  ? -4.451  17.945  83.705  1.00 78.47  ? 790  ASP A C     1 
ATOM   6907  O  O     . ASP D 4  790  ? -4.957  17.532  84.750  1.00 98.04  ? 790  ASP A O     1 
ATOM   6908  C  CB    . ASP D 4  790  ? -2.990  19.428  85.129  1.00 74.64  ? 790  ASP A CB    1 
ATOM   6909  C  CG    . ASP D 4  790  ? -1.799  20.362  85.181  1.00 93.06  ? 790  ASP A CG    1 
ATOM   6910  O  OD1   . ASP D 4  790  ? -1.991  21.586  85.020  1.00 97.91  ? 790  ASP A OD1   1 
ATOM   6911  O  OD2   . ASP D 4  790  ? -0.667  19.869  85.371  1.00 97.30  ? 790  ASP A OD2   1 
ATOM   6912  N  N     . ASP D 4  791  ? -4.891  17.584  82.503  1.00 70.19  ? 791  ASP A N     1 
ATOM   6913  C  CA    . ASP D 4  791  ? -5.906  16.556  82.314  1.00 72.56  ? 791  ASP A CA    1 
ATOM   6914  C  C     . ASP D 4  791  ? -5.217  15.283  81.843  1.00 77.62  ? 791  ASP A C     1 
ATOM   6915  O  O     . ASP D 4  791  ? -4.637  15.256  80.752  1.00 68.01  ? 791  ASP A O     1 
ATOM   6916  C  CB    . ASP D 4  791  ? -6.967  16.998  81.306  1.00 78.82  ? 791  ASP A CB    1 
ATOM   6917  C  CG    . ASP D 4  791  ? -8.176  16.079  81.291  1.00 69.22  ? 791  ASP A CG    1 
ATOM   6918  O  OD1   . ASP D 4  791  ? -8.175  15.079  82.039  1.00 69.59  ? 791  ASP A OD1   1 
ATOM   6919  O  OD2   . ASP D 4  791  ? -9.125  16.351  80.525  1.00 68.85  ? 791  ASP A OD2   1 
ATOM   6920  N  N     . TYR D 4  792  ? -5.280  14.236  82.667  1.00 98.01  ? 792  TYR A N     1 
ATOM   6921  C  CA    . TYR D 4  792  ? -4.674  12.946  82.362  1.00 85.91  ? 792  TYR A CA    1 
ATOM   6922  C  C     . TYR D 4  792  ? -5.721  11.866  82.103  1.00 83.78  ? 792  TYR A C     1 
ATOM   6923  O  O     . TYR D 4  792  ? -5.394  10.674  82.115  1.00 72.15  ? 792  TYR A O     1 
ATOM   6924  C  CB    . TYR D 4  792  ? -3.736  12.521  83.494  1.00 75.41  ? 792  TYR A CB    1 
ATOM   6925  C  CG    . TYR D 4  792  ? -2.504  13.392  83.630  1.00 73.65  ? 792  TYR A CG    1 
ATOM   6926  C  CD1   . TYR D 4  792  ? -2.552  14.596  84.321  1.00 74.55  ? 792  TYR A CD1   1 
ATOM   6927  C  CD2   . TYR D 4  792  ? -1.293  13.011  83.064  1.00 73.10  ? 792  TYR A CD2   1 
ATOM   6928  C  CE1   . TYR D 4  792  ? -1.428  15.397  84.445  1.00 79.22  ? 792  TYR A CE1   1 
ATOM   6929  C  CE2   . TYR D 4  792  ? -0.163  13.803  83.186  1.00 81.11  ? 792  TYR A CE2   1 
ATOM   6930  C  CZ    . TYR D 4  792  ? -0.236  14.997  83.876  1.00 84.71  ? 792  TYR A CZ    1 
ATOM   6931  O  OH    . TYR D 4  792  ? 0.883   15.792  83.998  1.00 74.56  ? 792  TYR A OH    1 
ATOM   6932  N  N     . SER D 4  793  ? -6.972  12.263  81.854  1.00 94.24  ? 793  SER A N     1 
ATOM   6933  C  CA    . SER D 4  793  ? -8.084  11.355  81.598  1.00 83.62  ? 793  SER A CA    1 
ATOM   6934  C  C     . SER D 4  793  ? -7.786  10.490  80.376  1.00 78.39  ? 793  SER A C     1 
ATOM   6935  O  O     . SER D 4  793  ? -6.834  10.777  79.640  1.00 108.32 ? 793  SER A O     1 
ATOM   6936  C  CB    . SER D 4  793  ? -9.376  12.157  81.403  1.00 85.99  ? 793  SER A CB    1 
ATOM   6937  O  OG    . SER D 4  793  ? -9.167  13.267  80.550  1.00 100.52 ? 793  SER A OG    1 
ATOM   6938  N  N     . PRO D 4  794  ? -8.551  9.419   80.129  1.00 67.14  ? 794  PRO A N     1 
ATOM   6939  C  CA    . PRO D 4  794  ? -8.300  8.638   78.906  1.00 75.86  ? 794  PRO A CA    1 
ATOM   6940  C  C     . PRO D 4  794  ? -8.503  9.451   77.639  1.00 73.80  ? 794  PRO A C     1 
ATOM   6941  O  O     . PRO D 4  794  ? -7.678  9.375   76.719  1.00 64.30  ? 794  PRO A O     1 
ATOM   6942  C  CB    . PRO D 4  794  ? -9.303  7.477   79.010  1.00 79.01  ? 794  PRO A CB    1 
ATOM   6943  C  CG    . PRO D 4  794  ? -9.756  7.461   80.425  1.00 84.83  ? 794  PRO A CG    1 
ATOM   6944  C  CD    . PRO D 4  794  ? -9.666  8.865   80.916  1.00 75.51  ? 794  PRO A CD    1 
ATOM   6945  N  N     . GLU D 4  795  ? -9.572  10.253  77.580  1.00 72.61  ? 795  GLU A N     1 
ATOM   6946  C  CA    . GLU D 4  795  ? -9.850  11.053  76.390  1.00 64.75  ? 795  GLU A CA    1 
ATOM   6947  C  C     . GLU D 4  795  ? -8.757  12.083  76.133  1.00 64.44  ? 795  GLU A C     1 
ATOM   6948  O  O     . GLU D 4  795  ? -8.297  12.231  74.996  1.00 87.94  ? 795  GLU A O     1 
ATOM   6949  C  CB    . GLU D 4  795  ? -11.207 11.746  76.531  1.00 65.32  ? 795  GLU A CB    1 
ATOM   6950  C  CG    . GLU D 4  795  ? -12.281 10.898  77.196  1.00 95.83  ? 795  GLU A CG    1 
ATOM   6951  C  CD    . GLU D 4  795  ? -12.397 11.172  78.682  1.00 106.52 ? 795  GLU A CD    1 
ATOM   6952  O  OE1   . GLU D 4  795  ? -11.936 12.246  79.126  1.00 107.59 ? 795  GLU A OE1   1 
ATOM   6953  O  OE2   . GLU D 4  795  ? -12.935 10.309  79.407  1.00 115.84 ? 795  GLU A OE2   1 
ATOM   6954  N  N     . SER D 4  796  ? -8.327  12.801  77.174  1.00 65.24  ? 796  SER A N     1 
ATOM   6955  C  CA    . SER D 4  796  ? -7.332  13.854  76.993  1.00 65.11  ? 796  SER A CA    1 
ATOM   6956  C  C     . SER D 4  796  ? -5.999  13.298  76.512  1.00 64.42  ? 796  SER A C     1 
ATOM   6957  O  O     . SER D 4  796  ? -5.288  13.962  75.749  1.00 63.90  ? 796  SER A O     1 
ATOM   6958  C  CB    . SER D 4  796  ? -7.149  14.629  78.303  1.00 66.25  ? 796  SER A CB    1 
ATOM   6959  O  OG    . SER D 4  796  ? -5.938  15.367  78.328  1.00 66.26  ? 796  SER A OG    1 
ATOM   6960  N  N     . LYS D 4  797  ? -5.648  12.087  76.927  1.00 67.05  ? 797  LYS A N     1 
ATOM   6961  C  CA    . LYS D 4  797  ? -4.341  11.522  76.624  1.00 85.28  ? 797  LYS A CA    1 
ATOM   6962  C  C     . LYS D 4  797  ? -4.326  10.679  75.356  1.00 76.71  ? 797  LYS A C     1 
ATOM   6963  O  O     . LYS D 4  797  ? -3.263  10.170  74.986  1.00 65.06  ? 797  LYS A O     1 
ATOM   6964  C  CB    . LYS D 4  797  ? -3.851  10.682  77.808  1.00 116.42 ? 797  LYS A CB    1 
ATOM   6965  C  CG    . LYS D 4  797  ? -3.038  11.454  78.844  1.00 95.66  ? 797  LYS A CG    1 
ATOM   6966  C  CD    . LYS D 4  797  ? -1.720  11.927  78.250  1.00 79.30  ? 797  LYS A CD    1 
ATOM   6967  C  CE    . LYS D 4  797  ? -0.734  12.359  79.325  1.00 86.07  ? 797  LYS A CE    1 
ATOM   6968  N  NZ    . LYS D 4  797  ? 0.658   12.444  78.796  1.00 85.32  ? 797  LYS A NZ    1 
ATOM   6969  N  N     . GLY D 4  798  ? -5.464  10.515  74.686  1.00 93.86  ? 798  GLY A N     1 
ATOM   6970  C  CA    . GLY D 4  798  ? -5.482  9.838   73.404  1.00 90.72  ? 798  GLY A CA    1 
ATOM   6971  C  C     . GLY D 4  798  ? -6.088  8.448   73.387  1.00 93.35  ? 798  GLY A C     1 
ATOM   6972  O  O     . GLY D 4  798  ? -5.591  7.565   72.679  1.00 85.67  ? 798  GLY A O     1 
ATOM   6973  N  N     . PHE D 4  799  ? -7.154  8.234   74.152  1.00 85.45  ? 799  PHE A N     1 
ATOM   6974  C  CA    . PHE D 4  799  ? -7.901  6.984   74.109  1.00 62.34  ? 799  PHE A CA    1 
ATOM   6975  C  C     . PHE D 4  799  ? -9.165  7.184   73.288  1.00 62.09  ? 799  PHE A C     1 
ATOM   6976  O  O     . PHE D 4  799  ? -9.854  8.200   73.429  1.00 62.41  ? 799  PHE A O     1 
ATOM   6977  C  CB    . PHE D 4  799  ? -8.267  6.496   75.511  1.00 63.40  ? 799  PHE A CB    1 
ATOM   6978  C  CG    . PHE D 4  799  ? -8.895  5.131   75.533  1.00 63.58  ? 799  PHE A CG    1 
ATOM   6979  C  CD1   . PHE D 4  799  ? -8.134  4.004   75.276  1.00 63.24  ? 799  PHE A CD1   1 
ATOM   6980  C  CD2   . PHE D 4  799  ? -10.242 4.973   75.816  1.00 64.16  ? 799  PHE A CD2   1 
ATOM   6981  C  CE1   . PHE D 4  799  ? -8.700  2.745   75.302  1.00 63.48  ? 799  PHE A CE1   1 
ATOM   6982  C  CE2   . PHE D 4  799  ? -10.815 3.713   75.843  1.00 64.41  ? 799  PHE A CE2   1 
ATOM   6983  C  CZ    . PHE D 4  799  ? -10.041 2.599   75.585  1.00 64.08  ? 799  PHE A CZ    1 
ATOM   6984  N  N     . VAL D 4  800  ? -9.465  6.210   72.436  1.00 63.08  ? 800  VAL A N     1 
ATOM   6985  C  CA    . VAL D 4  800  ? -10.568 6.290   71.485  1.00 61.29  ? 800  VAL A CA    1 
ATOM   6986  C  C     . VAL D 4  800  ? -11.607 5.256   71.897  1.00 61.90  ? 800  VAL A C     1 
ATOM   6987  O  O     . VAL D 4  800  ? -11.480 4.068   71.579  1.00 61.72  ? 800  VAL A O     1 
ATOM   6988  C  CB    . VAL D 4  800  ? -10.095 6.067   70.047  1.00 60.26  ? 800  VAL A CB    1 
ATOM   6989  C  CG1   . VAL D 4  800  ? -11.086 6.661   69.078  1.00 59.96  ? 800  VAL A CG1   1 
ATOM   6990  C  CG2   . VAL D 4  800  ? -8.723  6.681   69.842  1.00 59.77  ? 800  VAL A CG2   1 
ATOM   6991  N  N     . GLU D 4  801  ? -12.650 5.714   72.592  1.00 87.00  ? 801  GLU A N     1 
ATOM   6992  C  CA    . GLU D 4  801  ? -13.678 4.808   73.093  1.00 74.53  ? 801  GLU A CA    1 
ATOM   6993  C  C     . GLU D 4  801  ? -14.533 4.252   71.962  1.00 70.71  ? 801  GLU A C     1 
ATOM   6994  O  O     . GLU D 4  801  ? -14.914 3.075   71.982  1.00 63.35  ? 801  GLU A O     1 
ATOM   6995  C  CB    . GLU D 4  801  ? -14.542 5.534   74.125  1.00 69.02  ? 801  GLU A CB    1 
ATOM   6996  C  CG    . GLU D 4  801  ? -15.851 4.846   74.453  1.00 78.40  ? 801  GLU A CG    1 
ATOM   6997  C  CD    . GLU D 4  801  ? -16.601 5.541   75.572  1.00 98.23  ? 801  GLU A CD    1 
ATOM   6998  O  OE1   . GLU D 4  801  ? -17.565 4.950   76.105  1.00 106.24 ? 801  GLU A OE1   1 
ATOM   6999  O  OE2   . GLU D 4  801  ? -16.222 6.679   75.924  1.00 101.50 ? 801  GLU A OE2   1 
ATOM   7000  N  N     . ASN D 4  802  ? -14.838 5.081   70.968  1.00 85.72  ? 802  ASN A N     1 
ATOM   7001  C  CA    . ASN D 4  802  ? -15.690 4.668   69.864  1.00 69.28  ? 802  ASN A CA    1 
ATOM   7002  C  C     . ASN D 4  802  ? -14.960 3.698   68.940  1.00 77.30  ? 802  ASN A C     1 
ATOM   7003  O  O     . ASN D 4  802  ? -13.729 3.602   68.930  1.00 72.83  ? 802  ASN A O     1 
ATOM   7004  C  CB    . ASN D 4  802  ? -16.155 5.883   69.065  1.00 65.90  ? 802  ASN A CB    1 
ATOM   7005  C  CG    . ASN D 4  802  ? -16.880 6.895   69.918  1.00 66.71  ? 802  ASN A CG    1 
ATOM   7006  O  OD1   . ASN D 4  802  ? -18.066 6.740   70.199  1.00 73.40  ? 802  ASN A OD1   1 
ATOM   7007  N  ND2   . ASN D 4  802  ? -16.175 7.943   70.331  1.00 66.64  ? 802  ASN A ND2   1 
ATOM   7008  N  N     . SER D 4  803  ? -15.744 2.974   68.151  1.00 64.41  ? 803  SER A N     1 
ATOM   7009  C  CA    . SER D 4  803  ? -15.223 2.092   67.121  1.00 60.69  ? 803  SER A CA    1 
ATOM   7010  C  C     . SER D 4  803  ? -15.346 2.758   65.755  1.00 61.05  ? 803  SER A C     1 
ATOM   7011  O  O     . SER D 4  803  ? -15.959 3.817   65.604  1.00 64.84  ? 803  SER A O     1 
ATOM   7012  C  CB    . SER D 4  803  ? -15.963 0.752   67.137  1.00 62.50  ? 803  SER A CB    1 
ATOM   7013  O  OG    . SER D 4  803  ? -17.363 0.940   67.012  1.00 61.80  ? 803  SER A OG    1 
ATOM   7014  N  N     . TYR D 4  804  ? -14.744 2.121   64.749  1.00 76.35  ? 804  TYR A N     1 
ATOM   7015  C  CA    . TYR D 4  804  ? -14.872 2.620   63.383  1.00 76.42  ? 804  TYR A CA    1 
ATOM   7016  C  C     . TYR D 4  804  ? -16.324 2.592   62.925  1.00 76.31  ? 804  TYR A C     1 
ATOM   7017  O  O     . TYR D 4  804  ? -16.777 3.494   62.210  1.00 58.74  ? 804  TYR A O     1 
ATOM   7018  C  CB    . TYR D 4  804  ? -13.996 1.798   62.440  1.00 74.30  ? 804  TYR A CB    1 
ATOM   7019  C  CG    . TYR D 4  804  ? -12.513 2.009   62.637  1.00 68.51  ? 804  TYR A CG    1 
ATOM   7020  C  CD1   . TYR D 4  804  ? -11.595 1.074   62.181  1.00 82.07  ? 804  TYR A CD1   1 
ATOM   7021  C  CD2   . TYR D 4  804  ? -12.029 3.144   63.271  1.00 69.15  ? 804  TYR A CD2   1 
ATOM   7022  C  CE1   . TYR D 4  804  ? -10.238 1.259   62.354  1.00 72.81  ? 804  TYR A CE1   1 
ATOM   7023  C  CE2   . TYR D 4  804  ? -10.670 3.338   63.448  1.00 77.02  ? 804  TYR A CE2   1 
ATOM   7024  C  CZ    . TYR D 4  804  ? -9.780  2.391   62.985  1.00 71.05  ? 804  TYR A CZ    1 
ATOM   7025  O  OH    . TYR D 4  804  ? -8.426  2.567   63.152  1.00 76.16  ? 804  TYR A OH    1 
ATOM   7026  N  N     . LEU D 4  805  ? -17.069 1.559   63.325  1.00 87.76  ? 805  LEU A N     1 
ATOM   7027  C  CA    . LEU D 4  805  ? -18.503 1.527   63.061  1.00 97.91  ? 805  LEU A CA    1 
ATOM   7028  C  C     . LEU D 4  805  ? -19.209 2.653   63.805  1.00 100.01 ? 805  LEU A C     1 
ATOM   7029  O  O     . LEU D 4  805  ? -20.042 3.368   63.235  1.00 87.91  ? 805  LEU A O     1 
ATOM   7030  C  CB    . LEU D 4  805  ? -19.072 0.161   63.456  1.00 105.34 ? 805  LEU A CB    1 
ATOM   7031  C  CG    . LEU D 4  805  ? -20.555 -0.180  63.255  1.00 84.48  ? 805  LEU A CG    1 
ATOM   7032  C  CD1   . LEU D 4  805  ? -21.399 0.180   64.477  1.00 87.77  ? 805  LEU A CD1   1 
ATOM   7033  C  CD2   . LEU D 4  805  ? -21.107 0.483   62.001  1.00 82.56  ? 805  LEU A CD2   1 
ATOM   7034  N  N     . ARG D 4  806  ? -18.880 2.828   65.086  1.00 117.68 ? 806  ARG A N     1 
ATOM   7035  C  CA    . ARG D 4  806  ? -19.489 3.897   65.870  1.00 110.98 ? 806  ARG A CA    1 
ATOM   7036  C  C     . ARG D 4  806  ? -19.091 5.269   65.338  1.00 95.46  ? 806  ARG A C     1 
ATOM   7037  O  O     . ARG D 4  806  ? -19.937 6.163   65.222  1.00 100.56 ? 806  ARG A O     1 
ATOM   7038  C  CB    . ARG D 4  806  ? -19.102 3.748   67.344  1.00 111.73 ? 806  ARG A CB    1 
ATOM   7039  C  CG    . ARG D 4  806  ? -19.870 2.654   68.082  1.00 106.21 ? 806  ARG A CG    1 
ATOM   7040  C  CD    . ARG D 4  806  ? -19.737 2.788   69.595  1.00 89.28  ? 806  ARG A CD    1 
ATOM   7041  N  NE    . ARG D 4  806  ? -20.874 2.191   70.292  1.00 84.40  ? 806  ARG A NE    1 
ATOM   7042  C  CZ    . ARG D 4  806  ? -22.077 2.753   70.379  1.00 103.06 ? 806  ARG A CZ    1 
ATOM   7043  N  NH1   . ARG D 4  806  ? -23.055 2.138   71.030  1.00 94.36  ? 806  ARG A NH1   1 
ATOM   7044  N  NH2   . ARG D 4  806  ? -22.303 3.934   69.819  1.00 124.94 ? 806  ARG A NH2   1 
ATOM   7045  N  N     . GLY D 4  807  ? -17.815 5.455   65.003  1.00 60.39  ? 807  GLY A N     1 
ATOM   7046  C  CA    . GLY D 4  807  ? -17.342 6.736   64.515  1.00 59.85  ? 807  GLY A CA    1 
ATOM   7047  C  C     . GLY D 4  807  ? -16.586 7.547   65.550  1.00 62.48  ? 807  GLY A C     1 
ATOM   7048  O  O     . GLY D 4  807  ? -17.036 7.692   66.690  1.00 67.79  ? 807  GLY A O     1 
ATOM   7049  N  N     . LEU D 4  808  ? -15.451 8.112   65.152  1.00 59.98  ? 808  LEU A N     1 
ATOM   7050  C  CA    . LEU D 4  808  ? -14.571 8.835   66.058  1.00 59.48  ? 808  LEU A CA    1 
ATOM   7051  C  C     . LEU D 4  808  ? -14.996 10.294  66.200  1.00 65.08  ? 808  LEU A C     1 
ATOM   7052  O  O     . LEU D 4  808  ? -15.511 10.908  65.264  1.00 59.74  ? 808  LEU A O     1 
ATOM   7053  C  CB    . LEU D 4  808  ? -13.124 8.764   65.565  1.00 58.69  ? 808  LEU A CB    1 
ATOM   7054  C  CG    . LEU D 4  808  ? -12.344 7.459   65.774  1.00 58.50  ? 808  LEU A CG    1 
ATOM   7055  C  CD1   . LEU D 4  808  ? -12.922 6.268   65.011  1.00 58.31  ? 808  LEU A CD1   1 
ATOM   7056  C  CD2   . LEU D 4  808  ? -10.887 7.667   65.397  1.00 57.85  ? 808  LEU A CD2   1 
ATOM   7057  N  N     . THR D 4  809  ? -14.769 10.844  67.389  1.00 92.64  ? 809  THR A N     1 
ATOM   7058  C  CA    . THR D 4  809  ? -15.006 12.256  67.645  1.00 102.04 ? 809  THR A CA    1 
ATOM   7059  C  C     . THR D 4  809  ? -13.911 13.087  66.987  1.00 86.46  ? 809  THR A C     1 
ATOM   7060  O  O     . THR D 4  809  ? -12.918 12.544  66.494  1.00 79.17  ? 809  THR A O     1 
ATOM   7061  C  CB    . THR D 4  809  ? -15.062 12.506  69.152  1.00 109.97 ? 809  THR A CB    1 
ATOM   7062  O  OG1   . THR D 4  809  ? -13.777 12.257  69.733  1.00 90.57  ? 809  THR A OG1   1 
ATOM   7063  C  CG2   . THR D 4  809  ? -16.104 11.611  69.810  1.00 133.14 ? 809  THR A CG2   1 
ATOM   7064  N  N     . PRO D 4  810  ? -14.078 14.414  66.928  1.00 60.37  ? 810  PRO A N     1 
ATOM   7065  C  CA    . PRO D 4  810  ? -13.000 15.254  66.372  1.00 59.86  ? 810  PRO A CA    1 
ATOM   7066  C  C     . PRO D 4  810  ? -11.645 15.051  67.034  1.00 59.79  ? 810  PRO A C     1 
ATOM   7067  O  O     . PRO D 4  810  ? -10.646 14.840  66.333  1.00 59.08  ? 810  PRO A O     1 
ATOM   7068  C  CB    . PRO D 4  810  ? -13.538 16.672  66.584  1.00 60.46  ? 810  PRO A CB    1 
ATOM   7069  C  CG    . PRO D 4  810  ? -15.011 16.517  66.539  1.00 60.90  ? 810  PRO A CG    1 
ATOM   7070  C  CD    . PRO D 4  810  ? -15.324 15.178  67.129  1.00 61.08  ? 810  PRO A CD    1 
ATOM   7071  N  N     . GLN D 4  811  ? -11.579 15.106  68.368  1.00 83.68  ? 811  GLN A N     1 
ATOM   7072  C  CA    . GLN D 4  811  ? -10.299 14.926  69.050  1.00 73.32  ? 811  GLN A CA    1 
ATOM   7073  C  C     . GLN D 4  811  ? -9.731  13.537  68.792  1.00 65.63  ? 811  GLN A C     1 
ATOM   7074  O  O     . GLN D 4  811  ? -8.542  13.387  68.485  1.00 60.05  ? 811  GLN A O     1 
ATOM   7075  C  CB    . GLN D 4  811  ? -10.453 15.172  70.554  1.00 65.77  ? 811  GLN A CB    1 
ATOM   7076  C  CG    . GLN D 4  811  ? -11.112 16.488  70.925  1.00 62.83  ? 811  GLN A CG    1 
ATOM   7077  C  CD    . GLN D 4  811  ? -12.605 16.348  71.140  1.00 64.95  ? 811  GLN A CD    1 
ATOM   7078  O  OE1   . GLN D 4  811  ? -13.187 15.293  70.879  1.00 75.44  ? 811  GLN A OE1   1 
ATOM   7079  N  NE2   . GLN D 4  811  ? -13.235 17.412  71.620  1.00 64.13  ? 811  GLN A NE2   1 
ATOM   7080  N  N     . GLU D 4  812  ? -10.574 12.505  68.909  1.00 75.96  ? 812  GLU A N     1 
ATOM   7081  C  CA    . GLU D 4  812  ? -10.129 11.141  68.641  1.00 71.03  ? 812  GLU A CA    1 
ATOM   7082  C  C     . GLU D 4  812  ? -9.511  11.027  67.255  1.00 80.37  ? 812  GLU A C     1 
ATOM   7083  O  O     . GLU D 4  812  ? -8.506  10.330  67.070  1.00 63.45  ? 812  GLU A O     1 
ATOM   7084  C  CB    . GLU D 4  812  ? -11.301 10.167  68.773  1.00 66.42  ? 812  GLU A CB    1 
ATOM   7085  C  CG    . GLU D 4  812  ? -11.791 9.936   70.191  1.00 84.65  ? 812  GLU A CG    1 
ATOM   7086  C  CD    . GLU D 4  812  ? -13.105 9.172   70.230  1.00 88.86  ? 812  GLU A CD    1 
ATOM   7087  O  OE1   . GLU D 4  812  ? -13.920 9.338   69.298  1.00 100.99 ? 812  GLU A OE1   1 
ATOM   7088  O  OE2   . GLU D 4  812  ? -13.322 8.400   71.189  1.00 87.38  ? 812  GLU A OE2   1 
ATOM   7089  N  N     . PHE D 4  813  ? -10.090 11.719  66.272  1.00 63.68  ? 813  PHE A N     1 
ATOM   7090  C  CA    . PHE D 4  813  ? -9.569  11.643  64.913  1.00 57.53  ? 813  PHE A CA    1 
ATOM   7091  C  C     . PHE D 4  813  ? -8.164  12.227  64.830  1.00 57.25  ? 813  PHE A C     1 
ATOM   7092  O  O     . PHE D 4  813  ? -7.286  11.648  64.181  1.00 56.67  ? 813  PHE A O     1 
ATOM   7093  C  CB    . PHE D 4  813  ? -10.511 12.361  63.947  1.00 57.36  ? 813  PHE A CB    1 
ATOM   7094  C  CG    . PHE D 4  813  ? -10.109 12.237  62.502  1.00 58.69  ? 813  PHE A CG    1 
ATOM   7095  C  CD1   . PHE D 4  813  ? -9.599  11.044  62.012  1.00 62.95  ? 813  PHE A CD1   1 
ATOM   7096  C  CD2   . PHE D 4  813  ? -10.227 13.312  61.640  1.00 56.31  ? 813  PHE A CD2   1 
ATOM   7097  C  CE1   . PHE D 4  813  ? -9.225  10.922  60.688  1.00 55.33  ? 813  PHE A CE1   1 
ATOM   7098  C  CE2   . PHE D 4  813  ? -9.850  13.196  60.315  1.00 55.61  ? 813  PHE A CE2   1 
ATOM   7099  C  CZ    . PHE D 4  813  ? -9.349  11.999  59.840  1.00 55.12  ? 813  PHE A CZ    1 
ATOM   7100  N  N     . PHE D 4  814  ? -7.926  13.364  65.490  1.00 57.73  ? 814  PHE A N     1 
ATOM   7101  C  CA    . PHE D 4  814  ? -6.598  13.967  65.436  1.00 57.58  ? 814  PHE A CA    1 
ATOM   7102  C  C     . PHE D 4  814  ? -5.577  13.111  66.169  1.00 57.67  ? 814  PHE A C     1 
ATOM   7103  O  O     . PHE D 4  814  ? -4.436  12.968  65.712  1.00 63.10  ? 814  PHE A O     1 
ATOM   7104  C  CB    . PHE D 4  814  ? -6.619  15.381  66.013  1.00 58.20  ? 814  PHE A CB    1 
ATOM   7105  C  CG    . PHE D 4  814  ? -5.348  16.140  65.770  1.00 58.09  ? 814  PHE A CG    1 
ATOM   7106  C  CD1   . PHE D 4  814  ? -5.080  16.683  64.529  1.00 57.54  ? 814  PHE A CD1   1 
ATOM   7107  C  CD2   . PHE D 4  814  ? -4.415  16.300  66.776  1.00 68.22  ? 814  PHE A CD2   1 
ATOM   7108  C  CE1   . PHE D 4  814  ? -3.914  17.376  64.296  1.00 57.52  ? 814  PHE A CE1   1 
ATOM   7109  C  CE2   . PHE D 4  814  ? -3.241  16.995  66.547  1.00 75.32  ? 814  PHE A CE2   1 
ATOM   7110  C  CZ    . PHE D 4  814  ? -2.994  17.533  65.304  1.00 64.56  ? 814  PHE A CZ    1 
ATOM   7111  N  N     . PHE D 4  815  ? -5.966  12.539  67.310  1.00 58.97  ? 815  PHE A N     1 
ATOM   7112  C  CA    . PHE D 4  815  ? -5.086  11.606  68.004  1.00 58.39  ? 815  PHE A CA    1 
ATOM   7113  C  C     . PHE D 4  815  ? -4.824  10.376  67.148  1.00 57.71  ? 815  PHE A C     1 
ATOM   7114  O  O     . PHE D 4  815  ? -3.673  9.959   66.971  1.00 57.43  ? 815  PHE A O     1 
ATOM   7115  C  CB    . PHE D 4  815  ? -5.695  11.203  69.348  1.00 59.21  ? 815  PHE A CB    1 
ATOM   7116  C  CG    . PHE D 4  815  ? -5.865  12.346  70.309  1.00 59.99  ? 815  PHE A CG    1 
ATOM   7117  C  CD1   . PHE D 4  815  ? -7.032  12.489  71.041  1.00 60.67  ? 815  PHE A CD1   1 
ATOM   7118  C  CD2   . PHE D 4  815  ? -4.860  13.281  70.475  1.00 60.13  ? 815  PHE A CD2   1 
ATOM   7119  C  CE1   . PHE D 4  815  ? -7.189  13.542  71.926  1.00 61.46  ? 815  PHE A CE1   1 
ATOM   7120  C  CE2   . PHE D 4  815  ? -5.011  14.335  71.354  1.00 60.93  ? 815  PHE A CE2   1 
ATOM   7121  C  CZ    . PHE D 4  815  ? -6.176  14.467  72.082  1.00 61.59  ? 815  PHE A CZ    1 
ATOM   7122  N  N     . HIS D 4  816  ? -5.888  9.789   66.594  1.00 72.20  ? 816  HIS A N     1 
ATOM   7123  C  CA    . HIS D 4  816  ? -5.722  8.625   65.732  1.00 72.41  ? 816  HIS A CA    1 
ATOM   7124  C  C     . HIS D 4  816  ? -4.832  8.956   64.539  1.00 68.58  ? 816  HIS A C     1 
ATOM   7125  O  O     . HIS D 4  816  ? -3.969  8.156   64.160  1.00 78.84  ? 816  HIS A O     1 
ATOM   7126  C  CB    . HIS D 4  816  ? -7.094  8.116   65.279  1.00 75.40  ? 816  HIS A CB    1 
ATOM   7127  C  CG    . HIS D 4  816  ? -7.079  6.723   64.728  1.00 79.46  ? 816  HIS A CG    1 
ATOM   7128  N  ND1   . HIS D 4  816  ? -5.913  6.030   64.481  1.00 82.11  ? 816  HIS A ND1   1 
ATOM   7129  C  CD2   . HIS D 4  816  ? -8.089  5.902   64.355  1.00 77.99  ? 816  HIS A CD2   1 
ATOM   7130  C  CE1   . HIS D 4  816  ? -6.205  4.840   63.990  1.00 76.53  ? 816  HIS A CE1   1 
ATOM   7131  N  NE2   . HIS D 4  816  ? -7.519  4.737   63.902  1.00 80.77  ? 816  HIS A NE2   1 
ATOM   7132  N  N     . ALA D 4  817  ? -5.008  10.145  63.951  1.00 56.02  ? 817  ALA A N     1 
ATOM   7133  C  CA    . ALA D 4  817  ? -4.122  10.562  62.870  1.00 68.69  ? 817  ALA A CA    1 
ATOM   7134  C  C     . ALA D 4  817  ? -2.707  10.810  63.372  1.00 55.91  ? 817  ALA A C     1 
ATOM   7135  O  O     . ALA D 4  817  ? -1.739  10.549  62.650  1.00 55.15  ? 817  ALA A O     1 
ATOM   7136  C  CB    . ALA D 4  817  ? -4.670  11.819  62.192  1.00 89.69  ? 817  ALA A CB    1 
ATOM   7137  N  N     . MET D 4  818  ? -2.567  11.307  64.601  1.00 56.25  ? 818  MET A N     1 
ATOM   7138  C  CA    . MET D 4  818  ? -1.239  11.499  65.167  1.00 78.90  ? 818  MET A CA    1 
ATOM   7139  C  C     . MET D 4  818  ? -0.504  10.172  65.285  1.00 68.05  ? 818  MET A C     1 
ATOM   7140  O  O     . MET D 4  818  ? 0.691   10.085  64.980  1.00 56.20  ? 818  MET A O     1 
ATOM   7141  C  CB    . MET D 4  818  ? -1.351  12.175  66.529  1.00 72.10  ? 818  MET A CB    1 
ATOM   7142  C  CG    . MET D 4  818  ? -0.252  13.170  66.811  1.00 57.69  ? 818  MET A CG    1 
ATOM   7143  S  SD    . MET D 4  818  ? -0.467  13.958  68.411  1.00 71.41  ? 818  MET A SD    1 
ATOM   7144  C  CE    . MET D 4  818  ? -2.235  14.213  68.448  1.00 58.89  ? 818  MET A CE    1 
ATOM   7145  N  N     . GLY D 4  819  ? -1.204  9.126   65.725  1.00 81.95  ? 819  GLY A N     1 
ATOM   7146  C  CA    . GLY D 4  819  ? -0.585  7.815   65.792  1.00 96.25  ? 819  GLY A CA    1 
ATOM   7147  C  C     . GLY D 4  819  ? -0.264  7.258   64.420  1.00 79.58  ? 819  GLY A C     1 
ATOM   7148  O  O     . GLY D 4  819  ? 0.769   6.610   64.229  1.00 79.17  ? 819  GLY A O     1 
ATOM   7149  N  N     . GLY D 4  820  ? -1.137  7.511   63.442  1.00 72.99  ? 820  GLY A N     1 
ATOM   7150  C  CA    . GLY D 4  820  ? -0.905  6.992   62.107  1.00 75.46  ? 820  GLY A CA    1 
ATOM   7151  C  C     . GLY D 4  820  ? 0.326   7.574   61.445  1.00 80.88  ? 820  GLY A C     1 
ATOM   7152  O  O     . GLY D 4  820  ? 1.022   6.874   60.703  1.00 95.07  ? 820  GLY A O     1 
ATOM   7153  N  N     . ARG D 4  821  ? 0.620   8.851   61.706  1.00 73.89  ? 821  ARG A N     1 
ATOM   7154  C  CA    . ARG D 4  821  ? 1.773   9.484   61.074  1.00 77.46  ? 821  ARG A CA    1 
ATOM   7155  C  C     . ARG D 4  821  ? 3.070   8.801   61.482  1.00 63.36  ? 821  ARG A C     1 
ATOM   7156  O  O     . ARG D 4  821  ? 3.961   8.603   60.650  1.00 54.17  ? 821  ARG A O     1 
ATOM   7157  C  CB    . ARG D 4  821  ? 1.818   10.975  61.413  1.00 82.13  ? 821  ARG A CB    1 
ATOM   7158  C  CG    . ARG D 4  821  ? 1.089   11.857  60.406  1.00 93.79  ? 821  ARG A CG    1 
ATOM   7159  C  CD    . ARG D 4  821  ? 1.988   12.258  59.240  1.00 83.42  ? 821  ARG A CD    1 
ATOM   7160  N  NE    . ARG D 4  821  ? 2.601   13.568  59.450  1.00 86.56  ? 821  ARG A NE    1 
ATOM   7161  C  CZ    . ARG D 4  821  ? 2.013   14.726  59.161  1.00 90.22  ? 821  ARG A CZ    1 
ATOM   7162  N  NH1   . ARG D 4  821  ? 0.790   14.739  58.649  1.00 83.97  ? 821  ARG A NH1   1 
ATOM   7163  N  NH2   . ARG D 4  821  ? 2.645   15.871  59.388  1.00 83.42  ? 821  ARG A NH2   1 
ATOM   7164  N  N     . GLU D 4  822  ? 3.195   8.429   62.759  1.00 84.20  ? 822  GLU A N     1 
ATOM   7165  C  CA    . GLU D 4  822  ? 4.385   7.702   63.187  1.00 90.63  ? 822  GLU A CA    1 
ATOM   7166  C  C     . GLU D 4  822  ? 4.502   6.375   62.450  1.00 82.25  ? 822  GLU A C     1 
ATOM   7167  O  O     . GLU D 4  822  ? 5.608   5.944   62.103  1.00 83.63  ? 822  GLU A O     1 
ATOM   7168  C  CB    . GLU D 4  822  ? 4.359   7.477   64.699  1.00 96.44  ? 822  GLU A CB    1 
ATOM   7169  C  CG    . GLU D 4  822  ? 5.612   6.798   65.229  1.00 101.19 ? 822  GLU A CG    1 
ATOM   7170  C  CD    . GLU D 4  822  ? 5.624   6.679   66.740  1.00 104.21 ? 822  GLU A CD    1 
ATOM   7171  O  OE1   . GLU D 4  822  ? 4.723   7.248   67.391  1.00 101.54 ? 822  GLU A OE1   1 
ATOM   7172  O  OE2   . GLU D 4  822  ? 6.537   6.017   67.276  1.00 109.82 ? 822  GLU A OE2   1 
ATOM   7173  N  N     . GLY D 4  823  ? 3.367   5.722   62.187  1.00 69.35  ? 823  GLY A N     1 
ATOM   7174  C  CA    . GLY D 4  823  ? 3.399   4.479   61.435  1.00 67.99  ? 823  GLY A CA    1 
ATOM   7175  C  C     . GLY D 4  823  ? 3.920   4.666   60.024  1.00 62.87  ? 823  GLY A C     1 
ATOM   7176  O  O     . GLY D 4  823  ? 4.613   3.800   59.487  1.00 72.94  ? 823  GLY A O     1 
ATOM   7177  N  N     . LEU D 4  824  ? 3.597   5.803   59.404  1.00 59.89  ? 824  LEU A N     1 
ATOM   7178  C  CA    . LEU D 4  824  ? 4.117   6.087   58.071  1.00 76.73  ? 824  LEU A CA    1 
ATOM   7179  C  C     . LEU D 4  824  ? 5.594   6.454   58.123  1.00 89.77  ? 824  LEU A C     1 
ATOM   7180  O  O     . LEU D 4  824  ? 6.368   6.064   57.240  1.00 93.84  ? 824  LEU A O     1 
ATOM   7181  C  CB    . LEU D 4  824  ? 3.306   7.207   57.420  1.00 60.54  ? 824  LEU A CB    1 
ATOM   7182  C  CG    . LEU D 4  824  ? 1.785   7.085   57.518  1.00 62.92  ? 824  LEU A CG    1 
ATOM   7183  C  CD1   . LEU D 4  824  ? 1.126   8.268   56.835  1.00 68.08  ? 824  LEU A CD1   1 
ATOM   7184  C  CD2   . LEU D 4  824  ? 1.290   5.770   56.921  1.00 65.01  ? 824  LEU A CD2   1 
ATOM   7185  N  N     . ILE D 4  825  ? 6.003   7.211   59.144  1.00 82.18  ? 825  ILE A N     1 
ATOM   7186  C  CA    . ILE D 4  825  ? 7.421   7.507   59.324  1.00 83.27  ? 825  ILE A CA    1 
ATOM   7187  C  C     . ILE D 4  825  ? 8.187   6.232   59.651  1.00 95.93  ? 825  ILE A C     1 
ATOM   7188  O  O     . ILE D 4  825  ? 9.259   5.972   59.093  1.00 105.09 ? 825  ILE A O     1 
ATOM   7189  C  CB    . ILE D 4  825  ? 7.621   8.577   60.413  1.00 81.35  ? 825  ILE A CB    1 
ATOM   7190  C  CG1   . ILE D 4  825  ? 6.757   9.809   60.138  1.00 80.64  ? 825  ILE A CG1   1 
ATOM   7191  C  CG2   . ILE D 4  825  ? 9.082   8.982   60.493  1.00 95.08  ? 825  ILE A CG2   1 
ATOM   7192  C  CD1   . ILE D 4  825  ? 6.924   10.372  58.751  1.00 97.97  ? 825  ILE A CD1   1 
ATOM   7193  N  N     . ASP D 4  826  ? 7.640   5.411   60.552  1.00 99.04  ? 826  ASP A N     1 
ATOM   7194  C  CA    . ASP D 4  826  ? 8.280   4.143   60.888  1.00 100.07 ? 826  ASP A CA    1 
ATOM   7195  C  C     . ASP D 4  826  ? 8.396   3.247   59.661  1.00 104.95 ? 826  ASP A C     1 
ATOM   7196  O  O     . ASP D 4  826  ? 9.416   2.576   59.467  1.00 105.69 ? 826  ASP A O     1 
ATOM   7197  C  CB    . ASP D 4  826  ? 7.494   3.440   61.996  1.00 102.04 ? 826  ASP A CB    1 
ATOM   7198  C  CG    . ASP D 4  826  ? 8.388   2.695   62.969  1.00 114.88 ? 826  ASP A CG    1 
ATOM   7199  O  OD1   . ASP D 4  826  ? 9.621   2.891   62.918  1.00 122.87 ? 826  ASP A OD1   1 
ATOM   7200  O  OD2   . ASP D 4  826  ? 7.859   1.908   63.785  1.00 121.34 ? 826  ASP A OD2   1 
ATOM   7201  N  N     . THR D 4  827  ? 7.361   3.231   58.814  1.00 114.50 ? 827  THR A N     1 
ATOM   7202  C  CA    . THR D 4  827  ? 7.393   2.410   57.606  1.00 110.75 ? 827  THR A CA    1 
ATOM   7203  C  C     . THR D 4  827  ? 8.452   2.911   56.631  1.00 108.37 ? 827  THR A C     1 
ATOM   7204  O  O     . THR D 4  827  ? 9.230   2.120   56.084  1.00 114.36 ? 827  THR A O     1 
ATOM   7205  C  CB    . THR D 4  827  ? 6.014   2.388   56.940  1.00 96.37  ? 827  THR A CB    1 
ATOM   7206  O  OG1   . THR D 4  827  ? 5.024   1.967   57.887  1.00 102.73 ? 827  THR A OG1   1 
ATOM   7207  C  CG2   . THR D 4  827  ? 6.004   1.432   55.750  1.00 80.10  ? 827  THR A CG2   1 
ATOM   7208  N  N     . ALA D 4  828  ? 8.497   4.225   56.400  1.00 102.99 ? 828  ALA A N     1 
ATOM   7209  C  CA    . ALA D 4  828  ? 9.549   4.788   55.559  1.00 98.05  ? 828  ALA A CA    1 
ATOM   7210  C  C     . ALA D 4  828  ? 10.931  4.577   56.167  1.00 112.91 ? 828  ALA A C     1 
ATOM   7211  O  O     . ALA D 4  828  ? 11.908  4.393   55.433  1.00 130.04 ? 828  ALA A O     1 
ATOM   7212  C  CB    . ALA D 4  828  ? 9.288   6.277   55.324  1.00 70.63  ? 828  ALA A CB    1 
ATOM   7213  N  N     . VAL D 4  829  ? 11.034  4.593   57.499  1.00 108.43 ? 829  VAL A N     1 
ATOM   7214  C  CA    . VAL D 4  829  ? 12.325  4.383   58.151  1.00 116.67 ? 829  VAL A CA    1 
ATOM   7215  C  C     . VAL D 4  829  ? 12.728  2.914   58.082  1.00 130.28 ? 829  VAL A C     1 
ATOM   7216  O  O     . VAL D 4  829  ? 13.858  2.585   57.701  1.00 126.62 ? 829  VAL A O     1 
ATOM   7217  C  CB    . VAL D 4  829  ? 12.283  4.893   59.605  1.00 109.37 ? 829  VAL A CB    1 
ATOM   7218  C  CG1   . VAL D 4  829  ? 13.442  4.316   60.417  1.00 114.82 ? 829  VAL A CG1   1 
ATOM   7219  C  CG2   . VAL D 4  829  ? 12.330  6.417   59.639  1.00 105.00 ? 829  VAL A CG2   1 
ATOM   7220  N  N     . LYS D 4  830  ? 11.812  2.009   58.443  1.00 163.21 ? 830  LYS A N     1 
ATOM   7221  C  CA    . LYS D 4  830  ? 12.147  0.586   58.465  1.00 154.19 ? 830  LYS A CA    1 
ATOM   7222  C  C     . LYS D 4  830  ? 12.532  0.083   57.079  1.00 145.38 ? 830  LYS A C     1 
ATOM   7223  O  O     . LYS D 4  830  ? 13.480  -0.696  56.937  1.00 144.43 ? 830  LYS A O     1 
ATOM   7224  C  CB    . LYS D 4  830  ? 10.979  -0.222  59.032  1.00 140.32 ? 830  LYS A CB    1 
ATOM   7225  C  CG    . LYS D 4  830  ? 11.253  -0.827  60.403  1.00 123.55 ? 830  LYS A CG    1 
ATOM   7226  C  CD    . LYS D 4  830  ? 11.405  0.254   61.464  1.00 120.72 ? 830  LYS A CD    1 
ATOM   7227  C  CE    . LYS D 4  830  ? 11.497  -0.338  62.863  1.00 104.73 ? 830  LYS A CE    1 
ATOM   7228  N  NZ    . LYS D 4  830  ? 11.535  0.719   63.914  1.00 91.15  ? 830  LYS A NZ    1 
ATOM   7229  N  N     . THR D 4  831  ? 11.811  0.521   56.043  1.00 138.11 ? 831  THR A N     1 
ATOM   7230  C  CA    . THR D 4  831  ? 12.187  0.157   54.681  1.00 122.79 ? 831  THR A CA    1 
ATOM   7231  C  C     . THR D 4  831  ? 13.565  0.707   54.326  1.00 119.45 ? 831  THR A C     1 
ATOM   7232  O  O     . THR D 4  831  ? 14.370  0.022   53.684  1.00 125.66 ? 831  THR A O     1 
ATOM   7233  C  CB    . THR D 4  831  ? 11.136  0.661   53.688  1.00 111.64 ? 831  THR A CB    1 
ATOM   7234  O  OG1   . THR D 4  831  ? 10.822  2.031   53.966  1.00 106.51 ? 831  THR A OG1   1 
ATOM   7235  C  CG2   . THR D 4  831  ? 9.858   -0.171  53.784  1.00 115.45 ? 831  THR A CG2   1 
ATOM   7236  N  N     . ALA D 4  832  ? 13.858  1.939   54.745  1.00 118.06 ? 832  ALA A N     1 
ATOM   7237  C  CA    . ALA D 4  832  ? 15.146  2.550   54.431  1.00 108.72 ? 832  ALA A CA    1 
ATOM   7238  C  C     . ALA D 4  832  ? 16.280  1.873   55.190  1.00 93.81  ? 832  ALA A C     1 
ATOM   7239  O  O     . ALA D 4  832  ? 17.322  1.545   54.610  1.00 85.27  ? 832  ALA A O     1 
ATOM   7240  C  CB    . ALA D 4  832  ? 15.106  4.045   54.748  1.00 123.95 ? 832  ALA A CB    1 
ATOM   7241  N  N     . GLU D 4  833  ? 16.097  1.662   56.495  1.00 97.13  ? 833  GLU A N     1 
ATOM   7242  C  CA    . GLU D 4  833  ? 17.157  1.076   57.307  1.00 109.48 ? 833  GLU A CA    1 
ATOM   7243  C  C     . GLU D 4  833  ? 17.411  -0.379  56.927  1.00 105.49 ? 833  GLU A C     1 
ATOM   7244  O  O     . GLU D 4  833  ? 18.566  -0.817  56.872  1.00 102.98 ? 833  GLU A O     1 
ATOM   7245  C  CB    . GLU D 4  833  ? 16.802  1.189   58.790  1.00 105.98 ? 833  GLU A CB    1 
ATOM   7246  C  CG    . GLU D 4  833  ? 17.895  1.805   59.647  1.00 94.71  ? 833  GLU A CG    1 
ATOM   7247  C  CD    . GLU D 4  833  ? 17.392  2.217   61.017  1.00 110.12 ? 833  GLU A CD    1 
ATOM   7248  O  OE1   . GLU D 4  833  ? 16.188  2.023   61.292  1.00 115.55 ? 833  GLU A OE1   1 
ATOM   7249  O  OE2   . GLU D 4  833  ? 18.197  2.739   61.815  1.00 122.90 ? 833  GLU A OE2   1 
ATOM   7250  N  N     . THR D 4  834  ? 16.346  -1.140  56.649  1.00 99.22  ? 834  THR A N     1 
ATOM   7251  C  CA    . THR D 4  834  ? 16.514  -2.560  56.349  1.00 84.40  ? 834  THR A CA    1 
ATOM   7252  C  C     . THR D 4  834  ? 17.236  -2.764  55.023  1.00 76.41  ? 834  THR A C     1 
ATOM   7253  O  O     . THR D 4  834  ? 18.054  -3.681  54.892  1.00 73.59  ? 834  THR A O     1 
ATOM   7254  C  CB    . THR D 4  834  ? 15.158  -3.270  56.324  1.00 73.04  ? 834  THR A CB    1 
ATOM   7255  O  OG1   . THR D 4  834  ? 14.315  -2.746  57.357  1.00 57.76  ? 834  THR A OG1   1 
ATOM   7256  C  CG2   . THR D 4  834  ? 15.344  -4.761  56.554  1.00 76.95  ? 834  THR A CG2   1 
ATOM   7257  N  N     . GLY D 4  835  ? 16.948  -1.922  54.029  1.00 77.34  ? 835  GLY A N     1 
ATOM   7258  C  CA    . GLY D 4  835  ? 17.661  -2.020  52.767  1.00 91.28  ? 835  GLY A CA    1 
ATOM   7259  C  C     . GLY D 4  835  ? 19.161  -1.879  52.938  1.00 86.14  ? 835  GLY A C     1 
ATOM   7260  O  O     . GLY D 4  835  ? 19.941  -2.566  52.273  1.00 89.63  ? 835  GLY A O     1 
ATOM   7261  N  N     . TYR D 4  836  ? 19.584  -0.989  53.837  1.00 62.89  ? 836  TYR A N     1 
ATOM   7262  C  CA    . TYR D 4  836  ? 21.000  -0.892  54.172  1.00 80.97  ? 836  TYR A CA    1 
ATOM   7263  C  C     . TYR D 4  836  ? 21.488  -2.169  54.843  1.00 92.29  ? 836  TYR A C     1 
ATOM   7264  O  O     . TYR D 4  836  ? 22.530  -2.719  54.468  1.00 96.86  ? 836  TYR A O     1 
ATOM   7265  C  CB    . TYR D 4  836  ? 21.245  0.315   55.078  1.00 91.11  ? 836  TYR A CB    1 
ATOM   7266  C  CG    . TYR D 4  836  ? 22.690  0.763   55.127  1.00 85.46  ? 836  TYR A CG    1 
ATOM   7267  C  CD1   . TYR D 4  836  ? 23.643  0.205   54.283  1.00 76.31  ? 836  TYR A CD1   1 
ATOM   7268  C  CD2   . TYR D 4  836  ? 23.103  1.737   56.024  1.00 90.46  ? 836  TYR A CD2   1 
ATOM   7269  C  CE1   . TYR D 4  836  ? 24.964  0.609   54.328  1.00 63.75  ? 836  TYR A CE1   1 
ATOM   7270  C  CE2   . TYR D 4  836  ? 24.421  2.147   56.077  1.00 97.54  ? 836  TYR A CE2   1 
ATOM   7271  C  CZ    . TYR D 4  836  ? 25.347  1.580   55.227  1.00 86.52  ? 836  TYR A CZ    1 
ATOM   7272  O  OH    . TYR D 4  836  ? 26.659  1.990   55.280  1.00 104.96 ? 836  TYR A OH    1 
ATOM   7273  N  N     . ILE D 4  837  ? 20.748  -2.648  55.847  1.00 87.58  ? 837  ILE A N     1 
ATOM   7274  C  CA    . ILE D 4  837  ? 21.147  -3.853  56.575  1.00 81.96  ? 837  ILE A CA    1 
ATOM   7275  C  C     . ILE D 4  837  ? 21.333  -5.019  55.615  1.00 70.91  ? 837  ILE A C     1 
ATOM   7276  O  O     . ILE D 4  837  ? 22.353  -5.719  55.649  1.00 59.30  ? 837  ILE A O     1 
ATOM   7277  C  CB    . ILE D 4  837  ? 20.115  -4.184  57.670  1.00 73.21  ? 837  ILE A CB    1 
ATOM   7278  C  CG1   . ILE D 4  837  ? 20.030  -3.055  58.701  1.00 71.37  ? 837  ILE A CG1   1 
ATOM   7279  C  CG2   . ILE D 4  837  ? 20.434  -5.516  58.328  1.00 70.37  ? 837  ILE A CG2   1 
ATOM   7280  C  CD1   . ILE D 4  837  ? 19.049  -3.330  59.824  1.00 58.78  ? 837  ILE A CD1   1 
ATOM   7281  N  N     . GLN D 4  838  ? 20.354  -5.234  54.734  1.00 68.90  ? 838  GLN A N     1 
ATOM   7282  C  CA    . GLN D 4  838  ? 20.429  -6.355  53.800  1.00 57.24  ? 838  GLN A CA    1 
ATOM   7283  C  C     . GLN D 4  838  ? 21.664  -6.246  52.914  1.00 57.57  ? 838  GLN A C     1 
ATOM   7284  O  O     . GLN D 4  838  ? 22.383  -7.229  52.711  1.00 58.10  ? 838  GLN A O     1 
ATOM   7285  C  CB    . GLN D 4  838  ? 19.150  -6.425  52.959  1.00 63.68  ? 838  GLN A CB    1 
ATOM   7286  C  CG    . GLN D 4  838  ? 18.953  -7.738  52.196  1.00 56.53  ? 838  GLN A CG    1 
ATOM   7287  C  CD    . GLN D 4  838  ? 19.597  -7.735  50.817  1.00 68.49  ? 838  GLN A CD    1 
ATOM   7288  O  OE1   . GLN D 4  838  ? 20.167  -6.735  50.381  1.00 85.78  ? 838  GLN A OE1   1 
ATOM   7289  N  NE2   . GLN D 4  838  ? 19.514  -8.869  50.126  1.00 71.71  ? 838  GLN A NE2   1 
ATOM   7290  N  N     . ARG D 4  839  ? 21.933  -5.049  52.385  1.00 57.35  ? 839  ARG A N     1 
ATOM   7291  C  CA    . ARG D 4  839  ? 23.100  -4.877  51.525  1.00 65.23  ? 839  ARG A CA    1 
ATOM   7292  C  C     . ARG D 4  839  ? 24.393  -5.140  52.288  1.00 58.65  ? 839  ARG A C     1 
ATOM   7293  O  O     . ARG D 4  839  ? 25.338  -5.721  51.742  1.00 59.18  ? 839  ARG A O     1 
ATOM   7294  C  CB    . ARG D 4  839  ? 23.113  -3.474  50.917  1.00 64.59  ? 839  ARG A CB    1 
ATOM   7295  C  CG    . ARG D 4  839  ? 24.292  -3.251  49.991  1.00 57.82  ? 839  ARG A CG    1 
ATOM   7296  C  CD    . ARG D 4  839  ? 24.502  -1.790  49.657  1.00 57.72  ? 839  ARG A CD    1 
ATOM   7297  N  NE    . ARG D 4  839  ? 25.912  -1.513  49.396  1.00 68.28  ? 839  ARG A NE    1 
ATOM   7298  C  CZ    . ARG D 4  839  ? 26.538  -1.805  48.259  1.00 68.15  ? 839  ARG A CZ    1 
ATOM   7299  N  NH1   . ARG D 4  839  ? 25.883  -2.384  47.262  1.00 74.06  ? 839  ARG A NH1   1 
ATOM   7300  N  NH2   . ARG D 4  839  ? 27.825  -1.517  48.120  1.00 66.35  ? 839  ARG A NH2   1 
ATOM   7301  N  N     . ARG D 4  840  ? 24.453  -4.720  53.555  1.00 86.00  ? 840  ARG A N     1 
ATOM   7302  C  CA    . ARG D 4  840  ? 25.655  -4.938  54.355  1.00 94.93  ? 840  ARG A CA    1 
ATOM   7303  C  C     . ARG D 4  840  ? 25.901  -6.423  54.592  1.00 95.54  ? 840  ARG A C     1 
ATOM   7304  O  O     . ARG D 4  840  ? 27.037  -6.897  54.474  1.00 93.08  ? 840  ARG A O     1 
ATOM   7305  C  CB    . ARG D 4  840  ? 25.541  -4.197  55.685  1.00 79.71  ? 840  ARG A CB    1 
ATOM   7306  C  CG    . ARG D 4  840  ? 25.492  -2.686  55.555  1.00 92.49  ? 840  ARG A CG    1 
ATOM   7307  C  CD    . ARG D 4  840  ? 26.064  -2.014  56.788  1.00 106.78 ? 840  ARG A CD    1 
ATOM   7308  N  NE    . ARG D 4  840  ? 25.360  -2.426  57.998  1.00 115.00 ? 840  ARG A NE    1 
ATOM   7309  C  CZ    . ARG D 4  840  ? 24.304  -1.796  58.500  1.00 109.22 ? 840  ARG A CZ    1 
ATOM   7310  N  NH1   . ARG D 4  840  ? 23.823  -0.718  57.897  1.00 107.30 ? 840  ARG A NH1   1 
ATOM   7311  N  NH2   . ARG D 4  840  ? 23.729  -2.245  59.607  1.00 113.94 ? 840  ARG A NH2   1 
ATOM   7312  N  N     . LEU D 4  841  ? 24.850  -7.170  54.933  1.00 69.38  ? 841  LEU A N     1 
ATOM   7313  C  CA    . LEU D 4  841  ? 25.001  -8.609  55.123  1.00 63.12  ? 841  LEU A CA    1 
ATOM   7314  C  C     . LEU D 4  841  ? 25.430  -9.292  53.833  1.00 65.62  ? 841  LEU A C     1 
ATOM   7315  O  O     . LEU D 4  841  ? 26.309  -10.162 53.847  1.00 78.79  ? 841  LEU A O     1 
ATOM   7316  C  CB    . LEU D 4  841  ? 23.695  -9.217  55.632  1.00 62.71  ? 841  LEU A CB    1 
ATOM   7317  C  CG    . LEU D 4  841  ? 23.008  -8.529  56.807  1.00 68.00  ? 841  LEU A CG    1 
ATOM   7318  C  CD1   . LEU D 4  841  ? 21.755  -9.290  57.213  1.00 62.24  ? 841  LEU A CD1   1 
ATOM   7319  C  CD2   . LEU D 4  841  ? 23.974  -8.406  57.972  1.00 92.70  ? 841  LEU A CD2   1 
ATOM   7320  N  N     . VAL D 4  842  ? 24.818  -8.914  52.708  1.00 82.44  ? 842  VAL A N     1 
ATOM   7321  C  CA    . VAL D 4  842  ? 25.110  -9.578  51.441  1.00 92.90  ? 842  VAL A CA    1 
ATOM   7322  C  C     . VAL D 4  842  ? 26.559  -9.344  51.038  1.00 87.51  ? 842  VAL A C     1 
ATOM   7323  O  O     . VAL D 4  842  ? 27.265  -10.270 50.626  1.00 94.17  ? 842  VAL A O     1 
ATOM   7324  C  CB    . VAL D 4  842  ? 24.139  -9.107  50.345  1.00 88.19  ? 842  VAL A CB    1 
ATOM   7325  C  CG1   . VAL D 4  842  ? 24.602  -9.612  48.998  1.00 89.40  ? 842  VAL A CG1   1 
ATOM   7326  C  CG2   . VAL D 4  842  ? 22.731  -9.603  50.633  1.00 97.87  ? 842  VAL A CG2   1 
ATOM   7327  N  N     . LYS D 4  843  ? 27.029  -8.102  51.158  1.00 86.61  ? 843  LYS A N     1 
ATOM   7328  C  CA    . LYS D 4  843  ? 28.402  -7.802  50.773  1.00 95.30  ? 843  LYS A CA    1 
ATOM   7329  C  C     . LYS D 4  843  ? 29.417  -8.368  51.759  1.00 81.23  ? 843  LYS A C     1 
ATOM   7330  O  O     . LYS D 4  843  ? 30.606  -8.445  51.430  1.00 66.44  ? 843  LYS A O     1 
ATOM   7331  C  CB    . LYS D 4  843  ? 28.589  -6.291  50.633  1.00 93.74  ? 843  LYS A CB    1 
ATOM   7332  C  CG    . LYS D 4  843  ? 27.777  -5.682  49.500  1.00 89.50  ? 843  LYS A CG    1 
ATOM   7333  C  CD    . LYS D 4  843  ? 27.934  -6.499  48.226  1.00 114.97 ? 843  LYS A CD    1 
ATOM   7334  C  CE    . LYS D 4  843  ? 28.545  -5.680  47.113  1.00 131.05 ? 843  LYS A CE    1 
ATOM   7335  N  NZ    . LYS D 4  843  ? 29.992  -5.443  47.357  1.00 134.01 ? 843  LYS A NZ    1 
ATOM   7336  N  N     . ALA D 4  844  ? 28.977  -8.763  52.954  1.00 87.62  ? 844  ALA A N     1 
ATOM   7337  C  CA    . ALA D 4  844  ? 29.889  -9.366  53.919  1.00 103.47 ? 844  ALA A CA    1 
ATOM   7338  C  C     . ALA D 4  844  ? 30.050  -10.862 53.682  1.00 105.63 ? 844  ALA A C     1 
ATOM   7339  O  O     . ALA D 4  844  ? 31.166  -11.389 53.757  1.00 117.67 ? 844  ALA A O     1 
ATOM   7340  C  CB    . ALA D 4  844  ? 29.396  -9.102  55.340  1.00 96.38  ? 844  ALA A CB    1 
ATOM   7341  N  N     . LEU D 4  845  ? 28.953  -11.561 53.395  1.00 85.44  ? 845  LEU A N     1 
ATOM   7342  C  CA    . LEU D 4  845  ? 28.963  -13.008 53.234  1.00 77.85  ? 845  LEU A CA    1 
ATOM   7343  C  C     . LEU D 4  845  ? 28.860  -13.432 51.775  1.00 77.87  ? 845  LEU A C     1 
ATOM   7344  O  O     . LEU D 4  845  ? 28.451  -14.563 51.493  1.00 77.69  ? 845  LEU A O     1 
ATOM   7345  C  CB    . LEU D 4  845  ? 27.819  -13.626 54.036  1.00 77.47  ? 845  LEU A CB    1 
ATOM   7346  C  CG    . LEU D 4  845  ? 27.519  -12.947 55.371  1.00 77.42  ? 845  LEU A CG    1 
ATOM   7347  C  CD1   . LEU D 4  845  ? 26.239  -13.496 55.972  1.00 77.09  ? 845  LEU A CD1   1 
ATOM   7348  C  CD2   . LEU D 4  845  ? 28.682  -13.114 56.326  1.00 84.33  ? 845  LEU A CD2   1 
ATOM   7349  N  N     . GLU D 4  846  ? 29.224  -12.553 50.838  1.00 103.94 ? 846  GLU A N     1 
ATOM   7350  C  CA    . GLU D 4  846  ? 28.968  -12.845 49.431  1.00 104.80 ? 846  GLU A CA    1 
ATOM   7351  C  C     . GLU D 4  846  ? 29.863  -13.958 48.906  1.00 98.66  ? 846  GLU A C     1 
ATOM   7352  O  O     . GLU D 4  846  ? 29.489  -14.650 47.953  1.00 103.81 ? 846  GLU A O     1 
ATOM   7353  C  CB    . GLU D 4  846  ? 29.135  -11.582 48.584  1.00 103.69 ? 846  GLU A CB    1 
ATOM   7354  C  CG    . GLU D 4  846  ? 30.560  -11.249 48.203  1.00 113.53 ? 846  GLU A CG    1 
ATOM   7355  C  CD    . GLU D 4  846  ? 30.668  -9.888  47.549  1.00 128.82 ? 846  GLU A CD    1 
ATOM   7356  O  OE1   . GLU D 4  846  ? 30.624  -8.873  48.275  1.00 140.62 ? 846  GLU A OE1   1 
ATOM   7357  O  OE2   . GLU D 4  846  ? 30.793  -9.836  46.308  1.00 122.63 ? 846  GLU A OE2   1 
ATOM   7358  N  N     . ASP D 4  847  ? 31.026  -14.157 49.510  1.00 90.48  ? 847  ASP A N     1 
ATOM   7359  C  CA    . ASP D 4  847  ? 31.967  -15.150 49.020  1.00 106.76 ? 847  ASP A CA    1 
ATOM   7360  C  C     . ASP D 4  847  ? 31.808  -16.505 49.693  1.00 107.77 ? 847  ASP A C     1 
ATOM   7361  O  O     . ASP D 4  847  ? 32.501  -17.455 49.316  1.00 121.19 ? 847  ASP A O     1 
ATOM   7362  C  CB    . ASP D 4  847  ? 33.399  -14.661 49.215  1.00 131.81 ? 847  ASP A CB    1 
ATOM   7363  C  CG    . ASP D 4  847  ? 34.302  -15.079 48.087  1.00 152.61 ? 847  ASP A CG    1 
ATOM   7364  O  OD1   . ASP D 4  847  ? 34.616  -14.224 47.239  1.00 161.54 ? 847  ASP A OD1   1 
ATOM   7365  O  OD2   . ASP D 4  847  ? 34.664  -16.270 48.025  1.00 166.99 ? 847  ASP A OD2   1 
ATOM   7366  N  N     . ILE D 4  848  ? 30.918  -16.621 50.671  1.00 97.61  ? 848  ILE A N     1 
ATOM   7367  C  CA    . ILE D 4  848  ? 30.821  -17.837 51.468  1.00 90.85  ? 848  ILE A CA    1 
ATOM   7368  C  C     . ILE D 4  848  ? 30.020  -18.874 50.689  1.00 79.21  ? 848  ILE A C     1 
ATOM   7369  O  O     . ILE D 4  848  ? 28.803  -18.748 50.536  1.00 80.65  ? 848  ILE A O     1 
ATOM   7370  C  CB    . ILE D 4  848  ? 30.188  -17.561 52.834  1.00 107.54 ? 848  ILE A CB    1 
ATOM   7371  C  CG1   . ILE D 4  848  ? 31.082  -16.631 53.658  1.00 118.99 ? 848  ILE A CG1   1 
ATOM   7372  C  CG2   . ILE D 4  848  ? 29.938  -18.860 53.557  1.00 100.52 ? 848  ILE A CG2   1 
ATOM   7373  C  CD1   . ILE D 4  848  ? 32.550  -16.979 53.595  1.00 126.67 ? 848  ILE A CD1   1 
ATOM   7374  N  N     . MET D 4  849  ? 30.704  -19.905 50.197  1.00 90.43  ? 849  MET A N     1 
ATOM   7375  C  CA    . MET D 4  849  ? 30.050  -21.050 49.585  1.00 97.11  ? 849  MET A CA    1 
ATOM   7376  C  C     . MET D 4  849  ? 30.665  -22.329 50.130  1.00 103.50 ? 849  MET A C     1 
ATOM   7377  O  O     . MET D 4  849  ? 31.854  -22.380 50.456  1.00 112.02 ? 849  MET A O     1 
ATOM   7378  C  CB    . MET D 4  849  ? 30.153  -21.033 48.050  1.00 84.19  ? 849  MET A CB    1 
ATOM   7379  C  CG    . MET D 4  849  ? 31.463  -21.551 47.471  1.00 84.70  ? 849  MET A CG    1 
ATOM   7380  S  SD    . MET D 4  849  ? 31.327  -21.868 45.696  1.00 87.32  ? 849  MET A SD    1 
ATOM   7381  C  CE    . MET D 4  849  ? 33.007  -22.336 45.284  1.00 85.62  ? 849  MET A CE    1 
ATOM   7382  N  N     . VAL D 4  850  ? 29.834  -23.361 50.244  1.00 85.54  ? 850  VAL A N     1 
ATOM   7383  C  CA    . VAL D 4  850  ? 30.324  -24.671 50.650  1.00 88.14  ? 850  VAL A CA    1 
ATOM   7384  C  C     . VAL D 4  850  ? 31.207  -25.225 49.541  1.00 87.48  ? 850  VAL A C     1 
ATOM   7385  O  O     . VAL D 4  850  ? 30.766  -25.381 48.397  1.00 113.99 ? 850  VAL A O     1 
ATOM   7386  C  CB    . VAL D 4  850  ? 29.160  -25.618 50.963  1.00 94.41  ? 850  VAL A CB    1 
ATOM   7387  C  CG1   . VAL D 4  850  ? 29.659  -27.049 51.115  1.00 101.63 ? 850  VAL A CG1   1 
ATOM   7388  C  CG2   . VAL D 4  850  ? 28.440  -25.163 52.216  1.00 101.18 ? 850  VAL A CG2   1 
ATOM   7389  N  N     . HIS D 4  851  ? 32.459  -25.527 49.874  1.00 79.27  ? 851  HIS A N     1 
ATOM   7390  C  CA    . HIS D 4  851  ? 33.399  -26.059 48.896  1.00 79.78  ? 851  HIS A CA    1 
ATOM   7391  C  C     . HIS D 4  851  ? 33.140  -27.555 48.732  1.00 82.20  ? 851  HIS A C     1 
ATOM   7392  O  O     . HIS D 4  851  ? 32.185  -28.105 49.288  1.00 80.40  ? 851  HIS A O     1 
ATOM   7393  C  CB    . HIS D 4  851  ? 34.831  -25.745 49.315  1.00 80.26  ? 851  HIS A CB    1 
ATOM   7394  C  CG    . HIS D 4  851  ? 35.250  -24.346 48.994  1.00 94.63  ? 851  HIS A CG    1 
ATOM   7395  N  ND1   . HIS D 4  851  ? 36.241  -24.054 48.082  1.00 97.71  ? 851  HIS A ND1   1 
ATOM   7396  C  CD2   . HIS D 4  851  ? 34.799  -23.156 49.456  1.00 100.61 ? 851  HIS A CD2   1 
ATOM   7397  C  CE1   . HIS D 4  851  ? 36.387  -22.743 48.001  1.00 99.85  ? 851  HIS A CE1   1 
ATOM   7398  N  NE2   . HIS D 4  851  ? 35.525  -22.175 48.824  1.00 99.43  ? 851  HIS A NE2   1 
ATOM   7399  N  N     . TYR D 4  852  ? 34.000  -28.243 47.976  1.00 109.53 ? 852  TYR A N     1 
ATOM   7400  C  CA    . TYR D 4  852  ? 33.658  -29.595 47.536  1.00 115.05 ? 852  TYR A CA    1 
ATOM   7401  C  C     . TYR D 4  852  ? 33.639  -30.584 48.697  1.00 115.29 ? 852  TYR A C     1 
ATOM   7402  O  O     . TYR D 4  852  ? 32.702  -31.382 48.820  1.00 125.20 ? 852  TYR A O     1 
ATOM   7403  C  CB    . TYR D 4  852  ? 34.601  -30.043 46.423  1.00 122.82 ? 852  TYR A CB    1 
ATOM   7404  C  CG    . TYR D 4  852  ? 33.915  -29.971 45.076  1.00 106.23 ? 852  TYR A CG    1 
ATOM   7405  C  CD1   . TYR D 4  852  ? 34.338  -29.084 44.093  1.00 103.46 ? 852  TYR A CD1   1 
ATOM   7406  C  CD2   . TYR D 4  852  ? 32.825  -30.785 44.799  1.00 105.70 ? 852  TYR A CD2   1 
ATOM   7407  C  CE1   . TYR D 4  852  ? 33.687  -29.016 42.868  1.00 124.57 ? 852  TYR A CE1   1 
ATOM   7408  C  CE2   . TYR D 4  852  ? 32.176  -30.727 43.584  1.00 125.08 ? 852  TYR A CE2   1 
ATOM   7409  C  CZ    . TYR D 4  852  ? 32.608  -29.844 42.621  1.00 128.48 ? 852  TYR A CZ    1 
ATOM   7410  O  OH    . TYR D 4  852  ? 31.955  -29.794 41.411  1.00 113.59 ? 852  TYR A OH    1 
ATOM   7411  N  N     . ASP D 4  853  ? 34.655  -30.556 49.554  1.00 103.35 ? 853  ASP A N     1 
ATOM   7412  C  CA    . ASP D 4  853  ? 34.464  -31.079 50.898  1.00 107.23 ? 853  ASP A CA    1 
ATOM   7413  C  C     . ASP D 4  853  ? 33.750  -30.009 51.711  1.00 98.97  ? 853  ASP A C     1 
ATOM   7414  O  O     . ASP D 4  853  ? 33.879  -28.812 51.438  1.00 123.73 ? 853  ASP A O     1 
ATOM   7415  C  CB    . ASP D 4  853  ? 35.794  -31.469 51.547  1.00 104.63 ? 853  ASP A CB    1 
ATOM   7416  C  CG    . ASP D 4  853  ? 36.523  -30.286 52.169  1.00 104.92 ? 853  ASP A CG    1 
ATOM   7417  O  OD1   . ASP D 4  853  ? 36.252  -29.989 53.354  1.00 113.52 ? 853  ASP A OD1   1 
ATOM   7418  O  OD2   . ASP D 4  853  ? 37.368  -29.664 51.488  1.00 102.23 ? 853  ASP A OD2   1 
ATOM   7419  N  N     . ASN D 4  854  ? 32.998  -30.431 52.726  1.00 79.99  ? 854  ASN A N     1 
ATOM   7420  C  CA    . ASN D 4  854  ? 32.028  -29.503 53.297  1.00 79.45  ? 854  ASN A CA    1 
ATOM   7421  C  C     . ASN D 4  854  ? 32.699  -28.466 54.184  1.00 82.43  ? 854  ASN A C     1 
ATOM   7422  O  O     . ASN D 4  854  ? 32.290  -28.255 55.330  1.00 96.42  ? 854  ASN A O     1 
ATOM   7423  C  CB    . ASN D 4  854  ? 30.964  -30.259 54.091  1.00 79.22  ? 854  ASN A CB    1 
ATOM   7424  C  CG    . ASN D 4  854  ? 30.292  -31.337 53.275  1.00 79.27  ? 854  ASN A CG    1 
ATOM   7425  O  OD1   . ASN D 4  854  ? 30.886  -31.891 52.351  1.00 93.65  ? 854  ASN A OD1   1 
ATOM   7426  N  ND2   . ASN D 4  854  ? 29.045  -31.644 53.612  1.00 78.99  ? 854  ASN A ND2   1 
ATOM   7427  N  N     . THR D 4  855  ? 33.702  -27.784 53.640  1.00 79.75  ? 855  THR A N     1 
ATOM   7428  C  CA    . THR D 4  855  ? 34.403  -26.722 54.347  1.00 79.85  ? 855  THR A CA    1 
ATOM   7429  C  C     . THR D 4  855  ? 33.854  -25.376 53.882  1.00 82.85  ? 855  THR A C     1 
ATOM   7430  O  O     . THR D 4  855  ? 33.982  -25.010 52.708  1.00 87.78  ? 855  THR A O     1 
ATOM   7431  C  CB    . THR D 4  855  ? 35.916  -26.821 54.131  1.00 80.50  ? 855  THR A CB    1 
ATOM   7432  O  OG1   . THR D 4  855  ? 36.559  -25.669 54.689  1.00 85.36  ? 855  THR A OG1   1 
ATOM   7433  C  CG2   . THR D 4  855  ? 36.269  -26.944 52.646  1.00 80.74  ? 855  THR A CG2   1 
ATOM   7434  N  N     . THR D 4  856  ? 33.213  -24.660 54.798  1.00 90.55  ? 856  THR A N     1 
ATOM   7435  C  CA    . THR D 4  856  ? 32.652  -23.347 54.503  1.00 78.85  ? 856  THR A CA    1 
ATOM   7436  C  C     . THR D 4  856  ? 33.786  -22.327 54.489  1.00 79.20  ? 856  THR A C     1 
ATOM   7437  O  O     . THR D 4  856  ? 34.399  -22.058 55.527  1.00 80.77  ? 856  THR A O     1 
ATOM   7438  C  CB    . THR D 4  856  ? 31.588  -22.988 55.536  1.00 79.44  ? 856  THR A CB    1 
ATOM   7439  O  OG1   . THR D 4  856  ? 30.473  -23.881 55.407  1.00 87.32  ? 856  THR A OG1   1 
ATOM   7440  C  CG2   . THR D 4  856  ? 31.105  -21.573 55.341  1.00 78.20  ? 856  THR A CG2   1 
ATOM   7441  N  N     . ARG D 4  857  ? 34.073  -21.759 53.317  1.00 86.58  ? 857  ARG A N     1 
ATOM   7442  C  CA    . ARG D 4  857  ? 35.232  -20.892 53.155  1.00 106.11 ? 857  ARG A CA    1 
ATOM   7443  C  C     . ARG D 4  857  ? 34.850  -19.639 52.380  1.00 113.50 ? 857  ARG A C     1 
ATOM   7444  O  O     . ARG D 4  857  ? 33.773  -19.546 51.782  1.00 121.70 ? 857  ARG A O     1 
ATOM   7445  C  CB    . ARG D 4  857  ? 36.384  -21.613 52.439  1.00 109.96 ? 857  ARG A CB    1 
ATOM   7446  C  CG    . ARG D 4  857  ? 36.797  -22.923 53.079  1.00 109.80 ? 857  ARG A CG    1 
ATOM   7447  C  CD    . ARG D 4  857  ? 38.222  -23.293 52.712  1.00 112.78 ? 857  ARG A CD    1 
ATOM   7448  N  NE    . ARG D 4  857  ? 38.523  -24.673 53.074  1.00 121.23 ? 857  ARG A NE    1 
ATOM   7449  C  CZ    . ARG D 4  857  ? 39.730  -25.223 53.004  1.00 119.71 ? 857  ARG A CZ    1 
ATOM   7450  N  NH1   . ARG D 4  857  ? 40.768  -24.503 52.600  1.00 103.78 ? 857  ARG A NH1   1 
ATOM   7451  N  NH2   . ARG D 4  857  ? 39.899  -26.494 53.346  1.00 126.37 ? 857  ARG A NH2   1 
ATOM   7452  N  N     . ASN D 4  858  ? 35.761  -18.670 52.402  1.00 108.83 ? 858  ASN A N     1 
ATOM   7453  C  CA    . ASN D 4  858  ? 35.673  -17.439 51.636  1.00 113.51 ? 858  ASN A CA    1 
ATOM   7454  C  C     . ASN D 4  858  ? 36.573  -17.541 50.403  1.00 125.78 ? 858  ASN A C     1 
ATOM   7455  O  O     . ASN D 4  858  ? 37.082  -18.616 50.068  1.00 120.27 ? 858  ASN A O     1 
ATOM   7456  C  CB    . ASN D 4  858  ? 36.013  -16.239 52.532  1.00 111.84 ? 858  ASN A CB    1 
ATOM   7457  C  CG    . ASN D 4  858  ? 37.465  -16.238 53.016  1.00 124.98 ? 858  ASN A CG    1 
ATOM   7458  O  OD1   . ASN D 4  858  ? 38.344  -16.867 52.427  1.00 128.84 ? 858  ASN A OD1   1 
ATOM   7459  N  ND2   . ASN D 4  858  ? 37.714  -15.513 54.100  1.00 130.30 ? 858  ASN A ND2   1 
ATOM   7460  N  N     . SER D 4  859  ? 36.761  -16.412 49.711  1.00 146.95 ? 859  SER A N     1 
ATOM   7461  C  CA    . SER D 4  859  ? 37.675  -16.381 48.571  1.00 156.35 ? 859  SER A CA    1 
ATOM   7462  C  C     . SER D 4  859  ? 39.063  -16.865 48.963  1.00 151.12 ? 859  SER A C     1 
ATOM   7463  O  O     . SER D 4  859  ? 39.611  -17.780 48.339  1.00 163.43 ? 859  SER A O     1 
ATOM   7464  C  CB    . SER D 4  859  ? 37.743  -14.966 47.991  1.00 158.88 ? 859  SER A CB    1 
ATOM   7465  O  OG    . SER D 4  859  ? 37.954  -13.998 49.007  1.00 155.81 ? 859  SER A OG    1 
ATOM   7466  N  N     . LEU D 4  860  ? 39.649  -16.262 49.998  1.00 134.49 ? 860  LEU A N     1 
ATOM   7467  C  CA    . LEU D 4  860  ? 40.971  -16.686 50.448  1.00 119.41 ? 860  LEU A CA    1 
ATOM   7468  C  C     . LEU D 4  860  ? 40.952  -18.137 50.912  1.00 113.75 ? 860  LEU A C     1 
ATOM   7469  O  O     . LEU D 4  860  ? 41.942  -18.862 50.746  1.00 115.37 ? 860  LEU A O     1 
ATOM   7470  C  CB    . LEU D 4  860  ? 41.455  -15.775 51.574  1.00 110.48 ? 860  LEU A CB    1 
ATOM   7471  C  CG    . LEU D 4  860  ? 41.393  -14.281 51.264  1.00 118.53 ? 860  LEU A CG    1 
ATOM   7472  C  CD1   . LEU D 4  860  ? 41.644  -13.422 52.497  1.00 130.68 ? 860  LEU A CD1   1 
ATOM   7473  C  CD2   . LEU D 4  860  ? 42.394  -13.951 50.172  1.00 120.43 ? 860  LEU A CD2   1 
ATOM   7474  N  N     . GLY D 4  861  ? 39.837  -18.575 51.489  1.00 96.91  ? 861  GLY A N     1 
ATOM   7475  C  CA    . GLY D 4  861  ? 39.719  -19.892 52.063  1.00 86.33  ? 861  GLY A CA    1 
ATOM   7476  C  C     . GLY D 4  861  ? 39.733  -19.969 53.597  1.00 85.11  ? 861  GLY A C     1 
ATOM   7477  O  O     . GLY D 4  861  ? 40.065  -21.027 54.142  1.00 82.10  ? 861  GLY A O     1 
ATOM   7478  N  N     . ASN D 4  862  ? 39.419  -18.877 54.293  1.00 122.74 ? 862  ASN A N     1 
ATOM   7479  C  CA    . ASN D 4  862  ? 39.336  -18.925 55.749  1.00 126.91 ? 862  ASN A CA    1 
ATOM   7480  C  C     . ASN D 4  862  ? 38.111  -19.744 56.153  1.00 107.71 ? 862  ASN A C     1 
ATOM   7481  O  O     . ASN D 4  862  ? 36.991  -19.450 55.724  1.00 112.59 ? 862  ASN A O     1 
ATOM   7482  C  CB    . ASN D 4  862  ? 39.271  -17.510 56.329  1.00 143.74 ? 862  ASN A CB    1 
ATOM   7483  C  CG    . ASN D 4  862  ? 40.578  -16.751 56.172  1.00 141.85 ? 862  ASN A CG    1 
ATOM   7484  O  OD1   . ASN D 4  862  ? 41.404  -17.104 55.330  1.00 139.52 ? 862  ASN A OD1   1 
ATOM   7485  N  ND2   . ASN D 4  862  ? 40.761  -15.693 56.958  1.00 134.32 ? 862  ASN A ND2   1 
ATOM   7486  N  N     . VAL D 4  863  ? 38.319  -20.767 56.978  1.00 81.12  ? 863  VAL A N     1 
ATOM   7487  C  CA    . VAL D 4  863  ? 37.243  -21.694 57.321  1.00 80.63  ? 863  VAL A CA    1 
ATOM   7488  C  C     . VAL D 4  863  ? 36.263  -20.981 58.251  1.00 80.17  ? 863  VAL A C     1 
ATOM   7489  O  O     . VAL D 4  863  ? 36.562  -20.751 59.426  1.00 92.28  ? 863  VAL A O     1 
ATOM   7490  C  CB    . VAL D 4  863  ? 37.787  -22.978 57.963  1.00 80.97  ? 863  VAL A CB    1 
ATOM   7491  C  CG1   . VAL D 4  863  ? 36.643  -23.899 58.386  1.00 80.51  ? 863  VAL A CG1   1 
ATOM   7492  C  CG2   . VAL D 4  863  ? 38.729  -23.697 57.008  1.00 81.48  ? 863  VAL A CG2   1 
ATOM   7493  N  N     . ILE D 4  864  ? 35.095  -20.613 57.723  1.00 83.90  ? 864  ILE A N     1 
ATOM   7494  C  CA    . ILE D 4  864  ? 34.027  -20.087 58.570  1.00 95.47  ? 864  ILE A CA    1 
ATOM   7495  C  C     . ILE D 4  864  ? 33.469  -21.196 59.452  1.00 100.00 ? 864  ILE A C     1 
ATOM   7496  O  O     . ILE D 4  864  ? 33.466  -21.098 60.684  1.00 111.09 ? 864  ILE A O     1 
ATOM   7497  C  CB    . ILE D 4  864  ? 32.923  -19.443 57.712  1.00 101.91 ? 864  ILE A CB    1 
ATOM   7498  C  CG1   . ILE D 4  864  ? 33.526  -18.449 56.716  1.00 103.56 ? 864  ILE A CG1   1 
ATOM   7499  C  CG2   . ILE D 4  864  ? 31.869  -18.788 58.594  1.00 100.34 ? 864  ILE A CG2   1 
ATOM   7500  C  CD1   . ILE D 4  864  ? 34.328  -17.340 57.360  1.00 109.92 ? 864  ILE A CD1   1 
ATOM   7501  N  N     . GLN D 4  865  ? 32.991  -22.268 58.826  1.00 85.91  ? 865  GLN A N     1 
ATOM   7502  C  CA    . GLN D 4  865  ? 32.560  -23.471 59.516  1.00 86.66  ? 865  GLN A CA    1 
ATOM   7503  C  C     . GLN D 4  865  ? 33.238  -24.668 58.866  1.00 114.19 ? 865  GLN A C     1 
ATOM   7504  O  O     . GLN D 4  865  ? 33.500  -24.670 57.660  1.00 133.15 ? 865  GLN A O     1 
ATOM   7505  C  CB    . GLN D 4  865  ? 31.033  -23.653 59.458  1.00 85.88  ? 865  GLN A CB    1 
ATOM   7506  C  CG    . GLN D 4  865  ? 30.219  -22.411 59.791  1.00 79.67  ? 865  GLN A CG    1 
ATOM   7507  C  CD    . GLN D 4  865  ? 28.799  -22.488 59.250  1.00 91.38  ? 865  GLN A CD    1 
ATOM   7508  O  OE1   . GLN D 4  865  ? 28.578  -22.921 58.119  1.00 96.49  ? 865  GLN A OE1   1 
ATOM   7509  N  NE2   . GLN D 4  865  ? 27.832  -22.059 60.054  1.00 86.35  ? 865  GLN A NE2   1 
ATOM   7510  N  N     . PHE D 4  866  ? 33.522  -25.692 59.672  1.00 116.55 ? 866  PHE A N     1 
ATOM   7511  C  CA    . PHE D 4  866  ? 34.110  -26.916 59.139  1.00 107.33 ? 866  PHE A CA    1 
ATOM   7512  C  C     . PHE D 4  866  ? 33.065  -27.853 58.552  1.00 108.34 ? 866  PHE A C     1 
ATOM   7513  O  O     . PHE D 4  866  ? 33.411  -28.721 57.743  1.00 103.95 ? 866  PHE A O     1 
ATOM   7514  C  CB    . PHE D 4  866  ? 34.912  -27.631 60.227  1.00 104.49 ? 866  PHE A CB    1 
ATOM   7515  C  CG    . PHE D 4  866  ? 36.140  -26.880 60.657  1.00 89.77  ? 866  PHE A CG    1 
ATOM   7516  C  CD1   . PHE D 4  866  ? 36.077  -25.946 61.677  1.00 86.45  ? 866  PHE A CD1   1 
ATOM   7517  C  CD2   . PHE D 4  866  ? 37.351  -27.091 60.021  1.00 82.92  ? 866  PHE A CD2   1 
ATOM   7518  C  CE1   . PHE D 4  866  ? 37.205  -25.248 62.064  1.00 93.70  ? 866  PHE A CE1   1 
ATOM   7519  C  CE2   . PHE D 4  866  ? 38.481  -26.394 60.402  1.00 83.40  ? 866  PHE A CE2   1 
ATOM   7520  C  CZ    . PHE D 4  866  ? 38.406  -25.472 61.423  1.00 87.70  ? 866  PHE A CZ    1 
ATOM   7521  N  N     . ILE D 4  867  ? 31.809  -27.713 58.969  1.00 109.25 ? 867  ILE A N     1 
ATOM   7522  C  CA    . ILE D 4  867  ? 30.672  -28.392 58.356  1.00 103.24 ? 867  ILE A CA    1 
ATOM   7523  C  C     . ILE D 4  867  ? 29.543  -27.373 58.266  1.00 103.00 ? 867  ILE A C     1 
ATOM   7524  O  O     . ILE D 4  867  ? 29.245  -26.689 59.251  1.00 107.44 ? 867  ILE A O     1 
ATOM   7525  C  CB    . ILE D 4  867  ? 30.221  -29.628 59.163  1.00 94.43  ? 867  ILE A CB    1 
ATOM   7526  C  CG1   . ILE D 4  867  ? 31.419  -30.362 59.776  1.00 116.69 ? 867  ILE A CG1   1 
ATOM   7527  C  CG2   . ILE D 4  867  ? 29.474  -30.581 58.264  1.00 84.08  ? 867  ILE A CG2   1 
ATOM   7528  C  CD1   . ILE D 4  867  ? 31.046  -31.407 60.824  1.00 115.48 ? 867  ILE A CD1   1 
ATOM   7529  N  N     . TYR D 4  868  ? 28.925  -27.258 57.089  1.00 98.19  ? 868  TYR A N     1 
ATOM   7530  C  CA    . TYR D 4  868  ? 27.882  -26.254 56.889  1.00 89.56  ? 868  TYR A CA    1 
ATOM   7531  C  C     . TYR D 4  868  ? 26.706  -26.517 57.818  1.00 94.70  ? 868  TYR A C     1 
ATOM   7532  O  O     . TYR D 4  868  ? 26.102  -27.591 57.779  1.00 97.81  ? 868  TYR A O     1 
ATOM   7533  C  CB    . TYR D 4  868  ? 27.411  -26.234 55.437  1.00 97.65  ? 868  TYR A CB    1 
ATOM   7534  C  CG    . TYR D 4  868  ? 26.162  -25.400 55.246  1.00 96.24  ? 868  TYR A CG    1 
ATOM   7535  C  CD1   . TYR D 4  868  ? 26.224  -24.016 55.242  1.00 102.07 ? 868  TYR A CD1   1 
ATOM   7536  C  CD2   . TYR D 4  868  ? 24.923  -25.998 55.065  1.00 93.92  ? 868  TYR A CD2   1 
ATOM   7537  C  CE1   . TYR D 4  868  ? 25.085  -23.250 55.080  1.00 102.83 ? 868  TYR A CE1   1 
ATOM   7538  C  CE2   . TYR D 4  868  ? 23.781  -25.240 54.892  1.00 89.59  ? 868  TYR A CE2   1 
ATOM   7539  C  CZ    . TYR D 4  868  ? 23.868  -23.866 54.899  1.00 91.90  ? 868  TYR A CZ    1 
ATOM   7540  O  OH    . TYR D 4  868  ? 22.742  -23.094 54.730  1.00 91.80  ? 868  TYR A OH    1 
ATOM   7541  N  N     . GLY D 4  869  ? 26.379  -25.536 58.654  1.00 77.39  ? 869  GLY A N     1 
ATOM   7542  C  CA    . GLY D 4  869  ? 25.407  -25.787 59.689  1.00 77.30  ? 869  GLY A CA    1 
ATOM   7543  C  C     . GLY D 4  869  ? 25.822  -26.809 60.722  1.00 77.58  ? 869  GLY A C     1 
ATOM   7544  O  O     . GLY D 4  869  ? 24.973  -27.250 61.491  1.00 77.57  ? 869  GLY A O     1 
ATOM   7545  N  N     . GLU D 4  870  ? 27.099  -27.200 60.754  1.00 78.42  ? 870  GLU A N     1 
ATOM   7546  C  CA    . GLU D 4  870  ? 27.681  -28.164 61.689  1.00 80.71  ? 870  GLU A CA    1 
ATOM   7547  C  C     . GLU D 4  870  ? 27.220  -29.599 61.435  1.00 87.65  ? 870  GLU A C     1 
ATOM   7548  O  O     . GLU D 4  870  ? 27.708  -30.526 62.111  1.00 112.51 ? 870  GLU A O     1 
ATOM   7549  C  CB    . GLU D 4  870  ? 27.411  -27.770 63.149  1.00 86.61  ? 870  GLU A CB    1 
ATOM   7550  C  CG    . GLU D 4  870  ? 27.700  -26.290 63.407  1.00 94.82  ? 870  GLU A CG    1 
ATOM   7551  C  CD    . GLU D 4  870  ? 27.527  -25.868 64.847  1.00 98.94  ? 870  GLU A CD    1 
ATOM   7552  O  OE1   . GLU D 4  870  ? 27.786  -26.695 65.737  1.00 111.01 ? 870  GLU A OE1   1 
ATOM   7553  O  OE2   . GLU D 4  870  ? 27.120  -24.712 65.084  1.00 90.14  ? 870  GLU A OE2   1 
ATOM   7554  N  N     . ASP D 4  871  ? 26.328  -29.822 60.467  1.00 82.86  ? 871  ASP A N     1 
ATOM   7555  C  CA    . ASP D 4  871  ? 25.965  -31.164 60.040  1.00 84.98  ? 871  ASP A CA    1 
ATOM   7556  C  C     . ASP D 4  871  ? 26.149  -31.402 58.551  1.00 85.87  ? 871  ASP A C     1 
ATOM   7557  O  O     . ASP D 4  871  ? 26.173  -32.564 58.132  1.00 86.58  ? 871  ASP A O     1 
ATOM   7558  C  CB    . ASP D 4  871  ? 24.508  -31.487 60.422  1.00 78.21  ? 871  ASP A CB    1 
ATOM   7559  C  CG    . ASP D 4  871  ? 23.503  -30.507 59.832  1.00 77.84  ? 871  ASP A CG    1 
ATOM   7560  O  OD1   . ASP D 4  871  ? 23.887  -29.646 59.009  1.00 77.67  ? 871  ASP A OD1   1 
ATOM   7561  O  OD2   . ASP D 4  871  ? 22.314  -30.605 60.201  1.00 77.78  ? 871  ASP A OD2   1 
ATOM   7562  N  N     . GLY D 4  872  ? 26.267  -30.350 57.745  1.00 90.31  ? 872  GLY A N     1 
ATOM   7563  C  CA    . GLY D 4  872  ? 26.498  -30.503 56.324  1.00 96.04  ? 872  GLY A CA    1 
ATOM   7564  C  C     . GLY D 4  872  ? 25.264  -30.718 55.482  1.00 84.56  ? 872  GLY A C     1 
ATOM   7565  O  O     . GLY D 4  872  ? 25.386  -31.169 54.338  1.00 109.21 ? 872  GLY A O     1 
ATOM   7566  N  N     . MET D 4  873  ? 24.081  -30.409 56.005  1.00 78.87  ? 873  MET A N     1 
ATOM   7567  C  CA    . MET D 4  873  ? 22.833  -30.618 55.288  1.00 86.83  ? 873  MET A CA    1 
ATOM   7568  C  C     . MET D 4  873  ? 22.431  -29.369 54.508  1.00 86.79  ? 873  MET A C     1 
ATOM   7569  O  O     . MET D 4  873  ? 22.948  -28.272 54.723  1.00 82.48  ? 873  MET A O     1 
ATOM   7570  C  CB    . MET D 4  873  ? 21.720  -31.003 56.262  1.00 81.64  ? 873  MET A CB    1 
ATOM   7571  C  CG    . MET D 4  873  ? 22.039  -32.225 57.089  1.00 81.47  ? 873  MET A CG    1 
ATOM   7572  S  SD    . MET D 4  873  ? 22.197  -33.713 56.086  1.00 104.51 ? 873  MET A SD    1 
ATOM   7573  C  CE    . MET D 4  873  ? 23.380  -34.622 57.072  1.00 119.97 ? 873  MET A CE    1 
ATOM   7574  N  N     . ASP D 4  874  ? 21.491  -29.551 53.583  1.00 91.20  ? 874  ASP A N     1 
ATOM   7575  C  CA    . ASP D 4  874  ? 20.804  -28.435 52.947  1.00 84.63  ? 874  ASP A CA    1 
ATOM   7576  C  C     . ASP D 4  874  ? 19.520  -28.166 53.720  1.00 82.91  ? 874  ASP A C     1 
ATOM   7577  O  O     . ASP D 4  874  ? 18.746  -29.091 53.988  1.00 77.22  ? 874  ASP A O     1 
ATOM   7578  C  CB    . ASP D 4  874  ? 20.508  -28.736 51.475  1.00 82.40  ? 874  ASP A CB    1 
ATOM   7579  C  CG    . ASP D 4  874  ? 19.889  -27.552 50.738  1.00 81.72  ? 874  ASP A CG    1 
ATOM   7580  O  OD1   . ASP D 4  874  ? 18.748  -27.160 51.064  1.00 81.12  ? 874  ASP A OD1   1 
ATOM   7581  O  OD2   . ASP D 4  874  ? 20.556  -27.004 49.834  1.00 87.77  ? 874  ASP A OD2   1 
ATOM   7582  N  N     . ALA D 4  875  ? 19.303  -26.900 54.082  1.00 76.85  ? 875  ALA A N     1 
ATOM   7583  C  CA    . ALA D 4  875  ? 18.187  -26.543 54.951  1.00 76.79  ? 875  ALA A CA    1 
ATOM   7584  C  C     . ALA D 4  875  ? 16.832  -26.913 54.359  1.00 80.79  ? 875  ALA A C     1 
ATOM   7585  O  O     . ALA D 4  875  ? 15.858  -27.044 55.109  1.00 76.99  ? 875  ALA A O     1 
ATOM   7586  C  CB    . ALA D 4  875  ? 18.223  -25.048 55.257  1.00 76.59  ? 875  ALA A CB    1 
ATOM   7587  N  N     . ALA D 4  876  ? 16.745  -27.082 53.037  1.00 76.98  ? 876  ALA A N     1 
ATOM   7588  C  CA    . ALA D 4  876  ? 15.461  -27.394 52.419  1.00 77.15  ? 876  ALA A CA    1 
ATOM   7589  C  C     . ALA D 4  876  ? 15.001  -28.801 52.776  1.00 77.43  ? 876  ALA A C     1 
ATOM   7590  O  O     . ALA D 4  876  ? 13.822  -29.015 53.083  1.00 77.60  ? 876  ALA A O     1 
ATOM   7591  C  CB    . ALA D 4  876  ? 15.553  -27.223 50.903  1.00 77.20  ? 876  ALA A CB    1 
ATOM   7592  N  N     . HIS D 4  877  ? 15.914  -29.767 52.756  1.00 108.63 ? 877  HIS A N     1 
ATOM   7593  C  CA    . HIS D 4  877  ? 15.588  -31.163 53.043  1.00 112.46 ? 877  HIS A CA    1 
ATOM   7594  C  C     . HIS D 4  877  ? 15.638  -31.443 54.543  1.00 110.48 ? 877  HIS A C     1 
ATOM   7595  O  O     . HIS D 4  877  ? 16.278  -32.393 54.989  1.00 133.41 ? 877  HIS A O     1 
ATOM   7596  C  CB    . HIS D 4  877  ? 16.543  -32.091 52.297  1.00 118.96 ? 877  HIS A CB    1 
ATOM   7597  C  CG    . HIS D 4  877  ? 16.720  -31.772 50.842  1.00 110.11 ? 877  HIS A CG    1 
ATOM   7598  N  ND1   . HIS D 4  877  ? 17.093  -30.526 50.384  1.00 113.58 ? 877  HIS A ND1   1 
ATOM   7599  C  CD2   . HIS D 4  877  ? 16.613  -32.556 49.743  1.00 105.29 ? 877  HIS A CD2   1 
ATOM   7600  C  CE1   . HIS D 4  877  ? 17.182  -30.550 49.067  1.00 106.66 ? 877  HIS A CE1   1 
ATOM   7601  N  NE2   . HIS D 4  877  ? 16.895  -31.770 48.653  1.00 106.97 ? 877  HIS A NE2   1 
ATOM   7602  N  N     . ILE D 4  878  ? 14.951  -30.620 55.336  1.00 105.99 ? 878  ILE A N     1 
ATOM   7603  C  CA    . ILE D 4  878  ? 15.041  -30.667 56.793  1.00 78.30  ? 878  ILE A CA    1 
ATOM   7604  C  C     . ILE D 4  878  ? 13.674  -30.347 57.382  1.00 77.89  ? 878  ILE A C     1 
ATOM   7605  O  O     . ILE D 4  878  ? 13.062  -29.333 57.031  1.00 101.93 ? 878  ILE A O     1 
ATOM   7606  C  CB    . ILE D 4  878  ? 16.100  -29.684 57.330  1.00 77.47  ? 878  ILE A CB    1 
ATOM   7607  C  CG1   . ILE D 4  878  ? 17.512  -30.219 57.079  1.00 82.30  ? 878  ILE A CG1   1 
ATOM   7608  C  CG2   . ILE D 4  878  ? 15.886  -29.436 58.802  1.00 77.50  ? 878  ILE A CG2   1 
ATOM   7609  C  CD1   . ILE D 4  878  ? 18.616  -29.396 57.720  1.00 110.64 ? 878  ILE A CD1   1 
ATOM   7610  N  N     . GLU D 4  879  ? 13.202  -31.201 58.288  1.00 78.19  ? 879  GLU A N     1 
ATOM   7611  C  CA    . GLU D 4  879  ? 11.878  -31.062 58.873  1.00 78.43  ? 879  GLU A CA    1 
ATOM   7612  C  C     . GLU D 4  879  ? 11.961  -31.187 60.388  1.00 83.06  ? 879  GLU A C     1 
ATOM   7613  O  O     . GLU D 4  879  ? 12.803  -31.913 60.926  1.00 78.61  ? 879  GLU A O     1 
ATOM   7614  C  CB    . GLU D 4  879  ? 10.912  -32.114 58.311  1.00 78.85  ? 879  GLU A CB    1 
ATOM   7615  C  CG    . GLU D 4  879  ? 10.789  -32.102 56.796  1.00 78.81  ? 879  GLU A CG    1 
ATOM   7616  C  CD    . GLU D 4  879  ? 9.780   -33.111 56.290  1.00 79.30  ? 879  GLU A CD    1 
ATOM   7617  O  OE1   . GLU D 4  879  ? 10.120  -33.880 55.364  1.00 84.66  ? 879  GLU A OE1   1 
ATOM   7618  O  OE2   . GLU D 4  879  ? 8.652   -33.141 56.822  1.00 79.62  ? 879  GLU A OE2   1 
ATOM   7619  N  N     . LYS D 4  880  ? 11.075  -30.464 61.068  1.00 98.98  ? 880  LYS A N     1 
ATOM   7620  C  CA    . LYS D 4  880  ? 11.008  -30.483 62.524  1.00 94.50  ? 880  LYS A CA    1 
ATOM   7621  C  C     . LYS D 4  880  ? 10.306  -31.753 62.987  1.00 97.20  ? 880  LYS A C     1 
ATOM   7622  O  O     . LYS D 4  880  ? 9.127   -31.965 62.685  1.00 119.49 ? 880  LYS A O     1 
ATOM   7623  C  CB    . LYS D 4  880  ? 10.273  -29.245 63.032  1.00 98.58  ? 880  LYS A CB    1 
ATOM   7624  C  CG    . LYS D 4  880  ? 9.747   -29.355 64.451  1.00 87.69  ? 880  LYS A CG    1 
ATOM   7625  C  CD    . LYS D 4  880  ? 8.787   -28.214 64.757  1.00 90.73  ? 880  LYS A CD    1 
ATOM   7626  C  CE    . LYS D 4  880  ? 9.473   -26.861 64.628  1.00 98.26  ? 880  LYS A CE    1 
ATOM   7627  N  NZ    . LYS D 4  880  ? 8.531   -25.732 64.867  1.00 91.51  ? 880  LYS A NZ    1 
ATOM   7628  N  N     . GLN D 4  881  ? 11.030  -32.596 63.715  1.00 90.83  ? 881  GLN A N     1 
ATOM   7629  C  CA    . GLN D 4  881  ? 10.481  -33.838 64.235  1.00 98.05  ? 881  GLN A CA    1 
ATOM   7630  C  C     . GLN D 4  881  ? 10.931  -34.020 65.675  1.00 93.60  ? 881  GLN A C     1 
ATOM   7631  O  O     . GLN D 4  881  ? 12.025  -33.599 66.060  1.00 80.62  ? 881  GLN A O     1 
ATOM   7632  C  CB    . GLN D 4  881  ? 10.913  -35.035 63.389  1.00 92.08  ? 881  GLN A CB    1 
ATOM   7633  C  CG    . GLN D 4  881  ? 12.251  -34.834 62.721  1.00 80.45  ? 881  GLN A CG    1 
ATOM   7634  C  CD    . GLN D 4  881  ? 12.523  -35.881 61.674  1.00 81.57  ? 881  GLN A CD    1 
ATOM   7635  O  OE1   . GLN D 4  881  ? 11.861  -36.921 61.635  1.00 81.06  ? 881  GLN A OE1   1 
ATOM   7636  N  NE2   . GLN D 4  881  ? 13.492  -35.614 60.808  1.00 80.26  ? 881  GLN A NE2   1 
ATOM   7637  N  N     . SER D 4  882  ? 10.077  -34.664 66.462  1.00 101.73 ? 882  SER A N     1 
ATOM   7638  C  CA    . SER D 4  882  ? 10.299  -34.812 67.890  1.00 82.70  ? 882  SER A CA    1 
ATOM   7639  C  C     . SER D 4  882  ? 11.173  -36.025 68.183  1.00 83.63  ? 882  SER A C     1 
ATOM   7640  O  O     . SER D 4  882  ? 11.100  -37.050 67.498  1.00 81.37  ? 882  SER A O     1 
ATOM   7641  C  CB    . SER D 4  882  ? 8.965   -34.941 68.627  1.00 81.48  ? 882  SER A CB    1 
ATOM   7642  O  OG    . SER D 4  882  ? 8.372   -36.206 68.389  1.00 82.00  ? 882  SER A OG    1 
ATOM   7643  N  N     . LEU D 4  883  ? 12.014  -35.890 69.213  1.00 81.15  ? 883  LEU A N     1 
ATOM   7644  C  CA    . LEU D 4  883  ? 12.808  -36.991 69.757  1.00 93.12  ? 883  LEU A CA    1 
ATOM   7645  C  C     . LEU D 4  883  ? 12.166  -37.390 71.083  1.00 97.07  ? 883  LEU A C     1 
ATOM   7646  O  O     . LEU D 4  883  ? 12.341  -36.707 72.096  1.00 90.47  ? 883  LEU A O     1 
ATOM   7647  C  CB    . LEU D 4  883  ? 14.270  -36.591 69.942  1.00 81.73  ? 883  LEU A CB    1 
ATOM   7648  C  CG    . LEU D 4  883  ? 15.022  -36.036 68.728  1.00 80.60  ? 883  LEU A CG    1 
ATOM   7649  C  CD1   . LEU D 4  883  ? 15.004  -34.521 68.726  1.00 80.14  ? 883  LEU A CD1   1 
ATOM   7650  C  CD2   . LEU D 4  883  ? 16.455  -36.545 68.676  1.00 80.59  ? 883  LEU A CD2   1 
ATOM   7651  N  N     . ASP D 4  884  ? 11.428  -38.502 71.073  1.00 116.63 ? 884  ASP A N     1 
ATOM   7652  C  CA    . ASP D 4  884  ? 10.633  -38.899 72.230  1.00 113.75 ? 884  ASP A CA    1 
ATOM   7653  C  C     . ASP D 4  884  ? 11.477  -39.293 73.434  1.00 99.84  ? 884  ASP A C     1 
ATOM   7654  O  O     . ASP D 4  884  ? 10.929  -39.401 74.536  1.00 110.22 ? 884  ASP A O     1 
ATOM   7655  C  CB    . ASP D 4  884  ? 9.705   -40.057 71.861  1.00 117.68 ? 884  ASP A CB    1 
ATOM   7656  C  CG    . ASP D 4  884  ? 9.065   -39.881 70.499  1.00 124.71 ? 884  ASP A CG    1 
ATOM   7657  O  OD1   . ASP D 4  884  ? 9.174   -40.805 69.665  1.00 123.04 ? 884  ASP A OD1   1 
ATOM   7658  O  OD2   . ASP D 4  884  ? 8.452   -38.820 70.261  1.00 142.57 ? 884  ASP A OD2   1 
ATOM   7659  N  N     . THR D 4  885  ? 12.783  -39.509 73.257  1.00 88.69  ? 885  THR A N     1 
ATOM   7660  C  CA    . THR D 4  885  ? 13.625  -39.893 74.385  1.00 102.28 ? 885  THR A CA    1 
ATOM   7661  C  C     . THR D 4  885  ? 13.826  -38.744 75.370  1.00 109.00 ? 885  THR A C     1 
ATOM   7662  O  O     . THR D 4  885  ? 14.036  -38.989 76.563  1.00 104.39 ? 885  THR A O     1 
ATOM   7663  C  CB    . THR D 4  885  ? 14.979  -40.405 73.885  1.00 86.39  ? 885  THR A CB    1 
ATOM   7664  O  OG1   . THR D 4  885  ? 15.518  -39.491 72.922  1.00 99.66  ? 885  THR A OG1   1 
ATOM   7665  C  CG2   . THR D 4  885  ? 14.827  -41.774 73.244  1.00 85.92  ? 885  THR A CG2   1 
ATOM   7666  N  N     . ILE D 4  886  ? 13.757  -37.496 74.900  1.00 90.06  ? 886  ILE A N     1 
ATOM   7667  C  CA    . ILE D 4  886  ? 14.077  -36.353 75.757  1.00 87.21  ? 886  ILE A CA    1 
ATOM   7668  C  C     . ILE D 4  886  ? 13.077  -36.238 76.902  1.00 104.81 ? 886  ILE A C     1 
ATOM   7669  O  O     . ILE D 4  886  ? 13.451  -36.230 78.080  1.00 115.07 ? 886  ILE A O     1 
ATOM   7670  C  CB    . ILE D 4  886  ? 14.144  -35.059 74.927  1.00 92.33  ? 886  ILE A CB    1 
ATOM   7671  C  CG1   . ILE D 4  886  ? 15.545  -34.900 74.352  1.00 83.45  ? 886  ILE A CG1   1 
ATOM   7672  C  CG2   . ILE D 4  886  ? 13.811  -33.838 75.781  1.00 97.04  ? 886  ILE A CG2   1 
ATOM   7673  C  CD1   . ILE D 4  886  ? 16.575  -34.704 75.426  1.00 81.78  ? 886  ILE A CD1   1 
ATOM   7674  N  N     . GLY D 4  887  ? 11.791  -36.146 76.576  1.00 113.32 ? 887  GLY A N     1 
ATOM   7675  C  CA    . GLY D 4  887  ? 10.771  -36.009 77.591  1.00 106.65 ? 887  GLY A CA    1 
ATOM   7676  C  C     . GLY D 4  887  ? 10.401  -37.337 78.218  1.00 85.65  ? 887  GLY A C     1 
ATOM   7677  O  O     . GLY D 4  887  ? 10.982  -38.386 77.939  1.00 84.75  ? 887  GLY A O     1 
ATOM   7678  N  N     . GLY D 4  888  ? 9.413   -37.281 79.096  1.00 85.19  ? 888  GLY A N     1 
ATOM   7679  C  CA    . GLY D 4  888  ? 8.859   -38.506 79.649  1.00 86.00  ? 888  GLY A CA    1 
ATOM   7680  C  C     . GLY D 4  888  ? 9.605   -38.989 80.876  1.00 96.10  ? 888  GLY A C     1 
ATOM   7681  O  O     . GLY D 4  888  ? 10.789  -38.718 81.077  1.00 92.00  ? 888  GLY A O     1 
ATOM   7682  N  N     . SER D 4  889  ? 8.886   -39.732 81.713  1.00 117.17 ? 889  SER A N     1 
ATOM   7683  C  CA    . SER D 4  889  ? 9.455   -40.280 82.932  1.00 122.74 ? 889  SER A CA    1 
ATOM   7684  C  C     . SER D 4  889  ? 10.500  -41.346 82.614  1.00 124.18 ? 889  SER A C     1 
ATOM   7685  O  O     . SER D 4  889  ? 10.514  -41.943 81.534  1.00 118.88 ? 889  SER A O     1 
ATOM   7686  C  CB    . SER D 4  889  ? 8.358   -40.882 83.811  1.00 132.07 ? 889  SER A CB    1 
ATOM   7687  O  OG    . SER D 4  889  ? 8.026   -42.192 83.378  1.00 125.99 ? 889  SER A OG    1 
ATOM   7688  N  N     . ASP D 4  890  ? 11.392  -41.577 83.581  1.00 133.68 ? 890  ASP A N     1 
ATOM   7689  C  CA    . ASP D 4  890  ? 12.305  -42.711 83.487  1.00 118.92 ? 890  ASP A CA    1 
ATOM   7690  C  C     . ASP D 4  890  ? 11.546  -44.030 83.504  1.00 116.74 ? 890  ASP A C     1 
ATOM   7691  O  O     . ASP D 4  890  ? 12.028  -45.032 82.965  1.00 112.05 ? 890  ASP A O     1 
ATOM   7692  C  CB    . ASP D 4  890  ? 13.322  -42.665 84.628  1.00 111.68 ? 890  ASP A CB    1 
ATOM   7693  C  CG    . ASP D 4  890  ? 14.433  -41.657 84.384  1.00 109.67 ? 890  ASP A CG    1 
ATOM   7694  O  OD1   . ASP D 4  890  ? 15.159  -41.808 83.378  1.00 100.29 ? 890  ASP A OD1   1 
ATOM   7695  O  OD2   . ASP D 4  890  ? 14.573  -40.711 85.190  1.00 100.05 ? 890  ASP A OD2   1 
ATOM   7696  N  N     . ALA D 4  891  ? 10.361  -44.047 84.116  1.00 124.68 ? 891  ALA A N     1 
ATOM   7697  C  CA    . ALA D 4  891  ? 9.545   -45.256 84.151  1.00 138.98 ? 891  ALA A CA    1 
ATOM   7698  C  C     . ALA D 4  891  ? 8.864   -45.512 82.811  1.00 131.80 ? 891  ALA A C     1 
ATOM   7699  O  O     . ALA D 4  891  ? 8.928   -46.625 82.279  1.00 131.01 ? 891  ALA A O     1 
ATOM   7700  C  CB    . ALA D 4  891  ? 8.507   -45.151 85.269  1.00 163.18 ? 891  ALA A CB    1 
ATOM   7701  N  N     . ALA D 4  892  ? 8.206   -44.492 82.252  1.00 123.30 ? 892  ALA A N     1 
ATOM   7702  C  CA    . ALA D 4  892  ? 7.543   -44.660 80.963  1.00 123.88 ? 892  ALA A CA    1 
ATOM   7703  C  C     . ALA D 4  892  ? 8.553   -44.933 79.857  1.00 105.06 ? 892  ALA A C     1 
ATOM   7704  O  O     . ALA D 4  892  ? 8.263   -45.681 78.916  1.00 95.68  ? 892  ALA A O     1 
ATOM   7705  C  CB    . ALA D 4  892  ? 6.710   -43.422 80.635  1.00 122.90 ? 892  ALA A CB    1 
ATOM   7706  N  N     . PHE D 4  893  ? 9.735   -44.318 79.947  1.00 103.51 ? 893  PHE A N     1 
ATOM   7707  C  CA    . PHE D 4  893  ? 10.835  -44.648 79.046  1.00 87.79  ? 893  PHE A CA    1 
ATOM   7708  C  C     . PHE D 4  893  ? 11.123  -46.142 79.060  1.00 88.44  ? 893  PHE A C     1 
ATOM   7709  O  O     . PHE D 4  893  ? 11.267  -46.771 78.006  1.00 88.33  ? 893  PHE A O     1 
ATOM   7710  C  CB    . PHE D 4  893  ? 12.084  -43.857 79.451  1.00 87.28  ? 893  PHE A CB    1 
ATOM   7711  C  CG    . PHE D 4  893  ? 13.313  -44.176 78.635  1.00 86.87  ? 893  PHE A CG    1 
ATOM   7712  C  CD1   . PHE D 4  893  ? 13.640  -43.425 77.521  1.00 86.07  ? 893  PHE A CD1   1 
ATOM   7713  C  CD2   . PHE D 4  893  ? 14.152  -45.218 78.997  1.00 87.34  ? 893  PHE A CD2   1 
ATOM   7714  C  CE1   . PHE D 4  893  ? 14.774  -43.717 76.779  1.00 85.76  ? 893  PHE A CE1   1 
ATOM   7715  C  CE2   . PHE D 4  893  ? 15.280  -45.514 78.257  1.00 87.03  ? 893  PHE A CE2   1 
ATOM   7716  C  CZ    . PHE D 4  893  ? 15.592  -44.761 77.149  1.00 86.25  ? 893  PHE A CZ    1 
ATOM   7717  N  N     . GLU D 4  894  ? 11.219  -46.726 80.256  1.00 89.17  ? 894  GLU A N     1 
ATOM   7718  C  CA    . GLU D 4  894  ? 11.592  -48.133 80.371  1.00 94.52  ? 894  GLU A CA    1 
ATOM   7719  C  C     . GLU D 4  894  ? 10.532  -49.036 79.753  1.00 90.35  ? 894  GLU A C     1 
ATOM   7720  O  O     . GLU D 4  894  ? 10.846  -49.908 78.936  1.00 90.43  ? 894  GLU A O     1 
ATOM   7721  C  CB    . GLU D 4  894  ? 11.825  -48.495 81.839  1.00 105.99 ? 894  GLU A CB    1 
ATOM   7722  C  CG    . GLU D 4  894  ? 12.481  -49.852 82.045  1.00 111.14 ? 894  GLU A CG    1 
ATOM   7723  C  CD    . GLU D 4  894  ? 12.687  -50.190 83.509  1.00 115.27 ? 894  GLU A CD    1 
ATOM   7724  O  OE1   . GLU D 4  894  ? 11.687  -50.262 84.254  1.00 120.45 ? 894  GLU A OE1   1 
ATOM   7725  O  OE2   . GLU D 4  894  ? 13.853  -50.381 83.917  1.00 124.06 ? 894  GLU A OE2   1 
ATOM   7726  N  N     . LYS D 4  895  ? 9.264   -48.831 80.123  1.00 105.30 ? 895  LYS A N     1 
ATOM   7727  C  CA    . LYS D 4  895  ? 8.200   -49.716 79.652  1.00 119.10 ? 895  LYS A CA    1 
ATOM   7728  C  C     . LYS D 4  895  ? 8.142   -49.762 78.130  1.00 108.24 ? 895  LYS A C     1 
ATOM   7729  O  O     . LYS D 4  895  ? 7.945   -50.832 77.541  1.00 114.18 ? 895  LYS A O     1 
ATOM   7730  C  CB    . LYS D 4  895  ? 6.851   -49.274 80.222  1.00 127.36 ? 895  LYS A CB    1 
ATOM   7731  C  CG    . LYS D 4  895  ? 5.659   -49.687 79.362  1.00 117.13 ? 895  LYS A CG    1 
ATOM   7732  C  CD    . LYS D 4  895  ? 4.330   -49.448 80.062  1.00 122.18 ? 895  LYS A CD    1 
ATOM   7733  C  CE    . LYS D 4  895  ? 4.118   -50.444 81.195  1.00 122.21 ? 895  LYS A CE    1 
ATOM   7734  N  NZ    . LYS D 4  895  ? 2.756   -50.341 81.789  1.00 113.89 ? 895  LYS A NZ    1 
ATOM   7735  N  N     . ARG D 4  896  ? 8.328   -48.617 77.475  1.00 101.11 ? 896  ARG A N     1 
ATOM   7736  C  CA    . ARG D 4  896  ? 8.194   -48.573 76.025  1.00 98.96  ? 896  ARG A CA    1 
ATOM   7737  C  C     . ARG D 4  896  ? 9.404   -49.163 75.308  1.00 99.17  ? 896  ARG A C     1 
ATOM   7738  O  O     . ARG D 4  896  ? 9.267   -49.651 74.181  1.00 122.14 ? 896  ARG A O     1 
ATOM   7739  C  CB    . ARG D 4  896  ? 7.961   -47.132 75.565  1.00 101.45 ? 896  ARG A CB    1 
ATOM   7740  C  CG    . ARG D 4  896  ? 7.014   -47.014 74.377  1.00 120.05 ? 896  ARG A CG    1 
ATOM   7741  C  CD    . ARG D 4  896  ? 6.750   -45.564 73.992  1.00 130.84 ? 896  ARG A CD    1 
ATOM   7742  N  NE    . ARG D 4  896  ? 7.965   -44.880 73.564  1.00 130.59 ? 896  ARG A NE    1 
ATOM   7743  C  CZ    . ARG D 4  896  ? 7.985   -43.716 72.921  1.00 131.97 ? 896  ARG A CZ    1 
ATOM   7744  N  NH1   . ARG D 4  896  ? 6.850   -43.097 72.627  1.00 131.85 ? 896  ARG A NH1   1 
ATOM   7745  N  NH2   . ARG D 4  896  ? 9.142   -43.170 72.573  1.00 135.46 ? 896  ARG A NH2   1 
ATOM   7746  N  N     . TYR D 4  897  ? 10.586  -49.144 75.934  1.00 89.02  ? 897  TYR A N     1 
ATOM   7747  C  CA    . TYR D 4  897  ? 11.819  -49.519 75.253  1.00 88.70  ? 897  TYR A CA    1 
ATOM   7748  C  C     . TYR D 4  897  ? 12.518  -50.751 75.811  1.00 102.14 ? 897  TYR A C     1 
ATOM   7749  O  O     . TYR D 4  897  ? 13.307  -51.362 75.083  1.00 99.48  ? 897  TYR A O     1 
ATOM   7750  C  CB    . TYR D 4  897  ? 12.825  -48.356 75.278  1.00 87.87  ? 897  TYR A CB    1 
ATOM   7751  C  CG    . TYR D 4  897  ? 12.493  -47.216 74.346  1.00 87.06  ? 897  TYR A CG    1 
ATOM   7752  C  CD1   . TYR D 4  897  ? 11.245  -46.612 74.370  1.00 87.04  ? 897  TYR A CD1   1 
ATOM   7753  C  CD2   . TYR D 4  897  ? 13.431  -46.737 73.445  1.00 86.36  ? 897  TYR A CD2   1 
ATOM   7754  C  CE1   . TYR D 4  897  ? 10.940  -45.571 73.523  1.00 102.73 ? 897  TYR A CE1   1 
ATOM   7755  C  CE2   . TYR D 4  897  ? 13.134  -45.692 72.591  1.00 113.25 ? 897  TYR A CE2   1 
ATOM   7756  C  CZ    . TYR D 4  897  ? 11.884  -45.113 72.635  1.00 108.76 ? 897  TYR A CZ    1 
ATOM   7757  O  OH    . TYR D 4  897  ? 11.579  -44.073 71.789  1.00 94.72  ? 897  TYR A OH    1 
ATOM   7758  N  N     . ARG D 4  898  ? 12.272  -51.129 77.064  1.00 109.87 ? 898  ARG A N     1 
ATOM   7759  C  CA    . ARG D 4  898  ? 13.016  -52.222 77.677  1.00 92.91  ? 898  ARG A CA    1 
ATOM   7760  C  C     . ARG D 4  898  ? 12.524  -53.563 77.156  1.00 91.53  ? 898  ARG A C     1 
ATOM   7761  O  O     . ARG D 4  898  ? 11.328  -53.865 77.222  1.00 92.02  ? 898  ARG A O     1 
ATOM   7762  C  CB    . ARG D 4  898  ? 12.892  -52.174 79.201  1.00 103.53 ? 898  ARG A CB    1 
ATOM   7763  C  CG    . ARG D 4  898  ? 13.686  -53.249 79.943  1.00 113.23 ? 898  ARG A CG    1 
ATOM   7764  C  CD    . ARG D 4  898  ? 15.082  -53.426 79.358  1.00 120.94 ? 898  ARG A CD    1 
ATOM   7765  N  NE    . ARG D 4  898  ? 16.018  -54.018 80.310  1.00 118.77 ? 898  ARG A NE    1 
ATOM   7766  C  CZ    . ARG D 4  898  ? 17.233  -54.455 79.988  1.00 117.11 ? 898  ARG A CZ    1 
ATOM   7767  N  NH1   . ARG D 4  898  ? 17.661  -54.368 78.735  1.00 114.94 ? 898  ARG A NH1   1 
ATOM   7768  N  NH2   . ARG D 4  898  ? 18.020  -54.979 80.918  1.00 121.07 ? 898  ARG A NH2   1 
ATOM   7769  N  N     . VAL D 4  899  ? 13.449  -54.366 76.639  1.00 91.66  ? 899  VAL A N     1 
ATOM   7770  C  CA    . VAL D 4  899  ? 13.185  -55.755 76.287  1.00 92.48  ? 899  VAL A CA    1 
ATOM   7771  C  C     . VAL D 4  899  ? 14.112  -56.612 77.138  1.00 101.40 ? 899  VAL A C     1 
ATOM   7772  O  O     . VAL D 4  899  ? 15.301  -56.753 76.828  1.00 113.14 ? 899  VAL A O     1 
ATOM   7773  C  CB    . VAL D 4  899  ? 13.390  -56.037 74.797  1.00 92.14  ? 899  VAL A CB    1 
ATOM   7774  C  CG1   . VAL D 4  899  ? 12.943  -57.446 74.479  1.00 93.07  ? 899  VAL A CG1   1 
ATOM   7775  C  CG2   . VAL D 4  899  ? 12.626  -55.044 73.955  1.00 91.40  ? 899  VAL A CG2   1 
ATOM   7776  N  N     . ASP D 4  900  ? 13.576  -57.186 78.212  1.00 94.02  ? 900  ASP A N     1 
ATOM   7777  C  CA    . ASP D 4  900  ? 14.298  -58.145 79.045  1.00 98.44  ? 900  ASP A CA    1 
ATOM   7778  C  C     . ASP D 4  900  ? 13.910  -59.537 78.558  1.00 103.13 ? 900  ASP A C     1 
ATOM   7779  O  O     . ASP D 4  900  ? 12.862  -60.067 78.936  1.00 108.48 ? 900  ASP A O     1 
ATOM   7780  C  CB    . ASP D 4  900  ? 13.962  -57.949 80.522  1.00 123.96 ? 900  ASP A CB    1 
ATOM   7781  C  CG    . ASP D 4  900  ? 15.121  -58.305 81.451  1.00 115.09 ? 900  ASP A CG    1 
ATOM   7782  O  OD1   . ASP D 4  900  ? 16.206  -58.683 80.958  1.00 101.39 ? 900  ASP A OD1   1 
ATOM   7783  O  OD2   . ASP D 4  900  ? 14.943  -58.205 82.684  1.00 96.26  ? 900  ASP A OD2   1 
ATOM   7784  N  N     . LEU D 4  901  ? 14.752  -60.125 77.700  1.00 124.72 ? 901  LEU A N     1 
ATOM   7785  C  CA    . LEU D 4  901  ? 14.488  -61.480 77.224  1.00 124.55 ? 901  LEU A CA    1 
ATOM   7786  C  C     . LEU D 4  901  ? 14.437  -62.467 78.380  1.00 132.63 ? 901  LEU A C     1 
ATOM   7787  O  O     . LEU D 4  901  ? 13.654  -63.423 78.357  1.00 137.42 ? 901  LEU A O     1 
ATOM   7788  C  CB    . LEU D 4  901  ? 15.552  -61.914 76.214  1.00 117.14 ? 901  LEU A CB    1 
ATOM   7789  C  CG    . LEU D 4  901  ? 15.625  -61.177 74.881  1.00 100.35 ? 901  LEU A CG    1 
ATOM   7790  C  CD1   . LEU D 4  901  ? 16.766  -61.726 74.033  1.00 98.51  ? 901  LEU A CD1   1 
ATOM   7791  C  CD2   . LEU D 4  901  ? 14.300  -61.283 74.145  1.00 111.87 ? 901  LEU A CD2   1 
ATOM   7792  N  N     . LEU D 4  902  ? 15.262  -62.250 79.401  1.00 117.57 ? 902  LEU A N     1 
ATOM   7793  C  CA    . LEU D 4  902  ? 15.341  -63.148 80.553  1.00 99.50  ? 902  LEU A CA    1 
ATOM   7794  C  C     . LEU D 4  902  ? 14.305  -62.753 81.608  1.00 115.39 ? 902  LEU A C     1 
ATOM   7795  O  O     . LEU D 4  902  ? 14.614  -62.546 82.781  1.00 140.49 ? 902  LEU A O     1 
ATOM   7796  C  CB    . LEU D 4  902  ? 16.751  -63.128 81.131  1.00 99.52  ? 902  LEU A CB    1 
ATOM   7797  C  CG    . LEU D 4  902  ? 17.912  -63.053 80.138  1.00 98.93  ? 902  LEU A CG    1 
ATOM   7798  C  CD1   . LEU D 4  902  ? 19.187  -62.621 80.836  1.00 106.68 ? 902  LEU A CD1   1 
ATOM   7799  C  CD2   . LEU D 4  902  ? 18.120  -64.382 79.453  1.00 102.33 ? 902  LEU A CD2   1 
ATOM   7800  N  N     . ASN D 4  903  ? 13.049  -62.661 81.173  1.00 111.09 ? 903  ASN A N     1 
ATOM   7801  C  CA    . ASN D 4  903  ? 11.977  -62.220 82.056  1.00 101.87 ? 903  ASN A CA    1 
ATOM   7802  C  C     . ASN D 4  903  ? 10.638  -62.635 81.463  1.00 104.37 ? 903  ASN A C     1 
ATOM   7803  O  O     . ASN D 4  903  ? 10.461  -62.608 80.244  1.00 99.70  ? 903  ASN A O     1 
ATOM   7804  C  CB    . ASN D 4  903  ? 12.025  -60.699 82.260  1.00 98.46  ? 903  ASN A CB    1 
ATOM   7805  C  CG    . ASN D 4  903  ? 11.122  -60.226 83.387  1.00 109.45 ? 903  ASN A CG    1 
ATOM   7806  O  OD1   . ASN D 4  903  ? 9.964   -60.633 83.493  1.00 130.93 ? 903  ASN A OD1   1 
ATOM   7807  N  ND2   . ASN D 4  903  ? 11.654  -59.355 84.236  1.00 98.46  ? 903  ASN A ND2   1 
ATOM   7808  N  N     . THR D 4  904  ? 9.702   -63.017 82.333  1.00 118.22 ? 904  THR A N     1 
ATOM   7809  C  CA    . THR D 4  904  ? 8.362   -63.375 81.880  1.00 128.77 ? 904  THR A CA    1 
ATOM   7810  C  C     . THR D 4  904  ? 7.531   -62.153 81.514  1.00 135.44 ? 904  THR A C     1 
ATOM   7811  O  O     . THR D 4  904  ? 6.651   -62.244 80.651  1.00 160.03 ? 904  THR A O     1 
ATOM   7812  C  CB    . THR D 4  904  ? 7.624   -64.172 82.961  1.00 138.15 ? 904  THR A CB    1 
ATOM   7813  O  OG1   . THR D 4  904  ? 8.533   -65.061 83.619  1.00 157.58 ? 904  THR A OG1   1 
ATOM   7814  C  CG2   . THR D 4  904  ? 6.491   -64.984 82.349  1.00 138.61 ? 904  THR A CG2   1 
ATOM   7815  N  N     . ASP D 4  905  ? 7.789   -61.009 82.150  1.00 119.50 ? 905  ASP A N     1 
ATOM   7816  C  CA    . ASP D 4  905  ? 6.918   -59.851 82.023  1.00 126.32 ? 905  ASP A CA    1 
ATOM   7817  C  C     . ASP D 4  905  ? 7.503   -58.717 81.194  1.00 131.87 ? 905  ASP A C     1 
ATOM   7818  O  O     . ASP D 4  905  ? 6.751   -57.822 80.794  1.00 150.56 ? 905  ASP A O     1 
ATOM   7819  C  CB    . ASP D 4  905  ? 6.557   -59.309 83.415  1.00 132.88 ? 905  ASP A CB    1 
ATOM   7820  C  CG    . ASP D 4  905  ? 6.082   -60.401 84.362  1.00 137.09 ? 905  ASP A CG    1 
ATOM   7821  O  OD1   . ASP D 4  905  ? 5.610   -61.450 83.875  1.00 139.01 ? 905  ASP A OD1   1 
ATOM   7822  O  OD2   . ASP D 4  905  ? 6.181   -60.208 85.594  1.00 136.50 ? 905  ASP A OD2   1 
ATOM   7823  N  N     . HIS D 4  906  ? 8.808   -58.725 80.926  1.00 118.16 ? 906  HIS A N     1 
ATOM   7824  C  CA    . HIS D 4  906  ? 9.463   -57.657 80.177  1.00 114.18 ? 906  HIS A CA    1 
ATOM   7825  C  C     . HIS D 4  906  ? 10.115  -58.183 78.901  1.00 104.75 ? 906  HIS A C     1 
ATOM   7826  O  O     . HIS D 4  906  ? 11.134  -57.653 78.451  1.00 94.99  ? 906  HIS A O     1 
ATOM   7827  C  CB    . HIS D 4  906  ? 10.494  -56.936 81.048  1.00 127.21 ? 906  HIS A CB    1 
ATOM   7828  C  CG    . HIS D 4  906  ? 9.909   -56.251 82.246  1.00 127.72 ? 906  HIS A CG    1 
ATOM   7829  N  ND1   . HIS D 4  906  ? 8.552   -56.172 82.475  1.00 125.72 ? 906  HIS A ND1   1 
ATOM   7830  C  CD2   . HIS D 4  906  ? 10.502  -55.609 83.281  1.00 127.13 ? 906  HIS A CD2   1 
ATOM   7831  C  CE1   . HIS D 4  906  ? 8.334   -55.513 83.599  1.00 130.66 ? 906  HIS A CE1   1 
ATOM   7832  N  NE2   . HIS D 4  906  ? 9.501   -55.160 84.108  1.00 131.79 ? 906  HIS A NE2   1 
ATOM   7833  N  N     . THR D 4  907  ? 9.537   -59.220 78.306  1.00 107.66 ? 907  THR A N     1 
ATOM   7834  C  CA    . THR D 4  907  ? 10.043  -59.813 77.078  1.00 96.44  ? 907  THR A CA    1 
ATOM   7835  C  C     . THR D 4  907  ? 9.032   -59.603 75.957  1.00 96.21  ? 907  THR A C     1 
ATOM   7836  O  O     . THR D 4  907  ? 7.844   -59.373 76.199  1.00 107.80 ? 907  THR A O     1 
ATOM   7837  C  CB    . THR D 4  907  ? 10.324  -61.310 77.274  1.00 97.53  ? 907  THR A CB    1 
ATOM   7838  O  OG1   . THR D 4  907  ? 11.089  -61.493 78.470  1.00 124.40 ? 907  THR A OG1   1 
ATOM   7839  C  CG2   . THR D 4  907  ? 11.113  -61.889 76.104  1.00 97.34  ? 907  THR A CG2   1 
ATOM   7840  N  N     . LEU D 4  908  ? 9.527   -59.655 74.722  1.00 100.83 ? 908  LEU A N     1 
ATOM   7841  C  CA    . LEU D 4  908  ? 8.666   -59.615 73.547  1.00 95.45  ? 908  LEU A CA    1 
ATOM   7842  C  C     . LEU D 4  908  ? 7.599   -60.695 73.625  1.00 96.62  ? 908  LEU A C     1 
ATOM   7843  O  O     . LEU D 4  908  ? 7.913   -61.888 73.671  1.00 101.17 ? 908  LEU A O     1 
ATOM   7844  C  CB    . LEU D 4  908  ? 9.504   -59.797 72.281  1.00 94.95  ? 908  LEU A CB    1 
ATOM   7845  C  CG    . LEU D 4  908  ? 10.700  -58.863 72.117  1.00 98.31  ? 908  LEU A CG    1 
ATOM   7846  C  CD1   . LEU D 4  908  ? 11.518  -59.244 70.896  1.00 103.42 ? 908  LEU A CD1   1 
ATOM   7847  C  CD2   . LEU D 4  908  ? 10.233  -57.420 72.027  1.00 108.80 ? 908  LEU A CD2   1 
ATOM   7848  N  N     . ASP D 4  909  ? 6.340   -60.269 73.647  1.00 101.64 ? 909  ASP A N     1 
ATOM   7849  C  CA    . ASP D 4  909  ? 5.234   -61.213 73.658  1.00 116.59 ? 909  ASP A CA    1 
ATOM   7850  C  C     . ASP D 4  909  ? 5.319   -62.111 72.423  1.00 114.12 ? 909  ASP A C     1 
ATOM   7851  O  O     . ASP D 4  909  ? 5.669   -61.638 71.335  1.00 123.06 ? 909  ASP A O     1 
ATOM   7852  C  CB    . ASP D 4  909  ? 3.902   -60.458 73.694  1.00 124.05 ? 909  ASP A CB    1 
ATOM   7853  C  CG    . ASP D 4  909  ? 2.698   -61.374 73.861  1.00 130.34 ? 909  ASP A CG    1 
ATOM   7854  O  OD1   . ASP D 4  909  ? 2.401   -62.166 72.941  1.00 126.55 ? 909  ASP A OD1   1 
ATOM   7855  O  OD2   . ASP D 4  909  ? 2.039   -61.292 74.920  1.00 136.38 ? 909  ASP A OD2   1 
ATOM   7856  N  N     . PRO D 4  910  ? 5.033   -63.409 72.559  1.00 107.04 ? 910  PRO A N     1 
ATOM   7857  C  CA    . PRO D 4  910  ? 5.132   -64.312 71.399  1.00 117.47 ? 910  PRO A CA    1 
ATOM   7858  C  C     . PRO D 4  910  ? 4.274   -63.897 70.214  1.00 142.18 ? 910  PRO A C     1 
ATOM   7859  O  O     . PRO D 4  910  ? 4.524   -64.364 69.096  1.00 145.63 ? 910  PRO A O     1 
ATOM   7860  C  CB    . PRO D 4  910  ? 4.682   -65.662 71.969  1.00 125.53 ? 910  PRO A CB    1 
ATOM   7861  C  CG    . PRO D 4  910  ? 5.004   -65.574 73.425  1.00 126.06 ? 910  PRO A CG    1 
ATOM   7862  C  CD    . PRO D 4  910  ? 4.767   -64.140 73.810  1.00 122.45 ? 910  PRO A CD    1 
ATOM   7863  N  N     . SER D 4  911  ? 3.267   -63.045 70.419  1.00 146.00 ? 911  SER A N     1 
ATOM   7864  C  CA    . SER D 4  911  ? 2.494   -62.530 69.297  1.00 130.08 ? 911  SER A CA    1 
ATOM   7865  C  C     . SER D 4  911  ? 3.302   -61.564 68.442  1.00 112.24 ? 911  SER A C     1 
ATOM   7866  O  O     . SER D 4  911  ? 2.970   -61.363 67.268  1.00 120.35 ? 911  SER A O     1 
ATOM   7867  C  CB    . SER D 4  911  ? 1.230   -61.830 69.802  1.00 124.34 ? 911  SER A CB    1 
ATOM   7868  O  OG    . SER D 4  911  ? 1.545   -60.597 70.430  1.00 123.22 ? 911  SER A OG    1 
ATOM   7869  N  N     . LEU D 4  912  ? 4.351   -60.962 69.003  1.00 96.87  ? 912  LEU A N     1 
ATOM   7870  C  CA    . LEU D 4  912  ? 5.111   -59.941 68.294  1.00 95.64  ? 912  LEU A CA    1 
ATOM   7871  C  C     . LEU D 4  912  ? 6.178   -60.508 67.368  1.00 95.43  ? 912  LEU A C     1 
ATOM   7872  O  O     . LEU D 4  912  ? 6.724   -59.757 66.554  1.00 109.77 ? 912  LEU A O     1 
ATOM   7873  C  CB    . LEU D 4  912  ? 5.770   -58.985 69.294  1.00 94.91  ? 912  LEU A CB    1 
ATOM   7874  C  CG    . LEU D 4  912  ? 4.844   -58.296 70.295  1.00 95.04  ? 912  LEU A CG    1 
ATOM   7875  C  CD1   . LEU D 4  912  ? 5.567   -57.151 70.986  1.00 94.13  ? 912  LEU A CD1   1 
ATOM   7876  C  CD2   . LEU D 4  912  ? 3.578   -57.801 69.609  1.00 95.08  ? 912  LEU A CD2   1 
ATOM   7877  N  N     . LEU D 4  913  ? 6.491   -61.799 67.457  1.00 101.33 ? 913  LEU A N     1 
ATOM   7878  C  CA    . LEU D 4  913  ? 7.525   -62.347 66.595  1.00 112.74 ? 913  LEU A CA    1 
ATOM   7879  C  C     . LEU D 4  913  ? 7.253   -63.830 66.380  1.00 112.44 ? 913  LEU A C     1 
ATOM   7880  O  O     . LEU D 4  913  ? 6.692   -64.501 67.248  1.00 118.22 ? 913  LEU A O     1 
ATOM   7881  C  CB    . LEU D 4  913  ? 8.911   -62.139 67.212  1.00 125.04 ? 913  LEU A CB    1 
ATOM   7882  C  CG    . LEU D 4  913  ? 10.125  -61.899 66.309  1.00 129.71 ? 913  LEU A CG    1 
ATOM   7883  C  CD1   . LEU D 4  913  ? 11.267  -61.344 67.135  1.00 118.90 ? 913  LEU A CD1   1 
ATOM   7884  C  CD2   . LEU D 4  913  ? 10.579  -63.146 65.565  1.00 135.31 ? 913  LEU A CD2   1 
ATOM   7885  N  N     . GLU D 4  914  ? 7.650   -64.331 65.206  1.00 103.00 ? 914  GLU A N     1 
ATOM   7886  C  CA    . GLU D 4  914  ? 7.595   -65.769 64.957  1.00 104.51 ? 914  GLU A CA    1 
ATOM   7887  C  C     . GLU D 4  914  ? 8.493   -66.518 65.934  1.00 124.33 ? 914  GLU A C     1 
ATOM   7888  O  O     . GLU D 4  914  ? 8.130   -67.590 66.435  1.00 145.52 ? 914  GLU A O     1 
ATOM   7889  C  CB    . GLU D 4  914  ? 8.004   -66.068 63.514  1.00 112.37 ? 914  GLU A CB    1 
ATOM   7890  C  CG    . GLU D 4  914  ? 6.979   -65.640 62.474  1.00 109.64 ? 914  GLU A CG    1 
ATOM   7891  C  CD    . GLU D 4  914  ? 7.398   -66.000 61.060  1.00 100.72 ? 914  GLU A CD    1 
ATOM   7892  O  OE1   . GLU D 4  914  ? 8.606   -66.234 60.838  1.00 98.05  ? 914  GLU A OE1   1 
ATOM   7893  O  OE2   . GLU D 4  914  ? 6.524   -66.042 60.169  1.00 98.56  ? 914  GLU A OE2   1 
ATOM   7894  N  N     . SER D 4  915  ? 9.665   -65.960 66.225  1.00 132.63 ? 915  SER A N     1 
ATOM   7895  C  CA    . SER D 4  915  ? 10.615  -66.539 67.160  1.00 138.77 ? 915  SER A CA    1 
ATOM   7896  C  C     . SER D 4  915  ? 10.355  -66.112 68.600  1.00 127.87 ? 915  SER A C     1 
ATOM   7897  O  O     . SER D 4  915  ? 11.288  -66.112 69.409  1.00 130.28 ? 915  SER A O     1 
ATOM   7898  C  CB    . SER D 4  915  ? 12.041  -66.166 66.752  1.00 146.64 ? 915  SER A CB    1 
ATOM   7899  O  OG    . SER D 4  915  ? 12.233  -66.345 65.358  1.00 156.65 ? 915  SER A OG    1 
ATOM   7900  N  N     . GLY D 4  916  ? 9.116   -65.747 68.936  1.00 113.98 ? 916  GLY A N     1 
ATOM   7901  C  CA    . GLY D 4  916  ? 8.843   -65.215 70.262  1.00 111.38 ? 916  GLY A CA    1 
ATOM   7902  C  C     . GLY D 4  916  ? 9.092   -66.212 71.379  1.00 112.23 ? 916  GLY A C     1 
ATOM   7903  O  O     . GLY D 4  916  ? 9.667   -65.864 72.413  1.00 105.08 ? 916  GLY A O     1 
ATOM   7904  N  N     . SER D 4  917  ? 8.651   -67.459 71.199  1.00 130.07 ? 917  SER A N     1 
ATOM   7905  C  CA    . SER D 4  917  ? 8.931   -68.487 72.199  1.00 117.24 ? 917  SER A CA    1 
ATOM   7906  C  C     . SER D 4  917  ? 10.389  -68.921 72.144  1.00 102.00 ? 917  SER A C     1 
ATOM   7907  O  O     . SER D 4  917  ? 11.021  -69.138 73.185  1.00 102.31 ? 917  SER A O     1 
ATOM   7908  C  CB    . SER D 4  917  ? 8.004   -69.687 71.992  1.00 119.54 ? 917  SER A CB    1 
ATOM   7909  O  OG    . SER D 4  917  ? 8.230   -70.304 70.734  1.00 116.06 ? 917  SER A OG    1 
ATOM   7910  N  N     . GLU D 4  918  ? 10.939  -69.043 70.936  1.00 115.29 ? 918  GLU A N     1 
ATOM   7911  C  CA    . GLU D 4  918  ? 12.342  -69.387 70.740  1.00 113.15 ? 918  GLU A CA    1 
ATOM   7912  C  C     . GLU D 4  918  ? 13.288  -68.318 71.279  1.00 103.66 ? 918  GLU A C     1 
ATOM   7913  O  O     . GLU D 4  918  ? 14.501  -68.552 71.319  1.00 103.90 ? 918  GLU A O     1 
ATOM   7914  C  CB    . GLU D 4  918  ? 12.587  -69.613 69.243  1.00 121.16 ? 918  GLU A CB    1 
ATOM   7915  C  CG    . GLU D 4  918  ? 13.873  -70.339 68.875  1.00 121.64 ? 918  GLU A CG    1 
ATOM   7916  C  CD    . GLU D 4  918  ? 14.132  -70.311 67.379  1.00 129.92 ? 918  GLU A CD    1 
ATOM   7917  O  OE1   . GLU D 4  918  ? 15.313  -70.358 66.974  1.00 138.00 ? 918  GLU A OE1   1 
ATOM   7918  O  OE2   . GLU D 4  918  ? 13.152  -70.221 66.607  1.00 122.93 ? 918  GLU A OE2   1 
ATOM   7919  N  N     . ILE D 4  919  ? 12.766  -67.163 71.704  1.00 99.70  ? 919  ILE A N     1 
ATOM   7920  C  CA    . ILE D 4  919  ? 13.618  -66.039 72.081  1.00 106.14 ? 919  ILE A CA    1 
ATOM   7921  C  C     . ILE D 4  919  ? 13.901  -65.990 73.581  1.00 110.95 ? 919  ILE A C     1 
ATOM   7922  O  O     . ILE D 4  919  ? 14.893  -65.369 73.992  1.00 100.16 ? 919  ILE A O     1 
ATOM   7923  C  CB    . ILE D 4  919  ? 12.990  -64.706 71.623  1.00 109.08 ? 919  ILE A CB    1 
ATOM   7924  C  CG1   . ILE D 4  919  ? 14.069  -63.757 71.108  1.00 97.29  ? 919  ILE A CG1   1 
ATOM   7925  C  CG2   . ILE D 4  919  ? 12.206  -64.040 72.753  1.00 116.73 ? 919  ILE A CG2   1 
ATOM   7926  C  CD1   . ILE D 4  919  ? 14.753  -64.273 69.863  1.00 110.12 ? 919  ILE A CD1   1 
ATOM   7927  N  N     . LEU D 4  920  ? 13.069  -66.630 74.404  1.00 113.29 ? 920  LEU A N     1 
ATOM   7928  C  CA    . LEU D 4  920  ? 13.234  -66.567 75.851  1.00 105.34 ? 920  LEU A CA    1 
ATOM   7929  C  C     . LEU D 4  920  ? 14.579  -67.152 76.262  1.00 111.17 ? 920  LEU A C     1 
ATOM   7930  O  O     . LEU D 4  920  ? 15.091  -68.088 75.643  1.00 121.97 ? 920  LEU A O     1 
ATOM   7931  C  CB    . LEU D 4  920  ? 12.093  -67.314 76.546  1.00 101.47 ? 920  LEU A CB    1 
ATOM   7932  C  CG    . LEU D 4  920  ? 11.056  -66.463 77.283  1.00 101.28 ? 920  LEU A CG    1 
ATOM   7933  C  CD1   . LEU D 4  920  ? 9.905   -67.324 77.760  1.00 102.51 ? 920  LEU A CD1   1 
ATOM   7934  C  CD2   . LEU D 4  920  ? 11.692  -65.751 78.463  1.00 100.95 ? 920  LEU A CD2   1 
ATOM   7935  N  N     . GLY D 4  921  ? 15.155  -66.588 77.322  1.00 100.50 ? 921  GLY A N     1 
ATOM   7936  C  CA    . GLY D 4  921  ? 16.527  -66.903 77.667  1.00 100.68 ? 921  GLY A CA    1 
ATOM   7937  C  C     . GLY D 4  921  ? 17.471  -66.307 76.645  1.00 106.71 ? 921  GLY A C     1 
ATOM   7938  O  O     . GLY D 4  921  ? 17.486  -65.088 76.448  1.00 114.58 ? 921  GLY A O     1 
ATOM   7939  N  N     . ASP D 4  922  ? 18.255  -67.158 75.979  1.00 142.48 ? 922  ASP A N     1 
ATOM   7940  C  CA    . ASP D 4  922  ? 19.062  -66.771 74.821  1.00 138.19 ? 922  ASP A CA    1 
ATOM   7941  C  C     . ASP D 4  922  ? 20.037  -65.645 75.178  1.00 141.28 ? 922  ASP A C     1 
ATOM   7942  O  O     . ASP D 4  922  ? 19.933  -64.512 74.705  1.00 146.22 ? 922  ASP A O     1 
ATOM   7943  C  CB    . ASP D 4  922  ? 18.161  -66.375 73.645  1.00 111.31 ? 922  ASP A CB    1 
ATOM   7944  C  CG    . ASP D 4  922  ? 18.814  -66.629 72.300  1.00 109.46 ? 922  ASP A CG    1 
ATOM   7945  O  OD1   . ASP D 4  922  ? 20.016  -66.325 72.149  1.00 104.03 ? 922  ASP A OD1   1 
ATOM   7946  O  OD2   . ASP D 4  922  ? 18.121  -67.138 71.394  1.00 131.68 ? 922  ASP A OD2   1 
ATOM   7947  N  N     . LEU D 4  923  ? 20.991  -65.996 76.044  1.00 127.57 ? 923  LEU A N     1 
ATOM   7948  C  CA    . LEU D 4  923  ? 22.012  -65.045 76.477  1.00 117.77 ? 923  LEU A CA    1 
ATOM   7949  C  C     . LEU D 4  923  ? 22.795  -64.455 75.309  1.00 111.26 ? 923  LEU A C     1 
ATOM   7950  O  O     . LEU D 4  923  ? 23.366  -63.367 75.447  1.00 114.82 ? 923  LEU A O     1 
ATOM   7951  C  CB    . LEU D 4  923  ? 22.984  -65.714 77.453  1.00 107.28 ? 923  LEU A CB    1 
ATOM   7952  C  CG    . LEU D 4  923  ? 22.571  -65.928 78.916  1.00 104.74 ? 923  LEU A CG    1 
ATOM   7953  C  CD1   . LEU D 4  923  ? 22.415  -64.592 79.634  1.00 121.37 ? 923  LEU A CD1   1 
ATOM   7954  C  CD2   . LEU D 4  923  ? 21.315  -66.777 79.060  1.00 104.14 ? 923  LEU A CD2   1 
ATOM   7955  N  N     . LYS D 4  924  ? 22.839  -65.146 74.167  1.00 97.92  ? 924  LYS A N     1 
ATOM   7956  C  CA    . LYS D 4  924  ? 23.568  -64.633 73.011  1.00 97.21  ? 924  LYS A CA    1 
ATOM   7957  C  C     . LYS D 4  924  ? 22.955  -63.342 72.482  1.00 97.90  ? 924  LYS A C     1 
ATOM   7958  O  O     . LYS D 4  924  ? 23.653  -62.532 71.862  1.00 95.29  ? 924  LYS A O     1 
ATOM   7959  C  CB    . LYS D 4  924  ? 23.603  -65.685 71.902  1.00 100.01 ? 924  LYS A CB    1 
ATOM   7960  C  CG    . LYS D 4  924  ? 25.001  -66.143 71.517  1.00 102.34 ? 924  LYS A CG    1 
ATOM   7961  C  CD    . LYS D 4  924  ? 25.628  -66.982 72.616  1.00 118.43 ? 924  LYS A CD    1 
ATOM   7962  C  CE    . LYS D 4  924  ? 24.773  -68.201 72.925  1.00 125.27 ? 924  LYS A CE    1 
ATOM   7963  N  NZ    . LYS D 4  924  ? 25.365  -69.048 73.996  1.00 118.31 ? 924  LYS A NZ    1 
ATOM   7964  N  N     . LEU D 4  925  ? 21.657  -63.138 72.699  1.00 95.78  ? 925  LEU A N     1 
ATOM   7965  C  CA    . LEU D 4  925  ? 20.962  -61.956 72.207  1.00 94.75  ? 925  LEU A CA    1 
ATOM   7966  C  C     . LEU D 4  925  ? 20.800  -60.877 73.265  1.00 94.25  ? 925  LEU A C     1 
ATOM   7967  O  O     . LEU D 4  925  ? 20.934  -59.690 72.953  1.00 93.66  ? 925  LEU A O     1 
ATOM   7968  C  CB    . LEU D 4  925  ? 19.583  -62.337 71.666  1.00 94.93  ? 925  LEU A CB    1 
ATOM   7969  C  CG    . LEU D 4  925  ? 19.577  -63.366 70.540  1.00 95.43  ? 925  LEU A CG    1 
ATOM   7970  C  CD1   . LEU D 4  925  ? 18.163  -63.617 70.078  1.00 95.60  ? 925  LEU A CD1   1 
ATOM   7971  C  CD2   . LEU D 4  925  ? 20.436  -62.880 69.388  1.00 94.76  ? 925  LEU A CD2   1 
ATOM   7972  N  N     . GLN D 4  926  ? 20.509  -61.267 74.509  1.00 94.91  ? 926  GLN A N     1 
ATOM   7973  C  CA    . GLN D 4  926  ? 20.280  -60.294 75.572  1.00 94.54  ? 926  GLN A CA    1 
ATOM   7974  C  C     . GLN D 4  926  ? 21.457  -59.345 75.753  1.00 93.91  ? 926  GLN A C     1 
ATOM   7975  O  O     . GLN D 4  926  ? 21.279  -58.254 76.301  1.00 93.33  ? 926  GLN A O     1 
ATOM   7976  C  CB    . GLN D 4  926  ? 19.963  -61.023 76.880  1.00 95.51  ? 926  GLN A CB    1 
ATOM   7977  C  CG    . GLN D 4  926  ? 19.449  -60.123 77.994  1.00 103.42 ? 926  GLN A CG    1 
ATOM   7978  C  CD    . GLN D 4  926  ? 18.338  -59.196 77.536  1.00 100.22 ? 926  GLN A CD    1 
ATOM   7979  O  OE1   . GLN D 4  926  ? 17.177  -59.590 77.451  1.00 94.87  ? 926  GLN A OE1   1 
ATOM   7980  N  NE2   . GLN D 4  926  ? 18.690  -57.947 77.258  1.00 105.18 ? 926  GLN A NE2   1 
ATOM   7981  N  N     . VAL D 4  927  ? 22.651  -59.725 75.293  1.00 110.01 ? 927  VAL A N     1 
ATOM   7982  C  CA    . VAL D 4  927  ? 23.766  -58.783 75.263  1.00 112.64 ? 927  VAL A CA    1 
ATOM   7983  C  C     . VAL D 4  927  ? 23.483  -57.655 74.277  1.00 112.22 ? 927  VAL A C     1 
ATOM   7984  O  O     . VAL D 4  927  ? 23.782  -56.486 74.550  1.00 122.38 ? 927  VAL A O     1 
ATOM   7985  C  CB    . VAL D 4  927  ? 25.080  -59.515 74.930  1.00 113.19 ? 927  VAL A CB    1 
ATOM   7986  C  CG1   . VAL D 4  927  ? 24.889  -60.448 73.750  1.00 101.64 ? 927  VAL A CG1   1 
ATOM   7987  C  CG2   . VAL D 4  927  ? 26.192  -58.517 74.644  1.00 109.75 ? 927  VAL A CG2   1 
ATOM   7988  N  N     . LEU D 4  928  ? 22.890  -57.981 73.126  1.00 108.13 ? 928  LEU A N     1 
ATOM   7989  C  CA    . LEU D 4  928  ? 22.640  -56.965 72.107  1.00 98.13  ? 928  LEU A CA    1 
ATOM   7990  C  C     . LEU D 4  928  ? 21.534  -56.009 72.533  1.00 103.77 ? 928  LEU A C     1 
ATOM   7991  O  O     . LEU D 4  928  ? 21.620  -54.802 72.279  1.00 128.19 ? 928  LEU A O     1 
ATOM   7992  C  CB    . LEU D 4  928  ? 22.295  -57.631 70.777  1.00 96.97  ? 928  LEU A CB    1 
ATOM   7993  C  CG    . LEU D 4  928  ? 23.465  -58.324 70.076  1.00 108.50 ? 928  LEU A CG    1 
ATOM   7994  C  CD1   . LEU D 4  928  ? 23.058  -58.800 68.691  1.00 100.95 ? 928  LEU A CD1   1 
ATOM   7995  C  CD2   . LEU D 4  928  ? 24.669  -57.393 69.999  1.00 107.92 ? 928  LEU A CD2   1 
ATOM   7996  N  N     . LEU D 4  929  ? 20.487  -56.525 73.178  1.00 91.22  ? 929  LEU A N     1 
ATOM   7997  C  CA    . LEU D 4  929  ? 19.434  -55.648 73.680  1.00 90.83  ? 929  LEU A CA    1 
ATOM   7998  C  C     . LEU D 4  929  ? 19.933  -54.800 74.843  1.00 98.03  ? 929  LEU A C     1 
ATOM   7999  O  O     . LEU D 4  929  ? 19.531  -53.639 74.988  1.00 89.96  ? 929  LEU A O     1 
ATOM   8000  C  CB    . LEU D 4  929  ? 18.215  -56.466 74.099  1.00 91.55  ? 929  LEU A CB    1 
ATOM   8001  C  CG    . LEU D 4  929  ? 17.693  -57.471 73.079  1.00 91.97  ? 929  LEU A CG    1 
ATOM   8002  C  CD1   . LEU D 4  929  ? 16.326  -57.950 73.499  1.00 92.55  ? 929  LEU A CD1   1 
ATOM   8003  C  CD2   . LEU D 4  929  ? 17.637  -56.854 71.693  1.00 91.18  ? 929  LEU A CD2   1 
ATOM   8004  N  N     . ASP D 4  930  ? 20.798  -55.365 75.689  1.00 116.09 ? 930  ASP A N     1 
ATOM   8005  C  CA    . ASP D 4  930  ? 21.419  -54.569 76.742  1.00 110.80 ? 930  ASP A CA    1 
ATOM   8006  C  C     . ASP D 4  930  ? 22.361  -53.528 76.153  1.00 127.16 ? 930  ASP A C     1 
ATOM   8007  O  O     . ASP D 4  930  ? 22.461  -52.411 76.671  1.00 158.57 ? 930  ASP A O     1 
ATOM   8008  C  CB    . ASP D 4  930  ? 22.161  -55.474 77.726  1.00 116.87 ? 930  ASP A CB    1 
ATOM   8009  C  CG    . ASP D 4  930  ? 21.220  -56.306 78.578  1.00 117.89 ? 930  ASP A CG    1 
ATOM   8010  O  OD1   . ASP D 4  930  ? 20.023  -55.958 78.653  1.00 115.80 ? 930  ASP A OD1   1 
ATOM   8011  O  OD2   . ASP D 4  930  ? 21.676  -57.304 79.179  1.00 111.09 ? 930  ASP A OD2   1 
ATOM   8012  N  N     . GLU D 4  931  ? 23.061  -53.874 75.069  1.00 96.09  ? 931  GLU A N     1 
ATOM   8013  C  CA    . GLU D 4  931  ? 23.873  -52.880 74.375  1.00 96.06  ? 931  GLU A CA    1 
ATOM   8014  C  C     . GLU D 4  931  ? 22.994  -51.822 73.720  1.00 100.59 ? 931  GLU A C     1 
ATOM   8015  O  O     . GLU D 4  931  ? 23.325  -50.630 73.741  1.00 87.91  ? 931  GLU A O     1 
ATOM   8016  C  CB    . GLU D 4  931  ? 24.769  -53.556 73.338  1.00 99.46  ? 931  GLU A CB    1 
ATOM   8017  C  CG    . GLU D 4  931  ? 25.410  -52.588 72.355  1.00 115.67 ? 931  GLU A CG    1 
ATOM   8018  C  CD    . GLU D 4  931  ? 26.776  -53.050 71.887  1.00 133.63 ? 931  GLU A CD    1 
ATOM   8019  O  OE1   . GLU D 4  931  ? 27.719  -53.037 72.706  1.00 138.15 ? 931  GLU A OE1   1 
ATOM   8020  O  OE2   . GLU D 4  931  ? 26.908  -53.421 70.701  1.00 139.03 ? 931  GLU A OE2   1 
ATOM   8021  N  N     . GLU D 4  932  ? 21.866  -52.240 73.143  1.00 125.13 ? 932  GLU A N     1 
ATOM   8022  C  CA    . GLU D 4  932  ? 20.923  -51.283 72.572  1.00 120.90 ? 932  GLU A CA    1 
ATOM   8023  C  C     . GLU D 4  932  ? 20.357  -50.368 73.651  1.00 109.48 ? 932  GLU A C     1 
ATOM   8024  O  O     . GLU D 4  932  ? 20.368  -49.141 73.506  1.00 108.34 ? 932  GLU A O     1 
ATOM   8025  C  CB    . GLU D 4  932  ? 19.802  -52.026 71.840  1.00 96.91  ? 932  GLU A CB    1 
ATOM   8026  C  CG    . GLU D 4  932  ? 18.584  -51.167 71.536  1.00 113.31 ? 932  GLU A CG    1 
ATOM   8027  C  CD    . GLU D 4  932  ? 17.568  -51.871 70.652  1.00 127.14 ? 932  GLU A CD    1 
ATOM   8028  O  OE1   . GLU D 4  932  ? 17.924  -52.253 69.517  1.00 129.24 ? 932  GLU A OE1   1 
ATOM   8029  O  OE2   . GLU D 4  932  ? 16.409  -52.038 71.091  1.00 131.79 ? 932  GLU A OE2   1 
ATOM   8030  N  N     . TYR D 4  933  ? 19.876  -50.950 74.754  1.00 94.89  ? 933  TYR A N     1 
ATOM   8031  C  CA    . TYR D 4  933  ? 19.269  -50.152 75.816  1.00 88.69  ? 933  TYR A CA    1 
ATOM   8032  C  C     . TYR D 4  933  ? 20.281  -49.206 76.453  1.00 87.89  ? 933  TYR A C     1 
ATOM   8033  O  O     . TYR D 4  933  ? 19.943  -48.070 76.806  1.00 87.42  ? 933  TYR A O     1 
ATOM   8034  C  CB    . TYR D 4  933  ? 18.650  -51.070 76.874  1.00 89.11  ? 933  TYR A CB    1 
ATOM   8035  C  CG    . TYR D 4  933  ? 17.694  -50.369 77.820  1.00 89.11  ? 933  TYR A CG    1 
ATOM   8036  C  CD1   . TYR D 4  933  ? 16.323  -50.556 77.715  1.00 89.32  ? 933  TYR A CD1   1 
ATOM   8037  C  CD2   . TYR D 4  933  ? 18.162  -49.526 78.819  1.00 88.98  ? 933  TYR A CD2   1 
ATOM   8038  C  CE1   . TYR D 4  933  ? 15.448  -49.917 78.571  1.00 89.38  ? 933  TYR A CE1   1 
ATOM   8039  C  CE2   . TYR D 4  933  ? 17.295  -48.884 79.678  1.00 89.03  ? 933  TYR A CE2   1 
ATOM   8040  C  CZ    . TYR D 4  933  ? 15.938  -49.084 79.551  1.00 89.23  ? 933  TYR A CZ    1 
ATOM   8041  O  OH    . TYR D 4  933  ? 15.069  -48.448 80.408  1.00 92.91  ? 933  TYR A OH    1 
ATOM   8042  N  N     . LYS D 4  934  ? 21.526  -49.656 76.621  1.00 91.21  ? 934  LYS A N     1 
ATOM   8043  C  CA    . LYS D 4  934  ? 22.531  -48.795 77.237  1.00 105.59 ? 934  LYS A CA    1 
ATOM   8044  C  C     . LYS D 4  934  ? 22.933  -47.660 76.302  1.00 100.54 ? 934  LYS A C     1 
ATOM   8045  O  O     . LYS D 4  934  ? 23.190  -46.539 76.756  1.00 106.44 ? 934  LYS A O     1 
ATOM   8046  C  CB    . LYS D 4  934  ? 23.750  -49.617 77.663  1.00 109.92 ? 934  LYS A CB    1 
ATOM   8047  C  CG    . LYS D 4  934  ? 23.526  -50.420 78.944  1.00 112.70 ? 934  LYS A CG    1 
ATOM   8048  C  CD    . LYS D 4  934  ? 24.687  -51.351 79.252  1.00 114.25 ? 934  LYS A CD    1 
ATOM   8049  C  CE    . LYS D 4  934  ? 24.410  -52.165 80.506  1.00 107.07 ? 934  LYS A CE    1 
ATOM   8050  N  NZ    . LYS D 4  934  ? 25.502  -53.133 80.793  1.00 98.20  ? 934  LYS A NZ    1 
ATOM   8051  N  N     . GLN D 4  935  ? 22.985  -47.927 74.993  1.00 92.49  ? 935  GLN A N     1 
ATOM   8052  C  CA    . GLN D 4  935  ? 23.263  -46.860 74.034  1.00 90.51  ? 935  GLN A CA    1 
ATOM   8053  C  C     . GLN D 4  935  ? 22.111  -45.862 73.971  1.00 88.16  ? 935  GLN A C     1 
ATOM   8054  O  O     . GLN D 4  935  ? 22.336  -44.656 73.817  1.00 92.34  ? 935  GLN A O     1 
ATOM   8055  C  CB    . GLN D 4  935  ? 23.541  -47.450 72.651  1.00 87.57  ? 935  GLN A CB    1 
ATOM   8056  C  CG    . GLN D 4  935  ? 23.813  -46.412 71.566  1.00 85.51  ? 935  GLN A CG    1 
ATOM   8057  C  CD    . GLN D 4  935  ? 24.887  -45.413 71.965  1.00 97.61  ? 935  GLN A CD    1 
ATOM   8058  O  OE1   . GLN D 4  935  ? 24.596  -44.254 72.265  1.00 89.57  ? 935  GLN A OE1   1 
ATOM   8059  N  NE2   . GLN D 4  935  ? 26.137  -45.861 71.970  1.00 126.59 ? 935  GLN A NE2   1 
ATOM   8060  N  N     . LEU D 4  936  ? 20.870  -46.344 74.086  1.00 85.70  ? 936  LEU A N     1 
ATOM   8061  C  CA    . LEU D 4  936  ? 19.731  -45.432 74.131  1.00 85.29  ? 936  LEU A CA    1 
ATOM   8062  C  C     . LEU D 4  936  ? 19.745  -44.594 75.404  1.00 85.29  ? 936  LEU A C     1 
ATOM   8063  O  O     . LEU D 4  936  ? 19.365  -43.417 75.382  1.00 84.77  ? 936  LEU A O     1 
ATOM   8064  C  CB    . LEU D 4  936  ? 18.417  -46.209 74.019  1.00 85.67  ? 936  LEU A CB    1 
ATOM   8065  C  CG    . LEU D 4  936  ? 18.179  -47.087 72.787  1.00 85.77  ? 936  LEU A CG    1 
ATOM   8066  C  CD1   . LEU D 4  936  ? 16.694  -47.319 72.571  1.00 85.95  ? 936  LEU A CD1   1 
ATOM   8067  C  CD2   . LEU D 4  936  ? 18.815  -46.492 71.539  1.00 87.78  ? 936  LEU A CD2   1 
ATOM   8068  N  N     . VAL D 4  937  ? 20.172  -45.182 76.523  1.00 85.91  ? 937  VAL A N     1 
ATOM   8069  C  CA    . VAL D 4  937  ? 20.309  -44.413 77.756  1.00 92.33  ? 937  VAL A CA    1 
ATOM   8070  C  C     . VAL D 4  937  ? 21.389  -43.352 77.596  1.00 96.09  ? 937  VAL A C     1 
ATOM   8071  O  O     . VAL D 4  937  ? 21.217  -42.199 78.012  1.00 100.27 ? 937  VAL A O     1 
ATOM   8072  C  CB    . VAL D 4  937  ? 20.596  -45.352 78.943  1.00 86.83  ? 937  VAL A CB    1 
ATOM   8073  C  CG1   . VAL D 4  937  ? 21.372  -44.627 80.033  1.00 86.92  ? 937  VAL A CG1   1 
ATOM   8074  C  CG2   . VAL D 4  937  ? 19.297  -45.917 79.496  1.00 87.33  ? 937  VAL A CG2   1 
ATOM   8075  N  N     . LYS D 4  938  ? 22.514  -43.721 76.977  1.00 94.92  ? 938  LYS A N     1 
ATOM   8076  C  CA    . LYS D 4  938  ? 23.567  -42.749 76.700  1.00 85.16  ? 938  LYS A CA    1 
ATOM   8077  C  C     . LYS D 4  938  ? 23.044  -41.601 75.848  1.00 84.23  ? 938  LYS A C     1 
ATOM   8078  O  O     . LYS D 4  938  ? 23.425  -40.442 76.050  1.00 83.87  ? 938  LYS A O     1 
ATOM   8079  C  CB    . LYS D 4  938  ? 24.747  -43.436 76.009  1.00 85.19  ? 938  LYS A CB    1 
ATOM   8080  C  CG    . LYS D 4  938  ? 25.794  -42.475 75.463  1.00 87.16  ? 938  LYS A CG    1 
ATOM   8081  C  CD    . LYS D 4  938  ? 26.989  -43.216 74.888  1.00 103.75 ? 938  LYS A CD    1 
ATOM   8082  C  CE    . LYS D 4  938  ? 27.983  -42.252 74.262  1.00 107.34 ? 938  LYS A CE    1 
ATOM   8083  N  NZ    . LYS D 4  938  ? 29.177  -42.964 73.731  1.00 112.39 ? 938  LYS A NZ    1 
ATOM   8084  N  N     . ASP D 4  939  ? 22.161  -41.903 74.895  1.00 107.59 ? 939  ASP A N     1 
ATOM   8085  C  CA    . ASP D 4  939  ? 21.583  -40.850 74.070  1.00 112.22 ? 939  ASP A CA    1 
ATOM   8086  C  C     . ASP D 4  939  ? 20.677  -39.938 74.886  1.00 110.18 ? 939  ASP A C     1 
ATOM   8087  O  O     . ASP D 4  939  ? 20.732  -38.713 74.738  1.00 123.68 ? 939  ASP A O     1 
ATOM   8088  C  CB    . ASP D 4  939  ? 20.812  -41.457 72.899  1.00 105.25 ? 939  ASP A CB    1 
ATOM   8089  C  CG    . ASP D 4  939  ? 21.726  -42.026 71.838  1.00 100.97 ? 939  ASP A CG    1 
ATOM   8090  O  OD1   . ASP D 4  939  ? 22.953  -41.814 71.938  1.00 98.58  ? 939  ASP A OD1   1 
ATOM   8091  O  OD2   . ASP D 4  939  ? 21.217  -42.671 70.897  1.00 95.54  ? 939  ASP A OD2   1 
ATOM   8092  N  N     . ARG D 4  940  ? 19.843  -40.513 75.758  1.00 83.68  ? 940  ARG A N     1 
ATOM   8093  C  CA    . ARG D 4  940  ? 18.896  -39.693 76.508  1.00 83.64  ? 940  ARG A CA    1 
ATOM   8094  C  C     . ARG D 4  940  ? 19.617  -38.707 77.417  1.00 83.56  ? 940  ARG A C     1 
ATOM   8095  O  O     . ARG D 4  940  ? 19.175  -37.565 77.577  1.00 83.23  ? 940  ARG A O     1 
ATOM   8096  C  CB    . ARG D 4  940  ? 17.944  -40.568 77.321  1.00 84.29  ? 940  ARG A CB    1 
ATOM   8097  C  CG    . ARG D 4  940  ? 16.770  -39.777 77.870  1.00 84.27  ? 940  ARG A CG    1 
ATOM   8098  C  CD    . ARG D 4  940  ? 16.141  -40.417 79.089  1.00 85.02  ? 940  ARG A CD    1 
ATOM   8099  N  NE    . ARG D 4  940  ? 14.714  -40.119 79.169  1.00 85.12  ? 940  ARG A NE    1 
ATOM   8100  C  CZ    . ARG D 4  940  ? 13.975  -40.280 80.262  1.00 85.72  ? 940  ARG A CZ    1 
ATOM   8101  N  NH1   . ARG D 4  940  ? 14.529  -40.737 81.376  1.00 99.38  ? 940  ARG A NH1   1 
ATOM   8102  N  NH2   . ARG D 4  940  ? 12.684  -39.983 80.243  1.00 85.83  ? 940  ARG A NH2   1 
ATOM   8103  N  N     . LYS D 4  941  ? 20.726  -39.128 78.026  1.00 105.26 ? 941  LYS A N     1 
ATOM   8104  C  CA    . LYS D 4  941  ? 21.544  -38.182 78.775  1.00 115.24 ? 941  LYS A CA    1 
ATOM   8105  C  C     . LYS D 4  941  ? 22.238  -37.199 77.842  1.00 108.05 ? 941  LYS A C     1 
ATOM   8106  O  O     . LYS D 4  941  ? 22.358  -36.012 78.166  1.00 139.59 ? 941  LYS A O     1 
ATOM   8107  C  CB    . LYS D 4  941  ? 22.572  -38.921 79.630  1.00 129.72 ? 941  LYS A CB    1 
ATOM   8108  C  CG    . LYS D 4  941  ? 22.077  -39.293 81.016  1.00 130.18 ? 941  LYS A CG    1 
ATOM   8109  C  CD    . LYS D 4  941  ? 23.243  -39.628 81.932  1.00 116.26 ? 941  LYS A CD    1 
ATOM   8110  C  CE    . LYS D 4  941  ? 22.775  -39.925 83.346  1.00 118.23 ? 941  LYS A CE    1 
ATOM   8111  N  NZ    . LYS D 4  941  ? 21.994  -38.795 83.922  1.00 121.60 ? 941  LYS A NZ    1 
ATOM   8112  N  N     . PHE D 4  942  ? 22.698  -37.673 76.681  1.00 83.03  ? 942  PHE A N     1 
ATOM   8113  C  CA    . PHE D 4  942  ? 23.417  -36.805 75.750  1.00 90.12  ? 942  PHE A CA    1 
ATOM   8114  C  C     . PHE D 4  942  ? 22.549  -35.634 75.306  1.00 81.94  ? 942  PHE A C     1 
ATOM   8115  O  O     . PHE D 4  942  ? 22.957  -34.472 75.401  1.00 81.66  ? 942  PHE A O     1 
ATOM   8116  C  CB    . PHE D 4  942  ? 23.894  -37.607 74.537  1.00 92.48  ? 942  PHE A CB    1 
ATOM   8117  C  CG    . PHE D 4  942  ? 24.804  -36.832 73.618  1.00 86.21  ? 942  PHE A CG    1 
ATOM   8118  C  CD1   . PHE D 4  942  ? 26.180  -36.916 73.752  1.00 97.15  ? 942  PHE A CD1   1 
ATOM   8119  C  CD2   . PHE D 4  942  ? 24.283  -36.016 72.625  1.00 85.22  ? 942  PHE A CD2   1 
ATOM   8120  C  CE1   . PHE D 4  942  ? 27.020  -36.203 72.914  1.00 91.61  ? 942  PHE A CE1   1 
ATOM   8121  C  CE2   . PHE D 4  942  ? 25.120  -35.299 71.785  1.00 85.71  ? 942  PHE A CE2   1 
ATOM   8122  C  CZ    . PHE D 4  942  ? 26.489  -35.394 71.930  1.00 87.83  ? 942  PHE A CZ    1 
ATOM   8123  N  N     . LEU D 4  943  ? 21.347  -35.924 74.809  1.00 81.82  ? 943  LEU A N     1 
ATOM   8124  C  CA    . LEU D 4  943  ? 20.475  -34.852 74.349  1.00 81.34  ? 943  LEU A CA    1 
ATOM   8125  C  C     . LEU D 4  943  ? 19.950  -34.017 75.509  1.00 81.45  ? 943  LEU A C     1 
ATOM   8126  O  O     . LEU D 4  943  ? 19.743  -32.809 75.354  1.00 87.75  ? 943  LEU A O     1 
ATOM   8127  C  CB    . LEU D 4  943  ? 19.316  -35.425 73.533  1.00 81.28  ? 943  LEU A CB    1 
ATOM   8128  C  CG    . LEU D 4  943  ? 19.592  -36.633 72.639  1.00 90.56  ? 943  LEU A CG    1 
ATOM   8129  C  CD1   . LEU D 4  943  ? 18.302  -37.127 72.000  1.00 81.43  ? 943  LEU A CD1   1 
ATOM   8130  C  CD2   . LEU D 4  943  ? 20.626  -36.296 71.577  1.00 109.02 ? 943  LEU A CD2   1 
ATOM   8131  N  N     . ARG D 4  944  ? 19.732  -34.630 76.675  1.00 82.00  ? 944  ARG A N     1 
ATOM   8132  C  CA    . ARG D 4  944  ? 19.291  -33.849 77.826  1.00 82.18  ? 944  ARG A CA    1 
ATOM   8133  C  C     . ARG D 4  944  ? 20.369  -32.873 78.275  1.00 82.07  ? 944  ARG A C     1 
ATOM   8134  O  O     . ARG D 4  944  ? 20.052  -31.790 78.780  1.00 81.98  ? 944  ARG A O     1 
ATOM   8135  C  CB    . ARG D 4  944  ? 18.888  -34.777 78.970  1.00 82.86  ? 944  ARG A CB    1 
ATOM   8136  C  CG    . ARG D 4  944  ? 17.448  -35.247 78.889  1.00 83.04  ? 944  ARG A CG    1 
ATOM   8137  C  CD    . ARG D 4  944  ? 16.954  -35.775 80.218  1.00 83.75  ? 944  ARG A CD    1 
ATOM   8138  N  NE    . ARG D 4  944  ? 15.503  -35.924 80.227  1.00 83.95  ? 944  ARG A NE    1 
ATOM   8139  C  CZ    . ARG D 4  944  ? 14.794  -36.263 81.298  1.00 103.80 ? 944  ARG A CZ    1 
ATOM   8140  N  NH1   . ARG D 4  944  ? 15.404  -36.490 82.455  1.00 124.93 ? 944  ARG A NH1   1 
ATOM   8141  N  NH2   . ARG D 4  944  ? 13.475  -36.377 81.212  1.00 99.80  ? 944  ARG A NH2   1 
ATOM   8142  N  N     . GLU D 4  945  ? 21.643  -33.238 78.100  1.00 110.39 ? 945  GLU A N     1 
ATOM   8143  C  CA    . GLU D 4  945  ? 22.725  -32.276 78.282  1.00 113.70 ? 945  GLU A CA    1 
ATOM   8144  C  C     . GLU D 4  945  ? 22.597  -31.124 77.295  1.00 126.97 ? 945  GLU A C     1 
ATOM   8145  O  O     . GLU D 4  945  ? 22.795  -29.958 77.658  1.00 159.58 ? 945  GLU A O     1 
ATOM   8146  C  CB    . GLU D 4  945  ? 24.082  -32.962 78.107  1.00 108.34 ? 945  GLU A CB    1 
ATOM   8147  C  CG    . GLU D 4  945  ? 24.458  -33.949 79.200  1.00 118.70 ? 945  GLU A CG    1 
ATOM   8148  C  CD    . GLU D 4  945  ? 25.826  -34.567 78.974  1.00 115.77 ? 945  GLU A CD    1 
ATOM   8149  O  OE1   . GLU D 4  945  ? 26.645  -33.961 78.249  1.00 113.91 ? 945  GLU A OE1   1 
ATOM   8150  O  OE2   . GLU D 4  945  ? 26.079  -35.663 79.515  1.00 113.49 ? 945  GLU A OE2   1 
ATOM   8151  N  N     . VAL D 4  946  ? 22.268  -31.433 76.041  1.00 117.46 ? 946  VAL A N     1 
ATOM   8152  C  CA    . VAL D 4  946  ? 22.235  -30.415 74.997  1.00 99.76  ? 946  VAL A CA    1 
ATOM   8153  C  C     . VAL D 4  946  ? 20.958  -29.587 75.089  1.00 99.58  ? 946  VAL A C     1 
ATOM   8154  O  O     . VAL D 4  946  ? 21.006  -28.355 75.184  1.00 91.52  ? 946  VAL A O     1 
ATOM   8155  C  CB    . VAL D 4  946  ? 22.392  -31.071 73.611  1.00 84.91  ? 946  VAL A CB    1 
ATOM   8156  C  CG1   . VAL D 4  946  ? 22.456  -30.017 72.525  1.00 95.64  ? 946  VAL A CG1   1 
ATOM   8157  C  CG2   . VAL D 4  946  ? 23.639  -31.939 73.569  1.00 84.99  ? 946  VAL A CG2   1 
ATOM   8158  N  N     . PHE D 4  947  ? 19.799  -30.247 75.074  1.00 104.69 ? 947  PHE A N     1 
ATOM   8159  C  CA    . PHE D 4  947  ? 18.505  -29.563 75.055  1.00 102.73 ? 947  PHE A CA    1 
ATOM   8160  C  C     . PHE D 4  947  ? 17.967  -29.516 76.483  1.00 100.59 ? 947  PHE A C     1 
ATOM   8161  O  O     . PHE D 4  947  ? 17.148  -30.333 76.903  1.00 111.34 ? 947  PHE A O     1 
ATOM   8162  C  CB    . PHE D 4  947  ? 17.543  -30.260 74.096  1.00 109.08 ? 947  PHE A CB    1 
ATOM   8163  C  CG    . PHE D 4  947  ? 17.926  -30.124 72.644  1.00 100.36 ? 947  PHE A CG    1 
ATOM   8164  C  CD1   . PHE D 4  947  ? 17.196  -30.757 71.657  1.00 108.10 ? 947  PHE A CD1   1 
ATOM   8165  C  CD2   . PHE D 4  947  ? 19.013  -29.350 72.268  1.00 110.46 ? 947  PHE A CD2   1 
ATOM   8166  C  CE1   . PHE D 4  947  ? 17.552  -30.631 70.324  1.00 122.37 ? 947  PHE A CE1   1 
ATOM   8167  C  CE2   . PHE D 4  947  ? 19.369  -29.221 70.939  1.00 107.70 ? 947  PHE A CE2   1 
ATOM   8168  C  CZ    . PHE D 4  947  ? 18.637  -29.860 69.967  1.00 108.79 ? 947  PHE A CZ    1 
ATOM   8169  N  N     . VAL D 4  948  ? 18.441  -28.519 77.232  1.00 93.34  ? 948  VAL A N     1 
ATOM   8170  C  CA    . VAL D 4  948  ? 18.142  -28.442 78.659  1.00 81.27  ? 948  VAL A CA    1 
ATOM   8171  C  C     . VAL D 4  948  ? 16.669  -28.129 78.889  1.00 81.39  ? 948  VAL A C     1 
ATOM   8172  O  O     . VAL D 4  948  ? 16.038  -28.685 79.797  1.00 81.89  ? 948  VAL A O     1 
ATOM   8173  C  CB    . VAL D 4  948  ? 19.058  -27.405 79.333  1.00 81.30  ? 948  VAL A CB    1 
ATOM   8174  C  CG1   . VAL D 4  948  ? 18.726  -27.277 80.811  1.00 81.85  ? 948  VAL A CG1   1 
ATOM   8175  C  CG2   . VAL D 4  948  ? 20.517  -27.791 79.142  1.00 81.29  ? 948  VAL A CG2   1 
ATOM   8176  N  N     . ASP D 4  949  ? 16.091  -27.248 78.067  1.00 80.99  ? 949  ASP A N     1 
ATOM   8177  C  CA    . ASP D 4  949  ? 14.703  -26.842 78.265  1.00 93.46  ? 949  ASP A CA    1 
ATOM   8178  C  C     . ASP D 4  949  ? 13.724  -28.001 78.117  1.00 98.51  ? 949  ASP A C     1 
ATOM   8179  O  O     . ASP D 4  949  ? 12.571  -27.881 78.544  1.00 106.94 ? 949  ASP A O     1 
ATOM   8180  C  CB    . ASP D 4  949  ? 14.337  -25.717 77.290  1.00 103.14 ? 949  ASP A CB    1 
ATOM   8181  C  CG    . ASP D 4  949  ? 14.910  -25.935 75.901  1.00 120.58 ? 949  ASP A CG    1 
ATOM   8182  O  OD1   . ASP D 4  949  ? 15.714  -26.876 75.728  1.00 124.79 ? 949  ASP A OD1   1 
ATOM   8183  O  OD2   . ASP D 4  949  ? 14.558  -25.163 74.983  1.00 114.81 ? 949  ASP A OD2   1 
ATOM   8184  N  N     . GLY D 4  950  ? 14.155  -29.119 77.536  1.00 94.05  ? 950  GLY A N     1 
ATOM   8185  C  CA    . GLY D 4  950  ? 13.299  -30.270 77.361  1.00 93.48  ? 950  GLY A CA    1 
ATOM   8186  C  C     . GLY D 4  950  ? 12.541  -30.319 76.053  1.00 122.60 ? 950  GLY A C     1 
ATOM   8187  O  O     . GLY D 4  950  ? 11.765  -31.259 75.843  1.00 136.74 ? 950  GLY A O     1 
ATOM   8188  N  N     . GLU D 4  951  ? 12.734  -29.340 75.171  1.00 127.34 ? 951  GLU A N     1 
ATOM   8189  C  CA    . GLU D 4  951  ? 12.065  -29.354 73.877  1.00 117.28 ? 951  GLU A CA    1 
ATOM   8190  C  C     . GLU D 4  951  ? 12.582  -30.511 73.030  1.00 107.70 ? 951  GLU A C     1 
ATOM   8191  O  O     . GLU D 4  951  ? 13.795  -30.705 72.898  1.00 89.49  ? 951  GLU A O     1 
ATOM   8192  C  CB    . GLU D 4  951  ? 12.285  -28.026 73.152  1.00 114.13 ? 951  GLU A CB    1 
ATOM   8193  C  CG    . GLU D 4  951  ? 11.572  -27.916 71.810  1.00 110.05 ? 951  GLU A CG    1 
ATOM   8194  C  CD    . GLU D 4  951  ? 10.161  -27.372 71.935  1.00 125.73 ? 951  GLU A CD    1 
ATOM   8195  O  OE1   . GLU D 4  951  ? 9.862   -26.338 71.300  1.00 139.79 ? 951  GLU A OE1   1 
ATOM   8196  O  OE2   . GLU D 4  951  ? 9.350   -27.981 72.664  1.00 127.26 ? 951  GLU A OE2   1 
ATOM   8197  N  N     . ALA D 4  952  ? 11.657  -31.283 72.456  1.00 115.40 ? 952  ALA A N     1 
ATOM   8198  C  CA    . ALA D 4  952  ? 12.007  -32.408 71.600  1.00 123.33 ? 952  ALA A CA    1 
ATOM   8199  C  C     . ALA D 4  952  ? 11.802  -32.142 70.117  1.00 124.74 ? 952  ALA A C     1 
ATOM   8200  O  O     . ALA D 4  952  ? 12.429  -32.814 69.294  1.00 145.93 ? 952  ALA A O     1 
ATOM   8201  C  CB    . ALA D 4  952  ? 11.195  -33.650 71.995  1.00 120.16 ? 952  ALA A CB    1 
ATOM   8202  N  N     . ASN D 4  953  ? 10.949  -31.187 69.754  1.00 101.09 ? 953  ASN A N     1 
ATOM   8203  C  CA    . ASN D 4  953  ? 10.655  -30.904 68.353  1.00 79.90  ? 953  ASN A CA    1 
ATOM   8204  C  C     . ASN D 4  953  ? 11.779  -30.051 67.775  1.00 79.35  ? 953  ASN A C     1 
ATOM   8205  O  O     . ASN D 4  953  ? 11.895  -28.866 68.101  1.00 80.05  ? 953  ASN A O     1 
ATOM   8206  C  CB    . ASN D 4  953  ? 9.307   -30.199 68.237  1.00 83.79  ? 953  ASN A CB    1 
ATOM   8207  C  CG    . ASN D 4  953  ? 8.305   -30.702 69.253  1.00 85.53  ? 953  ASN A CG    1 
ATOM   8208  O  OD1   . ASN D 4  953  ? 8.418   -30.410 70.442  1.00 96.30  ? 953  ASN A OD1   1 
ATOM   8209  N  ND2   . ASN D 4  953  ? 7.324   -31.474 68.794  1.00 81.06  ? 953  ASN A ND2   1 
ATOM   8210  N  N     . TRP D 4  954  ? 12.605  -30.646 66.918  1.00 84.69  ? 954  TRP A N     1 
ATOM   8211  C  CA    . TRP D 4  954  ? 13.776  -29.981 66.365  1.00 97.24  ? 954  TRP A CA    1 
ATOM   8212  C  C     . TRP D 4  954  ? 14.004  -30.441 64.931  1.00 114.69 ? 954  TRP A C     1 
ATOM   8213  O  O     . TRP D 4  954  ? 13.662  -31.576 64.577  1.00 141.67 ? 954  TRP A O     1 
ATOM   8214  C  CB    . TRP D 4  954  ? 15.023  -30.258 67.222  1.00 81.81  ? 954  TRP A CB    1 
ATOM   8215  C  CG    . TRP D 4  954  ? 14.921  -29.641 68.587  1.00 90.06  ? 954  TRP A CG    1 
ATOM   8216  C  CD1   . TRP D 4  954  ? 14.375  -30.208 69.701  1.00 111.03 ? 954  TRP A CD1   1 
ATOM   8217  C  CD2   . TRP D 4  954  ? 15.342  -28.324 68.975  1.00 103.44 ? 954  TRP A CD2   1 
ATOM   8218  N  NE1   . TRP D 4  954  ? 14.442  -29.336 70.761  1.00 121.58 ? 954  TRP A NE1   1 
ATOM   8219  C  CE2   . TRP D 4  954  ? 15.031  -28.172 70.342  1.00 112.78 ? 954  TRP A CE2   1 
ATOM   8220  C  CE3   . TRP D 4  954  ? 15.958  -27.263 68.302  1.00 105.39 ? 954  TRP A CE3   1 
ATOM   8221  C  CZ2   . TRP D 4  954  ? 15.314  -27.004 71.049  1.00 112.26 ? 954  TRP A CZ2   1 
ATOM   8222  C  CZ3   . TRP D 4  954  ? 16.237  -26.103 69.008  1.00 111.09 ? 954  TRP A CZ3   1 
ATOM   8223  C  CH2   . TRP D 4  954  ? 15.915  -25.984 70.366  1.00 111.74 ? 954  TRP A CH2   1 
ATOM   8224  N  N     . PRO D 4  955  ? 14.580  -29.581 64.084  1.00 95.03  ? 955  PRO A N     1 
ATOM   8225  C  CA    . PRO D 4  955  ? 14.644  -29.877 62.644  1.00 85.95  ? 955  PRO A CA    1 
ATOM   8226  C  C     . PRO D 4  955  ? 15.742  -30.885 62.325  1.00 89.82  ? 955  PRO A C     1 
ATOM   8227  O  O     . PRO D 4  955  ? 16.887  -30.738 62.764  1.00 78.97  ? 955  PRO A O     1 
ATOM   8228  C  CB    . PRO D 4  955  ? 14.942  -28.511 62.019  1.00 83.23  ? 955  PRO A CB    1 
ATOM   8229  C  CG    . PRO D 4  955  ? 15.719  -27.800 63.068  1.00 89.55  ? 955  PRO A CG    1 
ATOM   8230  C  CD    . PRO D 4  955  ? 15.187  -28.274 64.400  1.00 97.58  ? 955  PRO A CD    1 
ATOM   8231  N  N     . LEU D 4  956  ? 15.389  -31.905 61.548  1.00 80.32  ? 956  LEU A N     1 
ATOM   8232  C  CA    . LEU D 4  956  ? 16.288  -33.010 61.247  1.00 78.46  ? 956  LEU A CA    1 
ATOM   8233  C  C     . LEU D 4  956  ? 16.102  -33.466 59.806  1.00 78.48  ? 956  LEU A C     1 
ATOM   8234  O  O     . LEU D 4  956  ? 15.015  -33.313 59.238  1.00 78.52  ? 956  LEU A O     1 
ATOM   8235  C  CB    . LEU D 4  956  ? 16.059  -34.184 62.210  1.00 88.89  ? 956  LEU A CB    1 
ATOM   8236  C  CG    . LEU D 4  956  ? 16.741  -33.957 63.558  1.00 78.93  ? 956  LEU A CG    1 
ATOM   8237  C  CD1   . LEU D 4  956  ? 16.173  -34.883 64.615  1.00 84.15  ? 956  LEU A CD1   1 
ATOM   8238  C  CD2   . LEU D 4  956  ? 18.250  -34.128 63.423  1.00 78.88  ? 956  LEU A CD2   1 
ATOM   8239  N  N     . PRO D 4  957  ? 17.146  -34.039 59.195  1.00 81.59  ? 957  PRO A N     1 
ATOM   8240  C  CA    . PRO D 4  957  ? 17.161  -34.180 57.728  1.00 90.22  ? 957  PRO A CA    1 
ATOM   8241  C  C     . PRO D 4  957  ? 16.203  -35.212 57.150  1.00 124.88 ? 957  PRO A C     1 
ATOM   8242  O  O     . PRO D 4  957  ? 15.950  -35.162 55.940  1.00 174.67 ? 957  PRO A O     1 
ATOM   8243  C  CB    . PRO D 4  957  ? 18.616  -34.568 57.432  1.00 81.59  ? 957  PRO A CB    1 
ATOM   8244  C  CG    . PRO D 4  957  ? 19.383  -34.040 58.580  1.00 91.81  ? 957  PRO A CG    1 
ATOM   8245  C  CD    . PRO D 4  957  ? 18.491  -34.218 59.768  1.00 104.63 ? 957  PRO A CD    1 
ATOM   8246  N  N     . VAL D 4  958  ? 15.678  -36.155 57.927  1.00 79.19  ? 958  VAL A N     1 
ATOM   8247  C  CA    . VAL D 4  958  ? 14.793  -37.178 57.373  1.00 79.60  ? 958  VAL A CA    1 
ATOM   8248  C  C     . VAL D 4  958  ? 13.561  -37.299 58.256  1.00 85.86  ? 958  VAL A C     1 
ATOM   8249  O  O     . VAL D 4  958  ? 13.680  -37.548 59.461  1.00 108.54 ? 958  VAL A O     1 
ATOM   8250  C  CB    . VAL D 4  958  ? 15.490  -38.541 57.238  1.00 79.98  ? 958  VAL A CB    1 
ATOM   8251  C  CG1   . VAL D 4  958  ? 14.471  -39.619 56.899  1.00 80.49  ? 958  VAL A CG1   1 
ATOM   8252  C  CG2   . VAL D 4  958  ? 16.568  -38.476 56.176  1.00 79.83  ? 958  VAL A CG2   1 
ATOM   8253  N  N     . ASN D 4  959  ? 12.382  -37.135 57.657  1.00 79.98  ? 959  ASN A N     1 
ATOM   8254  C  CA    . ASN D 4  959  ? 11.119  -37.303 58.374  1.00 80.33  ? 959  ASN A CA    1 
ATOM   8255  C  C     . ASN D 4  959  ? 10.804  -38.792 58.437  1.00 80.92  ? 959  ASN A C     1 
ATOM   8256  O  O     . ASN D 4  959  ? 10.149  -39.354 57.560  1.00 81.24  ? 959  ASN A O     1 
ATOM   8257  C  CB    . ASN D 4  959  ? 10.001  -36.517 57.699  1.00 80.30  ? 959  ASN A CB    1 
ATOM   8258  C  CG    . ASN D 4  959  ? 8.727   -36.473 58.532  1.00 80.66  ? 959  ASN A CG    1 
ATOM   8259  O  OD1   . ASN D 4  959  ? 8.278   -37.489 59.062  1.00 81.17  ? 959  ASN A OD1   1 
ATOM   8260  N  ND2   . ASN D 4  959  ? 8.142   -35.287 58.651  1.00 80.47  ? 959  ASN A ND2   1 
ATOM   8261  N  N     . ILE D 4  960  ? 11.277  -39.438 59.504  1.00 83.87  ? 960  ILE A N     1 
ATOM   8262  C  CA    . ILE D 4  960  ? 10.987  -40.853 59.710  1.00 88.72  ? 960  ILE A CA    1 
ATOM   8263  C  C     . ILE D 4  960  ? 9.523   -41.049 60.088  1.00 82.50  ? 960  ILE A C     1 
ATOM   8264  O  O     . ILE D 4  960  ? 8.940   -42.107 59.820  1.00 82.79  ? 960  ILE A O     1 
ATOM   8265  C  CB    . ILE D 4  960  ? 11.946  -41.426 60.771  1.00 93.86  ? 960  ILE A CB    1 
ATOM   8266  C  CG1   . ILE D 4  960  ? 13.395  -41.255 60.306  1.00 83.71  ? 960  ILE A CG1   1 
ATOM   8267  C  CG2   . ILE D 4  960  ? 11.649  -42.894 61.043  1.00 82.55  ? 960  ILE A CG2   1 
ATOM   8268  C  CD1   . ILE D 4  960  ? 14.429  -41.667 61.328  1.00 81.57  ? 960  ILE A CD1   1 
ATOM   8269  N  N     . ARG D 4  961  ? 8.903   -40.036 60.696  1.00 82.61  ? 961  ARG A N     1 
ATOM   8270  C  CA    . ARG D 4  961  ? 7.486   -40.118 61.043  1.00 82.54  ? 961  ARG A CA    1 
ATOM   8271  C  C     . ARG D 4  961  ? 6.632   -40.418 59.818  1.00 93.03  ? 961  ARG A C     1 
ATOM   8272  O  O     . ARG D 4  961  ? 5.629   -41.134 59.913  1.00 100.88 ? 961  ARG A O     1 
ATOM   8273  C  CB    . ARG D 4  961  ? 7.044   -38.812 61.704  1.00 87.14  ? 961  ARG A CB    1 
ATOM   8274  C  CG    . ARG D 4  961  ? 5.655   -38.827 62.316  1.00 93.91  ? 961  ARG A CG    1 
ATOM   8275  C  CD    . ARG D 4  961  ? 5.668   -38.215 63.720  1.00 129.32 ? 961  ARG A CD    1 
ATOM   8276  N  NE    . ARG D 4  961  ? 5.933   -36.775 63.724  1.00 128.67 ? 961  ARG A NE    1 
ATOM   8277  C  CZ    . ARG D 4  961  ? 7.118   -36.225 63.977  1.00 85.33  ? 961  ARG A CZ    1 
ATOM   8278  N  NH1   . ARG D 4  961  ? 8.167   -36.988 64.253  1.00 81.58  ? 961  ARG A NH1   1 
ATOM   8279  N  NH2   . ARG D 4  961  ? 7.253   -34.905 63.957  1.00 81.16  ? 961  ARG A NH2   1 
ATOM   8280  N  N     . ARG D 4  962  ? 7.020   -39.884 58.656  1.00 106.61 ? 962  ARG A N     1 
ATOM   8281  C  CA    . ARG D 4  962  ? 6.270   -40.130 57.428  1.00 94.59  ? 962  ARG A CA    1 
ATOM   8282  C  C     . ARG D 4  962  ? 6.668   -41.447 56.772  1.00 95.52  ? 962  ARG A C     1 
ATOM   8283  O  O     . ARG D 4  962  ? 5.813   -42.136 56.204  1.00 108.39 ? 962  ARG A O     1 
ATOM   8284  C  CB    . ARG D 4  962  ? 6.467   -38.973 56.445  1.00 93.64  ? 962  ARG A CB    1 
ATOM   8285  C  CG    . ARG D 4  962  ? 5.738   -37.687 56.826  1.00 99.99  ? 962  ARG A CG    1 
ATOM   8286  C  CD    . ARG D 4  962  ? 5.637   -36.720 55.647  1.00 90.44  ? 962  ARG A CD    1 
ATOM   8287  N  NE    . ARG D 4  962  ? 6.871   -35.968 55.426  1.00 80.97  ? 962  ARG A NE    1 
ATOM   8288  C  CZ    . ARG D 4  962  ? 7.821   -36.326 54.567  1.00 80.78  ? 962  ARG A CZ    1 
ATOM   8289  N  NH1   . ARG D 4  962  ? 7.688   -37.435 53.855  1.00 84.76  ? 962  ARG A NH1   1 
ATOM   8290  N  NH2   . ARG D 4  962  ? 8.910   -35.583 54.428  1.00 80.23  ? 962  ARG A NH2   1 
ATOM   8291  N  N     . ILE D 4  963  ? 7.954   -41.808 56.831  1.00 82.79  ? 963  ILE A N     1 
ATOM   8292  C  CA    . ILE D 4  963  ? 8.419   -43.033 56.182  1.00 83.16  ? 963  ILE A CA    1 
ATOM   8293  C  C     . ILE D 4  963  ? 7.695   -44.248 56.749  1.00 83.94  ? 963  ILE A C     1 
ATOM   8294  O  O     . ILE D 4  963  ? 7.371   -45.196 56.021  1.00 84.46  ? 963  ILE A O     1 
ATOM   8295  C  CB    . ILE D 4  963  ? 9.949   -43.165 56.321  1.00 82.79  ? 963  ILE A CB    1 
ATOM   8296  C  CG1   . ILE D 4  963  ? 10.665  -42.260 55.318  1.00 82.21  ? 963  ILE A CG1   1 
ATOM   8297  C  CG2   . ILE D 4  963  ? 10.389  -44.604 56.110  1.00 83.32  ? 963  ILE A CG2   1 
ATOM   8298  C  CD1   . ILE D 4  963  ? 12.158  -42.520 55.221  1.00 82.00  ? 963  ILE A CD1   1 
ATOM   8299  N  N     . ILE D 4  964  ? 7.412   -44.232 58.052  1.00 84.84  ? 964  ILE A N     1 
ATOM   8300  C  CA    . ILE D 4  964  ? 6.727   -45.363 58.673  1.00 100.33 ? 964  ILE A CA    1 
ATOM   8301  C  C     . ILE D 4  964  ? 5.325   -45.523 58.099  1.00 90.93  ? 964  ILE A C     1 
ATOM   8302  O  O     . ILE D 4  964  ? 4.885   -46.642 57.809  1.00 88.35  ? 964  ILE A O     1 
ATOM   8303  C  CB    . ILE D 4  964  ? 6.715   -45.205 60.207  1.00 94.22  ? 964  ILE A CB    1 
ATOM   8304  C  CG1   . ILE D 4  964  ? 7.920   -45.918 60.832  1.00 84.92  ? 964  ILE A CG1   1 
ATOM   8305  C  CG2   . ILE D 4  964  ? 5.416   -45.734 60.809  1.00 89.98  ? 964  ILE A CG2   1 
ATOM   8306  C  CD1   . ILE D 4  964  ? 9.264   -45.516 60.273  1.00 84.27  ? 964  ILE A CD1   1 
ATOM   8307  N  N     . GLN D 4  965  ? 4.613   -44.411 57.893  1.00 86.62  ? 965  GLN A N     1 
ATOM   8308  C  CA    . GLN D 4  965  ? 3.272   -44.504 57.323  1.00 87.56  ? 965  GLN A CA    1 
ATOM   8309  C  C     . GLN D 4  965  ? 3.314   -44.955 55.871  1.00 94.36  ? 965  GLN A C     1 
ATOM   8310  O  O     . GLN D 4  965  ? 2.390   -45.636 55.408  1.00 86.61  ? 965  GLN A O     1 
ATOM   8311  C  CB    . GLN D 4  965  ? 2.548   -43.164 57.436  1.00 91.78  ? 965  GLN A CB    1 
ATOM   8312  C  CG    . GLN D 4  965  ? 2.158   -42.786 58.851  1.00 108.60 ? 965  GLN A CG    1 
ATOM   8313  C  CD    . GLN D 4  965  ? 2.573   -41.370 59.199  1.00 130.81 ? 965  GLN A CD    1 
ATOM   8314  O  OE1   . GLN D 4  965  ? 3.250   -40.699 58.419  1.00 131.46 ? 965  GLN A OE1   1 
ATOM   8315  N  NE2   . GLN D 4  965  ? 2.178   -40.912 60.381  1.00 150.54 ? 965  GLN A NE2   1 
ATOM   8316  N  N     . ASN D 4  966  ? 4.365   -44.580 55.138  1.00 112.03 ? 966  ASN A N     1 
ATOM   8317  C  CA    . ASN D 4  966  ? 4.560   -45.110 53.794  1.00 125.92 ? 966  ASN A CA    1 
ATOM   8318  C  C     . ASN D 4  966  ? 4.671   -46.629 53.824  1.00 122.97 ? 966  ASN A C     1 
ATOM   8319  O  O     . ASN D 4  966  ? 3.931   -47.330 53.126  1.00 134.97 ? 966  ASN A O     1 
ATOM   8320  C  CB    . ASN D 4  966  ? 5.802   -44.485 53.155  1.00 126.28 ? 966  ASN A CB    1 
ATOM   8321  C  CG    . ASN D 4  966  ? 5.684   -42.981 52.989  1.00 111.84 ? 966  ASN A CG    1 
ATOM   8322  O  OD1   . ASN D 4  966  ? 4.793   -42.348 53.556  1.00 110.83 ? 966  ASN A OD1   1 
ATOM   8323  N  ND2   . ASN D 4  966  ? 6.591   -42.400 52.212  1.00 105.07 ? 966  ASN A ND2   1 
ATOM   8324  N  N     . ALA D 4  967  ? 5.576   -47.157 54.652  1.00 88.34  ? 967  ALA A N     1 
ATOM   8325  C  CA    . ALA D 4  967  ? 5.715   -48.605 54.767  1.00 86.74  ? 967  ALA A CA    1 
ATOM   8326  C  C     . ALA D 4  967  ? 4.509   -49.239 55.447  1.00 99.15  ? 967  ALA A C     1 
ATOM   8327  O  O     . ALA D 4  967  ? 4.177   -50.396 55.161  1.00 103.03 ? 967  ALA A O     1 
ATOM   8328  C  CB    . ALA D 4  967  ? 6.994   -48.951 55.529  1.00 86.96  ? 967  ALA A CB    1 
ATOM   8329  N  N     . GLN D 4  968  ? 3.842   -48.509 56.344  1.00 133.68 ? 968  GLN A N     1 
ATOM   8330  C  CA    . GLN D 4  968  ? 2.647   -49.039 56.991  1.00 144.28 ? 968  GLN A CA    1 
ATOM   8331  C  C     . GLN D 4  968  ? 1.491   -49.186 56.012  1.00 140.78 ? 968  GLN A C     1 
ATOM   8332  O  O     . GLN D 4  968  ? 0.587   -49.994 56.252  1.00 154.42 ? 968  GLN A O     1 
ATOM   8333  C  CB    . GLN D 4  968  ? 2.237   -48.138 58.162  1.00 150.70 ? 968  GLN A CB    1 
ATOM   8334  C  CG    . GLN D 4  968  ? 1.614   -48.867 59.347  1.00 150.36 ? 968  GLN A CG    1 
ATOM   8335  C  CD    . GLN D 4  968  ? 0.100   -48.750 59.384  1.00 147.74 ? 968  GLN A CD    1 
ATOM   8336  O  OE1   . GLN D 4  968  ? -0.548  -48.574 58.352  1.00 166.58 ? 968  GLN A OE1   1 
ATOM   8337  N  NE2   . GLN D 4  968  ? -0.471  -48.850 60.579  1.00 122.62 ? 968  GLN A NE2   1 
ATOM   8338  N  N     . GLN D 4  969  ? 1.511   -48.439 54.909  1.00 119.30 ? 969  GLN A N     1 
ATOM   8339  C  CA    . GLN D 4  969  ? 0.452   -48.496 53.911  1.00 105.77 ? 969  GLN A CA    1 
ATOM   8340  C  C     . GLN D 4  969  ? 0.886   -49.120 52.592  1.00 89.14  ? 969  GLN A C     1 
ATOM   8341  O  O     . GLN D 4  969  ? 0.048   -49.708 51.906  1.00 89.92  ? 969  GLN A O     1 
ATOM   8342  C  CB    . GLN D 4  969  ? -0.103  -47.088 53.650  1.00 97.66  ? 969  GLN A CB    1 
ATOM   8343  C  CG    . GLN D 4  969  ? -1.534  -47.066 53.135  1.00 92.62  ? 969  GLN A CG    1 
ATOM   8344  C  CD    . GLN D 4  969  ? -1.612  -46.906 51.630  1.00 104.19 ? 969  GLN A CD    1 
ATOM   8345  O  OE1   . GLN D 4  969  ? -0.688  -46.393 50.999  1.00 88.59  ? 969  GLN A OE1   1 
ATOM   8346  N  NE2   . GLN D 4  969  ? -2.717  -47.354 51.044  1.00 129.52 ? 969  GLN A NE2   1 
ATOM   8347  N  N     . THR D 4  970  ? 2.169   -49.019 52.224  1.00 88.48  ? 970  THR A N     1 
ATOM   8348  C  CA    . THR D 4  970  ? 2.655   -49.665 51.005  1.00 88.67  ? 970  THR A CA    1 
ATOM   8349  C  C     . THR D 4  970  ? 2.423   -51.169 51.066  1.00 89.62  ? 970  THR A C     1 
ATOM   8350  O  O     . THR D 4  970  ? 1.705   -51.741 50.235  1.00 91.08  ? 970  THR A O     1 
ATOM   8351  C  CB    . THR D 4  970  ? 4.143   -49.360 50.797  1.00 87.87  ? 970  THR A CB    1 
ATOM   8352  O  OG1   . THR D 4  970  ? 4.315   -47.964 50.524  1.00 87.07  ? 970  THR A OG1   1 
ATOM   8353  C  CG2   . THR D 4  970  ? 4.709   -50.175 49.641  1.00 88.17  ? 970  THR A CG2   1 
ATOM   8354  N  N     . PHE D 4  971  ? 3.029   -51.823 52.050  1.00 90.29  ? 971  PHE A N     1 
ATOM   8355  C  CA    . PHE D 4  971  ? 2.732   -53.209 52.379  1.00 97.72  ? 971  PHE A CA    1 
ATOM   8356  C  C     . PHE D 4  971  ? 1.644   -53.200 53.444  1.00 112.08 ? 971  PHE A C     1 
ATOM   8357  O  O     . PHE D 4  971  ? 1.896   -52.806 54.589  1.00 122.10 ? 971  PHE A O     1 
ATOM   8358  C  CB    . PHE D 4  971  ? 3.995   -53.913 52.868  1.00 96.69  ? 971  PHE A CB    1 
ATOM   8359  C  CG    . PHE D 4  971  ? 5.267   -53.317 52.325  1.00 102.21 ? 971  PHE A CG    1 
ATOM   8360  C  CD1   . PHE D 4  971  ? 6.122   -52.603 53.148  1.00 100.77 ? 971  PHE A CD1   1 
ATOM   8361  C  CD2   . PHE D 4  971  ? 5.619   -53.490 50.997  1.00 117.53 ? 971  PHE A CD2   1 
ATOM   8362  C  CE1   . PHE D 4  971  ? 7.290   -52.052 52.650  1.00 89.57  ? 971  PHE A CE1   1 
ATOM   8363  C  CE2   . PHE D 4  971  ? 6.788   -52.948 50.497  1.00 116.59 ? 971  PHE A CE2   1 
ATOM   8364  C  CZ    . PHE D 4  971  ? 7.624   -52.230 51.325  1.00 88.79  ? 971  PHE A CZ    1 
ATOM   8365  N  N     . HIS D 4  972  ? 0.434   -53.610 53.070  1.00 141.23 ? 972  HIS A N     1 
ATOM   8366  C  CA    . HIS D 4  972  ? -0.709  -53.520 53.972  1.00 149.01 ? 972  HIS A CA    1 
ATOM   8367  C  C     . HIS D 4  972  ? -0.437  -54.302 55.250  1.00 141.43 ? 972  HIS A C     1 
ATOM   8368  O  O     . HIS D 4  972  ? -0.350  -55.535 55.232  1.00 130.64 ? 972  HIS A O     1 
ATOM   8369  C  CB    . HIS D 4  972  ? -1.978  -54.014 53.275  1.00 165.21 ? 972  HIS A CB    1 
ATOM   8370  C  CG    . HIS D 4  972  ? -2.521  -53.048 52.267  1.00 165.07 ? 972  HIS A CG    1 
ATOM   8371  N  ND1   . HIS D 4  972  ? -3.561  -52.188 52.547  1.00 164.89 ? 972  HIS A ND1   1 
ATOM   8372  C  CD2   . HIS D 4  972  ? -2.160  -52.798 50.986  1.00 164.36 ? 972  HIS A CD2   1 
ATOM   8373  C  CE1   . HIS D 4  972  ? -3.820  -51.453 51.480  1.00 165.34 ? 972  HIS A CE1   1 
ATOM   8374  N  NE2   . HIS D 4  972  ? -2.985  -51.803 50.519  1.00 164.13 ? 972  HIS A NE2   1 
ATOM   8375  N  N     . ILE D 4  973  ? -0.299  -53.583 56.362  1.00 142.21 ? 973  ILE A N     1 
ATOM   8376  C  CA    . ILE D 4  973  ? 0.230   -54.140 57.601  1.00 137.01 ? 973  ILE A CA    1 
ATOM   8377  C  C     . ILE D 4  973  ? -0.902  -54.775 58.393  1.00 157.96 ? 973  ILE A C     1 
ATOM   8378  O  O     . ILE D 4  973  ? -1.944  -54.150 58.625  1.00 165.84 ? 973  ILE A O     1 
ATOM   8379  C  CB    . ILE D 4  973  ? 0.944   -53.055 58.427  1.00 111.71 ? 973  ILE A CB    1 
ATOM   8380  C  CG1   . ILE D 4  973  ? 2.356   -52.815 57.884  1.00 92.34  ? 973  ILE A CG1   1 
ATOM   8381  C  CG2   . ILE D 4  973  ? 0.991   -53.429 59.905  1.00 119.31 ? 973  ILE A CG2   1 
ATOM   8382  C  CD1   . ILE D 4  973  ? 3.175   -54.077 57.711  1.00 92.74  ? 973  ILE A CD1   1 
ATOM   8383  N  N     . ASP D 4  974  ? -0.699  -56.024 58.800  1.00 162.29 ? 974  ASP A N     1 
ATOM   8384  C  CA    . ASP D 4  974  ? -1.620  -56.729 59.678  1.00 164.29 ? 974  ASP A CA    1 
ATOM   8385  C  C     . ASP D 4  974  ? -1.120  -56.626 61.112  1.00 169.96 ? 974  ASP A C     1 
ATOM   8386  O  O     . ASP D 4  974  ? 0.025   -56.986 61.406  1.00 164.57 ? 974  ASP A O     1 
ATOM   8387  C  CB    . ASP D 4  974  ? -1.762  -58.193 59.255  1.00 158.50 ? 974  ASP A CB    1 
ATOM   8388  C  CG    . ASP D 4  974  ? -0.449  -58.796 58.787  1.00 161.26 ? 974  ASP A CG    1 
ATOM   8389  O  OD1   . ASP D 4  974  ? 0.602   -58.140 58.947  1.00 170.23 ? 974  ASP A OD1   1 
ATOM   8390  O  OD2   . ASP D 4  974  ? -0.470  -59.922 58.248  1.00 159.35 ? 974  ASP A OD2   1 
ATOM   8391  N  N     . HIS D 4  975  ? -1.975  -56.121 61.995  1.00 175.46 ? 975  HIS A N     1 
ATOM   8392  C  CA    . HIS D 4  975  ? -1.651  -55.974 63.406  1.00 177.27 ? 975  HIS A CA    1 
ATOM   8393  C  C     . HIS D 4  975  ? -1.994  -57.218 64.211  1.00 176.82 ? 975  HIS A C     1 
ATOM   8394  O  O     . HIS D 4  975  ? -1.889  -57.198 65.442  1.00 160.37 ? 975  HIS A O     1 
ATOM   8395  C  CB    . HIS D 4  975  ? -2.372  -54.753 63.980  1.00 181.65 ? 975  HIS A CB    1 
ATOM   8396  C  CG    . HIS D 4  975  ? -2.611  -53.673 62.971  1.00 187.71 ? 975  HIS A CG    1 
ATOM   8397  N  ND1   . HIS D 4  975  ? -3.714  -53.659 62.144  1.00 190.22 ? 975  HIS A ND1   1 
ATOM   8398  C  CD2   . HIS D 4  975  ? -1.881  -52.581 62.644  1.00 188.60 ? 975  HIS A CD2   1 
ATOM   8399  C  CE1   . HIS D 4  975  ? -3.657  -52.600 61.357  1.00 192.10 ? 975  HIS A CE1   1 
ATOM   8400  N  NE2   . HIS D 4  975  ? -2.555  -51.929 61.640  1.00 188.73 ? 975  HIS A NE2   1 
ATOM   8401  N  N     . THR D 4  976  ? -2.402  -58.295 63.543  1.00 184.62 ? 976  THR A N     1 
ATOM   8402  C  CA    . THR D 4  976  ? -2.677  -59.571 64.187  1.00 192.38 ? 976  THR A CA    1 
ATOM   8403  C  C     . THR D 4  976  ? -1.648  -60.633 63.822  1.00 204.40 ? 976  THR A C     1 
ATOM   8404  O  O     . THR D 4  976  ? -1.884  -61.821 64.064  1.00 216.46 ? 976  THR A O     1 
ATOM   8405  C  CB    . THR D 4  976  ? -4.080  -60.058 63.818  1.00 188.00 ? 976  THR A CB    1 
ATOM   8406  O  OG1   . THR D 4  976  ? -4.101  -60.451 62.440  1.00 188.76 ? 976  THR A OG1   1 
ATOM   8407  C  CG2   . THR D 4  976  ? -5.103  -58.954 64.036  1.00 183.61 ? 976  THR A CG2   1 
ATOM   8408  N  N     . LYS D 4  977  ? -0.512  -60.235 63.252  1.00 184.07 ? 977  LYS A N     1 
ATOM   8409  C  CA    . LYS D 4  977  ? 0.484   -61.176 62.771  1.00 164.99 ? 977  LYS A CA    1 
ATOM   8410  C  C     . LYS D 4  977  ? 1.873   -60.782 63.254  1.00 172.99 ? 977  LYS A C     1 
ATOM   8411  O  O     . LYS D 4  977  ? 2.192   -59.589 63.339  1.00 181.15 ? 977  LYS A O     1 
ATOM   8412  C  CB    . LYS D 4  977  ? 0.466   -61.249 61.238  1.00 149.31 ? 977  LYS A CB    1 
ATOM   8413  C  CG    . LYS D 4  977  ? -0.800  -61.876 60.677  1.00 162.87 ? 977  LYS A CG    1 
ATOM   8414  C  CD    . LYS D 4  977  ? -1.015  -63.273 61.238  1.00 164.49 ? 977  LYS A CD    1 
ATOM   8415  C  CE    . LYS D 4  977  ? -2.478  -63.675 61.180  1.00 172.23 ? 977  LYS A CE    1 
ATOM   8416  N  NZ    . LYS D 4  977  ? -3.334  -62.753 61.976  1.00 177.99 ? 977  LYS A NZ    1 
ATOM   8417  N  N     . PRO D 4  978  ? 2.717   -61.759 63.573  1.00 140.23 ? 978  PRO A N     1 
ATOM   8418  C  CA    . PRO D 4  978  ? 4.065   -61.458 64.056  1.00 110.15 ? 978  PRO A CA    1 
ATOM   8419  C  C     . PRO D 4  978  ? 5.003   -61.098 62.912  1.00 96.19  ? 978  PRO A C     1 
ATOM   8420  O  O     . PRO D 4  978  ? 4.713   -61.308 61.733  1.00 97.06  ? 978  PRO A O     1 
ATOM   8421  C  CB    . PRO D 4  978  ? 4.489   -62.766 64.723  1.00 111.94 ? 978  PRO A CB    1 
ATOM   8422  C  CG    . PRO D 4  978  ? 3.790   -63.811 63.924  1.00 109.21 ? 978  PRO A CG    1 
ATOM   8423  C  CD    . PRO D 4  978  ? 2.464   -63.210 63.516  1.00 127.79 ? 978  PRO A CD    1 
ATOM   8424  N  N     . SER D 4  979  ? 6.153   -60.553 63.288  1.00 94.77  ? 979  SER A N     1 
ATOM   8425  C  CA    . SER D 4  979  ? 7.128   -60.119 62.305  1.00 93.97  ? 979  SER A CA    1 
ATOM   8426  C  C     . SER D 4  979  ? 7.914   -61.309 61.759  1.00 94.50  ? 979  SER A C     1 
ATOM   8427  O  O     . SER D 4  979  ? 7.795   -62.444 62.226  1.00 95.46  ? 979  SER A O     1 
ATOM   8428  C  CB    . SER D 4  979  ? 8.078   -59.086 62.911  1.00 92.98  ? 979  SER A CB    1 
ATOM   8429  O  OG    . SER D 4  979  ? 9.357   -59.154 62.305  1.00 92.54  ? 979  SER A OG    1 
ATOM   8430  N  N     . ASP D 4  980  ? 8.713   -61.030 60.732  1.00 97.42  ? 980  ASP A N     1 
ATOM   8431  C  CA    . ASP D 4  980  ? 9.661   -61.981 60.172  1.00 110.19 ? 980  ASP A CA    1 
ATOM   8432  C  C     . ASP D 4  980  ? 11.093  -61.669 60.589  1.00 98.73  ? 980  ASP A C     1 
ATOM   8433  O  O     . ASP D 4  980  ? 12.032  -62.254 60.040  1.00 104.78 ? 980  ASP A O     1 
ATOM   8434  C  CB    . ASP D 4  980  ? 9.558   -61.994 58.642  1.00 132.38 ? 980  ASP A CB    1 
ATOM   8435  C  CG    . ASP D 4  980  ? 8.122   -62.075 58.146  1.00 143.93 ? 980  ASP A CG    1 
ATOM   8436  O  OD1   . ASP D 4  980  ? 7.216   -62.351 58.960  1.00 157.79 ? 980  ASP A OD1   1 
ATOM   8437  O  OD2   . ASP D 4  980  ? 7.900   -61.868 56.934  1.00 143.06 ? 980  ASP A OD2   1 
ATOM   8438  N  N     . LEU D 4  981  ? 11.278  -60.763 61.543  1.00 93.09  ? 981  LEU A N     1 
ATOM   8439  C  CA    . LEU D 4  981  ? 12.585  -60.210 61.868  1.00 92.42  ? 981  LEU A CA    1 
ATOM   8440  C  C     . LEU D 4  981  ? 13.180  -60.922 63.074  1.00 100.30 ? 981  LEU A C     1 
ATOM   8441  O  O     . LEU D 4  981  ? 12.550  -60.991 64.134  1.00 93.30  ? 981  LEU A O     1 
ATOM   8442  C  CB    . LEU D 4  981  ? 12.477  -58.713 62.164  1.00 91.42  ? 981  LEU A CB    1 
ATOM   8443  C  CG    . LEU D 4  981  ? 12.278  -57.739 61.005  1.00 90.67  ? 981  LEU A CG    1 
ATOM   8444  C  CD1   . LEU D 4  981  ? 11.431  -56.561 61.454  1.00 90.11  ? 981  LEU A CD1   1 
ATOM   8445  C  CD2   . LEU D 4  981  ? 13.621  -57.259 60.488  1.00 90.02  ? 981  LEU A CD2   1 
ATOM   8446  N  N     . THR D 4  982  ? 14.390  -61.447 62.911  1.00 142.96 ? 982  THR A N     1 
ATOM   8447  C  CA    . THR D 4  982  ? 15.189  -61.800 64.072  1.00 138.16 ? 982  THR A CA    1 
ATOM   8448  C  C     . THR D 4  982  ? 15.680  -60.525 64.754  1.00 125.52 ? 982  THR A C     1 
ATOM   8449  O  O     . THR D 4  982  ? 15.765  -59.456 64.141  1.00 124.68 ? 982  THR A O     1 
ATOM   8450  C  CB    . THR D 4  982  ? 16.376  -62.679 63.671  1.00 145.52 ? 982  THR A CB    1 
ATOM   8451  O  OG1   . THR D 4  982  ? 15.991  -63.545 62.596  1.00 154.38 ? 982  THR A OG1   1 
ATOM   8452  C  CG2   . THR D 4  982  ? 16.850  -63.519 64.851  1.00 145.86 ? 982  THR A CG2   1 
ATOM   8453  N  N     . ILE D 4  983  ? 15.981  -60.638 66.048  1.00 100.84 ? 983  ILE A N     1 
ATOM   8454  C  CA    . ILE D 4  983  ? 16.551  -59.500 66.763  1.00 92.00  ? 983  ILE A CA    1 
ATOM   8455  C  C     . ILE D 4  983  ? 17.845  -59.058 66.092  1.00 91.44  ? 983  ILE A C     1 
ATOM   8456  O  O     . ILE D 4  983  ? 18.131  -57.858 65.990  1.00 95.79  ? 983  ILE A O     1 
ATOM   8457  C  CB    . ILE D 4  983  ? 16.759  -59.849 68.252  1.00 92.52  ? 983  ILE A CB    1 
ATOM   8458  C  CG1   . ILE D 4  983  ? 15.534  -59.447 69.076  1.00 92.56  ? 983  ILE A CG1   1 
ATOM   8459  C  CG2   . ILE D 4  983  ? 18.009  -59.175 68.811  1.00 92.04  ? 983  ILE A CG2   1 
ATOM   8460  C  CD1   . ILE D 4  983  ? 14.318  -60.286 68.805  1.00 93.30  ? 983  ILE A CD1   1 
ATOM   8461  N  N     . LYS D 4  984  ? 18.626  -60.015 65.584  1.00 91.97  ? 984  LYS A N     1 
ATOM   8462  C  CA    . LYS D 4  984  ? 19.886  -59.665 64.937  1.00 91.57  ? 984  LYS A CA    1 
ATOM   8463  C  C     . LYS D 4  984  ? 19.669  -58.828 63.683  1.00 99.88  ? 984  LYS A C     1 
ATOM   8464  O  O     . LYS D 4  984  ? 20.500  -57.971 63.368  1.00 90.16  ? 984  LYS A O     1 
ATOM   8465  C  CB    . LYS D 4  984  ? 20.681  -60.930 64.605  1.00 92.41  ? 984  LYS A CB    1 
ATOM   8466  C  CG    . LYS D 4  984  ? 21.884  -61.172 65.522  1.00 92.74  ? 984  LYS A CG    1 
ATOM   8467  C  CD    . LYS D 4  984  ? 22.798  -62.253 64.968  1.00 93.47  ? 984  LYS A CD    1 
ATOM   8468  C  CE    . LYS D 4  984  ? 22.056  -63.566 64.800  1.00 94.42  ? 984  LYS A CE    1 
ATOM   8469  N  NZ    . LYS D 4  984  ? 21.453  -64.037 66.078  1.00 94.98  ? 984  LYS A NZ    1 
ATOM   8470  N  N     . ASP D 4  985  ? 18.566  -59.045 62.961  1.00 156.81 ? 985  ASP A N     1 
ATOM   8471  C  CA    . ASP D 4  985  ? 18.324  -58.263 61.751  1.00 155.82 ? 985  ASP A CA    1 
ATOM   8472  C  C     . ASP D 4  985  ? 18.142  -56.785 62.079  1.00 142.51 ? 985  ASP A C     1 
ATOM   8473  O  O     . ASP D 4  985  ? 18.712  -55.914 61.411  1.00 143.63 ? 985  ASP A O     1 
ATOM   8474  C  CB    . ASP D 4  985  ? 17.098  -58.785 60.995  1.00 161.37 ? 985  ASP A CB    1 
ATOM   8475  C  CG    . ASP D 4  985  ? 16.989  -60.296 61.006  1.00 174.00 ? 985  ASP A CG    1 
ATOM   8476  O  OD1   . ASP D 4  985  ? 17.903  -60.972 60.485  1.00 183.59 ? 985  ASP A OD1   1 
ATOM   8477  O  OD2   . ASP D 4  985  ? 15.965  -60.804 61.511  1.00 179.34 ? 985  ASP A OD2   1 
ATOM   8478  N  N     . ILE D 4  986  ? 17.342  -56.486 63.103  1.00 94.82  ? 986  ILE A N     1 
ATOM   8479  C  CA    . ILE D 4  986  ? 17.048  -55.098 63.447  1.00 88.47  ? 986  ILE A CA    1 
ATOM   8480  C  C     . ILE D 4  986  ? 18.305  -54.390 63.937  1.00 88.00  ? 986  ILE A C     1 
ATOM   8481  O  O     . ILE D 4  986  ? 18.757  -53.403 63.345  1.00 87.29  ? 986  ILE A O     1 
ATOM   8482  C  CB    . ILE D 4  986  ? 15.929  -55.026 64.502  1.00 88.70  ? 986  ILE A CB    1 
ATOM   8483  C  CG1   . ILE D 4  986  ? 14.664  -55.730 64.008  1.00 89.25  ? 986  ILE A CG1   1 
ATOM   8484  C  CG2   . ILE D 4  986  ? 15.627  -53.578 64.859  1.00 87.89  ? 986  ILE A CG2   1 
ATOM   8485  C  CD1   . ILE D 4  986  ? 13.500  -55.630 64.971  1.00 89.53  ? 986  ILE A CD1   1 
ATOM   8486  N  N     . VAL D 4  987  ? 18.894  -54.893 65.024  1.00 88.44  ? 987  VAL A N     1 
ATOM   8487  C  CA    . VAL D 4  987  ? 19.934  -54.148 65.727  1.00 88.06  ? 987  VAL A CA    1 
ATOM   8488  C  C     . VAL D 4  987  ? 21.204  -54.057 64.889  1.00 95.97  ? 987  VAL A C     1 
ATOM   8489  O  O     . VAL D 4  987  ? 21.835  -52.996 64.812  1.00 106.94 ? 987  VAL A O     1 
ATOM   8490  C  CB    . VAL D 4  987  ? 20.200  -54.788 67.100  1.00 88.69  ? 987  VAL A CB    1 
ATOM   8491  C  CG1   . VAL D 4  987  ? 21.230  -53.979 67.869  1.00 94.72  ? 987  VAL A CG1   1 
ATOM   8492  C  CG2   . VAL D 4  987  ? 18.900  -54.904 67.888  1.00 88.96  ? 987  VAL A CG2   1 
ATOM   8493  N  N     . LEU D 4  988  ? 21.610  -55.163 64.260  1.00 88.46  ? 988  LEU A N     1 
ATOM   8494  C  CA    . LEU D 4  988  ? 22.788  -55.123 63.399  1.00 88.37  ? 988  LEU A CA    1 
ATOM   8495  C  C     . LEU D 4  988  ? 22.511  -54.325 62.131  1.00 88.55  ? 988  LEU A C     1 
ATOM   8496  O  O     . LEU D 4  988  ? 23.419  -53.683 61.591  1.00 87.32  ? 988  LEU A O     1 
ATOM   8497  C  CB    . LEU D 4  988  ? 23.243  -56.549 63.073  1.00 89.26  ? 988  LEU A CB    1 
ATOM   8498  C  CG    . LEU D 4  988  ? 24.678  -56.854 62.624  1.00 89.53  ? 988  LEU A CG    1 
ATOM   8499  C  CD1   . LEU D 4  988  ? 25.012  -56.275 61.253  1.00 106.20 ? 988  LEU A CD1   1 
ATOM   8500  C  CD2   . LEU D 4  988  ? 25.676  -56.374 63.670  1.00 98.72  ? 988  LEU A CD2   1 
ATOM   8501  N  N     . GLY D 4  989  ? 21.265  -54.340 61.655  1.00 113.73 ? 989  GLY A N     1 
ATOM   8502  C  CA    . GLY D 4  989  ? 20.922  -53.538 60.491  1.00 114.32 ? 989  GLY A CA    1 
ATOM   8503  C  C     . GLY D 4  989  ? 21.031  -52.049 60.762  1.00 110.74 ? 989  GLY A C     1 
ATOM   8504  O  O     . GLY D 4  989  ? 21.600  -51.302 59.962  1.00 130.65 ? 989  GLY A O     1 
ATOM   8505  N  N     . VAL D 4  990  ? 20.490  -51.597 61.898  1.00 86.03  ? 990  VAL A N     1 
ATOM   8506  C  CA    . VAL D 4  990  ? 20.591  -50.184 62.255  1.00 85.28  ? 990  VAL A CA    1 
ATOM   8507  C  C     . VAL D 4  990  ? 22.050  -49.795 62.462  1.00 85.13  ? 990  VAL A C     1 
ATOM   8508  O  O     . VAL D 4  990  ? 22.497  -48.733 62.011  1.00 84.55  ? 990  VAL A O     1 
ATOM   8509  C  CB    . VAL D 4  990  ? 19.737  -49.879 63.502  1.00 85.27  ? 990  VAL A CB    1 
ATOM   8510  C  CG1   . VAL D 4  990  ? 20.165  -48.567 64.139  1.00 85.09  ? 990  VAL A CG1   1 
ATOM   8511  C  CG2   . VAL D 4  990  ? 18.256  -49.839 63.150  1.00 85.26  ? 990  VAL A CG2   1 
ATOM   8512  N  N     . LYS D 4  991  ? 22.819  -50.656 63.133  1.00 96.28  ? 991  LYS A N     1 
ATOM   8513  C  CA    . LYS D 4  991  ? 24.234  -50.378 63.355  1.00 111.86 ? 991  LYS A CA    1 
ATOM   8514  C  C     . LYS D 4  991  ? 25.004  -50.311 62.042  1.00 126.29 ? 991  LYS A C     1 
ATOM   8515  O  O     . LYS D 4  991  ? 25.996  -49.581 61.939  1.00 128.50 ? 991  LYS A O     1 
ATOM   8516  C  CB    . LYS D 4  991  ? 24.833  -51.439 64.282  1.00 116.16 ? 991  LYS A CB    1 
ATOM   8517  C  CG    . LYS D 4  991  ? 26.237  -51.138 64.788  1.00 126.66 ? 991  LYS A CG    1 
ATOM   8518  C  CD    . LYS D 4  991  ? 26.669  -52.164 65.831  1.00 128.15 ? 991  LYS A CD    1 
ATOM   8519  C  CE    . LYS D 4  991  ? 28.037  -51.839 66.410  1.00 106.62 ? 991  LYS A CE    1 
ATOM   8520  N  NZ    . LYS D 4  991  ? 28.416  -52.796 67.484  1.00 91.11  ? 991  LYS A NZ    1 
ATOM   8521  N  N     . ASP D 4  992  ? 24.560  -51.057 61.028  1.00 122.24 ? 992  ASP A N     1 
ATOM   8522  C  CA    . ASP D 4  992  ? 25.161  -50.946 59.704  1.00 126.99 ? 992  ASP A CA    1 
ATOM   8523  C  C     . ASP D 4  992  ? 24.614  -49.748 58.936  1.00 126.45 ? 992  ASP A C     1 
ATOM   8524  O  O     . ASP D 4  992  ? 25.341  -49.146 58.137  1.00 146.83 ? 992  ASP A O     1 
ATOM   8525  C  CB    . ASP D 4  992  ? 24.930  -52.237 58.914  1.00 133.76 ? 992  ASP A CB    1 
ATOM   8526  C  CG    . ASP D 4  992  ? 25.356  -52.119 57.460  1.00 146.97 ? 992  ASP A CG    1 
ATOM   8527  O  OD1   . ASP D 4  992  ? 24.537  -51.679 56.626  1.00 150.80 ? 992  ASP A OD1   1 
ATOM   8528  O  OD2   . ASP D 4  992  ? 26.517  -52.463 57.151  1.00 154.21 ? 992  ASP A OD2   1 
ATOM   8529  N  N     . LEU D 4  993  ? 23.348  -49.390 59.165  1.00 104.56 ? 993  LEU A N     1 
ATOM   8530  C  CA    . LEU D 4  993  ? 22.750  -48.256 58.466  1.00 86.47  ? 993  LEU A CA    1 
ATOM   8531  C  C     . LEU D 4  993  ? 23.447  -46.952 58.832  1.00 83.47  ? 993  LEU A C     1 
ATOM   8532  O  O     . LEU D 4  993  ? 23.765  -46.136 57.958  1.00 83.07  ? 993  LEU A O     1 
ATOM   8533  C  CB    . LEU D 4  993  ? 21.254  -48.180 58.783  1.00 83.95  ? 993  LEU A CB    1 
ATOM   8534  C  CG    . LEU D 4  993  ? 20.535  -46.833 58.657  1.00 83.26  ? 993  LEU A CG    1 
ATOM   8535  C  CD1   . LEU D 4  993  ? 20.562  -46.319 57.224  1.00 82.96  ? 993  LEU A CD1   1 
ATOM   8536  C  CD2   . LEU D 4  993  ? 19.099  -46.957 59.144  1.00 83.36  ? 993  LEU A CD2   1 
ATOM   8537  N  N     . GLN D 4  994  ? 23.685  -46.735 60.129  1.00 95.00  ? 994  GLN A N     1 
ATOM   8538  C  CA    . GLN D 4  994  ? 24.380  -45.530 60.564  1.00 96.30  ? 994  GLN A CA    1 
ATOM   8539  C  C     . GLN D 4  994  ? 25.766  -45.436 59.945  1.00 93.00  ? 994  GLN A C     1 
ATOM   8540  O  O     . GLN D 4  994  ? 26.238  -44.335 59.642  1.00 88.68  ? 994  GLN A O     1 
ATOM   8541  C  CB    . GLN D 4  994  ? 24.486  -45.507 62.089  1.00 126.98 ? 994  GLN A CB    1 
ATOM   8542  C  CG    . GLN D 4  994  ? 23.167  -45.702 62.808  1.00 132.18 ? 994  GLN A CG    1 
ATOM   8543  C  CD    . GLN D 4  994  ? 23.353  -45.989 64.284  1.00 126.85 ? 994  GLN A CD    1 
ATOM   8544  O  OE1   . GLN D 4  994  ? 24.477  -46.126 64.767  1.00 132.52 ? 994  GLN A OE1   1 
ATOM   8545  N  NE2   . GLN D 4  994  ? 22.248  -46.092 65.006  1.00 124.27 ? 994  GLN A NE2   1 
ATOM   8546  N  N     . GLU D 4  995  ? 26.430  -46.578 59.753  1.00 95.14  ? 995  GLU A N     1 
ATOM   8547  C  CA    . GLU D 4  995  ? 27.743  -46.578 59.121  1.00 109.59 ? 995  GLU A CA    1 
ATOM   8548  C  C     . GLU D 4  995  ? 27.674  -46.038 57.699  1.00 113.67 ? 995  GLU A C     1 
ATOM   8549  O  O     . GLU D 4  995  ? 28.632  -45.418 57.222  1.00 105.89 ? 995  GLU A O     1 
ATOM   8550  C  CB    . GLU D 4  995  ? 28.322  -47.996 59.130  1.00 121.89 ? 995  GLU A CB    1 
ATOM   8551  C  CG    . GLU D 4  995  ? 29.631  -48.156 59.900  1.00 123.37 ? 995  GLU A CG    1 
ATOM   8552  C  CD    . GLU D 4  995  ? 30.853  -47.783 59.080  1.00 131.24 ? 995  GLU A CD    1 
ATOM   8553  O  OE1   . GLU D 4  995  ? 30.690  -47.186 57.995  1.00 142.13 ? 995  GLU A OE1   1 
ATOM   8554  O  OE2   . GLU D 4  995  ? 31.982  -48.091 59.520  1.00 133.37 ? 995  GLU A OE2   1 
ATOM   8555  N  N     . ASN D 4  996  ? 26.549  -46.244 57.015  1.00 122.09 ? 996  ASN A N     1 
ATOM   8556  C  CA    . ASN D 4  996  ? 26.399  -45.854 55.621  1.00 125.87 ? 996  ASN A CA    1 
ATOM   8557  C  C     . ASN D 4  996  ? 25.804  -44.461 55.438  1.00 122.30 ? 996  ASN A C     1 
ATOM   8558  O  O     . ASN D 4  996  ? 25.649  -44.019 54.295  1.00 123.55 ? 996  ASN A O     1 
ATOM   8559  C  CB    . ASN D 4  996  ? 25.539  -46.882 54.879  1.00 136.87 ? 996  ASN A CB    1 
ATOM   8560  C  CG    . ASN D 4  996  ? 26.318  -48.125 54.500  1.00 154.47 ? 996  ASN A CG    1 
ATOM   8561  O  OD1   . ASN D 4  996  ? 27.537  -48.080 54.332  1.00 159.98 ? 996  ASN A OD1   1 
ATOM   8562  N  ND2   . ASN D 4  996  ? 25.616  -49.243 54.354  1.00 162.95 ? 996  ASN A ND2   1 
ATOM   8563  N  N     . LEU D 4  997  ? 25.467  -43.759 56.521  1.00 98.75  ? 997  LEU A N     1 
ATOM   8564  C  CA    . LEU D 4  997  ? 24.964  -42.387 56.425  1.00 81.52  ? 997  LEU A CA    1 
ATOM   8565  C  C     . LEU D 4  997  ? 26.160  -41.446 56.318  1.00 81.32  ? 997  LEU A C     1 
ATOM   8566  O  O     . LEU D 4  997  ? 26.598  -40.823 57.287  1.00 82.59  ? 997  LEU A O     1 
ATOM   8567  C  CB    . LEU D 4  997  ? 24.087  -42.042 57.622  1.00 81.31  ? 997  LEU A CB    1 
ATOM   8568  C  CG    . LEU D 4  997  ? 22.810  -42.858 57.820  1.00 81.53  ? 997  LEU A CG    1 
ATOM   8569  C  CD1   . LEU D 4  997  ? 21.944  -42.255 58.912  1.00 81.28  ? 997  LEU A CD1   1 
ATOM   8570  C  CD2   . LEU D 4  997  ? 22.039  -42.938 56.520  1.00 81.48  ? 997  LEU A CD2   1 
ATOM   8571  N  N     . LEU D 4  998  ? 26.692  -41.338 55.104  1.00 81.78  ? 998  LEU A N     1 
ATOM   8572  C  CA    . LEU D 4  998  ? 27.917  -40.581 54.875  1.00 95.62  ? 998  LEU A CA    1 
ATOM   8573  C  C     . LEU D 4  998  ? 27.631  -39.094 54.699  1.00 97.85  ? 998  LEU A C     1 
ATOM   8574  O  O     . LEU D 4  998  ? 26.657  -38.703 54.049  1.00 85.11  ? 998  LEU A O     1 
ATOM   8575  C  CB    . LEU D 4  998  ? 28.649  -41.113 53.641  1.00 109.17 ? 998  LEU A CB    1 
ATOM   8576  C  CG    . LEU D 4  998  ? 29.636  -42.272 53.815  1.00 112.75 ? 998  LEU A CG    1 
ATOM   8577  C  CD1   . LEU D 4  998  ? 30.784  -41.866 54.727  1.00 121.67 ? 998  LEU A CD1   1 
ATOM   8578  C  CD2   . LEU D 4  998  ? 28.951  -43.527 54.336  1.00 113.42 ? 998  LEU A CD2   1 
ATOM   8579  N  N     . VAL D 4  999  ? 28.488  -38.264 55.296  1.00 96.68  ? 999  VAL A N     1 
ATOM   8580  C  CA    . VAL D 4  999  ? 28.472  -36.823 55.064  1.00 82.87  ? 999  VAL A CA    1 
ATOM   8581  C  C     . VAL D 4  999  ? 29.869  -36.401 54.622  1.00 84.73  ? 999  VAL A C     1 
ATOM   8582  O  O     . VAL D 4  999  ? 30.036  -35.428 53.877  1.00 90.82  ? 999  VAL A O     1 
ATOM   8583  C  CB    . VAL D 4  999  ? 28.015  -36.060 56.322  1.00 81.66  ? 999  VAL A CB    1 
ATOM   8584  C  CG1   . VAL D 4  999  ? 28.199  -34.555 56.155  1.00 81.28  ? 999  VAL A CG1   1 
ATOM   8585  C  CG2   . VAL D 4  999  ? 26.568  -36.388 56.638  1.00 81.48  ? 999  VAL A CG2   1 
ATOM   8586  N  N     . LEU D 4  1000 ? 30.878  -37.155 55.053  1.00 80.91  ? 1000 LEU A N     1 
ATOM   8587  C  CA    . LEU D 4  1000 ? 32.254  -36.934 54.637  1.00 81.27  ? 1000 LEU A CA    1 
ATOM   8588  C  C     . LEU D 4  1000 ? 32.936  -38.283 54.467  1.00 82.06  ? 1000 LEU A C     1 
ATOM   8589  O  O     . LEU D 4  1000 ? 32.611  -39.250 55.160  1.00 112.21 ? 1000 LEU A O     1 
ATOM   8590  C  CB    . LEU D 4  1000 ? 33.020  -36.067 55.641  1.00 81.26  ? 1000 LEU A CB    1 
ATOM   8591  C  CG    . LEU D 4  1000 ? 33.393  -34.677 55.122  1.00 87.20  ? 1000 LEU A CG    1 
ATOM   8592  C  CD1   . LEU D 4  1000 ? 33.996  -33.830 56.233  1.00 82.87  ? 1000 LEU A CD1   1 
ATOM   8593  C  CD2   . LEU D 4  1000 ? 34.342  -34.776 53.931  1.00 86.37  ? 1000 LEU A CD2   1 
ATOM   8594  N  N     . ARG D 4  1001 ? 33.890  -38.343 53.536  1.00 88.10  ? 1001 ARG A N     1 
ATOM   8595  C  CA    . ARG D 4  1001 ? 34.477  -39.610 53.115  1.00 100.97 ? 1001 ARG A CA    1 
ATOM   8596  C  C     . ARG D 4  1001 ? 35.995  -39.637 53.267  1.00 114.15 ? 1001 ARG A C     1 
ATOM   8597  O  O     . ARG D 4  1001 ? 36.668  -40.419 52.588  1.00 128.23 ? 1001 ARG A O     1 
ATOM   8598  C  CB    . ARG D 4  1001 ? 34.073  -39.910 51.671  1.00 123.86 ? 1001 ARG A CB    1 
ATOM   8599  C  CG    . ARG D 4  1001 ? 32.572  -40.070 51.514  1.00 126.66 ? 1001 ARG A CG    1 
ATOM   8600  C  CD    . ARG D 4  1001 ? 32.097  -39.769 50.106  1.00 117.28 ? 1001 ARG A CD    1 
ATOM   8601  N  NE    . ARG D 4  1001 ? 30.709  -39.312 50.112  1.00 105.31 ? 1001 ARG A NE    1 
ATOM   8602  C  CZ    . ARG D 4  1001 ? 29.658  -40.110 50.277  1.00 92.76  ? 1001 ARG A CZ    1 
ATOM   8603  N  NH1   . ARG D 4  1001 ? 29.828  -41.416 50.439  1.00 88.09  ? 1001 ARG A NH1   1 
ATOM   8604  N  NH2   . ARG D 4  1001 ? 28.433  -39.600 50.269  1.00 87.10  ? 1001 ARG A NH2   1 
ATOM   8605  N  N     . GLY D 4  1002 ? 36.547  -38.807 54.146  1.00 113.46 ? 1002 GLY A N     1 
ATOM   8606  C  CA    . GLY D 4  1002 ? 37.978  -38.842 54.385  1.00 120.13 ? 1002 GLY A CA    1 
ATOM   8607  C  C     . GLY D 4  1002 ? 38.392  -40.122 55.091  1.00 137.34 ? 1002 GLY A C     1 
ATOM   8608  O  O     . GLY D 4  1002 ? 37.678  -40.648 55.946  1.00 151.19 ? 1002 GLY A O     1 
ATOM   8609  N  N     . LYS D 4  1003 ? 39.567  -40.632 54.719  1.00 139.60 ? 1003 LYS A N     1 
ATOM   8610  C  CA    . LYS D 4  1003 ? 40.098  -41.838 55.341  1.00 135.11 ? 1003 LYS A CA    1 
ATOM   8611  C  C     . LYS D 4  1003 ? 40.688  -41.571 56.721  1.00 129.28 ? 1003 LYS A C     1 
ATOM   8612  O  O     . LYS D 4  1003 ? 40.883  -42.516 57.494  1.00 122.52 ? 1003 LYS A O     1 
ATOM   8613  C  CB    . LYS D 4  1003 ? 41.161  -42.466 54.436  1.00 131.42 ? 1003 LYS A CB    1 
ATOM   8614  C  CG    . LYS D 4  1003 ? 41.479  -43.923 54.743  1.00 121.61 ? 1003 LYS A CG    1 
ATOM   8615  C  CD    . LYS D 4  1003 ? 41.707  -44.714 53.464  1.00 122.12 ? 1003 LYS A CD    1 
ATOM   8616  C  CE    . LYS D 4  1003 ? 40.478  -44.687 52.568  1.00 123.50 ? 1003 LYS A CE    1 
ATOM   8617  N  NZ    . LYS D 4  1003 ? 40.713  -45.411 51.289  1.00 115.43 ? 1003 LYS A NZ    1 
ATOM   8618  N  N     . ASN D 4  1004 ? 40.963  -40.313 57.050  1.00 132.16 ? 1004 ASN A N     1 
ATOM   8619  C  CA    . ASN D 4  1004 ? 41.630  -39.980 58.298  1.00 128.87 ? 1004 ASN A CA    1 
ATOM   8620  C  C     . ASN D 4  1004 ? 40.664  -40.052 59.472  1.00 126.05 ? 1004 ASN A C     1 
ATOM   8621  O  O     . ASN D 4  1004 ? 39.452  -39.869 59.323  1.00 119.55 ? 1004 ASN A O     1 
ATOM   8622  C  CB    . ASN D 4  1004 ? 42.250  -38.587 58.209  1.00 129.93 ? 1004 ASN A CB    1 
ATOM   8623  C  CG    . ASN D 4  1004 ? 43.057  -38.398 56.944  1.00 137.65 ? 1004 ASN A CG    1 
ATOM   8624  O  OD1   . ASN D 4  1004 ? 44.138  -38.967 56.797  1.00 158.24 ? 1004 ASN A OD1   1 
ATOM   8625  N  ND2   . ASN D 4  1004 ? 42.541  -37.591 56.025  1.00 122.75 ? 1004 ASN A ND2   1 
ATOM   8626  N  N     . GLU D 4  1005 ? 41.222  -40.318 60.657  1.00 131.62 ? 1005 GLU A N     1 
ATOM   8627  C  CA    . GLU D 4  1005 ? 40.397  -40.523 61.842  1.00 139.55 ? 1005 GLU A CA    1 
ATOM   8628  C  C     . GLU D 4  1005 ? 39.643  -39.260 62.237  1.00 139.99 ? 1005 GLU A C     1 
ATOM   8629  O  O     . GLU D 4  1005 ? 38.525  -39.347 62.755  1.00 162.73 ? 1005 GLU A O     1 
ATOM   8630  C  CB    . GLU D 4  1005 ? 41.261  -41.013 63.006  1.00 145.49 ? 1005 GLU A CB    1 
ATOM   8631  C  CG    . GLU D 4  1005 ? 40.471  -41.441 64.236  1.00 151.69 ? 1005 GLU A CG    1 
ATOM   8632  C  CD    . GLU D 4  1005 ? 39.922  -42.850 64.117  1.00 161.91 ? 1005 GLU A CD    1 
ATOM   8633  O  OE1   . GLU D 4  1005 ? 40.712  -43.811 64.225  1.00 163.75 ? 1005 GLU A OE1   1 
ATOM   8634  O  OE2   . GLU D 4  1005 ? 38.698  -42.997 63.915  1.00 166.74 ? 1005 GLU A OE2   1 
ATOM   8635  N  N     . ILE D 4  1006 ? 40.225  -38.084 61.998  1.00 115.83 ? 1006 ILE A N     1 
ATOM   8636  C  CA    . ILE D 4  1006 ? 39.535  -36.847 62.345  1.00 100.84 ? 1006 ILE A CA    1 
ATOM   8637  C  C     . ILE D 4  1006 ? 38.339  -36.630 61.428  1.00 89.74  ? 1006 ILE A C     1 
ATOM   8638  O  O     . ILE D 4  1006 ? 37.269  -36.200 61.876  1.00 100.66 ? 1006 ILE A O     1 
ATOM   8639  C  CB    . ILE D 4  1006 ? 40.506  -35.653 62.306  1.00 108.76 ? 1006 ILE A CB    1 
ATOM   8640  C  CG1   . ILE D 4  1006 ? 41.296  -35.641 60.995  1.00 109.88 ? 1006 ILE A CG1   1 
ATOM   8641  C  CG2   . ILE D 4  1006 ? 41.445  -35.691 63.506  1.00 116.56 ? 1006 ILE A CG2   1 
ATOM   8642  C  CD1   . ILE D 4  1006 ? 42.358  -34.567 60.935  1.00 113.36 ? 1006 ILE A CD1   1 
ATOM   8643  N  N     . ILE D 4  1007 ? 38.492  -36.934 60.137  1.00 83.92  ? 1007 ILE A N     1 
ATOM   8644  C  CA    . ILE D 4  1007 ? 37.379  -36.772 59.208  1.00 92.13  ? 1007 ILE A CA    1 
ATOM   8645  C  C     . ILE D 4  1007 ? 36.304  -37.813 59.487  1.00 94.99  ? 1007 ILE A C     1 
ATOM   8646  O  O     . ILE D 4  1007 ? 35.104  -37.531 59.384  1.00 91.31  ? 1007 ILE A O     1 
ATOM   8647  C  CB    . ILE D 4  1007 ? 37.879  -36.841 57.754  1.00 99.94  ? 1007 ILE A CB    1 
ATOM   8648  C  CG1   . ILE D 4  1007 ? 39.185  -36.059 57.603  1.00 106.37 ? 1007 ILE A CG1   1 
ATOM   8649  C  CG2   . ILE D 4  1007 ? 36.821  -36.292 56.805  1.00 106.55 ? 1007 ILE A CG2   1 
ATOM   8650  C  CD1   . ILE D 4  1007 ? 39.697  -35.981 56.178  1.00 94.80  ? 1007 ILE A CD1   1 
ATOM   8651  N  N     . GLN D 4  1008 ? 36.714  -39.032 59.850  1.00 106.51 ? 1008 GLN A N     1 
ATOM   8652  C  CA    . GLN D 4  1008 ? 35.748  -40.032 60.291  1.00 103.03 ? 1008 GLN A CA    1 
ATOM   8653  C  C     . GLN D 4  1008 ? 35.082  -39.607 61.593  1.00 104.47 ? 1008 GLN A C     1 
ATOM   8654  O  O     . GLN D 4  1008 ? 33.875  -39.806 61.774  1.00 98.14  ? 1008 GLN A O     1 
ATOM   8655  C  CB    . GLN D 4  1008 ? 36.428  -41.393 60.451  1.00 90.33  ? 1008 GLN A CB    1 
ATOM   8656  C  CG    . GLN D 4  1008 ? 37.018  -41.953 59.165  1.00 91.91  ? 1008 GLN A CG    1 
ATOM   8657  C  CD    . GLN D 4  1008 ? 35.950  -42.356 58.164  1.00 101.88 ? 1008 GLN A CD    1 
ATOM   8658  O  OE1   . GLN D 4  1008 ? 34.850  -42.761 58.542  1.00 112.48 ? 1008 GLN A OE1   1 
ATOM   8659  N  NE2   . GLN D 4  1008 ? 36.272  -42.250 56.880  1.00 96.88  ? 1008 GLN A NE2   1 
ATOM   8660  N  N     . ASN D 4  1009 ? 35.851  -39.018 62.511  1.00 111.13 ? 1009 ASN A N     1 
ATOM   8661  C  CA    . ASN D 4  1009 ? 35.253  -38.492 63.732  1.00 111.38 ? 1009 ASN A CA    1 
ATOM   8662  C  C     . ASN D 4  1009 ? 34.355  -37.301 63.423  1.00 87.25  ? 1009 ASN A C     1 
ATOM   8663  O  O     . ASN D 4  1009 ? 33.293  -37.139 64.038  1.00 86.59  ? 1009 ASN A O     1 
ATOM   8664  C  CB    . ASN D 4  1009 ? 36.341  -38.116 64.741  1.00 120.67 ? 1009 ASN A CB    1 
ATOM   8665  C  CG    . ASN D 4  1009 ? 36.716  -39.272 65.654  1.00 118.12 ? 1009 ASN A CG    1 
ATOM   8666  O  OD1   . ASN D 4  1009 ? 37.643  -40.030 65.366  1.00 122.43 ? 1009 ASN A OD1   1 
ATOM   8667  N  ND2   . ASN D 4  1009 ? 35.992  -39.414 66.758  1.00 102.38 ? 1009 ASN A ND2   1 
ATOM   8668  N  N     . ALA D 4  1010 ? 34.753  -36.462 62.463  1.00 82.33  ? 1010 ALA A N     1 
ATOM   8669  C  CA    . ALA D 4  1010 ? 33.868  -35.386 62.023  1.00 85.48  ? 1010 ALA A CA    1 
ATOM   8670  C  C     . ALA D 4  1010 ? 32.570  -35.942 61.458  1.00 81.81  ? 1010 ALA A C     1 
ATOM   8671  O  O     . ALA D 4  1010 ? 31.503  -35.342 61.637  1.00 80.81  ? 1010 ALA A O     1 
ATOM   8672  C  CB    . ALA D 4  1010 ? 34.569  -34.509 60.985  1.00 81.59  ? 1010 ALA A CB    1 
ATOM   8673  N  N     . GLN D 4  1011 ? 32.642  -37.092 60.783  1.00 85.60  ? 1011 GLN A N     1 
ATOM   8674  C  CA    . GLN D 4  1011 ? 31.437  -37.759 60.304  1.00 92.16  ? 1011 GLN A CA    1 
ATOM   8675  C  C     . GLN D 4  1011 ? 30.556  -38.200 61.465  1.00 96.07  ? 1011 GLN A C     1 
ATOM   8676  O  O     . GLN D 4  1011 ? 29.345  -37.949 61.470  1.00 96.75  ? 1011 GLN A O     1 
ATOM   8677  C  CB    . GLN D 4  1011 ? 31.818  -38.954 59.432  1.00 105.43 ? 1011 GLN A CB    1 
ATOM   8678  C  CG    . GLN D 4  1011 ? 30.693  -39.947 59.212  1.00 105.96 ? 1011 GLN A CG    1 
ATOM   8679  C  CD    . GLN D 4  1011 ? 29.639  -39.424 58.263  1.00 96.09  ? 1011 GLN A CD    1 
ATOM   8680  O  OE1   . GLN D 4  1011 ? 29.895  -38.532 57.456  1.00 87.61  ? 1011 GLN A OE1   1 
ATOM   8681  N  NE2   . GLN D 4  1011 ? 28.439  -39.980 58.357  1.00 109.07 ? 1011 GLN A NE2   1 
ATOM   8682  N  N     . ARG D 4  1012 ? 31.148  -38.866 62.460  1.00 101.02 ? 1012 ARG A N     1 
ATOM   8683  C  CA    . ARG D 4  1012 ? 30.369  -39.311 63.612  1.00 101.19 ? 1012 ARG A CA    1 
ATOM   8684  C  C     . ARG D 4  1012 ? 29.820  -38.124 64.393  1.00 86.52  ? 1012 ARG A C     1 
ATOM   8685  O  O     . ARG D 4  1012 ? 28.704  -38.181 64.922  1.00 85.12  ? 1012 ARG A O     1 
ATOM   8686  C  CB    . ARG D 4  1012 ? 31.223  -40.207 64.509  1.00 116.44 ? 1012 ARG A CB    1 
ATOM   8687  C  CG    . ARG D 4  1012 ? 31.870  -41.378 63.784  1.00 121.90 ? 1012 ARG A CG    1 
ATOM   8688  C  CD    . ARG D 4  1012 ? 32.451  -42.387 64.763  1.00 137.04 ? 1012 ARG A CD    1 
ATOM   8689  N  NE    . ARG D 4  1012 ? 33.439  -43.256 64.129  1.00 140.35 ? 1012 ARG A NE    1 
ATOM   8690  C  CZ    . ARG D 4  1012 ? 34.742  -42.996 64.083  1.00 139.61 ? 1012 ARG A CZ    1 
ATOM   8691  N  NH1   . ARG D 4  1012 ? 35.220  -41.891 64.641  1.00 123.18 ? 1012 ARG A NH1   1 
ATOM   8692  N  NH2   . ARG D 4  1012 ? 35.569  -43.842 63.484  1.00 146.29 ? 1012 ARG A NH2   1 
ATOM   8693  N  N     . ASP D 4  1013 ? 30.589  -37.035 64.474  1.00 81.86  ? 1013 ASP A N     1 
ATOM   8694  C  CA    . ASP D 4  1013 ? 30.089  -35.832 65.131  1.00 101.98 ? 1013 ASP A CA    1 
ATOM   8695  C  C     . ASP D 4  1013 ? 28.951  -35.202 64.337  1.00 106.71 ? 1013 ASP A C     1 
ATOM   8696  O  O     . ASP D 4  1013 ? 27.966  -34.732 64.918  1.00 100.76 ? 1013 ASP A O     1 
ATOM   8697  C  CB    . ASP D 4  1013 ? 31.222  -34.824 65.328  1.00 109.79 ? 1013 ASP A CB    1 
ATOM   8698  C  CG    . ASP D 4  1013 ? 32.361  -35.378 66.162  1.00 99.68  ? 1013 ASP A CG    1 
ATOM   8699  O  OD1   . ASP D 4  1013 ? 32.159  -36.405 66.843  1.00 102.00 ? 1013 ASP A OD1   1 
ATOM   8700  O  OD2   . ASP D 4  1013 ? 33.463  -34.788 66.129  1.00 87.52  ? 1013 ASP A OD2   1 
ATOM   8701  N  N     . ALA D 4  1014 ? 29.061  -35.194 63.006  1.00 111.97 ? 1014 ALA A N     1 
ATOM   8702  C  CA    . ALA D 4  1014 ? 28.070  -34.519 62.177  1.00 101.46 ? 1014 ALA A CA    1 
ATOM   8703  C  C     . ALA D 4  1014 ? 26.743  -35.266 62.113  1.00 83.74  ? 1014 ALA A C     1 
ATOM   8704  O  O     . ALA D 4  1014 ? 25.717  -34.650 61.806  1.00 85.81  ? 1014 ALA A O     1 
ATOM   8705  C  CB    . ALA D 4  1014 ? 28.618  -34.315 60.764  1.00 96.36  ? 1014 ALA A CB    1 
ATOM   8706  N  N     . VAL D 4  1015 ? 26.736  -36.570 62.386  1.00 82.91  ? 1015 VAL A N     1 
ATOM   8707  C  CA    . VAL D 4  1015 ? 25.519  -37.373 62.334  1.00 80.13  ? 1015 VAL A CA    1 
ATOM   8708  C  C     . VAL D 4  1015 ? 25.011  -37.746 63.715  1.00 95.81  ? 1015 VAL A C     1 
ATOM   8709  O  O     . VAL D 4  1015 ? 24.007  -38.467 63.818  1.00 88.47  ? 1015 VAL A O     1 
ATOM   8710  C  CB    . VAL D 4  1015 ? 25.721  -38.642 61.483  1.00 80.49  ? 1015 VAL A CB    1 
ATOM   8711  C  CG1   . VAL D 4  1015 ? 26.311  -38.285 60.130  1.00 80.36  ? 1015 VAL A CG1   1 
ATOM   8712  C  CG2   . VAL D 4  1015 ? 26.611  -39.641 62.206  1.00 81.06  ? 1015 VAL A CG2   1 
ATOM   8713  N  N     . THR D 4  1016 ? 25.658  -37.261 64.782  1.00 95.86  ? 1016 THR A N     1 
ATOM   8714  C  CA    . THR D 4  1016 ? 25.376  -37.758 66.127  1.00 80.74  ? 1016 THR A CA    1 
ATOM   8715  C  C     . THR D 4  1016 ? 23.938  -37.477 66.545  1.00 80.82  ? 1016 THR A C     1 
ATOM   8716  O  O     . THR D 4  1016 ? 23.286  -38.329 67.159  1.00 90.42  ? 1016 THR A O     1 
ATOM   8717  C  CB    . THR D 4  1016 ? 26.350  -37.141 67.134  1.00 80.86  ? 1016 THR A CB    1 
ATOM   8718  O  OG1   . THR D 4  1016 ? 27.685  -37.232 66.627  1.00 82.28  ? 1016 THR A OG1   1 
ATOM   8719  C  CG2   . THR D 4  1016 ? 26.273  -37.863 68.474  1.00 81.33  ? 1016 THR A CG2   1 
ATOM   8720  N  N     . LEU D 4  1017 ? 23.425  -36.287 66.230  1.00 80.06  ? 1017 LEU A N     1 
ATOM   8721  C  CA    . LEU D 4  1017 ? 22.051  -35.978 66.606  1.00 79.92  ? 1017 LEU A CA    1 
ATOM   8722  C  C     . LEU D 4  1017 ? 21.064  -36.827 65.813  1.00 84.04  ? 1017 LEU A C     1 
ATOM   8723  O  O     . LEU D 4  1017 ? 20.089  -37.338 66.374  1.00 91.96  ? 1017 LEU A O     1 
ATOM   8724  C  CB    . LEU D 4  1017 ? 21.775  -34.490 66.404  1.00 79.44  ? 1017 LEU A CB    1 
ATOM   8725  C  CG    . LEU D 4  1017 ? 20.779  -33.821 67.357  1.00 79.39  ? 1017 LEU A CG    1 
ATOM   8726  C  CD1   . LEU D 4  1017 ? 20.772  -32.328 67.104  1.00 82.28  ? 1017 LEU A CD1   1 
ATOM   8727  C  CD2   . LEU D 4  1017 ? 19.365  -34.387 67.273  1.00 79.52  ? 1017 LEU A CD2   1 
ATOM   8728  N  N     . PHE D 4  1018 ? 21.305  -36.997 64.510  1.00 107.26 ? 1018 PHE A N     1 
ATOM   8729  C  CA    . PHE D 4  1018 ? 20.350  -37.728 63.683  1.00 99.50  ? 1018 PHE A CA    1 
ATOM   8730  C  C     . PHE D 4  1018 ? 20.284  -39.197 64.084  1.00 101.36 ? 1018 PHE A C     1 
ATOM   8731  O  O     . PHE D 4  1018 ? 19.191  -39.768 64.181  1.00 104.26 ? 1018 PHE A O     1 
ATOM   8732  C  CB    . PHE D 4  1018 ? 20.707  -37.596 62.203  1.00 100.07 ? 1018 PHE A CB    1 
ATOM   8733  C  CG    . PHE D 4  1018 ? 19.773  -38.345 61.290  1.00 108.29 ? 1018 PHE A CG    1 
ATOM   8734  C  CD1   . PHE D 4  1018 ? 18.408  -38.342 61.525  1.00 110.99 ? 1018 PHE A CD1   1 
ATOM   8735  C  CD2   . PHE D 4  1018 ? 20.258  -39.064 60.210  1.00 100.81 ? 1018 PHE A CD2   1 
ATOM   8736  C  CE1   . PHE D 4  1018 ? 17.544  -39.029 60.697  1.00 111.30 ? 1018 PHE A CE1   1 
ATOM   8737  C  CE2   . PHE D 4  1018 ? 19.395  -39.756 59.378  1.00 100.27 ? 1018 PHE A CE2   1 
ATOM   8738  C  CZ    . PHE D 4  1018 ? 18.037  -39.737 59.622  1.00 108.57 ? 1018 PHE A CZ    1 
ATOM   8739  N  N     . CYS D 4  1019 ? 21.436  -39.829 64.319  1.00 80.84  ? 1019 CYS A N     1 
ATOM   8740  C  CA    . CYS D 4  1019 ? 21.420  -41.217 64.764  1.00 81.43  ? 1019 CYS A CA    1 
ATOM   8741  C  C     . CYS D 4  1019 ? 20.663  -41.368 66.074  1.00 85.07  ? 1019 CYS A C     1 
ATOM   8742  O  O     . CYS D 4  1019 ? 20.020  -42.398 66.303  1.00 107.78 ? 1019 CYS A O     1 
ATOM   8743  C  CB    . CYS D 4  1019 ? 22.845  -41.751 64.903  1.00 86.43  ? 1019 CYS A CB    1 
ATOM   8744  S  SG    . CYS D 4  1019 ? 23.829  -41.655 63.390  1.00 81.57  ? 1019 CYS A SG    1 
ATOM   8745  N  N     . CYS D 4  1020 ? 20.715  -40.352 66.939  1.00 88.58  ? 1020 CYS A N     1 
ATOM   8746  C  CA    . CYS D 4  1020 ? 19.932  -40.388 68.171  1.00 96.62  ? 1020 CYS A CA    1 
ATOM   8747  C  C     . CYS D 4  1020 ? 18.443  -40.477 67.867  1.00 96.68  ? 1020 CYS A C     1 
ATOM   8748  O  O     . CYS D 4  1020 ? 17.703  -41.200 68.543  1.00 103.36 ? 1020 CYS A O     1 
ATOM   8749  C  CB    . CYS D 4  1020 ? 20.231  -39.156 69.023  1.00 96.22  ? 1020 CYS A CB    1 
ATOM   8750  S  SG    . CYS D 4  1020 ? 21.844  -39.183 69.833  1.00 111.44 ? 1020 CYS A SG    1 
ATOM   8751  N  N     . LEU D 4  1021 ? 17.983  -39.736 66.858  1.00 84.43  ? 1021 LEU A N     1 
ATOM   8752  C  CA    . LEU D 4  1021 ? 16.614  -39.905 66.388  1.00 94.50  ? 1021 LEU A CA    1 
ATOM   8753  C  C     . LEU D 4  1021 ? 16.420  -41.282 65.766  1.00 98.02  ? 1021 LEU A C     1 
ATOM   8754  O  O     . LEU D 4  1021 ? 15.367  -41.906 65.934  1.00 99.84  ? 1021 LEU A O     1 
ATOM   8755  C  CB    . LEU D 4  1021 ? 16.266  -38.814 65.377  1.00 87.65  ? 1021 LEU A CB    1 
ATOM   8756  C  CG    . LEU D 4  1021 ? 14.883  -38.952 64.738  1.00 80.88  ? 1021 LEU A CG    1 
ATOM   8757  C  CD1   . LEU D 4  1021 ? 13.782  -38.806 65.786  1.00 81.15  ? 1021 LEU A CD1   1 
ATOM   8758  C  CD2   . LEU D 4  1021 ? 14.692  -37.964 63.602  1.00 80.40  ? 1021 LEU A CD2   1 
ATOM   8759  N  N     . LEU D 4  1022 ? 17.433  -41.770 65.049  1.00 94.64  ? 1022 LEU A N     1 
ATOM   8760  C  CA    . LEU D 4  1022 ? 17.303  -43.034 64.333  1.00 88.21  ? 1022 LEU A CA    1 
ATOM   8761  C  C     . LEU D 4  1022 ? 17.170  -44.206 65.300  1.00 86.75  ? 1022 LEU A C     1 
ATOM   8762  O  O     . LEU D 4  1022 ? 16.246  -45.019 65.178  1.00 88.21  ? 1022 LEU A O     1 
ATOM   8763  C  CB    . LEU D 4  1022 ? 18.504  -43.221 63.405  1.00 88.83  ? 1022 LEU A CB    1 
ATOM   8764  C  CG    . LEU D 4  1022 ? 18.602  -44.518 62.606  1.00 84.77  ? 1022 LEU A CG    1 
ATOM   8765  C  CD1   . LEU D 4  1022 ? 17.359  -44.701 61.752  1.00 84.83  ? 1022 LEU A CD1   1 
ATOM   8766  C  CD2   . LEU D 4  1022 ? 19.853  -44.504 61.743  1.00 84.64  ? 1022 LEU A CD2   1 
ATOM   8767  N  N     . ARG D 4  1023 ? 18.082  -44.307 66.270  1.00 83.00  ? 1023 ARG A N     1 
ATOM   8768  C  CA    . ARG D 4  1023 ? 18.015  -45.400 67.237  1.00 83.68  ? 1023 ARG A CA    1 
ATOM   8769  C  C     . ARG D 4  1023 ? 16.732  -45.339 68.054  1.00 83.91  ? 1023 ARG A C     1 
ATOM   8770  O  O     . ARG D 4  1023 ? 16.132  -46.376 68.361  1.00 84.53  ? 1023 ARG A O     1 
ATOM   8771  C  CB    . ARG D 4  1023 ? 19.224  -45.356 68.171  1.00 83.79  ? 1023 ARG A CB    1 
ATOM   8772  C  CG    . ARG D 4  1023 ? 20.562  -45.274 67.480  1.00 83.60  ? 1023 ARG A CG    1 
ATOM   8773  C  CD    . ARG D 4  1023 ? 21.585  -44.612 68.387  1.00 83.49  ? 1023 ARG A CD    1 
ATOM   8774  N  NE    . ARG D 4  1023 ? 22.885  -44.467 67.743  1.00 83.37  ? 1023 ARG A NE    1 
ATOM   8775  C  CZ    . ARG D 4  1023 ? 23.849  -43.668 68.187  1.00 83.18  ? 1023 ARG A CZ    1 
ATOM   8776  N  NH1   . ARG D 4  1023 ? 23.655  -42.934 69.274  1.00 83.07  ? 1023 ARG A NH1   1 
ATOM   8777  N  NH2   . ARG D 4  1023 ? 25.002  -43.593 67.538  1.00 83.15  ? 1023 ARG A NH2   1 
ATOM   8778  N  N     . SER D 4  1024 ? 16.299  -44.130 68.420  1.00 83.47  ? 1024 SER A N     1 
ATOM   8779  C  CA    . SER D 4  1024 ? 15.142  -43.990 69.299  1.00 83.73  ? 1024 SER A CA    1 
ATOM   8780  C  C     . SER D 4  1024 ? 13.863  -44.446 68.612  1.00 83.98  ? 1024 SER A C     1 
ATOM   8781  O  O     . SER D 4  1024 ? 13.000  -45.064 69.245  1.00 84.56  ? 1024 SER A O     1 
ATOM   8782  C  CB    . SER D 4  1024 ? 15.012  -42.541 69.772  1.00 83.86  ? 1024 SER A CB    1 
ATOM   8783  O  OG    . SER D 4  1024 ? 15.145  -41.622 68.700  1.00 82.59  ? 1024 SER A OG    1 
ATOM   8784  N  N     . ARG D 4  1025 ? 13.723  -44.156 67.322  1.00 86.53  ? 1025 ARG A N     1 
ATOM   8785  C  CA    . ARG D 4  1025 ? 12.515  -44.531 66.601  1.00 90.39  ? 1025 ARG A CA    1 
ATOM   8786  C  C     . ARG D 4  1025 ? 12.571  -45.954 66.062  1.00 92.45  ? 1025 ARG A C     1 
ATOM   8787  O  O     . ARG D 4  1025 ? 11.522  -46.596 65.924  1.00 91.46  ? 1025 ARG A O     1 
ATOM   8788  C  CB    . ARG D 4  1025 ? 12.257  -43.548 65.457  1.00 99.49  ? 1025 ARG A CB    1 
ATOM   8789  C  CG    . ARG D 4  1025 ? 12.077  -42.108 65.909  1.00 85.70  ? 1025 ARG A CG    1 
ATOM   8790  C  CD    . ARG D 4  1025 ? 11.371  -41.294 64.843  1.00 99.14  ? 1025 ARG A CD    1 
ATOM   8791  N  NE    . ARG D 4  1025 ? 9.985   -41.013 65.205  1.00 114.62 ? 1025 ARG A NE    1 
ATOM   8792  C  CZ    . ARG D 4  1025 ? 9.545   -39.825 65.604  1.00 123.99 ? 1025 ARG A CZ    1 
ATOM   8793  N  NH1   . ARG D 4  1025 ? 10.380  -38.798 65.683  1.00 123.09 ? 1025 ARG A NH1   1 
ATOM   8794  N  NH2   . ARG D 4  1025 ? 8.267   -39.661 65.916  1.00 131.90 ? 1025 ARG A NH2   1 
ATOM   8795  N  N     . LEU D 4  1026 ? 13.764  -46.465 65.761  1.00 85.78  ? 1026 LEU A N     1 
ATOM   8796  C  CA    . LEU D 4  1026 ? 13.932  -47.836 65.295  1.00 85.00  ? 1026 LEU A CA    1 
ATOM   8797  C  C     . LEU D 4  1026 ? 14.347  -48.779 66.420  1.00 85.61  ? 1026 LEU A C     1 
ATOM   8798  O  O     . LEU D 4  1026 ? 15.089  -49.740 66.188  1.00 85.98  ? 1026 LEU A O     1 
ATOM   8799  C  CB    . LEU D 4  1026 ? 14.937  -47.892 64.144  1.00 84.70  ? 1026 LEU A CB    1 
ATOM   8800  C  CG    . LEU D 4  1026 ? 14.501  -47.146 62.880  1.00 84.21  ? 1026 LEU A CG    1 
ATOM   8801  C  CD1   . LEU D 4  1026 ? 15.248  -47.657 61.659  1.00 84.23  ? 1026 LEU A CD1   1 
ATOM   8802  C  CD2   . LEU D 4  1026 ? 12.995  -47.262 62.672  1.00 84.50  ? 1026 LEU A CD2   1 
ATOM   8803  N  N     . ALA D 4  1027 ? 13.887  -48.509 67.639  1.00 90.00  ? 1027 ALA A N     1 
ATOM   8804  C  CA    . ALA D 4  1027 ? 14.120  -49.409 68.756  1.00 86.45  ? 1027 ALA A CA    1 
ATOM   8805  C  C     . ALA D 4  1027 ? 13.393  -50.729 68.530  1.00 87.26  ? 1027 ALA A C     1 
ATOM   8806  O  O     . ALA D 4  1027 ? 12.315  -50.775 67.933  1.00 90.10  ? 1027 ALA A O     1 
ATOM   8807  C  CB    . ALA D 4  1027 ? 13.654  -48.769 70.063  1.00 86.48  ? 1027 ALA A CB    1 
ATOM   8808  N  N     . THR D 4  1028 ? 13.995  -51.811 69.025  1.00 87.87  ? 1028 THR A N     1 
ATOM   8809  C  CA    . THR D 4  1028 ? 13.484  -53.146 68.728  1.00 88.69  ? 1028 THR A CA    1 
ATOM   8810  C  C     . THR D 4  1028 ? 12.071  -53.332 69.270  1.00 89.22  ? 1028 THR A C     1 
ATOM   8811  O  O     . THR D 4  1028 ? 11.197  -53.870 68.581  1.00 89.60  ? 1028 THR A O     1 
ATOM   8812  C  CB    . THR D 4  1028 ? 14.431  -54.206 69.292  1.00 89.30  ? 1028 THR A CB    1 
ATOM   8813  O  OG1   . THR D 4  1028 ? 15.770  -53.919 68.865  1.00 88.83  ? 1028 THR A OG1   1 
ATOM   8814  C  CG2   . THR D 4  1028 ? 14.036  -55.593 68.802  1.00 90.14  ? 1028 THR A CG2   1 
ATOM   8815  N  N     . ARG D 4  1029 ? 11.824  -52.893 70.505  1.00 89.30  ? 1029 ARG A N     1 
ATOM   8816  C  CA    . ARG D 4  1029 ? 10.471  -52.978 71.046  1.00 89.82  ? 1029 ARG A CA    1 
ATOM   8817  C  C     . ARG D 4  1029 ? 9.512   -52.093 70.264  1.00 89.37  ? 1029 ARG A C     1 
ATOM   8818  O  O     . ARG D 4  1029 ? 8.345   -52.450 70.067  1.00 89.89  ? 1029 ARG A O     1 
ATOM   8819  C  CB    . ARG D 4  1029 ? 10.464  -52.599 72.529  1.00 89.99  ? 1029 ARG A CB    1 
ATOM   8820  C  CG    . ARG D 4  1029 ? 9.145   -52.899 73.238  1.00 90.75  ? 1029 ARG A CG    1 
ATOM   8821  C  CD    . ARG D 4  1029 ? 9.350   -53.825 74.432  1.00 92.59  ? 1029 ARG A CD    1 
ATOM   8822  N  NE    . ARG D 4  1029 ? 8.105   -54.109 75.140  1.00 109.91 ? 1029 ARG A NE    1 
ATOM   8823  C  CZ    . ARG D 4  1029 ? 8.047   -54.544 76.395  1.00 125.17 ? 1029 ARG A CZ    1 
ATOM   8824  N  NH1   . ARG D 4  1029 ? 9.165   -54.749 77.077  1.00 121.61 ? 1029 ARG A NH1   1 
ATOM   8825  N  NH2   . ARG D 4  1029 ? 6.874   -54.776 76.969  1.00 124.86 ? 1029 ARG A NH2   1 
ATOM   8826  N  N     . ARG D 4  1030 ? 9.991   -50.936 69.803  1.00 88.45  ? 1030 ARG A N     1 
ATOM   8827  C  CA    . ARG D 4  1030 ? 9.121   -50.001 69.099  1.00 88.01  ? 1030 ARG A CA    1 
ATOM   8828  C  C     . ARG D 4  1030 ? 8.787   -50.495 67.697  1.00 88.08  ? 1030 ARG A C     1 
ATOM   8829  O  O     . ARG D 4  1030 ? 7.651   -50.345 67.232  1.00 88.27  ? 1030 ARG A O     1 
ATOM   8830  C  CB    . ARG D 4  1030 ? 9.778   -48.624 69.038  1.00 87.05  ? 1030 ARG A CB    1 
ATOM   8831  C  CG    . ARG D 4  1030 ? 8.786   -47.488 69.097  1.00 87.36  ? 1030 ARG A CG    1 
ATOM   8832  C  CD    . ARG D 4  1030 ? 9.426   -46.143 68.810  1.00 88.55  ? 1030 ARG A CD    1 
ATOM   8833  N  NE    . ARG D 4  1030 ? 8.508   -45.049 69.113  1.00 85.64  ? 1030 ARG A NE    1 
ATOM   8834  C  CZ    . ARG D 4  1030 ? 8.702   -43.785 68.754  1.00 95.73  ? 1030 ARG A CZ    1 
ATOM   8835  N  NH1   . ARG D 4  1030 ? 9.784   -43.446 68.068  1.00 92.76  ? 1030 ARG A NH1   1 
ATOM   8836  N  NH2   . ARG D 4  1030 ? 7.809   -42.860 69.075  1.00 115.34 ? 1030 ARG A NH2   1 
ATOM   8837  N  N     . VAL D 4  1031 ? 9.762   -51.086 67.008  1.00 88.00  ? 1031 VAL A N     1 
ATOM   8838  C  CA    . VAL D 4  1031 ? 9.525   -51.575 65.653  1.00 88.10  ? 1031 VAL A CA    1 
ATOM   8839  C  C     . VAL D 4  1031 ? 8.461   -52.665 65.660  1.00 89.07  ? 1031 VAL A C     1 
ATOM   8840  O  O     . VAL D 4  1031 ? 7.516   -52.643 64.865  1.00 89.95  ? 1031 VAL A O     1 
ATOM   8841  C  CB    . VAL D 4  1031 ? 10.840  -52.075 65.030  1.00 87.94  ? 1031 VAL A CB    1 
ATOM   8842  C  CG1   . VAL D 4  1031 ? 10.568  -52.813 63.732  1.00 88.25  ? 1031 VAL A CG1   1 
ATOM   8843  C  CG2   . VAL D 4  1031 ? 11.788  -50.907 64.788  1.00 87.00  ? 1031 VAL A CG2   1 
ATOM   8844  N  N     . LEU D 4  1032 ? 8.589   -53.631 66.569  1.00 89.78  ? 1032 LEU A N     1 
ATOM   8845  C  CA    . LEU D 4  1032 ? 7.734   -54.811 66.503  1.00 91.89  ? 1032 LEU A CA    1 
ATOM   8846  C  C     . LEU D 4  1032 ? 6.395   -54.606 67.199  1.00 92.31  ? 1032 LEU A C     1 
ATOM   8847  O  O     . LEU D 4  1032 ? 5.391   -55.190 66.776  1.00 91.94  ? 1032 LEU A O     1 
ATOM   8848  C  CB    . LEU D 4  1032 ? 8.457   -56.020 67.096  1.00 91.44  ? 1032 LEU A CB    1 
ATOM   8849  C  CG    . LEU D 4  1032 ? 9.898   -56.212 66.624  1.00 91.05  ? 1032 LEU A CG    1 
ATOM   8850  C  CD1   . LEU D 4  1032 ? 10.502  -57.458 67.243  1.00 91.83  ? 1032 LEU A CD1   1 
ATOM   8851  C  CD2   . LEU D 4  1032 ? 9.945   -56.303 65.113  1.00 90.83  ? 1032 LEU A CD2   1 
ATOM   8852  N  N     . GLN D 4  1033 ? 6.348   -53.802 68.259  1.00 95.79  ? 1033 GLN A N     1 
ATOM   8853  C  CA    . GLN D 4  1033 ? 5.096   -53.625 68.983  1.00 105.79 ? 1033 GLN A CA    1 
ATOM   8854  C  C     . GLN D 4  1033 ? 4.285   -52.438 68.480  1.00 118.29 ? 1033 GLN A C     1 
ATOM   8855  O  O     . GLN D 4  1033 ? 3.050   -52.484 68.521  1.00 141.55 ? 1033 GLN A O     1 
ATOM   8856  C  CB    . GLN D 4  1033 ? 5.367   -53.473 70.483  1.00 95.29  ? 1033 GLN A CB    1 
ATOM   8857  C  CG    . GLN D 4  1033 ? 4.104   -53.417 71.330  1.00 99.19  ? 1033 GLN A CG    1 
ATOM   8858  C  CD    . GLN D 4  1033 ? 4.299   -53.991 72.719  1.00 118.50 ? 1033 GLN A CD    1 
ATOM   8859  O  OE1   . GLN D 4  1033 ? 5.405   -53.981 73.260  1.00 129.82 ? 1033 GLN A OE1   1 
ATOM   8860  N  NE2   . GLN D 4  1033 ? 3.220   -54.498 73.306  1.00 122.50 ? 1033 GLN A NE2   1 
ATOM   8861  N  N     . GLU D 4  1034 ? 4.938   -51.384 67.992  1.00 98.74  ? 1034 GLU A N     1 
ATOM   8862  C  CA    . GLU D 4  1034 ? 4.231   -50.197 67.524  1.00 89.54  ? 1034 GLU A CA    1 
ATOM   8863  C  C     . GLU D 4  1034 ? 4.146   -50.108 66.004  1.00 92.55  ? 1034 GLU A C     1 
ATOM   8864  O  O     . GLU D 4  1034 ? 3.098   -49.732 65.471  1.00 89.38  ? 1034 GLU A O     1 
ATOM   8865  C  CB    . GLU D 4  1034 ? 4.895   -48.932 68.080  1.00 88.68  ? 1034 GLU A CB    1 
ATOM   8866  C  CG    . GLU D 4  1034 ? 4.972   -48.897 69.601  1.00 88.97  ? 1034 GLU A CG    1 
ATOM   8867  C  CD    . GLU D 4  1034 ? 4.936   -47.487 70.165  1.00 96.59  ? 1034 GLU A CD    1 
ATOM   8868  O  OE1   . GLU D 4  1034 ? 5.936   -46.753 70.022  1.00 96.69  ? 1034 GLU A OE1   1 
ATOM   8869  O  OE2   . GLU D 4  1034 ? 3.901   -47.113 70.754  1.00 102.42 ? 1034 GLU A OE2   1 
ATOM   8870  N  N     . TYR D 4  1035 ? 5.220   -50.447 65.291  1.00 98.28  ? 1035 TYR A N     1 
ATOM   8871  C  CA    . TYR D 4  1035 ? 5.204   -50.392 63.834  1.00 88.60  ? 1035 TYR A CA    1 
ATOM   8872  C  C     . TYR D 4  1035 ? 4.755   -51.701 63.200  1.00 89.45  ? 1035 TYR A C     1 
ATOM   8873  O  O     . TYR D 4  1035 ? 4.190   -51.681 62.100  1.00 101.58 ? 1035 TYR A O     1 
ATOM   8874  C  CB    . TYR D 4  1035 ? 6.589   -50.026 63.287  1.00 87.80  ? 1035 TYR A CB    1 
ATOM   8875  C  CG    . TYR D 4  1035 ? 7.175   -48.722 63.794  1.00 86.95  ? 1035 TYR A CG    1 
ATOM   8876  C  CD1   . TYR D 4  1035 ? 8.515   -48.419 63.584  1.00 86.33  ? 1035 TYR A CD1   1 
ATOM   8877  C  CD2   . TYR D 4  1035 ? 6.395   -47.791 64.470  1.00 86.83  ? 1035 TYR A CD2   1 
ATOM   8878  C  CE1   . TYR D 4  1035 ? 9.064   -47.233 64.040  1.00 85.61  ? 1035 TYR A CE1   1 
ATOM   8879  C  CE2   . TYR D 4  1035 ? 6.935   -46.604 64.932  1.00 87.62  ? 1035 TYR A CE2   1 
ATOM   8880  C  CZ    . TYR D 4  1035 ? 8.269   -46.330 64.713  1.00 85.50  ? 1035 TYR A CZ    1 
ATOM   8881  O  OH    . TYR D 4  1035 ? 8.809   -45.149 65.168  1.00 84.84  ? 1035 TYR A OH    1 
ATOM   8882  N  N     . ARG D 4  1036 ? 4.998   -52.834 63.865  1.00 91.18  ? 1036 ARG A N     1 
ATOM   8883  C  CA    . ARG D 4  1036 ? 4.677   -54.161 63.333  1.00 95.91  ? 1036 ARG A CA    1 
ATOM   8884  C  C     . ARG D 4  1036 ? 5.386   -54.425 62.005  1.00 101.80 ? 1036 ARG A C     1 
ATOM   8885  O  O     . ARG D 4  1036 ? 4.851   -55.113 61.130  1.00 93.34  ? 1036 ARG A O     1 
ATOM   8886  C  CB    . ARG D 4  1036 ? 3.164   -54.352 63.178  1.00 107.53 ? 1036 ARG A CB    1 
ATOM   8887  C  CG    . ARG D 4  1036 ? 2.404   -54.485 64.489  1.00 110.94 ? 1036 ARG A CG    1 
ATOM   8888  C  CD    . ARG D 4  1036 ? 2.775   -55.769 65.211  1.00 118.75 ? 1036 ARG A CD    1 
ATOM   8889  N  NE    . ARG D 4  1036 ? 1.960   -55.982 66.403  1.00 120.51 ? 1036 ARG A NE    1 
ATOM   8890  C  CZ    . ARG D 4  1036 ? 1.021   -56.916 66.507  1.00 123.38 ? 1036 ARG A CZ    1 
ATOM   8891  N  NH1   . ARG D 4  1036 ? 0.324   -57.038 67.630  1.00 115.46 ? 1036 ARG A NH1   1 
ATOM   8892  N  NH2   . ARG D 4  1036 ? 0.787   -57.739 65.493  1.00 123.65 ? 1036 ARG A NH2   1 
ATOM   8893  N  N     . LEU D 4  1037 ? 6.599   -53.895 61.855  1.00 100.90 ? 1037 LEU A N     1 
ATOM   8894  C  CA    . LEU D 4  1037 ? 7.319   -54.001 60.592  1.00 89.58  ? 1037 LEU A CA    1 
ATOM   8895  C  C     . LEU D 4  1037 ? 7.725   -55.440 60.305  1.00 90.33  ? 1037 LEU A C     1 
ATOM   8896  O  O     . LEU D 4  1037 ? 8.223   -56.152 61.183  1.00 107.37 ? 1037 LEU A O     1 
ATOM   8897  C  CB    . LEU D 4  1037 ? 8.569   -53.118 60.606  1.00 88.63  ? 1037 LEU A CB    1 
ATOM   8898  C  CG    . LEU D 4  1037 ? 8.394   -51.599 60.583  1.00 87.78  ? 1037 LEU A CG    1 
ATOM   8899  C  CD1   . LEU D 4  1037 ? 9.625   -50.933 59.981  1.00 89.67  ? 1037 LEU A CD1   1 
ATOM   8900  C  CD2   . LEU D 4  1037 ? 7.139   -51.197 59.821  1.00 89.68  ? 1037 LEU A CD2   1 
ATOM   8901  N  N     . THR D 4  1038 ? 7.510   -55.862 59.064  1.00 90.57  ? 1038 THR A N     1 
ATOM   8902  C  CA    . THR D 4  1038 ? 8.017   -57.134 58.579  1.00 91.22  ? 1038 THR A CA    1 
ATOM   8903  C  C     . THR D 4  1038 ? 9.428   -56.951 58.025  1.00 90.63  ? 1038 THR A C     1 
ATOM   8904  O  O     . THR D 4  1038 ? 9.916   -55.832 57.853  1.00 89.74  ? 1038 THR A O     1 
ATOM   8905  C  CB    . THR D 4  1038 ? 7.092   -57.721 57.515  1.00 91.87  ? 1038 THR A CB    1 
ATOM   8906  O  OG1   . THR D 4  1038 ? 7.203   -56.960 56.306  1.00 91.27  ? 1038 THR A OG1   1 
ATOM   8907  C  CG2   . THR D 4  1038 ? 5.648   -57.696 57.997  1.00 92.41  ? 1038 THR A CG2   1 
ATOM   8908  N  N     . LYS D 4  1039 ? 10.089  -58.078 57.754  1.00 91.19  ? 1039 LYS A N     1 
ATOM   8909  C  CA    . LYS D 4  1039 ? 11.468  -58.032 57.277  1.00 90.79  ? 1039 LYS A CA    1 
ATOM   8910  C  C     . LYS D 4  1039 ? 11.575  -57.252 55.974  1.00 90.19  ? 1039 LYS A C     1 
ATOM   8911  O  O     . LYS D 4  1039 ? 12.483  -56.430 55.804  1.00 89.44  ? 1039 LYS A O     1 
ATOM   8912  C  CB    . LYS D 4  1039 ? 12.003  -59.456 57.107  1.00 91.65  ? 1039 LYS A CB    1 
ATOM   8913  C  CG    . LYS D 4  1039 ? 13.187  -59.591 56.161  1.00 93.77  ? 1039 LYS A CG    1 
ATOM   8914  C  CD    . LYS D 4  1039 ? 14.467  -59.020 56.754  1.00 94.81  ? 1039 LYS A CD    1 
ATOM   8915  C  CE    . LYS D 4  1039 ? 15.661  -59.306 55.852  1.00 105.42 ? 1039 LYS A CE    1 
ATOM   8916  N  NZ    . LYS D 4  1039 ? 16.898  -58.633 56.340  1.00 114.90 ? 1039 LYS A NZ    1 
ATOM   8917  N  N     . GLN D 4  1040 ? 10.642  -57.487 55.049  1.00 118.90 ? 1040 GLN A N     1 
ATOM   8918  C  CA    . GLN D 4  1040 ? 10.638  -56.757 53.787  1.00 118.77 ? 1040 GLN A CA    1 
ATOM   8919  C  C     . GLN D 4  1040 ? 10.329  -55.280 54.006  1.00 108.71 ? 1040 GLN A C     1 
ATOM   8920  O  O     . GLN D 4  1040 ? 10.968  -54.410 53.403  1.00 100.99 ? 1040 GLN A O     1 
ATOM   8921  C  CB    . GLN D 4  1040 ? 9.626   -57.387 52.830  1.00 126.21 ? 1040 GLN A CB    1 
ATOM   8922  C  CG    . GLN D 4  1040 ? 9.525   -56.712 51.473  1.00 119.71 ? 1040 GLN A CG    1 
ATOM   8923  C  CD    . GLN D 4  1040 ? 8.435   -57.318 50.612  1.00 106.43 ? 1040 GLN A CD    1 
ATOM   8924  O  OE1   . GLN D 4  1040 ? 7.279   -57.413 51.028  1.00 104.53 ? 1040 GLN A OE1   1 
ATOM   8925  N  NE2   . GLN D 4  1040 ? 8.800   -57.750 49.411  1.00 117.57 ? 1040 GLN A NE2   1 
ATOM   8926  N  N     . ALA D 4  1041 ? 9.353   -54.980 54.867  1.00 89.27  ? 1041 ALA A N     1 
ATOM   8927  C  CA    . ALA D 4  1041 ? 9.018   -53.589 55.154  1.00 88.50  ? 1041 ALA A CA    1 
ATOM   8928  C  C     . ALA D 4  1041 ? 10.165  -52.878 55.861  1.00 100.52 ? 1041 ALA A C     1 
ATOM   8929  O  O     . ALA D 4  1041 ? 10.476  -51.723 55.544  1.00 86.99  ? 1041 ALA A O     1 
ATOM   8930  C  CB    . ALA D 4  1041 ? 7.742   -53.518 55.993  1.00 88.86  ? 1041 ALA A CB    1 
ATOM   8931  N  N     . PHE D 4  1042 ? 10.802  -53.552 56.821  1.00 117.59 ? 1042 PHE A N     1 
ATOM   8932  C  CA    . PHE D 4  1042 ? 11.884  -52.933 57.580  1.00 104.76 ? 1042 PHE A CA    1 
ATOM   8933  C  C     . PHE D 4  1042 ? 13.065  -52.581 56.683  1.00 105.32 ? 1042 PHE A C     1 
ATOM   8934  O  O     . PHE D 4  1042 ? 13.657  -51.503 56.819  1.00 100.47 ? 1042 PHE A O     1 
ATOM   8935  C  CB    . PHE D 4  1042 ? 12.318  -53.865 58.713  1.00 102.75 ? 1042 PHE A CB    1 
ATOM   8936  C  CG    . PHE D 4  1042 ? 13.435  -53.321 59.553  1.00 106.28 ? 1042 PHE A CG    1 
ATOM   8937  C  CD1   . PHE D 4  1042 ? 13.165  -52.519 60.647  1.00 94.62  ? 1042 PHE A CD1   1 
ATOM   8938  C  CD2   . PHE D 4  1042 ? 14.754  -53.628 59.262  1.00 97.01  ? 1042 PHE A CD2   1 
ATOM   8939  C  CE1   . PHE D 4  1042 ? 14.189  -52.018 61.424  1.00 91.89  ? 1042 PHE A CE1   1 
ATOM   8940  C  CE2   . PHE D 4  1042 ? 15.782  -53.132 60.036  1.00 92.20  ? 1042 PHE A CE2   1 
ATOM   8941  C  CZ    . PHE D 4  1042 ? 15.499  -52.327 61.119  1.00 91.85  ? 1042 PHE A CZ    1 
ATOM   8942  N  N     . ASP D 4  1043 ? 13.424  -53.479 55.761  1.00 103.33 ? 1043 ASP A N     1 
ATOM   8943  C  CA    . ASP D 4  1043 ? 14.551  -53.220 54.869  1.00 105.62 ? 1043 ASP A CA    1 
ATOM   8944  C  C     . ASP D 4  1043 ? 14.285  -52.033 53.954  1.00 105.16 ? 1043 ASP A C     1 
ATOM   8945  O  O     . ASP D 4  1043 ? 15.219  -51.310 53.587  1.00 98.30  ? 1043 ASP A O     1 
ATOM   8946  C  CB    . ASP D 4  1043 ? 14.862  -54.469 54.045  1.00 116.31 ? 1043 ASP A CB    1 
ATOM   8947  C  CG    . ASP D 4  1043 ? 15.810  -55.412 54.756  1.00 130.20 ? 1043 ASP A CG    1 
ATOM   8948  O  OD1   . ASP D 4  1043 ? 15.327  -56.265 55.526  1.00 134.93 ? 1043 ASP A OD1   1 
ATOM   8949  O  OD2   . ASP D 4  1043 ? 17.036  -55.301 54.544  1.00 141.31 ? 1043 ASP A OD2   1 
ATOM   8950  N  N     . TRP D 4  1044 ? 13.024  -51.818 53.571  1.00 113.76 ? 1044 TRP A N     1 
ATOM   8951  C  CA    . TRP D 4  1044 ? 12.700  -50.670 52.732  1.00 123.94 ? 1044 TRP A CA    1 
ATOM   8952  C  C     . TRP D 4  1044 ? 12.857  -49.365 53.505  1.00 126.94 ? 1044 TRP A C     1 
ATOM   8953  O  O     . TRP D 4  1044 ? 13.362  -48.374 52.963  1.00 129.86 ? 1044 TRP A O     1 
ATOM   8954  C  CB    . TRP D 4  1044 ? 11.280  -50.804 52.178  1.00 128.66 ? 1044 TRP A CB    1 
ATOM   8955  C  CG    . TRP D 4  1044 ? 10.885  -49.654 51.308  1.00 124.17 ? 1044 TRP A CG    1 
ATOM   8956  C  CD1   . TRP D 4  1044 ? 11.382  -49.354 50.072  1.00 113.97 ? 1044 TRP A CD1   1 
ATOM   8957  C  CD2   . TRP D 4  1044 ? 9.934   -48.628 51.617  1.00 124.97 ? 1044 TRP A CD2   1 
ATOM   8958  N  NE1   . TRP D 4  1044 ? 10.788  -48.214 49.586  1.00 118.53 ? 1044 TRP A NE1   1 
ATOM   8959  C  CE2   . TRP D 4  1044 ? 9.896   -47.748 50.516  1.00 120.71 ? 1044 TRP A CE2   1 
ATOM   8960  C  CE3   . TRP D 4  1044 ? 9.106   -48.371 52.714  1.00 113.39 ? 1044 TRP A CE3   1 
ATOM   8961  C  CZ2   . TRP D 4  1044 ? 9.064   -46.633 50.481  1.00 111.53 ? 1044 TRP A CZ2   1 
ATOM   8962  C  CZ3   . TRP D 4  1044 ? 8.281   -47.261 52.677  1.00 92.10  ? 1044 TRP A CZ3   1 
ATOM   8963  C  CH2   . TRP D 4  1044 ? 8.267   -46.407 51.568  1.00 94.54  ? 1044 TRP A CH2   1 
ATOM   8964  N  N     . VAL D 4  1045 ? 12.428  -49.344 54.771  1.00 85.31  ? 1045 VAL A N     1 
ATOM   8965  C  CA    . VAL D 4  1045 ? 12.633  -48.163 55.606  1.00 84.56  ? 1045 VAL A CA    1 
ATOM   8966  C  C     . VAL D 4  1045 ? 14.119  -47.861 55.736  1.00 84.14  ? 1045 VAL A C     1 
ATOM   8967  O  O     . VAL D 4  1045 ? 14.541  -46.700 55.673  1.00 83.50  ? 1045 VAL A O     1 
ATOM   8968  C  CB    . VAL D 4  1045 ? 11.967  -48.357 56.982  1.00 84.83  ? 1045 VAL A CB    1 
ATOM   8969  C  CG1   . VAL D 4  1045 ? 12.264  -47.177 57.895  1.00 84.20  ? 1045 VAL A CG1   1 
ATOM   8970  C  CG2   . VAL D 4  1045 ? 10.466  -48.539 56.823  1.00 85.26  ? 1045 VAL A CG2   1 
ATOM   8971  N  N     . LEU D 4  1046 ? 14.938  -48.900 55.910  1.00 84.57  ? 1046 LEU A N     1 
ATOM   8972  C  CA    . LEU D 4  1046 ? 16.385  -48.710 55.902  1.00 84.30  ? 1046 LEU A CA    1 
ATOM   8973  C  C     . LEU D 4  1046 ? 16.865  -48.197 54.552  1.00 83.99  ? 1046 LEU A C     1 
ATOM   8974  O  O     . LEU D 4  1046 ? 17.779  -47.367 54.482  1.00 86.11  ? 1046 LEU A O     1 
ATOM   8975  C  CB    . LEU D 4  1046 ? 17.088  -50.020 56.258  1.00 84.94  ? 1046 LEU A CB    1 
ATOM   8976  C  CG    . LEU D 4  1046 ? 17.625  -50.157 57.684  1.00 85.77  ? 1046 LEU A CG    1 
ATOM   8977  C  CD1   . LEU D 4  1046 ? 16.524  -49.929 58.712  1.00 85.29  ? 1046 LEU A CD1   1 
ATOM   8978  C  CD2   . LEU D 4  1046 ? 18.273  -51.520 57.884  1.00 89.77  ? 1046 LEU A CD2   1 
ATOM   8979  N  N     . SER D 4  1047 ? 16.262  -48.682 53.466  1.00 84.31  ? 1047 SER A N     1 
ATOM   8980  C  CA    . SER D 4  1047 ? 16.665  -48.239 52.136  1.00 84.09  ? 1047 SER A CA    1 
ATOM   8981  C  C     . SER D 4  1047 ? 16.319  -46.770 51.918  1.00 83.39  ? 1047 SER A C     1 
ATOM   8982  O  O     . SER D 4  1047 ? 17.155  -45.990 51.446  1.00 82.97  ? 1047 SER A O     1 
ATOM   8983  C  CB    . SER D 4  1047 ? 16.003  -49.120 51.077  1.00 94.72  ? 1047 SER A CB    1 
ATOM   8984  O  OG    . SER D 4  1047 ? 16.175  -50.492 51.387  1.00 100.54 ? 1047 SER A OG    1 
ATOM   8985  N  N     . ASN D 4  1048 ? 15.090  -46.375 52.265  1.00 90.15  ? 1048 ASN A N     1 
ATOM   8986  C  CA    . ASN D 4  1048 ? 14.665  -44.990 52.074  1.00 91.97  ? 1048 ASN A CA    1 
ATOM   8987  C  C     . ASN D 4  1048 ? 15.536  -44.029 52.871  1.00 84.66  ? 1048 ASN A C     1 
ATOM   8988  O  O     . ASN D 4  1048 ? 16.004  -43.014 52.342  1.00 84.19  ? 1048 ASN A O     1 
ATOM   8989  C  CB    . ASN D 4  1048 ? 13.197  -44.824 52.475  1.00 110.22 ? 1048 ASN A CB    1 
ATOM   8990  C  CG    . ASN D 4  1048 ? 12.248  -44.953 51.301  1.00 136.44 ? 1048 ASN A CG    1 
ATOM   8991  O  OD1   . ASN D 4  1048 ? 12.565  -45.586 50.295  1.00 162.14 ? 1048 ASN A OD1   1 
ATOM   8992  N  ND2   . ASN D 4  1048 ? 11.076  -44.340 51.424  1.00 135.97 ? 1048 ASN A ND2   1 
ATOM   8993  N  N     . ILE D 4  1049 ? 15.762  -44.335 54.150  1.00 82.24  ? 1049 ILE A N     1 
ATOM   8994  C  CA    . ILE D 4  1049 ? 16.487  -43.414 55.020  1.00 81.76  ? 1049 ILE A CA    1 
ATOM   8995  C  C     . ILE D 4  1049 ? 17.879  -43.135 54.470  1.00 81.54  ? 1049 ILE A C     1 
ATOM   8996  O  O     . ILE D 4  1049 ? 18.317  -41.981 54.420  1.00 81.05  ? 1049 ILE A O     1 
ATOM   8997  C  CB    . ILE D 4  1049 ? 16.534  -43.963 56.459  1.00 82.01  ? 1049 ILE A CB    1 
ATOM   8998  C  CG1   . ILE D 4  1049 ? 15.143  -43.895 57.095  1.00 82.14  ? 1049 ILE A CG1   1 
ATOM   8999  C  CG2   . ILE D 4  1049 ? 17.537  -43.190 57.303  1.00 81.62  ? 1049 ILE A CG2   1 
ATOM   9000  C  CD1